4B71A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
total genus 197
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b71A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b71A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b71A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b71A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b71A03
3FAOA 1UEIA 3RU4D 3QE0A 3GLHB 1O33A 1P2NA 2BBOA 1KHTA 2ZC9H 2QG6A 1MCVA 2I1QA 4BLRA 5AUOB 1XCPA 3AKCA 2ZU3A 3KQHA 2H9EH 4NKRA 2ZXUA 1J17T 4LC1A 1PYTD 2PMKA 2J9NA 3AVPA 1G16A 1AZTA 3WBKA 3RXFA 1UTOA 3QTOH 1Q21A 3BOSA 4AG2A 3BGWA 2SFAA 2F1RA 2D7DA 4FUIA 1VG0B 2ODNA 4ZKNU 4JBYA 2HDNB 1E96A 1KZ7B 2BEKA 2VTKA 3ZYEA 3OEHA 2GT8A 1SVOA 4I7YH 2CJWA 3GICB 1XD2B 3QUSA 2N46A 5LH8A 4O0MA 1M7GA 1D5CA 5KSPA 4RY2A 1P60A 1XEFA 3D31A 3BORA 2VIQA 1VTKA 3GEIA 4Z0KA 3DT0H 1YZLA 4YMWA 3CPEA 1G3RA 5DI3B 1RTLA 4IDPA 5HTKA 3UY9A 2EFDB 4Z1MD 1R6BX 1THPB 1HCGA 2OLKA 1VZQH 3H2YA 2JJ2D 4MRPA 3LJOA 3PTBA 2J7KA 2V54A 1WMSA 2G00A 4U01A 3ZVEA 1ELGA 3P26A 3C7KA 3FB4A 4V0KA 3N5CA 3R9IA 3JVVA 4ABBA 4YONB 3E1SA 4F93B 4MPUA 4LYFA 1WTGH 1YRAA 2OSBA 4MGZR 2ZO3H 2JETC 4LV8B 4ZKRU 1EFRD 3UNQA 3SNAA 1O2UA 1KNQA 2R6FA 1IXRC 4NWKA 3B2EA 1GM5A 2GKVE 3HP1A 1C1SA 1T5IA 3MFJA 821PA 5JECA 1V2QT 2FMJA 1H9LB 3B6EA 1X7AC 5AR1A 2QMHA 5SZIA 1BTZA 3TK6A 2WWXA 4XOJA 1G41A 4BFTA 3UG6A 2FZLA 2VF8A 4Y76A 3AF4A 4FIDA 3BB4A 3OTJE 1TGTA 1T7CA 4UFGH 2HNTC 1ZU5A 1U90A 2JKHA 2BLOA 1FAXA 2XBWA 1R0WA 5A0FA 2FODA 4H1VA 2OC7A 4D80A 2BHGA 3L3TA 4QGGA 1N6OA 3TK1A 1RTKA 2GESA 3GP8A 1SFQB 1SXJD 4RKJB 1F5LA 5AFYH 4AD8A 2GHIA 4MVNA 4DCNA 4LJ5A 4RD6A 2G83A 1GBKA 1W7XH 4PZZA 1ZNXA 3T1OA 3TR5A 3QDZB 1I4TD 5IK2D 1TBQH 2OFOA 4DCVA 2R9PA 3DM9B 2QYIA 5T3HA 1ZNWA 4K60A 4I33A 1MT0A 1YKSA 3WYFA 2PKSB 1QRZA 3OY6U 4C7OA 3I92A 3QOFA 5C2JB 2BM2A 4FWTA 2XXAA 1MTNB 1BTUA 4ASUD 2AMQA 2C9YA 3SN6A 5EXLA 1OXXK 1G291 4IEIA 4KFSA 2G0TA 2UUYA 5T6GA 4A8JC 2AEIH 3RS7A 1AUJA 2J0VA 3ZJYA 1A5HA 2QPOA 4KV9A 4V0LA 1FZQA 2QAJA 3CX8A 2PZEA 3K0CC 1GDUA 2ZYWX 4YXWA 1RPZA 3MH5A 1T4VH 2FJUA 2PKSC 4OM9A 2WJJA 4ABEA 2ALPA 3EARA 4U30A 1NJGA 2XC4A 4JT2A 2K1QA 3RXCA 5DI3A 1TABE 3UIEA 2CJIA 3SNBA 1DAGA 1Z8JB 1C5UA 3RXQA 3SGBE 1ZR0A 2OP9A 3A36A 4Q4JB 1HAOH 1UCYH 5GJCA 4CEJB 1KDPA 1A5GH 3SOPA 2IUSA 2GRJA 1CSOE 2RG3A 1NRJB 3KJHA 1SGWA 4FW9A 1OS8A 1J8AA 3I5XA 3BIVH 4BAQB 4ACBA 4FVDA 1C2EA 5C67A 4Y71A 1QA0A 1W7GH 1DWEH 5FPKA 2HALA 1IONA 4I1SA 1FJSA 1Z6TA 5DHFA 3QKRA 1XKAC 4YQFA 4RKFA 4NMMA 1PV4A 1A2CH 1VG8A 1G18A 1WB9A 2IUUA 2WKQA 5FTJA 3KTAA 2BM0A 1X1RA 1F5NA 2EQBA 5LB4A 1P2UA 1MBMA 2P6RA 4INLA 2F6RA 3I5YA 1NTPA 5B6OA 4Q4HA 4M7GA 1O3FA 2VIWA 3P20A 1Z83A 3KQUA 2B8TA 1ID5H 5J47A 3PO1B 4ZHAA 1P0SH 4TPIZ 1SPJA 5HXFA 1VHTA 2XITA 1WQVH 5DI9A 1F7ZA 3KJGA 2ZM5A 3FVQA 1LHFH 4CRWB 3THYA 1ZSKA 5CJ2A 1XWIA 4YC7A 4XOIA 1W44A 3ZVGA 2PJRA 4O2RA 3SU4A 5F2EA 3SBDA 2YC2C 4HZUA 5JMTA 1II0A 3M3SA 4Z54A 2GZAA 2OT3B 4RD3A 4N1AA 1DSUA 2AMPA 4FMBB 1EWRA 2QA5A 1MH0A 3FFBA 3RXIA 1O87A 2STBE 1RRPA 5EQTA 1AS0A 3REFA 1AUTC 1O3NA 3UREA 3Q7PA 3X1ZA 2YWEA 1TALA 4NSYA 2O9QA 1EFUA 2A5DA 2ZUBA 1QA7A 1TNLA 2IWHA 4KFRA 4JYVH 1L1NA 3L0PA 2PLFA 2HNTE 4DLXA 4AYXA 1Z0IA 2Q3MA 1ZM9A 2ZIAA 1SBWA 4KFUA 1GDNA 1C2HA 1ZHRA 2NMVA 4CGZA 1UJ1A 4FUEA 2Y8EA 1QB6A 4OJKA 4CBOA 3SN8A 2Z6VA 3QG1A 3RHFA 2OCBA 1P6XA 3RXAA 5F9FA 4MNXA 4JYTA 5FL3A 2EA3A 4EAQA 1E4VA 2VP0A 4BOHA 1CT4E 1HAZB 5G53C 2AWOA 4IW4E 1RGQA 3TGIE 1M6NA 1A2BA 1S84A 3WXMA 2H8KA 2R2MB 1C5NH 3PUYA 1G19A 1GHVH 4BAHB 2J7PA 1XZPA 3T34A 3TLXA 3GY7A 2SGPE 4Q7YA 2QCYA 1JIRA 1G17A 5A8ZA 4IN1A 1ONBA 1TQ4A 3DL0A 2DCUA 1RIFA 3E16B 1L7VC 1DS2E 3I29A 3U8TH 2REBA 5FX6A 1X8LA 2H6MA 3TVJB 3SJ8A 4D25A 1GL1A 2IPHA 4IVRA 1VITF 2X77A 2AX4A 1IQEA 1SVIA 1QJ7B 3GLHA 4FVBA 1GFIA 4Z1MA 4BECA 1YLCA 3ZVRA 3I73A 5E7MA 4US0R 1W7AA 3R7WA 3NXSA 3QXSA 2QXHA 3K53A 1L1JA 1F2TA 3MFYA 5T1VA 3B9FH 4FUGA 3LV8A 4A5TS 4PC7A 1LHEH 4CRAA 2VYFA 1KSJA 2YOFA 5CMXH 3P8GA 5GCHG 1DWCH 1ZTJA 1CRQA 4WMDA 4OK6A 2N1BA 3SNHA 2ZRIA 3L6PA 1HTWA 2ZAOA 2ZI7A 5G3ZA 5AFZH 1XUIA 3SV8A 1LS6A 3ZGXA 3OY5U 4BXWA 1E99A 4DW2U 1N5KA 4ZI3A 2ILNA 2FTLE 4X8OA 2K5UA 1OKKD 2IYRA 4FUFA 2O8FB 3MWJA 2IF2A 1YQTA 2ZPTX 1NRPH 2Z43A 2R9VA 1YM0A 1OXGA 1OYQA 2V3OH 1O3PB 2F9VA 3L82B 1H4WA 3SHCH 2BDCA 1SVWA 4CT5A 4TMXA 4IS5A 1P06A 3PTNA 4Z8YA 3C41J 3I78A 4JBWA 1E0FD 2D1JA 1W36D 4JT4A 5GVRA 4A15A 1Z29A 2OE2A 3WRXC 2DFTA 1TB6H 3RXTA 1ARBA 1NJFA 2GVZC 4XSGA 3BAFA 1FQKA 2FYRA 3VPKA 1C1NA 2HPPH 1TF2A 1LHGH 3MLEA 2A7CA 3OX7U 2HCBA 2PLXA 3MRSA 2GDDA 4M1OA 1R5OA 4WWYA 4BFXA 5CDFE 4PZYA 2QAGC 1BTYA 4DBLC 3AW0A 3VB5A 1OJLA 4Q7LA 2VWNA 4TMWA 1WQSA 3QTVH 3M5OA 3GJ0A 2WJIA 4HAYA 4Q01A 1J99A 1TU4A 3NG1A 2V6NA 2F9LA 1XUHA 3FHCB 2EVWX 5FR1A 2H9HA 3MO3A 4HATA 1J15A 3RWMB 2Z3DA 1AWHB 4P3YA 2PHBA 4OJQA 3SJIA 1YU9A 4Q03A 1JB1A 4B2PA 1O2XA 5F3WB 3NC1C 2XYAA 2ZFSA 1G1MA 4NTZA 1EZUC 2OAP1 1R8SA 1SVSA 4GRAA 1V2UT 4CT4B 5E0HA 1UTMA 2BY9X 4YMUA 5FPHA 3BTFE 4B73A 1TMKA 1AFEH 2H5EA 4NCHA 5B6LA 1HURA 2RB4A 2GCOB 4WOPA 4EJSC 5FCKA 2Q3FA 3AP1A 4IOKA 4L8GA 1IQKA 4Z51A 