4B71A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
total genus 197
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b71A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b71A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b71A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b71A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b71A03
4GRAA 2BX4A 4DIEA 3LC3A 4H6SB 5BW8A 3WP0A 3SC3A 4DCSA 4LYHA 2H9HA 4X8OA 3ATKA 1Q0UA 2GK7A 1ZSJA 1DWEH 4HAXA 1O3YA 4UNNA 5ELXA 1NSTA 4TYQA 3ATWA 3ZVBA 4W9MC 1W0KD 2BMEA 2ZYWX 1NKTA 1LVBA 4NH0A 2BMDA 3HKJB 1GMCF 3UTUH 3NK8A 3BC1A 4IS5A 2Z43A 2F91A 1GNRA 1N2CE 4FU9A 4I99A 1AK2A 4HAVA 6ESTA 2VSXA 2PUXB 3K09A 2NPIA 2GA8A 1OIWA 1PLJA 3TW8B 1SHZA 2GHIA 2OT3B 3C5HA 1AO5A 4EPYA 3HPRA 3LJJA 3B9PA 3RS7A 5A8ZA 2ANCA 3ZVFA 3ZZ4A 2ZI4A 3GLIE 1S9DA 2HJVA 4AC9A 2G4TA 3DZ8A 2ZRJA 4LV6A 4PROA 3B85A 3BG4B 2NO9A 4TL8A 1KO8A 3H09A 1WQSA 4XOJA 2J87A 1H9HE 4Y79A 5GJWC 2C9CA 4C0LA 4P4TA 1HXEH 5J40A 3QLPH 2WWFA 5GPIB 2QI9C 1ZOMA 5A09A 2YC4C 1PYTD 2F9BH 1BIFA 2I3BA 2ZDLA 4C0AC 3AP2A 4HAYA 1OKKA 3U7HB 4IXMA 3DPUA 1YE8A 4ZDWA 2C8VA 1P10A 3VKGA 1ZMJA 4QHYA 1C5LH 1XFAA 4KLNA 3GLGE 1BO6A 1FZZA 3H4MA 2TGAA 2ZRCA 4CRBA 1XP8A 2IWHA 3GLGA 3NUMA 3PV5A 4AIIA 2IYYA 4Z54A 3R9WA 1V2VT 3BERA 2QP4A 1GKIA 5SZIA 5FOSA 4DKXA 3A83A 5FUYA 4DCDA 4OQFA 3UG7A 4AG6A 1BITA 3U7GA 1MTSA 1C2MA 4X1RU 3CR8A 1T4VH 2ZM5A 4Q9LA 3GLFA 4LJ7A 2QBYB 5DHFA 3P27A 4IC5A 4DLRA 4CHAB 1HIAB 4PQFA 1E2DA 3UIEA 3OAAA 1KAOA 4TL6A 5GJCA 4BUJA 5EXNA 2F9OA 6Q21A 1KLTA 2Z9IA 3P95A 4NYJQ 1ZD8A 2WVJA 1SQ5A 4B76A 1MBQA 1IBRA 3T1TA 1MTUA 5F9HA 1CGJE 2ZU3A 3F5FA 1NRQH 3JVUA 2QMHA 2WJYA 1ZC3A 4TYNA 3LFUA 2ZPRA 3AP3A 3K9GA 4IFBA 2FH5B 1N6RA 4LJ5A 4FCWA 2DWQA 1NO9H 1HAHH 4RFVA 5L3VA 3TK1A 5KOYA 3A4LA 1G7RA 3CNOA 1HAXB 1N6YA 3ZVNA 1Q3TA 1W7GH 4NSYA 4UNRA 4ISHH 4AYTA 3PO1C 5JBQA 4RN6A 2GBLA 1NJFA 4KLZA 1DAIA 2XXAB 1X3SA 2XZOA 2F9PA 2JETB 1QHHB 3E91A 2Z94A 1QGFA 3N7OA 4YLUA 3BB1A 3MJHA 2KAIB 1VGCC 5EE3A 1FAXA 2TGTA 2A5AA 2G4UA 3M0EA 1TBZH 1IN4A 2PWXA 3V0XA 1LV7A 2HPQH 2LPRA 5DP3A 4JKYA 3N70A 2OFXA 3SU2A 3NWUA 3SU3A 3ZQJA 2XW9A 2ZU2A 3F3YA 4XTCS 4WH6A 2C96A 5EP4A 1I2MA 2UUFB 5BRRE 3RAPR 2QU8A 3CX8A 4JLVA 2FI4E 1Y8TA 5HCNA 3RLWH 1YYY1 4G5SA 1HAVA 3FP8E 2ZJZA 1SGNE 4AB8A 1P6XA 1C1RA 3TUZC 3VHLB 4AG1A 1GHXH 4O2LA 2N46A 1THPB 1GG6C 3HU3A 2V3CC 1QJ7B 1WBBA 2OTVA 1HV8A 4D4KA 4CRAA 3PUVA 1G3CA 4FCVA 1ELBA 1CHGA 1NFYA 2VO1A 1TFXA 4M2LA 1K2I1 1EGAA 3WRXC 4URWR 1ETSH 1G18A 1PPBH 1QHYA 4YOGA 3RXDA 3MFYA 3HP1A 2VHUA 3CS0A 1JIMA 2AMQA 1P11E 1PJRA 3DD2H 2ATVA 3AVOA 3Q77A 1IN8A 2NG1A 3AAVA 3FVQA 1LQDB 4CH2B 1DELA 2ONKA 2BEJA 2IL1A 3W34A 1G30B 3QBTA 1OH5A 2ZYUX 2CLSA 1A0LA 4RD1A 4TQUS 2GVDC 4EFNA 1CEEA 2BY6X 1TPAE 2C8ZB 2FFHA 4YMVA 2FPZA 2VL7A 4RD2A 1HE1C 2ZITA 5L3SB 5KO2A 1DY9A 3QPUA 2TPIZ 2UWOA 2VP2A 3T5GA 1HA3A 4V03A 5FI0B 3M36A 5JRZA 4Q4HA 4LJ9A 2XBVA 3BD9A 5TARA 4XD7D 5LB2A 1PJPA 1S6HA 2ZJ5A 2OESA 3K65B 3K70B 2XB4A 1ELDE 3QUMP 3K0SA 1II8B 4CT5A 1A61H 3KB2A 1LB1B 4MRSA 1VG0B 4R8TB 1X8KA 5L8VA 4LZ4B 2ZTYA 3KQEA 5EJEA 2C03A 2W6JA 4JL8A 2FMXA 5EQQA 4A0RA 4Q7LA 2A5JA 1T9HA 2IYRA 3D7MA 3ASYA 3LVQE 4U02A 4DCVA 2QE7A 4BLQA 1GBJA 3LQRA 4K1EA 4G5OA 2WWIA 1LW7A 1B0FA 2ZDNA 1SXJD 2B8OH 3BTGE 1NG9A 2DCUA 4B3FX 2OQ5A 2ANWA 5EQTA 3PLBA 2H2ZA 3ADBA 1BRUP 1G2LA 1RKBA 1IJEA 1Z08A 3RC6A 2PX3A 4JSTA 4KTSA 5B6LA 4Q19A 1GNPA 3NDBB 1P04A 3QPWA 1ELGA 5FOWA 1YPKH 4NCNA 3DEFA 4FIDA 2F3CE 4R7ZA 4TYWA 2OBMA 2GWHA 4IDQA 2I6QA 1JPNA 3GQBA 4LBWA 1FY4A 4FWIB 2HXYA 1QBOA 3HJNA 4GDFA 3MYWA 5EPNA 3PEYA 5FUXA 3SN8A 3SV9A 1SXJB 4TMWA 1UKZA 3NG1A 2AKAB 2VWMA 1KXCA 2BBTA 1CF4A 2WPMS 4QT8C 4IOLA 3RXJA 1P01A 4UNPA 1BKDR 1T8NA 4DT1A 3WBJA 1C1PA 1NN3A 3FWYA 1C5WB 3MU8A 3SNCA 5CJ2A 1O3IA 2KAIA 2WPIS 2G6BA 1HJ9A 4OHZA 3STIA 1O2HA 1EZSC 2ZA5A 4HDCA 5D3QA 4Y0AA 1GBCA 2FOCA 1XMSA 5GJBA 3SJOA 4EAQA 5DP4A 2PR3A 3W8NA 5KUTA 1KDPA 4H9GA 1XEWX 1E9AA 1I4TD 1YPJH 3T25A 4K46A 3M7QA 1S5SA 1ELOA 2Q3MA 3L82B 4NA7A 1QRXA 1LHGH 7GCHG 3WY9A 4A6PA 1F0UA 5KDLA 3QIAA 3U6BA 4LJYA 5GWZA 1C5TA 2ANYA 1GBEA 3I1FA 3IEVA 1MKXH 1U9IC 1G20E 4EDHA 2DPXA 4FWTA 3MNSA 2Q6DA 4X1NU 4LHXA 2VIDA 5B6OA 2PJZA 3SZRA 1XTRA 3C1KA 3MMGA 3GICB 3TPIZ 3E1SA 3S69A 2ZHFH 3R3GB 2YVUA 4XSKU 1E3MA 5LPEA 3PWBA 1O35A 3HPQA 3T2NA 3AVVA 2JJ1D 1NF3A 2BLWA 4RCZA 1YQTA 3GY4A 1GRNA 2ZDAH 4C7OA 1L1GA 4XTRA 4NMMA 3CIOA 1KDQA 5EQRA 5JBBS 1SI5H 2W2TA 3T28A 3JZAA 5EXLA 2F9NA 1JXOA 1ZIPA 1O3KA 4IOMA 3WYGA 3FVFB 1YZKA 3LDAA 3QK1A 1S3SA 3KN2A 3RABA 3MAAC 3KUCA 1TU4A 3SNEA 2G9NA 3C7KA 1OP0A 2CCJA 4FUJA 5ESTE 1W36B 1E0FD 3U1IB 1TBQH 1D6JA 4RI0A 2Z5FA 4A4DA 4K69A 1HJAB 5FL7A 3THOA 1GL9B 3TSWA 4LSGA 2KBEA 4YT6H 5FBWB 3AVWA 1UBEA 2AYWA 3ZVEA 3PV0A 2IHBA 1AE8H 1TX6A 1EFRD 4UFDH 3TBKA 4HUQB 4C2UA 2AS9A 1II9A 1HIAA 1RXPA 1IQGA 4IDHA 4BOHA 1CJUC 1BMNH 3EPJA 1GG2A 1ZUIA 4C3ZA 4BAKB 1AN0A 1W4CA 5C5NA 1OWHA 1KHTA 4ZDKA 1MO6A 3AW0A 4NU0A 1OWKA 3NC1C 2JLQA 1VECA 3P8FA 4TLCA 1Y5AT 1B7XB 4QL3A 2BLVA 5HMAA 2ZRLA 2XOKD 4TQ9A 1WP9A 3UMFA 2BWJA 1S6FA 3ZVLA 1AU8A 3O47A 1N6NA 