4B71A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
total genus 197
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b71A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b71A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b71A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b71A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b71A03
3GCTG 1GJ8B 1MTSA 4KLZA 3PEUA 1E99A 3LXRA 3TITA 5FTMA 3KKPA 6LPRA 2V9PA 2VP5A 1XXFA 2RGXA 2BKUA 4PO1A 3VKWA 1Q21A 2AK2A 4FUJA 2WIAA 521PA 1P61B 3I4LA 1BOFA 3B5JA 4HLDA 1C5XB 4A82A 3AVOA 4HB3A 3HU2A 2B8TA 1MAYA 1DO0A 4K3JA 1HAYB 2A5YB 3QVVA 3TSWA 2I1VB 4HLQB 4OHYA 3AVTA 4OL0A 2R2MB 5G4BA 4YMWA 3ZS9A 1C5OH 1D8TA 1NN1A 1CGHA 3GFPA 1RRGA 4LPKA 3L3TA 2UWOA 1GWAA 2IYUA 1XEXA 2GEDA 1UADA 1UAAA 2QC2A 4LC0A 5H70A 1HE8B 2J3EA 3UK6A 1G291 4OQFA 1JMOH 4L9SA 4LZ4B 1KTVA 4FN5A 4EJSA 3SJ9A 1TPAE 3LKWA 3EA0A 2FO9A 3C8UA 4AFUA 1P6XA 2EFCB 1VYVA 2D26C 3QE0A 1KMHB 3OY6U 1T91A 1S83A 4RVCA 5HZHA 2A4RA 1XVOA 1ZR0A 3NKVA 3HGPA 2QROA 3TLOA 1FNNA 2RGBA 3IG6B 2XBWA 2J0QA 1CVWH 2YNAA 3IPYA 1HQCA 4XSGA 3MNSA 4A0RA 3ZZ5A 2O8FB 1UCYH 4FUDA 1GBIA 5DN6A 2FTMA 4HB4A 3UWJH 3U7HB 2ORWA 4I8LA 2ZRGA 1MCTA 1P01A 3GLHA 2PZEA 4RKOB 2CBZA 1DAIA 2AN9A 2VF8A 2QAGC 3B8HA 4A1FA 4CH8B 4JKIA 1G16A 4NFEA 4FMDB 1GVNB 3EA8A 1O3OA 2YWGA 4JMPA 3RS2A 3UQVA 2DPXA 4NWKA 1W4CA 1H8EA 3I1FA 1OB5A 2BMFA 1N0WA 1KI9A 4BAMB 3HPTB 4DLRA 1WTGH 1Y63A 4PTLA 1FDPA 3CENA 5DI9A 4Y76A 5C3NA 2HCBA 3X1XA 2O8LA 3SV2H 4Y10E 1BBRH 4Q4AA 3WMFA 1TBRH 2PKAB 2ZI7A 4Q9LA 5CLLA 4B74A 4CH2B 1XUGA 1DUEA 3MGCA 1DG3A 1C2JA 2RDLA 4ASUA 4NMMA 5AFYH 2P6RA 1NIJA 5GADl 3RC6A 3I62A 3LDAA 2GD4B 3V4RA 1GHAG 1ZSJA 4URZR 4ESTE 2L0XA 2OBOA 1S1CA 2GZDA 3NBYC 4IFEA 2IYWA 3CS7A 4NCKA 4UFFH 1QHGA 4FI3C 2MSDB 4HLCA 3WRYC 1NU9A 1WV7H 4IS5A 1LHCH 4INLA 4UFEH 5FPYA 1WAYB 2ZDKA 5A8ZA 4NYMR 4ZMAH 1RTLA 5I25A 3SN8A 3KL4A 2ZHWH 2O8FA 1O5EH 2OEPA 2PTNA 3BG4C 1IN6A 3QKSB 2VINA 3RANA 3W9YA 4OQXA 4CR5A 5I46H 1OSNA 2WWXA 3GCNA 4MQAA 1YPGH 4PPNA 4XOIA 3C27B 1OF1A 4BLQA 2C8ZB 1FW6A 1P60A 2A3RA 2FX6A 3AVUA 1Z29A 2UZ3A 1DWEH 1XX9A 4JBXA 3GY4A 1GCDA 4H1UA 2WMOB 4GUXA 3LBIA 1TOCB 3PYHA 3QDZB 4CREA 4GMXA 4RD2A 1O5BB 3F68H 2RGEA 1JQLB 2BDAA 4A15A 1W4RA 2ANMH 2BQWB 2A5GA 3ZVLA 1QG2A 2BBWA 2CF9H 1KO4A 4Q1EA 2VWOA 4TQAA 2WJGA 3ATKA 1T5IA 2XC4A 5AF9H 2OC1A 1ZMJA 5AK0A 3EGKH 3AUYA 4ZDIA 4BOHA 3FP6E 5B6LA 2H1UA 2EFHB 3LAWA 2QE7A 1BTHH 2H92A 1LCYA 2BJWA 1FX0A 2BY5X 1NLZA 3CPJB 2J94A 4YONB 1N6PA 4PO9A 3QY0A 2J1LA 3RXTA 1NM6A 2JJ1D 2V4ZA 4P32A 1C5UA 1WXRA 2O8UA 1NP6A 3IPXA 4CEIB 2NQ2C 1E0SA 4UE7H 3CRW1 2IS6A 2YC2C 2A2QH 4JLNA 1H8IH 3FKSA 1OXUA 2C95A 1JRTA 2ONKA 4AGJA 1MZDA 2BDYA 1CBWB 1TGNA 4AFZA 1LF5A 1UMAH 4C7OB 1G8YA 4B2IA 4PXAA 1QVRA 4TQ9A 3VXFH 2J87A 3Q77A 1XWIA 3WYFA 4GRAA 4NTZA 2BVXH 4JLVA 3FKSD 3EDXB 1ZYUA 4NU0A 4C0LA 2F43A 1DDJA 3CR8A 2VIWA 2CJWA 4LJ6A 3QKRB 3A1UA 3BN9A 1NBME 1P2VA 5TB5A 2KAIB 4GPGA 3ITIA 1NTPA 2ZYTX 2OBLA 4UNPA 1C9TA 3TBKA 1EKBB 1HUTH 3AKYA 3K0SA 3VB5A 1P2IA 2RGCA 2DE9A 5J47A 4YC7A 2HRVA 1CIPA 3BBPA 5JHGB 1YKSA 3PB1E 1XVMA 2QQEA 3BTTE 5DI3A 1QVAA 2KJQA 4I1UA 5JJLA 2VP4A 2D3WA 1FUJA 2IYVA 2ULLA 4WWYA 1UO6A 6ESTA 4GI7A 3EXAA 4G5SA 2ZE6A 3BEIB 4D4MA 4EJSC 2IHBA 1ANDA 2QQ0A 3L0PA 1TNKA 3LX5A 1Z8JB 1O3PB 4HUTA 2GJ9A 1GIAA 2ZCKP 1PPFE 1AK2A 4XH9B 4NIVA 3M37A 3GY8A 1E2DA 4PPFA 3GP8A 3O8DA 5JWRA 2ZYUX 1CO7E 3RM2H 3WRXC 1KLJH 3QXCA 4MVNA 1IY0A 5EQQA 2QXHA 1BRCE 2VNTA 1M6NA 5EG4A 3MUFA 2H17A 3TNSA 2ZU6A 4QGFA 1ANKA 1L0ZA 2FZ4A 3RRYA 4OQMA 3GLFA 4O25A 1H1BA 5AR1A 2NO1A 4P4SA 3QF4B 2JGNA 2G5NA 2TPIZ 4Z51A 1R4AA 1NG1A 6Q21A 4V0LA 3A1VA 3SHWA 2OC0A 3KJEA 1C5PA 1VCWA 1BBRK 1UTPA 1DFPA 3U7FB 4RFVA 4M9QA 1YZKA 3TQFA 1E79A 4I1VA 1CJTC 4IHQA 1WXQA 5HXFA 2HXYA 5F9HA 4M1OA 3RSLA 2G00A 2ZSDA 1YR6A 4A8JA 3AF3A 1SXJB 2RGNC 1OH6A 4HGCA 2GP9B 1EP6A 1U8AA 3M6AA 2DHRA 3PEWA 2ZR7A 1WOFA 2ZPRA 2WUBA 4AX9H 1GL1A 1ZD1A 4K8YA 4F4OC 1LQEA 3H4MA 2AERH 1TUEA 3EIEA 1NSFA 2H5EA 5JI3E 4WXPA 4KCGA 4JLPA 3VMFA 4PC1A 2V6IA 4PAOA 2JJ2A 3RXVA 2G6BA 3WMEA 3A8BA 3EYDA 2XBXA 1DARA 3N2EA 4OM9A 1TWXB 1Z63A 4PAQA 2O8EA 1R0XA 3QBTA 5IK2D 4JZIA 4AK9A 1Z8IB 1D5CA 3A7TA 3T27A 4PQRA 2IK8A 1YR7A 3U3RA 4R8TB 1K9OE 3M0EA 1COWA 2NWNA 3FMFA 3LQQA 1SLWB 2IWRA 2ZC9H 2XOKA 4W5JA 4I32A 2P5SA 3T34A 5A0CA 3ADKA 1T8OA 4XTRA 1C2KA 1O5DH 4B32A 2PKSB 1C1PA 2OTVA 4BLTA 3FMPB 1VG9B 4NCIA 5FOUA 4UNNA 3UG6A 4OI2A 4BAOB 1WSSH 2B92A 1E9FA 4YLQH 4NIWA 2F6RA 3M1IA 1G5PA 4DLXA 2RA0A 2FWRA 3PIRA 3QOFA 4UKDA 4HATA 1IHSH 3OAAA 5JS8A 2ATVA 1P3CA 2BEJA 4GZLA 5CYPA 4G0NA 2Y7XA 2OFWA 1BMNH 1ZM2A 4BPBA 1WQVH 2FSIA 1LVBA 3MH5A 3PVSA 1JNYA 3SZEA 1JJVA 4XSHA 1CT0E 3MWKA 5L3QA 4CW7A 3W90A 3QQ5A 2PV9B 9LPRA 3B60A 1A2CH 3FKQA 3GY3A 1OV4A 4OS4A 3LO5A 4FXPA 1BA8B 1ZM7A 2FEOA 2FFBA 2X8AA 1G3QA 3MH4A 4S35A 4B33A 1GBHA 3E0PB 1BMAA 2H5DA 1RRKA 4JVLA 4XJXA 3ZZUA 5GVRA 3BFXA 3GPLA 4A8JC 3URCA 2ZJ5A 5DK1A 1AMHA 2ERYA 1DM4B 2G0NA 3I32A 1P9NA 1UKEA 4DLYA 2ZU2A 1N6HA 1CR0A 2FP7B 2VBCA 1HYLA 5F9FA 1EAIA 2GHIA 2R2AA 4D0NA 1U99A 4PC3A 1GI9B 1TAWA 5DSZA 