3LFUA 3GCTG 1G7CA 3C14C 1E36B 4D8NA 1CRPA 2J94A 3MH4A 2Z9JA 3X1XA 2RH5A 4B76A 1ZC3A 2JDIA 4M53A 3OIYA 4URWR 5C1XA 3IDQA 1OW3B 4D9RA 2G9NA 1P01A 2VHTA 2XZLA 4W5JA 5HYOA 2ZSBA 1GOTA 4JK5A 2CK3D 3PEWA 2AKYA 4JLKA 5TCAA 3LKWA 2F43A 2XC0A 3BG4B 3OAAD 4OS7A 3RNLA 1TRMA 4X2XA 3KEEA 4B71A 1UVOA 4AKHA 1YZUA 2BOHB 4AYYB 5EXNA 5LDDC 2Q6GA 1KTSB 4B2IA 3SGQE 1DAEA 1YZNA 2BQWB 3GCOA 2H5CA 4IW3B 2QY0B 2JH5D 3RVBA 4UJ5A 1FY1A 4A0FA 2QPTA 5C4GB 3M7QA 2FA9A 1UMAH 1G7SA 1JMOH 4Q9JA 3REGA 1SULA 4II7A 4PC3A 1DO0A 3HYTA 4ABFA 6GCHF 3QPUA 1NRSH 6LPRA 3SJBA 2A5AA 3RM0H 3AF3A 2OTVA 5JJLA 2TMKA 4DGJA 5CK5A 2P5TB 3BG4C 2WWYA 3JZAA 4HUQB 2F9MA 2HNTF 1DLEA 2X19A 3RXJA 3ZV9A 1EAWA 4UNQA 1P09A 4OQFA 4Q1BA 3MO9A 1VDZA 1YRBA 1L4YA 1N0UA 3S1AA 1MQ5A 8OHMA 3PO1C 1SGTA 2D06A 1VITG 1HY3A 3FE2A 4NIXA 2RGEA 4HTCH 3SFVA 1SXJA 2FPMA 2ANCA 1NFWA 4PC1A 4OQXA 4H9GA 1ELOA 1T91A 2ZRKA 1W5TA 3SHAH 3PENA 1E2PA 1FL9A 4GCHG 4B48A 1LTQA 1BDAA 3IPYA 2PLRA 5J4LA 4CHAB 4EUNA 2GETA 2BD8A 1BTPA 5EJEA 5DE3A 1ZPZA 5K8LA 1GMCG 3GY2A 2G52A 1NY5A 2VVUA 2O8DB 3U4QA 2WKRA 1LVGA 1KOFA 1ZAKA 2A4GA 2V7QD 1Y8TA 4NG9H 3T61A 1W36B 1E9DA 4WVFA 2C3SA 4DLTA 3H84A 1ZM7A 4CDGA 1K8RA 3DO6A 4LHWA 2R0KA 1V5WA 4CEHA 4X2WA 2BY6X 4QJ5A 3A84A 1SQOA 3PV4A 2X8AA 2F9OA 4LBWA 2ERYA 1FNIA 1H8HA 3LLUA 4KYIB 2G51A 2CMKA 4WXVA 2ODBA 4B35A 3F3YA 1QDEA 1WBBA 4HZHA 4E07A 1BHXB 2XBVA 5BN5A 2P6UA 1C9PA 1V2NT 5AUPB 2R3YA 2D4HA 2PJZA 4IKEA 5FPTA 2W5EA 1PQAA 2A1DB 1O3IA 2RDLA 1XXFA 1WBGB 3ATLA 4S2EA 1MO4A 4ZKOU 2BMJA 2GKSA 2BXTH 3LOXA 4GSYA 4YXWD 2QENA 1LVMA 3GLFA 3C5HA 1OP8A 5JBQA 3U5ZB 3SUDA 5EW1H 1Q3TA 4RSPA 2W58A 3I32A 4I81A 3LDXH 4Y6DA 1WQ1R 3OESA 1WV7H 5E0JA 3GLIE 1W0KA 4AG1A 4YOGA 5FBWB 5C18A 5C5NA 1OYWA 1ELBA 1W1WA 3MWYW 4ABIA 1W2HA 1BMMH 2GXQA 2IHBA 3NK8A 3A4NA 2QAGB 1G5TA 1BIOA 1O3DA 1FUUA 1MTNC 4AGKA 4JYCA 4ABHA 1Z6GA 1J9CH 4DUGD 1O3YA 2W00A 4FMDB 5FBRB 3KQDA 2OQUA 2AN9A 2QT0A 4EPRA 2FTMA 2WPJS 4OYHA 2Y7ZA 3DMNA 5EODA 2XGJA 1OFHA 2F43B 1IM2A 2O0HA 5FPSA 1C5TA 6Q21A 3PLKA 2I1VB 2ZJOA 3LXXA 3Q3YA 3T29A 1W5SA 1TA2A 4Q80A 5JB9S 3E5HA 3QO6A 3T5GA 2BEJA 2QBYB 1AJEA 1GRQA 4ZIRB 1E1QD 3HPTB 2NZ8A 4BEJA 1R7RA 3VGCB 2IC5A 2Z9GA 1EFCA 1C4Y2 1XXHA 4NU0A 2XSZA 4DDUA 2Z4SA 5HR5A 2CNWD 1Z63A 1JQJC 4GOJA 4AB8A 2A5YB 2G1JA 1DS6A 4E7RG 3TSWA 1UTQA 3FGNA 5JSZA 3P70B 1FONA 2IEYA 1GJBB 4B32A 1LTOA 3VB7A 2W2XA 1C5QA 1L1GA 1SFIA 5B58C 3PUVA 3TK5A 1BMAA 3IHWA 2E1RA 2YNMA 5EXMA 3SQHE 2J46A 2LWIA 4C0SA 4BPBA 1TX6A 4O3MA 4HI0E 3CUEF 2W3KA 1O2JA 3GCHB 3MO6A 4C7OB 3VKHA 2FX6A 1WXRA 5EXPA 3ZVBA 4C30A 1TIOA 4DUGA 3Q3KA 3DZ8A 5L3VA 1CA0B 2W2TA 5BQ5A 2MSEB 2F3CE 3KIDU 2DB3A 4TSFA 1F92A 1DVRA 3M3TA 3VR2A 2XNSA 2YINC 1F2SE 4R7ZA 1N6LA 1PPHE 2YZ2A 3KX2A 4O03A 1NKSA 2PH1A 2QMEA 2IS2A 1C9TA 1CGIE 4TLDA 1Z2CA 3UANA 1KXEA 3UR6A 3SORA 4CEIA 5E7JA 4AFQA 4AWXA 1O2ZA 3CF6R 1CJTC 3A37A 2O8EB 2J7PD 1AVXA 1XXHB 4Q1CA 3SFZA 3SYJA 1GVKB 2RKOA 4HLQB 2ZIQH 4BFSA 4TL8A 1QVRA 1NNEA 1L2TA 4AKGA 1QJ6B 3KB2A 3G5UA 3PXGA 1I4DD 1MABA 2XWAA 1Z47A 5JI2E 5LB2A 1QBOA 4OHYA 3A7VA 2ANYA 2ZQ1A 3QBVA 1P5ZB 1XMJA 3PLPA 3THXA 1ESBA 1E2DA 1PJRA 4X2YA 4K46A 1GHBG 2QI9C 1C5LH 6ESTA 2GVFA 3THOA 1BT7A 4M2LA 1Z6JH 1V2VT 4XWOA 4Q47A 2ZI4A 1KJZA 2OBLA 4GVUA 1C1TA 5JS8A 4FMDF 5KNCA 1AY6H 1K1MA 3IITA 4OQNA 3JZMA 1E9AA 1QHNA 1FN8A 1YZKA 4A1XA 1DITH 5FFMA 1RRFA 4IOJA 4MKGA 4EPVA 3U6KA 3UTUH 4Q9LA 3KQNA 1A0LA 4NCYA 3FTQA 2OINA 1ZYOA 2O8MA 521PA 2OM2A 1N5JA 4WY3A 4MUAA 1Z5ZA 1ELCA 2A5KA 1NVVQ 1K21H 1Z0DA 2GCHG 4MTBA 3DKPA 4WZAE 1ETSH 5KDOA 2A7JA 5HZKA 3A86A 2JJ1A 4F7WA 4Q5IA 2BC9A 5CHAB 1M2OB 1GHXH 5LPNA 1IHTH 1TLDA 1MTVA 1FPMA 3BBPA 1PPZA 1R2QA 2ZFTA 3SV7A 1ABJH 1A3BH 1O5GH 1O5CB 3B9PA 1G8HA 1OH8A 5FOXA 4ZH8A 2DFNA 3L2OB 3ECCA 5GJWC 4G5SA 5EP4A 3SHFA 3VR3A 4ASUA 1P9SA 3H5CB 4Q4LA 3PEYA 2XAUA 2TGPZ 1O3GA 4MYHA 5HE9A 3RMNH 1A5TA 3ZYCA 2JJ8A 2GGVB 221PA 2ZHQH 1GBHA 3RXMA 1W0ZU 2DWOA 1DTSA 1RW4A 3B23B 2CCJA 2YVUA 1GRRA 1G3IA 3CRRA 2XBXA 5LD2C 4DIEA 2V9PA 4U00A 1G32B 1GJCB 4W7SA 2XTZA 3HGNA 1EAXA 2EFCB 5BWMA 4ZDJA 1CO7E 1RJ9B 4URXR 3UG7A 3QX5H 3A8TA 2ZEBA 2VA8A 3PUXA 1WF3A 4I4LA 4ZO4A 1OB2A 4X1NU 1W3CA 1KO7A 4M9QA 3U2QA 4HUQA 2IS4A 1S81A 2RCNA 5CM8B 3A88A 4ZKDA 1O2SA 4PANA 1GI2A 1ZCAA 4Q9IA 4GUXA 1P73A 4GHTA 1M1YE 1V2JT 2TPIZ 1ELVA 1QG2A 2X2EA 1NT1A 5T6FA 3L8YA 5IHPA 5GNDA 3KNXA 4NYJQ 1O2YA 1R10A 4Q00A 2B92A 4QM7A 1II8A 1TOMH 2C93B 4MG3A 1XXHE 4LK2A 1CR4A 4ERNA 1FN6A 3IBGA 1Z8FA 5TB5A 4U2WA 2ZSFA 1GI5A 1LKBA 1A61H 1SL3A 1TMTH 3E0NB 4OS5A 2AKAB 2QP4A 5FBQB 2VH6A 2CXXA 1Z3IX 1RFLA 1MKYA 1VGCC 2A2QH 1CVWH 2ODEA 3RS0A 4UDWH 3M5NA 3R3GB 4XTCS 1ZBDA 4IDNA 3FFGA 3T2NA 4MA4A 5BYKA 3ZZTA 1ESMA 1QGFA 4BE7B 4R71A 2B7CA 1O30A 5KSZA 1O3BA 3TE6A 4A92A 3CS7A 3BRWD 4X8MA 5H4IB 4LGMA 2D7CA 1Q57A 1KI8A 3VU9A 4JKYA 1C1RA 3DPUA 3QVUA 1Z07A 2ODPA 4EQ6B 4AORA 4FUHA 3ATWA 4OS4A 3OHMA 4GP6A 2HYDA 2BZAA 2BMGB 2F9NA 4X1PU 3GJ8A 3ZZ4A 4NIWA 2STAE 1QBKC 1F0UA 4BZQA 4Q4AB 2ATVA 3LONA 4K1SA 3K09A 5DNYB 1VCQA 1CJKC 1AWFH 2RA3A 2QN5T 3M6AA 1NRRH 3LAWA 5TV2A 3AKYA 1SB1H 3W3ZB 1P02A 2FFAA 1O5FH 2PBRA 