4B71A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 197
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b71A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b71A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b71A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b71A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b71A03
1HEIA 1DADA 2FPZA 2STBE 3GLIB 2A7CA 2ZI6A 1ELEE 5D3MB 5EP2A 4FUCA 3ZS9A 4RY2A 3FMFA 1FN6A 5EZ5A 1ZCAA 1II0A 3D7MA 4YO9A 2GCOB 3HGPA 1M7BA 1Q20A 2JLRA 4R0IA 4Y0VA 2DE9A 4P0TA 2FA9A 2V0BA 3MU4A 3FMIA 2G81E 3KQHA 3PUZA 1TPZA 1YZLA 3RXAA 2PLRA 1Q1QA 4B2CA 1GI0A 4XDEA 2K5UA 1K1NA 1YCPH 5H8WA 2YOFA 4DUGD 2ZU6A 3WP0A 3VR1A 3U44B 5DGXA 3IIKA 4HB2A 2PJZA 3IDQA 4ACAA 2LKCA 1S3SA 2OT3B 1E0SA 2ZDLA 4LXBH 2SHKA 1NRQH 2Z3CA 3M7TA 3B1VA 4X8LA 3NBFA 3ZVEA 3ONWA 3T1VA 5JWRA 1O3OA 1ETRH 2AS9A 4JZDH 3JZAA 3SN8A 1FL9A 2PCLA 5FHTA 1PQ7A 6GCHG 4F4CA 2OZEA 1P10A 3U8OH 1FPMA 3T15A 3ND8A 5CLQA 2YWEA 2ZGHA 2OBMA 2W2VA 4IC5A 1E0FD 2P94A 1GDUA 1TAGA 2CDNA 1V2PT 4E7RG 2RGXA 1TA2A 1AD8H 1IHUA 1ZGVA 2RGAA 1OH7A 1RGQA 1IY1A 3JVUA 4XSKU 4X1NU 2W5EA 3MU1A 4TYWA 3KCGH 2P8OC 2J0UB 4NYIQ 4Z54A 3ZVGA 3WBJA 3M3SA 1KHTA 4UJ5A 3NBYC 5FTLA 3HKIB 1MKXH 1GI7B 4AB9A 3OFNA 3AAUA 4TL6A 2YHSA 2VL7A 3NC1C 2OO7A 2P5TB 4DDUA 1AI8H 1KXCA 2C93B 4JJZA 1DE0A 1G64A 3RRMA 1F2TB 3H2YA 1W11U 2BDHA 1D9XA 4HAYA 4BFVA 1AQUA 2F9VA 3U61B 2J7PA 2D2EA 2ZR7A 3GY4A 1XJQA 2QQ0A 4AYVB 1O2MA 3CNOA 3L8ZA 3P17H 5LPNA 1Q2WA 1XM1A 1KDQA 2CCJA 2OC7A 1UPTA 3A4NA 4QNMA 1JR6A 1C5SA 3HU1A 1SKQA 1C5LH 3VB3A 2IT1A 1N5KA 2JLSA 4FUFA 5DSZA 2CLCX 4TMWA 2R62A 3RXLA 5AHGH 1E4YA 1MBMA 4GDFA 4DHEA 1TMKA 1A7SA 2GK6A 2PKAB 4JBXA 1TABE 1PLJA 2WWHA 3QG5A 1RXPA 5HM2A 3DUXH 4XWOA 4GLYA 2GXUA 3NVAA 3NEJA 1BTZA 2J3EA 4ABIA 5JBBS 2E87A 2OG2A 4D26A 4R8TB 1HAVB 3BB1A 3OIUA 1XVMA 4NYJR 4URWR 3CW2A 1ZD1A 2FYQA 2JLQA 4OQLA 2GZ9A 4X8VH 4OK6A 2Y5HA 4NA7A 5KNDA 3MGCA 3QJYA 4Z1MD 5DHAA 4N1AA 1R0ZA 1ZHPA 3O8DA 2G1JA 5HZHA 1XX9A 4H1VA 3RXUA 5DYGA 2PZEA 5A09A 2IL1A 3BORA 3RUOA 5E8EH 4I8GA 2RCNA 4V0ME 2NWNA 1OXUA 3OIYA 3WNDA 1TGSZ 1TADA 3BTME 2ORVA 2JETB 1A5IA 3QXSA 5HZKA 3PFIA 3BAFA 5B6OA 2ZIAA 2MMCA 2HGTH 2YWFA 1ZJDA 4FW9A 2A3RA 2R44A 2WVJA 2ZJ5A 2UZ3A 4ARZB 3EZ2A 4URXR 4GP7A 4FVBA 2HYIC 1FDPA 3M0EA 1NMYA 2XXAB 3QY0A 4A0RA 3SZNA 2GZAA 1E1QD 1GBKA 4CH8B 2VP6A 3BTHE 1XDBA 2ZPTX 2FI5E 2IWHA 1SVOA 1RIWC 2YV5A 1S8FA 2QN6A 2ZQ2A 2P67A 3A7YA 4W5JA 1CJKC 1AUJA 1KDPA 4BANB 1QQUA 2QXGA 2BLWA 2GEUA 4A2QA 1S0RA 3ZZTA 3B8HA 1O5GH 5FCRA 3AW1A 3TH2H 4H9GA 2JJ2D 4X6PA 5DI3A 2WPJS 2ZXUA 5B6LA 1HJAC 4PSVA 2F9UA 1UCYK 5EPYA 3EC1A 4HLUA 4JZFH 3M7QA 1ZTLA 1T4GA 1UTMA 2VWLA 2AR7A 1DPFA 3VR6A 1P3EA 1LDTT 4MRPA 3RS7A 1HQCA 3CZQA 1KTTB 2C9CA 2W6JA 4TTQA 2YZ2A 3W3AA 3C14C 5BYJA 3IHLA 1QBNA 2B6HA 1XEWX 5DO9A 1VCWA 1DXWA 1U99A 4KELA 4BLTA 5GVRA 2ODPA 4Q1FA 4Q9HA 1T8NA 3NC0C 1BTHH 4G0NA 1E36B 2QTVB 1E79A 4B35A 2HRVA 1SPJA 2XITA 3RU4T 1BO6A 2TGAA 3AGPA 4H6TA 1W46A 1L2EA 2P5SA 4B43A 1HUQA 1U90A 3WYGA 2XBWA 5JJIA 2F1HA 3KQLA 4JMPA 4FMDB 3OEHA 2ZA5A 3TNTA 1V2VT 1IQEA 3F9EA 4MLFB 2WBLC 2XNDD 5JJKA 1MMJN 2HLDA 2F43B 3IBYA 4HFPB 2B21A 3SU2A 1BRBE 2DYKA 1Z0DA 1GBJA 3FAOA 3GYLB 1U81A 1W4CA 1L4DA 1LKAA 2G88A 3GQBA 2VTKA 5EQTA 1EUFA 1Q3XA 5CK5A 1FIZA 4LZ1H 3RM0H 1L7VC 2O5VA 4W7SA 3RXKA 1XXHA 4D9QA 1T3LA 4E06H 3R8CA 3W9YA 2XJ4A 1EATA 4P31A 3PR1A 3QI2A 2ESTE 4US0R 1JIRA 1WXRA 4I1UA 3U7HB 2D26C 2PMKA 3QXXA 3QXHA 2A5IA 1SVKA 3HATH 1ZAKA 2ZQ5A 4X1RU 2IYRA 2ZUCA 1P2VA 3GLIA 2KI5A 5D3MA 1EX7A 2A5YB 1JAIA 1UCYE 1D2EA 4HSEA 2IC5A 1FUUA 5F03A 2VA8A 2D1JA 3EQ0H 2ZJBA 1F0UA 2PX0A 2P2LA 2ZSFA 3CX6A 2G4UA 4RZUA 1KXEA 1RFLA 3QNUA 2ODNA 4TLAA 4GPGA 5B57C 2YOGA 3TW8B 4IW4E 4TZ0A 4U2WA 1XEWY 2B7CA 3E70C 3PLKA 2ZI4A 1UK2A 7LPRA 3P20A 1ZMXA 1P7CA 2BDGA 2QA5A 2NO0A 2QMHA 3KJGA 4PPGA 3U44A 5C4GB 1FP7A 4HUQB 4Q80A 4LC1A 5A8YA 2B8TA 3LXRA 2GAAA 1SVLA 3RABA 4KFUA 3UREA 4DIHH 1YZNA 3QKRA 3NWUA 3F9FA 4B48A 1G3IA 3PMJA 2FEQH 1TF5A 4CVNA 2R65A 1EP5A 5HXFA 4AIIA 3H09A 3O8RA 4C0AC 1SGIB 2XGJA 3A6PC 3RRNA 4Q7ZA 1ZM2A 1KKLA 1LNZA 3ZZBA 4LJ7A 1WMSA 2GCPA 4M1TA 1DLKB 3BWDD 2WAYA 121PA 2OC1A 3BSQA 1G3QA 3AVPA 3WNCA 5L3QB 5EW1H 2J0QA 3TGJE 3RC8A 1C1MA 3RC3A 2FX4A 2FZZA 3BIVH 4GSYA 4A7IB 3EZ9A 3KIDU 2DY1A 1IY0A 2J0UA 2QNRA 1P60A 3KZ1E 1UJ2A 4AZ2B 3I78A 2ZTSA 1KO1A 3F0TA 5E2PA 1QTFA 3A8TA 1P03A 1BH2A 3QQ5A 1V2QT 1OOKB 2QC2A 1ZTJA 4GHQA 