4B71A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 197
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b71A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b71A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b71A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b71A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b71A03
2ZU5A 2BBOA 1O3CA 1IHTH 3EPJA 4HSEA 4LYAA 4W7SA 1E3MA 2QZ4A 3Q00A 2BTCE 1R2QA 1U2RA 1F5RA 4JK6A 3M0EA 4D9RA 2GJKA 2X77A 2LCFA 1GDNA 3IHWA 3K0AB 4OYHA 4OS6A 2AERH 5DYIA 2AGGX 2CLDX 2ANBA 1HA3A 1S1CA 2BVXH 3RXKA 5DP9A 4QT8C 1OF1A 1ZCAA 4QL3A 4UKDA 2FP7B 3GYMA 3NPSA 5KNCA 1A61H 3KUCA 1YLDA 3CENA 2FLRH 4Y0ZE 3I8SA 2ASUB 5B30A 1Y5BT 2G77B 2TGDA 3TJUA 1F2UB 1QBVH 5DP4A 3P8FA 4R2IA 2G6BA 1JIMA 3SV2H 2Q9BA 4MKHA 5HZHA 1L8QA 4N3NA 2UZ3A 1SLWB 3K53A 1XPOA 1KOFA 2I4IA 1G5RA 3GY4A 3VFEA 2C5LA 3LWNA 1N6LA 1EATA 1AA9A 2G55A 3IHLA 2IS6A 3KX2A 2SGPE 4PAMA 2QTVB 3QXCA 5FOSA 1UCYK 2BX4A 3RS4A 1BRCE 5HXFA 3SHWA 4KLZA 4DJZB 1LHCH 2OP9A 2GJ8A 5H8WA 4DLWA 3AKEA 4BECA 2F43A 2JATA 2QSYA 2EU8A 2J7PD 5BQ5A 1WCZA 2W00A 1W8BH 3KB1A 2WIBA 5CMXH 1O2UA 1DDJA 2DY1A 5SZIA 2ZRKA 1BJVA 2C8XB 2WWIA 1WCV1 1ZP6A 3QGJA 3PUVA 5M04A 1NVVQ 1FOEB 2R9PA 2A7HA 3QDZB 3N5CA 2OCVB 1EB2A 5KDDA 2GCOB 4Q47A 2BD8A 1M9UA 4IDPA 1Z8FA 3KGPA 4PZLA 2NTYC 2HCJB 1U94A 2ODEA 1E2FA 1O3HA 2CCJA 4DUGD 2ZU2A 5FOXA 2G5VA 5EXTA 4IOLA 1A5HA 2AK3A 1TALA 2BM1A 3KKMA 2GKVE 4URWR 2FSHA 3EXAA 2R0LA 4URYR 1XEXB 2RHMA 1LMWB 4QGFA 2OT3B 4DB2A 3H7OA 5G3YA 1TQ0B 4D26A 2FYQA 3K1JA 2WICA 1B0FA 1FY1A 2FOFA 3GFOA 1NN3A 2XC0A 1NROH 2Y82A 1XJCA 1SGNE 1OKKD 1BHXF 4B48A 4U00A 2NU2E 3SI7A 4D81A 1JRSA 1S3SA 1Y5AT 1OOKB 2AWNA 3QPUA 2WJYA 3P8OA 1ZNXA 4R2HA 3T5FH 1AI8H 1YPMH 3WP1B 3ZGXA 3BB4A 2W3IA 2BXTH 2UWLA 1E96A 1HQCA 4L8GA 4ISOA 3LV8A 1LHEH 1THSH 2XC4A 1E0FD 1CHOF 5IYTA 1V43A 1ZVQA 3SC3A 1XRJA 4YOIA 4OJQA 1JPJA 2OEPA 1HB0B 3WYGA 3W8NA 4D4LA 5JBTA 2GCNA 3QG1A 2QP3A 2V1XA 2WBLC 3U44B 1NP6A 3VPKA 3F68H 1O3BA 4MPXA 4FCTA 1AFEH 4FWIB 3RRYA 1NKTA 2AGIX 2EYQA 2ZGCA 3L33A 1DPOA 1A4RA 4PPQA 1SVIA 5LPEA 3K0EA 4IN1A 3IQWA 4EDHA 5DP6A 2ZRNA 1IY1A 1LV7A 1F2TB 2GX4A 1G5TA 1S83A 1L4ZA 3CLVA 1O2NA 2XCFA 1GVLA 3PEUA 1G3IA 4QM7A 5CK5A 4RKEA 1G36A 4JBWA 1BMFA 1QRXA 2GMTC 4I8HA 5DHAA 3QPWA 3W34A 2GZHA 4YMVA 3E1SA 2OC0A 1ETSH 3AP3A 3BTTE 2AFIE 1XMJA 3TK6A 4AD8A 3TNSA 5B64A 2X1VA 2DFTA 1JR3E 4PAQA 4DDUA 2WWFA 4BXSA 5L2YH 2WV4A 2HT6A 3GICB 4GBMA 1RGQA 2YHSA 5KSOA 1ZD1A 2FA9A 5GJCA 1AS0A 3PR1A 1ZLRA 2PLRA 1Q22A 2GMTB 1RJ9B 5AUQA 5T3HA 5DI3A 1C9PA 3NH9A 1Z2AA 1DVRA 1GBMA 2VHJA 3URCA 1Q57A 3VR4A 3S0NA 3BGWA 3F3YA 3HPRA 4GFDA 3OYPA 4HLUC 2WIAA 3SUGA 1GGDC 3MWIU 2OESA 4AZ2B 5FOWA 2PCLA 3KXKA 1Q3XA 1VITH 3QKUA 2B8WA 1UVPA 4OHWA 1FP7A 1UF9A 4YMWA 1NT1A 4KSCA 2PT5A 3T5GA 1T3SA 3I62A 1IQKA 1ZIPA 2FPZA 2JLQA 3B13B 1OWJA 1ZM4A 4LOAA 1M8PA 4Q7YA 3SJAA 2Z9LA 1P11E 1EOLA 1MABB 4LCBA 5JFGA 1LF0A 3ADKA 4LJ4A 5JBCS 2QY0B 5C1UA 2QAGC 1NRRH 1P2QA 1Z0DA 1K1OA 3A58B 5H4IB 4KTCA 2ZAOA 4V03A 4ZPXA 4CRFA 1K28D 2GV6A 3SU1A 3THXA 1GI9B 1DUAA 4Q4JB 2GXUA 1PLLA 2A3RA 1IAQA 1UBEA 4ZI3A 2JLXA 4EKDA 2QORA 1GBKA 2EEKA 2YWFA 3ZVBA 3AGQA 2CJWB 1P2KA 2PGQB 4M2LA 2WJGA 1P9UA 1Y3VA 1GHAG 1R0ZA 4A8JC 1VR1H 5KUTA 2IJOB 1UEIA 1I4TD 2FV8A 1EUFA 1DBSA 2QXIA 1E9BA 4Q9HA 1JOUB 1COWA 2QAGB 3Q9LA 4I99A 3PO1B 3K6ZA 3DUXH 1G4UR 1MZDA 2BYAX 2EVWX 5GPIB 3U3KA 3RXPA 4C0BA 2NOAA 3LGWA 1OH6A 3DOFA 3QF4A 3KQCA 3SNDA 4U2WA 2QA5A 3B85A 1TNHA 2VVVA 1ZD9A 2EFHB 2BY9X 1G3RA 2V3CC 2D3WA 2QG6A 3AGPA 1RRFA 1LNZA 2ZRHA 4HGCA 4A8JB 2ZPSA 4XTCS 4IBLH 3GLFE 2ZUCA 1AU8A 3AB3A 2XX3A 3O8DA 1AO5A 2FODA 5HZKA 4NZQA 4UJ5A 1ZHMA 4Y8YA 4IRUB 1ZRHA 421PA 2HLDA 1U90A 3MGCA 2BY8X 1TGSZ 2ALVA 2KB0A 3TIUA 3RNLA 4GLYA 4JCNA 1XEWX 1JBKA 5EP4A 1AFQC 4HFPB 3PVSA 4BZXA 4TMZA 2QUZA 1W36C 4NCHA 1M7GA 2QAAA 1B0UA 3BRWD 2ZJZA 1L4DA 1GKUB 2DWPA 3UG7A 3TK5A 4WZAE 3E70C 1QHSA 1AS2A 1CSOE 3RS2A 3ZH9B 2IYXA 4RZ2A 3U1IB 3THWB 3WNCA 3STJA 2FMXA 4QBGB 3A8CA 4WF8A 2ZQ1A 3K0CC 1RRKA 1WQSA 1EGAA 1KDRA 4IJMA 2ZUDA 3P27A 1AE5A 4KFSA 1O3NA 2OLJA 1Z6TA 2BD3A 1AFQB 4DHEA 1MTNC 2CF9H 4CDGA 4DLSA 2F7SA 1BTPA 1W36B 4Q4AB 3B2EA 4AB8A 3AVQA 5E95A 4ZH8A 2ZFFH 4JZ1A 3UG6A 1TLDA 3CZQA 3GLGE 2VO1A 1C5LH 2GCPA 5J40A 4K8OA 1UKYA 1SGQE 5KU1A 4IOJA 2GESA 2C9YA 2PH1A 3MJHA 2XTNA 1N6RA 3AK5A 1N1LA 2CXXA 4UNRA 4WW0A 1E9CA 1C4Y2 1V6DA 1MTSA 3DPUA 3NUMA 4F4OC 3WP0A 1GRNA 1UVTH 1FZQA 2Q6DA 1T8TA 4PC6A 1JR6A 5BWMA 1MTVA 4DLUA 4JLPA 4EQ6A 4U02A 2NMVA 1XUKA 4JK5A 2XNDD 2VBCA 1KXCA 2ZTZA 1Z8IB 1TONA 2W3KA 3ADBA 2VL7A 4JSTA 2H92A 1R0WA 3P92A 1ZC4A 2A4RA 4B74A 4K5ZA 3W5JA 4C0AC 1ZTKA 2ZYTX 3BIUH 4ZIRB 3ELAH 5AFZH 4NA7A 2J0SA 2HUPA 5HPYB 1W0ZU 3ZZ9A 3K9NA 3QKTA 2WTUA 3JVUA 2J41A 2QF0A 2WMOB 4U01A 2WMNB 4FMCF 2QP9X 1Z8GA 3M3VA 1C5SA 4Q7ZA 4A9AA 4MLFB 3VB7A 3SGAE 5D3MA 1KLTA 1OB2A 5I25A 5DP5A 3OTPA 1QG4A 4EFLA 4H6SB 2OQ5A 4NHOA 1IN7A 5BN3A 3AV0B 4QNMA 2VH0A 4JZFH 2ZHDA 2J0UB 3V00A 4LY6A 1G6HA 1V2TT 3MJRA 1FTNA 1CA0B 3CPJB 3RXVA 4FUIA 1IN5A 1SXJA 4Q7KA 1DM4B 1PQ5A 4NGAH 1NY22 3LGTA 4E7RG 