1N6PA 1EP5A 1O5DH 1YPLH 2F1JA 5F9HA 1BKDR 4DCSA 2DWPA 1CHOF 4W5WA 1HAPH 1TONA 3MNBA 3RXDA 3GLGA 3EX7C 5EUMA 4HLUA 4GOXA 5FBEA 4OHZA 4CR5A 3TVDA 4DOQA 1JXPA 1CXZA 2GBLC 4NA8A 3D3QA 3GY3A 5L3SA 1C4V2 1HUTH 2WPIS 1KMHB 1CT2E 2FIRH 3EPHA 2G88A 5C3NA 1YCPH 4DSUA 1TF7A 1COWA 1ESTA 3TIFA 1AN0A 4UONA 4X6MA 5GXPA 2H92A 2G4UA 4R9UC 4TYWA 1GJ5H 5KO2A 3W3AA 1LO6A 2G4TA 2HJGA 3C8UA 2W7UA 4B2LA 2WAXA 4F4OC 4EFLA 1GBAA 2VIOA 3A8AA 3GCHC 3AV0B 1FY4A 3VNUA 3PM3A 2VU8E 1TADA 3SUFA 4TMKA 2H1UA 4KAXA 1X86B 1MCTA 4TL6A 2HWLB 3ZIAD 1XMSA 2GJ8A 3S9BA 4Y8ZA 5HM9A 5JSZB 3DKVA 4M21A 1ZNZA 1IQFA 4NWLA 2VO1A 4MDEA 1US8A 1G5PA 1TNJA 3MTYA 3S7HB 5AF9H 1IBRA 5DP8A 2HLCA 4R2HA 3HU2A 1TQ0B 4BLOA 5FR2A 3VEQB 1AIPA 1ZVQA 1IQNA 3AUXA 4GDFA 2FOMB 1ZPCA 1C1PA 4MLFB 1FQ3A 4NYJR 2D2EA 2PCLA 4I8GA 1XTQA 1S3SA 3P95A 1SKQA 1GITA 3LJJA 1F60A 1KSNA 4G5GA 3C27B 4Q1EA 2EI6A 3QY0A 4DCUA 2F91A 5DP9A 3EYDA 4TQAA 3M7UA 3QLPH 3VXEH 4GOKA 3LH3A 1G8GA 1GMHF 1WAYB 1TRYA 1YZQA 1GKYA 3W5JA 3CENA 4JCNA 2FNAA 4M1SA 4TWYA 3UQOA 4CH8B 1SHHB 2ZG0H 2ZDNA 2R6AA 2XCNA 3I72A 4A1FA 1C2LA 1G3DA 3ODFA 3A7TA 1TPOA 3SU5A 3UPUA 4B3DA 1SXJC 1V3XA 1DE0A 1OPHB 1EASA 1GBEA 3K70C 2B8WA 3FP6E 2GF0A 3A58B 2WWHA 3FPAA 5DO9A 5L3SB 4LHVA 3I8XA 3BFVA 1C2IA 5A2MH 4LXBH 3OYPA 1O5AB 1O3KA 2VWOA 1GHYH 4HB2A 2ZS9A 4UEHH 3GY8A 4B6FA 4PQRA 1EUFA 2FESH 1NM6A 3A81A 4JIMA 5FX5A 3MH6A 2WICA 2AGEX 2BBSA 2UVQA 4A36A 3BTEE 3NTUA 2FLBH 4AGJA 2QT1A 2KE5A 1FI8A 3TJUA 1GBTA 1RRGA 1SKYE 1F2TB 2QNRA 4E7NA 3NCLA 3A1SA 5C1BA 3MU1A 1JWTA 4KHZA 4N0DA 1O2TA 1RC8A 1ZHMA 3RS5A 1O2LA 2IOTA 3PUWA 2A32A 1P2OA 2FI4E 4MRSA 4I32A 3ZVLA 1IJFA 1KKLA 4DZZA 1D4PB 1NN3A 2ZFFH 1AKEA 1GP2A 3A8DA 4KVAA 1OWIA 4CH2B 2H5DA 3TH2H 5FL7A 3QPWA 1NC6A 1U98A 4GPGA 2WBLC 4LWZA 1GBFA 5KPJA 5FHTA 3S7KB 4OHWA 1YLDA 1GHBF 4NGAH 1YCPK 3ZVNA 1YPGH 1P2KA 4NFEA 2J3EA 1T8MA 3SQWA 2RGCA 4QNMA 1VG1A 5HKKA 3SU3A 4PPNA 3NPSA 1Q12A 4HB3A 1NFYA 1FY8E 2ZHFH 4M1YA 2ESTE 3OIVA 2NU3E 4ZHMU 2F1HA 4C2UA 3K8YA 4IOMA 1G9IE 2YOHA 5TARA 1F0RA 4MQAA 1ZC4A 1Q22A 3VR5A 1UAAA 3AVVA 1KTTB 1E79A 3BN9A 2UUKB 2FOAA 2VINA 2OCAA 5AJVB 3NDBB 2JIZD 3I1FA 3W8RA 3RC3A 4TLBA 2FPKA 1O36A 1KLTA 5TY0A 4Q4HB 5JJIA 3RXVA 4RCYA 1DM4B 4XJXA 3TNFA 5HMAA 1ZOMA 1AFQC 1R0ZA 1ZHPA 3RXEA 2VP2A 1C1MA 3KTAB 2VP5A 5JCPA 2FPLA 2UUJB 2IW3A 3D23A 3QKTA 4EPTA 1GTVA 5EXSA 1UEJA 3KFVA 1CS4C 3U3OA 1EPTC 3DFLA 1A4WH 1C1UH 3ZS8A 4ASHA 2AL7A 2XOKD 4ILEA 1BO6A 4QHSA 3DD2H 1PYTC 1CTQA 4PHHA 1O32A 1OX1A 3LBIA 4ABYA 1Z7KA 1BQYA 1BRAA 5LD2B 1R5NA 1CA0C 5EQQA 1K9OE 3PMJA 2PV9B 1DWDH 4D4JA 3A6PC 1T0JB 3BWDD 4LYAA 3KB1A 1T3HA 3CPHA 1N0VC 1BIFA 5EUQB 2FDCA 1E34B 1P61B 2D3WA 4NBSA 4C0BA 1M7BA 3AVXA 2QGZA 2GILA 3VTKA 1PUIA 3ZS9A 1D6WA 3C15C 3EZ6A 2B0FA 1IY1A 1MTUA 4F4JA 4X8LA 3TQFA 4TWZA 4MYUA 3BS4A 5FI1B 5DH9A 2JIZA 3CW2A 1QBVH 2AWNA 5JHHB 1DLKB 1W2GA 4TZ0A 3WMEA 2C77A 3X1YA 1EOLA 3G01A 4JL6A 2OG2A 3EAQA 2JLQA 1J90A 1LW7A 1AU8A 1II9A 3BFKA 2BXUH 3K9NA 3ZD6A 1FTNA 3UWOA 3IO3A 2ZYTX 2DE8A 3K0FB 2GTBA 3LX5A 1BB0B 2IJOB 3QF4B 3OFND 2Q6TA 4XIGS 3CX7A 4I8JA 5SZHB 3EXAA 4DHEA 1O37A 8ESTE 2IHYA 3N7OA 1Z0JA 1GBMA 3TU7H 3KDSE 1GAJA 2WPKS 3LY5A 1LCYA 4CEJA 4K8BA 4Q4JA 2ZE8A 2HVXA 2C04A 1QG4A 3LQQA 3BIUH 4TQ9A 5GADl 1G3CA 3W6NA 3BERA 4ZKEA 2W3IA 2Q0HA 5L3QB 3TGPA 2GJ9A 1FPCH 2FSGA 4XH9B 3UMSA 4JK6A 1HJ9A 1P04A 4Y0YE 1AIXH 2FOGA 2CL7X 1W14U 2ZE5A 1TA6A 1ANBA 3URDA 1AZ8A 4L5BA 2FOCA 4DSNA 3BTME 2ZRHA 1IY0A 3K2UA 2Q21A 4R8TB 4RCZA 1XMIA 3WY9A 4BZPA 1NY6A 1N5LA 3QBTA 1BOFA 2W0SA 3DOFA 1S9DA 2QU8A 1XEXA 3EWSA 1N6XA 1T4UH 3PITA 1COWD 2OD3B 3P8NA 2EYUA 4K5ZA 1QURH 3BB1A 3OSYA 4PC2A 2ASUB 3RSOA 1I4LD 1JJVA 1VCNA 1QHIA 1GL6A 2IK8A 3QSYA 4E22A 2Y82A 3A7XA 3A89A 2ZU5A 1ZUHA 2CE7A 4Q7JB 1N6KA 4O25A 5C20A 3MWIU 1DPFA 1M7HA 2FEMA 1W49A 5IDVA 3ZYDA 1N8OB 5EE3A 1XUFA 3GLGB 1V2RT 4BFVA 3GLIA 1A7SA 3IEVA 1N6RA 4ESTE 1DARA 1JQLB 1JEDA 4ZIRA 1ELEE 1SVMA 1SMFE 1KLJH 3W34A 2HYIC 4B3XA 2PFEA 1ESNA 4WA7A 2C99A 3LIWA 3CWQA 2NU2E 1MUEB 3N70A 1E38B 2OHFA 4NYIQ 2XTMA 2QORA 3ND8A 1OH6A 1AN1E 5G3YA 5ABWA 4YM9A 1DY8A 1TOCB 3ZZUA 2IEZA 2ZU6A 3T1TA 1K1JA 1UVTH 4OS2A 2C8ZB 3I4LA 2RCEA 3HU3A 3AP2A 1UO6A 5ESTE 3Q5DA 4OGYA 1JR6A 4AOQA 3V7TA 3TKLA 3W5IA 2ZREA 1PQ5A 1XVOA 3MYWA 3M7TA 1NMYA 3IBYA 1AA9A 4HZUB 1ZM2A 1YZTA 2KWIA 4F91B 4JZEH 5E7IA 1DFPA 1G30B 2XTTB 2VHQA 1UJ2A 1KGDA 2IYVA 1M8PA 2IXGA 4EDHA 4Q1DA 1CKEA 5IF9A 2CV3A 2QXIA 3P1JA 5H1YA 1X1SA 1SLVB 2ORWA 4KBFA 4DG4A 1VHLA 4MH0R 2IS1A 1SI5H 4Y8YA 4EIWA 5EE5B 2OBMA 2GXUA 1RE0A 621PA 1BCUH 1ZM3A 5KYKA 2MSDB 1BHXF 4DIIH 4QG7A 1BYIA 1ZMLA 2AXNA 5JS7A 2C5LA 1GKIA 3ZVDA 5J4QA 7ESTE 2O8TA 3RRNA 5JEDA 4QT8C 4V0MA 1E2MA 4X6PA 3EASA 3EW9A 2Q9BA 3K6YA 4O9VA 1YR8A 3R8CA 4D4LA 4X6NA 1T3SA 2OC8A 1TUIA 4JZDH 1JOUB 4KGAA 2AFQB 3A83A 1P2JA 3BEFB 5DYIA 4DLVA 1C5WB 3KJIA 1F48A 2RAPA 3C1KA 2G8TA 1XMVA 4M22A 3ZD7A 2WV5A 4P33A 3CP7A 1P2MA 6GCHG 1EFRA 1Z0FA 4M8NE 1HJAC 2J87A 5A5GA 4P4SB 5BRRE 4KSBA 3V9PA 2V4ZA 1O3JA 3LW7A 1XJ0A 4RN6A 4ESHA 2P5SA 4HUTA 1SGPE 2IYSA 1OIWA 2J41A 1AFQB 1NBMA 3TUIC 1GHAF 1MKWH 2LPRA 1NESE 2G3YA 