3SQEE 2GVDC 3IG6B 2V9PA 3I3SR 1MT0A 3L0OA 1RKBA 3CRQA 2XBVA 2EFHB 3UIEA 1TU4A 4AG6A 4AD8A 3TSWA 4MKIA 1RD3B 2ZO3H 2EU8A 1F2TA 2GZ7A 2V1XA 1WV7H 1NRRH 1UBCA 5JCPA 3M36A 1EPTC 3SI4H 5ESTE 1C1RA 1CGJE 3AQ4A 3UPUA 3IO5A 1GJ8B 1GI8B 1TX8A 3TJNA 1CBWC 1C2HA 3QN7A 1ZSKA 1KXAA 1C2KA 1PPFE 1O0DH 1X8JA 1G21E 1GBHA 1Y63A 4ZDJA 5CM8B 1BCUH 1JXPA 1G8YA 2PR3A 4X6MA 1DM4B 3ZZ8A 2BEJA 1G3UA 3TSOA 4OYHA 1C9TA 4BZXA 2VNTA 1T0JB 4IHQA 2MSCB 1EJAA 4I8JA 3UNSA 4DLTA 1G3DA 2Q3HA 2PKAA 3ADDA 4K46A 3VKWA 4EPRA 4AFQA 1QHSA 2Z83A 5DN6A 2J4IA 2JH5D 1TPSA 1SMFE 4U30A 1HAVA 2XTMA 1ANEA 2OCPA 3GJ8A 3ZQJA 1BB0B 3R20A 3DMDA 1S96A 4U00A 1U8ZA 5AJVB 3QVVA 1UVPA 3QWCH 1F6BA 5IRCD 3IIJA 1FI8A 2B92A 2VU8E 3ZZ5A 5J5CA 1MRSA 2GJ9A 1Y8TA 4LJ5A 1GPZA 3X2SA 3GCOA 1SB1H 1QBVH 4JYUH 1FQKA 2EFDB 4CEIB 2PSYA 5J47A 1F7ZA 2WYJA 3PUWA 1XTRA 4JJKA 3KUCA 1A4WH 4RFVA 1BBRE 1YP9A 1MCTA 3L0IB 1KOFA 4G3XA 4LDJA 1N1LA 2FTMA 1KSGA 1U0LA 4QNRA 4ARZA 2KAIB 3NBZC 1V3XA 1CR0A 4QXAA 3I32A 2BQ7B 3SFZA 1RTKA 3RXVA 5DYIA 4PZZA 1VR1H 3KKMA 1N6HA 3SYNA 4BXWA 3CRRA 2NPIA 3TJUA 4LGMA 4NE2A 1V2ST 1P8VC 3GDUA 2YYZA 3KQDA 2QMUA 3PLBA 3KQEA 5CB8A 1O3AA 1ESBA 3SC3A 4B74A 2THFB 4YMVA 4NYMR 2OQ5A 2XC5A 1IAUA 4JZEH 1RRKA 5SZJA 3SORA 1OPXA 1P72A 1RJXB 3MUFA 1UBGA 1S82A 2ZJOA 4V03A 3TQCA 3LY5A 2C9OA 4LZ4B 5DNYB 1BUIA 2BV3A 2WWIA 4LPKA 2ATVA 3P6ZB 3OEED 2ZI2H 4LBVA 1FTNA 1W7AA 4FMCF 1D6RA 4LV6A 1V43A 1JWTA 2DFTA 1HAZB 3M61U 3FGNA 4LBZA 3ND9A 1EJMA 4EJSB 4NWLA 5LGOA 1ZUHA 1Y3XA 1U9IC 3RXMA 2ODQA 3KXIA 1ELAA 3SQXA 4RD6A 3LU9B 1WF3A 1VCOA 3FZDA 5AUNB 2QXJA 4XD7A 2ZM5A 1E2KA 3UMFA 5BQ5A 2AFQB 1VG1A 1E98A 3BH0A 1FLEE 1TNHA 2NO6A 5AUPB 4C0KA 3FHTA 4INLA 5DG6A 3CPHA 1R10A 1Q12A 1NM6A 3K9HA 3ZVMA 4UNRA 2A4GA 4YM9A 2FP7B 1ZC3A 3R3GB 4ZMAH 4YXWA 2ZS7A 4B32A 3MFJA 2F43A 4RFSB 4SGBE 4YONB 2HWLB 4HI0E 4KTCA 4YQFA 3LIWA 3RLWH 5A8XA 3V13A 3EA9A 2ZS9A 5F9FA 2C8YB 1R8QA 3I29A 1SLVB 1U0HC 2VH5R 2ZJAA 2CK3D 1IAQA 4ZO4A 2R9VA 2QQEA 2QORA 4JCNA 2FZ4A 2DBYA 1VYVA 2F3RA 3C27B 1ACBE 2STAE 3KKNA 4UFEH 3SJBA 5CLLA 4DCTA 2FV8A 5EP1A 4MPXA 3D3QA 3BB3A 1EFRD 4LRWA 4M1OA 3LQQA 1QL9A 2MSDB 1JOUB 1BMFA 3RXFA 3PMHB 4AC9A 1QB6A 1TNGA 2ZYTX 3ZZ3A 4JLJA 4YC7A 4RI0A 1HAHH 2WUCA 3CLVA 3ZZ6A 3I77A 1Z1IA 2GBLC 1GHAG 2WSMA 2J46A 4Y71A 1W7GH 3E2IA 2XB4A 2XCNA 4LHZA 2ZEBA 2FGJA 1GJDB 1OS8A 1Z0AA 1D6WA 4MQAA 3X1DA 3ZZ0A 5J4SA 3A82A 3V00A 2BD8A 1Y3VA 1RTFB 2FOLA 3GY7A 3SNHA 3GFTA 1BMLA 2RGNA 2BBOA 3EYDA 4HUQA 1KK0A 3W95A 5K8TA 1MBQA 1O3KA 2BD5A 1H1BA 1M7GA 9LPRA 5D3QA 3C8UA 1TX6A 1AZ8A 4KLZA 4NFFA 1G5TA 5DK1A 5FR1A 2AIQA 4CREA 4DVGA 1CIPA 4ZKNU 2TBSA 4J2YB 1S6HA 1O3JA 4BFWA 2A5KA 2UWOA 5EODA 1W1WA 2OUKA 3DL0A 2GF9A 2H5CA 4NYIR 2Y7XA 2GHIA 2GV6A 1UVUH 5TARA 5L3QA 3RXBA 5LH8A 2WM9B 1G8HA 1E0KA 4S2EA 2WWWA 5FBRB 1ZOMA 1X8KA 2R6AA 1O2SA 2VHTA 2H2ZA 1ZPBA 2G5VA 5F6MA 2W0SA 3ICQB 2WWGA 1HXFH 1KO4A 1RS0A 2H57A 2ZFTA 4WVPE 4Y0AA 4KFTA 3PJRA 5KYKA 1T8LA 2BOVA 2VSOA 2TPIZ 5L8VA 1P04A 1D2NA 1E2QA 4JLVA 1UADA 1P2MA 4U01A 3GJ0A 4Y8XA 3N2EA 3OE7D 1YC0A 1DICA 1TYNA 2P6RA 2VP5A 1E1RA 1AZZA 1LW7A 1TTTA 4B3GA 4A8JA 2X2EA 3U4QB 1TNLA 1A1VA 2RGCA 3CRVA 4URVR 4BLQA 1UKZA 3PENA 3A86A 5BYKA 2BLOA 4PPQA 1LS1A 5FOVA 1P02A 1CKEA 1LHEH 1UEIA 5DP6A 3ZVDA 4E03A 1QHGA 1XXDA 2AKAB 5AR1A 1YPKH 1B0UA 1KYIA 4M9FA 3QKTA 1LHGH 4DZZA 2J7KA 1RJ9B 1Z47A 1IXSB 3W90A 2NZ8A 3STIA 2W26A 4ZIRB 4NA8A 4A6XA 2AWNA 1UVSH 1COWD 1ELBA 1OKKA 2EC9H 3RC6A 1XMIA 2GKVE 3GDVA 2FX3A 2ZFRH 5P21A 1ETUA 1FAXA 1GBLA 1UJ1A 1GKUB 1XRJA 1ODFA 1XUKA 3ATWA 3QF4B 2HVXA 1E4VA 1CGHA 1DAEA 1LCYA 2J92A 1L0ZA 5FBQB 1LB1B 2Q6GA 1SQ5A 3BRWD 4JSYA 3FHCB 3V9PA 2VIVA 5DI9A 1P61B 5TVKA 4O2RA 1FPCH 1RRPA 4OGYA 3LX5A 4ASUD 1T5IA 3KUDA 2AMQA 2AD5A 1TGTA 1GMDF 2H7VA 1A2CH 2BX4A 4CEIA 4K1TA 5TY0A 1GI1A 1BRAA 3F9HA 1SULA 2F7SA 1OX1A 4OM9A 3FVFB 1O2LA 4ABEA 4WAUA 1O2HA 3KNXA 3P27A 1TEXA 3U3MA 2WOJA 4O25A 2KAIA 1Z07A 1N0WA 1JR3D 2VJ1A 1V2LT 2ANWA 3K9GA 2BC9A 1ETSH 821PA 2FFBA 3IUYA 5KPDA 4ZXYH 4ZAEA 3CR8A 1O5BB 4UKDA 1PJRA 4JL6A 3LBNA 1D4PB 3SI7A 5JJLA 2OSBA 1MTNB 4C0HA 2KE5A 1KXDA 2CNWD 4KYIB 1XFAA 1CA8B 1GJBB 2EFEB 2P0EA 2A9KA 1XUJA 4BWYA 2DUCA 4F4OC 4KFRA 3GLHB 1O3IA 1B0EA 3LH5A 3BTFE 4DSOA 5EXNA 2R9PA 4FXGH 2Z94A 2WPIS 3L8YA 2W00A 4IVRA 4KSCA 1TA6A 3SBEA 4KJZA 5LD2C 5JMTA 2IA5A 2AEIH 5B58C 2O8CB 4I8HA 1BA8B 2H6MA 1FY3A 4X8OA 4EJSA 1LF5A 3RDPA 4DCDA 1NNEA 1Z83A 3UMSA 1KK2A 1ESTA 4CHAB 3RS4A 5G4BA 2VRWA 