4X8SH 3A8BA 1GBBA 1YU9A 3SQXA 2A5KA 4X6PA 2HCBA 1AWFH 1GZSA 1W46A 2REBA 1OYYA 1GDUA 1SVPA 1CJVC 2X8AA 3UK6A 5K8TA 3MTYA 1HUTH 4NE2A 4DB4A 2H9EH 5ESTE 2ZXUA 2C98A 1OXGA 1W7XH 1JNYA 4ABJA 3KIDU 4M9ZA 5TB5A 4AKGA 1UBCA 1P2UA 3RXSA 2DBYA 3GLIA 2OM2A 2GVZC 5JSZB 1JXMA 1C5NH 2FO9A 4L15A 4Q4HB 2Q9AA 5A0AE 3N7OA 1SKQA 1P8VC 1W48A 4NYIQ 4FUCA 4CHAB 1N5JA 5C20A 1TA6A 4OI0A 1OW3B 1BRAA 3S69A 1ELEE 1M2OB 3GJ4A 1TAGA 2H5CA 1F3OA 1EXMA 1DWDH 3SV8A 4F93B 4B32A 1DUEA 1SQTA 2OFXA 1SB1H 4BFWA 3MO9A 5FBLB 1P2IA 5FUVA 5IK2D 4AORA 3U4QB 1P2TA 1XXFA 2GJ9A 5FTKA 2NQ2C 2JLVA 4A36A 4FXGH 4M22A 4CRGA 2HXYA 4BTIB 1V2OT 3ASYA 1J17T 2YJTD 4Y7AA 1KAGA 1S5SA 5A8YA 1O5CB 3GCHC 1TGCA 1WQVH 1S81A 5EJEA 2ODQA 2PL3A 4IEIA 6Q21A 3MSXA 4C2TA 1VYUA 1TGBA 3AUXA 2KE5A 4L16A 4TZ0A 1KLJH 4NIYA 1UTMA 4JLOA 2OBLA 2O8UA 2FTLE 1EOJA 2HJVA 5FBVB 5JEEA 4ESVA 2NO9A 1KK1A 1T0JB 3HR8A 1CBUA 3BTDE 3AP1A 2VTKA 1AKEA 2OCPA 4IDOA 3UREA 5FFMA 1KDQA 2P67A 1EQ9A 2BVRH 1EG7A 1TQ2A 2V7QA 3RS3A 3PLBA 2JH5D 3LLMA 3TQFA 5EW2H 5TY0A 3GCHB 3SHFA 2GDEH 3W9YA 1AGRA 2IXEA 5HYOA 1YYY1 1GBAA 3FGNA 2JCSA 4ZI2A 4LZ1H 1TX4B 4GSYA 2AFHE 1V2KT 4KU4A 5L3SB 5AJYA 4B2IA 2G51A 2IK8A 3VHLB 5EQQA 1ZJKA 1NPMA 4CRCA 1GL1A 4LHYA 1E32A 1ETRH 2PZEA 1T4UH 3V0XA 2PKSB 2RCEA 2ZR0A 4Y8ZA 2ZWLH 1BBRE 4BAMB 3PEVA 1OS8A 2F4LA 1YZLA 1YC0A 2O8FB 1B5GH 2FM2A 1S6HA 2BOKA 4II7A 3TR0A 4A6XA 2AMPA 2J59A 1CHOG 1XX6A 3V9PA 1QHHA 1CVWH 3W94A 1T4GA 2FF7A 2BVSH 1OXUA 4M9SA 4PPGA 4F4JA 4O0MA 1ARCA 4FI3C 1P4SA 3A86A 1ZSLA 2W2TA 3K9HA 1QJ7B 1S2MA 1GBFA 1QA0A 1LVBA 7GCHF 3GDSA 2QPTA 1WXQA 3VEQB 2OAP1 4A1XA 3SUFA 1AKYA 4FWTA 5LD2C 2BDGA 1MRSA 2WYGA 4EFMA 1KI9A 4JLNA 1CULC 1W47A 2MSEB 1C5QA 1AQYA 3GQBA 1IQGA 1SBWA 1IQEA 5C5NA 4DLYA 1MKWH 4PO9A 2JLYA 4DZZA 4KGAA 4TMXA 5KYKA 1K1LA 4KYUA 1MBMA 1GBLA 2W58A 1C2DA 2FZZA 1J7KA 3W6OA 1ZSJA 1W0YH 3M3TA 4ZKOU 4LGMA 1CO7E 2GK6A 3NK8A 2H5DA 4EPTA 1Z6AA 4O2LA 4HZIA 1OXXK 1RVDA 4VGCC 4KJZA 4E5UA 1ELDE 1DITH 5JRJA 1QDEA 5I46H 2O0KA 1BTUA 4TWWA 1QR3E 1LHGH 1UM8A 4UFEH 2YWHA 2F9OA 4DCSA 3QZQA 5EE3A 5ANRB 4L4UA 4RZXA 3LVRE 5DNYB 1YPEH 3ITIA 2F9LA 4GCHF 1XTQA 4FU8A 1ONBA 3PUYA 3GJXC 4H1UA 4BZQA 1FUKA 3KQNA 3VB4A 3L0PA 1ID5H 3CKLA 2TMKA 2ZJBA 2P3SA 4LBYA 3KNXA 2VIPA 2BMFA 3TQCA 3TH4H 2QRNA 4A6PA 4HAWA 4Q01A 4ZDJA 5CYOA 4ASHA 1LQDB 3DZDA 4B2LA 3C14C 1AHTH 3MH6A 2NU3E 1C2HA 1O31A 4CRBA 1DSUA 1O2GH 3WRYC 1XM1A 3BIVH 2BM0A 3U5ZB 3J81k 4RCYA 2R6DA 1GNPA 3KQKA 3K0FA 2QAJA 4X1SU 4Q7JB 1P9WA 1NFXA 1KJWA 1YZQA 2STAE 4FD2A 1G6OA 3A37A 5DN6A 3PMHB 2F43B 3I77A 2BBWA 1WYKA 4ZAEA 3FFAA 4WMEA 2B6HA 3K8YA 4ABAA 3G82C 2CL0X 2IS1A 4MDSA 3CRMA 4Z54A 1L4UA 5EE9A 3BG4C 1C1VH 5KNBA 3WMEA 1ETTH 5JLJA 4BAHB 2DPXA 4PPFA 1CR1A 4NBSA 4MPVA 3ZVDA 1DY9A 2FIRH 1SXJD 1K6MA 1UTLM 2VNTA 1E9SA 5ETXA 1DOAA 2CDNA 3U7EB 3SYJA 3PTBA 3RSLA 1RTLA 1G17A 1GJ4H 2BQWB 3F8TA 1EFRA 3BXZA 4QHYA 3BG4B 1UFQA 1TBRH 3QXXA 1G8PA 2HOBA 3QKSA 4BZPA 1IN4A 1J2JA 4Y10E 5TCCA 3VR5A 3SNEA 1XFAA 1MKXK 4TQ9A 5CHAB 1BMMH 3BAFA 2R2WU 1WRBA 5A5GA 2QN5T 2WWXA 4K3JA 3BG8A 2PMKA 3TSWA 2V3HH 4A2WA 3RXAA 2MSCB 1GSIA 3GCTF 2PMDA 2AYWA 2VQSA 4ON9A 2ZRPA 1DS6A 2O8MA 3GCGA 3RDZA 2C78A 4AB9A 4NFEA 1QURH 3VXFH 3ODFA 1UTPA 1A46H 4JKIA 1CHGA 1NIJA 4LJ7A 1P9RA 4FU7A 1O2XA 5C1XA 3FKSD 3PTNA 2R6AA 4RFSA 1QL7A 2BEKA 1V3XA 5JI2E 1SGFG 2AIPA 3EZ2A 1O2ZA 2ZJAA 3EE0B 1HYQA 1FNNA 1TUIA 2BY7X 3EA9A 3MNSA 4TY6A 2R6CA 4AG2A 3VNUA 3A1TA 4IGDA 3F9HA 1FNIA 2Y5GA 2ZTYA 3RHFA 3P8NA 1W2GA 4ACAA 1YR7A 1KNQA 2OXRA 4ZDKA 4CRDA 1BKDR 2WPIS 2RGNC 5F98A 1G3QA 3WY9A 3S9CA 4WXIA 1O3LA 1X1RA 2BVNA 1NNEA 5CB8A 1N0VC 2NPFA 1X8LA 1Z8JB 1G37A 1EJNA 2C9OA 4DT7B 1S96A 1GG6B 1O3GA 2NO6A 1BZXE 2XWBI 4UNNA 2BB4A 5EG4A 4BRUA 1WBGB 2PZFA 1ZUHA 1VIYA 1VGCB 2ZJYA 4QGAA 2VP9A 4MITA 4HUQA 4LYJA 3A1SA 3Q85A 1MU6B 1W4CA 2ATXA 4TMWA 1BITA 2EI7A 1HURA 2CHGA 5C1BA 1TMUH 3E8LA 2NPIA 3KJGA 2AMDA 4GRAA 4P4SA 2Z7FE 1O2TA 2EQBA 3F9EA 3B9FH 1N6IA 1GBTA 4TT3D 4A1VA 3AVVA 1C5ZB 1KDPA 1S85A 3FFGA 1EAXA 4FCWA 2B21A 1E2GA 5AUOB 5DI3B 1SG8B 1O3OA 1D2NA 3B60A 3VGCC 1KI6A 4HDOB 1DS2E 1BUIA 4JMYA 2ZITA 1E34B 3TH5A 4IDQA 4X8HA 1C5UA 5IHPA 4ACBA 2ZC9H 3GY3A 1MRNA 4JZKA 1RPZA 2GCTC 4EUNA 1AGJA 3VX3A 4BFSA 3M1IA 3HDTA 4KFTA 1VHTA 2ZRAA 121PA 4IMZA 1GBCA 1TQ4A 3ASZA 1ELBA 1Q1QA 3ADCA 1GITA 1E4YA 1CJUC 4F7WA 1YM0A 2RG3A 3GJ5A 4AYYB 3C5HA 1LTQA 1TMTH 3L8ZA 2F1HA 5EQTA 4I31A 1QY6A 2AKYA 1YPLH 5FL7D 1PYTC 1LVYA 3L2OB 4BWYA 1AB9B 3VR6A 1GBIA 4F4CA 2BXUH 1J8YF 2V55B 2JIZA 1AGPA 3A4MA 5J4SA 1JEDA 3C16C 1GJ7B 1L0ZA 1E79A 1HFDA 1GCTC 4B3CA 1UBGA 1TPOA 4HB3A 1QRWA 4PQRA 4OHXA 2O8BA 3JZ1B 2EW1A 4DGJA 4N1AA 1IXRC 5GJBA 3THXB 1P2MA 2W7SA 5BW8A 5SZHB 2JJ1D 3SYNA 4TTPA 1E9FA 2Z3DA 1UKVY 2JDID 3A88A 1P75A 4KHZA 1C1TA 3B78A 2QROA 3T1VA 3DHKH 1XKBC 1J16A 3R8CA 1XZQA 4MYTA 3I5YA 4XBDA 1O37A 3LA6A 4PPNA 5FTMA 3QF4B 3EG5A 3ZVFA 3OIUA 4TL9A 2HPPH 2JETC 3SN6A 5JRZA 5BYJA 1KMHA 3LX5A 1P73A 1MD7A 1G7CA 4X8LA 3UR6A 1QJ1B 3C4JA 5FBIA 2FPMA 4B34A 5DLQC 4DSNA 1KAOA 4JLDA 1MBQA 5TV2A 3ZYDA 1XXHA 1TYNA 3EA8A 1LHDH 2NG1A 2VPPA 1MO6A 3TE6A 2F3RA 1SHZA 