3FMPB 4HYYA 4OQMA 1XTRA 2GBLA 3X1DA 3Q76A 1OT3A 2BWJA 1L8QA 3GLIB 5B30A 4ISOA 2BDTA 3QKRB 1VKJA 4LPKA 2BOVA 3ZVCA 3D8BA 2J0QA 1KY9A 2SGFE 3RP2A 3U8OH 3FKSA 4TSFD 1NVUQ 1GNRA 4DT1B 4QJ3A 3CNLA 5GDSH 1FY5A 1GI3A 3WHLA 4GCHF 3F9HA 1P57B 1H65A 1NN5A 2FG5A 2C9CA 1THRH 4ZXXH 2OFWA 1UK2A 4M1WA 1V2OT 5K8IA 3OE7D 1CJUC 1VJAU 1BJUA 2ZSEA 3MAAC 2BTCE 4NYMQ 1ELTA 1AO5A 2HEIA 1NLYA 4DSTA 4BRUA 1WOFA 1V2MT 4QJ4A 4TLAA 4ZPXA 2GXSA 1UADA 1MKXK 2PX0A 1GKUB 1VCMA 2JCSA 5G40A 3N2EA 4NHOA 1TMBH 1ZIOA 2IS6A 5EPYA 4ITRC 1YR6A 1P2IA 4KU4A 2BD3A 2W0MA 1F0SA 1E6CA 2OC1A 3UR9A 2ZTYA 1D9XA 2FSHA 5C4MA 2WHXA 1S1CA 2ZITA 4IDQA 1K5DA 4MRVA 4YOIA 3WP1B 4TY6A 1TEVA 4P4UA 3PWBA 1V6DA 5C1YA 4EPWA 4O97A 1RYFA 3PFIA 3KKPA 3EA0A 3KKQA 4JYBA 2BDGA 1NLFA 5FUYA 2GCOA 5KNDA 4ABJA 3A85A 4IOLA 4C0LA 2VGCB 1ZYUA 2F9PA 2NGRA 1EXMA 4BTUB 2PTCE 3QZQA 3E1XB 2ZCKP 4OK3A 1XTSA 3GLHE 1A1VA 1VITH 1D2MA 2WYGA 1QQ4A 1OFUX 4PO1A 1X3SA 3TMKA 3SZNA 3KCGH 4RZUA 3U8RH 2AS9A 1SQAA 3WYGA 5C46F 3L0OA 2Q6FA 5FUXA 2XZOA 5KSOA 1NFUA 4ZDKA 1HAXB 1CR2A 2NO0A 3RS3A 7KMEH 3W8NA 3ZDQA 4I8LA 2QF0A 2JJ2A 1Q20A 2YC4C 1AB9B 5DGXA 3KJEA 3VR1A 1EPTB 2PL3A 1QQUA 2C8VA 1QHGA 3C16C 2SGEE 2GAAA 3FHTA 4DY7B 1OXVA 5DP7A 1G37A 2ZRLA 3NHAA 1PJPA 1E9SA 2WPDD 4DVAU 4LOAA 1UVUH 4JLAA 4LBVA 5PTPA 3M3VA 3AKEA 3GFOA 5EGMA 3DHWC 2H16A 1UHBA 3FP8E 2ZRMA 1HV7A 3BEIB 1C2JA 7LPRA 2UWLA 3HGPA 5E4FA 4AC9A 2BBTA 1KJYA 2A5FA 3QNUA 4FUBA 4TT3D 1UBEA 2C96A 2J2UA 3GDVA 1TGNA 4WVPE 2V6IA 3ZQ6A 3WNCA 1AI8H 1KO5A 4P0TA 1ZD9A 2VSFA 1RKBA 3U7HB 1CHOG 1K6MA 2D8WA 1OH5A 1NSTA 4QM6A 4X1SU 2PT5A 2DY1A 2CL6X 3BTGE 1E1RA 4TL9A 3MUFA 3ZVFA 2ZSDA 3K0CA 2ZI5A 3B9QA 3R9XA 4FCTA 3DA9B 1Q1QA 5BN3A 3AVYA 1IQMA 3WMFA 2WPHS 1FIWA 5DP6A 1W0KD 1GL0E 1B23P 1QRAA 3RYTC 2OXRA 5HZHA 2QP9X 1GPZA 4D4KA 1P8VC 1TWXB 1NP6A 1EXFA 1SVLA 1HT2E 2NPIA 1BTXA 1O35A 1ZINA 2RHDA 4GL2A 1RRCA 1LY1A 4JJKA 3H0KA 3SOSA 1HJAB 1YE8A 3V00A 3RC8A 3AH8A 4KLZA 3A80A 5KDLA 2DPXA 2IYXA 1M34E 2C95A 5CLQA 5C2ZA 1C4U2 4KJZA 4A6XA 3GCTF 3PEVA 3GLFB 1SGFG 5HGGA 1G3QA 2XJ4A 2YYZA 2VP4A 2WAYA 1IQHA 4Q7ZA 5AJXA 2QPAA 4BAOB 1O2VA 1BBRH 1H9IE 3BIFA 2MMGA 1KTVA 2TIOA 1YR7A 1VYVA 1PVOA 4U5XA 1GI0A 1UF9A 2F3TA 4Q66C 2CN0H 1XD9A 1C1VH 2FM2A 3T62A 1BH2A 3UWKA 3SBEA 2ZJAA 1OP2A 3LQRA 1P10A 4LC0A 2A4RA 1FTSA 1HGTH 4ABDA 3ADDA 2BDIA 3AB3A 1V2LT 2O8CA 4ZDWA 4ARZA 1KI3A 2C03A 2WWFA 2ZRCA 4F4IA 3QENA 3FVFB 2UUFB 2ZWLH 1B0EA 2BX4A 3U4QB 3PMAB 3O8DA 1QNJA 2ZANA 2H7VA 2YNAA 3RUOA 2H1LA 1A1RA 4IDOA 8GCHF 3DHKH 3K9LA 1QIXB 2VVCA 1XUJA 5F6MA 3NWJA 4YESB 3IGFA 2GCHF 3K9XB 4G1UC 3GISB 5CK4A 1JXOA 2ZR7A 4A2WA 1W8BH 1ZIPA 3MMPA 3RXHA 2VP6A 4TLEA 3HU1A 4ABGA 5AWFC 4C9BA 1AQ7A 2PKAB 5E0GA 4HB0A 5L30H 1YPHE 3I62A 1LF5A 2ZA5A 3EC1A 1Z6AA 1TE0A 4ZUHA 3ASZA 1CQQA 1H9HE 4DEXA 1HQCA 3SUEA 1GBBA 1P3EA 2D26C 2CF9H 1U2RA 1XTKA 4M9SA 4UXJA 3NH6A 4WXRA 5AUNB 4O3TA 1YKTA 2ZE7A 4A0HA 3VX4A 4DRZA 1RS0A 2PT7A 1EJNA 3RRMA 1MMJN 3Q8XB 3OZXA 3AVUA 5JWHA 4NL4H 1P2SA 2GJSA 2IJD1 1E2KA 3IUYA 1T3LA 2FYQA 3SEAA 1HAHH 2A2XH 3JZ1B 1AS2A 2VF7A 3TR0A 1T32A 1HRTH 4Z8XA 2Y81A 3QKSA 5EXXA 1WCV1 2JH6D 4AG6A 5FXLA 3KL6A 3EZ2A 3Q3XA 5C1UA 1DEKA 1SOTA 1U0LA 4OL0A 4PQFA 3B7GA 1GJ6A 2OBOA 2I6QA 2DFKB 5ETXA 3A7WA 2XBYA 1OKXA 4A6PA 3NVAA 2RGNA 2V1XA 2P2LA 2FOEA 2IA5A 1BS1A 5F8ZA 4HLCA 1XTJA 3SDZA 2A4QA 4FUJA 4PR0A 4RZ2A 4LJ7A 2ZJ5A 2IXEA 5A4JA 4NH0A 2JLVA 1YF4A 3U7EB 1W10U 3F9FA 2V0BA 1C4OA 4B43A 2ZVPX 2FFQA 2BQ7B 1B7XB 2GEUA 2NO6A 1O3MA 5KPDA 4LYJA 2P95A 2ZU4A 2JETB 2C8XB 3HYRA 1NIJA 4US1R 1SGIB 3K9HA 2UZIR 1IAUA 4PPGA 1AZSC 2C2HA 3K09C 3OU0A 4OHXA 4JZ1A 5EQSA 2DBYA 3H09A 1GILA 1RIWB 2WJVA 3KKMA 2WM9B 1J70A 1UM8A 1E0JA 3UNRA 1PPFE 1OWDA 3AVZA 1HYQA 6CHAC 2QM8A 5FTNA 3DDCA 7GCHG 1CP2A 1UTNA 2RGNC 4YMVA 4QGFA 1EESA 3QXHA 4F92B 1QHHA 2ZYVX 4HAXA 3M37A 1U81A 1IY2A 3SW2B 2R0LA 4XFQA 1MU8B 4ZKSU 3DZDA 1J8MF 1C5RA 2J0UA 2DFLA 4PO8A 2A31A 1ZW6A 3RXRA 3ZZ8A 2ZEJA 2QROA 4XVRA 2QQEA 4MPVA 5UKDA 1J2JA 3SI7A 4KYUA 3RXBA 3SYNA 1P7CA 1N3BA 1E9FA 4MPXA 2EYQA 2WPMS 1O38A 5EP2A 1DSTA 2Z3EA 4FMCB 3VFEA 5AVDA 4BANB 1XZQA 2KI5A 1GWNA 1WE2A 1OKKA 2A78A 4KODA 1K28D 4BLSA 2L0XA 4BZXA 3S0NA 2FE4A 1NSFA 5CJPA 5K0HA 3ZZ6A 1D6JA 2ZSAA 1TYNA 3A7YA 3LGVA 1OWHA 5TVKA 1TNKA 2ZFRH 4G01B 5HKKD 1PUJA 3CNOA 3OFNA 1KI7A 4QL3A 5SGAE 1OWEA 3FFAA 5JWOA 3HK6B 4URVR 3ASYA 1FV9A 1S8FA 3K0EA 3PEUA 1LS1A 1JEEA 1AD8H 3K0FA 1X8KA 2JLYA 2OBNA 4BQSA 3AGPA 1SHKA 4C0QC 3Q00A 4DEYA 4DT7B 1TAWA 3VB6A 1O3OA 3M5LA 3T5DA 4DLZA 3VU9B 1PLJA 2W6ID 5EU8A 1TPAE 1G2LA 1MR3F 2IWRA 3RXLA 1KXBA 4D26A 3NWUA 3CM0A 2OCYC 1GL7A 2GV6A 1EAUA 1OFTA 3GMTA 3GCNA 3ESTA 1SOZA 3CB4A 2E87A 2CL0X 1A4RA 2PWXA 4HAVA 2C8WB 1W4RA 2BIFA 2ZGXH 4KSCA 4M9FA 5FI0B 4MKHA 3U3MA 2A2ZA 1KI6A 3PMBB 2ANMH 3R7WB 4BLPA 1ZPBA 4JLNA 1P9WA 2FZ4A 1SGNE 3NXPA 1QZXA 1Q44A 4E05H 3M1IA 4ZCIA 2ZFPH 3ZH9B 2X2FA 3AVOA 3LNCA 3CNNA 3GQBA 3A1TA 2ZETA 2P3UB 4G5OA 4NA7A 1OYTH 2QF3A 1SLWB 2J45A 3RRYA 2BD2A 2XOKA 2YV5A 2ONJA 4JS0A 1S82A 2JGNA 1MRNA 2GMTC 1FLEE 3P4YA 4QOSA 4JLPA 3D7MA 1H8DH 5G4BA 1C1OA 2QE7D 3NKVA 1GBIA 2ANKH 8KME2 