1E2MA 4OS5A 3D6TB 3CPHA 1CR1A 1OXGA 4BFYA 3MH4A 2J0VA 1KSFX 3F68H 1Z0KA 4DHEA 3CENA 4B6FA 4DSNA 1C2LA 3OEHD 2ZWLH 3IPYA 5C4GB 3PJRA 3FZDA 2O8TA 3TIFA 1H8DH 2VHCA 3V3MA 2ZEJA 4OQXA 2UUJB 1H65A 1Z6GA 4UXIA 2OSBA 2F9MA 2H9EH 3MRSA 3Q85A 4Y76A 4A7IB 2XXLA 2W6JD 1RFLA 2GCHF 3QEOA 3OFND 4YMTA 1BBRK 3TMKA 2H17A 1BTPA 1ZC4A 1GMDF 1X1RA 2R44A 4BFVA 3G0HA 1CHOG 4OI1A 4TPIZ 3I72A 1SLXB 5H4IB 1M2OB 2ZU4A 1CP2A 1E2HA 3AVZA 1S0UA 1I2DA 3TGKE 1EB1H 2P5TB 4AKEA 2BQ7B 1HBTH 4JK6A 4XE4A 4F93B 2HPPH 1TEVA 3X1YA 2BDHA 4IDOA 1ZTLA 1DXPA 4V02A 4PHHA 3OIUA 1NG1A 1FZQA 4DOQA 3RC8A 1ESAA 1Q31A 3VR1A 4DDUA 2ZJYA 4QBIA 2HV8A 1TGBA 3MJRA 1P7CA 1KI4A 1V5WA 3E8LA 3FFAA 2RHDA 3A80A 3QEJA 4R98A 3VKHA 1GBDA 5BN3A 4RD6A 1RRGA 1L1NA 4N1AA 5E8EH 2ZRAA 3A85A 3SI3H 4Z8XA 2AWNA 4K1SA 3EYDA 1XPUA 5KSPA 1HNEE 5E2PA 4U30A 2ZFFH 2HRVA 3CM0A 1FTSA 4ZCIA 2BXTH 1C1SA 5GVSA 3RMNH 1DAHA 1YPHC 2YWEA 2ZRFA 1BOQA 2J9NA 2J7PA 3QKSA 1P2VA 3BH7A 2Y7ZA 3JVVA 2RDLA 5TDHA 4YONB 1TQ7B 2IS6A 2CHAC 1W36C 5EXMA 2Y6TA 3GJ6A 3BTDE 3B2EA 1N5IA 1NVXQ 4KYIB 2P5SA 1TRYA 3GOVB 4A1TA 4UE7H 3ZYDA 2C9OA 1UEJA 2HNTF 1E99A 2RA0A 5I25A 1G3BA 5J4SA 1SVSA 1N5KA 1EFUA 3GY7A 4DEYA 3THYB 1P06A 2FM2A 2AMDA 2Z83A 4M9ZA 4B43A 4BE7B 4MDFA 1BRBE 1FY1A 3BRWD 1TUIA 3KQHA 2J3EA 4B1TA 3KQDA 3PLKA 1HAPH 4Y0ZE 3RXBA 3L33A 4US0R 1ZU5A 3A7WA 1KI9A 2QIQA 1GJAB 2G83A 3RXFA 2PFEA 4ZCLA 3LGIA 4HTCH 3CO5A 2QGRA 4ESVA 3HDTA 2FTLE 3B8JA 4I81A 3GISB 5KNBA 1JWTA 4C0KA 4JCNA 1MRNA 1G8FA 4B3BA 4NL4H 1GI5A 1SVWA 4D80A 1GDUA 1TONA 8OHMA 2H9TH 3GLHA 4BQSA 3D3QA 3WNDA 4P4SA 5GXPA 3MUFA 3UKDA 1KYNA 3QVUA 3GLHE 1EFTA 4X0WU 4ARZA 5FOUA 1BYUA 4GAWA 3QKSB 4B34A 4JLAA 5G41A 1AGRA 1GKYA 4ZH8A 4KVGA 3MCAA 3A87A 1O3PB 1ZGIA 1VG8A 2GDDA 2XTTB 3A8DA 1FMJA 3OY5U 3LRPA 4L8GA 1KI6A 2O8UA 2JETC 1R6BX 2XNDD 2GP9B 1N6LA 2FSFA 1V6DA 5E0JA 2PL3A 2R9PA 3RWOA 1KO1A 1SVPA 2PJRA 2Z9GA 1L2TA 1O39A 4BGDA 3K6ZA 1F5LA 1SOTA 4KFSA 5C5OA 1PLKA 4DDVA 4S2EA 3PUXA 1PZNA 1UAAA 1ZRBA 3AKYA 3TW4A 2OAP1 1CJTC 3KNXA 2FDCA 3QOFA 1AB9B 721PA 1WXQA 2XBXA 1VCIA 1E9BA 1OF1A 1YPEH 1DUAA 4Z8YA 2P93A 3O8RA 3PTBA 1OHHA 2G1KA 1U94A 3SU6A 1C5XB 1SBWA 4MKHA 4OYHA 1XWIA 1TF2A 3KKNA 2QMEA 3H86A 4J1YA 1WQ1R 2GZ8A 4ZHLU 2RGGA 1ARBA 3OEED 1UTJA 1BZXE 1SXJE 3EWAA 5C1XA 2L0XA 1DE7H 4BNRA 4FUGA 1ZMLA 1N6IA 1NNEA 1P61B 4X8TH 4WA7A 2GZHA 2D4HA 3QF4A 4B6EA 1S83A 4H6TA 3SJ8A 3RP2A 2QN6A 1F2TA 1EPTA 1VYTA 1R0ZA 4X6MA 2ZI7A 5FXLA 3RS2A 3RS3A 1UVUH 5G4BA 1IY1A 2FJUA 1DEKA 4HB3A 3ZGXA 1F2TB 1TMKA 3W6OA 5CYOA 1QURH 4KELA 3BTWE 1BMFA 2BX3A 1FW6A 2ZU5A 1AS0A 1HT1E 4CEHA 4CBOA 1TTTA 1E2FA 1ZMNA 5FCRA 1EZUC 1AHTH 3QBVA 1MZAA 1WE2A 1WA5A 1UCYE 4R2HA 3GDUA 3NVAA 1N5JA 3A1TA 4EFMA 5J4KA 2A9KA 2A7QA 2RGDA 1XTKA 3PITA 2GJ9A 3ADDA 2RG3A 2BD7A 3G01A 2CHAB 2JLYA 3GY6A 2IBMA 3CX7A 3RRYA 1SOZA 5KNDA 1TQ6A 1F0RA 1BUIA 2STBE 1II0A 5TCAA 1ZMXA 3IUYA 1GI6A 1YJ5A 2IPHA 4K60A 2CNWD 4B3XA 2VJ1A 4QBHA 1OHHD 3UG6A 2R8RA 2PT5A 1G7TA 3KUDA 3A7VA 1F3OA 2PBRA 1G6OA 4NKRA 2TGDA 1DOAA 4C4PA 4ZUHA 4Q48A 3Q3JB 2GRJA 2D3WA 1F2UA 4UFEH 3E3TA 2JCSA 3GMTA 5EP2A 3PEUA 4M21A 1GFIA 1P9UA 3SNAA 1ONBA 3QGJA 3IIJA 1XKAC 4GHTA 1XXFA 3MU5A 2EYUA 1IHSH 5LPRA 1T8TA 5FBRB 1MD8A 2REBA 1IXRC 1IQKA 4FW9A 1YZGA 1KXDA 5F2EA 3SFZA 1J90A 9ESTA 1RGQA 3KJGA 4A6LA 4CREA 5KDOA 1HAOH 5GNDA 3B6EA 1VZQH 1US8A 3ASZA 3URDA 2P6RA 3QVVA 3ZQ6A 1G36A 1QRAA 1SG8B 1CT2E 5AUOB 1UJ1A 3BK7A 1MAXA 3EDXB 3PR1A 1GGDC 2C99A 3LOXA 1GMCG 1A4RA 3R8CA 1C4Y2 3RMLH 4LUCA 1P2MA 1Q3XA 2BDBA 2QPAA 3RS0A 5EE0A 2W7UA 1KZGB 3RRNA 4CIDA 4H1UA 2GF0A 1CGHA 1V2QT 2HJGA 3NH9A 1YZNA 3GY5A 2J38A 3KTAB 4D6PA 1R5OA 1P72A 1E9CA 4SGAE 2HCBA 2K1QA 3Q3KA 2J59A 1HCGA 1OB2A 3F1SB 1P3CA 3T1OA 4FUIA 4XBBA 4AZ2B 4XVQA 1GBBA 1EQ9A 1BBRE 3RXTA 3M4YA 2NMVA 3LV8A 3KKMA 1C1MA 4AN7A 3NZIA 1X1SA 3LWNA 1WUNH 2F1RA 4Q1AA 4Q66C 4X1SU 3TK6A 2HXSA 1G3EA 2ONJA 5DP8A 4BFUA 1Z22A 4G01B 3OE7D 1D4PB 4IEEA 4RKFA 3UQVA 3G82C 1GJBB 2V6JA 4UJ3A 4NCKA 1V2MT 1L4YA 3DM9B 3TQCA 3KTAA 3E2IA 1RPZA 3FPAA 2ZGHA 1Q1ZA 2R3UA 2ZRKA 3M5OA 3K70D 2THFB 3BIFA 1YR6A 2B7CA 5HCIA 2AXPA 3ZZ3A 2EFCB 3OIWA 4HZUA 2WZQA 2Q6TA 3PUWA 4BTTB 1H4WA 3OESA 2EYQA 1ZM3A 1WDTA 5C46F 3S1AB 3X1DA 4DC9A 1NY6A 2CJWB 4FUFA 1N8OB 3NBYC 1KMHB 1SGYE 1ZNWA 1W7XH 2XNDA 2W0MA 4JSYA 2PEYA 4P33A 1BMAA 5J4HA 4D81A 1O31A 3RXRA 3T06B 1XUIA 1MCTA 1GBTA 3OAAD 4EUNA 1C1YA 5DO9A 5DGXA 2IS2A 5EW2H 3WMGA 3SQXA 3FTQA 3V7TA 2DFKB 2ZRMA 4A5TS 4QOSA 2WOJA 5EG4A 4D9QA 2B8TA 2WPJS 4Q4JA 3SUEA 1DAFA 3BTQE 2XCNA 2Z6BD 3VX3A 4EFLA 1VMAA 3LY5A 3ODFA 3V00A 2IS1A 4W7SA 1H8IH 2DWOA 2J0QA 1ELFA 2EU8A 2BVNA 4K3JA 3U69H 7LPRA 1SLWB 1MT0A 3CKLA 2P3UB 1E1RD 3B1XA 1Y5UT 4BXSA 1OPXA 5FR1A 2FO9A 1QHHA 3A6PC 1HXFH 6CHAC 4FD2A 1K1OA 1O2IA 2D2FA 4QGAA 3SORA 2PCLA 2H92A 1SVKA 3A86A 1KI8A 4A1FA 1J7KA 2XTMA 2QF3A 4FUCA 4GP6A 3GJ0A 2GX4A 2C3SA 1TRNA 2XTZA 1KI3A 4MPWA 3MO6A 1TMUH 1SKYE 5JZVA 3AF1A 3OX7U 1K9OE 2Z9JA 1CRQA 2AGEX 3GDSA 1JI0A 1E2JA 3U61B 1HAYB 2CHQA 5BN5A 1O30A 5HM9A 1CR2A 3IO5A 5DP5A 2W3KA 1AY6H 3T62A 2O8DA 5DH9A 1ETUA 3K53A 2AK2A 1DPFA 5H1YA 1RTKA 1RJ9B 1SQTA 