3GPLA 4NP6A 4YESB 4I1SA 3WMGA 4JZDH 4I33A 3GISB 1H9LB 1QL8A 1Y3AA 2B0FA 4JBXA 1HV8A 4DXAA 1N5IA 5L8VA 4KTSA 1NKSA 4LHVA 5DN6D 1N5KA 1THRH 4IFBA 1O2OA 2UZIR 2C9CA 2QTFA 2ZIQH 3FP8E 3T29A 2P93A 2K5UA 1RKBA 5A8ZA 4EIWA 1C9KA 3SUDA 4KBFA 5PTPA 2CVHA 1TBZH 2CL7X 3LW7A 5GVRA 3H1TA 2IYVA 1PQ7A 4DLXA 4BFZA 3RXFA 5A4JA 5HCNA 1UKEA 3HGPA 2FU5C 3HU2A 4FXPA 1CJMA 2PJZA 2HDNB 4UXJA 2ZYWX 4X8UH 1JJ7A 3FKQA 1D3PB 3LC3A 2O0HA 3GY6A 4DJTA 4U7DA 4ZCLA 3V4RA 4RKFA 1FAKH 1YRBA 1N5LA 1NLYA 2QQ0A 1E9EA 3A1UA 2C4FH 1D2MA 1WA5A 2D4HA 1US8A 4RZ3A 5TJXA 1JAIA 4MKIA 2BC9A 4M4SA 4O03A 4Q9LA 5E8EH 4XSKU 1O2SA 4AI6A 1OWKA 1AY6H 1ZMLA 3MYWA 4JSYA 4EPVA 3H09A 4I8GA 1O5EH 2QBYA 1V2LT 3QQ5A 5GNDA 3OEEA 2FMJA 4KXFB 1W4BA 4MUBA 3N2IA 5J4KA 2NZJA 5DE3A 4EQ6B 4ZCIA 3OEHA 4HAZA 3RMLH 2F91A 4DLRA 1XUJA 1UEJA 1IXSB 1G291 1M6NA 5IDKA 4Q1AA 3MOCA 4B43A 3MFYA 5FTLA 1W5SA 1YZUA 3CM0A 1T0HB 2BCGY 2JJ8A 5G53C 5C46F 3Q5EA 2GGVB 1C5TA 3GLFA 4POAA 3TUIC 2YVUA 2OUKA 1GI3A 1ZRBA 4B3BA 3BB3A 4DIHH 1O3PB 4URUR 1IJFA 2IWHA 1UTKA 1EZXC 2IF0A 1J14A 4NYMQ 1HT2E 5TARA 4CEJA 3PYHA 1KIGH 2CBZA 5EXXA 4OHYA 5D3MB 3AF4A 1FQJA 1O2IA 2EFCB 1U8AA 5CM9C 4KP0A 1N2CE 3A36A 4IN2A 1WB9A 2BMDA 4FUBA 3MNBA 4DLTA 2ERXA 1ABJH 2G1JA 4ZUHA 5GCHF 4UXHA 1W0JD 1KO4A 5AF9H 5H68A 5FCKA 3RXGA 3KL4A 1Y3WA 1NFUA 4MDFA 3A80A 2RGEA 6GCHF 1XJQA 1T9HA 2WWHA 4DWJA 1SXJB 1O5AB 4BFYA 4C3ZA 1NN0A 3QO6A 3I72A 4MNXA 3WY8A 1QTFA 3ZZAA 1QHNA 3SU5A 4ZKEA 1K5DA 4B73A 1SHKA 1OIXA 3NDBB 3TGJE 4Z0KA 4TLEA 1PPGE 3UR9A 3ZVCA 4DC9A 3M4YA 3MG9A 2W26A 4NL4H 2OUAA 1O2KA 2Z9GA 2GXSA 1UO6A 5BPEA 2BY5X 4PSKA 1TF5A 4XVUA 1I2DA 1Y59T 1C1SA 2ESTE 4OGYA 1YGCH 1TPZA 3A7VA 2RMKA 2IL1A 3GLIB 2FPLA 2J92A 1M74A 4XBBA 5SZKB 3GLGA 2FJUA 3IO3A 1KSJA 3RXBA 2CNWD 2XOKD 4RVCA 1W44A 3E90B 1O5GH 2ZHEH 1MR3F 4A92A 4MQAA 1YPKH 3SV9A 4Z1MA 4NU0A 2AH4X 3FWYA 2OCBA 2D1JA 1KXEA 1N6YA 1MD8A 1XEWY 4HI0E 3OZXA 2PW8H 3V12A 1QHXA 1JRTA 3REGA 1TADA 5E4FA 4XSHA 2GTBA 4RY2A 3U3RA 5LDDC 1E9RA 1FQKA 1DLEA 1WBDA 4QGHA 3TMKA 4G1UC 4DCVA 4YTAA 4ZHLU 3B8JA 3DA9B 1ZBDA 1GL7A 2XYAA 1QHIA 3EIQA 2G4UA 4PZYA 2CGAA 3ENSB 1RFNA 2ZROA 4PC2A 3DZ8A 2VSXA 4Y0VA 4LHXA 2ZANA 4I7YH 1YP9A 2JH0D 3FPAA 3QKRA 3RSOA 3CZPA 3RRNA 5IRCD 1O3YA 3LNCA 2FFHA 1TEXA 4KAXA 1XMNB 4Q1FA 2XXLA 4ZV4A 2SGAA 1FJSA 3TUZC 1O2LA 1NJGA 3MWJA 1KY2A 4LJAA 1L7VC 1MO3A 2F3TA 3NIBA 3A82A 4DY7B 4OS7A 2JIZD 3IGFA 5JWOA 3RXTA 3W8RA 2ZDNA 1ZUIA 2RAPA 1XD8A 3KB2A 5HM9A 4DOQA 1KDQB 1P2JA 1CBWC 4P31A 1FNMA 2DWOA 4M9QA 3V13A 4I81A 1O5DH 4P32A 1G5PA 4Z6AH 2Z4RA 3UWJH 2AGEX 2BDAA 3PUZA 1UK4A 2JLRA 1NG9A 2VSOA 1CT4E 1PPBH 2G4TA 3THOA 2UVQA 3S1AB 1HRTH 1KYNA 3T27A 4OI4A 1EX3A 1XP8A 4Q9KA 4IMQA 2FOHA 521PA 4F4IA 2G8TA 4RD6A 1CBWB 1ZTLA 3SN8A 1DWBH 1KY9A 4LJ6A 1XEFA 1SXJE 3GJ0A 4Q7XA 2KAIA 1C5PA 2H2ZA 2GVDC 3MWYW 2QC2A 2SGFE 4BANB 1Z83A 1ZSKA 1KI4A 5J4VA 1O87A 4B76A 1QHHB 8GCHG 2BD9A 2BCJQ 1B0EA 3PV2A 2G5NA 1TIOA 1CE5A 2REOA 5DGXA 1W0KD 1E0AA 4DDWA 2FOLA 2DE8A 3HKIB 5EP1A 1VYVA 2FX4A 1CQQA 2OILA 3HYTA 2V4ZA 1AIPA 3GLIE 1C1WH 1P0SH 1W13U 4GI7A 1AK2A 4CEIA 3A1WA 1GBEA 1D6JA 2BEJA 4GUXA 3NWJA 2A4OA 1ZM7A 4C0HA 3CF6R 1XD9A 1WBBA 4AY2A 2E9SA 1GHXH 1FPHH 4NCNA 3KHVA 3RXUA 3LXRA 2EFGA 3LX8A 3R0FA 3KTAA 4NONA 1BJUA 1IOEA 4D9QA 2ULLA 1XXDA 5DO4H 1DT2A 1ZPBA 2BX3A 1FN8A 3U1JB 4K1TA 3NBXX 4N0EA 4D0LB 2A5IA 1XMSA 1O3MA 3Q72A 3P95A 1XB2A 4PO1A 1GL9B 1F5NA 2OSBA 1F2SE 3EZ7A 1A4WH 1TA2A 1QA7A 3CRQA 1ZRKA 2ZS9A 4AX9H 4X1PU 4TWZA 3WYFA 2R2MB 4KITB 3TLXA 1UTOA 2CF8H 4TPIZ 5B57C 1F48A 4O2RA 1TABE 1KDTA 2GEDA 2ZEJA 4G5QA 1S8FA 1DELA 2VSFA 4BEJA 1G3CA 2VLIA 1GJBB 1TF7A 4W9MC 3U8TH 2J7PA 1O2HA 5ABWA 1GAJA 1GPZA 2A2ZA 4ABIA 3IEVA 2ZI4A 1Q3HA 1YR8A 1L1JA 3T06B 3NG1A 1CKEA 1C5YB 2P0EA 2NU4E 5T6GA 1A3EH 3GLHA 3I73A 4CRAA 4ZKSU 2PEYA 1M34E 1JBUH 3ZVRA 3SJBA 4E09A 1IAUA 1VCNA 2R62A 3H2YA 4D6PA 1DEKA 1P3CA 1JALA 4FCVA 4BAQB 1AJEA 2IXFA 1A5IA 3V7TA 2JKHA 2VP4A 1KLIH 3NZIA 1Q20A 4JLVA 4DUGA 3K70D 3THYA 4G5RA 1VTKA 1MZAA 4XVRA 2BD7A 2WOJA 2TRMA 1TQ7B 3K0FB 2QE7D 1D3TB 4FMDB 3UIRA 2WPKS 3PLKA 5DSZA 1II0A 5E2PA 3RM0H 1ZPCA 1A5TA 2A5DA 1X8KA 3U8RH 1NBMD 1E2MA 2FOBA 4EPRA 2B9LA 3E91A 1OKKA 2A2QH 1MCTA 3E6PH 4ABYA 4KCGA 4CF7A 1P10A 1SMFE 2W83A 4ZXYH 4LUCA 5KDOA 3SDZA 5TVKA 4S35A 3R3GB 4MKFA 3OAAD 4FINA 4NTZA 1BBRH 4PXAA 1UBFA 1ORFA 3RU4E 1GTVA 1XBTA 2ZFTA 4KVAA 3EPHA 1PUIA 4D7GA 4Q00A 4KI0A 2B7DH 3U4QA 3LC5A 5DJ7A 1XWIA 1NU9A 3PENA 2PGBB 5FCRA 1FIZA 1ESTA 4CREA 3QKSB 1G8GA 3URDA 1SHYA 1FY3A 5F9HA 1VDZA 2Y81A 1MKWK 3GJ6A 1YZNA 3L82B 3TSOA 3QJYA 1LB1B 2ZVPX 4EPWA 1MV5A 1HQYE 2OFOA 2WPDD 2CHAB 5GIBA 2ZPQA 1SGTA 2DR3A 5HGGA 4QJ4A 3I8XA 2WKQA 2A45B 1KSFX 4US0R 1FL9A 2ZM5A 3R9WA 3CNLA 5EXNA 2VGCC 1C5XB 1P9SA 3G5UA 3DDCA 1OWDA 1OH7A 1FAXA 2AD5A 1CJTC 4Q9IA 1O33A 3L3TA 3PQCA 1KZGB 4RFSB 3W3ZB 1QFKH 4LOYH 4NMMA 5FBEA 1C2JA 3DFJA 1P6XA 2EC9H 1E4VA 1SOZA 1OKXA 4IDNA 4THNH 1CRPA 4M8NE 3VB6A 1RC8A 2VGCB 2O9QA 4MTBA 1MQ6A 3MH7A 2GJAA 1T5IA 2IBMA 4M7GA 1S1MA 1A7SA 2O8EA 3ATMA 2GZ9A 4Q4LA 2BJWA 2V9PA 4YONB 3CO5A 4RSGA 2CXVA 1ZOMA 1KO7A 3OIYA 3RYTC 4TN1A 