1GJCB 521PA 2AXPA 1QF9A 4HDOB 1ZRHA 4G5SA 1OFUX 5JCZA 3ZZCA 4LYFA 4FN5A 1HNEE 4UNNA 3A1UA 4RD3A 2AKYA 4IOLA 1S6FA 2ZGJA 1O3NA 1E9BA 3RXEA 7KMEH 2JLXA 2AERH 1E99A 2OXCA 3FWYA 4JBYA 5FTNA 2BKUA 3CX8A 3MO9A 2YWGA 2EQBA 2OLJA 2J59A 4RFSA 1QURH 3AVVA 4XWKA 1W2KH 3P4YA 4URYR 1BTWA 3FMOB 4DT7B 3BEUA 2QXHA 1NN0A 2ZGCA 4NIVA 2WKQA 2BM2A 1KK3A 1S9DA 4BTUB 2X8AA 3PMBB 3HP1A 3MWJA 3U69H 1C2FA 2GRJA 4Q1BA 1C5UA 1ZPZA 1T32A 3FKSD 1KO7A 4Z1MA 1TNDA 1KXFA 3SYJA 2XOKD 4QT8C 1BMAA 2REOA 1JECA 4CRBA 4O03A 4OHVA 2AMDA 1L4UA 1QG4A 1WAYB 3SUFA 4Q4LA 1C5RA 4POAA 1CR4A 1J9CH 4DRZA 1VG8A 4F49A 3UQOA 3FE2A 4LX0A 3ADCA 3SYKA 1ZUNB 3KQUA 4H6SB 5FUVA 3MU5A 1P11E 1NIJA 3GY3A 2WWYA 4WF8A 4OHYA 5FBIA 3U7FB 1KYNA 5ETXA 2NO7A 4KITB 5CDFE 4Q2KA 1E1QA 5H1YA 3K53A 1KMHB 1VGCC 1NU9A 3RXCA 3E90B 2QRNA 3AGQA 1GBDA 5EQQA 3CIOA 1IJEA 1CHOG 1BIFA 2A5FA 1R2QA 2WSSA 4OK3A 4HB3A 2QAGC 4U32A 4WBSA 3CPEA 1AN0A 4Q4AA 2V35A 4PHHA 4DEXA 4MQBA 3S1AB 2JJ2A 4BNRA 2BMEA 3S7HB 5L6NH 3U3KA 2FYRA 4Y76A 3VNUA 1N5JA 3PO1C 4Q7MB 3LJOA 4X6NA 2JEOA 2F9MA 2PTCE 3DVLA 2A30A 2GDEH 2X19A 1Z6EA 1N5IA 1AE8H 1YE8A 2D3WA 1C5YB 5G41A 4NIXA 4BFZA 1F0RA 5GJBA 1U6QA 3TH4H 4I32A 5K7RA 4PHGA 5T1VA 3P95A 4MUBA 2AL7A 3MTYA 2ZE8A 3K9NA 3P4XA 4C0BA 2HV8A 3EIEA 5DP8A 5JBAS 5HTKA 3GLGB 1DOAA 1SVWA 4DG4A 4KP0A 1R5BA 1L1GA 4NA9H 4A4DA 3IPXA 3BTQE 3U4QA 2CV3A 1DUAA 2ZSEA 4O3MA 1E37B 4HDQB 2PHBA 4QKQA 4OS1A 1ZM7A 3SV9A 1P2TA 3LGIA 1EXMA 3NCLA 1RZ3A 3OF5A 3STJA 1KI7A 1TMTH 1VITH 3PEYA 2RCEA 4TY6A 1MO6A 3LVRE 3RMMH 1SXJD 4ZIRA 3MYWA 3IKJA 2J7PD 1AM4D 3RC5A 1QRAA 1XPUA 1XEFA 2GCTC 1NY5A 4I1SA 4H4FA 5CE1A 4CT4B 1TE0A 1F5LA 4D81A 1U2RA 1YGCH 4XOJA 2OC8A 2G55A 2AK3A 4B3XA 2ANBA 4NTZA 5IYTA 2KBEA 4TPYA 5JB9S 4YLUA 5JBTA 1TB6H 4FUBA 1Y5AT 4D0LB 4MGZR 1MAYA 2BVSH 2SGFE 1OLOA 4XVUA 4ABJA 4TLDA 2JLUA 3HPRA 4ZDIA 721PA 2Q3FA 6CHAB 1E9CA 1E0AA 1C5XB 2FPMA 2B7DH 3QIAA 1GL1A 3RRYA 5F8TA 2BB4A 1HAXB 3TR5A 4IEIA 4P32A 3Q76A 2IUTA 1E2GA 3LFUA 4UE7H 1PYTD 1Z8IB 2C4FH 2CL0X 3M35A 1T91A 4XJXA 2P3SA 3SBKA 1EZUC 4C4PA 4QRHA 3PWCA 2FFQA 3SEAA 1DAFA 1O2VA 2ZU1A 3WYAA 1W0ZU 3EDXB 3RXOA 4BEBA 4DWJA 1R7RA 5B30A 3VXEH 2IWRA 3TGKE 2BJVA 3AVUA 1KNQA 1NKSA 1OHHD 1NRPH 3DFLA 1MTSA 2Z9KA 3OTPA 1TGNA 3AVOA 1ID5H 3AKYA 3LGVA 4NBSA 5T6GA 2IK8A 1V2UT 4C7OB 4C0SA 2HNTC 3RXPA 4B3DA 1QR3E 7GCHG 1UKVY 2DCUA 5FUWA 5FOTA 3QTOH 1ABJH 4PQRA 4TMVA 4KV9A 3GLHA 3O47A 4X8UH 2WPLS 4CRDA 4IRUB 1P9SA 2HCBA 1C2GA 5GVSA 4M8NE 2H17A 1JB1A 4FUIA 1WBGB 4R71A 1XMVA 2J95A 1O2WA 2C98A 1E2LA 4QGAA 3FP6E 1RTLA 3V7TA 1PPHE 2ZREA 1C2EA 4AI6A 2O8CA 2P8OB 1BTPA 2HEIA 3Q85A 3ZQ6A 3EPLA 1HE8B 3AP3A 4DLYA 3MMGA 2Q9BA 1P2UA 2PMDA 2ZHFH 2KB0A 4ASHA 1NBMD 4JYVH 2JLWA 4AX9H 2UUJB 1YBWA 2W6JD 2W3IA 2J9NA 4X1PU 1GMCF 1UBFA 2H9EH 2KSQA 1C5QA 2ZITA 3D31A 1SGFA 2YJTD 1NT1A 1O3FA 1E79D 5AUQA 1HV8A 2GZHA 1AE5A 1O5FH 1C5TA 5DISB 1E32A 2BMGB 4IMQA 3E5HA 1QHHB 1G3EA 3MJRA 1ELCA 3LONA 1NP6A 4IW3B 4MKFA 3ZH9B 4HLUC 4B2AA 5KDDA 4WMDA 2NU4E 3AASA 1TRMA 2DWQA 3OEHD 4QJ5A 4YMSA 1SOTA 1MTUA 2FOMB 5JZVA 1TU3A 3RWOA 3ZDQA 1KXBA 4PPNA 5E3HA 4LOYH 2OBNA 2D62A 1Y3YA 5L2YH 4GL2A 1XEXB 2ZR0A 3QEOA 4HAZA 4KLNA 3QK1A 4MPUA 5JEDA 2F4LA 1US8B 4UNQA 3UWOA 3GJ3A 4M0LA 3MU8A 1CT2E 5KSOA 4DXAA 3FP7E 1DBSA 1C5OH 3QENA 4ZPXA 3T5GA 3T35A 3ZZ7A 1QRXA 2G3YA 1C5NH 1C1OA 1G16A 2ZE6A 1LHCH 3UPEA 1DWCH 1NFYA 4K3JA 1MKWH 1N6RA 1AZSC 2CMYA 3TK1A 3LNCA 1OIXA 1KY9A 4G1UC 4MA4A 5AVDA 3G0HA 3NH6A 2GCHF 1G3BA 3RC4A 1CT4E 1XUIA 4LYAA 3HKJB 4IEEA 1HY3A 2VGCC 1T7CA 5C1UA 3ATLA 2WIBA 1H4WA 1CJTC 2ODBA 1V2MT 3E91A 2QCYA 1DARA 5DKMA 5DP3A 5C4MA 3DKVA 1P3JA 3B1YA 3T34A 4DIDA 4OI0A 3I73A 2PUQH 4UONA 3J81k 2PV9B 3LKWA 1E9EA 1KMQA 4Q9JA 2DWPA 1FMJA 5GXPA 5AJYA 4RKFA 4ACBA 3A87A 3F68H 1HV7A 2BYAX 4Q7JB 1E3MA 3GY8A 2C03A 4JSTA 3L0SA 1TRNA 1MTWA 4W5HA 4F91B 1RIWB 3S1AA 3QZRA 4PFSA 3PITA 1SVPA 3TPIZ 5F8ZA 3UOUA 4KO8A 1J8MF 4IBLH 3ATKA 3OEEA 3SHCH 3RSOA 1MH0A 2QP4A 1GHYH 3JZMA 4UDWH 1G19A 3ASZA 3CWZA 1W47A 4QGFA 1CA0B 2YVUA 1GMHF 2F3TA 3Q3JB 4LJ9A 1HJAB 2Q1JA 1LMWB 3BEIB 4G5QA 3AF1A 1PQ8A 2OQUA 2ZHQH 4ZI3A 4BUJA 1LHDH 1GBEA 4Q7XA 2AGEX 2PUXB 1BITA 1SGRE 2B5TB 3Q3YA 1ARCA 3RMLH 3CF0A 2HNTF 3MWLA 1VJAU 5DLQC 1GI2A 2PT7A 3TRFA 3IIMA 4IDPA 3TE6A 1IQFA 4Q4JA 1K5DA 4IMZA 2C96A 2VIIA 5EXSA 2ORIA 1AS3A 3V3MA 4Q9KA 4JIMA 4YMUA 1XPOA 5JWOA 1LVYA 5E0GA 2WJHA 4LJ8A 2RA0A 2CK3A 4D76A 3M3TA 4HAVA 4TQUS 4NG9H 3P8FA 4DCNA 3ZV9A 