1MRSA 2OC8A 3OESA 3ZVNA 3VXEH 4II7A 3QZQA 5AVDA 4OQLA 4BXSA 1KZGB 2A7QA 4KTSA 3AVZA 1ELDE 1TALA 1KJZA 1OFTA 1ZPCA 2BY9X 4MPXA 4CEIA 1Z6AA 1N8OB 2IF2A 4JMYA 5EW1H 2JASA 3BWDD 1OXVA 1ESAA 2Q0HA 5AWFC 3QXJA 4MYCA 1ORFA 3D8BA 3ZZ8A 1E2IA 2CEAA 1TF2A 5EXNA 4TZ6A 1KDQA 2BOVA 5JECA 1H65A 3ATWA 2TIOA 3GQBA 4M7GA 1S8FA 1CGIE 1Z6XA 1F5KU 3GCTF 2BCGY 3RDZA 1TX6A 2HWLB 1Z8GA 1GI8B 2HVXA 1W0JD 4MNYA 3M5MA 2GDJA 2OCPA 1XDBA 2AFHE 4EFMA 1VITH 4Q1DA 5FBIA 4MKGA 3M35A 3TJUA 2FA9A 4G5RA 2UUKB 3CX8A 2P3UB 1N25A 2FV8A 3SNCA 3QJYA 1BDAA 1Q31A 5H4IB 1NZQH 5FUYA 3LGVA 1KOFA 1N6KA 1G3EA 2R6AA 4HAZA 1DWCH 3RP2A 1EFTA 2A5FA 3TVTA 5E0HA 1UTLM 1L1GA 2P0EA 2Q21A 3RC3A 2QYIA 1DADA 1DPOA 4BQSA 1AI8H 2FGKA 1CE5A 4DY7B 4A1TA 5GIBA 1TAGA 4WJG2 3K0FA 2IPHA 3FZDA 5DP6A 5KPDA 3TRFA 3AF1A 4Y8XA 2O8MA 2AMPA 2HPQH 3P17H 3SGQE 1NNEA 4CRDA 2UUFB 2VO1A 3HK3B 1SKYB 2FOBA 1CKEA 2GKSA 3WY9A 1EAUA 4U01A 3QX5H 5KDOA 3EG5A 2R0KA 4KFTA 2WWYA 1UJ1A 1KIMA 2OINA 3T28A 1X1RA 1OWKA 2F43B 3A7XA 3VB4A 3K8YA 4YXWD 3A80A 2Z5FA 1GJ7B 4MGKR 3GMTA 4FWTA 4TMVA 2P93A 1C5NH 5FBQB 5AJXA 1V2WT 1TA2A 1F48A 2Z3CA 1YF4A 5TV2A 5EP4A 4IOJA 3BXZA 1SVSA 3E0NB 1PQ5A 3B7GA 4L15A 1TMKA 4CT5A 3ND9A 4BTIB 1W5SA 3B1XA 1W46A 2XTMA 3K0AB 1DANH 1PFXC 2F4LA 2FOGA 2BX3A 1EG7A 2BLQA 2FWWA 1PVOA 4MG3A 4PAMA 4Z0KA 4WH8A 3GY5A 1KSFX 4E06H 1DELA 4XOJA 2R6DA 3LGIA 1JPJA 2J7KA 1PYTD 1E98A 2BDCA 1L2TA 1XTQA 4AYTA 1MKXH 3TJOA 1NVVR 2WWWA 3GFOA 3RRNA 4BUJA 2BY7X 2ZDNA 3PO1B 1DITH 1P4SA 1HRTH 3NC1C 4Q47A 2O9QA 2IUSA 4Q4JB 3A85A 2P6UA 4JLMA 4D2IA 4CBOA 1V2NT 1G3CA 3R9WA 3TH4H 1ONBA 1VITG 1SQ5A 4TLEA 5IF9A 1LHDH 1VGCC 1TEXA 3I8SA 4I81A 1JQJC 1G4AE 4KSBA 3FMOB 4K5ZA 4ZDWA 1SGQE 2V3CC 2ZFSA 3MH7A 4B2LA 1P05A 2Y80A 4O2LA 2PHBA 1OB2A 4DB4A 5DP4A 1HAVB 1SGPE 4DLUA 3PUZA 4M1MA 2QMUA 3RXAA 6GCHF 4JLBA 4XTCS 3FP7E 1F0RA 3TIUA 5LBIA 3E70C 2O5VA 4LHWA 1UTMA 4E07A 1KI6B 1AVWA 2CLDX 1ESBA 2W2VA 1GJDB 2GX4A 3NEYA 4QT8C 2ZJBA 2VU8E 3KKOA 1GDDA 1X6VA 1UVPA 5DHFA 4OK6A 2GV6A 2HOBA 1J8YF 5J4SA 5HR5A 1JAIA 2ZJ2A 4GP7A 3SNBA 4H6SB 4AN7A 4H6TA 2Z7FE 2O8DB 1N5JA 3AVWA 4C30A 2EWVA 1SZPA 1V3XA 1SI5H 3ZZCA 4YMUA 2A5KA 2O0HA 3BOSA 1FUUA 1MBQA 5C4MA 3BIUH 4EQ6B 1ZCAA 1IQEA 3SS8A 4ZI3A 5FPSA 3IWMA 3OYPA 3B1ZA 1BYIA 4ACAA 3UKDA 4IOLA 2I6QA 3I77A 1KI4A 4K1EA 2ZRJA 4OYHA 3KQUA 4FMCF 3BE4A 5FTNA 4JYVH 4MLFB 4NZQA 5GPIB 4BECA 4LUCA 5FPKA 4XE4A 2GZAA 1G21E 2BLOA 3CONA 1W7GH 4HI0E 2ORVA 1ZJDA 2FF7A 4TMKA 3HKJB 1C5ZB 2VB0A 4WVPE 1QCPA 5FBRB 3P4XA 3UR6A 5J4YA 1KXFA 1NBMD 3HR7A 4YLUA 4C9BA 2WYGA 2B8OH 5A0FA 1YZQA 1NJFA 1UJ2A 4KBGA 2VA8A 5FL7D 4KBFA 2BOHB 1ZBDA 1UBEA 3QXSA 4ZKNU 4Q9HA 4LGMA 3M5OA 3ADCA 4OS6A 2BVRH 4JLAA 3NBFA 2CVFA 1D4PB 2OZEA 1W14U 2VHQA 3AEZA 5B57C 1II8A 1C4OA 1NFWA 3SU6A 2BXTH 4NZYA 4OBEA 1O2YA 2LPRA 4QGHA 1EFCA 1V2UT 2WPDD 4JYUH 3GD7A 1W2GA 5LD2B 3FWYA 1EZQA 3NZIA 3KKQA 4N1AA 2VIPA 1W12U 4YT6H 2BMDA 4RZUA 1VTKA 2FSFA 1PV4A 3KN2A 2QGRA 1Y3YA 2GXAA 3PWBA 4OHXA 5HKKD 1G7CA 2H9HA 2QBYA 4Q5IA 3A1SA 1IQMA 5J4HA 2WPHS 2A30A 2J34A 2PUQH 1XTJA 4MPVA 1XCGB 3I29A 3MNBA 3FPAA 4TTPA 1NBMA 1QHNA 1O38A 2XAUA 1NF3A 1KDPA 5GJCA 3MJRA 3BTFE 2TGDA 3H5CB 1EOLA 1O3YA 2V3HH 1VKJA 1E2FA 3FE2A 2GZ7A 4I4LA 3OY5U 2EW1A 4DJTA 4P0TA 2QV1A 3DD2H 1NI3A 3ZDQA 4JK5A 2ATXA 1NVVQ 1FMLA 1DEKA 1EFRD 3RXUA 2ZIAA 2VF7A 4YM9A 3ZVBA 4A4DA 4LV6A 3ZJYA 3ZZBA 1TQDA 3VR5A 5G3YA 3TAHA 4B34A 3NDPA 1Z0KA 1YPHE 1O2SA 4CRGA 2QAAA 4X2WA 3IUYA 4FUBA 1GSIA 2OM2A 5C18A 1ELTA 4Y0ZE 1KI2A 1FX0B 2JLWA 1E9DA 1MO6A 3GISB 2WOOA 3FDIA 3GCHC 2G1JA 1CJUC 2CHVA 4Y79A 2IJOB 3GDSA 4RD6A 4LSGA 1PUJA 2AGGX 3WYAA 1W36B 2XBVA 3GLIA 3BERA 1U94A 5FPTA 2GK7A 1MKYA 1XJCA 3NXPA 1LKAA 4IOKA 1O35A 4K1SA 1GI2A 2Z3DA 1EFUA 3GJ5A 4DURA 3SQEE 4JSTA 2BV3A 1XTRA 1CBWC 1Z47A 1U6QA 4NYJR 2ZDLA 2NU0E 3TVJB 5L3SA 3Q7PA 2RCEA 3EWAA 4FCWA 1VECA 3ESTA 2MSCB 1KDOA 3H1TA 2DB3A 1CEEA 3DVLA 2ODBA 1QJ7B 3TJVA 1PLLA 2LKCA 2J9RA 2Q3MA 4HB2A 2ZGCA 1IAUA 2OESA 3QVUA 3ZZ6A 4MGYR 4C4PA 3ZVDA 4VGCC 2MMCA 5DP7A 4QL3A 2OLGA 1WQ1R 2BB4A 2P3TB 1W5TA 1F2UA 1HJAC 4KU4A 2CF8H 5LPFA 1MZAA 3AK5A 2OUKA 1DSUA 2BDHA 2IUTA 2PSYA 1A82A 1AGRA 1XTIA 1X3SA 1U0JA 1BYUA 4HDQB 2YZ2A 4BXWA 4DLWA 2FJUA 3RXOA 2B9LA 1QA7A 1RKBA 2AR7A 2AD1A 3KFVA 2EFEB 1B23P 4AYXA 4D0LB 1NMYA 4X8UH 1FMGA 3B13B 1XMNB 1FL9A 2GWHA 3HU1A 1ELEE 3LBNA 1CU1A 5L3QB 1C1QA 5EPYA 3CKLA 4URVR 1K5DA 4GCHG 1Y8TA 4LI0A 3ZYCA 5DPAA 2PLRA 3A89A 1RJXB 2ZU5A 1OXTA 1G1MA 4ZKSU 4BNRA 5FOVA 1UBCA 1A0JA 1T0HB 3W6NA 4D81A 4H1VA 4X6NA 1AQUA 3AUXA 3GY2A 3RXFA 3BJIC 4EPVA 3IQXA 2ZR0A 1ZTLA 4W7SA 1YKTA 4ISNA 5FBVB 1NMZA 2REOA 2Y81A 1YPLH 2ZQ1A 3SE0A 1IQHA 1GJ5H 1UDWA 4WVFA 1SGFG 1Z0IA 4HAWA 3NKKA 2ZDVH 1CBUA 2O8CA 2C90B 1N6OA 4AURA 1US8B 3U60B 3THYB 1MV5A 1O2HA 4HLUA 1FAXA 1BUIA 4Q7YA 1QTFA 1Q44A 1UBFA 2ERXA 1LNZA 3ADDA 1IQLA 1HXEH 1GILA 1XXHB 1O5FH 3BEUA 2W83A 3Q76A 3VGCC 5D3MA 4MDFA 2HUPA 5AJYA 5EE9A 1ABIH 5EXPA 4L5BA 3ZIAD 1HPGA 1FONA 1LVYA 2ZUDA 5EPNA 1GBAA 4A6PA 1ZMLA 1SGDE 4YMSA 2CCKA 2A5DA 4M1KA 1HIAA 4UFDH 4MPWA 1UVUH 3TGKE 3VR2A 2XYAA 4BLOA 3U69H 4QBIA 4Z1MA 1G9XA 3QBVA 