1G3DA 3A87A 1SLUB 2CE7A 1NC6A 1U0LA 2Q3FA 1GI4A 3UMRA 1ZHRA 5FBQB 5EZ5A 3SJKA 3LBIA 2FGKA 4AKEA 2GBLA 2ZP0H 3UMFA 5H1YA 2VP2A 2SGDE 2HALA 3SR0A 2ZR7A 3TVDA 4CYMA 2XB2A 2IYLD 1TB6H 1TX7A 2FS8A 2ZU6A 3TJZA 3D31A 1AS3A 5FX5A 3TJNA 4K81B 5JJIA 5J4QA 2C8WB 2F9BH 4HUQB 2FDAA 4HB0A 1Z63A 1HV7A 3M5MA 4BASA 4B2BA 2PBRA 3QI2A 1XPUA 2WWWA 1PFXC 4GHTA 3LH1A 3UPEA 1GMCF 4XVQA 3B7GA 3R7WA 1CR2A 3VAAA 3ATWA 3QTVH 4P4SB 1NRNH 4B2CA 4BLPA 1G3MA 2AKAB 8LPRA 1Z28A 1K9OE 1VJAU 1G3BA 1K2I1 2FI5E 1DE7H 3EC2A 3L0IB 2X2EA 2P59A 4ZMAH 1V5WA 4E07A 3ESTA 5E0JA 2BMGB 2Z3CA 4N0DA 3KL6A 5SZJA 2Y7ZA 3NCLA 3P4XA 1KI6B 2H5EA 5J4LA 2C93B 2ZPRA 2OCYC 4XWKA 2SGQE 5FPHA 4NSYA 2BKEA 4B1TA 1FY5A 6ESTA 1Q12A 1C2FA 2W2VA 5A2MH 2A4QA 1KI7A 4MYHA 4YLUA 2ANWA 4YOJA 2M5TA 1KI1A 1BTWA 4NZYA 1A2BA 2BHGA 4WA7A 1RS0A 5C3NA 3GYLB 4YT7H 3PMJA 3EIHA 5EGMA 2CV3A 3AH8A 3RP2A 4HAUA 3DEFA 2VVCA 4GOJA 1EPTB 4XFQA 3SGBE 3MU5A 4B6EA 1Q3TA 5HE9A 1IJEA 1BOFA 1TAWA 2WAXA 4TMVA 2FOCA 2QRZA 4P0TA 3Q3JB 3B6EA 3ZQJA 1RRGA 3MAAC 4GMDA 1OFIA 2FLBH 1E2NA 1QCPA 5L30H 4M1KA 2O8BB 1H9HE 3LJOA 3KUDA 4MGZR 3TK1A 3KFXA 2Y5HA 2RGBA 4MGYR 1ZMNA 5JHHB 1GG2A 3SYLA 1X7AC 1E9AA 2ORIA 4LPSA 5DO9A 2BIFA 4NA8A 1GBDA 3SO3A 1TRNA 1AMHA 2H9TH 3BWDD 2VIVA 3A7YA 3AVTA 2A7JA 3GJ3A 3TAUA 4MPUA 1GWAA 1J90A 2RB4A 3EA0A 1E35B 1NSFA 4X0WU 4JJZA 3X1YA 2RA3A 2F3CE 2P5TB 2B5TB 2QYIA 3MO6A 4EFNA 2SGEE 5DKMA 1SL3A 3P8GA 2IEYA 3FP7E 1NFWA 3A4NA 1LF5A 1LTOA 3OF5A 5JECA 2FI4E 1E2IA 2GJSA 4JYVH 1E1QD 1VCPA 4UFGH 1YVDA 3FMFA 1DX5M 2VIQA 4PO8A 4BNRA 1KMHB 3EWSA 2WV5A 2QU8A 4TYNA 2GT8A 3S7HB 1EFTA 4Q03A 2A5JA 2A5FA 3EAQA 2GXQA 5L6NH 2EI8A 3FOZA 2ZR9A 1XXHB 1EXFA 4DVAU 4HEJA 1CTQA 2EYUA 4ABGA 2ATVA 3LAWA 3U98H 1GJ6A 5DP7A 4GNKA 1P2OA 2FSFA 2VH5R 4FVDA 4XD7A 1E2KA 3I29A 1CU1A 5GXPA 1EX6A 2ZQ5A 5K7RA 1KSGA 1DXWA 5EE0A 3QPVA 1GVZA 1O2WA 1MH0A 3N2EA 2ASEA 2FWRA 2RH5A 2W0MA 1R5OA 3ND8A 3I4LA 2JLZA 3GEIA 1NL3A 4RJLA 4FMBB 4Z8YA 2C8VA 3SYKA 1AN1E 2FI3E 1TX6A 3CW2A 3E0NB 1OP8A 4LYHA 4JYUH 2NZ8A 4NKRA 5FX6A 2XNDA 1P72A 2PX0A 5J47A 3AP2A 3RMOH 1KTTB 2IUTA 3X1ZA 5AJXA 1NRSH 2C03A 1JEEA 4WZBE 1RTFB 2ZPTX 2WAYA 3SS8A 2QMOA 5EZ6B 1W1WA 3PB1E 1P60A 1Q44A 1SHHB 1C1NA 3H4MA 2KJQA 1QNJA 1DAKA 3OIVA 1R4AA 4D4MA 4KELA 3A8TA 2IYSA 1IONA 2QL6A 4JLAA 4A2PA 4CH2B 3T35A 2ZS7A 4A6LA 1E36B 2CLSA 2D62A 3K2UA 1HNEE 1US8B 2GETA 3D62A 1TBQH 1MH1A 2BWJA 5FPKA 3GOVB 4OGXA 3SJ9A 3IBGA 2F55A 1AZZA 1O3JA 2YWEA 5KPJA 5FUYA 4LDJA 4C0SA 2QBYB 1VKJA 4OBEA 3KXIA 3KXLA 3RLYH 4D0NA 3BFVA 1IQMA 3RMMH 4Y6DA 3DHWC 1TFXA 2ZE6A 1O38A 1BIOA 3M61U 4JIMA 4PZZA 2HRVA 3X1XA 5FOUA 3LU9B 4NIWA 1ZU5A 4XOJA 2YNMA 2CVFA 4UJ3A 1DTSA 3KJIA 2CHQA 3PCRB 3K70B 3O8CA 4BTUB 1HE1C 4RFVA 3LRPA 3GLFB 5K8UA 2D06A 3P26A 3DM5A 3SU3A 4CEJB 3OE7A 4DT1A 1HGTH 1PPCE 2Z9KA 4V0KA 4ZXXH 3FDIA 4GHQA 1Z0FA 3CWQA 1E1RD 1XCPA 4B3GA 1X1SA 5ELXA 4HLUA 1SGPE 1C2GA 3BTKE 1XXHE 3O47A 3F9GA 4PROA 3RABA 1SULA 1ZNZA 3JZMA 2OZEA 3P17H 4CGZA 1TRMA 3U6KA 4SGAE 5JB9S 4JYCA 4HLCA 5EE1A 3SI4H 1OP2A 1G41A 4IW4E 1JMOH 3KN2A 3AAVA 3ZZUA 2GXAA 3SZRA 1BYIA 1YZKA 2QTHA 3U7HB 1K1MA 1LW7A 4WBSA 5IK2A 2FPKA 5C67A 1YCPH 1N6KA 2A0QB 2ODNA 1GM5A 2CHVA 1DWEH 1G21E 4H42U 1VHLA 1U8ZA 4GPTA 1VMAA 2O8TA 4X1RU 3W3AA 3BS4A 3BTQE 2IX3A 1HAIH 4WVPE 1Q1EA 4BAKB 3REFA 1DAFA 2BY6X 3GLGB 1HAVA 1R6BX 5CLQA 1JXOA 3ZZBA 4EAQA 4DSOA 2H9HA 2G88A 3EGKH 5AR1A 1II8A 1KJYA 2B92A 4GOXA 4PC3A 3PO1C 2V8OA 1FQ3A 2IHYA 4FUJA 4DDVA 1WQ1R 2XAUA 2FOMB 3BB1A 4C0LA 4XWOA 3RXLA 1T3HA 2Z9JA 1ARBA 5BN5A 1GHBG 2XSZD 7LPRA 1EAIA 4A7IB 4GAWA 1AQUA 3WHLA 1H1BA 3K9GA 4DVGA 2GZ8A 1U98A 4BTTB 2J5XA 1IQFA 1IY0A 5BRRE 4PTLA 2F9PA 4D7FA 1Z2CA 1LKAA 4LJYA 1QHRB 4XTRA 1IHSH 1UK3A 2RDLA 1SVOA 4RKOB 1LCYA 1LVGA 4PFSA 1C2LA 3QKRB 3FTQA 1PPEE 3QUMP 4M53A 4BLTA 1VITG 3AASA 3E5HA 1E98A 4FW9A 2ZRJA 2P5SA 4WY3A 3W6NA 1UMAH 2PUQH 4Q1BA 1BO6A 4AYTA 1FPMA 1SKYE 5EPYA 1SQ5A 2F1IA 5DP3A 1W12U 3LOXA 1LKBA 3BN9A 5L2ZH 1KXFA 1P05A 4HAVA 2D8WA 3TNTA 1EP6A 1AZSC 3BBPA 1GI8B 2WZQA 2FDCA 3LH5A 1OWIA 1L2TA 2R2AA 3NBYC 2J7KA 1AIXH 3EC1A 2VWLA 1KI8A 2IEZA 3UTUH 3CRW1 4AYXA 3TITA 1DARA 3CNNA 1NBME 1MUEB 4GSOA 2CL6X 3K0CA 3QK1A 3QUSA 4PANA 2J1LA 5L3VA 4R0IA 1KNXA 4ISNA 2ZEBA 2ZDMA 4KSBA 4H4FA 4WXPA 2OV2A 2W5EA 3H84A 3ZDQA 3LGIA 3SU0A 2ODYB 1P9NA 3IIMA 3MMPA 4IOKA 2QT1A 1B23P 2KAIB 4AYVB 1ABIH 5LB4A 4FUDA 1H8IH 3QZRA 3VU9A 2P3UB 4KBGA 3X2SA 2W6ID 3BIFA 1G8HA 4IHQA 1CEEA 3CS0A 1YKSA 1SVLA 3MU8A 4GP6A 4FMDF 3U8OH 1LQEA 1ZNYA 5HR5A 4G5GA 5HCIA 4D8NA 2O8CA 1R10A 3RXJA 5EXSA 1ZM3A 1BTHH 2FFAA 4MRSA 2WUBA 3I92A 4I1UA 3PV4A 2RGGA 1WU1A 1NM6A 2TGAA 1PQ8A 1GUAA 3LW8A 4DLVA 1O5BB 4XD7D 3A8DA 2QT0A 3A84A 2BDIA 4GPGA 2NU0E 3TPIZ 3TK9A 2AK2A 4CEIB 2PWXA 2ZJOA 5KNDA 4IW3B 4F38A 3FFBA 5L3QA 4LJ9A 4PHHA 3PV0A 3TAHA 5DK1A 1PPZA 5KSYA 1TMKA 3DMNA 2O8WA 3BC1A 4B75A 4J2YB 1YKTA 4X1QU 3KTAB 1TE0A 2RKOA 1SVMA 3UQVA 4MUAA 1GDQA 1O2RA 3R9IA 2WKRA 4O9VA 3RXRA 2B7BA 2J0VA 2PFEA 3BV9B 1FX0A 4JMPA 4H6TA 1E2HA 4A15A 2ZS8A 3QSYA 1VCQA 5A0CA 3MU4A 2WV9A 2I6SA 4FUHA 2KWIA 1EZQA 3SZEA 1GMCG 4IVRA 2WKPA 1UAAA 4F49A 