2Z6BD 4FCVA 4TTRA 3KXLA 1JNYA 1Q0UA 2O5VA 1C1QA 2BDYA 1NN0A 1OP0A 4TYNA 4RVCA 1XX9A 2DHRA 1KIGH 3F5FA 2OILA 3SV6A 1AKSA 1BITA 1DUAA 3ZZ5A 2H2ZA 1XPOA 3U1JB 2F7SA 3E91A 4NIYA 3D49H 1KZGB 1R0YA 2XEXA 1EWQA 1EATA 4F38A 1TPSA 3ELAH 2ASEA 5EOKA 4MKFA 5L6NH 1EP6A 3GJ5A 4DURA 2YJTD 4LX0A 3HK3B 2FS8A 2QN6A 2AGIX 4BFYA 1ELAA 2D74A 5TCCA 3V3MA 2ZHWH 2AYWA 5JPMH 1IN4A 1H1BA 2P65A 1IHSH 2RGGA 1X8JA 2NG1A 3SJOA 3B1WA 1UTPA 3H4MA 4MNVA 4LK4A 2CVFA 4LPSA 2HRVA 4FXPA 2WPDA 1Y5BT 5GJ4B 2XRCA 1TBZH 2A30A 1NFXA 2PEYA 1LV7A 4ZAEA 4MGYR 1DXWA 4B6EA 4NZLA 1KXFA 3RMOH 3GOVB 4LI0A 4YMTA 1OFIA 3LVQE 3TJOA 4D4MA 1U99A 1YP9A 1MKWK 1IOEA 2DR3A 2IUTA 2FSFA 2BQ6B 2QIQA 3PIRA 2P3FH 3ETLA 4X1QU 4ABAA 1T8OA 2VIDA 2ZS8A 1XPRA 2AR7A 1ZCBA 1XMNB 4B3GA 1GBDA 4K1EA 1RJ9A 1VPLA 1W0JD 3Q3JB 1OXSC 1R8QA 3PVSA 3A1VA 3JVUA 1HJ8A 5AHGH 3CBQA 4JLOA 2CHQA 3U3RA 4AFSA 3LW8A 1CJMA 3SU1A 1LMWB 1L4UA 1KDOA 1TU3A 2QXJA 2YOLA 2WIBA 2FX4A 2GEDA 3ITIA 1FMGA 4E06H 3ODDA 1UDXA 2KBFA 2XXLA 1HAYB 2BY8X 4V0ME 1N6YA 3V4RA 4DLWA 2FV8A 2EW1A 1ODFA 2QY9A 4URYR 1OOKB 2A5IA 3PG5A 2CE2X 2GZ7A 4DIHH 4PSAA 3SE0A 1GJAB 4DJTA 2ZKSA 4RFVA 4HAUA 1IQLA 4FWIB 1C2KA 2PGQB 2WSSD 4NCJA 3SJ9A 1E37B 1XX6A 2GAOA 4TN1A 2JLZA 3GJ7A 3SNCA 2BJWA 4A1VA 3I61A 1CE5A 3F9EA 4ZV4A 1Y3YA 3SV2H 3W6OA 2H17A 1GI8B 2GZHA 2BD9A 1G64A 1MABB 2NU1E 1QHXA 1A5IA 1BTWA 1XTIA 3PV0A 3RU4E 2W26A 5TMPA 2VBCA 4YTAA 3F8TA 3U7GA 1BYUA 2WIAA 2AGGX 2ZJBA 2PZGA 2G77B 3MU0A 1INCA 1QL8A 1FUKA 1TGCA 2D62A 1JIMA 2R6GA 3WMGA 1VMAA 3B1ZA 4ZXYH 2HUPA 1TQDA 4LHYA 1NBMD 4LJ9A 1YHNA 3H7OA 1B0UA 3LXRA 1ANKA 2O8UA 2EFGA 3V12A 2IX3A 3EWAA 4IFEA 2WWWA 1QBNA 4D0LB 1TPPA 4P32A 4DB4A 1EK0A 3CRQA 1C5SA 4BTTB 1IN5A 2ZVQX 2FEOA 1EZQA 2FI5E 4KBGA 2WOOA 6CHAB 2G0NA 3RDZA 3Q7QA 3H7TA 1UHBB 5CM9C 5EP1A 1KMQA 1HE1C 4US2R 3B8HA 5FCRA 1D3PB 4Y11E 4A1TA 1TQ6A 1LFDB 1NBME 3CLVA 2JLWA 2O0JA 1TGSZ 1Q1ZA 4PFSA 2CF8H 3IG6B 5JWRA 4B34A 4A2QA 2OBQA 3DM5A 2CHAC 1TQ2A 3ONWA 3NBXX 3A1WA 4V0NA 3UKDA 3ZZCA 1KMHA 4WZBE 2FF7A 5IDKA 5EE0A 3S9AA 4RKOB 3AKDA 5DHAA 3TLOA 1YC0A 1EFTA 4IVPA 1BOQA 3LPRA 3UATA 2V55B 3PYHA 3VR6A 3LT3A 3I3SR 1G8FA 1S1MA 2AMDA 2P3TB 4KVGA 5L3QA 1K22H 2XX3A 5FOSA 2BKUA 3IIKA 1XRJA 3LH1A 4H1UA 2C8YB 2XJ9A 3AAVA 4RD1A 1W0YH 1P3JA 1MAXA 2Y5FA 3S69A 5ANRB 2WSMA 2NO7A 3BK7A 2QRNA 2V3HH 1IQIA 1Z6EA 2N42A 4NCNA 1C5MD 2FI3E 5C5OA 4W9MC 1FDPA 5J4SA 1UVSH 4KELA 3KQKA 4Q2KA 1S4QA 4NONA 5ESBA 2P67A 4K8OA 2PZFA 2TGTA 2OCPA 3LGIA 5DJ7A 3U60B 2JH0D 1TX7A 1QTFA 1EZXC 3U6BA 1C2GA 3GY6A 1C2FA 1O5EH 2IYLD 4FMCF 2ZJZA 2FSIA 1W12U 5CHAC 4Q21A 3TJNA 2QAAA 3W6PA 3TBKA 2GZ8A 2Y7XA 3UQVA 1ZJDA 1GJ4H 3P27A 4U32A 5KNBA 1GG6B 1BMNH 1M9UA 2UWPA 2W6IA 4QRHA 3A8CA 2YKGA 1BMFA 4NZQA 1E98A 2QBYA 4QGAA 1SVPA 1W11U 1P4SA 3GFPA 2O8LA 3EQ0H 4X8SH 1MZDA 2PTNA 3HDTA 1NPMA 3KGPA 4ZDIA 2GCNA 4P4SA 2GP9B 1TEXA 4QC2A 2A4OA 4ZI2A 3SHWA 2FOFA 2FGJA 4KCGA 3MNSA 5F8TA 4R0IA 4CEHB 1O2OA 1Z06A 2ZRDA 5JEEA 2JASA 2C4FH 5K8UA 2ZECA 1MOZA 1ETTH 2ZTSA 4B2BA 5EXTA 5JBCS 4B44A 4DT1A 3Q85A 2ZE6A 2ZR0A 3H1TA 1Y3WA 1GSIA 4A4DA 1TNIA 1EOJA 3VHXA 1T8LA 4TTPA 5DPAA 4G3XA 5F03A 2A7HA 1ZUNB 4ISHH 4Q02A 3PV5A 2VNTA 4X6OA 4GMXA 4SGBE 1Y63A 4H4FA 5FOVA 3F6UH 3E90B 3J81k 1M74A 1W2KH 2NO9A 4XBCA 5EQRA 3SJZA 1GVLA 2ZUDA 3MWKA 2FOHA 3MMGA 5CB6A 4LJAA 4YLQH 8GCHG 3PMHB 5JI3E 4C2TA 2XNIA 2P0EA 4K8YA 5H8WA 1WTHD 3KFXA 4HAWA 3L43A 4XBBA 1GCTB 3ICQB 3BV9B 2JJ1D 3CH4B 2FOBA 2DE9A 4A9AA 2BHRA 3SNDA 1E35B 1F5KU 2VH0A 2IYTA 4KITB 1JBKA 1II8B 1XXDA 2AIQA 3U44A 1G4AE 4BAKB 1PPBH 1CA8B 3LWNA 1FY3A 1AE8H 2OUKA 3F1SB 4OS1A 4XVUA 1UK3A 3SC3A 4QKQA 4L16A 1ANEA 2A3RA 3WHKA 1IN8A 1FNNA 5J4VA 3GD7A 1PPCE 1E0SA 2KB0A 3NDPA 5EPNA 5KU1A 1L4ZA 5JLJA 4GLYA 5B57C 1GJ8B 1P9UA 1KK1A 4EJSA 4B33A 1Y3UA 1C1YA 1T8TA 1BJVA 4HDOB 2VL7A 1S83A 4Q18A 4I8KA 3THXB 3BXZA 3CRMA 2P8OC 1G5RA 4Y7BA 3CRW1 2QUZA 1SGFA 2ZFQH 4A8JA 5DN6D 1F6BA 3TUJC 2ZAMA 2JLRA 2AD5A 4EPYA 4NCIA 1KSFX 4EPXA 5CLLA 3LLMA 5AK0A 3W94A 1Q2WA 3EPLA 3MH7A 3ADCA 2AHOA 2PSXA 2EI8A 4TT3A 4I31A 1DDJA 1Y3XA 3QZRA 2WSSA 2BOKA 1EB2A 4JLJA 3KQEA 2NU4E 3TSOA 1A3EH 2BD7A 4K69A 3LVRE 4FD2A 4Q9KA 1JPJA 3RXGA 4DJZB 2EU8A 4AYVB 4UE7H 1MD8A 1QHHB 3UMRA 1V2KT 1OYYA 4I1VA 1LHDH 4L9WA 1HB0B 1XD8A 2PCJA 1DANH 5KHOC 2WMOB 1HQYE 2EWVA 4E03A 2O52A 1ZZZA 4U02A 4XWKA 3SO3A 3DVLA 2ZGJA 1P12E 3RXOA 3CX6A 4OBEA 1C1WH 1Q3HA 1ZSJA 1GHAG 1DT2A 4PC6A 4QGHA 2ERXA 2SGAA 1C2DA 3H86A 4RD0A 1ABIH 2RMKA 5BXQC 3RAPR 5TDHA 5DSZA 4B2CA 4NPHA 5JRZA 4POAA 4GFDA 3M0EA 2HXSA 3CWZA 1ANDA 4DXAA 1SGEE 2EFEB 1YBWA 4DSOA 4IXNA 3U69H 4INKA 3MJHA 2XW9A 5JBAS 1IHUA 1P2QA 2Q1JA 1US8B 1BBRE 2WOJA 1GWAA 1HPGA 3SJAA 1LKAA 4JVMA 2B9LA 4CVNA 1P75A 1KO1A 3KUCA 3PQCA 3U9AH 5F98A 3WY8A 2MSCB 4AYWA 2OUAA 1GDQA 1S9HA 4MQBA 5B2ZA 3SU6A 1W47A 4FI3C 2XTNA 1K1LA 4LY6A 2ZPRA 3PV2A 1UTJA 1XEXB 5FBVB 3CZPA 3EG5A 4YMSA 1D6RA 2FS9A 4HI3A 2FFHA 4J1YA 4UJ3A 4YLGA 2BLQA 3BSQA 1EAIA 3AASA 2QL6A 3VKWA 4GHQA 3OIWA 1O3EA 4PHGA 2W6JD 4D81A 3AAUA 3WBJA 4RSGA 4H42U 2R3UA 4PHFA 4BLQA 1QB1A 1ETRH 1O2QA 4GPTA 4RFSA 2Q3HA 2J0UB 3FOZA 1ZUIA 4QBFA 3RWOA 5T6DA 