1CLUA 2A31A 4UQOA 5EE9A 2IS4A 2CCGA 4XVQA 1DSTA 1UDWA 3U8RH 2XX3A 3D65E 2HF8A 1HCGA 4GOKA 2QU8A 1YLCA 1EFRA 3LGYA 2ZJ8A 4U02A 2JASA 3DO6A 2VP9A 3W6NA 1C1SA 4MRVA 2QPOA 4FWIB 1PPEE 4R7ZA 5AJWA 5A0AE 1IQIA 1MUEB 1G2MA 3HPQA 4HZHA 1F5NA 1H8ED 3CBQA 4GAWA 3BIUH 1C2MA 1VMAA 4JVNA 1W4AA 3I4LA 1G5RA 2QI9C 1KLJH 2O8TA 2GGVB 2R2WU 4QBHA 1EZXC 1SGCA 4M21A 1NL3A 4BLPA 3GICB 4OBEA 1VCQA 1SXJE 3M3VA 1LTQA 3SJZA 4XTRA 3SUDA 3OU0A 2IJD1 2ZVPX 1T31A 3A85A 4GFDA 4BLOA 1EKBB 2WKPA 1CJUC 4X2WA 5EQSA 1ZLRA 4JYBA 2FDAA 1XTJA 2QL6A 2TGTA 3BFKA 1O5DH 4DLWA 3LGTA 1G20E 4EDHA 3MU0A 2SFAA 1KSJA 3Q8XB 3B1XA 5DGJA 2C3SA 3U2QA 1CJVC 5CYPA 2GEDA 2BBSA 1RRCA 4LJYA 2XNSA 4FMCB 1AHTH 3RM2H 3MNBA 1SGQE 5LPEA 1EB1H 3NXSA 3T61A 4ABBA 1CHGA 1O5AB 2V6JA 1LVOA 1IOEA 2IF0A 3NIBA 1CBUA 1F2SE 1VCMA 5HGGA 2ALPA 1VCPA 1O87A 5DP5A 1A0LA 1KI6B 5J4VA 2WICA 1C4U2 1Z7KA 5C5OA 3RSLA 4I81A 1OWEA 5K8UA 4B6EA 5AWFC 3BG4B 1OP0A 2O8LA 1J2JA 1OFTA 3EW9A 3RXRA 3OE7A 3GPLA 2SGEE 4TTPA 1JIMA 4K8YA 3RVBA 2GNOA 4NKRA 2BDCA 1E9RA 3LO5A 1TALA 2KJQA 2D06A 3HWSA 4FUGA 1Z6GA 4JVLA 1O2UA 3SV7A 2CHVA 1HAOH 1XZPA 1G7CA 1ESMA 3GLFB 1DX5M 1WOFA 1TGBA 1N6LA 3REFA 2M5TA 3KQKA 2JATA 1HGTH 5E7MA 4ABAA 1QG2A 5J4LA 1KY2A 4JLBA 5C1XA 1COWA 4E5UA 1XP8A 1EPTB 3CENA 1MU8B 1ZM9A 2ZFPH 3A58B 1CBWB 4BAQB 3AP1A 3CF2A 3ITIA 4TYYA 1QHHA 3LBIA 1A3BH 4R2IA 3SS8A 4A6LA 4N0EA 4HTCH 1E94E 3HPTB 1P2KA 4EPTA 1NSFA 4X2YA 1MQ6A 3EXAA 1SQOA 1QB1A 1NLYA 3BD9A 4D4KA 3VB5A 4M2LA 4LBWA 5JRJA 1R5NA 2QF3A 3C5HA 1MKYA 2FX6A 2Z4SA 4IXMA 5FOXA 1XEXA 2VP4A 3REGA 2ZRBA 2XBYA 4ZKSU 2JH6D 3LGWA 4ASUA 2BMFA 1ZBDA 1G41A 2RB4A 4NSYA 5E95A 3MH5A 1E6CA 3A8CA 2RHDA 1WXQA 4AY2A 5A8ZA 3DOEA 1HYLA 1K1OA 2UUFB 4K60A 4DT1B 4KAXA 1MTVA 1GTVA 2HPQH 2ZDNA 2HYDA 4IJMA 1Q31A 2ZHEH 3R7WB 2GJAA 2FOBA 3FDIA 1Z29A 1Y5BT 3UNRA 2XZPA 2A1DB 5JEEA 1GHWH 1VG0B 1YRBA 2CXXA 4QL3A 2R3YA 1X86B 4H42U 2IW3A 1KIGH 3HYTA 2JDIA 2PZFA 3NTUA 2Q6FA 3QTVH 1GBIA 1JR3A 4XH9B 3OHMA 5C18A 1TMBH 1T5LA 3VAAA 3SU1A 4F38A 4MITA 4XSHA 4MGKR 3SU6A 3LXXA 3ZS8A 2V1UA 5C2JB 2XCFA 4RCZA 2WIAA 2CNWA 1EB2A 4MVNA 4QOSA 1ZHMA 3E8LA 1JJ7A 1XD8A 1L2TA 5A5GA 3P70B 4NWKA 3MWKA 3LPRA 1W5TA 1PPBH 2YOHA 4MRNA 1S85A 2GT8A 1Y59T 1O2YA 1RFNA 4JLDA 1UCYH 3AKEA 1EQ9A 4H1UA 2FOEA 2FFHA 1ZJKA 4X0WU 1UDXA 3GLIE 3THYA 2BHGA 3KKPA 1HAYB 1ARBA 1RC8A 1Z22A 4AORA 1W36C 1TBRH 7ESTE 4OKSA 1KNXA 1IN7A 1J17T 3SHFA 3A4MA 4LV5B 4IOMA 3ECCA 3CZPA 1DVRA 3VB6A 1WDTA 4HZUB 1H8HA 1C2DA 1ZNXA 1D3PB 2J94A 1NN3A 3T5DA 2RGNC 3SUEA 5BN3A 2ZZUH 2ZRPA 4OQNA 4S35A 3RS2A 2ZHDA 1GI5A 2G8TA 2X77A 2TGDA 3K9LA 1WUNH 2FM2A 1V5WA 1G1MA 2QP3A 3KJHA 1S4QA 1O3GA 2VWNA 4JLNA 3QUMP 1GL9B 4ISNA 2Q6DA 5FX5A 3HYRA 1YKSA 1ANCA 2ZDMA 4K1SA 3AF2A 5H68A 1EASA 3E16B 4GMXA 2NQ2C 2G9NA 2GV7A 4NIWA 4QGGA 1DO2A 4BAHB 4YDHB 1Y3AA 3SN6A 4QM7A 2ECKA 1EAIA 1P6XA 1DWEH 4O2LA 4OQFA 1TRYA 1G6HA 4INKA 2FFAA 1UVOA 2WWFA 3SFVA 2O0HA 3ADBA 3WP1B 1YPLH 4D4MA 2HJGA 2BMDA 1J99A 1FNIA 3BOSA 1W48A 3FKSA 3TSZA 1SVSA 1YU9A 3L6PA 1QQ4A 1O2PA 4BOHA 2DFKB 2XOKA 4L4UA 1T0HB 4ZDKA 2B0FA 5IHPA 4KXFB 3V4RA 1YM0A 4IDNA 3EAQA 4EPWA 1KO5A 3T5FH 1JQLB 3L2OB 3PB1E 1V2WT 3ODFA 4A8JC 1T3HA 1D6JA 5KDOA 3TUIC 1TBZH 3VR4A 1SBWA 2GJKA 4Q9IA 1AFQC 1FUJA 4ON9A 5CIQA 1DPOA 1AK2A 3SJ9A 2R6DA 3L0PA 1HDTH 5FPYA 1XU4A 1BZXE 1G9XA 1K5GA 4JYCA 5EZ6B 4RKJB 4EIWA 2XW9A 1F5RA 2YC2C 4TMKA 2JIZD 3KJEA 4WZAE 3B82A 5EJEA 2CL6X 4TWZA 1QHRB 1DELA 1JMOH 4OHZA 1EX6A 3THOA 2NU1E 2QENA 2ZCLP 3RLYH 2FLBH 1KTVA 2JJ1D 3CX7A 1KI2A 2Q3MA 1SGNE 3L82B 2NU2E 1TGCA 1A3EH 1GBCA 1T3SA 2F1JA 2V7QD 4DBLC 2VIWA 1GVKB 2QUZA 3S69A 1N6OA 4DIIH 4CZ2A 2R6FA 1DFPA 1FZQA 2ANKH 3VGCC 1ZVQA 1YR6A 4K5ZA 4CRCA 5EE3A 4DLZA 3PEUA 4YDSA 2NOAA 2FI3E 1SL3A 1AKSB 2IYVA 2BXUH 3K8YA 2VVVA 4HZIA 1OE0A 4BLSA 4LC0A 1T6NA 2NMVA 4ZUHA 3CH5A 3EC2A 4YMTA 2UUYA 1SQAA 3RU4D 3F9GA 4IVPA 1B0FA 2OP9A 1Q44A 1NIPA 1EFHA 2YNMA 4DB2A 3E1SA 8GCHG 4X6OA 3GISB 4MGIR 5HKKD 2VHUA 1J8AA 1JPJA 3BS4A 4MRRA 4RD4A 3RP2A 2J2UA 2ZROA 1SGWA 4NU0A 2BOHB 1TPAE 1YPMH 3BTKE 1BMNH 1FTSA 4BLRA 1DXPA 4XBBA 3RXTA 1AIXH 3EE0B 2DR3A 3SYLA 1TQ0B 1ZGIA 4GRAA 2R3UA 3GYMA 4CDGA 2B8OH 3UWKA 2A7QA 4P4SB 2V6NA 4DC9A 1OB2A 1KDRA 3SI3H 4KODA 1G7TA 1KJZA 4C3ZA 3GJ4A 2VIOA 4A2PA 1THSH 5C67A 4MUAA 1O36A 4VGCC 2CHAC 3SU0A 4RKEA 1OWJA 4NHOA 2AXNA 4FUEA 3PV2A 3GLFA 3SGQE 1Z1JA 5TMPA 2A5DA 4WOPA 1T8MA 8KME2 1NVVR 1X8LA 4IFEA 3JVVA 4JZKA 1SXJA 4FCWA 3QVUA 3WRXC 4PO1A 