2HF8A 4NCIA 1H8DH 1IXZA 2A7CA 1EZSC 4LK2A 4MRRA 4ZDIA 4NYJQ 3LBHA 1RRPA 4BFXA 4DCTA 1CA0C 3QNUA 5KPDA 5FPSA 3LPRA 1M1YE 4E05H 2PSYA 3BK7A 1P3JA 3UOUA 1SVWA 4B3FX 3VXEH 1NZQH 1K1JA 2GF9A 4X8OA 1XUFA 1J9CH 2YINC 2YYZA 4B44A 4WZ6A 1W14U 4K8BA 4FUGA 4UXIA 4LJ5A 3GLHB 3F5FA 4D4KA 3K0SA 2FWWA 5EUQB 4NIVA 3NC0C 5A09A 1DWCH 1Z71A 2Z94A 3CX7A 1G4AE 2ZECA 2VYFA 4OK5A 4A2QA 4E7NA 1SGWA 2ECKA 1NFYA 1GNQA 1E2DA 4ISLA 5DYGA 4IFEA 1G3UA 4ITRC 2W6JA 2ZRLA 2JJ2D 2BD2A 3NKVA 2A1DB 2Q6GA 5KHOC 2XZLA 2CCKA 3U2QA 2XNIA 3THYB 2FOGA 1YQTA 2GRJA 4CHAC 1NMZA 2BLQA 4NH0A 1GBHA 1UTJA 4OS1A 1U8YA 1ELFA 2HF9A 5B58C 2BOVA 1T91A 1UK2A 5IF9A 4BQSA 4C9BA 1GHWH 3OE7D 4EPXA 4TMTA 1P02A 4Q7LA 1XU4A 2IHBA 5JHGB 3BTFE 2P6RA 1FUUA 4YO9A 2YOGA 5JCZA 3M5OA 1V2JT 3C15C 1GL0E 1O3AA 3P70B 1P2NA 2JAQA 1CGJE 4AGKA 1ETUA 5A0BA 4CW7A 1YPHE 3MU1A 4V0LA 3OSYA 2R3YA 3MWKA 3QXJA 1G8FA 3OY5U 2AHOA 3A7ZA 2GEVA 4LWZA 2ZHWH 2FE4A 1IQNA 1TPSA 1FW6A 1S0QA 4ZROA 5JJKA 1FZZA 2ZI7A 4OQLA 1DFPA 5A8XA 4V0MA 2X19A 3FKSA 2FFQA 2PJRA 1C4V2 3KCGH 2ZDVH 3RS0A 4RN6A 1TEVA 1QB6A 2WSSD 4LBZA 2DFLA 3VB3A 1CT0E 2BLWA 2Z9IA 3X1DA 3TW4A 3L0SA 3OFND 1ZIOA 1P2VA 4X6OA 3W95A 2H16A 1X8JA 3OTJE 1AWHB 2IXGA 5FR1A 5JBQA 3GP8A 1N8OC 1KXDA 4MDEA 1Y5UT 1B7XB 3SUEA 3UQOA 2GZDA 1VCOA 1MAXA 3CF2A 2P2LA 3E2IA 1EKBB 2R6GA 5JS8A 3ZZTA 4ZKDA 3U3OA 3S9AA 1HAYB 3FMPB 4KV9A 1QHYA 4FUEA 2J94A 3H5CB 4OQNA 4YDHB 2GA8A 1C1UH 1IM2A 2C8ZB 1BTXA 2PKSC 1OHHA 5FPYA 2GILA 1XUGA 4PSAA 4QBFA 2VU8E 4H1VA 1N8OB 2TGPZ 4NCKA 3LY5A 3EARA 1G8YA 4AG5A 1BH2A 1WUNH 4F92B 1XF9A 1T6NA 1U0HC 1WDTA 3S1AA 1H4WA 5C1YA 1SVSA 5GJVC 2P94A 3TLOA 3DKPA 3GLHE 4PQYA 4OS5A 2F9MA 3P32A 2IYZA 3TR5A 1X86B 1ZC3A 2O8EB 2H17A 3SFZA 1ZHPA 2RA0A 1A3BH 2FZLA 4TT3A 2PR3A 3KFVA 3RXMA 2QXJA 2GV7A 3T34A 1OJLA 1E0JA 2P8OC 4D82A 3BERA 1G20E 1O2VA 2ZYVX 4LRWA 4JL6A 2FSGA 1Z1JA 1TQDA 1N6NA 2A4GA 3HU3A 1SGYE 1OT3A 5K0HA 4TLCA 1TNLA 2RHDA 4M1MA 5F8ZA 1W36D 1BMLA 1W3CA 1YZTA 1NN1A 2ODWA 3TUJC 2B8TA 1OH8A 2YOHA 1GDDA 2ONJA 1QG2A 3ZZ3A 4KFUA 1HJAC 3M3SA 2VRWA 9LPRA 1GI0A 1UCYE 1GBJA 3QVVA 3SFVA 3NEYA 3LQRA 3T1QA 2P8OB 1Z47A 2VINA 5GJWC 4LBVA 3FP6E 3QE0A 3CP7A 2RGCA 2IWRA 5TDHA 1PV4A 2DFKB 4Y0YE 4Y79A 3QBTA 5JMTA 3B1YA 5AVDA 4AG1A 4OHVA 3R7WB 3TSZA 2G83A 5FL7A 5E7IA 1BQYA 1SZPA 1Z5ZA 3K09A 5JDUB 1Z29A 2QM7A 1E2LA 3RWOA 1E9DA 1T8NA 2WSMA 4XIGS 1BRBE 1BBRK 2DUCA 1HJAB 7KMEH 3BH7A 4CVNA 1IBRA 4X1NU 4KFRA 3RC4A 3QEOA 3T5DA 4JYTA 4OQXA 2ALPA 1TU4A 1OIVA 1FI8A 2EI6A 2Q1JA 1KI2A 3VKHA 1TF2A 3BTEE 2FEOA 1MO5A 2OQUA 3U61B 1G32B 1E2JA 3KDSE 4P4TA 3ZVEA 5BYKA 1J99A 9ESTA 2JJ1A 2ZRCA 1XTIA 1RZ3A 1S6FA 5L3RA 1KGDA 4TMKA 5TMPA 1F0RA 3QIAA 2AEIH 3B1WA 4AC9A 4WMDA 2JDIA 1C1QA 3PJRA 4WIAA 3FANA 1R8QA 3T15A 3BFXA 1OSSA 4Q02A 1RYFA 3OY6U 3K9LA 2V54A 1O36A 4DBLC 3MMGA 4X6MA 4UEHH 3D23A 3SNAA 3ZJYA 3RXIA 2Q21A 4X2YA 2QP4A 3ZYCA 2TGTA 2Z4SA 1RTKA 1IOZA 2ZFRH 4TQUS 1Z6JH 2QXGA 1NVWQ 1EX7A 1OLOA 3MRSA 4TL7A 2G81E 1DO0A 1GILA 3P20A 1H8ED 2OD3B 2ZF0H 3MH5A 3NC1C 1LDTT 2HGTH 3WRXC 4BPBA 2XJ4A 2WWYA 3T2NA 3ODDA 2SHKA 3WXMA 1O5FH 1F60A 1CS4C 3M35A 5FAHA 5F03A 2EWVA 1O2QA 5FUXA 1HAOH 1QZXA 3HWSA 4M1TA 1VYTA 1XZPA 2O5VA 2A30A 3GY2A 4M21A 4X8MA 4I8JA 2QI9C 2HNTC 1QRAA 2A7QA 2C77A 5HKKD 4B3XA 4QC2A 3RC5A 4MNYA 1XD2A 4NFFA 2V3OH 2AIQA 2HT1A 1KO5A 4HB4A 4JVMA 1GIAA 4Y8XA 1EB1H 3Q3KA 1ESNA 4MVNA 1DE0A 1OSNA 2J45A 3QVUA 1UTNA 1HBTH 3HGNA 3EIEA 3RRZA 1Z1IA 1HDTH 2K1QA 4HZUA 2ZI3A 4ABFA 3RC8A 4QOSA 1J8AA 4TTQA 2ZRBA 1SI5H 2UKDA 1N3BA 4SGBE 1O39A 1XDBA 5CHAC 1M7BA 3VFDA 8KME2 4L9WA 2I6QA 2VP0A 2FX6A 2W6JD 2VHCA 1E94E 4MYCA 4D0GA 1IQIA 1HPGA 3SGQE 2XBVA 1QF9A 4JZEH 4IC6A 1ANBA 1N6XA 2CJIA 4J0QA 3LLUA 3UATA 1O2PA 1NY6A 2WJJA 1TPAE 2J3EA 2XNSA 4MKGA 5BN4A 4MGIR 2D2DA 4PSVA 2QSZA 2GF0A 2ODPA 1AVWA 1ZZZA 3RS7A 1QVAA 1O34A 2ZRGA 1LPZB 5CYPA 2XZOA 4NYMR 2OBMA 2ZFQH 2IYUA 2NWNA 2J0QA 1L4YA 4F91B 3QXSA 2FX3A 2YZ2A 5FI1B 1AVGH 2C3SA 4HZHA 1QB9A 1W49A 1CLUA 1WP9A 1S0RA 1RIFA 1XCMA 3B5JA 1ZPZA 2GVFA 2ANYA 2ZU3A 3GCOA 3QXHA 2F6RA 4GDFA 3HK6B 1UDXA 3UXMA 3ZVGA 1FIWA 1GJ5H 2AX4A 2RGNA 1HAXB 3KKNA 1SQOA 3BEIB 3VMFA 1ZR0A 4LC1A 3TH3H 5LPFA 2GCHF 1NO9H 1EK0A 2N46A 3RXCA 2ZRMA 1GG6C 1R7RA 3MUFA 1RW4A 2QENA 3W6PA 3Q5DA 1VGCC 1WTGH 2E1RA 1QHGA 4I1VA 1P01A 2QV1A 3JZAA 1GL6A 1NN5A 1EAWA 1HH4A 4RSPA 3GY8A 3EA7A 2AN9A 1W0JA 3A1VA 3T1TA 721PA 3UKDA 1OXVA 3SQWA 1FFHA 1HLTH 1TGNA 3ZVMA 1GVNB 2UUKB 2BDTA 2ZDLA 3NHAA 3ATLA 1TOMH 3SEAA 2FESH 4ZKRU 2Z43A 4LI0A 1YE8A 1R0YA 1OHHD 4ARZA 4B6FA 2ZI6A 1XMIA 1EJMA 2VB0A 4TY7A 4QXAA 1AKSA 4JLMA 1GMDF 5CM8B 5EPNA 4R71A 5E3HA 4DW2U 5CIQA 3R9XA 4RD1A 3BORA 4K60A 1G3EA 4RD2A 1X6VA 2HNTE 5TXGA 1GJAB 4LZZA 4DT1B 4D76A 3NHBA 2GHIA 3IG6B 1VCMA 5DISB 2CNWA 4DCUA 3N70A 2XOKA 3GFPA 1HAZB 2RCNA 2UUFB 1GGDB 2VP6A 3MU0A 4DEYA 3T25A 4DKXA 2QY9A 3LO5A 1LVMA 1OFUX 3S9BA 2ZSBA 1Y8TA 4UE7H 1R8SA 4WXRA 3RM2H 2MMCA 5LGOA 1TMBH 1NRPH 2ILNA 5FH9A 1AB9C 3VR2A 1SR5C 3IIKA 2HLCA 4LV8B 5EE5B 2F1RA 3MNCA 2RGDA 1SFIA 4Q1CA 3NBZC 4DDTA 2H1LA 1A5GH 3RANA 1O0DH 5JB8S 3VX4A 1PLJA 4AFQA 2KI5A 3B9PA 4IXNA 1KHTA 