2GV7A 1N2CE 1O33A 2YOFA 1QQ4A 2ZRHA 2EI6A 3M7QA 4TZ0A 3DKPA 1NRRH 4IC5A 1Z06A 3DHKH 1D2MA 1E79D 4N0DA 2PWXA 3UOPA 5BYJA 3UMRA 2ZHQH 1XEWX 4BAQB 2BY6X 3L0IB 1F60A 5FX5A 4ZCIA 4CEJB 3GLFE 3P6ZB 1AWFH 3T06B 5LPEA 4RCYA 3ODFA 1UM8A 2C5LA 1YLDA 2F7SA 4HZUB 3C41J 4XD7D 4X6MA 1SOZA 1IAQA 3L0OA 2SGFE 4KAXA 1G3DA 3MOCA 2PKSC 1OP2A 1AS3A 1EZXC 1EPTA 2QN6A 2V55B 3ZQJA 2W3KA 1O3KA 1ZM3A 1ESTA 3KZ1E 1W47A 1BMMH 5E95A 1GJ9B 2FPLA 2GCNA 1AIXH 4C7OA 3K65B 3T1TA 3FP8E 1QY6A 7GCHF 4KXFB 3MU5A 3GYLB 1T8MA 3F9HA 3M7UA 4X8TH 1HCGA 3RVBA 2GVFA 3CNOA 1E4VA 1HJ9A 5C1BA 1RIWB 1YE8A 3ZD7A 1KY9A 2ZE7A 4BFWA 2ZHFH 1W44A 4HTCH 4AY2A 1I2DA 2MSEB 4WZBE 4Q1FA 2Z9LA 4YOJA 4V03A 1U8YA 1WF3A 1KK2A 3AP1A 3OEED 4L4UA 1DWBH 4AG6A 2GETA 3IILA 1BJUA 5LDDC 1V43A 3U6BA 1HAIH 3A1TA 3ZZ4A 1PQAA 1X1SA 5ETXA 2HEIA 1KI7A 5CDFE 4V0MA 3CPHA 1HJ8A 3K09A 2H18A 1G7SA 5DISB 1GZSA 3BGWA 5M04A 3PEVA 2BYAX 3FFGA 4OS1A 2GTBA 1ZM9A 3IQWA 1J16A 2TMKA 3OX7U 1TBZH 3T35A 1DXPA 1E0AA 4GCHF 3N7OA 1DPFA 2RGNA 1C2EA 3EAJA 3HDTA 4RI0A 5FAHA 1F2SE 3RSOA 4KKDA 4MDSA 4PSVA 3ENSB 2ZPQA 1KAGA 5JZVA 1TX7A 1UEJA 1QBNA 1YRBA 1UBGA 3B6EA 1XPUA 4DCNA 3ASYA 1F3OA 4W5HA 3RLYH 2A7HA 1EESA 1U98A 2ZROA 1C1VH 4ZKOU 2GDDA 1EAXA 2QRNA 2XNDA 5HE8A 2VGCC 3SGAE 4LX0A 5GJBA 4JBYA 2ZRKA 2C78A 3LGUA 1E37B 5TARA 2W0SA 4D26A 1YJ5A 3KTAB 3REGA 3GJ7A 3W8RA 4UXHA 3BH6A 1FMJA 4UNRA 5LH8A 4F7WA 2IN2A 3ADBA 2WIBA 1HTWA 3A4LA 5TXGA 1AB9B 1Q1ZA 4INKA 1FPCH 3QUSA 2ZQ2A 2G3YA 4JT4A 5HCIA 1V2RT 3EA5A 2IYTA 4IN2A 2V54A 4XSKU 2YWHA 3BB1A 1V2TT 4FMBB 1C4V2 4M9FA 3F5FA 1P9RA 4KFRA 5F6MA 5EQRA 1OIWA 2YWFA 2JLRA 2A31A 4EPYA 5DGJA 2AHOA 2ZZUH 3D23A 5E7IA 2C9OA 3NIBA 5DJ7A 4EPTA 1X8KA 5FBWB 2Z3EA 3A4NA 1AFQC 1BTZA 3SU3A 3RYTC 2G55A 1T32A 1N3BA 2C8WB 2VIQA 3BIVH 2J0VA 4QHYA 1A61H 4AORA 2C98A 3LV8A 3AVQA 3K53A 4OK5A 1GBJA 4B75A 4NDZA 4PC7A 1WE2A 3DKVA 2Y5GA 4JLJA 5EU8A 1HV8A 1E32A 1W0JA 1Q3TA 2OXCA 4XVRA 1K1LA 3LBHA 1T7CA 3GICB 1O34A 3DMDA 4LRWA 3VQTA 4FUIA 1N6XA 4ZHMU 4RN6A 1NRNH 2REXB 3R20A 1ZMXA 1XUJA 1RZ3A 1QBOA 3K9LA 3UQOA 1VITF 1L2EA 2HV8A 2KE5A 5K8TA 1XCPA 3G01A 3ZYDA 4LBYA 4O0MA 4UXJA 3MMGA 4YESB 3TUZC 1VMAA 5IHPA 3SDZA 4B43A 1O2IA 1W0KA 1CS4C 2A2XH 3WNCA 1DAHA 1OSSA 3K9HA 1TNJA 5KSZA 5L3VA 1PPCE 1ZGIA 4DDVA 3E5HA 4BFUA 1KTTB 1T6NA 1OWEA 1S0UA 4L9WA 1I4DD 5F98A 3H84A 4O3UA 1NLFA 3B2EA 2OCAA 4KGAA 3AKEA 4BLRA 5KDLA 1LHGH 4MH0R 4X8HA 2ZFFH 1KI3A 4ITRC 3A86A 4PHGA 4ARZA 3A8TA 4C0HA 3AW0A 4X1RU 1KAOA 4KFSA 1AVGH 1GCTC 3M5LA 2A1DB 1BH2A 3LXXA 4TTQA 2W6JD 3QK1A 5JS7A 4HAXA 2ZF0H 1T4UH 3PEYA 5KSPA 5DYGA 1W13U 2VP2A 3S69A 3S1AA 1AB9C 1XU4A 1WTHD 2IC5A 4C2UA 1K28D 3FANA 2HNTC 1FOEB 1QL7A 3WNBA 5K8LA 1JEDA 4BAHB 1UF9A 2QSYA 1ZU4A 4QM7A 2JLYA 2BHRA 2JETC 3CX7A 1AFQB 1U81A 4UXIA 2PEZA 3OAAD 1K6MA 3PUYA 4ZH8A 3R9XA 4DSOA 1P2NA 1TNGA 1QGFA 1NFUA 1A0HB 2ODPA 4AYYB 4UDWH 4DCUA 5TCCA 3A87A 5G41A 4AFSA 4K8BA 1KZ7B 3U3MA 2SGEE 1QL8A 2ZU1A 1EASA 1ANCA 1GHZA 1XZPA 4LY6A 1BIFA 1HY3A 3LONA 2W58A 4NYJQ 1HIAB 2ZQ5A 2PSXA 3R0FA 2FE4A 3CPEA 1H8ED 1LPGB 2QMOA 1LPZB 2UZIR 2R9PA 1T8UA 5AJZA 1F2UB 1SKYE 3WMGA 1IXRC 2CNWD 1SVLA 1IQNA 1IOZA 3BTEE 4NYMQ 1O2VA 2ASEA 3N5CA 4ZIRB 2IX3A 4M22A 4DBLC 3U3KA 1X8LA 5K0HA 4ZHAA 2AEIH 4JS0A 4ZO4A 1G3RA 4DIIH 2JH0D 1V2KT 3T5GA 4LDJA 1SHZA 1ZNYA 4DLTA 2RCNA 4U00A 1SLXB 4BRUA 5L3SB 1OKXA 1ESNA 3SZRA 4X1NU 4ABYA 2IS4A 1MQ6A 1NRSH 3IEUA 4U30A 1WBGB 4ZUHA 4INHA 1AGJA 1O3JA 2RHMA 2ODWA 2J0UA 2TGTA 1GNPA 4EPXA 1GJCB 1NRJB 1AZSC 3ETLA 3U61B 5EGMA 4MTBA 4Q1AA 4FU8A 1BBRE 2BD8A 4F4CA 4DUGA 2PGBB 4TWZA 3OEEA 1EATA 3BTHE 1XX6A 4PANA 4V02A 2JKHA 4TPIZ 3Q3KA 3RAPR 4QG7A 3SO3A 3ONWA 2NO9A 1JR6A 621PA 2FMXA 1WYKA 5SZJA 2PUXB 1IQIA 2FOEA 5BN3A 2ZVPX 4U5XA 3EPJA 5HGGA 2VYFA 2XTNA 3I92A 2GJKA 2ZECA 4XWKA 3N2IA 2C9YA 3AP2A 1XMJA 1Q1QA 1ZIOA 4ABAA 2FFQA 1QDEA 1QHRB 1P04A 1FXYA 3AGPA 2WHXA 5LD2C 1WB9A 1AVXA 1AY6H 1P8VC 4Y71A 2QBYB 3TAUA 2FMJA 1B7XB 2OAQ1 3SUGA 4JL5A 2P8OB 1R6BX 4NSVA 1WBBA 5JEEA 3LVQE 4MITA 3QTOH 1QFKH 4LYHA 1VCIA 1CULC 3B9PA 1PQ8A 1PJRA 3RXMA 1LMWB 4M8NE 2ZCLP 1NY5A 4RSGA 4LBWA 1TA6A 1L4ZA 2JJ1A 3QUMP 1TF5A 1TGBA 3LWNA 1G8FA 2DCUA 5JWOA 1YPHC 3BRWD 1FAKH 4B3XA 2ZNKH 4YXWA 5CJPA 2FIRH 4FINA 4BZPA 3VB3A 3ZD6A 3ZLJA 2CJIA 3VKGA 3R3GB 3B85A 3DOFA 4DCDA 1AIPA 3B23B 1V2VT 1KYNA 3UMSA 2V3OH 2RGDA 1Z1JA 4LZ1H 1PLKA 4AYWA 3V12A 1LW7A 1E35B 1AQ7A 3TK9A 4Q21A 1O0DH 3ZZ9A 3AKCA 4IEEA 3DM9B 4DXAA 3VKHA 4U7DA 1QRWA 3GEEA 1S4QA 1JAHA 4O9VA 4A1XA 1ZRKA 1KO8A 2JJ8A 3L6PA 2HLCA 1YPEH 2VIVA 3EA9A 4I8KA 2R9VA 1AUJA 2JLZA 5JSZA 1UK2A 1EZSC 3V3MA 1THRH 3TNFA 3U4QA 1GDQA 4MUBA 1ZUHA 3G5UA 5FL3A 3TGIE 4J2YB 1ARCA 2HF9A 2FSHA 2ZM5A 1AWHB 1MUEB 2OBMA 2XX3A 1Q22A 1GL7A 1QRZA 3T1OA 4YTAA 4D76A 3EAQA 3KXKA 4NYIR 2VSFA 3RMMH 1XB2A 2WZQA 2W0MA 3C7KA 3SI7A 1UEIA 5ABWA 3WHLA 2WPIS 4M1YA 3KFXA 2NMVA 4AG5A 1YPKH 2XXAB 4UD9H 1ETRH 2ZEBA 2ZRBA 1DAMA 2XXLA 2EWWA 4C0SA 1Z83A 4ZCLA 5GJ4B 4BFYA 4JK6A 1BMLA 1Y5UT 5EP1A 1NFYA 4TSFA 5H1YA 1SVOA 1OH5A 4E7RG 3T1QA 1G41A 2BBTA 2BDBA 4JL6A 1HJAB 3AASA 5E3HA 1TQ6A 2EU8A 4W9MC 4H4FA 3IGFA 1JWTA 3REFA 