4PSKA 1EPTA 2TMKA 1I4DD 4NZLA 4MDFA 1TQ7B 2ZE7A 1JPNA 1K1PA 1P12E 1KY3A 4WH8A 1KI3A 4JMYA 2XYAA 3MJHA 1Z6XA 4KBFA 2ZFSA 2GXSA 3AH8A 2FEOA 3LV8A 2F9BH 2CBZA 3RXSA 1N6NA 4BRWA 1OXGA 3IITA 5FR2A 1K1LA 3ZJYA 3M6AA 1A5HA 1NVWQ 5CK4A 4TN1A 3IGFA 4QC2A 5JB8S 1OFIA 2VLIA 1CRQA 2J87A 5E0JA 1GI3A 1GWNA 1C5ZB 2OCYC 2FOHA 1T8UA 4A92A 5FH9A 1E0JA 1P2OA 3GY5A 4K69A 4LI0A 3K70D 3IPYA 4M1SA 4NCJA 3TW4A 3K9XB 2ZECA 1LVGA 1FUKA 5M04A 2CL7X 2K1QA 3RLFA 4CRWB 4DJTA 1SHHB 4JT4A 4CEJB 4DT1A 3EPHA 6GCHF 1EFUA 1M7HA 2JLVA 2V55B 3T12A 3R7WA 1Z8JB 3U3OA 4F93B 4GPTA 3TQFA 1TMUH 2F91A 5SZHB 5TDHA 2AN9A 4M1YA 2ZPSA 3RS5A 3TITA 3ZZUA 2GD4B 3UNQA 5EUMA 1O2XA 3SHWA 5PTPA 4X8TH 1K6MA 3B9FH 4RZ2A 1C1VH 1OHHA 3A88A 1N8OC 3K0EA 1W5SA 1QL8A 1FNNA 2IJOB 1MO5A 2ALVA 3OZXA 3GJ6A 4INHA 2ONKA 4BAOB 3RXIA 4Y0ZE 1ZW6A 3LGUA 1S9HA 1K1IA 3BXZA 2FESH 1KI1A 1GVZA 2A32A 1A4RA 4DKXA 1TF2A 4TMZA 1VITG 1SGTA 2ZU4A 1KLIH 5TJXA 4YMWA 3GEEA 1P2QA 5EP3A 4DLVA 1ZSJA 2AFIE 3ADKA 2WSSD 3K6ZA 3SOPA 1WA5A 1LQEA 2F1IA 1OWKA 5G3ZA 3DHWC 2FLRH 1Z0FA 2BD4A 1XJ0A 4AURA 1JBKA 3KTAB 3KQNA 1XUGA 4NYJQ 4CF7A 3QZQA 5TXGA 2ZRCA 1CS4C 1G17A 1BTUA 1YPGH 3QGNB 3FPAA 1OWIA 3FYHA 1FIWA 1WQSA 4HZUA 5HE8A 4Q7LA 4WH6A 4ZCMA 2VBCA 1NBMA 4R98A 4TTRA 1WBDA 2HT1A 1Q57A 1ESAA 1E2NA 2Z9IA 3AUXA 5EXMA 1NVXQ 1G291 2WAXA 1W4BA 3OIWA 1ZR0A 3PCRB 1O3EA 3EA5A 1G4AE 1U9IA 1IQHA 1CULC 1XVOA 1OKXA 3CPJB 1M1YE 3QG1A 3DMNA 2XNIA 1SKYB 2VO1A 3DFJA 2ZJZA 2ZWLH 4PC1A 3EAJA 5HPYB 4Q48A 3SNDA 4MNYA 3MD0A 5EUQB 1JXOA 1RE0A 4AN7A 1JAHA 4MYUA 4AKIA 2IN2A 5KU1A 4ZV4A 1EOJA 4IOKA 5BN4A 1GRNA 4JYTA 1UAAA 4Q7YA 2R2AA 3WHLA 1GFIA 1VDZA 4WMEA 3LC5A 3D49H 1SI5H 4X1QU 3LRPA 4GI7A 2HUPA 2W2TA 2C99A 3FFBA 1EXFA 2IBMA 4R9UC 1WSSH 1NU7B 1SR5C 1N6IA 3C15C 1XTSA 2EW1A 4GVUA 4D80A 5GPIB 1QDEA 4B1TA 1P0SH 1ZMJA 2ZAMA 2IYTA 1FNMA 4ISHH 4TT3D 3GY6A 3SE0A 2OFWA 4I99A 3TGPA 3ZD7A 4UFDH 2R6CA 1D3QB 2ZI3A 3LH1A 1NC6A 3EWAA 5FOUA 3KL6A 3I61A 5L3RA 1IN4A 4B71A 1N0UA 3KKOA 3SU4A 2P6UA 2FN4A 4MKHA 2H1LA 2H8KA 5F9HA 1FMGA 4ZKRU 2GCOA 1AMHA 1GJ9B 1DWDH 5FPSA 1GG6C 2ZYWX 1VJ9U 4IGDA 2GP9B 5H70A 2GBLA 2I6QA 3NKVA 2IOTA 3K0CC 2QXIA 3U1IB 4URUR 2QPAA 3P8OA 3RAPR 1K1MA 2Z4RA 2O8UA 1DAIA 4U5XA 3CH4B 1GGDC 1Z0IA 2QTHA 4FU9A 5C20A 1XKBC 3TAUA 1V2JT 3RNLA 1A61H 4AGKA 1A2KC 3FTQA 4GZMA 4URZR 5C5NA 2FWWA 1X1RA 5JS7A 1GVNB 1VGCB 3A7VA 2EVWX 1ELVA 4DLRA 2QAGB 2ZGXH 5EPNA 2BDIA 3K09C 4L8GA 4Z0KA 4JLMA 2IYXA 4CGZA 1THPB 3K6YA 2CE7A 1W8BH 3LDAA 3SJAA 1HA3A 1HT1E 2XEXA 3PO1B 3PIRA 1B23P 4LHVA 1H9IE 3T06B 1J8YF 3QLPH 2HCJB 2Q0HA 1IHSH 3ELAH 1UBEA 1MH1A 1N6YA 3HK3B 4CEHB 1D9IA 1O2JA 1X7AC 1V2KT 4X8SH 1F0SA 3ZVRA 3QDZB 2QM8A 4AKGA 4WMFA 4P3YA 1NF3A 4CYMA 3PUVA 4KTSA 2GTPA 3MH6A 3A8BA 1C4Y2 2VHQA 3OX7U 4M9SA 4MG3A 1G3CA 2QGZA 4PTLA 1ONBA 2WUBA 3PROA 1QJ6B 4Z8XA 1GSIA 1BBRK 4WZBE 1FZZA 1TOCB 2H1UA 4K2YA 4BECA 1QVAA 4J0QA 3HDTA 3RU4E 1YPHE 5FOWA 3TNFA 1S81A 1LPGB 1LVMA 4ESHA 5CJPA 3QKUA 3RMNH 3LVQE 2GJ8A 4BFTA 2QSZA 5K0HA 1MV5A 4MYTA 1M74A 2BD2A 2ZG0H 3UFAA 4JLOA 3A36A 2VIDA 1I4LD 3P1JA 3A1TA 3BN9A 1GNPA 3K65B 2VSXA 2C8ZB 2WOOA 1QCPA 2FGKA 3QBVA 1O3BA 3EIQA 5FTKA 1QRZA 1H8EA 1NN6A 2J9RA 2GCTB 4Q00A 2RKOA 1W13U 4ZCLA 2F1RA 2JH0D 2TGPZ 1G8FA 4ZHAA 1AVGH 1ZIOA 2ZFFH 3QXJA 1GBFA 2C2HA 3PV5A 2Z3EA 1OXVA 5AFYH 1R0XA 3PM3A 3KFVA 1G3MA 2QMOA 4PO8A 4CEJA 1TQ2A 2ZRNA 1IONA 2ONJA 2Q9AA 1AGPA 3MCAA 1XKAC 1OJLA 2Z43A 4M4SA 2W7SA 1A46H 2BBTA 2EI8A 1NROH 3B6EA 1IXRC 4UEHH 1PUIA 3TIFA 1C2LA 4TQ9A 3T28A 4WXPA 2AMPA 2WHXA 1CT0E 5KHOC 1MRNA 4ABYA 4PAMA 3TLOA 3ODDA 1R5OA 2BZ6H 4DGJA 1AKEA 1YYY1 4I4LA 2FTLE 1AO5A 4OQMA 1TF7A 4MDEA 2SGPE 3MNCA 1A5GH 4HGCA 1T9HA 2IYWA 3S9CA 2XXAA 3U3JA 2AGGX 1XJCA 1XUHA 3A7ZA 1NMXA 4B47A 1R8SA 3GCTG 1DS6A 1RRGA 2Y80A 3VR2A 1GHBG 1QY6A 3NXPA 1ZYUA 1NLZA 3F8TA 2ZQ1A 4Y8ZA 1QJ1B 2HXSA 2V4ZA 1MU6B 1E2MA 5H4IB 1QHXA 4QJ3A 4A15A 2PWXA 1ELGA 3KTAA 3U98H 2I1VB 3M4YA 2GZDA 5J40A 4DSNA 3N70A 3A83A 4US2R 2AX4A 4PHTA 1QB9A 5JFGA 4C30A 1FJSA 4DDWA 2R0LA 2JA1A 3WMEA 2XZLA 1GBBA 3W6PA 3JZ1B 2BD9A 1N6XA 1AVWA 3I1FA 2ULLA 1W36D 1TNKA 4IVQA 4FU7A 4LWZA 2VQSA 5JPMH 1UTKA 3BTEE 3T25A 4KCGA 4RZXA 2PGBB 2GVZC 4B3FX 3GCHC 2QM7A 1SGFG 1VIYA 1Y5UT 2A2XH 1YZTA 1WQ1R 4ZKDA 1F48A 1GRQA 3KL4A 1F3OA 2WTUA 1RIFA 3IWMA 2XRCA 1LQDB 3B2EA 3TIUA 2JAQA 1FX0B 3V0XA 5AFZH 1YHNA 5DP9A 4I1OA 4N3NA 1ELDE 3FANA 2BY9X 3UXMA 1AN1E 1JALA 4PAQA 4JKIA 2UWLA 4JL8A 4M53A 5DI3B 2CEAA 2ATXA 