1XNJA 4U30A 3E16B 5E0GA 1ZU4A 3C27B 2IJD1 1EPTA 1O3FA 1UHBA 4IC5A 4XSGA 2XBXA 3KKOA 5AJVB 1HAVB 3LGUA 1EWRA 1VECA 3LBNA 4EPYA 5JWHA 4W5JA 1UJ2A 1D3DB 4I4LA 1QIXB 3SJZA 1PQAA 1II8B 2J4IA 4C2UA 2WM9B 2VIWA 1A7JA 4O3TA 3KZ1E 1CRQA 2TBSA 5H70A 4G01B 4QRHA 3H7TA 4CT4B 4ISIH 4WXVA 1VJ9U 1DVAH 2GD4B 2XWAA 3LGVA 2VF7A 4C30A 2ZSDA 3AVWA 2P95A 4JT4A 1BTZA 1XVOA 1P09A 2ZO3H 4I1OA 1NS3A 4CZ2A 1T32A 3SNHA 4TWYA 2WJIA 3HK3B 4MH0R 1GJ9B 3A6PC 4IOMA 1TX8A 3SJCA 4YMTA 4CRWB 4P3YA 1WE2A 1F6BA 4O3MA 2YNBA 1EFCA 5CJ2A 1A2KC 1T31A 2PLXA 2XTTB 2DWQA 3VTKA 1EP5A 4G5SA 2ZRDA 2I3BA 1K8RA 1V2NT 4MRVA 4DCNA 3U3MA 1AM4D 2ZAMA 3RRMA 2IYTA 2IT1A 4XBCA 1D6RA 4PAOA 4MQBA 1G18A 1KIMA 4Y0AA 4BRWA 3R20A 3RLWH 3BSQA 2BOHB 1F92A 3SBKA 2G0NA 2GDDA 2HEIA 2LKDA 1W0KA 4ERNA 5JBAS 4JVNA 2ZZUH 4HLQB 1F5KU 3A89A 2QNRA 1VCWA 4Q1DA 1V2VT 1U0JA 2ZGHA 2ZFPH 4DIDA 1GOTA 1HAHH 1OWEA 2Z3EA 2BKUA 5BXQC 5AK0A 3DMDA 4XDEA 4CBNA 1RJXB 3MFJA 1MCVA 1W11U 3AVPA 2ZJ8A 1E69A 2J38A 2J9RA 1A1VA 1MTNB 3C8UA 3FAOA 2SFAA 5FPTA 4QHTA 1C5MD 1C2MA 1GRRA 1ZGIA 1C1RA 1THPB 1JWTA 2GK7A 3H86A 3K9XB 3AF3A 5JYIA 2Z6VA 3CR8A 2ZKSA 3VU9B 2IUSA 2ZDKA 2G0TA 3LDAA 1NU7B 4MYUA 3SJOA 4LV6A 1W5TA 1YCPK 1OX1A 4AFUA 1BB0B 4AURA 2VHUA 2AR7A 5B6OA 2ORWA 2C96A 4TYDA 3NWUA 4S2EA 4ZO4A 1OXSC 2O8CB 2HXSA 6LPRA 3BE4A 4B2PA 1DSTA 4PHGA 3CWZA 2H6MA 1KTVA 1P12E 1T3LA 2G52A 5CDFA 3RXEA 4Q5IA 3RAPR 2JLUA 1Z6EA 4OHZA 5DPAA 1BOQA 1BMAA 5L3QB 3VKGA 1OYWA 5CJPA 2BV3A 2J34A 5UKDA 1C1PA 2J87A 3A7WA 1JPNA 2ZGJA 1XPRA 4K46A 3HR7A 1GI2A 3RXHA 3CBQA 3WBKA 3QY0A 1SGDE 3EZ6A 4HUTA 4U32A 1ZAKA 4KLNA 1SC8U 4DURA 2FOEA 2CEAA 1FX0B 2IA5A 1LVOA 1ANKA 2PLFA 7GCHG 3AW0A 4US2R 3CH5A 3QTOH 2PV9B 2D7DA 3KJHA 2HPQH 621PA 4M9FA 4M1WA 2ZI5A 4JZIA 1VG1A 1T8UA 1BMFD 2WWGA 2XW9A 221PA 3M6AA 4C7OA 3KF2A 2P3FH 4ABHA 5EOKA 1E2QA 2QE7A 4LK4A 3CPHA 1SXJC 5FOVA 3EZFA 1BCUH 1GP2A 3AEZA 1K21H 1MOZA 5EU8A 3BEFB 4FVBA 1NBMA 1JECA 2C8YB 1O3IA 2OO7A 2QGNA 5GJ4B 3A81A 5ESBA 3TW8B 1Z8RA 3T12A 3QOFA 1N6OA 5FXLA 1XTKA 4AGJA 5EXLA 2VVUA 4OK3A 1Z7KA 2REXB 3OAAA 4UQOA 4KVGA 3AVXA 5KDLA 2XXAA 1ESAA 3GFTA 1QL9A 3DKVA 1ZINA 2C04A 5FI0B 3RVBA 1CR4A 3A85A 4NPHA 3ZZ5A 3G01A 2XJ9A 3M7QA 1I4DD 1ACBE 3EW9A 4BE7B 2VIIA 2EA3A 2AXNA 1O32A 4ASUA 5E0HA 4GCHG 4A0RA 3M7UA 1OFHA 1P7CA 2H7VA 3PUXA 4H9GA 1L1GA 3W5IA 2J95A 5KSZA 1UPTA 1SLVB 4BFVA 1MMJN 2GZAA 2P65A 1C2KA 1AZ8A 4URXR 1I2MA 2XC5A 1E2EA 1W2KH 2YV5A 3SOSA 2ZTSA 2WPDA 1G7RA 1NRJB 3HKJB 3KQDA 3ZV8A 4QG7A 3M7TA 1FPCH 5P21A 2BLVA 3LQQA 5GDSH 3PV5A 4A1FA 1ELTA 1HJ8A 1P62B 5DP8A 1O2JA 1TNIA 1N0WA 2PKAA 3D3QA 1N6HA 4PR0A 1F0UA 2NO0A 4AK9A 1U81A 3I3SR 4JLJA 4BLRA 4CR9A 2AXPA 2ERYA 1D8TA 4GZMA 2NO1A 3OHMA 2QCYA 1H8HA 4I32A 1GJCB 2XGJA 1PYTD 3OX7U 2PT7A 2F9UA 3UWIA 1XJ0A 2WJVA 1SOTA 3SJIA 5C4MA 4EJSA 4PC1A 1GJDB 1COWD 2PEZA 2WPLS 2WINI 1F0SA 4OS2A 2IYYA 4XJXA 4TL8A 2IS2A 1IN6A 2QMUA 3CRVA 3PFIA 3BOSA 5GADl 2Y8EA 1GCDA 1DO2A 3LFUA 2F9VA 1P61B 1MKYA 2CCGA 1S9HA 5G41A 1E0SA 3LJJA 1AD8H 1UVOA 2BQ6B 1DICA 4QHSA 2THFB 4BLSA 1T4VH 1ANDA 1ZGVA 3HYRA 3AF2A 1Z3IX 3VB5A 2ZU1A 5C5OA 3FMIA 4DG4A 2ZQ2A 4G3XA 1ZYUA 1PLKA 2YC4C 1T8MA 1EASA 3P4YA 4Z51A 2LPRA 3ZZ7A 3EYDA 1Y3XA 1GI5A 2A5AA 2BDCA 2QMHA 1JIRA 2HLDD 4WH8A 1W10U 3CNOA 4K2YA 1A0LA 2JA1A 4O25A 5C18A 1OH5A 2C90B 1KZ7B 2WYJA 3A83A 3ZVLA 1QGFA 1NY5A 3BEUA 2A78A 3TNFA 3GCTG 3E0PB 3M5NA 3PWBA 1LY1A 2OBOA 1S3GA 3ZIAA 4YT6H 2XBWA 5AUPB 1G19A 1VIAA 2MSDB 4B2AA 4IS5A 1WTHD 3PWCA 5LBIA 1MTUA 4G5OA 3MNXA 1ZMJA 3ZV9A 5DGJA 4LV5B 5D3QA 4FUFA 1HIAA 5CK4A 1AUJA 1CXZA 5CIWA 1F0TA 3U7FB 2Q3HA 4K69A 1G7TA 3QLPH 4MGKR 2FEQH 4KKDA 4JLBA 1FN6A 4P4UA 3O8RA 2N1BA 2G3YA 2GCHG 5LD2B 4NCJA 1C5VA 3K09C 1L2EA 5F6MA 1BS1A 3AVOA 3UIEA 1Y3UA 1BTYA 4ESHA 2ZYUX 3QGNB 1SFQB 2N42A 1K1NA 2R6FA 2ANMH 2B8OH 5C4GB 1K5GA 2FXRA 2XEXA 1VG0B 3F1SB 3QN7A 4C0QC 3EZ9A 4PHTA 4ZHAA 2HNTF 5FHTA 1OYTH 2ZJ2A 2KBEA 1BYUA 2YOFA 4Q18A 4DSUA 1XCGB 2HWLB 4C0JA 3D6TB 2A5GA 1O3DA 2Q3MA 3UWKA 1U9IA 2ZI2H 3NXPA 1GFIA 4RKJB 3DOEA 1EAUA 4V0ME 3PUWA 1TNKA 1Z0AA 3CIOA 4HDCA 1ESBA 2H18A 2BDYA 1WV7H 4VGCB 2VHTA 2O8DA 1KK3A 4BFUA 2C2HA 1DG3A 1YPJH 1XTRA 1QQ4A 5DI9A 4A0GA 1GMDG 1VZQH 1FUJA 1F7ZA 4MRPA 2CE2X 1ZMXA 1SGFA 1HEIA 2CLCX 1NVVR 3IKJA 5KOYA 1HTWA 1WF3A 8OHMA 2AL7A 2A5YB 1Z0JA 4DIIH 4GMXA 4YMUA 1KTSB 1OYQA 3IEUA 5B2ZA 1IQLA 3T62A 1KKMA 2IOTA 4ABDA 5LB2A 1KY3A 3CB4A 5HTKA 2IW3A 2Q0HA 4JVLA 3WNBA 1NI3A 4UD9H 3GEEA 4B47A 3ZZ4A 3DFLA 2DHRA 2W7UA 5KSPA 1LS1A 2V0BA 1TTTA 4X2XA 1U6QA 2ANCA 1ZW6A 3NXSA 5AJWA 4HATA 3MD0A 1E1QA 2DYKA 1T8OA 4DLZA 1ESMA 1X3SA 1V2RT 4XWAA 1W7AA 1HUQA 1OE0A 3FE2A 2XTZA 4BLOA 2Z6BD 1JI0A 3SORA 2BBTA 3L8YA 2PUXB 4TSFA 3AKYA 1N0UA 1S84A 1EZUC 3CPEA 4QFMA 2OTVA 3VNVA 5A0FA 3X1WA 3AUYA 1QBNA 1E2PA 1LPKB 1XD2B 4JL8A 2VIDA 1ZJ6A 2BZ6H 1ZNWA 2VHQA 2AS9A 3ZS8A 1T7CA 4CH8B 2BDHA 2F1JA 4INKA 4BAOB 1IQHA 4MA4A 1DG1G 1EWQA 1FMJA 2ZE5A 3EPLA 8ESTE 3FVQA 4WOPA 3B1ZA 5DG6A 2ZUBA 4YLGA 4B3DA 3WYAA 4M1SA 2ZU0C 4HZUB 1DAGA 3QF7A 3IWMA 4TL6A 1T8LA 2G9NA 1ANCA 4UFDH 5LH8A 3U69H 3VR1A 3AAUA 4AWXA 1C1OA 1SGCA 3IIJA 4U5XA 4P33A 