2B0FA 1HAVB 3QKTA 1ODFA 1HH4A 1R10A 3WBKA 2ZECA 3U4QA 2KI5A 3TAHA 3TU7H 3T1VA 2J4IA 2ZU1A 4RFSA 4MKIA 2P59A 4KTCA 2HUPA 3AF0A 2LNCA 4OS1A 3UNRA 4RZ3A 1OXVA 1XZQA 3A88A 4P4SB 4Z1MD 2LCFA 1EAXA 3K9XB 4GOKA 4HDQB 2PSXA 6CHAB 4LJ6A 1OH8A 1IXZA 2GKSA 3SJIA 3BWDD 3S9AA 1GI9B 9LPRA 1GHBF 1JMOH 1EZXC 5T6FA 3DHKH 2WJHA 1Z7KA 1W0ZU 4ABDA 4PQYA 4B35A 4G3XA 3IIMA 4FMBB 2O8LA 4BZQA 2WAXA 2ZJ2A 4XDEA 1EUFA 1P75A 4QGGA 2SGFE 2CDNA 4LOYH 2YJTD 1N1LA 4C7OB 1OYQA 1TBRH 1LNZA 2C78A 2NO1A 1E36B 3Q72A 1QRWA 4A8JA 2V7QD 2ZR9A 3TGIE 1QHRB 2ZR0A 2NU2E 2AXNA 4WAUA 4I1SA 1V2PT 3S7KB 3CR7A 1UEIA 3CH4B 4JS0A 1EP6A 2BVSH 1O3CA 2UVQA 3EZFA 3PYHA 2G51A 1EG7A 1P2UA 2WUBA 1D3QB 2Z9LA 5C1UA 4Q7YA 1J2JA 1QHSA 1RS0A 3J81k 4ZIRB 3RDZA 1XJQA 4Q7KA 4URYR 1G41A 1FX0B 3CBQA 2JIZA 1K1PA 1O2ZA 2Q1JA 1E9EA 4I7YH 3FMOB 4AKHA 2VP6A 2WUCA 2FIRH 3CP7A 3ENSB 3MH6A 5AFZH 4B2BA 3FP6E 1NVVQ 4ASHA 2FS9A 4PANA 1A5HA 4IN2A 4OHWA 4V0MA 1YPLH 4VGCC 1N6KA 1M1YE 4IVPA 1GVLA 2JH0D 2P3TB 2VHQA 3M35A 4AD8A 4PHGA 4F7WA 3TK5A 5AJYA 3PM3A 4TTPA 4EJSA 1MKWK 2GKVE 5HM2A 2Q21A 1ZD1A 1HQCA 3IEUA 3HR8A 4A1XA 3THYA 1S0RA 1P9SA 1NKSA 3RXPA 1O2RA 1C5SA 4JYBA 1P2OA 2FEQH 1JOUB 1Z0IA 3OHMA 1ABJH 3C41J 1HDTH 3B82A 2SFAA 5AUNB 2JJ8A 4IKEA 1PYTC 1ESTA 2FFQA 3SU1A 2GV6A 4DCTA 3RU4D 4JLOA 3PEVA 1HFDA 1QL9A 2DWPA 1BA8B 4Q00A 2OFOA 2G5VA 4JZDH 1K1MA 2BY5X 1SGPE 3WMEA 3VU9B 2FODA 5GDSH 3Q3YA 4B3DA 2AFHE 1KZ7B 1Z6XA 3ATMA 4YTAA 1CJVC 3FFGA 1GJDB 4JVSB 2CNWA 5KNCA 3SGBE 2O0HA 4WW0A 2C4FH 3C4JA 3M7UA 3I73A 1KK1A 3ZZCA 4BAQB 1DBSA 1AZSC 1GG6B 5JHGB 5DIFA 4CEIA 4RY2A 2DBYA 2C04A 2MSDB 3AGQA 1COWA 1W47A 4Q7ZA 3TKLA 3C14C 2A3RA 4H4FA 4FCTA 1PPCE 3GFPA 1A2KC 3LXRA 4RD4A 1G3UA 1E69A 4WY3A 1XXHB 4KVAA 1EAWA 4X8HA 1F0SA 4F92B 2WINI 4R71A 2G88A 4BFTA 2Y81A 4JZ1A 4US2R 2B5TB 1UBGA 1C2JA 1TNHA 1NRNH 2YV5A 1O2OA 4NA8A 3LA6A 2VVCA 1AQYA 1YRBA 1O3BA 3GLIB 3SYJA 1NVWQ 4EQ6B 2OEPA 2FLRH 2QG6A 4KFRA 1L0ZA 3AAUA 3P1JA 1LTOA 5K8UA 3BEIB 2GD4B 1CO7E 3P6ZB 1XMVA 1LVMA 5B30A 2GCOB 3EPLA 2ZANA 5EPYA 1YRAA 4R0IA 2V54A 4WMDA 2JLVA 2ZQ1A 5LD2C 1TNGA 4N0DA 5DKMA 1GI3A 1TOCB 3ICEA 2ZUBA 3ZDQA 1XM1A 4YDHB 1Z3IX 1O3FA 2QMOA 2BCJQ 4Q4AA 4ZI3A 2OC1A 2ZFQH 3U4QB 1Z8FA 1YCPM 5JEDA 3HATH 1UBCA 3ZH9B 1XMJA 1LHEH 2WSSD 1EB2A 4Q02A 3ATLA 1V2UT 5JECA 3AF3A 3VHXA 3SR0A 1NJGA 1JQLB 5JHHB 4DIIH 3UWOA 1V2RT 1HAZB 2Q9BA 2TIOA 3A4MA 4AI6A 2QAJA 5E0HA 1V3XA 3ZS8A 4Q1BA 1V2LT 1FIZA 1N6XA 1SHKA 1Z47A 5GADl 2C2HA 2OE2A 3NH6A 1Z0DA 4MNXA 1O37A 4WMFA 2WPDD 1EKBB 3VFDA 4M1KA 4WOPA 3SE0A 4ABJA 3L8YA 3OTJE 3ONWA 4OK5A 3MNCA 5D3MB 3TRFA 2C8WB 1ZIOA 3K8YA 1LHDH 3SN6A 1M9UA 1ZVQA 4ZDJA 2V3OH 3UIRA 1BQYA 1NU9A 2ZRPA 2AEIH 1T8OA 4RSGA 4QJ5A 4U00A 5CK4A 2BB4A 4DB4A 1AIPA 1H9IE 2GZAA 4ZAEA 2B7BA 1ABIH 4HLCA 2O9QA 1OXUA 1PPZA 1W0KA 1C5QA 2FPKA 4X8LA 3DDCA 2XWBI 4PAOA 1GBKA 2Z9KA 2V8OA 1TUEA 1NLYA 2ASEA 3AEZA 3L0IB 3T12A 1J99A 2XAUA 1D3TB 3Q9LA 1Q1EA 4A2PA 1MCVA 4AB9A 3SUDA 3QI2A 4X8SH 3TLOA 2XX3A 2IXFA 2IOTA 4E07A 1EWRA 2GK6A 5FH9A 3AVTA 5FUWA 1ZHRA 1A2BA 2O8BA 5GIBA 2W5EA 1AGJA 1OLOA 2IYSA 2YOHA 1TWXB 4JJKA 2ZTSA 2BV3A 5FX5A 1XF9A 3B1ZA 1MO3A 1KDQB 1NFXA 2A45B 2N42A 2ZVQX 2FWWA 1YBWA 2PSYA 2PKSB 2C9YA 2VRWA 1FUKA 4LC0A 1OWJA 3FAOA 1SGCA 2IS4A 2SGDE 3E90B 3ZLJA 2ALPA 4Y8ZA 1G291 4TT3D 2QRNA 3GY2A 1C1OA 3SQEE 5GCHG 3PROA 4RCYA 3UPUA 1T8MA 1F92A 3X1WA 1Z8GA 5JBAS 2QYIA 4ABAA 2BD2A 1YR7A 2A5IA 2ZKSA 1CS4C 1RW4A 1UTOA 4MVNA 4HLQB 2J2UA 5DP6A 1N6HA 1S1MA 4C0QC 2GT7A 2XNIA 4A2WA 2FLBH 4RZXA 2PZGA 4AG2A 4RJLA 1UKYA 2R62A 1G7CA 2QAGA 1OX1A 2GJSA 2GCTC 1OP8A 4CR9A 4MITA 1U6QA 3VR6A 2AGIX 2ZAMA 2ERXA 1NESE 2WYGA 2F9UA 1A7SA 3I4LA 5GJVC 2H57A 5K8LA 1ZPCA 4O0MA 4THNH 3CF2A 2IUUA 5JYIA 1K1IA 1TL7C 2GCHG 1G8HA 5PTPA 4DLVA 4LRWA 1N0UA 4A0FA 3IIKA 3TQFA 2QXHA 1XTQA 1GI1A 2AIQA 2JKHA 3RM2H 1GI8B 1G1MA 1ZAKA 1GWAA 1G3DA 2IYTA 1FPHH 1JR3D 2BIFA 4IGDA 4D4JA 4ZXYH 1TE0A 3RXQA 4DURA 1N3BA 2V3HH 1TAGA 4Z0KA 4TL7A 4GLYA 2CEAA 1NY22 3BOSA 1XU4A 1SVLA 4MQBA 3TJVA 3G5UA 5ANRB 4I8LA 1U8ZA 1WF3A 2R0KA 2ESTE 4JMYA 2OD3B 3H0KA 2VP9A 5LBIA 2OXRA 4D9RA 2O8MA 3DVLA 2FOLA 4KSBA 2GV7A 3BTEE 3B1YA 4OJKA 1ZNZA 4TZ0A 5EQSA 2QNRA 2GT8A 2IK8A 2ZSAA 4A82A 1C1WH 1EFCA 3KCGH 1TLDA 4FUBA 2R6FA 3A7XA 4JVLA 3QF4B 2AIPA 5IK2A 1KJWA 2A2QH 1QJ1B 2A4RA 5J4VA 2KE5A 1KO4A 4PXAA 1E94E 2F43B 1GHWH 1FJSA 4YQFA 4BWYA 3AV0B 4XVRA 2OUKA 1DUEA 1M6NA 5FPHA 2WJGA 5TVKA 1MO4A 2ZR7A 1NMXA 2E87A 3CF0A 1CU1A 5J4LA 4FU8A 5FPTA 4B2AA 4CEIB 2OV2A 1MMJN 2IF0A 5A0FA 2UUKB 3ZZTA 2ZYTX 3B9QA 4CYMA 2X8AA 3T29A 2XRCA 4AWXA 2C8YB 1W4BA 3IKJA 2ZRGA 4YLQH 4L16A 3UOPA 4BFSA 1BHXB 5LH8A 1TMBH 3O8DA 4B74A 2GJAA 3U9AH 3CPJB 1MKWH 3Q5EA 1IN6A 4BFXA 1N5LA 2ORIA 3P8OA 1CJMA 1H8EA 1Q2WA 1MKYA 1R0WA 5JBTA 1KK3A 1PUJA 3VGCC 4BECA 2OUAA 1W13U 2E1RA 5HXFA 1XPRA 3D8BA 2D7CA 1KLIH 4DLZA 1W2GA 2CLDX 4DUGD 2NU0E 1CJKC 1VCNA 3GFOA 5BPEA 2NU4E 1C4V2 1GGDB 2SGAA 3CZQA 1G8YA 2A31A 3TNFA 1ZM4A 2NU1E 1OSSA 3A8TA 1Z1JA 4PPQA 1G3IA 1EXMA 3H5CB 3TH3H 3BEUA 5C1YA 4DXAA 5EOKA 5JI3E 3V9PA 1O2KA 4E09A 1VYUA 3ZZUA 3FDIA 1E9SA 2FOHA 5FOVA 1O5FH 1A1RA 