4D76A 3DOEA 3THWB 1UFQA 1EJMA 2ZDKA 5E8EH 1CHGA 2Y6TA 3K65B 3VHLB 3GEEA 2QRZA 1FFHA 1THSH 1YPKH 4A8JB 2CMYA 1ZTLA 2ZCHP 1UKVY 2GF9A 1TX4B 1FZZA 4CREA 3NH9A 2FXRA 3M61U 1S85A 2BVXH 4UFDH 3U98H 1KYNA 1VYTA 3WNBA 1UCYE 1GHZA 2PX3A 1JRTA 4X0WU 1HLTH 1S96A 2O8WA 1F3OA 2Z7FE 4Q1AA 5D3QA 2AK3A 3CO5A 3PROA 2F4LA 3WYAA 1O3LA 4B3CA 5E3HA 1KI4A 4EQ6A 4AN7A 2H57A 5KTYA 3IILA 2QTHA 4LZ4B 5JBBS 8LPRA 5H70A 3F0TA 9ESTA 4JKIA 3KQBA 1SR5C 1E2LA 1RTFB 4ACAA 2AFIE 2R2WU 1U9IA 2ZRFA 1YPEH 3MJRA 4LDJA 1YYY1 1YZGA 2CEAA 1VYUA 3RANA 2XSZD 1KI9A 3TUZC 1VIYA 4KP0A 2HF9A 4FU9A 3L0SA 4CZ2A 2FOLA 1G3MA 2V35A 1HA3A 2F55A 4IC6A 3KQCA 2VH5R 5GJVC 3ZZ0A 4M4SA 9LPRA 2BLWA 4Y10E 1C5VA 4MRNA 3FMFA 3IO5A 2IBMA 3P4XA 1WU1A 2ZP0H 4UNSA 3QK1A 1ZD1A 5BN4A 1XUGA 4A0RA 1XNJA 1J8YF 1O2IA 2WPLS 4A82A 3P92A 3AVTA 3HKJB 3KN2A 2JEOA 5FUWA 3Q9LA 3HR8A 2ZPSA 4SGAE 1FW6A 3TVTA 1C2MA 5TXGA 2RGDA 5GJBA 1SLUB 2O8BA 1E9BA 2BY7X 3D6TB 2J59A 1ZP6A 1DX5M 1Y5UT 4NSVA 1G3BA 4Y0ZE 1LQDB 2XB4A 4XSKU 4JLVA 1G8YA 5EP3A 4K81B 4Q7KA 1BZXE 5D3MB 4G5QA 4NYIR 1E0KA 4OI1A 2VEDA 3IQWA 2NTYC 4U7DA 1E3MA 4GT1A 5JCZA 2W7SA 2QQ0A 3QJYA 1HIAA 3ADKA 4AFUA 4M0LA 1AM4D 1Y3AA 4JLBA 1SQ5A 3RS4A 4K3JA 1AVWA 1IN6A 4CRGA 5A09A 1E9CA 1MZAA 2KSQA 3B85A 4DVGA 1SGRE 4N3NA 1DELA 1KDQA 2FMXA 3OIUA 4KFTA 4G0NA 4F49A 1YR9A 4WH8A 2BVNA 2DYKA 5DGJA 3GJXC 4GBMA 4TL7A 1KY3A 3VNVA 1E2GA 2A0QB 1HNEE 3A82A 1N6IA 1LVYA 1WBDA 2J1LA 3HWSA 4AURA 2IF0A 1LVBA 2NO1A 4QBIA 1TQ7B 5CDFA 1IN7A 2GXAA 4PHTA 1J14A 1VR1H 3SU0A 2SNWA 1JAHA 4GZMA 3KHVA 4Y7AA 2QSZA 3K1JA 1PQ7A 2Q9AA 3LRPA 1SG8B 2VIIA 1IQPA 4E09A 1E2JA 5DYGA 4OI0A 5AUQA 3EA7A 3KZ1E 1SGQE 4DLRA 1R4AA 3O47A 1QF9A 5FOWA 3RXUA 4AFZA 3FANA 3NKKA 4KI0A 1JRSA 4DLUA 2ZUCA 4TMTA 4JL5A 5HM2A 1E2EA 4OHVA 3SI4H 3AVWA 3OEHD 3AF2A 4IN2A 3SGAE 2JLUA 1FIZA 3T06B 3SYLA 1N6HA 2CBZA 1MO3A 3TJZA 1BMFD 1SLXB 4CIDA 1G7RA 3B5JA 1CIPA 1KDTA 4IMZA 1T5LA 2GT7A 1E9RA 1P11E 1NLZA 1W36C 5A0AE 3MNCA 5A8YA 3BFXA 1Z71A 1BUIA 2AIPA 1WSSH 1WYKA 4AIIA 2V6JA 4C0JA 1C9KA 1UKYA 4IFBA 1EGAA 4XWAA 1JI0A 5ELXA 1HBTH 1KIMA 5DKMA 1EG7A 3STJA 3QUMP 2GEVA 1GZSA 2R6DA 1MTSA 2VWLA 3VR4A 2CLCX 3TSZA 1IQJA 3GJ6A 1OF1A 1CU1A 4BXSA 2XXAB 4HAZA 2AD1A 1J16A 2D2FA 1S2MA 1OWJA 2LKDA 3K0SA 2QP3A 4GAWA 5LPFA 5CYOA 2ZU0C 2TGAA 1U6QA 4DLSA 3SS8A 2KBEA 4TMZA 4UD9H 3WRYC 4MDFA 5GPIB 1VG9B 4PXAA 3E8LA 4QHYA 1MU6B 3VX3A 1ZGIA 1WA5A 5EE9A 1W48A 3G82C 3M36A 1O34A 1QHSA 2CK3A 3GCGA 4C0HA 1R0XA 1B5GH 1ZD8A 2JDID 3RXKA 1GMHG 5LGOA 1BRUP 2WYJA 1A0JA 5JZVA 1W4CA 3BC1A 3RSLA 2XNDD 4NP6A 2X1VA 1AGPA 4TYQA 3TNSA 1T0HB 1DPOA 3R0FA 1FP6A 1YPJH 1GI4A 3UFAA 1UTLM 3SU2A 1C5OH 2HF8A 1Z8GA 1NG1A 3RXSA 2FZZA 1HH4A 1Z6XA 4BFUA 2ZRNA 2A7QA 2ZHDA 4WXPA 2GX4A 3MHWU 2ZRGA 5JHGB 4JVNA 1WXQA 1H8EA 4XBDA 5DIFA 3URCA 1ZMNA 1AKYA 1FMLA 3QQ5A 5DISB 2BCJQ 1U0JA 2A5GA 4VGCC 1SC8U 1ZU4A 3TPIZ 1ZM4A 1NI3A 2GMTB 2HGTH 5HE8A 3CH5A 1T8NA 2WV4A 2MMCA 4QBHA 1G6HA 5KSYA 1DG3A 3Q72A 1XKBC 3A7ZA 2CVHA 2AERH 2CCGA 4WIAA 2WKPA 1O3AA 3CKLA 1PFXC 1KDRA 3T15A 4B47A 3UWIA 1ARCA 4NDZA 1HE8B 5SZKB 4LJ6A 2BVRH 2VPPA 3NC0C 2V3CC 5GIBA 1JALA 4LZZA 2UKDA 4H6TA 2H9TH 3MU5A 2PEZA 4WF8A 4P4TA 3SZRA 2IT1A 3LBNA 1Z0AA 2FFBA 4MGKR 1O2GH 1SZPA 4LCBA 2WTUA 3T27A 2BY5X 1NU7B 2THFB 1A0HB 5DN6A 3RLWH 1G36A 2ZJ2A 3T1VA 5GVSA 2XZPA 3BTTE 1Z08A 3KKOA 5JDUB 1SQTA 1CR0A 1MO5A 7GCHF 3FZDA 1OXTA 3ADBA 1HDTH 1U0HC 1XD2A 4X8TH 4E5UA 1KLIH 4RKEA 2XC5A 4Z6AH 3K6ZA 3STIA 4MRRA 4Y79A 3SQEE 1UBFA 1P9NA 4B75A 2HT1A 4UFEH 3P32A 1UTKA 1W0JA 1HAVB 2ZDMA 1GMCF 5DK1A 1O2NA 5CITA 4D7GA 1FMJA 1KI2A 3VB4A 2OLJA 4BGDA 1FUJA 1E2HA 2IYQA 2TGDA 3BTHE 1XUKA 3M4YA 3AGQA 3RS2A 2F83A 2IN2A 3F9GA 4GP7A 4QXAA 5LPRA 4DIDA 3ZLJA 1HFDA 2VVVA 1B0FA 3GY5A 2PUXB 4LHXA 2Z9IA 3FMOB 2NPFA 2GZDA 1F2UA 1GIAA 1GJ9B 4ZHLU 2J0SA 5AJWA 3BTWE 5M04A 1G6OA 3AP3A 4HEJA 4XD7A 3SNEA 1ZJ6A 2KJQA 1XEWX 2WWIA 2EI7A 3EGKH 1SVKA 1BBRK 1V2TT 4D6PA 1XPUA 4PSKA 1IXZA 4C0KA 3HATH 1NRNH 3ZZ3A 3BF6H 3QPVA 1LDTT 3BB3A 3QF4A 2GZ9A 1DUEA 2BDBA 3B13B 4IGDA 3QN7A 2VLIA 1NMZA 3QGJA 3EZFA 2BYAX 2WZQA 2VHUA 5A0CA 2BMFA 5GCHF 4I1OA 2OEPA 4FU7A 1NVXQ 2OV2A 5KUTA 2CLSA 1XVMA 1CF4A 1QHRB 4X8HA 5J5CA 2HT6A 2QC2A 1NN6A 1FQJA 1EX6A 1AZZA 4D7FA 1NL3A 2GK6A 3KXKA 3E6PH 2LKCA 3KL4A 1ELFA 3Q5EA 3ZIAA 2CNWA 5FPYA 2A45B 1VCPA 1NG9A 4DDWA 1E69A 3DMDA 2SGDE 2VSOA 2W6JA 2QTFA 2ZDAH 1RVDA 2ZTXA 1I2DA 3TRFA 1KYIA 2NOAA 1KI6B 4MDSA 4NCKA 2VP9A 2REXB 2VIVA 1VCIA 2VHCA 4NIVA 4XVQA 4JL8A 1MQ6A 4WMEA 3RMLH 3FHOA 1BTHH 2Z83A 5D3MA 3PWCA 1QR3E 1GVZA 4YOJA 4NE2A 2CXVA 5DP5A 5CB8A 1P2TA 3HR7A 1D3QB 1O2RA 3MU8A 3BH6A 1V2WT 4AX9H 2ZQ5A 4GNKA 1TBRH 3LO5A 1RRKA 3NIBA 1TGBA 2TBSA 4KTUA 2WJHA 4PPFA 5AJYA 2A5JA 3IKJA 4TTQA 2QZ4A 3VGCC 1YPMH 4Q7MB 2CCKA 5FTLA 3RLFA 4RI0A 4W5HA 3RC6A 2UZ3A 1TUEA 1ZRBA 4JLDA 4WXIA 1AQUA 3W90A 4L4UA 3ICEA 1K1OA 3KUDA 2GVDC 4AB9A 3P8FA 1KK0A 2IL1A 3EA5A 3UUZA 1ACBE 2OFXA 3LGUA 2CHAB 3LGTA 2R44A 4TZ6A 1OXUA 4JBXA 4B3BA 1O3CA 2OCVB 2OXSA 3UPEA 2QMUA 3WP0A 1YPHC 4AZ2B 4MNWA 2EC9H 1KK3A 2WJYA 2QGNA 1KSHA 3U3KA 3EIQA 1KKMA 1G21E 2P94A 1LPGB 1S0RA 4RFSB 