5F8ZA 3EZ2A 1YPMH 1D2NA 2GCOB 4ERNA 1ZINA 3SJBA 5EODA 1KLTA 1H9LB 1CJMA 4JYCA 1TMTH 1VJAU 2A4GA 1V6DA 4X1QU 6GCHG 2GMTB 3W3ZB 1YCPM 3B1VA 2H7VA 1SL3A 4Q9KA 1TRYA 2OILA 1L4UA 3T5DA 3E91A 1KI6A 4NBSA 4D25A 1DS6A 1O36A 2NO7A 4QXAA 3HJNA 4AKEA 3F9GA 2SGPE 3THXA 3O8CA 1KXBA 3P27A 2WJHA 2V1XA 3AF2A 5FPHA 4O3MA 4GLYA 1G64A 4B35A 3H86A 4KO8A 4IDPA 1E2GA 5B64A 5ESTE 3LGTA 3R7WA 3WYGA 5L3RA 1ZU5A 2VP0A 1FZZA 3M5NA 4NCYA 1GI4A 1TFXA 5FFMA 3RWOA 1GPZA 2IXFA 2NOAA 4O03A 2PFEA 3QG5A 1HNEE 3UPUA 1P2MA 4BZQA 1TPOA 4L16A 2YKGA 4D4LA 3THOA 4B48A 3BTQE 2WPJS 5AHGH 4AGKA 3WXMA 1KJYA 4A6XA 1N5KA 1EJMA 3C14C 3K0AA 1HXFH 4TLBA 1TL7C 2QF3A 4MPUA 1GBBA 4CF7A 2WUCA 4BRWA 1P75A 4JZKA 1WRBA 2H9TH 3NXSA 3KQCA 1ELAA 3TH2H 2FI4E 4ISOA 5H68A 2WV4A 4QGGA 2I4IA 2FPMA 3I72A 2VIDA 2WPLS 1Q0UA 1YQTA 2GEVA 1ZSKA 2RG3A 4QJ5A 1Z1IA 1W49A 2XC5A 4IDNA 1QHIA 4RSPA 1P9WA 3BTDE 4JZEH 1GUAA 2M5TA 4IDQA 1DAKA 1A3EH 3I61A 1SGFA 3Q85A 1NC6A 3CB4A 3QLPH 2BLWA 1MU6B 1D6JA 3U9AH 4JYBA 3MMPA 3F0TA 4OS5A 4H9GA 4HEJA 3PO1C 3IITA 3UNRA 4D80A 1GAJA 4DCSA 2O8TA 4IRUB 2ZEJA 4MRVA 1VCNA 2XC0A 1DE0A 1JR3A 1FP7A 4EPRA 2IOTA 1ZYOA 2WBLC 1TRNA 1UHBA 1C1NA 1LTOA 4TMZA 4CZ2A 4PSKA 3HK6B 4LK2A 1CA8B 3CX6A 2BQ6B 3ZIAA 5A5GA 4ISIH 4Q1CA 4NYIQ 2GCTB 2DY1A 1RGQA 3Q00A 2C3SA 3F3YA 4KJZA 3AKDA 3I73A 3R9IA 1W48A 1D9XA 2ZS7A 5E2OA 4P4UA 2IYXA 2OLKA 5BYKA 1YYY1 4AKIA 3M61U 1J15A 3AGQA 2XWBI 2J92A 1E9AA 5JMTA 2OQUA 2B7BA 3Q5DA 3RS7A 2NGRA 2ZSBA 2KSQA 4DVGA 4B76A 2PLXA 4IVRA 1RC8A 2AGIX 2R2WU 3RU4E 1OFIA 2IBMA 4B2CA 1LF0A 1OYQA 1E9EA 2WVJA 2XITA 2OP9A 4OI4A 2PR3A 2P3FH 4PFSA 3OIWA 2GAAA 1EFRA 1VCMA 2VP9A 1QHSA 4M1TA 2AL7A 1OXGA 5EXTA 2G81E 3TLXA 1RE0A 5TJXA 1W8BH 2ANYA 3UMFA 2W26A 3CNLA 3ATIA 3IBYA 4K1TA 1OLOA 3U8OH 2CL6X 3T61A 3GLHB 1VIYA 2Q6DA 5JJKA 1V2ST 2WV9A 2GZ8A 2XSZD 3T25A 1BJVA 3CR7A 5F8XA 4LHZA 2OSBA 3RS3A 1ZIPA 4Q03A 2ZSEA 3UIRA 3BB3A 3ATMA 3M3VA 2QP9X 4PPGA 1SXJA 2V6JA 3NK8A 1Y5AT 3HR8A 3UY9A 4L8GA 1K1JA 1Z6EA 4FUEA 5CHAB 1K1NA 1E2HA 2BDTA 3PITA 4XBCA 1R7RA 4DLSA 5ESBA 1UTOA 3KQNA 2ZKSA 1PQ7A 1FQKA 3KXLA 1VCPA 4B3GA 1UPTA 2HGTH 5DN6D 4AKGA 2DFKB 2XOKD 3UR9A 2ZTXA 4DVAU 2QTVB 4GFDA 2GJAA 5ELXA 5FI1B 4Y7AA 1QQUA 1DBSA 1F0UA 1M9UA 3TH5A 1X7AC 3LC3A 3TH3H 4GZMA 2QGZA 2BTCE 2VGCB 1Z8FA 5SZHB 1US8A 1KDTA 1M7GA 2Z9KA 1DOAA 2F1IA 4JL8A 2XBYA 5FL7A 1F0TA 2BDGA 3K70D 3DMNA 2B6HA 2RH5A 1L4DA 2NZJA 4NH0A 2ZI9A 3CWZA 4V0KA 3TK6A 3F6UH 1YLCA 1JBKA 3Q8XB 4Z6AH 1G8HA 2FSGA 3OFND 3SC3A 4QHSA 3MH6A 5IT5A 4XVQA 1SGWA 2GESA 2JA1A 3K0CC 1OJLA 1TGSZ 1RJ9A 1AO5A 1GBLA 1XJQA 4WMDA 4LJ8A 2ZITA 4DIEA 1KSHA 1TNHA 2KWIA 1OT3A 5TCAA 2Q9AA 1G9IE 4GNKA 1O2OA 1TONA 1QZXA 5C20A 2D2DA 2CE2X 3KDSE 1Z5ZA 3RXRA 4NP6A 3QO6A 3OTJE 2WWIA 3T2NA 1L1NA 2FYQA 1G2LA 1AZTA 2CLSA 2Y7ZA 3SUEA 5DLQC 1F5NA 2PCJA 1O2JA 4PHTA 2AFQB 2OCVB 2ZU4A 2CXVA 1FZQA 4BTUB 4ISHH 2GDEH 4POAA 4E03A 2W6IA 1TRMA 2HF8A 2ZAOA 5JFGA 2C93B 1O2LA 5LB2A 1A1RA 4BFSA 3RXQA 1SLUB 3A1WA 1NN0A 4R71A 4K69A 1KY3A 4C0BA 3GOVB 2J59A 2DFNA 3RU4T 1QRXA 3A82A 5C1YA 3BORA 4FU9A 2IXEA 5FR2A 1GBKA 1ZNWA 2E87A 3HPQA 2CVHA 1KSGA 2X77A 4OGYA 1GVLA 5B58C 1MD7A 1S0QA 1GKIA 4BFVA 3LRPA 5KNCA 4CYMA 4DT7B 2GBLA 1O3CA 4Q4JA 2F1JA 2C04A 2P2LA 3SQHE 1JR3E 3NBZC 4I8HA 4Y8YA 4D7FA 2JIZD 3GCHB 1G6HA 2R65A 2ZRFA 2AIPA 4NWLA 4O3TA 1ZGVA 5BQ5A 1GGDC 3U7EB 4E22A 4RZXA 2KB0A 2PT5A 1WP9A 3CRMA 3U8RH 2VJ1A 1P62B 4QOSA 5JCZA 3VX4A 3HATH 1U0HC 1Q3HA 3W8NA 1R5NA 1N6RA 4MGZR 2QF0A 1YC0A 1KO5A 1GTVA 2YOHA 3MSXA 1N0VC 2OHFA 2F9NA 1CR2A 3A36A 1CSOE 1PPHE 3QF7A 1P3JA 4AWXA 2QIQA 1R0WA 3RS4A 1E9CA 1R8QA 2ZHEH 5K8IA 6CHAB 1L8QA 9ESTA 3V9PA 5FTLA 2XZLA 1IXZA 3SJIA 1GBMA 2JETB 1NL3A 2F1RA 1N5LA 4MNWA 1SPJA 2FNAA 2P16A 1O2KA 4OI1A 3X1DA 2WM9B 3PFIA 2J7PA 4GVUA 4ISLA 3MFJA 1BKDR 1OPXA 1F7ZA 1KDRA 1FFHA 2YC4C 4A2WA 1IQFA 3KKMA 1OWIA 2FOMB 1MO3A 1TLDA 3M36A 1J17T 2STBE 3AH8A 1YVDA 3K0FB 2J46A 5EUMA 1TNIA 5CJ2A 2D7DA 2KBEA 4URXR 1HAOH 5T1VA 3NH9A 2FLBH 3STJA 1NROH 3PLKA 3U44A 2ODQA 1KNXA 4KP0A 5L8VA 3MO9A 2R62A 1MD8A 4JSYA 3DPUA 1XXHA 4TL7A 4ZI2A 2ZRAA 3U3OA 3S9CA 2WKPA 1W36D 4ABJA 2P94A 5FTJA 1ID5H 2NU4E 4RCZA 3SU2A 2PBRA 1W11U 1HYQA 1NKTA 5K8UA 1IY1A 1MTUA 1AA9A 3GJXC 1VHTA 4QHTA 3F9FA 3MLEA 3U5ZB 3HPRA 4J1YA 1O3NA 1XEXB 3P1JA 3T29A 2PMKA 1Q3XA 1SR5C 3CF2A 2DFLA 2HLDD 4B47A 5LPNA 1E69A 4LCBA 3EC2A 3M4YA 3NPSA 2FX4A 3D6TB 3SHFA 5JBCS 1GHYH 5A09A 3CIOA 4DG4A 2CL7X 1UVOA 4IEIA 1TPPA 1EX7A 5J4VA 3ZZAA 5E7MA 3LD9A 2BHGA 4E7NA 2F3RA 2B5TB 4A2QA 2DWPA 3CWQA 1UTQA 3IDQA 1CHOG 1F2TA 5LPRA 1THSH 4IMZA 6CHAC 2EI7A 1FY4A 1EWQA 1FY3A 1ABJH 4AFQA 2PW8H 2YVUA 4HB0A 1O2QA 2GJ8A 2AWOA 4B3DA 1E1QD 1BTWA 1HUQA 1J70A 2FEMA 1QA0A 3SQWA 4K2YA 1OXXK 2QG6A 3V13A 1S96A 4ZXYH 3UIEA 1G5RA 3ZZ0A 2WPMS 821PA 4NA8A 5CIQA 4XBBA 1NRQH 1ZPBA 4TYYA 1PPBH 3LQRA 2FH5B 5IDKA 5JJIA 4P33A 1T9HA 3KQEA 3AW1A 5A2MH 4EJSB 1S3GA 1E94E 2JEOA 2R0LA 2P8OC 2QL6A 4G01B 3ICEA 5B30A 1O3BA 2GF9A 1ZRBA 3UATA 3UANA 1KNQA 4EPWA 1SFQB 4IW3B 2JAQA 2ZRLA 3FHTA 3LJJA 2D8WA 3EARA 2BQ7B 4AB9A 4KVAA 4B6FA 4K8OA 1GHWH 3BTME 2CDNA 4MUAA 1QHYA 2FFHA 