7GCHF 1LTQA 4GHQA 3SU0A 3OYPA 1ANBA 5EODA 4AOQA 2V35A 1YZLA 1DICA 4BLSA 4MRPA 1P8VC 1O32A 1DM4B 1GL7A 2J7PD 4XSGA 1RYHA 3RXEA 1Q12A 4HUTA 3LW7A 5F8XA 1TRMA 4KSCA 3BEFB 2CCKA 1MABB 1UTQA 1WSSH 2HGTH 3HGPA 4PC1A 4D26A 3AB3A 2BLOA 2VF8A 5L3SA 1KNXA 2O8EA 1JR6A 1EASA 1DTSA 3NBXX 2VH5R 3EQ0H 1IAQA 3AM1A 1SGFA 1T8LA 1GHVH 2KSQA 3QZRA 4NYIR 1XTJA 4OI0A 2CV3A 4LY6A 1FY5A 1TQ2A 2EI6A 4OQLA 2HCJB 4MDSA 3RWMB 1AKSA 1THSH 5JJIA 3NHAA 1Y3AA 5HYOA 1GSIA 1DLEA 1NBMD 3NPSA 1TQ4A 5EE1A 3WNBA 4ASUD 1LY1A 1RIFA 1G8GA 2JJ2A 4URZR 1Z2AA 1EPTC 3UNQA 4AKGA 4QXAA 4DLWA 3P26A 1A7JA 4HLUA 1KJYA 4CT4B 3IDQA 3RXCA 4PPNA 5C2ZA 4ZDIA 1KK2A 3EAQA 2X1VA 2D26C 5A2MH 3P4YA 1O5BB 2H18A 2TBSA 1CSOE 4IJMA 5FUVA 1WAYB 1IY2A 3KKQA 2QMUA 3BAFA 3R0FA 3BG4C 1KTSB 5AUQA 2DYKA 2BM1A 3L0OA 2ZGBH 5E4FA 2VINA 1D2MA 2FU5C 3SS8A 1NL3A 2ASUB 2R2AA 4CEJB 1CQQA 5DI3B 4NFFA 4RKEA 2JJ2D 1KIGH 2CF9H 3LBHA 2FEMA 4IFEA 2XBWA 4DRZA 3CUEF 3BBPA 1B5GH 1E2KA 3ZZ6A 2KWIA 2JLUA 4M1YA 2IT1A 3LGTA 2AHOA 2XITA 1DO2A 2DE8A 1BBRH 1GHZA 1P57B 5HTKA 2Y7XA 4I1OA 4ABIA 1RVDA 1FLEE 4EPXA 4CF7A 2IN2A 3QO6A 5K8TA 4I33A 1E2EA 2QT1A 4TMVA 1D2EA 3QDZB 1VJAU 2D06A 3SEAA 1FNIA 2AKYA 1CTQA 1YZUA 1CA0B 4GZMA 5KU1A 3A1SA 3F0TA 1DX5M 1BCUH 3ZV8A 2ZU0C 3EA7A 4PSKA 1U2RA 4GSYA 2Y82A 5IDKA 4YMWA 2QY0B 2WICA 1YP9A 4IOJA 4IW4E 1S81A 4F38A 5FTLA 2VBCA 4MG3A 1O38A 3CRW1 3NXPA 4BFZA 1COWD 1W0YH 4IDNA 4C0SA 1XMIA 2XZPA 3KKPA 1KYIA 4NIXA 2ALVA 4I8HA 4DCNA 1AFQB 1DAMA 3M37A 3C27B 1QY6A 3VX4A 4U7DA 4HFPB 4GMXA 1CA0C 4ABBA 1BOFA 2IXGA 5FL7D 2GGVB 3QTVH 4MYHA 1KTTB 2GZ9A 3WNCA 2GILA 4ISIH 3D23A 4YXWA 4DW2U 3ZZBA 1T91A 4WZAE 4QFMA 3STJA 5FHTA 1XVMA 2ZE7A 3Q8XB 4ZKOU 2VVUA 2SNWA 5E2OA 1AE5A 5C20A 3HWSA 1DSTA 1C2FA 1JIRA 2VGCC 3K9NA 3VMFA 5FX6A 5JWRA 4HSEA 1FOEB 2ZGCA 3CZPA 2H1LA 3A37A 4OQNA 4K2YA 5C3NA 1TF7A 2QY9A 5T3HA 1QL8A 2RB4A 4V0OA 4P4UA 3TGJE 3FFBA 1Q22A 3THXA 4GUXA 1UFQA 1S1CA 1S8FA 2O0KA 3NDPA 3BB3A 1Q21A 1C5YB 3ODDA 4QG7A 2W3IA 1MQ6A 1XXHA 4BANB 4IVRA 1A3BH 3RRMA 1UBFA 4MA4A 1O36A 1IQHA 5SZJA 1MTVA 3LLMA 2SGEE 1TU3A 3LH3A 5CK5A 1TMTH 1P9NA 2ZF0H 3RHFA 4FXPA 3S9BA 1ZUHA 4IHQA 1P12E 1XBTA 2J94A 421PA 2I1QA 4LYFA 2MSCB 1OYTH 1OWEA 2G3YA 2P67A 4Q1EA 4CR5A 1OOKB 3RLFA 5JJKA 2ZROA 4NCHA 3EA9A 4HZHA 4PR0A 2VTKA 2JA1A 1ELCA 1WV7H 4BEBA 3UR9A 1QBKC 1MU6B 4I1VA 2A5FA 2B7DH 2CF8H 2GCPA 2ZS8A 821PA 4JZIA 1YF4A 1LF5A 3Q5DA 1P02A 4FUHA 1JR3A 1ZM2A 1XD8A 3PUYA 3UMRA 1VR1H 3SHCH 1ETRH 3SGQE 1XVOA 4MNYA 1XEXB 3SBDA 1SGEE 4RVCA 5ABWA 2JDID 4AFQA 2FSIA 5DN6A 4JLDA 1QG4A 2PT7A 3ETLA 3OEHA 3OIVA 3LIWA 1FP7A 4LHYA 3WRYC 3A84A 1T8UA 1G37A 3LONA 4JVMA 5J5CA 1I4LD 2ZIAA 1BTHH 2JLSA 2IW3A 5FAHA 3EA5A 1D3DB 2CE2X 2CBZA 1YCPK 4BAOB 1QB1A 4N3NA 1KXBA 4LDJA 3IQWA 2VIQA 1B23P 5CJPA 4Q1FA 1RRFA 1AWHB 1HT2E 4GOXA 1AIXH 4PC3A 5AF9H 5J4YA 3UWIA 5TB5A 5JPMH 4W5JA 4Q4AB 3GCNA 3ND9A 4E7NA 4QGHA 3TK9A 1V2JT 3RC3A 1E4YA 2CGAA 5AK0A 1P0SH 3DT0H 3X1ZA 3Q3XA 2ZDVH 4WXRA 1KDTA 2BQ6B 5CDFE 3R7WB 1T0HB 1KSHA 1WOFA 4TWWA 1R4AA 2LKCA 4RZUA 1SZPA 1ZZZA 4PZYA 2KB0A 2P65A 2QT0A 2HVXA 2Y5HA 5FOXA 5JBCS 3KJEA 1MQ5A 3BTTE 3SU4A 4OBEA 5LDDC 4ZXXH 2JLWA 4Q4LA 2JLZA 2Z3CA 1QVAA 1QDEA 5ESBA 1YLCA 2BOVA 4IXNA 3B8HA 4G5RA 4VGCB 5AJXA 1IONA 1G2MA 3GEIA 5P21A 4IMZA 1XUJA 4UXJA 1C5ZB 3RANA 1Z1IA 4DSUA 3REGA 1GHAG 3QUSA 1SL3A 1C2EA 4M1MA 5DPAA 1JRSA 1TOMH 1E35B 4TY7A 1GVKB 5L3QB 2CMYA 4GVUA 4YMUA 4UNQA 4CRCA 521PA 4FMDF 4NP6A 2B21A 3B5JA 4B73A 4K81B 4OS2A 3VR5A 1SFQB 3ZVRA 1DT2A 2BHGA 4QM7A 2J45A 1NIPA 8GCHF 6LPRA 1PQAA 4NCYA 1W2HA 3K9LA 4V0ME 1LPGB 5EW1H 1G3RA 3W8RA 3T5FH 1L4ZA 2ZFRH 1AVWA 1Z8RA 1EPTB 1IHUA 2CJIA 3E1XB 3GCGA 4QJ3A 1QFKH 4Q9KA 3IBGA 1WTHD 4AGKA 1K5GA 1D8TA 3AKDA 3PUZA 3BB4A 1YR9A 1KKLA 5DSZA 2F3TA 1XEFA 2DE9A 4ZCMA 3H84A 2GVFA 1HB0B 2HF8A 4GT1A 4BLOA 1TA6A 4LCBA 4NYMQ 1AB9C 2QROA 1AZ8A 3BF6H 1UF9A 2F3RA 3B7GA 4RFSB 1P2NA 3CW2A 3SBKA 3UATA 4D82A 1NP6A 2V6NA 5C1BA 1EP5A 1J70A 1OKXA 4XIGS 3P20A 3UY9A 2BD5A 1UTKA 4BLPA 1ZGVA 2A5GA 1LFDB 1C5UA 4MYTA 2IYZA 2F9VA 4M9FA 1MD7A 3SFVA 2ZQ5A 2CL0X 5HPYB 3SZEA 4DLTA 3ADCA 3AVUA 1PPGE 4L4UA 2BY9X 1BMMH 2BBSA 5LPFA 1X6VA 2V1UA 3PWCA 1O5CB 3SYNA 2ECKA 3K9HA 2G52A 1TGNA 3GLHB 1T6NA 4INHA 1M74A 2ZJBA 2ZVPX 4JLBA 3IQXA 1W8BH 4GP7A 3D62A 4TWYA 4DLUA 4F4JA 2Q9AA 1C4U2 2NOAA 3H7OA 3PV4A 2PLFA 3E5HA 1XKBC 4DDTA 1G7SA 4IOKA 1G21E 3VFEA 4AG5A 2EC9H 2WHXA 2VU8E 5A4JA 1PFXC 1S2MA 7KMEH 2VPPA 4K1TA 4LX0A 4I1UA 3EAJA 2UWPA 3UWKA 1K5DA 4CGZA 4SGBE 1QQUA 1NPMA 1UVOA 5T6DA 1GM5A 2PH1A 1XUGA 2WWWA 1C5RA 3U7FB 1FQKA 3QXSA 1ZHPA 2P8OC 4NIYA 3KQUA 5A0BA 3RXUA 2VP4A 1R0XA 3RLYH 2ULLA 4QKQA 2FX3A 2GCNA 2ZTXA 1HJ8A 2A5KA 1GCDA 2IWRA 2VIPA 3VQTA 2VHJA 1H8ED 3TJUA 3MFJA 1P05A 3VPKA 5JLJA 3NKKA 3I5YA 4JMPA 1ZRHA 1OXTA 1XRJA 4IRUB 5DN6D 4HAZA 3VXFH 4MLFB 1U98A 2QAGC 4NSVA 1VCOA 4TT3A 1PPEE 1VTKA 1E79A 1HAIH 1LPKB 2V7QA 4M22A 2OCPA 1VDZA 4IBLH 2ZJAA 3LBIA 3A58B 3E6PH 3PVSA 4WZ6A 3RS4A 1GBIA 3T35A 2G77B 5E7MA 2R6DA 3CWQA 3GPLA 2WTUA 2FV8A 4DEXA 1XCPA 2FX6A 5K7RA 3LH5A 4Y0YE 2YNAA 2RCNA 1A5TA 2J46A 1EFHA 4PPGA 3OIYA 3B9FH 4O3TA 