4X2WA 1OPHB 1QBKC 5C2JB 3T28A 3VKWA 4DRZA 1AUTC 2CHAC 3GY7A 3P1JA 4A5TS 4O3UA 1KXAA 8GCHF 1UVUH 2V6IA 1C5WB 3VR3A 4R98A 4ASUD 4HI3A 2AD1A 1KXBA 3SI3H 4US1R 1SGEE 2XB4A 2O8LA 3Q76A 3SU8A 2R44A 4RD0A 3RUOA 2WPMS 3PLPA 5JWRA 1UCYH 4WH6A 4WVFA 3BTME 1PPHE 2DB3A 4MNWA 1XX9A 4OI2A 3SBDA 4LC0A 2FZ4A 1CP2A 3RDPA 1TGTA 2F83A 4ISHH 1GHVH 3RU4T 1TPPA 2OG2A 5EXMA 4HAXA 3BH0A 3PM3A 2BMJA 3HU1A 4GVUA 1NLZA 1W4AA 4Q7MB 2V7QD 1TWXB 3B9QA 5JS7A 1FDPA 1AN0A 1KK2A 3RC6A 3D65E 3UNRA 2ORVA 3D49H 3FB4A 3SU6A 1H8HD 1GNRA 3ZVNA 3KEEA 4Y76A 2D7CA 1Z06A 4QGGA 4X2VA 3SV7A 1KI3A 1NVXQ 3RXQA 2VWNA 1C2EA 3ONWA 5GVSA 4KYIB 1DPFA 4UNSA 1A82A 1QRZA 4LHWA 2ZVQX 1P5ZB 1SGIB 1KO1A 1E1RA 4LPKA 1GI6A 3Q3XA 4UDWH 4CEHA 1QVRA 1C2IA 2ZNKH 3ZZ6A 1C5OH 2HYIC 3RXOA 1OIWA 1XTSA 2RGAA 3B8HA 1D9IA 4NWLA 5EP3A 4NZLA 5T6DA 1PJPA 1CA8B 3A7TA 2GZ7A 4ARZB 1GJ8B 2A9KA 1EESA 2B7CA 1HJ9A 1YF4A 4FN5A 2OLKA 4WMFA 1ELCA 1AKSB 1C1YA 3KKQA 3KKPA 2P6UA 3K0AA 1G1MA 1O30A 3RU4D 2ZREA 4BEBA 1GI7B 1Y63A 5FUWA 3C41J 2D2EA 3ICEA 2XTMA 3NDPA 3M36A 2HJGA 2BD4A 3VGCB 1IN8A 4E06H 2WPHS 2BQ7B 2ZGBH 2ZGXH 1P2SA 3KJEA 3UY9A 3ZIAD 2KBFA 4QM6A 2A32A 1A0HB 5DHFA 2GCTB 5F3WB 3IITA 2Q6TA 3LGYA 1F2UA 4GP7A 3MI4A 3Q8XB 3ICQB 1TQ6A 3FHCB 1G9IE 1A1RA 1R0XA 4OK6A 2FTMA 1LO6A 4NG9H 4JT2A 5EODA 1YJ5A 2J9NA 2WJHA 3OU0A 1EPTC 4XH9B 3AVZA 2FH5B 1DLKB 1HCGA 3AKCA 3SV6A 1PUJA 3D7MA 3IPYA 3U6BA 2XSZA 5CITA 4L5BA 1XUIA 5JBBS 5GWZA 1O3KA 3VQTA 3UNSA 1CR0A 1FLEE 1JJVA 3SZNA 1Z22A 2QIQA 3CS7A 1W7GH 4YDSA 1FXYA 3DO6A 2OLGA 4Q1EA 4KO8A 1ELGA 3EA5A 5GCHG 3DM9B 1V2ST 2SNWA 1U99A 1GCTB 4NIXA 2TPIZ 1HT1E 6GCHG 4BLQA 1UHBB 4QJ5A 5K8LA 4LYFA 2OBQA 3ZD6A 3DVLA 3NVAA 3LONA 2PX3A 2BDBA 3O8BA 4ILEA 4PC7A 2LNCA 1JR3A 2FFBA 3LIWA 1TOCB 1OP0A 3BH6A 1QB1A 4G0NA 4A0FA 1I4LD 4NWKA 3UUZA 2QQEA 2EFEB 2GCOA 5E7JA 3IO5A 3EDXB 4R8TB 3FVFB 2O0JA 1DY8A 1T5LA 3IILA 3TU7H 1C5RA 1Z08A 4INHA 2BLOA 1Q0UA 2E87A 3HJNA 4JJKA 5FTNA 3EASA 4GZLA 1C1MA 4HLDA 2J2UA 1C4U2 6CHAC 2JETB 2GAOA 3RC3A 3NTUA 1WXRA 1TRYA 3B1XA 4IVQA 4OQFA 2R9VA 2JH6D 4TYQA 3FYHA 3MCAA 1XEXA 2FOAA 3LH3A 4Q2KA 3UNQA 1Q2WA 3IDQA 5F8TA 4LZ4B 2WOOA 1TNGA 4JVSB 3PITA 3SW2B 4AOQA 1TNDA 2OXCA 3ZZ0A 2ZDAH 4C4PA 1LFDB 3IBYA 4B33A 1MAYA 3UOPA 2W6IA 4AIIA 2VH6A 6CHAB 2NGRA 3GJ8A 2L0XA 4ESTE 1E6CA 3BFKA 4QKQA 4AKHA 2CMYA 3ZZCA 4TQAA 1XMVA 4OL0A 2BBSA 4GL2A 1QJ6B 1PPFE 1GMHF 5TCAA 2FGJA 3U7GA 3MH4A 5B6LA 2A2XH 3AKDA 4TSFD 1A0JA 3ZZDA 4LHZA 1EFRD 1P06A 1G7SA 1PZNA 2P3TB 3C7KA 2TIOA 3CH4B 4ABBA 4ZHMU 2IF2A 3LXXA 5JI3E 3EPKA 3UWOA 1CIPA 1RE0A 2PSXA 2IYWA 4NYJR 2PTCE 2DCUA 3U44A 4BXWA 4A0HA 3TKLA 1ELAA 1P03A 4YC7A 3ATIA 4YLQH 3ZVAA 2BM2A 1SLXB 1DAMA 1KDOA 3ZYEA 3U9AH 3CF0A 1W4RA 1LHFH 4LXBH 1ZM2A 1OV4A 4MPWA 3MWLA 2QEQA 4ZKNU 1QQUA 2AWOA 4LSGA 3TBKA 4B35A 2CK3A 1RRCA 3H0KA 1Z0KA 1F2TA 1Z6XA 3SOPA 1S0UA 1W2HA 1OFTA 1AQ7A 4FU9A 1UVSH 1G30B 2OC1A 2ZE8A 4D80A 2IYRA 3NEJA 3C5CA 2YNAA 1UJ1A 2IUUA 1NJFA 3V4FA 1AE8H 3NH6A 3KQUA 2GEUA 4M1OA 2QF3A 3ZQ6A 5AUNB 2ZFSA 4DEXA 1UADA 3AM1A 2ZCKP 3GDVA 1KYIA 1VCIA 4RCZA 1TUEA 2QM8A 2ZSFA 4CR5A 2IC5A 1RFLA 1ELVA 1IQPA 3K70C 1EFHA 2QMEA 3UANA 3ETLA 4YM9A 4YXWA 5IT5A 1HAGE 1V2UT 3QEJA 4JLKA 1NG1A 1HXEH 1TU3A 1DANH 1D4PB 1RJ9A 3OIWA 1D6WA 1S4QA 5HMAA 3AVUA 3ZS9A 1V2MT 5CLLA 4UNPA 2STBE 1ZCBA 2Z83A 1O35A 3UPUA 2OBNA 4NYIR 2JJ2A 3B1VA 2VIOA 1BMNH 1SKYB 1Z6GA 1BHXB 2R0KA 1CF4A 4C0KA 4K1EA 821PA 2YWGA 4GOKA 3Q7PA 3RLFA 3ZLJA 2OC8A 4OKSA 4C7OB 2QGRA 5AHGH 3HP1A 3D8BA 3GCNA 3GD7A 4TYPA 2PTNA 2Z0MA 1FY4A 3GEHA 2NO7A 1GKIA 1G64A 2KSQA 1A2CH 2OAQ1 3T61A 1DAIA 2FG5A 3PMBB 1MABA 1O3EA 4R7ZA 3TRFA 5G4BA 4WWYA 1P3EA 2Y80A 2UWOA 4ZCMA 3RS5A 1HE8B 4PQFA 3I61A 1Q1BA 1WAYB 4TYWA 5HM2A 2XXAB 3SU4A 2ZA5A 3M37A 1EJAA 3F9FA 4UONA 1Z0IA 3TGPA 3ADDA 4ABEA 1ANEA 3TH2H 4Q4JA 3ATKA 4INLA 1MTWA 5E2OA 2ANKH 4M0LA 4M9XA 4Y7BA 3EX7C 3I5XA 4CBOA 1NVUQ 2WSSA 4RI0A 5CB6A 2CJWA 1FTSA 4AFZA 3DT0H 4YZUA 1WMSA 4TZ6A 2VJ1A 2UWPA 3OFNA 5FL3A 4TLDA 1L1NA 5HE8A 2QAGA 1H9IE 4E03A 1RIWC 3KQEA 1OPXA 3LDXH 2LKCA 1UDWA 1HYLA 5C2ZA 1SGRE 3I32A 2I1VB 5EXPA 4E22A 3F0TA 3PEWA 1SVKA 3I78A 5T6FA 4I8KA 2OHFA 5JJLA 3AVYA 1MO4A 3UMSA 1NESE 4X6NA 1Z07A 2IS4A 5LPNA 3MO3A 1ELOA 1G2LA 4PHFA 1F5LA 1E0KA 2NIPA 3DD2H 1WSSH 4QBHA 1CT2E 3QX5H 4OI1A 1GWNA 4V0OA 4EJSC 4A8JA 2PKAB 3TGKE 1YRAA 4W5WA 3AF1A 1NIPA 5J4HA 1E79D 3QENA 2X2FA 1UTQA 1S9DA 1N25A 1RIWB 2O52A 3Q77A 4YOGA 1ODFA 5CDFE 2IN2A 1J15A 2P6NA 3EAJA 3SQHE 1D2EA 3WBJA 2D26C 1OXTA 4AN7A 2UUYA 4K1SA 2VA8A 3A7XA 1GKYA 3AF0A 1R5NA 3JVVA 2HYDA 2GKSA 3BTGE 2JLWA 5FTJA 4BGDA 2G1KA 1BIFA 5EQSA 4EJSB 3S7KB 3GMTA 1IQJA 2FEMA 1YLCA 1NN6A 5JCPA 2XCNA 5JPMH 2Z5FA 5G40A 1SPJA 3A8AA 2V1UA 1NRQH 2OFWA 1HXFH 1BRUP 3THWA 4A82A 4I8LA 1JQJC 1DXPA 1VG8A 3AQ4A 4IVPA 2V6NA 4AKIA 2ZHFH 3STIA 3SNBA 2Y5FA 4QBIA 4QNRA 5JZVA 4LX0A 1O2YA 1JR3D 2ZIAA 3K65B 5F9FA 1NMYA 2FSIA 4TLAA 3ZZ8A 5E7MA 2VEDA 3PROA 2R65A 3FHTA 4Q4AA 2VWOA 2XITA 2VP5A 2NU1E 3L43A 2PHBA 3L0OA 4TYYA 3SHAH 1QBOA 3GJ7A 3OESA 1FV9A 2G00A 3EWAA 2Y7XA 3RXDA 4R9UC 2DFNA 2H8KA 2XRCA 2FNAA 5J4YA 2QGZA 3EQ0H 1GHZA 3AW1A 