1WMSA 2ZA5A 4F91B 4BLPA 2GCOA 2YV5A 3TMKA 5H8WA 4HLUC 5SGAE 3MU0A 2ZSFA 2ZU0C 5FBLB 2GKVE 3WNDA 3IHWA 4IXMA 4F38A 1AZ8A 3Q9LA 3SU8A 3KJIA 3VHXA 1XTSA 4JT2A 3U8TH 2ZDAH 1TX8A 3GCOA 1P72A 4DEXA 1E1QA 3SJKA 1RIFA 2XRCA 3SJCA 3KF2A 2GBLC 4GPTA 1G8PA 1EOJA 2HALA 2ZFQH 1HQYE 4M53A 4C2TA 2HJGA 2F83A 3PMJA 1WUNH 2V7QD 2BOKA 2UUJB 1DOJA 5SZKB 1C2DA 2WKRA 1EPTB 3QPUA 5DKMA 3O47A 4Q00A 1Y59T 4DWJA 1E9SA 1SXJC 5JYIA 2AWNA 1XCMA 1GKYA 4YOGA 5KNDA 1Z2CA 3ZVFA 1LQDB 1D9IA 2J38A 2I6SA 4HZUA 4CHAC 2IYSA 4AB8A 3FGNA 3QKTA 2WAXA 3PCRB 4DW2U 1ZUIA 4OHZA 4Q7JB 2QZ4A 1M7HA 2GVDC 1YZTA 4F49A 1F2TB 3MNCA 1G18A 2IYQA 3M3TA 3PV2A 3D3QA 4WOPA 1L7VC 5F3WB 3ATLA 5DYIA 2FESH 1K1IA 4QNMA 1P9SA 3IIMA 4C3ZA 2CHAB 2VVUA 2RGGA 4ASHA 4NA9H 1F92A 2BKEA 1LKBA 1VZQH 4KHZA 4M21A 1BRAA 5GCHG 3SUDA 3A8AA 1RFLA 1W4AA 3KB2A 3BEFB 4JZFH 2A2ZA 2WINI 1AKYA 3NWUA 4EDHA 1ZAKA 1NY22 3SV6A 5DNYB 4X6PA 1E36B 5D3MB 2STAE 3GLIB 2W00A 3D65E 3SYJA 1C5MD 2O52A 3K70B 3WP0A 1DG1G 5SZIA 3MJHA 3PJRA 1XP8A 4Q4AB 1BOQA 2TBSA 1OWJA 1IONA 4XVUA 2EEKA 4US1R 3O8BA 4GAWA 2NU3E 2P67A 5KPJA 4AG1A 2IYYA 1NPMA 2D1JA 4TWYA 3SJOA 1KI8A 1G5TA 3DHWC 2CHQA 5DO4H 3P70B 2GMTC 5IYTA 4RY2A 5FUVA 4IBLH 2QNRA 2P65A 4KVGA 1G17A 4DHEA 2A9KA 4TN1A 1DT2A 5JBQA 3GY6A 1Z07A 2JIZA 3U2QA 1H8DH 4ABFA 1UK3A 4QM6A 3W5JA 4LXBH 1QB1A 1GBTA 1SQAA 3WBKA 1XMVA 4YMTA 3PENA 2QA5A 1QBKC 3B1YA 3TUIC 1FIWA 2JH6D 121PA 1KXAA 4Q2KA 1XUIA 3R8FA 5C2JB 1TQ4A 3CP7A 3BV9B 2W2XA 3CRRA 1XUFA 1MQ5A 3ZZDA 4CHAB 3RWMB 3ZVEA 4F92B 2G4TA 3Q3XA 3SNAA 4ABEA 4I31A 1CJVC 3FMIA 5JLJA 1G6OA 1M2OB 4LJAA 3P32A 2B21A 1D9ZA 2O8BB 5HZKA 1EX6A 1P11E 3P8FA 1C9PA 5K7RA 3VPKA 1KYIA 2QENA 2A45B 4MYHA 4HUQB 3B8JA 2QTHA 3SBKA 4C0QC 4MRNA 2BD2A 1XKBC 1RJ9B 1Y3AA 3TJZA 2ZI4A 4M0LA 1CP2A 1L4YA 2PMDA 1FIZA 2ILNA 2GEUA 3T1VA 3CBQA 2D06A 2BIFA 3A37A 1HURA 4ZKRU 4ABGA 2DR3A 2FPKA 4X2YA 1DLKB 2GZ9A 2VWNA 3PQCA 4ASUD 4U2WA 4X8OA 3EPLA 4GT1A 2CHGA 2VEDA 2P59A 1GHAF 3E90B 1ZC4A 1O3FA 4ZDJA 3ZGXA 1JB1A 1CXZA 1FTNA 2QN5T 4HSEA 2ODYB 1FN8A 3HKIB 1JEEA 5IRCD 2YINC 1HA3A 4BANB 2BM1A 1AKEA 4NCHA 4IC6A 1J8MF 2TGPZ 4MKHA 1TGCA 3RXIA 3ZZ3A 1H8HA 5LGOA 1H9HE 2IS2A 3SYNA 1ETTH 2GCHF 2GCTC 3C16C 4HDCA 1ESMA 2R6CA 2NIPA 1XD2B 5J4LA 5A4JA 1O32A 2OFXA 3KL6A 1E1RA 1E9BA 1TTTA 1VYTA 1YBWA 1S85A 5GVSA 5AJVB 3ZZTA 4D7GA 4DT1B 2MMGA 5JBTA 3BTGE 4YDSA 1YZLA 1G8GA 2OT3B 2ZAMA 3SQXA 3BG4B 3E2IA 3NC0C 5EQTA 2BBOA 2ODNA 3AAUA 1G19A 2CXXA 4DRZA 4OQNA 2GA8A 1S81A 4ESHA 1OKKA 3EZ7A 4K81B 4D6PA 3MCAA 2H16A 1GHVH 2E9SA 4RZ2A 4RD1A 2NO6A 4TL9A 3SHCH 3RRZA 3B78A 4URUR 4CRAA 1Y3UA 1C2HA 1C5YB 4DOQA 2AGEX 2F9PA 3S1AB 1G7TA 2OBQA 1OX1A 2CJWB 4YOIA 1OPHB 2REBA 3WBJA 1O2WA 4WMFA 2GT8A 3ASZA 3I8XA 1XJ0A 2WOJA 3P8NA 1MRNA 2D62A 4RFSA 4ZIRA 4US2R 4HUQA 1IJEA 3ZVRA 1QG4A 4I1OA 2OXRA 4V0OA 4Q4LA 2ZUCA 2ZSAA 3RXEA 1OHHD 3VB7A 4MGIR 4E05H 3TQCA 2NPIA 2ZR9A 4X8LA 2F9MA 1HAHH 4D0GA 2Y6TA 4EFLA 1OOKB 3MU4A 1GL0E 1A5TA 1QRAA 2GXQA 3EZ9A 3SN6A 3SJAA 1LPKB 3RXGA 3LY5A 4EUNA 5TY0A 2AMDA 3K1JA 1MKWK 2KBFA 3EZ6A 3I5XA 1LHFH 3VR6A 3VR3A 4CRCA 1P0SH 5FCRA 4A0FA 1KKMA 2VHTA 2Y82A 1GNQA 3SYLA 4WZ6A 1D3TB 3THXB 5DP8A 2NTYC 2EI8A 2GT7A 5A8YA 1S84A 3TGPA 1VHLA 2BMEA 2I3BA 1VGCB 3E1XB 5FTKA 1W0YH 3UXMA 3DZDA 1B0UA 1OIXA 5F2EA 1GMCG 2CLCX 3CUEF 3AVPA 1ZHPA 4OK3A 2H2ZA 5C4GB 4BEBA 2WWHA 3TW8B 3DOEA 1OP8A 3S9BA 1MO4A 1LV7A 4WH6A 2VWMA 2DBYA 3K09C 4ZAEA 1O3AA 2OO7A 2O8DA 2Z4RA 4AI6A 3RABA 4I1SA 1BIOA 2UWLA 3IEVA 1RRPA 1K2I1 5HPYB 2SHKA 1SGTA 4C0JA 3V0XA 4BZXA 3ICQB 3JZAA 4IFBA 4HAUA 1OIVA 5EE0A 4ZKEA 4P4SB 4G5GA 1VIAA 3VTKA 5HYOA 3FYHA 1TNDA 3SW2B 2W3IA 2CCGA 2VVCA 4WF8A 3OTPA 2BWJA 1AFEH 1GJAB 4JLKA 1A2BA 1O87A 3SI3H 2C8VA 2PH1A 4P4TA 2Z9JA 1J7KA 2JCSA 4TYQA 3C5HA 4FMCB 1EX3A 4JKYA 5BW8A 3GLGA 1Q20A 1XPOA 1X86B 2BBSA 4XWAA 3A83A 1MABB 3I78A 2ZJYA 1C2GA 1SGRE 2FGJA 2ZO3H 1A46H 3LX8A 2F9OA 3NVAA 3QTVH 1JXMA 4LK4A 1TQ7B 4J0QA 4Q02A 4B3FX 2R3YA 4X8MA 3VB6A 2KI5A 1THPB 3EZFA 1TF7A 4U02A 3PLBA 4GOKA 2ZU3A 2V7QA 1B5GH 1C1UH 2GCPA 4Q7ZA 4Q9JA 4WIAA 1JPNA 1FNIA 2P95A 5AUOB 5KNBA 2NZ8A 1VCOA 5C5NA 4E09A 1C1WH 1LS6A 1GVZA 4LYJA 1Z0AA 3BS4A 1RRFA 2SGQE 4B6EA 3DL0A 3BG8A 3RXLA 5BXQC 1TIOA 3RXCA 2J0UB 2H57A 1OYYA 4Q18A 4Q7LA 1Z71A 4PR0A 2RMKA 3RUOA 2XTZA 4Q7XA 2Q9BA 2Q6TA 2QUZA 3EX7C 1GGDB 3NWJA 2VSOA 5FOTA 3NCLA 1ELCA 3RHFA 3E1SA 2LNCA 4ARZB 1RFNA 2JLSA 2ZPSA 2SNWA 2ZRDA 3NHAA 4JVMA 1RPZA 1LVOA 1O2ZA 2JJ2D 2A7JA 1ZLRA 4IOMA 3DT0H 2HXSA 1W0ZU 1Z6TA 2JATA 4EFNA 1JIMA 2IWHA 2WAYA 3Q72A 1BCUH 1IQKA 4QNRA 1FUKA 4JJKA 4DIDA 2Z43A 2WSSD 3PR1A 1S9HA 1P2TA 4H42U 1OYWA 1NO9H 3KB1A 4LZZA 1DUAA 5DP9A 1U8ZA 2OFOA 3LNCA 3Q5EA 4FIDA 1NSTA 2BD9A 2X2FA 2VPPA 1QBVH 5CYOA 1RYFA 1TU3A 3KUCA 3SU4A 1T5LA 2QT1A 3VHLB 4B3BA 1C1YA 1AUTC 3DM5A 3CZQA 2QXJA 1ZTKA 1BITA 1ZSLA 2X2EA 4BLSA 3QNUA 2A5JA 1MTWA 2PJRA 3PUVA 3RRMA 2G83A 2ZFPH 4LJ4A 5EE5B 2J41A 4KODA 2O8EB 4LHYA 1A4RA 1SVWA 4LJ5A 1S6HA 3K0EA 4R2HA 4JBWA 4V0NA 2W7SA 3TR0A 4QFMA 2XCNA 5G40A 2QI9C 4TLCA 3AQ4A 3J81k 4DT1A 2W6JA 4LJ7A 1KIGH 1E2PA 1EK0A 3VAAA 1PUIA 4PROA 3LA6A 3OZXA 3A7YA 2R44A 1J8AA 