2ZPSA 4JT4A 3KXIA 1GI4A 1KGDA 4P3YA 3F9EA 4WXPA 5JCPA 5IDVA 1U0JA 3TE6A 3K09C 4LK2A 2ZHQH 2R6GA 1YM0A 1TGTA 7ESTE 2BMFA 1XB2A 4AYVB 4WVFA 4PSVA 5CHAC 3S0NA 2DHRA 1HYQA 2CK3A 3GY3A 2ZI6A 1ZPZA 4NTZA 4C0HA 2BDCA 4A6XA 1A4WH 2J41A 3K0AA 4YDSA 5KTYA 4L9WA 4B75A 1Z6TA 1JJVA 2FNAA 5EUQB 2EVWX 1SKQA 3A7TA 1EJAA 3HKIB 4URVR 2W00A 621PA 2CCGA 1SHYA 1A82A 1MH0A 3NIBA 1YC0A 3GDVA 2VQSA 2F4LA 3GCOA 3EC1A 1S96A 4PTLA 3GP8A 2PZEA 1SGFG 4Y8YA 5FBEA 2A7CA 2QRZA 3HGNA 1TNDA 3OF5A 2PV9B 4YMSA 2ZSDA 4XWKA 2F1HA 4Q9HA 5CM9C 3KHVA 2ODEA 2QP9X 1G32B 3WHLA 4QNRA 1RC8A 1CRPA 3QY0A 2G0TA 1GJ7B 3FANA 4C30A 2QGZA 4ABEA 1E0KA 4OL0A 4KBGA 2KBFA 4MUBA 4EPWA 1C1UH 4AFSA 2LWIA 4DIDA 1RTLA 2NU3E 2JH5D 1E2GA 2EFEB 2GJ8A 1PVOA 1FNNA 2GCTB 1UMAH 2IUTA 1VCPA 3NTUA 3EZ7A 4YOIA 3AUYA 1C1QA 3GCTG 4CRFA 2I4IA 1EFRA 4NHOA 1E37B 2RGBA 1UCYH 4DIHH 1ELTA 3PG5A 1L2EA 4Y0VA 1GILA 1IHTH 2UWLA 2CL7X 2ZGJA 4WJG2 4KKDA 3LXXA 2Q9CA 4LGMA 1O33A 4GCHF 1C5NH 1KDOA 2BEKA 3KEEA 4EPTA 1VCMA 4MKGA 4LV8B 1AFEH 1UVTH 2GAOA 3WYAA 1ZCBA 3ZV9A 5A0AE 2GXUA 3TJNA 3T27A 1ELEE 3LGVA 3M5MA 4GMDA 1G5TA 2PKSC 1Z29A 1CIPA 3GY8A 4FU7A 1CT0E 4KJZA 3PFIA 4LHWA 3MWLA 1KNQA 2H8KA 3SOPA 2X2EA 1NIJA 1CHOF 1JNYA 4TMKA 1D9ZA 4E22A 3ATIA 3K0EA 5JDUB 5DI9A 5AVDA 2FF7A 3I5XA 2FX4A 3TR5A 3IBYA 2IC5A 4NWKA 3ICQB 4LYJA 5EXPA 3KQBA 2EI8A 1FFHA 1DOJA 2FOMB 3EWSA 1YKTA 6GCHG 2ZE8A 5BN4A 4D4MA 1FDPA 3M61U 4Q80A 4KXFB 1AA9A 3CF6R 2P6UA 3M1IA 1JBUH 4LJ8A 3W6NA 2GEDA 4ESTE 1UM8A 3ITIA 5FCKA 4NYMR 5F03A 3MWKA 2J92A 4YXWD 2IX3A 1V2OT 2CVHA 5FTMA 4AYYB 1N6OA 4CRDA 5EXXA 1E9DA 1IQMA 3VB3A 2PX0A 3W95A 2RGNC 1NRSH 3M3SA 4KHZA 2JEOA 3F9GA 4PO8A 2J0UA 3NKVA 4TYDA 1J14A 1FNMA 2PCJA 2REOA 1CT4E 1SGQE 2BDTA 2ILNA 4CW7A 1LKBA 3KJIA 3RXKA 1T32A 4CEHB 4D8NA 2GZDA 1WTGH 4PC6A 2QA5A 2ZI2H 2OCVB 1S82A 5JMTA 1O5DH 2VNTA 4DB2A 4A1VA 2R6CA 3DM5A 3A81A 1BIOA 2GDEH 2HALA 3FB4A 1T0JB 4HB0A 2ZIQH 1OFIA 3LQQA 3NEJA 4HI3A 2OBLA 3ZZDA 1YPGH 2GEVA 3UREA 1PLLA 1Z83A 1TGCA 4C0BA 5UKDA 1YHNA 3ZZ0A 3X2SA 4JK5A 1W44A 2BMJA 1PPHE 1DLKB 4V0KA 5F9FA 1ZYUA 1ZJDA 2GXSA 1IQPA 1U0HC 1FONA 2ZZUH 2A4QA 2BKEA 5SGAE 2K5UA 4Q7JB 4Z6AH 4MGIR 2ZTZA 5BQ5A 1ZJ6A 3W3ZB 5DHAA 1FQ3A 2XGJA 2IYLD 2IF2A 5F3WB 4HLDA 4O25A 5FTNA 3WXMA 4Z51A 3KL6A 5EXTA 1TX7A 1OYYA 3VXEH 3SNHA 1HUTH 4IMQA 1K28D 2C98A 4LC1A 1P2QA 3OTPA 1GPZA 4QC2A 1UTPA 3ZZ7A 3S7HB 2G1JA 4EPRA 2SGPE 1BTZA 3NHBA 3P8GA 3ELAH 1AN1E 3GEEA 1P2KA 5CIWA 1WB9A 3SOSA 4HATA 2NIPA 2ZRHA 2Z4SA 2QENA 3L6PA 1DFPA 3LNCA 1Q1QA 2IYQA 2EI7A 3GLFE 1OWIA 2FXRA 2GESA 3KJHA 2QF0A 2OC7A 1O5GH 1D9IA 2V55B 2D74A 1NVUQ 4KFTA 2FTMA 3U3JA 4FMCB 4O3MA 3VB6A 3NXSA 3CRVA 1SMFE 3FGNA 1Q20A 4Q1DA 4JLKA 3LAWA 3P17H 2ZEBA 2NO6A 1E9RA 2BCGY 1GBLA 1NM6A 1VHLA 221PA 1K22H 4TSFA 4FVBA 1ZBDA 2B8WA 4D25A 4INLA 1Z07A 1C2GA 3CRRA 2VYFA 2BOKA 1V2NT 5HKKA 1KI7A 2WKQA 4XH9B 1K21H 1W14U 1OXSC 1QHXA 2OINA 3RDPA 4HB4A 4AFZA 5EXSA 2ZPQA 1GBHA 1K8RA 4RZ2A 4LK4A 4X2XA 2XZLA 3GD7A 1XTIA 2AK3A 1OFUX 4GOJA 5E3HA 1KK0A 4DZZA 5JS8A 1MZDA 4BASA 2ORVA 2O0JA 2GXAA 3DFLA 2A0QB 1J17T 8GCHG 1QQ4A 1F2SE 2PEZA 1DO0A 4NYIQ 1C1VH 4OGXA 4GNKA 4NGAH 4KODA 4X6NA 1DY8A 3DKVA 1O3OA 1DAKA 2J1LA 3KQNA 1LKAA 4UEHH 1FY8E 4NE2A 3PTNA 5FPSA 2VWNA 1M34E 1VHTA 1S84A 1IXSB 1GBAA 2VLIA 3EASA 3PMHB 4C2TA 4M9QA 1K1NA 1RE0A 1P5ZB 2ZC9H 4CBNA 1OW3B 1ZW6A 1AJEA 2D2EA 2FEOA 5DYIA 3THXB 3THWB 2IXEA 3TSOA 1WBDA 3SU8A 4ISOA 3PQCA 5F6MA 5KHOC 2RAPA 2H1UA 1Z6YA 3HPTB 4K8YA 2F6RA 1NBMA 2D7DA 1FQJA 3FZZA 3K2UA 1O5EH 5CHAB 2QM7A 1G5PA 1XTSA 4KO8A 1N8OC 3SJ9A 2V1XA 4R2IA 3A1UA 3PXGA 3OFNA 1FTNA 2JGNA 4Q2KA 1QVRA 1QBVH 3BSQA 1HGTH 2RGNA 1W4RA 4UXHA 2FZ4A 2VIOA 3RXMA 2VSFA 1CR4A 1K1LA 1GDQA 3TR0A 2PMDA 2BHRA 4UKDA 2ERYA 1Q57A 3MGCA 4QBGB 3QG5A 4OS4A 2ZPTX 2H5DA 3NWJA 1VPLA 4XBDA 2ZJ8A 1P03A 3AH8A 1YPMH 1O2VA 3T5DA 2A2XH 1BB0B 1P60A 2FOFA 3EC2A 3IG6B 3VEQB 5A8YA 2WV5A 2W6ID 2O8FB 1G19A 2H5CA 2BD4A 2BDAA 1KXFA 3SYLA 1OB5A 2VA8A 4A8JC 1AZTA 1U99A 2O8FA 1CGIE 2AN9A 2OCAA 1LPZB 3TJOA 5H8WA 3TUJC 3KGPA 5IT5A 5E7JA 4ZIRA 1U8YA 1Y3UA 1UHBA 1GIAA 4BPBA 4XD7A 4D2IA 3Q7QA 2EWWA 4JJZA 2HT6A 5H70A 5G53C 1IQNA 1P2SA 2WMNB 1A3EH 1QJ6B 2J9RA 1CULC 4NIWA 4GI7A 1W48A 2OLKA 4PZZA 4OHVA 3MHWU 1TQ0B 2NGRA 5FTJA 3P92A 4KYUA 1RD3B 3GEHA 3C5CA 1XUKA 4B33A 1Y3XA 1ZNYA 1T4UH 1IQEA 4XWAA 4E06H 3QTOH 4B3CA 1WRBA 3QZQA 3U44B 3VB4A 2IYWA 1DITH 3IWMA 1AS3A 1AUJA 5KSZA 4UJ5A 3UUZA 1OIVA 2JASA 5B58C 4RSPA 4PSAA 3U5ZB 3VR4A 2OC0A 5EE9A 2C8XB 1R8SA 1G8PA 5K8IA 3Q00A 3UNSA 1VITF 3ZVGA 4B48A 4OI2A 3LDXH 5HE9A 1GZSA 2GF9A 1O3EA 1NU7B 2RGEA 4KCGA 2ODBA 4TYYA 3LU9B 4JYUH 4F49A 1NC6A 1LVOA 4U01A 3DUXH 1W0JA 1L4DA 5DE3A 1VIYA 2W2XA 1D5CA 3MWIU 5CLQA 3TH2H 4OHXA 1RTFB 2ZGXH 1O34A 3BFKA 3BGWA 2ZXUA 4OGYA 3P8NA 1GCTC 1XX9A 2ZRIA 1O2XA 3C8UA 4WIAA 2QM8A 2BZAA 3DA9B 2BZ6H 1R7RA 2WPDA 1C4OA 1LQEA 2WPHS 4NWLA 4DVAU 4PPFA 3VB5A 1QHGA 2QBYA 1FIWA 1LS6A 5EU8A 2R2MB 3TVTA 1HUQA 1ESMA 1ANDA 1GNQA 3RYTC 1HJAC 2W2VA 3W6PA 1QIXB 4UDWH 2ZP0H 1NTPA 3U2QA 2QN5T 2EFHB 1QL7A 4GPGA 1VCWA 1MABA 2QP3A 2C77A 3PENA 3D49H 3KF2A 4TLAA 2BJWA 1QR3E 3EW9A 