2FNAA 5A2MH 2FG5A 3BEFB 2OESA 1W49A 3K70B 5FI1B 1XCMA 2OBQA 4NYMQ 2Z9GA 1EOLA 2J0SA 1SQTA 3KDSE 1O2TA 1W10U 3AP2A 2BOKA 4RKOB 2DWOA 2FOFA 1GBTA 2RGEA 4Y0YE 1KJYA 2QEQA 2QROA 3D23A 1JRSA 3CS0A 2YWHA 1HLTH 1T4VH 1S5SA 1TFXA 1HAIH 2O8BB 2ZTZA 5FTMA 4D25A 3Q5EA 4ZXXH 2QGRA 3LOXA 4ZROA 4LPSA 2ZFQH 2NO9A 2QIQA 2ZU3A 2FSIA 4TSFD 4CW7A 4B2LA 2O8WA 1ZP6A 3SNBA 4D82A 1MZDA 5DE3A 3RWMB 1Z8GA 3UG7A 1O2OA 1I2MA 1ZUIA 3GFPA 5TCAA 4TLEA 3UOPA 2OFXA 1HT2E 3A81A 4ZH8A 4V0OA 2VGCB 1KI4A 2ZI9A 4C2TA 1DT2A 1AA9A 3AVWA 1FY1A 4FUJA 1UK3A 4DLUA 4Y6DA 1X3SA 3BV9B 5C2ZA 4OL0A 621PA 2Y8EA 1XXHB 2XXLA 2AIPA 5E4FA 1T4UH 2G0TA 2ZF0H 3W5IA 3SHAH 4PHFA 1LPZB 2BDTA 3BBPA 4DW2U 1XTIA 3WYFA 1GM5A 3KXLA 3EPKA 2QAGA 4ISIH 1AWFH 4Q02A 3PV4A 5FI0B 1O5EH 1VYUA 3CNNA 1JEDA 1HYQA 1OIVA 3EZ7A 5IK2D 1W14U 2ODEA 2XC0A 4ISOA 1YZGA 3AAVA 2F83A 3P8NA 4ESVA 1CGIE 4MNWA 1O3YA 5KTYA 6CHAC 1BHXF 4UXHA 4MPVA 5LDDC 1DE7H 1Y3WA 2RGGA 2RA3A 1SC8U 4O97A 1G32B 1EZSC 2P16A 5CB6A 2C8XB 3QOFA 4LY6A 2R0KA 4CEHA 3B85A 3OIVA 1R4AA 2HOBA 4OS5A 4OJQA 3RXQA 1VPLA 3C16C 4EKDA 2A5GA 4PQYA 3PEWA 3GJXC 3BF6H 4A1FA 2O52A 2IHBA 1UTLM 1UTQA 3VXFH 1NRNH 1AS0A 2GF0A 2Q9CA 3TBKA 4GBMA 3QKRB 2OCVB 3WRYC 2O0JA 2SNWA 1W7XH 2BVXH 4B2PA 5ANRB 3CM0A 3ENSB 2EI6A 3EG5A 1O30A 3UR6A 2O8DB 4X1SU 1ZYOA 1SZPA 4II7A 5A4JA 1C1WH 3SR0A 1QVRA 4Q18A 1C1UH 1G5PA 4NP6A 2D2FA 2YINC 4J1YA 3BGWA 1M2OB 2G52A 1GHAF 3TK5A 3MFYA 1Z8RA 1DG3A 3LBHA 3L43A 2ZYVX 2W0MA 2XC4A 1C5VA 1YLDA 3TVDA 2Z9JA 1NVUQ 1GWAA 3GLHE 1W0JD 4CRAA 2W6ID 4N0DA 4GUXA 4PAOA 1MAXA 1PVOA 3B8JA 3AVTA 2FS9A 2BDYA 5KUTA 2W2XA 3UKDA 1IOZA 3P26A 1WYKA 3AM1A 4LJ6A 3IHWA 3U6KA 2VB0A 1W0KA 4YESB 3CO5A 2NGRA 4JZIA 4ESTE 3M37A 3QEJA 1RRFA 2J41A 5BWMA 5GNDA 4PO9A 4A1VA 2PZGA 4BFSA 3VB4A 1GCTC 4DB4A 3T1TA 2PT5A 4AG2A 2JIZA 1BQYA 1B7XB 1DSUA 4MRSA 1IN6A 1NN5A 1A2BA 5EU8A 2JJ1A 2W58A 3PV0A 4GOXA 2GXQA 2V7QA 1C2JA 3OESA 1DUEA 3B60A 4Y11E 3VX4A 2ZPQA 1NESE 4ABHA 3KB1A 1GKYA 1O2IA 4D2IA 4SGAE 4OS7A 4AG5A 1GI9B 5FX6A 3RS3A 2ZTYA 1DAHA 2WPDD 4FCVA 1LPKB 2GDJA 2JDID 1K2I1 1PPZA 1ZIPA 3B7GA 2RG3A 1GVLA 3WY9A 3UWJH 2FS8A 1IQMA 4Q21A 1SFIA 1GNQA 3N5CA 1WCZA 3H84A 4M7GA 3SNAA 5K8IA 1N0VC 2WJGA 3KHVA 1EAUA 1GL7A 3Q5DA 1I2DA 3NUMA 1BTXA 3HU2A 5HKKA 4UNPA 3DPUA 4TLBA 1J7KA 1DG1G 4HB4A 3UG6A 3F1SB 1C1QA 2BVRH 2RMKA 1J16A 1ELFA 3GCGA 3D62A 3T62A 1Z6AA 2FMXA 4M22A 1AB9C 3LWNA 2G5NA 3H5CB 2IXFA 3ZVBA 5DO4H 2EI7A 1E2IA 3WY8A 3CB4A 1E69A 5JSZB 1GL6A 1VKJA 1NRJB 4UXIA 3R9WA 4L9SA 2ZP0H 1IXZA 3AF4A 4A0GA 3X1WA 1NFUA 4P4TA 4RCYA 2FPLA 3BK7A 3MLEA 4GMDA 2CHQA 2BDAA 2FO9A 2GEVA 2OV2A 3TH5A 4NZQA 2LPRA 4GSOA 4V0LA 2FOCA 4OS4A 1Z6TA 1H8HD 3RHFA 1S1MA 5A0FA 1C5PA 2QBYB 5FBVB 3SUGA 4HAUA 5FL7D 1J70A 1KSFX 3AKCA 3CS7A 2ZNKH 1QBKC 1LF0A 1M9UA 1DANH 3MWYW 1CE5A 2V3HH 1PV4A 3X1XA 2PGQB 2QT0A 1C4V2 2IEYA 1FX0A 1VHTA 3B13B 1GDNA 2ZR9A 4XTCS 3QO6A 1BOQA 2ZRIA 2UZIR 5F98A 4CRFA 1E2DA 2B9LA 5JWHA 1VYTA 2AHOA 1CA0C 4BEJA 3R9XA 2P3FH 3ESTA 2J34A 3A89A 3B23B 4PZYA 3RXJA 1CP2A 1OH8A 2VH6A 1HURA 5DHFA 3TKLA 4CH2B 1A1RA 3RDZA 1O33A 3ZZAA 4PX9A 3CWQA 5CIWA 1P2NA 2GXAA 2XZOA 3WBKA 4ZHMU 3GLGE 2A7HA 4CIDA 4TYNA 4TWYA 3HR7A 3BTDE 2PEZA 2O8BA 3GFOA 3KXKA 1A0HB 2XTTB 1O39A 4Q19A 1CF4A 2ZTXA 4JKYA 1BRUP 2WWXA 5JHGB 3ZIAD 3NZIA 1XNJA 1FY4A 3I8SA 3LD9A 2D2DA 5BN5A 1KI9A 1AU8A 2NO1A 2CJIA 1OB5A 4RSGA 4LYJA 2Y81A 2OD3B 2J45A 3BH6A 1O3PB 4B2IA 5EOKA 1KK1A 5AJZA 1GHVH 4LYHA 4L5BA 2QE7D 5FTJA 3E6PH 1OP8A 4PC2A 1JNYA 4FIDA 4HYYA 1NPMA 2OLKA 2WJVA 4Z51A 2N42A 4A1XA 4Q4HB 3H86A 4CRGA 1EP6A 4Q47A 1BS1A 1C1NA 1ZHRA 2FZLA 3B9QA 1C5MD 1T8OA 3VHLB 1CRPA 4QM6A 1OPHB 3SW2B 2FSGA 2YC4C 4YZUA 5GJWC 1AY6H 4KU4A 3RYTC 1ZRBA 1DLEA 2EWVA 2IYZA 2JLYA 2NZJA 3HR8A 3TJZA 3TK6A 2P59A 1W36B 1E9AA 1PFXC 5JDUB 1D8TA 3AF3A 2WV5A 1DY8A 1XCPA 3BJIC 3MHWU 2YKGA 2V54A 2VIQA 2C78A 2YOLA 1HUTH 2ZJYA 1K28D 1G8PA 1OIWA 5KNCA 2OTVA 5C1BA 4X8HA 1DEKA 1GHXH 4K8BA 1G30B 1GUAA 3MOCA 4KHZA 1IQLA 2W3KA 1XMJA 1OYQA 3NKKA 2GETA 2OILA 3Q9LA 1TQDA 2Y6TA 1N2CE 1MCVA 3UMRA 3ZVNA 4JVSB 4LUCA 1O2ZA 1XTKA 3TK9A 5JI2E 1ANKA 1YCPK 2WJYA 2O8DA 3Q3XA 3ZVLA 2CMKA 2GT7A 2JGNA 2OBLA 2IXGA 4NCNA 2QRZA 2XWBI 2O8FB 2D4HA 3VB7A 2ZRDA 3BG4C 1ZNWA 1RJ9A 2I1QA 4IKEA 4WVFA 5SZKB 4TT3A 1MZAA 1EGAA 4I31A 3BFXA 2PKSC 4OS2A 1RVDA 1ZMNA 2AGIX 4V0KA 3ZV8A 5AF9H 1ZD8A 5FUYA 4I1VA 1H9HE 5GIBA 3H1TA 3MRSA 3VR3A 3DD2H 1S84A 5F3WB 1E9SA 3QF4A 4LJAA 5HCIA 2QN5T 1NZQH 