4MKIA 4FUHA 3GLIE 3CF6R 3C4JA 3VU9B 1S2MA 2X1VA 3CNNA 1NT1A 3S7KB 3FFBA 1O37A 1C1MA 2RHDA 1P10A 5A8XA 5FOWA 1KK1A 3NDBB 1JIRA 3MO3A 3QWCH 3QGNB 3A88A 4ABHA 3GJ4A 1GI6A 4FVBA 5KHOC 1ZNXA 4JJZA 3GEHA 2FS8A 3Q7QA 3X1WA 1BRUP 4WMEA 3MU8A 1ZNZA 2H5CA 2QP3A 2OQ5A 3QF4A 1U9IC 3QPWA 1E0FD 3DUXH 5TMPA 1GI0A 2A78A 1AM4D 2F1HA 2OLJA 1R5OA 4JLOA 3A8CA 3TVDA 1GMDF 2RGAA 1IN8A 3LW7A 4US0R 4JVSB 1DAFA 2D2EA 4A0GA 2QPOA 1XMIA 2YWEA 3SGBE 2HYDA 1BTXA 3PMBB 4KTUA 3B9QA 4A9AA 1UDXA 4DSNA 5AUQA 1AQYA 1VG0B 3SZNA 3TSOA 4PO8A 1C1TA 1VG8A 2ZTZA 4ABBA 2G77B 1Z0FA 1TOMH 1Y3WA 1SGYE 3ZS8A 4B71A 4QJ4A 1P2UA 4A5TS 1M1YE 1ZJKA 1ZC3A 5G53C 1GI3A 4TY6A 1ZTJA 4QGAA 4Y8ZA 2ECKA 2V1UA 1JR3D 3EASA 2RA3A 3H7OA 1K1OA 1TU4A 2O8BA 1DY8A 1KSNA 2PGQB 4JYTA 2FTLE 3PXGA 5EE3A 4VGCB 1XUKA 3R7WB 1HBTH 4ZKDA 2Z6VA 2OAP1 4QC2A 2ZUBA 4NSYA 2FOHA 1ZP6A 3ZZ7A 1D2EA 1AS2A 1IN4A 4LJ9A 1AN1E 3UWKA 2P5TB 3P92A 2W5EA 3SUFA 3WP1B 3KCGH 3EIHA 4DSUA 3QXHA 2ZTYA 3NEJA 1O30A 4SGAE 4YMVA 2ZVQX 1GJ6A 2ZE8A 5E2PA 1G3UA 2ZP0H 4LJYA 721PA 1O39A 1GNRA 1U0LA 1ELGA 2YOGA 1QNJA 1H9IE 1R5BA 4FUGA 1HV7A 2YNMA 1NVUQ 1SFIA 4D8NA 1ZCBA 1EXFA 2FOLA 1SVKA 1J2JA 2WWGA 2H9EH 2ZXUA 8GCHF 2O0KA 3KQHA 3P8GA 1YRAA 1O5GH 3LJOA 2ZS9A 1BS1A 5CM8B 1O2NA 1GBEA 1GI1A 1C2IA 1W7XH 4CR9A 4A7IB 1ACBE 2NG1A 2JH5D 5AFZH 1O31A 2FU5C 2WKQA 2ZPTX 3DFLA 4TLAA 4AIIA 3QENA 2ZJOA 5A0BA 1UVSH 3SFZA 3F9EA 3PMHB 4JLDA 4TYDA 3SV9A 1TPSA 1HE1C 3RMNH 2O8WA 1U2RA 1P2KA 2GK6A 3RXJA 3U1JB 4Z1MD 4UNSA 3VFEA 2F9LA 1C5TA 4RKFA 2HYIC 2YOLA 1VYUA 2OBNA 2YHSA 2CK3D 2FM2A 4PHHA 2BY8X 1DSTA 3KQLA 3A6PC 3E3TA 1KHTA 1AKSB 3MRSA 1C5SA 3DZ8A 1G2MA 2R3UA 3UREA 3JZMA 2A32A 4DUGD 1ELVA 1FQ3A 1DWDH 4PZZA 2ANWA 2TGAA 3RC5A 3QEJA 2XTTB 1ETUA 2IYZA 1G20E 3MU1A 2V8OA 1P02A 4UQOA 5CB6A 2FOAA 3P26A 4IXNA 1EB2A 1J9CH 8OHMA 2WPDA 2QXGA 3ELAH 4Q1BA 5FXLA 5HTKA 1LVMA 2CHAC 1C1OA 4FWIB 1O3EA 1A3BH 1R0ZA 4QBGB 3LGYA 1H8HD 4Y7BA 2QRZA 1CR4A 4LV5B 2IYRA 3T26A 3LFUA 1P09A 1Z6JH 4P31A 1P2QA 2F55A 1I4TD 1HAVA 1OE0A 2VRWA 1KO7A 1FJSA 3EQ0H 1W2HA 3FVQA 2NPFA 2AYWA 3B82A 2Q1JA 1P06A 1N0UA 3L8ZA 3UG7A 1SHHB 1N6NA 1OS8A 2BXUH 1ZPZA 3E8LA 3UNSA 1CT4E 3CH4B 1P5ZB 3X1ZA 2BEKA 4X1PU 1Q2WA 4NL4H 1OKKD 1P2JA 1XM1A 5KOYA 1PJPA 1ZRHA 1E2EA 1GHBF 5JBBS 3A84A 2SGAA 2WTUA 2ZGBH 2ZWLH 1YGCH 2XNDD 4DDUA 3I5YA 1NY6A 2N1BA 1SULA 4X8SH 3KKNA 2GTPA 1GBFA 1NJGA 3BF6H 2GNOA 2ORIA 3QN7A 3KX2A 4KTCA 1O3LA 1DO2A 1XTKA 4Q01A 4K46A 3RC4A 5EJEA 1S6FA 2JDID 2ZI6A 1OFUX 2Q3FA 4XWOA 3CM0A 4D9QA 3KQKA 1PPGE 3NG1A 4MQBA 3LOXA 1B0FA 1Q1EA 3SU5A 1SQTA 2ZFTA 1Z7KA 5E0GA 1PYTC 1YHNA 4GSOA 1Z08A 4MDEA 3BAFA 5BPEA 4CEHA 3GY7A 3V4FA 2BD4A 4FU7A 3CZPA 4UONA 1XUHA 2DWQA 2BM0A 2V35A 1W10U 2QSZA 3L8YA 4HZIA 2JLXA 2BZ6H 2GAOA 3ZQ6A 3HGNA 5IDVA 5GXPA 5FOXA 2IUUA 2Y5FA 2PT7A 3GLHE 4I8GA 2JLUA 4DDWA 4THNH 1MO5A 2AXNA 2OCBA 1CF4A 2XZPA 3PUXA 1DAGA 1VG1A 4CRFA 2NO0A 3GLGE 3Q3YA 3SHAH 2C99A 1KXEA 1C9KA 1IXSB 3U6KA 3UWOA 4GDFA 1XNJA 1SHKA 5EXLA 3KJGA 2J95A 4TPYA 5CK5A 1V2JT 5JPMH 2BD3A 4WZAE 1KXCA 1HB0B 1T8LA 1QHXA 3KEEA 1M34E 5CLQA 5CMXH 1M8PA 2BX4A 3RXPA 4NHOA 3RLFA 3LLUA 3GDUA 3A4MA 1V2OT 4ZPXA 4TL8A 2Q6GA 2O8CB 1M7BA 2K5UA 1O2XA 1AZZA 5EP2A 3S9AA 1C1SA 2XEXA 4AYVB 3D31A 3F1SB 3ZVCA 4DSTA 2VVVA 2CCJA 1GMHG 1IN7A 3OIUA 4PZYA 4FXGH 1ZMNA 3NBXX 4HAYA 1S3SA 2CV3A 3C1KA 2F3TA 3U98H 1QHHB 1MKWH 2BD7A 3TKLA 3A7WA 2ZJZA 2Z9GA 1QURH 4Y0VA 3GLGB 2OG2A 4IVQA 1MMJN 2FN4A 5KDDA 2BD5A 2WJIA 1AJEA 1XKAC 3RXHA 2C2HA 1XMSA 2B7DH 1KI1A 1CHGA 2AK3A 1TABE 2JDIA 1EJNA 1MR3F 1G7RA 1V2PT 3LC5A 1WBDA 1CTQA 3MI4A 3P95A 2H1LA 3I3SR 1BB0B 1FPHH 2H6MA 5HM9A 2R6FA 1GVKB 2QT0A 3EIQA 3BTWE 1E4YA 2JLQA 3A81A 4G5QA 2F9BH 3SORA 1XZQA 1J99A 4Z54A 2PCLA 1E34B 4KLNA 4WA7A 3VR4A 1UK4A 1S1MA 2SFAA 1KXDA 1SHYA 1BHXB 2GVZC 3AF0A 4DCVA 1MOZA 1YCPK 5FCKA 2QMHA 3ZYEA 1XPRA 4M9ZA 2ZIQH 4ZXXH 4R9UC 1HFDA 4BEJA 3L33A 4OJQA 4EKDA 4CGZA 1MH0A 5FH9A 2V0BA 5CIWA 2D74A 4LV8B 2OE2A 1OWHA 3KGPA 3KHVA 3TK5A 4G3XA 3QSYA 3ND8A 2F9UA 1G37A 3P8OA 3CRQA 1SGCA 4NCJA 1XD8A 5GJWC 4BAKB 1YR8A 4BASA 5CDFA 4I99A 3W34A 2FODA 3GCGA 2OK5A 3E16B 3BSQA 3NTUA 1U90A 1YR9A 2FFAA 4XFQA 5L6NH 3FFAA 1UTJA 3H7TA 3EC1A 1SVPA 3VEQB 1IHUA 2IA5A 4WXRA 2GXSA 4OHVA 1FQJA 3CH5A 3GLFB 1A7SA 1RXPA 4P3YA 8LPRA 1AKSA 2ANKH 1MKXK 2J9NA 2PZFA 1TQ2A 4WXVA 1K21H 5FUXA 2ZCHP 2VH0A 5EE1A 1BHXF 2SGDE 5EOKA 1GM5A 1MU8B 3L0SA 2XNIA 2ZDMA 1A4WH 4LOYH 3SU0A 3TE6A 2Z9IA 4BTTB 2AFIE 2QTFA 4GHQA 1P3EA 3DEFA 4X2VA 4GL2A 3IBGA 4ESVA 4TLDA 3K6ZA 1EQ9A 1SOTA 5CM9C 2ZRMA 5C1XA 5E0JA 4Q4HA 4D4JA 3KQBA 3ODDA 4X2XA 1K1PA 4MYTA 3RDPA 4RJLA 1A5HA 4N0EA 2F9VA 1AGPA 3K9GA 3QEOA 1SLVB 5DI3B 3LU9B 4A0HA 1IQPA 5CB8A 1AU8A 4Q19A 3MYWA 1GJBB 1U9IA 8GCHG 3THWB 2XWAA 1IY2A 2IW3A 1K1MA 1C5WB 1SVMA 4IKEA 5KUTA 3TJNA 1EB1H 1ZJ6A 3GEIA 5JCPA 4E5UA 4Y11E 1CA0C 1R2QA 3PWCA 3JVVA 3FTQA 3D7MA 1GP2A 2AKAB 2QPTA 1W3CA 1JXOA 3W3AA 4M9SA 5BN5A 1GWNA 4GHTA 3IO3A 4Y0YE 3JVUA 4GOJA 1COWD 1AHTH 1T4GA 4D82A 4DKXA 1C5VA 2R6GA 2J4IA 8ESTE 2WJJA 4JZ1A 3RS0A 2CNWA 3GJ3A 2G1KA 1IBRA 4Q66C 2ANBA 5DHAA 5GWZA 1IQGA 7KMEH 4PPQA 1HAXB 