4JT2A 3RMOH 3KQLA 3D31A 3MWYW 3ZZAA 1S85A 5FFMA 1E0AA 5HZKA 5IF9A 2ZRBA 1L4UA 2J5XA 2J7KA 4ZKDA 1PPFE 1P62B 3GLFB 3SYKA 4KU4A 3W5JA 2BDIA 1W5TA 1XJ0A 2XEXA 3CRQA 2Y5GA 4X2VA 2HYDA 1E1QA 3GJ7A 1R5NA 2XWAA 1GOTA 3SHFA 2WPLS 3LW8A 4AGJA 1D6WA 5HKKD 2B9LA 3BN9A 1IQFA 2QV1A 4OS6A 4BAMB 4FMCF 1XD2A 2R9VA 4AFUA 1E2QA 3U3OA 1F5KU 1T4GA 1O2TA 2EEKA 3U7EB 2AD1A 1F0TA 1RYFA 1KMQA 1AM4D 1ZINA 1A46H 1GHAF 5H68A 2PGQB 1BJVA 1IN5A 1YPHE 4EPVA 5IK2D 4OHYA 1J15A 2ZS9A 5EP1A 4H1VA 4ABYA 4PC7A 1OJLA 2JAQA 2WM9B 2Q6FA 3JZMA 2DUCA 3Q7PA 3M5LA 4Q9IA 4DT1B 4POAA 1KMHA 2G5NA 1TABE 3SV2H 1G9IE 4MPVA 2EWVA 2KJQA 1A0JA 1NT1A 1SQOA 5E7IA 1KI6B 5HGGA 4DLSA 3CNLA 4ZO4A 1GRQA 2FGKA 2XOKA 3EPKA 3K1JA 1E2LA 4JBXA 5FTKA 1RRKA 3EPHA 5J4QA 3AVPA 5FBIA 1IY0A 3UANA 4M4SA 4NG9H 3T61A 4M7GA 4X2WA 1O3JA 1Z5ZA 1AKEA 3N2IA 2FS8A 3HR7A 2BD8A 3BORA 4BTUB 2VWOA 3LH1A 1UHBB 8ESTE 1ARCA 3FHTA 2X19A 4B44A 3THWA 2BM2A 3MU1A 1AFQC 3K0AB 5LPNA 3M7TA 2QXIA 1DANH 3AF2A 3V4RA 3TNTA 3ZVDA 3SJCA 2D2DA 5EUMA 2ZJOA 1OV4A 3M3VA 1VGCB 3EA8A 2Z3DA 3GLGB 1W10U 2CE7A 2CVFA 3SI7A 1KY2A 4LOAA 2ZFSA 1ZNXA 2QQEA 1FY3A 4LI0A 1IQIA 3LJOA 3EZ9A 4MGYR 2VH0A 3LBNA 4ZKEA 4U2WA 4BAHB 1O3DA 4Q03A 2C93B 1C5VA 1QHIA 4HZUB 2FOAA 1XEWY 3MNXA 3BIVH 1W46A 1Y3YA 3M6AA 4D0LB 1MTNB 1THRH 4D7FA 4CHAC 4DY7B 2UZIR 4XOIA 3FHCB 3AVQA 1N6PA 2A2ZA 4FN5A 1BS1A 1EWQA 1OYWA 1CVWH 1ZRKA 4BRUA 1UTLM 1AGPA 2NO7A 2NZ8A 1NI3A 3ECCA 3L0PA 1ZTKA 1GKUB 4KV9A 1OH6A 1NROH 2VWLA 2F43A 1EOJA 1SGIB 4RD0A 3HYTA 3ADKA 1C9TA 1JAHA 1YVDA 2VIWA 2Z6VA 5G3YA 1JBKA 1ZD9A 1BRCE 1WXRA 2X77A 2HWLB 2SHKA 5L6NH 4A9AA 1NRPH 2XYAA 4I31A 4Y7BA 4IW3B 3EG5A 3I78A 5DP7A 3LGYA 1XDBA 1C9KA 3A7YA 1BDAA 3K70C 3RS5A 2VP5A 1TGSZ 1QBNA 1U90A 1UO6A 4ESHA 4KFUA 3DMDA 3MNBA 1GMHG 3VB7A 4LHZA 1BJUA 1HRTH 2AX4A 4OJQA 4B3GA 1SULA 3AF4A 3IPXA 4NA9H 5EGMA 1KSJA 2AH4X 4Q01A 1JB1A 3B1WA 1UPTA 4XWOA 3U8OH 2CXVA 4P0TA 3SV7A 4Q7XA 3EE0B 2XSZA 5EZ5A 4OS7A 1A0HB 1KKMA 3PV2A 2BY8X 1EX7A 4GFDA 1AQUA 4PQRA 1W0JD 3BV9B 4ISLA 2QTFA 1FMLA 1G4AE 3PMJA 5T6GA 2P6NA 4ACBA 5LGOA 4BTIB 4P32A 2GDJA 4NPHA 3WY8A 1PUIA 3VNVA 2A78A 4OK6A 1AVXA 2OBNA 2ZSBA 4Y10E 3I92A 5B64A 1QRZA 4Y6DA 5A0CA 1PV4A 1A2CH 3SO3A 2QQ0A 3MU0A 4HB2A 4LXBH 4DUGA 3REFA 1XD2B 2XC4A 3F9HA 1U8AA 1XXHE 4DJTA 2EA3A 4MRRA 1KSGA 1QB9A 2AGGX 1AZZA 4WVPE 4FINA 2HNTC 3UPEA 4BLRA 1SR5C 3QE0A 4Q47A 4FUDA 3QF7A 1XUHA 1OWDA 3RU4T 1ZPBA 1LO6A 4NZQA 2JDIA 3ZVCA 2ODQA 1NMYA 2WJJA 3T26A 4AORA 4DGJA 1RJXB 3HU1A 1NN1A 3P4XA 3VKWA 2FYRA 4RD3A 1F5NA 1ZCAA 3OY6U 4X1QU 1B0UA 1GHYH 4B2PA 1Z71A 3Q76A 2D62A 4JLJA 5DYGA 3ZYEA 2IEYA 2XSZD 4LJAA 4JLNA 3TUIC 3RXLA 3B13B 3PMBB 3LT3A 3U44A 3NBFA 3SDZA 3C15C 2FZLA 5BXQC 1ZUNB 2FE4A 3MO3A 2WMOB 5JSZB 1EAIA 2O8WA 1LCYA 1O0DH 1V2WT 3IHLA 3NC0C 4PC2A 4TYPA 4HAUA 4C9BA 1RZ3A 1TNIA 4MNWA 3OU0A 2SNVA 1Q3HA 1FI8A 1GL0E 3WMFA 4MYCA 2GMTC 3D65E 5DK1A 3M3TA 3ZD6A 4K8OA 1KDRA 5DO4H 5FPKA 3A36A 2NQ2C 1ANEA 4IC6A 4TLEA 3O8BA 1LMWB 1E2IA 1XCGB 3RMMH 1QA0A 1JECA 2IHYA 1P2JA 4D4LA 3SJZA 3P70B 4TMZA 1M8PA 3JZ2B 5A8XA 5D3MA 2P0EA 1GI7B 5CM8B 2PHBA 1V43A 3ZIAD 4F91B 1V2KT 3MU4A 3TITA 4TY6A 1F5RA 1M7GA 1FXYA 1D3PB 4L15A 1GRRA 2QPOA 2ZUDA 4F4OC 4EJSC 4O03A 2A32A 4GCHG 1QNJA 4ZI2A 1FPCH 2WBLC 4O97A 2O52A 4I8KA 3UMSA 1EJMA 2AL7A 1KSNA 5AUPB 3CH5A 2UKDA 2OILA 4B47A 1GP2A 3AKCA 4I32A 3TGPA 3PIRA 2J0SA 1VITH 1SQAA 3BH6A 2QGNA 1AUTC 2NO0A 4MKFA 1H9LB 4QGFA 3ND8A 4WXVA 3BS4A 2QE7D 1TYNA 4G1UC 4LZ1H 4EQ6A 2ZHEH 1O2YA 1OXXK 1GBMA 1N0WA 2ZE6A 1KAGA 2ZE5A 4DSTA 2ZRDA 1CR0A 3SNBA 5AR1A 3MTYA 3PLPA 1W12U 1N25A 3GJ3A 1O2SA 1GJ9B 1T5LA 2Z3EA 3SZNA 2RHMA 4YOJA 1O2GH 2STAE 1MKXK 1S0QA 4Q7MB 3LO5A 4ZV4A 1BRAA 4W5HA 1KJZA 3CPEA 4DVGA 4XBCA 2ZS7A 2VVVA 2XCFA 3A1VA 1G4UR 1GL6A 4DT7B 1NFWA 1A5IA 2YWFA 3BE4A 2IUSA 5KSYA 4FVDA 3RXOA 1GCTB 5F8ZA 5CB6A 5CB8A 4LHVA 1EATA 1UVPA 3KX2A 3U1JB 3GJ5A 1D9XA 1QF9A 2WV9A 1ELVA 3AK5A 5B57C 3VTKA 4CRWB 1F6BA 1ZR0A 3U98H 2PKAB 3ZZ8A 5JB9S 2PLXA 3KL4A 4MYUA 1RJ9A 5FOTA 5JWHA 1DE0A 3FMPB 1OFHA 2FDAA 4TZ6A 1NLFA 1MR3F 1UTMA 1W11U 2BDGA 2Q3HA 1W2KH 3LD9A 1C9PA 2FI5E 2GVZC 4D76A 4TN1A 4ABHA 2ZG0H 4E5UA 1JR3E 4Y71A 5EZ6B 3N2EA 1SKYB 2GEUA 2A4GA 3AVYA 2AR7A 2ZI5A 5BYJA 4LPSA 1GJ6A 3S1AA 4A0GA 4AURA 1E0SA 4UNSA 5M04A 1MH1A 3QPVA 2W0SA 2QAAA 3SUGA 2FPLA 3SI4H 1G9XA 2HF9A 3L3TA 5E95A 2A4OA 3PMAB 1IM2A 4I4LA 1FN6A 4Y8XA 3GJXC 3RSLA 4IDPA 2IA5A 3A1WA 2CMKA 1U9IA 3RU4E 5JB8S 1T3SA 1WMSA 2Z0MA 5IYTA 5FBVB 1QG2A 3DFJA 2UZ3A 1EOLA 2P94A 1TF5A 2DB3A 1E4VA 4JVNA 4XVUA 2WJIA 2R6AA 1RIWC 4A0HA 2VIVA 3FHOA 1Z28A 2BVRH 2ANKH 4JZFH 3DOFA 5HZHA 1NY5A 1W36D 3DOEA 1HQYE 3SV8A 5JFGA 3R8FA 2PKAA 4EJSB 1ETTH 2C5LA 1US8B 4O9VA 2YINC 4HDOB 2GTPA 1GVZA 1GJ8B 3A7ZA 2ZCHP 3QX5H 3L2OB 4U5XA 3VU9A 4KAXA 4PO9A 1SXJC 4V0NA 3TVJB 1ANCA 2BKUA 1W49A 3QXHA 1TNLA 4WF8A 1E6CA 1MTNC 4LYAA 1AI8H 1OE0A 1EAUA 4TTRA 2OXCA 2XNSA 1DVAH 2G8TA 1XPOA 3QG1A 4B71A 1FMGA 3H2YA 3PCRB 3FKSA 1DS6A 4BLTA 3F6UH 3U60B 2CK3D 2VEDA 5L2YH 2GETA 1CA8B 2DFTA 1SVMA 3IO3A 2QORA 2FESH 3B78A 3AVXA 2ZU6A 2TGPZ 1NLZA 3H1TA 1ZHMA 4A15A 3K0FA 2FOBA 3CB4A 