5K8IA 3L6PA 3HPQA 1R5BA 1YHNA 1M7HA 4AG6A 1YPHC 1FONA 1NF3A 4XE4A 1FMLA 2UUJB 5CE1A 3QG5A 3KQHA 1HIAB 2QPAA 1TL7C 4NA9H 5EP2A 4IKEA 2Y6TA 1JQLB 3PMAB 4W5HA 4CIDA 4A4DA 2ZI9A 3LVQE 2V35A 4V0NA 2OK5A 5EW1H 2GTPA 1DAEA 7ESTE 1YR6A 1KJZA 2ZJ5A 4K8YA 3SJ8A 1KMQA 1YZGA 1O2MA 1JAHA 1D3QB 2OC7A 2R3UA 4WJG2 4Y11E 4URVR 3NKKA 2DE9A 5LPRA 1ZTJA 1U9IC 2AFQB 1SSXA 3FMOB 1D5CA 2GP9B 1LPGB 2J46A 4ZIRA 2AMQA 3IPXA 3WHKA 2BHRA 1K1PA 3CUEF 4OQMA 1GVKB 2YOLA 3W90A 1NMXA 3VHXA 4HAYA 1GRQA 1NLFA 4HDQB 1WOFA 3I1FA 4NSVA 4RD4A 1VG9B 4CT5A 4IXMA 3TIFA 4BOHA 2P16A 4OS4A 4Q9JA 1C4OA 3TVJB 4A1TA 3CR7A 1H8EA 2ZG0H 1GHYH 3G0HA 3HPTB 3ECCA 3RWMB 3QBVA 1P57B 2OINA 1CJKC 4AFSA 2OCAA 1II9A 4X8VH 3TVTA 1PJRA 4JKYA 4ZDWA 3OEED 2J0UA 2O8DB 4FIDA 2D2FA 3ZD7A 2QA9E 2ZU4A 3HATH 3SNCA 2CK3D 3SU2A 3OEHD 1CGHA 5DIFA 2WVJA 1JB1A 5EUMA 2GDJA 3BTWE 3T1OA 2ODBA 3BF6H 2GWHA 2WHXA 1KK0A 3WMFA 4GT1A 1YPGH 3LD9A 4RZUA 3MHWU 4MG3A 1HY3A 4UNQA 3M5LA 2WUCA 4Q19A 4URZR 2PCJA 2JGNA 3QWCH 1ZJDA 3RMNH 5HKKA 1AVXA 2C95A 3LT3A 1DOJA 2GT7A 3SE0A 1GHBF 2H57A 2ZHQH 1XUHA 4YQFA 4YMSA 3PIRA 4Q21A 1KSHA 3A4LA 4TPYA 2ZSAA 5JSZA 4HYYA 1PVOA 1P04A 2FS9A 5FBRB 1GHAF 2HV8A 1XKAC 2EFDB 3GY5A 1Q21A 3BJIC 4MRNA 4Q66C 4TTRA 3SHCH 4YXWD 4Q4HA 1ZYOA 3KQBA 1AZTA 2IYQA 4WAUA 1KKLA 4BUJA 1E38B 2CMKA 1S82A 1XTJA 4OJKA 1MT0A 1KO8A 3WNDA 3JZ2B 4L9SA 3K6YA 4J1YA 5J5CA 1VITF 3MLEA 1UKZA 3E1XB 1LS6A 2YKGA 4JYBA 2Q9CA 2ZTXA 1INCA 1JXPA 4O97A 1DADA 3IUYA 2W0SA 1KSNA 2CN0H 2SNVA 3FZZA 3T26A 1GI1A 1OWHA 3SQEE 3PG5A 4BFTA 2FYRA 4DCDA 1H65A 2ZETA 1Z6YA 5IDVA 3CONA 2VWMA 2XBYA 3BD9A 1MU8B 3CRRA 1MQ5A 2BJVA 4KODA 1V2WT 4D2IA 1FP6A 4MNVA 4JS0A 5FBWB 2ZSEA 4D25A 5AFYH 1NTPA 1E99A 4IEEA 3KQLA 3UFAA 4KTUA 5F2EA 2R8RA 4M1YA 4IDHA 2XZPA 1K22H 3C1KA 4Z8XA 4UFFH 2WPJS 4FMCB 4PX9A 1Q31A 2IPHA 2LWIA 4Z1MD 5KTYA 1Q1ZA 1NSTA 1G16A 3ND9A 2JASA 1E37B 5DH9A 1V2QT 4LJ8A 2JLSA 2A31A 1ZD8A 1K1IA 1D9ZA 4AYWA 2YC2C 3B23B 2W2XA 1YCPM 1DAHA 4X8TH 1YR9A 3Q3YA 1ZM9A 1G2MA 3SBEA 1EFUA 2Q6FA 1J8MF 5L3SA 1VPLA 3R8FA 2JEOA 2ZCHP 5F8XA 4JBYA 2H1UA 3IQXA 2PZGA 2HVXA 4NDZA 1BDAA 4Q80A 3PEYA 4HTCH 5EQRA 3LKWA 4OM9A 2MMGA 2VF8A 1HAPH 2ZRIA 1FY8E 1CGIE 1V2PT 4NCYA 2O8FA 5KO2A 1TNJA 3B82A 3U3JA 1RYHA 1GMHG 4V02A 1J70A 2GNOA 1G9XA 2D74A 1IHUA 4HB2A 2RGXA 2GAAA 1RXPA 4DIEA 2ZE7A 3NBFA 4B71A 2V6JA 5FOTA 4LBWA 1Y3YA 4JL5A 2QN6A 1FMGA 1D9XA 3TGIE 3PXGA 5T1VA 2BD5A 1XVMA 5AJZA 2BZAA 4Q48A 4Y71A 4XOIA 5G3ZA 2QXHA 3FHOA 4RD3A 2FN4A 2ONKA 3TJOA 2QPOA 3Q7QA 3P6ZB 3TJVA 1BA8B 2GBLC 2BMEA 3U60B 1OB5A 2OXSA 2OE2A 3CX6A 1C9TA 2EWWA 5SGAE 5AWFC 3V3MA 4TLBA 2I1QA 1N6PA 4QJ3A 1BT7A 4DSTA 1RD3B 3DL0A 3GDUA 4CEHB 3BTHE 5JEDA 1MKXH 1IY2A 5FR2A 3E3TA 3FZDA 1YBWA 1SQAA 3CX8A 2F9NA 2ZRFA 4D4JA 2ZCLP 1ZUNB 3F6UH 2C99A
chains in the Genus database with same CATH superfamily
2ZU5A 2C83A 4BQEA 1O3CA 3MB5A 3HA3A 2I66A 4LYAA 3I39X 4FYXA 1ZK4A 3MTQA 5H82A 1F5RA 2Z5VA 3OMXA 4M8KA 5SYAA 3IHWA 3ET4A 3Q7SA 4LDAA 4ZZ0A 4L07A 4BJ1A 2LRHA 2VA9A 1S1CA 1QH0A 3HYNA 2HQSA 3PXDA 1DBIA 1LBQA 1A61H 3QSGA 3KUCA 1YLDA 3M1LA 4YPOA 4EKIA 2FLRH 3I8SA 3JVIA 3MWEA 3FUXA 2G77B 3TJUA 1F2UB 5EIXA 3FSRA 1I0LA 1P4HA 2JARA 3CNBA 5DP4A 3D5TA 4HEA1 2FPPA 1YDEA 5AJUA 3SV2H 4MKHA 4N3NA 2UZ3A 5I47A 4DZRA 3EY4A 1UKCA 3SEQA 3OICA 2SICE 1EWVA 4ZAXA 4HG2A 4RS4A 3LWNA 2G55A 3IHLA 3ZWYA 5I45A 2IS6A 4ZAFA 2HA5A 1QIGA 3QXCA 4M86A 4B81A 1MIOB 2BGLA 1CY6A 1VKZA 3QUCA 5HXFA 3OP1A 4FFWA 1OBVA 5H8WA 4EM6A 2H4YA 3K3PA 3DEZA 4TRJA 4KPGA 1RKXA 2JG3A 2EU8A 5BQ5A 4XLZA 4M7PA 4YRIA 4ZYYA 2NYRA 2YZGA 2QN9A 1Y6FA 1BJVA 2C8XB 1W34A 3H2KA 1EZ4A 1WCV1 3QGJA 4MVJA 4QTZA 1SKUA 2MSWA 4U0JA 4AN0A 1U7DA 5EMMA 1AA6A 1L5RA 3N5CA 4Q47A 2GKOA 4JJ8A 2Z8ZA 2EJUA 1BWRA 3KGPA 2NTYC 5A3JA 1DJMA 2ODEA 1E2FA 1DCMA 4RORA 4DUGD 2ZU2A 4FKMA 4UULA 2UUAB 4CQNA 2B4YA 5EXTA 3QIVA 4IOLA 2AK3A 2BM1A 1WXIA 1DIHA 4YJ2B 4L22A 1TC1A 2RFLA 3IA2A 3B6JA 2Z56A 2FSHA 5CPFA 1Z7WA 1VLQA 4URYR 3CC8A 4I50A 2OT3B 4DB2A 5K0LA 1EXWA 5IYZA 2FYQA 1XDZA 5J23A 2J3KA 2WICA 1FY1A 1R8JA 2A9VA 1NN3A 2Y82A 2HTEA 3L8EA 4MW7A 1SGNE 1IBKB 3D3WB 4D81A 1JRSA 3BIJA 4KUEA 1PF7E 1OOKB 4M9RA 3DMTC 3QPUA 5CDGA 3DONA 1AI8H 1HORA 2GD6A 3U4AA 4PLCA 2BXTH 2JFNA 2QUIA 3C8MA 1H4VB 1GR0A 3KO8A 4D9MA 4L8GA 5KYWA 3SBXA 1LHEH 3OQIA 1CERA 2O3SA 5IYTA 8GPBA 2IITA 1ZVQA 2FXVA 1P4AA 4YCBA 1DP4A 2JVIA 1JLMA 1WMFA 3CV3A 2WUVA 4HDMA 3U44B 4Y2GA 4J9VA 2NTJA 3U09A 1RZVA 2SKDA 5HKAA 1RLMA 1S2LA 1TO2E 5EQDA 1I1NA 1W581 1C4XA 3U3XA 2WNHA 1K3UB 1CP3A 3IC5A 2AGIX 3UA3A 5KVQA 4HGOA 3G1UA 3DOHA 1SB8A 3WLOA 3V33A 1ISPA 4LRYA 2XODA 2ZRNA 5JH7B 1JIXA 3I9FA 3R7NA 1E6WA 4QEZA 1G5TA 1Y1QA 2XCFA 1CQJB 3L8FA 4R16A 3HBJA 2HSGA 5CK5A 4RKEA 2XWQA 3NAZA 1UW7A 3KEGA 3QPCA 1LLFA 3T0GA 3CVJA 1WEKA 4BNJA 3BTTE 4OF4A 3EDMA 4PAQA 4DDUA 1J56A 5L2YH 1NI4A 1M0SA 5CB4F 2B9VA 1ZD1A 5GJCA 1NXVA 2FTKE 1RTTA 4MS4B 1ZLRA 1QIHA 2HSWA 4XAQA 2PE5A 5AUQA 1WW8A 5JVDB 5T3HA 2ZULA 2A86A 1DVRA 2VHJA 3HB7A 1Q57A 1W19A 3IIEA 3S0NA 1NASA 1RYMA 4ZYVA 2Y76A 2ZBQA 2Q41A 3VZRA 4G5XA 4K03A 4WK2B 4OAQA 1W73A 4OOFA 1GGDC 4TV8A 2A0KA 2OESA