5CE1A 4TWWA 3U4QB 1EUFA 3SEAA 5HKKA 1QR3E 2A4QA 2PTCE 1N6LA 4XIGS 3LH1A 2FI3E 4OS2A 3OE7D 1V5WA 2G51A 1D3QB 2ODEA 3A58B 1DTSA 1S5SA 4DCTA 1Z8RA 1YZUA 4OKSA 4NE2A 2IXGA 3BH0A 2ZREA 1C4U2 3LGWA 3VGCB 2F3CE 3UNQA 1T0JB 1XRJA 3OFNA 4R98A 1O2UA 4DC9A 4NIXA 1IJFA 2BDIA 3MTYA 1GL9B 4AC9A 2ASUB 2QMEA 3AM1A 4Q4HB 1NU7B 1EP5A 2PJZA 1IM2A 1RVDA 2ZE5A 2Y5HA 1GI7B 3QG1A 4EIWA 4I8JA 4KITB 3GFTA 1A5IA 1VDZA 1II0A 5JRJA 5T3HA 2GF0A 2WPKS 2IT1A 1HAPH 2ZGJA 1WU1A 5DG6A 4YZUA 2IJD1 2VIOA 1ELOA 1GMHF 1TQ0B 1CA0B 3LDXH 2FZLA 3MD0A 1M74A 1GRRA 5PTPA 4WBSA 4URWR 4OHWA 2VHJA 1PPZA 4GBMA 4KYIB 4CT4B 1BTPA 1BQYA 1NRPH 4UFGH 1TB6H 3SJZA 1S0RA 1LDTT 3BB4A 4TMWA 4TSFD 5BRRE 1ZM4A 1KLIH 1G4UR 4BWYA 3DA9B 3LIWA 1KMQA 1HT1E 3SI4H 2QXIA 2G0TA 1V2QT 2PEYA 2HCJB 3FB4A 3RU4D 1T3LA 4QBFA 3SFVA 3OIYA 3B9FH 2XB4A 4B3CA 2QAGA 2EFGA 1RIWC 3HP1A 5HE9A 1JJ7A 3C5CA 4HFPB 1R10A 2IYLD 1O2TA 4OS7A 4QBHA 1QHHA 3V7TA 4OGXA 1G36A 2E1RA 1XF9A 4BE7B 3RMLH 5T6DA 1Z3IX 2ESTE 1OW3B 1ZOMA 1T31A 1C5QA 5CK4A 2GZHA 3PV0A 2D4HA 4MYUA 1NMXA 1YPJH 3RNLA 3MAAC 1IOEA 5FI0B 2IF0A 1HDTH 4N3NA 3IKJA 2ZETA 2VQSA 2GILA 4NCNA 2WMNB 2IEYA 5JB9S 3O8RA 5L30H 1E2NA 3T5FH 2I1QA 5P21A 1ZVQA 1BZXE 4ZHLU 5DGXA 1BMFA 4FMDF 2ALVA 1TPZA 3EA7A 3H0KA 1HAGE 1JI0A 2QGNA 4I33A 3L2OB 5JI2E 3KTAA 3M3SA 4W5WA 3P20A 2VL7A 3LH5A 3VNUA 4XBDA 2WYJA 2BJVA 3WHKA 2J2UA 1XFAA 2FS9A 2ZGHA 4LC1A 3MFYA 1GHBG 1TYNA 1NESE 4PQFA 3T15A 1D6RA 1R8SA 1HT2E 1P73A 2QU8A 4HAVA 2G88A 2FZZA 1ZW6A 5DIFA 1MH1A 2G5VA 1C2FA 2CGAA 4GP6A 3PROA 2R8RA 5JB8S 3AV0B 4DLZA 2XZOA 4DB2A 2WJVA 3RS5A 5J4QA 1OH8A 2Y8EA 1GFIA 4TMTA 5EQSA 4GOXA 3VX3A 4V0ME 4JVNA 3BTKE 4UJ5A 3S7HB 1SG8B 3SOPA 4BGDA 1P57B 1C5LH 4TT3D 3ZVGA 1W4BA 5GJVC 4I7YH 1UCYK 5D3QA 5KYKA 1GI5A 4PC6A 2VP6A 1O2RA 1TMBH 1GMCF 5LB4A 4UNQA 1NN3A 5DO9A 1WQSA 2D7CA 2G8TA 4FUFA 4JZDH 1WCZA 4LYFA 2HT1A 7ESTE 221PA 5BWMA 3FZZA 1ZUNB 1QB6A 3LPRA 1JBUH 1SGNE 5AUNB 3NH6A 1C5RA 1GJ4H 1WDTA 1LO6A 2F91A 1XEWY 2AMQA 2EVWX 1P03A 5KO2A 4B2BA 1N5IA 5T6FA 3PLPA 2OV2A 2HDNB 5IK2A 3HWSA 4RKEA 4RD4A 2CN0H 1BO6A 2QY9A 1PZNA 1KJWA 5A0AE 1O5CB 1Q57A 4EQ6A 4C0KA 3GJ8A 2AH4X 1XD2A 3VR1A 1EFHA 4PX9A 3BD9A 2OC7A 1RTFB 3ZH9B 3L43A 1JRSA 3IO5A 4LWZA 5E4FA 2ZYVX 2OXSA 3RXSA 1MABA 4WAUA 1GITA 1SQOA 2DYKA 1MTNB 3FVFB 4IDHA 3RLWH 4RFSB 1SGEE 3GJ0A 1KSJA 1KGDA 4F4JA 1KK3A 2B7CA 3OEHA 5J4KA 1TNLA 4KSCA 4MRSA 4GSYA 3AVXA 1KDQB 2QAGB 2W7UA 3M7TA 4K60A 3B1WA 4AOQA 4ZDKA 1SMFE 4Z8YA 5FUWA 1A2KC 4Y0AA 2XGJA 4ABIA 4XD7A 1O5AB 3BFKA 2BMGB 4UEHH 4RD0A 1K5GA 2C8XB 2FDAA 3BC1A 2ZRPA 5C1UA 2HNTE 3MG9A 3MWLA 4CRBA 1T8NA 2XJ9A 4FCVA 4LHXA 3U1IB 1DVAH 5FHTA 2RKOA 3SNEA 3EW9A 1L1JA 3SV8A 1SVIA 3MHWU 4O2RA 3CRVA 2QM8A 3QIAA 1E2KA 4MKFA 1V2LT 421PA 1ELFA 2CE7A 3SU1A 1E2LA 3GJ6A 4NPHA 3VFDA 4NKRA 4M1WA 2QY0B 1GCTB 1TUIA 3RM0H 1HGTH 4IGDA 4G5OA 3RXDA 2Z0MA 1N6IA 1N6YA 4LPSA 1XXHE 4AD8A 2EQBA 1DS2E 5DP3A 3THWA 5GNDA 1NN5A 4PSAA 1LB1B 4WXIA 1CLUA 4QJ3A 3KJHA 4NG9H 1TE0A 4UJ3A 3PM3A 2ZRCA 1ANBA 5ANRB 3CLVA 1VJ9U 4LOAA 1RTKA 4R7ZA 2IHYA 1UCYE 3R8CA 5JSZB 4A92A 2FEQH 1Q12A 1UVTH 1C2LA 2A0QB 1FP6A 4IW4E 1JECA 4S2EA 1GG6B 1E2MA 1VR1H 5J40A 5KTYA 3IHLA 4FD2A 3FOZA 5GCHF 1YP9A 2XSZA 2EA3A 4CDGA 1A5GH 1CRPA 2QP4A 1GOTA 3PTBA 5TVKA 4X6OA 3X2SA 5C67A 1B0EA 1CGJE 2GCHG 4KYUA 4R2IA 3W94A 1TMUH 3K0CA 4LBVA 1MAXA 4NZLA 1GDNA 2Z94A 3QXXA 1RW4A 2PKAA 2QM7A 1CJKC 1MT0A 1OXSC 3AAVA 1MTNC 1S82A 2PLFA 4Q9IA 3GDVA 3TNTA 1GMDG 2UVQA 3A7ZA 1JOUB 5L2YH 2ZRNA 1HH4A 3OEHD 2DUCA 3A8DA 5JDUB 1SXJE 2XXAA 1FY1A 3SJ8A 2Z83A 2VTKA 1A0LA 2J7PD 4ILEA 2UWPA 2FXRA 2QA9E 5F03A 1F6BA 1E96A 4KI0A 1LVGA 5T6GA 1OFHA 2ZI5A 4KFUA 1C4Y2 2FG5A 5EP3A 5CHAC 2ANCA 3G82C 4IDOA 2THFB 4D4KA 1PLJA 1DVRA 3LLMA 2KAIA 3K9NA 3CF0A 1YZGA 4BFZA 4CVNA 4DDTA 1W1WA 3OSYA 4SGBE 5HM2A 1ZHMA 1ETSH 1UHBB 4FUCA 2HNTF 1IQJA 1OP0A 1SXJD 2ZJ8A 1FY5A 3OHMA 1MCVA 5JHHB 4ACBA 4TYWA 1OH7A 1NVXQ 4BFTA 5E8EH 3CO5A 4A6LA 2SNVA 2VWLA 2YJTD 1EXMA 2IEZA 5EUQB 4YQFA 2G4UA 2B0FA 1F5LA 2A5AA 1TEVA 2P6NA 3OIVA 3TUJC 2NU2E 4FCTA 1KMHA 1GG6C 1DE7H 3W6OA 3PG5A 1Z6YA 1Z6GA 5JWHA 1E3MA 3HYRA 4HDOB 1G32B 2EFDB 3S0NA 2CL0X 1AN0A 3SR0A 1EJAA 1QL9A 3ZVAA 5E7JA 1G3MA 2V6NA 1MBMA 3TSZA 1WA5A 1QJ1B 1O3HA 3MWIU 1E1RD 4MNVA 2J0SA 4B2AA 3SBEA 2C03A 4A2PA 3TK1A 2UUYA 3AB3A 1MTVA 1IN5A 1RYHA 4PC2A 1XD9A 2BLVA 4IVPA 4XDEA 3AVVA 1W0KD 3MWJA 3W6PA 4BFXA 1T8TA 2GXUA 1FPMA 3NHBA 3AF4A 2DWOA 1JALA 4O97A 5GDSH 4PZLA 3SOSA 3U7GA 1E9RA 1TADA 2XJ4A 7LPRA 1QF9A 1TBQH 1C2MA 5KSOA 3U44B 1CR1A 2X19A 1VPLA 1P7CA 4DIHH 1ZD8A 2OUAA 5DP5A 1ZZZA 2ZFRH 5L2ZH 1SBWA 4ZV4A 1E0KA 2Z6BD 1T4VH 1OWDA 2HT6A 1LS1A 1EAWA 2QORA 1TX4B 2VIIA 5JRZA 2RB4A 2JLVA 2HJVA 5BN4A 2VLIA 1O3IA 4MRRA 1ZHRA 1RD3B 3SYKA 3PV5A 3KXIA 1D3DB 3DDCA 2PL3A 3QKSA 3PV4A 1FV9A 4M2LA 1FI8A 3SBDA 3PUWA 4NGAH 1NKSA 4ZCMA 2ZRIA 4B73A 5KU1A 3KQDA 1IHTH 2CMKA 4HZHA 2PZGA 3BFVA 2ZYWX 2Q6FA 1E6CA 2J5XA 2CK3A 4DJZB 2OCYC 3OE7A 2EYQA 4PQYA 3W5IA 1ODFA 1BMFD 4TQUS 2WSMA 4DLVA 2D2FA 2BMJA 1LHEH 3T62A 1KKLA 2G52A 1GRQA 1FTSA 2FLRH 1Q1BA 1G3BA 2VH5R 3HU3A 3T12A 2VSXA 1TGTA 2QE7D 3K2UA 