4X1PU 2P3FH 1G17A 1R5BA 1DAGA 1AMHA 3QXCA 5FL3A 3KZ1E 1O2WA 1FP6A 1QCPA 2HNTE 1Z8IB 2BBOA 2RGXA 2J34A 4A36A 3ZVAA 2QAGB 5FBQB 5F98A 3A89A 4MH0R 4HUQA 5LB4A 2OC8A 5HE8A 4J0QA 2YYZA 2YOLA 1MRSA 2OCBA 1TAWA 1SB1H 2XC5A 1TPPA 3AQ4A 3K6YA 3I77A 4EIWA 3HU2A 2MMGA 4WZBE 1UK4A 2BC9A 1AS2A 1ZJKA 1KTVA 4Q18A 2OZEA 3V13A 4M0LA 2HLDA 1P09A 3EIQA 3RUOA 2EFDB 4JKIA 4E03A 1BTYA 1DVRA 3O8CA 4E7RG 4A8JB 1DG3A 3FKSD 3ZZ5A 2GXQA 3HK6B 1MV5A 3GCHB 2ZSFA 1Q1BA 3FKQA 1A1VA 4MGZR 2JIZD 1UJ2A 4BFWA 4G0NA 2YZ2A 1HTWA 2EQBA 1QHNA 2FSHA 3E16B 1JAIA 4NIVA 1LVGA 3CNNA 1ELAA 1GBFA 3I3SR 1HPGA 1QZXA 1JALA 2R65A 2J0UB 4PHTA 5C4MA 4TTQA 2B92A 1C2IA 4IVQA 1ZM7A 2ODWA 3MD0A 4AYWA 3E0NB 2BJVA 1O2PA 1K1JA 6GCHF 3VR2A 5SZKB 3QXXA 1O2UA 2DFLA 1IAUA 1MO5A 4G5QA 1BH2A 2ODYB 5C18A 4BRWA 3I8SA 2QTVB 1E32A 3B60A 1O2NA 1S4QA 3MMPA 2UUYA 1RFNA 4Q5IA 4MTBA 2Y5FA 3PO1B 2GCOA 3MWJA 1GWNA 2PW8H 1DADA 4M1SA 2ZUCA 4WXIA 1VITG 4GZLA 3UK6A 3ZYCA 4MGKR 2FMJA 4X8VH 5G3ZA 3RNLA 2F83A 2LKDA 2DR3A 2H5EA 3MLEA 2FFBA 4UQOA 4US1R 4NBSA 1H8HA 1IOZA 2PLRA 4IN1A 5TCCA 3URCA 1P2TA 1NN6A 1E0JA 1Y3WA 1NS3A 2ANMH 4TWZA 3IITA 2NPFA 2CXXA 4P31A 1SGTA 4ISNA 2OG2A 2GBLC 3E0PB 3W5IA 1J9CH 1N0VC 4C0JA 1CBUA 4PO1A 5F8TA 3SBEA 2BM0A 1JRTA 2BYAX 1EJNA 2RGCA 4AYXA 1JEEA 1LVYA 1UDWA 3SV6A 5AFYH 3ESTA 1BTUA 2O8CB 1A5GH 5EE5B 4MPXA 4E05H 1W5SA 1UKVY 4Z1MA 3KFVA 4R9UC 1OSNA 1EK0A 1H8HD 4CVNA 5BYKA 4FI3C 3RC5A 2ZFPH 2GTBA 3VNUA 1RRPA 1G16A 4M9XA 1YGCH 1Y5BT 4BXWA 1MUEB 3R9IA 1XZPA 2VSOA 1WCV1 5GVRA 2MMCA 2OLJA 1DDJA 3LPRA 4BEJA 3ZIAA 5TXGA 2GNOA 1HEIA 2A7JA 3K0CC 2F9LA 1J8MF 3MG9A 2YNMA 4Q21A 4A2QA 4OKSA 3UWJH 4DG4A 2CHGA 2BVXH 3L43A 1XX6A 3FE2A 2D8WA 2ODNA 3QGNB 1XEXA 1NRJB 2NZJA 3DO6A 3E70C 1GJ4H 2P8OB 1ZTJA 1E38B 1ZM9A 4IEIA 4X6PA 4PAQA 2YOFA 1DXWA 3PEWA 2OXSA 4ON9A 5AJWA 2A5YB 2RGAA 1F2UB 1XJCA 1EZQA 4X8UH 1T5IA 4OK3A 1JPJA 2R3YA 2Q3FA 3I8XA 2AD5A 1G64A 1L1JA 1ZLRA 1II8A 2FP7B 4TMTA 3CWZA 2E9SA 2IYVA 4ASUA 1P3EA 3A82A 4ACAA 1C5PA 1F7ZA 5KSOA 3N5CA 4GL2A 5JS7A 1DWBH 3VR3A 1X8JA 4RKOB 1SGRE 4NZYA 2WWHA 1YZTA 1SFIA 3DZDA 1O5AB 2ZETA 2ZI9A 3R9XA 1Z0FA 2ZQ2A 2AWOA 1X86B 4Y7AA 2VIIA 2M5TA 3GCHC 2BOHB 5TY0A 4PX9A 2RH5A 1OT3A 3WYFA 4RKJB 3ZVMA 1VG1A 1W3CA 4V0LA 1ANKA 4ABGA 2OHFA 3BXZA 3IILA 2OBQA 2ZFTA 1KOFA 3RXAA 1IQLA 1M7BA 3BTME 1E1RA 1VIAA 4CEJA 5K0HA 3SJBA 1WYKA 3DKPA 2PMKA 1ID5H 1QTFA 2TMKA 3RC4A 1VYVA 1VKJA 1HV7A 2WIBA 4F4CA 2WWGA 1VCQA 2REXB 1IJFA 3W3AA 4ZKNU 5KPDA 3NEYA 1TNKA 1Y59T 5JEEA 4QRHA 1DSUA 4ZMAH 2F55A 2BTCE 1RRCA 1DWCH 3ZD7A 2YC2C 2A30A 3QSYA 2O5VA 2JATA 1T3HA 1CLUA 1ESBA 5BWMA 1XD9A 2FYQA 1BHXF 1C1TA 3OE7A 3QKRB 3WHKA 2BMGB 1PQ7A 2OFWA 1UVSH 4LBYA 2PTNA 1O3GA 4KBFA 3I29A 3AUXA 3K0CA 1KO7A 3CRMA 4LPKA 4M53A 5TMPA 2VB0A 1MTWA 3I62A 2FSGA 3GFTA 1TIOA 3MOCA 3P32A 4LBZA 2VH6A 1VJ9U 1E9FA 2WWYA 4WBSA 2QCYA 4LV5B 3SUFA 5KDDA 1SGWA 2ZHDA 2ZRNA 3LGUA 4XFQA 1XXDA 1YKSA 2QEQA 2R0LA 3EZ6A 5A5GA 5IRCD 1GDDA 1ZYOA 2IEZA 2RCEA 2N1BA 4DDWA 1D6RA 5GJ4B 2ANBA 2BBWA 4KTUA 3AASA 3LGWA 1Z8JB 2I6SA 1E2PA 2G00A 1OH7A 1TPOA 2GAAA 4II7A 5B2ZA 3SJAA 2O8CA 2R2WU 1DS2E 1UADA 1TNJA 1C2KA 1O3HA 1YU9A 2OK5A 5SZHB 1JEDA 5FPYA 4DWJA 4W5WA 2V0BA 4M9SA 2WSSA 1R8QA 3A8BA 3UQOA 1GL1A 2BD3A 4NFEA 3W94A 2H7VA 3U3KA 1AD8H 3KFXA 2YNBA 4UONA 1U0LA 2H16A 4KGAA 1FV9A 4MQAA 1IN7A 3HYRA 1NSFA 1O87A 2BLQA 1GJCB 5T1VA 1E34B 4H42U 1SLVB 1RIWB 5I46H 4TL9A 4TLDA 4CH8B 3VGCB 3RM0H 2WWXA 3TSZA 2FGJA 121PA 1KI2A 3NCLA 2FWRA 2IJOB 3FYHA 4HGCA 2HLCA 2YKGA 1T3LA 4EKDA 1SC8U 2B6HA 4M1TA 1UTNA 2GMTB 1GAJA 1P3JA 2AMPA 2OP9A 1G3QA 1GUAA 1KI1A 5GCHF 5KPJA 4JZEH 3MO9A 1KXAA 4UFGH 1PQ5A 2ZO3H 5CE1A 3TH4H 4Q4JB 2YHSA 1O3NA 4URXR 3V4FA 2DY1A 2WSMA 2QXGA 3A8AA 2HT1A 2P2LA 5AJVB 4DSOA 4GBMA 5AHGH 2HOBA 4YESB 5CLLA 2OAQ1 1F60A 3UFAA 3CLVA 1GI0A 1MBMA 1UKEA 3BFXA 2DFNA 5C2JB 4JL6A 1OFTA 4X8MA 1C5OH 3QJYA 3SQHE 4NCIA 2OBOA 4JYCA 4TPYA 5AJZA 2NTYC 2ZDMA 5L3QA 5FR2A 2P3SA 1AVGH 4LJ4A 3GYMA 2OO7A 4X2YA 1E79D 4ZPXA 3KKOA 3QXJA 1G5RA 2PTCE 1E2NA 1L7VC 1V2TT 1H1BA 3LX5A 4JBWA 1NRRH 2AERH 3MH5A 5CITA 1ORFA 2FZZA 1BTWA 2F1JA 2QTHA 3KXKA 1Z63A 3UXMA 2AFQB 4F4IA 1G6HA 1KO5A 3GCTF 2FFAA 4MUAA 3ZS9A 3FP7E 4ERNA 1DPOA 2FN4A 1SXJA 3GJ4A 3SJKA 4HZIA 1Q44A 2ZNKH 2PZFA 2V4ZA 3TVDA 1UCYK 1KIMA 1UK3A 8LPRA 1GMHF 3KQCA 1J8AA 4J2YB 5L2ZH 2WKRA 3QQ5A 1AWFH 1NMZA 2XB2A 4JIMA 2A5DA 2IYUA 3I32A 1Z6EA 4TMXA 5JJLA 1FN8A 3SQWA 3DMNA 1NN0A 3LX8A 2O8EB 2FPMA 3OSYA 1Z06A 5IHPA 5LD2B 1ZU4A 4HEJA 2PUQH 3M5NA 2ZI3A 2SGQE 2Z4RA 2Y8EA 2QUZA 1NBME 1D2NA 3QKRA 2QSYA 3C16C 1YCPH 5JSZA 4JBYA 4DCUA 2OM2A 2GJKA 1Z6AA 3MH7A 5HR5A 1DG1G 4I8JA 1O3MA 2A1DB 1SPJA 1Z0AA 2I1VB 4DLYA 4L9SA 1OS8A 1ESNA 2A7HA 2Y80A 3KXLA 1BT7A 1OP2A 1O2LA 4LWZA 3RXGA 3U6KA 1GI2A 4QHSA 3BTHE 4HI0E 1UDXA 5DG6A 4ABFA 4OM9A 1LF0A 3TIUA 4TSFD 3LLUA 3SHAH 5L30H 4YO9A 1C2DA 1O3LA 3BIUH 5DP9A 1DWDH 4WWYA 3JZ1B 3PB1E 4M8NE 2FI3E 2PGBB 2TRMA 3GYLB 2YWGA 3RXIA 2CLCX 1TX4B 2ZCKP 4YT7H 1FPMA 2H6MA 4DLXA 2OLGA 2RKOA 2BDYA 1Z6JH 2WJVA 3AP1A 1TADA 4UFFH 4N0EA 1X7AC 2F7SA 1SHHB 3B23B 1S3GA 3DHWC 4ILEA 2V9PA 4JYVH 1MOZA 