1VCWA 1NMXA 3LD9A 4FXGH 2NIPA 1Q1EA 4LV5B 5JJKA 4FINA 2VRWA 2Z5FA 1D2NA 4ZROA 1CBWB 1E94E 4GI7A 4WJG2 3U3JA 3DUXH 1NKTA 1DY9A 1AQYA 3ATKA 1E2FA 5FL7D 4KXFB 1HAIH 1CEEA 4PZLA 5J4HA 4ZMAH 1X6VA 1TTTA 1N8OC 4PO9A 1G9XA 1G2MA 2BBWA 4RZ3A 4HZIA 3JZ2B 5FBIA 1E1RD 1G7TA 4OK5A 5DP3A 1AHTH 1E2IA 2D2DA 2B5TB 1Z1IA 1GJ7B 4HLDA 3GLFE 1KO8A 4CRFA 4URUR 4HGCA 2OESA 2XNDA 4G5RA 4OS6A 1WDTA 2NQ2C 3OEED 2AH4X 2F9BH 3TAUA 1K1NA 2O8EA 3TIUA 1GBLA 2PGBB 1G3EA 3O8BA 4X8VH 2G6BA 3BTKE 2ECKA 2W83A 5FTKA 5A8XA 1U8AA 2IYZA 1UDWA 3UOPA 4ISNA 4BLTA 4AKIA 4CRDA 2REOA 1EFHA 1TRNA 3RDPA 1L0ZA 5E2PA 1JPNA 3ATIA 4C0AC 4PAQA 3V4FA 1DAIA 2ATXA 2BDHA 1GUAA 2G5VA 1H8IH 1SHZA 4R2IA 2WMNB 3QXJA 4UQOA 3ENSB 1DAFA 4FCWA 1QVAA 1TNDA 2OC0A 4JMYA 1RYHA 3HPRA 5BW8A 1Z2AA 4ISIH 1E1QA 1K1IA 5FUVA 2BMDA 5I25A 3NBFA 4Q4AA 3K0AA 3BD9A 1DADA 2NWNA 4EJSB 1TMUH 2ZNKH 2ZR9A 3E2IA 1MBQA 4JSYA 3QKSB 1NROH 2HJVA 5P21A 1GG2A 3LBHA 2ZHEH 4INHA 4ISLA 1P05A 5K8TA 1ZJKA 3RC4A 2P59A 1IAQA 1D8TA 3K70B 1JR3A 3IIJA 1NS3A 1Z1JA 1O2HA 4BFZA 1OIVA 3B8JA 2FLRH 4DLYA 5EZ6B 3MWLA 4I1UA 2Z94A 2NZJA 4LJ8A 2GCTB 4C4PA 3BTQE 3U44B 1XF9A 1PPGE 1UVPA 4B3FX 3LGWA 1N0WA 2PUQH 4MKIA 2BJVA 1XDBA 3G0HA 2ZGHA 2Z4RA 4A7IB 3Q77A 2BMEA 4KO8A 1O2WA 4WW0A 1GDDA 4LRWA 2HV8A 4RZXA 1ZTKA 4LYHA 4IXMA 4J2YB 3SV9A 5DLQC 5KOYA 3DFJA 4DCDA 1LF0A 2ZS7A 1V43A 1S5SA 2H18A 4F4CA 1EX7A 4TYYA 2IYYA 4M1TA 1O5BB 1U8ZA 1DG1G 2FU5C 1HAGE 1MTWA 2UWOA 3B1YA 2OQ5A 1V2PT 3EZ7A 1FX0B 1QFKH 1DE7H 5IK2A 4IJMA 2R8RA 2QE7A 4CW7A 4V02A 4YO9A 2HOBA 1N25A 1FXYA 1MH1A 1R5BA 3B60A 2JATA 2B7BA 5DO4H 2GNOA 721PA 4CYMA 5EG4A 1O2MA 3ZZDA 1G3UA 4AI6A 2FWWA 3LGYA 1XM1A 2R62A 4Y0VA 3TQCA 4TMVA 3U1IB 3CS0A 1JR3D 3NBZC 3R8FA 3UNSA 3VB3A 1GI6A 4QBGB 1T9HA 2P16A 1UPTA 3E0PB 4UKDA 5L2YH 2JA1A 4KKDA 1P03A 3TITA 4BRWA 1MKXH 4DB2A 1JBUH 3LC5A 3QEJA 2SGQE 3VKGA 2BLVA 1HXEH 2DUCA 1IQGA 5CIWA 1L2EA 2A9KA 4WMFA 5JB8S 4K2YA 3RC5A 4QFMA 3O8CA 4JMPA 3GYLB 3GY4A 1CJVC 4XD7D 1RXPA 1ZSLA 2WJGA 1HIAB 1EQ9A 4THNH 2RGBA 1FP7A 2PMDA 4Q9HA 2ORIA 1HYLA 1ZRKA 3AF1A 3QKUA 1LPKB 1GL9B 3GDUA 1XP8A 1E2NA 1UBCA 3AM1A 4LOYH 5L8VA 2Y5GA 2E9SA 2QSYA 1LB1B 3L33A 2ANBA 2ZCLP 2WVJA 2BDAA 4V03A 3RRZA 2G55A 1W4AA 4PAOA 1XCMA 2EFHB 1WCZA 1Z28A 1OIXA 2O0KA 1C5XB 1S6HA 1GI7B 4FUCA 4BASA 4IDHA 1EJAA 2V7QA 1FX0A 4N0EA 3PB1E 3THYB 5CIQA 2R2AA 1KXCA 4NFFA 5FAHA 1S0UA 1T31A 4KLNA 1PLKA 5DG6A 1MAYA 2F9UA 2RA0A 1VJ9U 4NA9H 2GK7A 2V8OA 3UWJH 3T5FH 4CHAC 4JZIA 2ZGBH 4D9QA 1KSGA 2BD5A 4TLCA 1QY6A 1NO9H 4UNNA 3FDIA 2Y5HA 2HXYA 4EKDA 3PCRB 2ZU1A 2ZI3A 1O2KA 4PQYA 2BD4A 1QCPA 3TW8B 1ANCA 1NY22 1GCTC 3AEZA 1XJQA 3TH5A 3RU4T 1XBTA 2CHGA 3TNTA 1VECA 1PPEE 3GPLA 1CULC 4FN5A 3SUGA 3MGCA 2ZROA 5GWZA 1OV4A 3OAAA 2KAIA 3VXFH 3SZEA 3LA6A 3KKNA 2ODYB 1BRCE 4R98A 3RABA 1GBCA 1D3DB 3NZIA 2QMOA 2PR3A 2FPZA 2ALVA 4TYDA 2FX3A 1DOAA 2ZI9A 2VSXA 5J40A 2GD4B 4RJLA 1KI1A 4JYUH 1KY2A 1S0QA 2B7DH 4YLUA 4IEEA 3K0AB 2GDEH 3QF7A 3HJNA 5HCNA 3M35A 3QEOA 3R9WA 1A46H 1T4GA 1FPHH 1WUNH 2FGKA 4V0OA 3LC3A 3KQLA 2AFHE 2IXFA 2ZTZA 2F1IA 1W4BA 4A2PA 1AKSB 5H68A 4BNRA 5F8XA 3SQXA 3ZV8A 1QRWA 4WZ6A 1Q1BA 1HT1E 4Y0AA 2M5TA 2SHKA 2YOGA 4HSEA 1XU4A 3T28A 5B64A 1ESAA 2Y80A 4AKEA 4MPWA 1QB9A 1NZQH 3T1QA 3SI3H 4M9ZA 1Y59T 4YZUA 1Q3XA 4O2LA 5IT5A 3AW1A 1OHHD 2TRMA 3IEUA 1QL9A 2ZQ2A 3ZVAA 3U7FB 4Y8XA 3FYHA 1WP9A 2GCTC 1XCGB 1JJ7A 3PLBA 3OEEA 1GGDB 2SNVA 1G20E 4ZCLA 1V2ST 1SKYB 1RD3B 2I6SA 1DWBH 2EEKA 4GMDA 1SSXA 3ZQJA 3EPJA 1T6NA 1W46A 3SYKA 4XDEA 1OWKA 5EE1A 3U61B 2ODQA 4GSOA 2HLDD 2QA9E 1E32A 3EA9A 3RM2H 1Z6YA 4B2AA 1CR1A 3VAAA 1FAKH 1TX8A 1OB5A 1KK2A 3T25A 4RD2A 3FWYA 3E70C 1XEWY 1N5IA 1GRNA 3FKQA 3R20A 2ZI2H 4HDCA 1DBSA 2ORVA 3MU4A 5IYTA 4DC9A 1P9RA 4C3ZA 3BH0A 1GG6C 4YDHB 2IYUA 4BAMB 1MO6A 1N6NA 5AJZA 2ANWA 4AK9A 3IHLA 3EIEA 4MYCA 2VJ1A 3W9YA 2ZRBA 1A7JA 5L2ZH 4MITA 1SGDE 1Y3VA 1J7KA 5FH9A 1YGCH 2W2VA 1NF3A 2AK2A 2P6NA 4CBNA 2J5XA 3ZZAA 3C5CA 3CRVA 4DCTA 1UKZA 1U94A 4FUDA 2GJKA 3FKSD 4WAUA 2ZPQA 1YVDA 3BJIC 1HUQA 4LZ1H 4X2VA 4OQLA 1NU9A 3RXPA 4CEIB 3T12A 4TPYA 1E0AA 5E95A 4S35A 1IJEA 2BCGY 2HLDA 3K9GA 2R6CA 4LUCA 3UIRA 2VQSA 2ZF0H 2BZ6H 3M5MA 1EKBB 3T35A 4LV6A 3QXCA 1RJXB 3IIMA 3UMFA 3QG5A 4LBYA 2WUCA 2XCFA 2ZYUX 2PKAA 1A82A 2PSYA 2GWHA 2YWHA 3A8BA 3D62A 1WRBA 2Q9CA 5I46H 2CJWB 1EB1H 4J0QA 2O8FA 5HPYB 3TH4H 3SU8A 2QXGA 4QHTA 3GDSA 3CZQA 3T26A 4JLMA 2ZU2A 2CDNA 2GJAA 3FMIA 3CR7A 1GCDA 5CYPA 3P17H 1OLOA 1PLLA 4JZFH 3SR0A 2Z9LA 1Y5AT 5JRJA 2R65A 2WV9A 2C9OA 4B74A 4IMQA 4ARZB 2FN4A 2J92A 2O8CB 1L4DA 4UFFH 1QHYA 4M1KA 4NYMR 1XJCA 3CF2A 1SXJB 2FO9A 3K70D 3CPJB 2OK5A 4Q19A 4XE4A 3UOUA 2BV3A 4P31A 4B1TA 2BKEA 1CT0E 2GV7A 2ZRPA 2G81E 4MNYA 3EAJA 4ON9A 2J4IA 4UXIA 5LPEA 3SJKA 4BFWA 1E9EA 4LSGA 3P8OA 3TK9A 2ZRJA 3KF2A 2DWQA 1O3HA 4M9XA 4I8HA 3ATMA 1CBUA 1DICA 1DAKA 1LHCH 3EE0B 2ZJ8A 3TJVA 5LBIA 1HV8A 4JVSB 2CHVA 3B78A 1DXPA 3BE4A 1IOZA 2OZEA 1U9IC 4M1MA 4XSHA 1GNPA 1GJDB 1Z8IB 3WNDA 3LDAA 4OI4A 421PA 5FTMA 3EPKA 4IRUB 1AS3A 2GCPA 1ZLRA 3VFDA 2J34A 2C90B 1TNGA 1K2I1 2RGXA 3TGKE 3BG8A 1D2EA 4ESVA 2B6HA 4UNRA 3EC2A 1SHYA 3X2SA 