3GEHA 1V2TT 2GVFA 5DH9A 1CHOF 2WYGA 5EXLA 4A8JB 3VKHA 3E0PB 2G77B 1SVIA 1KTSB 1SXJC 1G7RA 2C90B 3SBDA 1AFQB 1XMSA 3M7UA 2H18A 2OAP1 1MOZA 5CHAC 1Y3UA 3G5UA 3THWB 1TIOA 1D3TB 1MKXK 4GNKA 8OHMA 3FB4A 5JBCS 1E38B 5CMXH 1PPCE 2RH5A 4BTTB 1Q3TA 4D4JA 1U94A 3H7TA 2ZHWH 2EA3A 4Q1EA 1HIAB 2IYUA 1NY22 1II8B 4G01B 4GZLA 1H8DH 4YOIA 3S0NA 5DJ7A 3RMOH 4PC7A 2HDNB 1YKTA 4B33A 4A2WA 4D0GA 1UEJA 1O2GH 2C8VA 5G53C 1U8AA 4QHYA 3MH7A 4BAMB 3NK8A 2QTFA 2VP2A 5BXQC 3VX3A 1TUIA 2LWIA 5TB5A 2IYQA 4HEJA 1HB0B 1V2NT 1E9FA 4DCSA 1E35B 3SU3A 1UMAH 1N3BA 5SGAE 4RSPA 5HM9A 3VGCB 4AG1A 4MH0R 1OYWA 3TR0A 4NSVA 2F9NA 1O3MA 1JRTA 1DAMA 3DKPA 1MR3F 2G1KA 2BCGY 3C7KA 4AFUA 2BLQA 3W8RA 4AYYB 5JRZA 1PYTC 1EK0A 8ESTE 4OHXA 5E7JA 3MH4A 2VPPA 1G8GA 1V2OT 1ZTKA 3EGKH 4QBIA 1VCNA 2BEKA 3CRW1 3SJOA 1OT3A 2WJJA 2QMEA 5JSZA 3ZGXA 1ZINA 2FI4E 2QF0A 1DAKA 4M1WA 9ESTA 2O8MA 4MDSA 2QAAA 1Z2CA 1AQYA 1ANDA 2D7DA 4TLCA 2ZDVH 3DM9B 1JR3E 1AGJA 5BPEA 4DLSA 1O3HA 3NEYA 2H9TH 3PYHA 1DY9A 1O34A 4UXJA 4KI0A 2BQWB 1E2EA 1O37A 4FD2A 4VGCB 2CHAB 4YOGA 2ZETA 1P5ZB 2ZKSA 4RVCA 4DDVA 2CJWB 2QBYA 1TPPA 4THNH 4WY3A 1JQJC 1CJMA 2B7BA 1GOTA 4AWXA 4D4LA 5A0CA 2BXTH 1VECA 5I46H 5C46F 1GIAA 2ZSAA 5KSYA 4Y79A 1KSHA 2O8EB 2XTZA 2IS2A 1BT7A 1DITH 4KSBA 3ZVFA 3U6BA 4ISLA 3I5XA 2ZC9H 1LKBA 2R2MB 4Y8YA 1AIPA 1LV7A 1PQ5A 2FMJA 1IQNA 1BJUA 1ZNYA 2RGBA 5FPKA 5C3NA 1UKYA 2Z6VA 1WP9A 1Z3IX 3H0KA 2L0XA 3F5FA 3PXGA 2ANMH 2ZU2A 1GI6A 2EWWA 2Y5FA 1GP2A 4ILEA 2RAPA 3UQVA 4ZKOU 4QJ4A 3EX7C 2P3TB 3ETLA 2FXRA 5LB2A 4FUDA 3SNCA 1PQAA 1QNJA 1DWBH 3SGAE 5JHHB 7GCHF 2NU0E 3GOVB 3KGPA 1Z63A 1O3CA 4B73A 3PWBA 3W94A 4MGYR 1DVAH 1QJ7B 2CF8H 4V0MA 4Q7KA 3BB4A 5FCKA 3DT0H 1YZKA 2DFLA 4GOJA 3E3TA 1LTOA 4AK9A 3X1YA 4ERNA 2ZS8A 4RD0A 2OXSA 3C5CA 3U9AH 4DSUA 3BTTE 2SGAA 1GITA 4XVRA 2OHFA 2PBRA 4KVGA 2GMTC 3NH9A 4HDCA 1XCGB 4E22A 1IJFA 2W83A 1O5CB 2VVUA 8LPRA 2WPKS 2GWHA 4X2XA 1D3DB 4OGXA 2C8WB 1G4UR 1R0WA 1N8OB 3W8NA 3OAAA 2A5AA 3QSYA 3PUXA 4MKGA 1KMHA 1ORFA 4Q4HA 3SDZA 1VTKA 1J90A 1OSSA 3SJCA 1TBQH 4O3TA 3NHBA 3LLMA 3S7KB 2BWJA 1FXYA 4C9BA 3ZZ9A 2D7CA 4TYPA 1TX4B 4Z8YA 2WMNB 2ODYB 3N7OA 2OCBA 3KF2A 4PPFA 1NG9A 4PQFA 2ZRGA 4DCVA 1CTQA 4JZ1A 4NCYA 2G0NA 3QGJA 1OYTH 2QSYA 2TRMA 1WU1A 2PJRA 4BFYA 4BE7B 4V02A 2J38A 4FWTA 3K0FB 1AUTC 1YR7A 5GADl 1BMMH 3TLXA 2AWOA 4RN6A 2BJWA 5JBQA 5CJ2A 5IF9A 1QZXA 2BBWA 3TMKA 5L30H 2CVFA 4IDHA 3BC1A 4AB8A 1L4ZA 2HPPH 1Z0KA 2BZAA 3GLGA 1TQ4A 3AK5A 2ZSDA 4UJ3A 4ABDA 3VTKA 1OXSC 2BMJA 4P4UA 1E9DA 1OFHA 6Q21A 3QX5H 2PL3A 3PTNA 4JVMA 4Q4AB 2WMOB 1KDOA 3ZYCA 4UFGH 4V0NA 2QGNA 1Z28A 3HU3A 2EYUA 1X6VA 4OJKA 1CU1A 2ZU5A 1K8RA 1C1TA 3FFGA 2R8RA 2O8FA 3SGBE 3SZRA 1GMDG 3MG9A 1GJ7B 1A7JA 3GY2A 3PMAB 4MNVA 4D8NA 1CXZA 3VQTA 3FFAA 3Q7QA 3NDBB 5FAHA 3BTWE 5DP7A 1Q1ZA 3B1WA 4EFLA 4Q1CA 5JECA 3W3ZB 1N5LA 2ZIQH 1Q0UA 1F60A 2PSXA 5A0BA 1PUJA 1G18A 4TSFA 3NBXX 2GILA 3AF0A 1E2JA 1LY1A 1TQ6A 4ITRC 3VFEA 1Q3HA 4L15A 4PROA 3TNSA 2ASUB 2BDBA 3GLFE 5ABWA 2IS6A 3THWA 2A5JA 3URDA 2AFHE 2F6RA 3ATIA 1ELOA 1C1PA 1UVTH 1CR2A 3ZVCA 2HLCA 3SQWA 1HIAA 1GG6B 4DCUA 4QBFA 3F3YA 1II8A 3VU9B 5FBWB 4XSGA 4BGDA 1HRTH 4KYUA 3S9BA 3KQBA 1TEVA 4C0QC 5DIFA 2IEZA 3A37A 4KBGA 1H9LB 3UR9A 3H7OA 1A5TA 1YJ5A 2FOGA 1F0TA 4UNSA 1GGDB 2QV1A 4IFBA 1ZSLA 2C95A 4GP6A 3PVSA 4K8OA 5CITA 3CF6R 1Q22A 1NG1A 4HLDA 3ZZ4A 1KI8A 3UATA 4XFQA 5IK2A 1GRRA 3BERA 2FDCA 1CVWH 4Y7BA 1KIMA 3CP7A 1Z08A 2Z9LA 1OW3B 2OAQ1 3ZYDA 1P2JA 2F9PA 5GJ4B 3IEUA 4TY7A 3LX8A 2SGDE 1YZUA 4C7OA 3U7GA 2CLDX 4LZZA 2BD3A 3KB2A 1II9A 3RRZA 5CM9C 1EAXA 2NPFA 4NH0A 4HATA 2ZRMA 1SGEE 4G5OA 5E0HA 4TYQA 4DUGA 3FP8E 1C9PA 4NGAH 2GCNA 1NJFA 4C0LA 4W5WA 2H16A 2JETC 1GJ4H 4EUNA 3Q7PA 4F92B 4YLQH 3T29A 3X1ZA 1ZD9A 5GCHG 1GCDA 1O35A 2FODA 5EXTA 1YZQA 1XXFA 2VP0A 2RGDA 4NONA 2OINA 2PW8H 3EZ6A 1K22H 2B8WA 2CJWA 1ZRKA 1SGYE 2PEYA 1O32A 4B2BA 3GJ7A 1UFQA 1F2UB 4Q01A 3AVXA 1W0JA 2W6IA 4F4JA 4K81B 2A78A 1Z6JH 3WXMA 2O8EA 4Q03A 4DURA 2FEMA 3QKSB 2G51A 2CGAA 1XD2B 4BASA 3E0NB 3A7WA 1ZM3A 4WIAA 2ZRLA 1IQJA 1TLDA 2P95A 2NIPA 4C2UA 4FI3C 3IQXA 5FBLB 2BX3A 1P57B 3DOFA 2BKEA 2J5XA 4HLQB 1HE1C 5EW2H 3TAHA 3GP8A 3KQCA 2G6BA 1ETTH 1HXEH 3QPVA 4FCTA 3SO3A 2OUAA 4JBWA 1S3GA 4QG7A 3VKGA 5GWZA 1HPGA 1NBME 2UKDA 2CHGA 1QIXB 1IHTH 4WW0A 1ELTA 1US8A 3DZ8A 4O3UA 2BQ6B 1C4OA 1OV4A 2PFEA 3SZEA 5EE5B 2IXEA 2F9LA 3ZYEA 1SHYA 2ZI7A 3VNVA 1L4YA 4DLXA 2V8OA 1O2NA 1RYFA 3CUEF 4CT5A 4WZ6A 4RJLA 4RD1A 4AYTA 