4O3UA 4AK9A 2WPKS 2WYJA 3IHWA 2BQWB 2QZ4A 3QWCH 2W7SA 2VGCB 3T15A 3R7WA 1KY3A 1GVNB 4GSOA 4HAWA 2W26A 1E96A 2ATXA 4QHTA 1DAEA 3LVRE 5DISB 3TJZA 1CXZA 1W1WA 4OI4A 3EA0A 1TEXA 1LHCH 3AGPA 4HYYA 4UD9H 1BYIA 3FMFA 1TB6H 3X1XA 1O3AA 3BJIC 1OKKD 2ZYVX 1Z0JA 1IQJA 4D7GA 2EFGA 1Z2CA 3OZXA 3SU5A 1FUUA 4I8GA 2FG5A 1GHBG 1SVIA 1GJ5H 3EIHA 4KITB 4ZHAA 5C67A 2Q6GA 3L0SA 3B1VA 3QENA 4PZLA 2VF7A 3FOZA 3SHWA 3VAAA 4O2RA 4YC7A 4QM6A 1NZQH 1KY9A 5E0GA 2P16A 1SLUB 1JXMA 3KDSE 1CE5A 1SVOA 1EX3A 2QL6A 2QPTA 3MI4A 1TPSA 1HURA 4FXGH 2ORWA 1ZSLA 4QJ4A 3ZJYA 1CBWB 2IYXA 2ZCLP 2V6IA 2EW1A 2BXUH 4LZZA 3U3MA 2HDNB 4PFSA 4CRGA 1LHFH 1C5MD 4HLUC 3UOUA 1YZQA 1R0YA 5TJXA 2JH6D 5L3RA 1BTXA 1Y3VA 2C95A 2F1IA 4INKA 2W83A 4B2CA 3KB1A 1LDTT 4BZPA 3EGKH 3H7TA 3KQKA 1TQDA 3RXVA 4Q1CA 3TH5A 1XMNB 2W6IA 3AKEA 3BFVA 2WOOA 4Q4HB 4DBLC 4ITRC 1I4DD 1P9WA 1C1NA 1GTVA 2BY7X 3F8TA 3CX6A 3QNUA 1BMFD 1XCMA 2WIAA 1F48A 3QKUA 4XJXA 4GPTA 1AQ7A 2WV4A 4AX9H 1O2JA 4MPUA 4M1WA 5G40A 5CYPA 1U81A 1OIXA 1LS1A 5TV2A 1HAGE 2IJD1 3S9CA 5DJ7A 1V2ST 1ZP6A 4Y11E 4FMDB 1UK2A 3W90A 4D0NA 4K5ZA 1PQ8A 2VHTA 1P9RA 4AY2A 4JL5A 1FX0A 4NONA 1ZSKA 5FBLB 1XNJA 5DNYB 4L5BA 3RRZA 4Q9JA 3TAUA 1K6MA 1EXFA 1WCZA 1ACBE 1T7CA 2CJWA 5EP3A 5ETXA 3QN7A 2BD9A 1HYLA 2RA3A 2Q0HA 4K8BA 2ZREA 4D0GA 1B0EA 5FI1B 5CMXH 4QNMA 1OPHB 1MU8B 2YOGA 4OQMA 1P73A 2G81E 1W4AA 1E98A 1S9HA 4MRVA 2G0NA 1IOEA 3CS7A 1HY3A 3EARA 3W9YA 4JLMA 4B2IA 1GDNA 4TQAA 4ZROA 4ZKSU 5JI2E 1TPZA 3ZZ9A 4KI0A 2W58A 1GMDG 2QSZA 4TLBA 3V12A 1YR8A 1NVVR 2C90B 1J8YF 3BG8A 1GITA 4B32A 1TA2A 1QA7A 4S35A 1P4SA 3BTKE 1CBWC 1CKEA 1O2MA 2JJ1A 4NDZA 2G55A 2XXAA 3SW2B 4B2LA 2CN0H 3RXHA 1O2QA 1SSXA 1AKYA 2JLRA 4A92A 3IGFA 1VG9B 3K0FB 1SGDE 1G3MA 1JXPA 2XC0A 3EZ2A 2RMKA 4WMEA 4ZHMU 2D1JA 1JJ7A 2HLDD 2P95A 3F9FA 5JWOA 2XTNA 4KP0A 3L8ZA 4X6OA 2OQUA 2MSEB 1L8QA 1JQJC 4ARZB 3TNSA 4JZKA 4U32A 4LBVA 1FUJA 4G5GA 3U3RA 2Z7FE 2QXJA 2QC2A 4MNVA 1X8LA 4M1OA 1EESA 5DI3A 3SNDA 4JLPA 1WBGB 4NZLA 4WH8A 4NYJR 5JCZA 4JYTA 3EX7C 1E1QD 1XUFA 5CDFA 2YWHA 3T34A 2JLXA 2FOEA 3OEEA 2FA9A 3SGAE 4MRNA 4NCJA 2XJ4A 3UR6A 3HK3B 3RSOA 2X2FA 3NBZC 1BMLA 2AFIE 4URUR 4ZKRU 1TALA 2O8BB 1FAKH 1KXEA 1HLTH 3GJ8A 1WQVH 1FL9A 2QA9E 1DARA 2OCYC 4AKIA 3EXAA 2J95A 5DLQC 1W7AA 1P2IA 2FOGA 2ZHWH 2WKPA 3LKWA 5AWFC 1QB6A 5KYKA 2ZAOA 2NWNA 2HYIC 1NFUA 4PAMA 4YLGA 2ZSEA 3U8RH 2WAYA 3R20A 4MDEA 1INCA 4BZXA 3LC5A 1M7HA 4XSHA 2VP0A 1J16A 1AKSB 3A4NA 3A8CA 1EX6A 1T31A 1C2HA 4QBFA 3T1QA 3EIEA 3WP1B 2GZ7A 5JRJA 3MSXA 1KLJH 2CHVA 3I61A 4CZ2A 3U8TH 3BTFE 3RXSA 1TX8A 2CL6X 5J47A 3CONA 3GLIA 2ODPA 2XBYA 5CIQA 4CDGA 2XJ9A 2O8DB 2HEIA 3BH0A 1Y63A 4YM9A 3KIDU 3AW1A 8KME2 1YLDA 3DL0A 4PHFA 1NN5A 1HE8B 4DJZB 3RVBA 1R2QA 1MAYA 2ZDKA 5DGJA 1WU1A 4FUEA 3TLXA 3FMIA 4YZUA
chains in the Genus database with same CATH superfamily
1HORA 4L8LA 1KC1A 3A14A 3AR6A 4KGXA 2WUGA 3FBWA 1QR6A 1I4OA 2BKVA 2BX4A 4GRAA 2F3PA 4YQYA 4DIEA 3S0JA 2DQ4A 3LC3A 4H6SB 5BW8A 1SQ6A 3WP0A 3SC3A 1G1AA 4DCSA 2YNMC 4LYHA 3VAZA 2AC7A 4DZRA 2WJ4A 2H9HA 5AXAA 1MHTA 4X8OA 2V9ZA 5CW1A 3ATKA 3DZHA 1JHPA 4U8GA 3RFUA 4FFSA 4CKEB 1Q0UA 1GA6A 1HYBA 2J3DA 2XY4A 1SCDA 1PDVA 1ZSJA 2GK7A 5EQJB 1AB6A 3I2FA 5KC9A 1DWEH 3HYNA 4HAXA 1O3YA 4UNNA 2MINB 3IVAA 5ELXA 1M6VA 4JI3B 1WXEA 2OFPA 4H6PA 3F6YA 1NSTA 1H1DA 4CR6A 5B3KA 2QTGA 2JIQA 2C5EA 4TYQA 2ZBUA 4S24A 2VA9A 1Y4ZA 3ATWA 3QBEA 1C1HA 4HS4A 2XNKA 3ZVBA 4Q4DA 1W0KD 4MR7A 4ZGBA 4W9MC 5CHBA 2HQOA 2BMEA 4IG4A 3PC2A 2ZYWX 1LSJA 3I6QA 2JIOA 3I9V6 1C9EA 1NKTA 3N7AA 1LVBA 3AM5A 4NH0A 3HFGA 3A31A 4G8DA 2FHSA 3VO8A 5LJLA 3KVYA 2BMDA 2MIIA 4C4RA 4Y2VA 3HKJB 2HMVA 1GMCF 1TZ2A 2YNMD 3UTUH 3NK8A 3BC1A 4IS5A 1ICEA 3GA7A 3IRUA 4P58A 1Y1LA 2Z43A 2F91A 4P83A 4YAGA 2ST1A 5CG2A 1GNRA 1N2CE 2I2CA 5IZCA 4FU9A 3E18A 3NNSA 4BVGA 1U8XX 3TQTA 1AKTA 4I99A 5JROA 2J5QA 1GL3A 2WDPA 3KB6A 5F2OA 3UJ8A 1D6MA 2DWCA 3R7DA 4U7TB 2AC4A 3QYFA 1CQJA 1AK2A 1UQUA 2EATA 3EGOA 4GX2A 1KAEA 4HAVA 3ZXYA 6ESTA 3REQB 1E4OA 3SZGA 1JSCA 3V46A 5FJJA 2VSXA 4RLSA 2PUXB 3K09A 2NPIA 2X8JB 1YT5A 2DPHA 1OIWA 1AG9A 1HLFA 2GA8A 1PLJA 3LFHA 5EJ8A 1JVNA 2G36A 3D0OA 4C4ZA 2F8MA 3TW8B 4GOND 4BNDB 1TD1A 1SHZA 2K8IA 2GHIA 3LZDA 2YWJA 3HI4A 3DUWA 4BQIA 3DOHA 2OT3B 1HC7A 1ISSA 3C5HA 3B9RA 2V3WA 1AO5A 5LZ5A 3K6SB 3AEKB 4EPYA 3BTSA 3HPRA 3LJJA 3B9PA 4R8MA 3VC7A 3RS7A 5A8ZA 1NDUA 4RWZA 5F78A 2ANCA 4YP9A 5AKLA 3ZVFA 3ZZ4A 2ZBEA 4QFCA 4TYMA 1H05A 1KYVA 5H59A 5B7NA 5LQKA 4DQUA 2ZI4A 1WDWB 3GVPA 4GLFA 5AOBA 1LBHA 5M7EA 4EL0A 4YJHB 2B4KA 4XA8A 5BW4A 3QELA 4J1QA 3W8DA 4KDRA 1RI2A 3GWGA 5EKSA 2OCIA 3GLIE 4BO2A 2IPNA 4BWGA 1WZ2A 3L6EA 1S9DA 2E4WA 4HNTA 2HJVA 3FOCA 4AC9A 2G4TA 1XTPA 1XLTA 3E1KA 3DZ8A 3FPFA 4G1FA 4PQGA 1ZRSA 2QVGA 2ZRJA 3H5AA 4PROA 4LV6A 3QLEA 3B85A 3B2QA 3I6MA 5HF9A 4DMKA 4NWIA 1HKUA 2NYRA 3BG4B 2NO9A 1BN6A 2HWUA 4P93A 1Y80A 3VHQA 4AY3A 4BMCA 4R71A 4TL8A 1KO8A 4MQFB 3H09A 4OP1A 4BBPA 1WQSA 4XOJA 2J87A 3DGEC 3RLIA 4MW9A 4HTFA 4K6OA 3VOAA 4C20A 5AW2A 5KTSA 2PK3A 3TCKA 1H9HE 1REQB 3NANA 4Y79A 1M2FA 2IP2A 4UE3S 5GJWC 4WKBA 2C9CA 3C0KA 4C0LA 4P4TA 1HXEH 3CJTA 2QUAA