1ELDE 1O0DH 4PPQA 2QV1A 4TQUS 5DP4A 1Z8RA 1OH7A 1PQ8A 5JBTA 1UCYK 2I4IA 4NZYA 1P2VA 3S9CA 2ULLA 5G41A 5K7RA 4H6SB 4FU8A 1H8ED 4KTCA 3ZZ9A 2B21A 4CRBA 1AB9C 3S1AB 4MYTA 4L9SA 3ZZ7A 2G5NA 1JR3E 3KXIA 1NIPA 5EW2H 2OO7A 3B82A 2XWBI 2RGAA 3GFTA 1VIAA 1LQEA 4X1RU 4D0GA 2O8DA 2YNBA 1LPZB 5E2OA 2JLXA 1DAMA 2Z3CA 2J9RA 1E79D 2Z9KA 1HEIA 1F5RA 3L0IB 3MI4A 3AK5A 2P8OB 4PAMA 1O39A 1Z22A 1P72A 2VGCC 2VIPA 3LH5A 1UBGA 4PSVA 1C5YB 4Q1FA 3A87A 1XB2A 3ND9A 4YDSA 4WH6A 3A1UA 3CIOA 2FH5B 1H8HD 4DDTA 1ETUA 2WINI 2Z0MA 3EIHA 2YWFA 3AF0A 2JAQA 4EFMA 4Q48A 2BVSH 4HB4A 4BWYA 4ZCMA 3A4MA 3THWA 4CRCA 1TAGA 1DOJA 3FZZA 4URZR 2OXCA 1E4YA 1OSNA 1GNQA 2BX3A 1EPTA 3QXXA 5JYIA 1FNMA 1BRBE 3TH3H 1C5ZB 1IXSB 3EA8A 4AY2A 4JZKA 3QGNB 3OF5A 1GHWH 5FBLB 2NU0E 121PA 2FP7B 3VQTA 4QNRA 5BPEA 2P93A 4BUJA 1P3CA 4UNPA 5A0BA 2AXPA 3PJRA 4MGIR 2QTVB 3RLYH 4TYPA 2LCFA 4OGXA 4DWJA 4IHQA 3DEFA 4AG5A 3HKIB 3GLGE 3BEUA 2QEQA 3AQ4A 1AGRA 1ZGVA 1RIWC 5EZ5A 1TL7C 2ZJYA 3E3TA 1FOEB 4PX9A 1MD7A 1OHHA 1GGDC 1O2PA 1PZNA 4CF7A 1GI9B 4O3UA 4JSTA 3LU9B 1JXMA 2HCJB 3OTPA 5BYJA 3PUZA 1KAOA 1KJWA 1N2CE 4MUBA 2CGAA 2J38A 3HPQA 4IC5A 4PTLA 3NEJA 1KXDA 1OPXA 3BTDE 3NEYA 1D3TB 5IRCD 2C98A 3B1XA 3O8RA 1QL7A 3TW4A 2KAIB 4I99A 1K5GA 1UK4A 2ZGCA 3IWMA 5HCIA 4LJ4A 2IYWA 1YCPM 1O31A 1E2QA 1MV5A 1AE5A 4BTIB 2WUBA 5KDDA 1TPZA 1RFNA 2V1UA 1YJ5A 1UKEA 1JECA 1P62B 1I2MA 2EWWA 4K1TA 3CR8A 3IQXA 1GMDF 5J4YA 4UXHA 4WBSA 2Q6DA 3V0XA 5J4KA 1ZRHA 2LNCA 1SXJE 2G1KA 2YHSA 1OSSA 3SBKA 4OI2A 3B1VA 2HPQH 3FP7E 3NBYC 3V13A 1AK2A 1U8YA 3A4LA 1AVGH 2PW8H 3MD0A 1LNZA 3QIAA 5CE1A 3RMMH 2ODWA 3ZVMA 4Q7XA 2GA8A 1SGCA 3W95A 1AMHA 4D0NA 3MSXA 3TGJE 4LJYA 3AUYA 1C5PA 3P6ZB 4D82A 2VWMA 3BH7A 4LHZA 1HXFH 1G8PA 4VGCB 2ZI6A 4A0GA 1BA8B 1KNXA 3TAHA 4TY7A 5FOTA 4IVQA 1CGHA 2VHJA 1VCOA 1A2KC 1ZMJA 1JAIA 2C78A 4HFPB 1T8UA 1D9IA 4YT6H 1D9ZA 3CF0A 3GJ4A 1Q31A 2ZZUH 1OE0A 5JFGA 2VB0A 2BB4A 1MRSA 1ORFA 3MOCA 2B8OH 2BM1A 4RD4A 2JLSA 3GEHA 3IPXA 2QM7A 1TF5A 3UXMA 3X1WA 3QVVA 3EZ9A 4AYTA 4LBZA 5L3RA 3N2IA 2ZRAA 3QI2A 2GDJA 4HLUC 3D65E 1W13U 1NVWQ 3C4JA 5SZJA 1KDQB 1GVNB 1TFXA 1TNHA 1KXAA 1QRXA 1S3GA 2P3SA 2FEQH 1XFAA 1RZ3A 4A6LA 3ZZBA 1K1PA 1LVOA 4PROA 2QAGA 3MCAA 4DKXA 4IBLH 3OE7A 4KTSA 1GMDG 1F2UB 2FWRA 1QJ1B 1SGYE 2ZDVH 1CBWC 3MNXA 2GTPA 4GZLA 2FDAA 3LX8A 4X8UH 2ONKA 2RHMA 1KO4A 1NRQH 4JJZA 5TJXA 1ZMXA 4BEBA 1Z0KA 3UK6A 1NN1A 2F3RA 3EDXB 4OKSA 1CLUA 2QGRA 3NHBA 4JVLA 1DVAH 3GJ3A 4XTRA 5FOUA 1ZNYA 3CONA 1BMLA 2WWGA 3PR1A 4L15A 1HAVA 2O8BB 1S6FA 1DAHA 3VMFA 1GI1A 1VGCB 1DO2A 2XB2A 1N1LA 3GYMA 3AVQA 2ZDLA 4DDVA 4EFNA 1F0TA 2YWGA 1KAGA 2OLGA 1EZSC 3L8ZA 4HDQB 3I77A 1G4UR 3I8SA 3NUMA 4CR9A 4TWWA 3SJCA 2CLDX 3F68H 4D2IA 2I3BA 1EX3A 1GBJA 3MG9A 1CGJE 2J95A 4YT7H 3QWCH 2OAQ1 1AGJA 1NVVR
chains in the Genus database with same CATH superfamily
4GQAA 1D8AA 1YCDA 3F5SA 3FAOA 1UEIA 3RU4D 1XQVA 2GFHA 2Y05A 3GLHB 1EG2A 1A9YA 1O33A 1QIEA 3DBOB 4GPIB 1P2NA 1P45A 5DWDA 2BBOA 1KHTA 3QEMA 1E3DA 1OU4A 2ZC9H 2XUIA 5JAIA 3T3MB 2QG6A 5KTRA 2F8TA 3QTLA 3TEJA 4P9NA 2AXEA 1L4MA 4EGQA 1MCVA 1JHAA 2I1QA 3OQNA 4BLRA 4JBIA 1R4ZA 1XCPA 3AKCA 2ZU3A 4NK5A 3KQHA 1V8OA 4BWFB 2H9EH 4QEZA 3CLUC 4E6EA 4PLWA 2AR0A 4NKRA 3NJ8A 4P2BA 2AR9A 2ZXUA 4NDAA 2O2GA 1FIUA 1J17T 4CIWA 4ENUA 4LC1A 1FTYA 1S2LA 2AEFA 1PYTD 2PMKA 5EWLB 2J9NA 3AVPA 3GJSA 1XZEA 5CTAA 1G16A 3KKKA 1AZTA 1JAYA 4FLMA 4OMFG 3WBKA 4P4LA 3ADPA 3LK7A 1D4FA 3RXFA 3K0HA 2H2GA 1IDOA 1UTOA 3QTOH 1PYGA 5FLEX 5KYGA 1TLLA 3Q7IA 1KZ1A 4N40A 3WGMA 1WUHS 1Q21A 4JITA 2D2XA 3ZBQA 1PWXA 1NRIA 3BOSA 4WBXC 3UK7A 4DA9A 5BV2P 4AG2A 2JARA 1H5QA 1J7JA 3FNBA 3TLMA 3BGWA 3DKRA 1IEQA 2C84A 4YROA 4HNQA 5E9AA 3U40A 2SFAA 1JIVA 2F1RA 3WAKA 1SUCA 4K0RA 4OGKA 5JD4A 3MCZA 3C74A 4FUIA 2FY8A 3MJTA 1VG0B 2H52A 1LNSA 3DCIA 2GN1A 2RK4A 1RFGE 3W0LB 4C08A 2C58A 1VI2A 1HNXB 2ODNA 2X5NA 3TOSA 4ZKNU 4JBYA 4Q9NA 1F6DA 5FORA 4QOHA 2RI6A 2RG7A 3DHYA 4Z49A 2WUWE 2HDNB 3IODA 1E96A 3HNPA 4FN4A 1KZ7B 3KHTA 1LA2A 3TRIA 2BEKA 2ZT5A 2VTKA 4YP0A 3ZYEA 3OEHA 4UDNA 5KOJA 2GT8A 1A7KA 4BYGA 1SVOA 4I7YH 1WNFA 2CJWA 2WRZA 3HDHA 3O8OB 3GICB 3E84A 1CY1A 3LXUX 1XD2B 1EQAA 3LT2A 4PCAA 4D8VA 3D3EA 5DBEX 4B8ZA 4DUGD 1ORRA 4JYZA 5B4UA 3QUSA 4RSRA 1RLTA 4FCCA 5KHAA 5E1DA 1X7WA 2N46A 5LH8A 1Y1RA 5CT6A 3SSNA 4OP1A 4O0MA 1M7GA 1D5CA 5AKYA 5KSPA 4RY2A 4WL0A 4CMAA 4YIHA 3RFFA 1P60A 1FDTA 2H2AA 3G2QA 4U4AA 1XEFA 2EZ8A 3AW8A 1JIJA 3D31A 3E9CA 1XRQA 3BORA 1PT7A 4JMLA 3I52A 1GFWA 4Z0NA 2P3OA 2XGGA 3ZXYA 4BYMA 4UTRA 2VIQA 2QRGA 4EYQA 1MW8X 2ILVA 1BVYF 5C51B 1E89A 2EX4A 2BGMA 1VTKA 1K7XB 3C48A 3GEIA 4Z0KA 3PUKA 3DT0H 1YZLA 4LZPA 4NNOA 4A0QA 5EJIA 2RSLA 4YMWA 2PGIA 5KTKA 3PNBA 4ZOLB 9MHTA 3CPEA 2XWJI 1G3RA 4WUVA 4I2VA 1MT3A 3COVA 5DI3B 1RTLA 4KGZA 4TKZA 4FD3A 4IDPA 5HTKA 4DUYB 1PHRA 4B3IA 3UY9A 4Z1MD 2EFDB 3W4KA 4CKBA 3JSAA 3VPBA 4RY0A 1R6BX 1EUDA 1THPB 3GVPA 4L0MA 2BEWA 5C3MA 3E2PA 2RHOA 3ZCSA 5EJZA 1Z82A 1HCGA 4IV5A 1PNVA 2OLKA 1VZQH 3H2YA 2JJ2D 5C1PA 3VH2A 5KINB 5CD9A 1GCAA 2H11A 1I4OA 3E18A 4MRPA 3LJOA 4TVBA 5HFAA 4U0KA 2HY7A 4BLVA 4CM5A 3PTBA 3W5CA 2J7KA 1T2FA