5EXMA 4ABDA 5B2ZA 3AVYA 1JXPA 2C8YB 5C46F 1LY1A 2BVSH 3RXBA 3THYA 1G30B 3C15C 3GYMA 4YO9A 1F5RA 4NA7A 3DO6A 5C2ZA 3K6YA 3PTNA 2PX0A 4B44A 2AIQA 1K22H 1O2GH 1SSXA 3SNHA 3EWSA 1FY8E 1ARBA 1ELBA 4M4SA 4RD3A 1A1VA 3BIFA 1AE5A 4JCNA 1I4LD 4CEJA 3EPHA 3AP3A 5EW2H 4B2PA 2RAPA 4DEYA 2FX3A 2WSSA 3LW8A 4B1TA 3RXKA 1FNMA 4Y6DA 4HYYA 2B8WA 2YNBA 3LT3A 5AJWA 4RZ3A 1SC8U 1RS0A 5CITA 1GBDA 3KIDU 1DY9A 1GG2A 2IS1A 1P2SA 3D49H 4TYNA 3UUZA 3CS0A 2PX3A 3U3JA 2TRMA 4TTRA 2A4OA 3FHOA 2AD5A 2BZAA 1E38B 5G3ZA 1LFDB 2N42A 3Q3JB 2VHCA 1CHOF 2ZTSA 3BH7A 3TR5A 1SKQA 4LBZA 4Q48A 4TL6A 3E6PH 1KY2A 2ZI2H 1NFXA 1Y5BT 3UWIA 1BT7A 4G1UC 1NN6A 4YLGA 2BC9A 3BK7A 3H09A 1OHHA 1H4WA 4URYR 1J14A 2AS9A 2Q9CA 2DE8A 2WJYA 3QKUA 1HEIA 4KELA 3CW2A 2UKDA 2BCJQ 4QRHA 1I2MA 1DLEA 1VCQA 4KV9A 1DAEA 5HMAA 5HCNA 3JZ2B 1YZNA 4A8JB 4DGJA 3TU7H 1ZD9A 1BTYA 7GCHG 3NUMA 1W36C 1NVWQ 1GHXH 3PMAB 2FOFA 4C0AC 4TMXA 1W7AA 1Z0DA 2XW9A 5TDHA 1R0YA 2HLDA 3FAOA 4Z8XA 2W6ID 4M9XA 1BRBE 5FR1A 4X1SU 3P4YA 3QPVA 2G9NA 4X8VH 2QEQA 1KTSB 3EE0B 1K8RA 1FN6A 3OU0A 2ZJAA 5UKDA 3QZRA 4QKQA 2OD3B 1LTQA 3RMOH 1ANEA 3DFJA 1YM0A 5EZ5A 1SB1H 2VH6A 4Q80A 1GDUA 4MA4A 1N8OC 1Z22A 4IN1A 1EWRA 4M1SA 3HYTA 2ZS8A 3G0HA 3RC8A 4ON9A 2ALPA 3IIJA 5JEDA 1KO1A 1UFQA 1W2KH 4IJMA 1YCPH 2EC9H 4A1VA 3MO6A 2ZI3A 4TT3A 1E2QA 3TIFA 4U32A 4OJKA 2QAJA 4Q7MB 1UKZA 1V2MT 2LCFA 2AKYA 1S9DA 4ZROA 4TY7A 3ZV9A 2WV5A 1KK0A 5JBAS 4F4IA 1II9A 1BTUA 1NIPA 1Z2AA 5B6OA 3QGJA 2DFTA 1N1LA 2XCFA 3F8TA 4AKHA 1UTKA 5EXSA 4Q7KA 2FDCA 2FYRA 2K1QA 4FW9A 4NFFA 5KSYA 4AZ2B 3TW4A 1AS0A 4LYAA 1HLTH 1E0JA 1P12E 2AXPA 1C1RA 1YU9A 3ECCA 1GL6A 3W95A 3A7VA 2P3SA 3SNDA 4MNXA 1RRCA 4HI3A 1T3HA 5FX6A 1Y3VA 1GKUB 3OF5A 4DZZA 1SGIB 1XBTA 3VU9A 1NS3A 1EGAA 2XNSA 4F93B 5DH9A 4D9RA 3EPKA 3MNXA 1GBCA 4CIDA 3IIKA 4CEHB 4TYPA 4YT7H 1PPEE 1Z0JA 5DE3A 4FVDA 4IMQA 1UKYA 4WY3A 2LKDA 2N46A 3SV7A 3UOUA 3L82B 2Q3HA 1XEFA 2EYUA 2YYZA 3MWYW 1O2MA 4OI0A 2A5IA 2C9CA 5AUPB 3LVRE 4PHFA 5EXXA 1CT2E 2ZG0H 1DX5M 3N70A 2NU1E 2GRJA 3LH3A 2ONJA 3VNVA 2C77A 2Z4SA 3X1YA 2WICA 2BVNA 1AE8H 1E2JA 4EAQA 4NIYA 5FBEA 1F0SA 2XB2A 4CRWB 1EZUC 5J5CA 1II8B 1WCV1 1EPTC 1QB9A 2ZGXH 1CQQA 2FPZA 3URDA 4MRPA 8KME2 1INCA 3FHCB 3K9XB 2O0JA 1O3MA 2A7CA 2FOCA 2GJSA 3UFAA 2IL1A 1DXWA 4NONA 3TPIZ 4CBNA 3KUDA 1T3SA 1A7JA 1X8JA 3UTUH 2J45A 2LWIA 1AD8H 4X0WU 5FOSA 2ZANA 4R0IA 1QJ6B 4GMDA 2WWFA 2C4FH 2GGVB 2FI5E 2QCYA 3QKRA 3TGJE 2AX4A 5EZ6B 1UKVY 1G3IA 1GRNA 2VHUA 2QPAA 4LHVA 2ZHDA 1FLEE 1J90A 1HAZB 4A36A 4YDHB 2C96A 1NG9A 3UPEA 3STIA 1Z28A 1O3DA 3KNXA 1CRQA 3D62A 4WW0A 1XXDA 1O3GA 3H2YA 3V00A 1D3PB 1UTNA 4RKJB 1O2PA 1P2OA 3QI2A 3JZ1B 5F8TA 1DICA 3ZV8A 5C5OA 2HPPH 4AG2A 2W2TA 1QIXB 3ZVMA 1D6WA 1OYTH 1NLYA 4JIMA 1P9UA 2H8KA 2CMYA 3WY8A 2BM2A 3K70C 1Y3XA
chains in the Genus database with same CATH superfamily
3GCTG 1GJ8B 1JIUA 5B57C 1MTSA 4KLZA 4RORA 3PEUA 5IABA 1LNQA 4MKXA 3GVIA 1E99A 4GG1A 4U0KA 3WJAA 2IJGX 3GJQA 3LWZA 3LXRA 1K6JA 4TGLA 3TITA 1UIRA 1RP1A 3L5OA 1Z0SA 1SBHA 3I2YX 4MS4A 3O74A 3KKPA 6LPRA 2V9PA 2Y93A 1LBSA 2I55A 2VP5A 2ZBUA 4FYIA 1VFNA 4N7RA 3UHFA 1XXFA 4EFDA 3D4OA 3T5MA 1QV7A 3S7TA 1MAWA 2RGXA 2BKUA 4Q34A 5LNK6 4PO1A 4CM7A 3FR8A 3VKWA 2Q5CA 2I54A 1MX1A 2NTJA 1Q21A 3A14A 1UOOA 2AK2A 4GZ3A 1DXQA 4FUJA 2WIAA 521PA 1P61B 3RKRA 3I4LA 5ECWA 3WWCA 1BOFA 2VJKA 3B5JA 5L95A 4HLDA 5FJJA 1KEEA 3MWDB 4TSRA 1NBHA 3DQQA 3HJTA 1JFVA 1NVKA 1BWQA 3O0DA 4D02A 1C5XB 1RM3A 2DC1A 2BMAA 1IHPA 1JSZA 3SEZA 3FY4A 4A82A 4CKBB 2NU8A 3AVOA 2V6GA 4HB3A 5HUQA 3HU2A 3F0PA 1PJ8A 1L5OA 3M89A 2KCPA 2B8TA 1MAYA 1DO0A 1T36B 1UBKS 4DQLA 4K3JA 1HAYB 3N8KA 3GRRA 2A5YB 1NPTO 3QVVA 4IIVA 1GYRA 3TQHA 3MTEA 3R41A 1ZSYA 5ALZA 3TSWA 4KN9S 2I1VB 3R3HA 1JTVA 4HLQB 1KMMA 4OHYA 2PFKA 2XGSA 3LY9A 4YT5A 5IVIA 4DGSA 2RKWA 3AVTA 1WSDA 1ZIDA 2R2MB 2X8WA 3O75A 5G4BA 4OL0A 4YAFA 3TLMA 4YMWA 1UT8A 4KQHA 2ZQYA 1Z6ZA 1C5OH 4S2UA 3ZHBA 3ZS9A 5JRDS 3T5PA 1D8TA 3CLUC 1NN1A 1H0RA 3A7DA 1CGHA 1ORDA 2NT3A 4G4IA 3GFPA 4V3CA 4B4UA 1RRGA 4HX2A 4LPKA 5AVZA 3L3TA 2UWOA 4HK4A 4F2HA 1CYDA 3R9XB 4R41A 1GWAA 1CRZA 1R6XA 2HWYA 2IYUA 3COWA 4XIYA 1XEXA 3K1AA 5IARA 3HCRA 3OD5A 1QVZA 2GEDA 2GVNA 2Q50A 3CF4G 4G4SO 4V39A 1UADA 4G36A 4KXUA 3BMCA 1UAAA 1RACA 1NXVA 2QC2A 1XA0A 2YNMC 4LZNA 5DX8A 4LC0A 5DM2A 1LPAB 5H70A 4O5AA 1HE8B 4DUZB 5HBGA 3BL8A 4KMRA 2C5GA 1CUIA 4MUHA 3I9NA 2J3EA 1X7DA 3UK6A 1G291 3SKVA 3U1VA 2EX4A 1ORTA 4OQFA 3KRTA 3STHA 4JXZA 1JMOH 4QEKA 4L9SA 4LZ4B 1KTVA 2AJLI 4R1MA 5AKJA 3LZDA 3MT7A 4FN5A 5CGZA 1W25A 1J00A 1ZSNA 3HSKA 2Q4DA 4EJSA 3SJ9A 1GGMA 2R00A 1P2BA 4Y2SA 1TPAE 2PFGA 3L02A 3LKWA 4RZHA 3W04A 4BKOA 3WICA 3EA0A 1N2JA 3L8EA 3RTGA 2FO9A 2XE8A 1SKAA 3C8UA 3RWBA 5EPEA 4UMVA 3VTZA 3E3AA 2JFBA 4AFUA 1AKVA 2P2GA 3QMPA 1P6XA 4D42A 5LZ2A 2X9NA 2EFCB 3GV0A 4H2DA 1VYVA 1UPCA 3KAJA 3ZDRA 5HJEA 2D26C 2V8BA 5CBPA 4L72A 4O4IA 3WL6A 3UOAB 3WK4A 1JAZA 3QE0A 3R6DA 4BJ3A 3TNDA 4C6HA 1ID8A 1E5LA 1KMHB 3OY6U 2NUAA 1T91A 3KJNA 1F7VA 3PP8A 1S83A 4RVCA 1T4MA 1QORA 1QZZA 1IUOA 1UBRS 3PGLA 4HHEA 3BWEA 3ZY3A 2A4RA 2C5BA 1XVOA 3R3ZA 1K8YB 3STVA 3CUSA 1TLFA