2QY0B 4D0NA 1KLTA 5EG4A 4M9XA 3RS0A 221PA 2C04A 2HXYA 3CONA 3TH3H 2WPDA 5FFMA 3Q3KA 3DA9B 2Q21A 3CKLA 3IQWA 1QHIA 1BHXB 3KJIA 3OSYA 3T26A 3CRMA 2ZDAH 4UD9H 3FHOA 4TMTA 2Z6BD 5IT5A 5AJXA 1SLUB 2XSZD 1WRBA 3NHAA 2FSHA 3TJVA 5T6FA 3ZLJA 1QHYA 4KFSA 4B6FA 5KPJA 2ZUDA 4NIYA 2I3BA 4KGAA 1TWXB 1GZSA 5GCHF 3UUZA 1TNJA 3UIRA 3RXDA 5L3SB 2C9YA 1FN8A 5BRRE 4EAQA 2JCSA 2UUKB 1EFCA 4P33A 3AVZA 1OWDA 4EQ6B 1SG8B 2ZDKA 4KKDA 3TUZC 4I7YH 1NS3A 1L1JA 4OQXA 3SV8A 1MO4A 4WXVA 1BTYA 1Z8FA 3AVQA 2CXVA 3LDXH 3M5LA 3SU5A 3P92A 5FUXA 3U8TH 2SGQE 3ASYA 2F9OA 1E96A 1G3RA 1ZZZA 3GDSA 2J1LA 2OLGA 2REBA 2KWIA 1P01A 5HYOA 2BIFA 4NCKA 3PLPA 3K0FA 2ZI5A 1OF1A 4B3CA 4DVAU 2ZRHA 1M34E 4IS5A 4PR0A 1LFDB 1KAOA 2CN0H 3DHKH 5UKDA 5SZIA 4A9AA 1IY2A 2G83A 2E9SA 2WPMS 1S0QA 3A7XA 5FL7A 1ESNA 4HI3A 4B75A 5EP4A 1ZU4A 1WTGH 2P3UB 1RPZA 1CR1A 3QXCA 1QFKH 2Z0MA 5KDLA 1J15A 3GCHB 4OHWA 4WXRA 3EASA 2IX3A 1DS2E 2EEKA 2RDLA 1KDTA 1SHZA 5JYIA 4UFFH 1P9WA 5KNBA 1ZU5A 2E1RA 4WXIA 1ABIH 1PJPA 3AKDA 2JLZA 4NCIA 3CNLA 1GKIA 4G5RA 2GJSA 1OH5A 1ANBA 2XAUA 1GG2A 3A8DA 4B76A 4TPIZ 5B2ZA 2OFOA 3SJIA 1YF4A 1HH4A 1WCV1 3TVJB 4EPVA 1NN1A 2EFCB 3K0AB 1INCA 5AUOB 4YLGA 1UO6A 1AWHB 4A5TS 2VWMA 1PLKA 3A84A 1Z5ZA 1FV9A 2ODWA 1GHZA 1J14A 3ZIAA 1AZTA 1C1YA 4WWYA 2FWRA 2J0VA 1NMZA 1UHBB 3LAWA 1S83A 4HAWA 3TUJC 4X8MA 5T3HA 2ILNA 2P6NA 2QPTA 4A1TA 1BDAA 2XNDA 4WJG2 1N25A 3KEEA 1ZJ6A 1MQ5A 5TCCA 1QBOA 1W0KD 4Q4JB 2WINI 3LT3A 1VZQH 3OFND 2QE7A 2ZYUX 3VFDA 2RHMA 2IYLD 3SOSA 1LS6A 2QAJA 1GILA 3BFVA 3ZVAA 2VYFA 2SNVA 3VU9A 3K0CA 1P4SA 2Z7FE 3VEQB 1XZQA 4WA7A 3SQHE 3RANA 2BY8X 1U8YA 4LBYA 1W0YH 3UY9A 1BIOA 2OK5A 4Q1AA 1G7SA 2QA9E 1Z2AA 4RZ3A 1NJGA 2GTBA 4L16A 1MD8A 2BY6X 4QGHA 3BTGE 5B64A 3NPSA 1QA0A 1FQJA 1K9OE 5LPRA 1W3CA 1XX6A 1DO0A 3A1WA 4DDTA 1HTWA 3AUYA 5I25A 2FJUA 3W5JA 2N46A 1GMCG 2DPXA 1OWHA 4FMDF 4B44A 4OK5A 3K09A 4NMMA 4AYXA 4AOQA 4FXPA 3EA8A 3M1IA 1QRWA 2ANYA 3EIHA 1S0UA 1KI6A 2C77A 1B5GH 1LVBA 5HCNA 1AVXA 2QP9X 2AH4X 4QHSA 1GJ6A 3SU8A 2ZANA 1EJNA 3DZDA 1GL0E 3GJ5A 1C9KA 1W2HA 1OYYA 2UWPA 4PSAA 1BBRH 1QGFA 1SGPE 2VH0A 2Z3DA 1L1NA 1W12U 4PZLA 4O9VA 1OXXK 4RD2A 2O0KA 2FE4A 5EE1A 1HAPH 1XB2A 1JXMA 4DIEA 1NFWA 4QHTA 4I8KA 5BW8A 4DJZB 3IEVA 3R0FA 3T27A 4F4IA 1G37A 4IXNA 1TUEA 3A1VA 4L9WA 1YPHC 4D7GA 1W4RA 1VHLA 3DM5A 3SV2H 1UTOA 4XOIA 3I92A 4IN2A 1TONA 2MSEB 1F2UA 1FQ3A 4KVAA 4FU8A 2ZRAA 2GK7A 4DOQA 1KAGA 1E34B 4D7FA 1WE2A 2X2FA 5FPHA 3QKSA 1FONA 5JLJA 2ZUBA 2ZCKP 1XD2A 3BE4A 1BJVA 2GCHG 3LC3A 1X1SA 1F92A 4QBGB 4E05H 2ZEJA 4YT7H 1FP6A 1MABB 5DP4A 3FVQA 1SOZA 4CR5A 3THXB 1PZNA 2XWAA 1P09A 4TQAA 2A0QB 2VINA 2BHRA 4LK2A 4XBCA 421PA 4EJSC 2GESA 1EAWA 2BY5X 2WV4A 3TJOA 4A36A 5F2EA 1UK4A 4TYDA 3FZZA 1EZQA 5T6DA 3AW0A 2ANCA 3HK6B 2PH1A 6LPRA 3AB3A 3B5JA 4W9MC 5E7IA 5J4QA 1Z71A 3LW8A 3Q77A 3LA6A 2WV9A 5KO2A 1BRCE 1W44A 1GCTB 1SKYE 1GBAA 1F5KU 4QFMA 3K2UA 1GJAB 1PPGE 1ZPCA 3KX2A 1D9ZA 1YPEH 1Z6YA 3A4LA 4NPHA 1KZGB 3LH3A 3VMFA 8GCHF 1SHKA 2OXRA 1WB9A 4A0FA 4TL7A 1H8IH 2V3OH 3E1XB 1NVVQ 4LJ4A 2VIPA 1BYIA 3RXHA 3C41J 1GMHG 5GDSH 1P06A 3L33A 1EG7A 3K70C 3TVTA 1E2HA 1HAGE 2IUUA 2HLDD 2IHYA 1NLFA 2VEDA 4AFSA 5ELXA 5L3SA 3L3TA 4HLCA 3R9IA 3P32A 1KZ7B 1BYUA 4EQ6A 4HUTA 5CYOA 1K21H 4EFNA 1VIAA 2IF2A 1XMNB 4OI1A 3D8BA 2AD1A 3O8BA 3I62A 1QHNA 5EXPA 5FL3A 1Q1BA 3SJ8A 1FMLA 4U7DA 3MNSA 3TGIE 4EPYA 4MYHA 2W7UA 1YVDA 1W2GA 1QA7A 1AB9B 1SSXA 4ZHLU 3GMTA 1PLLA 4TL8A 2CVHA 3NWJA 3WMFA 3MMPA 4LSGA 1NO9H 1XPRA 4AFZA 2VWOA 3QPWA 1XD9A 4MPWA 1P9RA 3JZ2B 4YTAA 2HF9A 5LD2B 3LJJA 1K1JA 4I33A 1CSOE 1JBUH 2Q6TA 1MO3A 2H92A 2NG1A 3BG8A 1IBRA 1UF9A 3T1QA 4EPXA 3W6OA 1ZCBA 1GI4A 4JL5A 1RW4A 1C2IA 5K8LA 4BXSA 1KO8A 4M1MA 5HE9A 1DAGA 2KBFA 1I4TD 2ZAOA 2PTNA 2VHCA 1TX7A 1G36A 1P9UA 2XB2A 1GDDA 4OS6A 1D2MA 4E09A 1S1CA 4AKEA 4BZPA 2ZE5A 1O2RA 2DE8A 3THYB 3SV6A 1NRSH 3T2NA 5FOSA 4HB0A 2ZGBH 1RYHA 1UM8A 4PANA 5KOYA 4ABFA 1QL7A 4NCHA 2CE2X 2XTNA 1YR8A 1UTNA 1EWQA 2REXB 3K0AA 2PLFA 1AFEH 3MSXA 1EESA 2Z5FA 3Q72A 2HJVA 4Y7AA 2X1VA 1EFTA 1V2RT 1CQQA 4FINA 2A7JA 3MI4A 5J4YA 2WPHS 2ASEA 3K1JA 2ORWA 4MYCA 5L3VA 3W34A 1TNIA 1UHBA 2PX3A 4PC6A 4LV8B 1GAJA 4NFEA 1VITF 1A82A 4G5GA 2QT1A 3GEIA 2JKHA 2C5LA 3IBGA 4LHYA 2ZRKA 2UVQA 2QY9A 3M5OA 4F7WA 1OH6A 4XWAA 1O2QA 4AYWA 5GJVC 2ZJ2A 4GT1A 3VPKA 1HJ9A 1YPJH 2BM0A 1P73A 1O38A 5AK0A 4AGJA 1U0JA 1Q1EA 3WNBA 4Z6AH 5CDFA 4E7NA 4JK6A 1DOJA 4IN1A 1G2LA 1M8PA 1XBTA 5J4KA 3C4JA 4LHWA 3IO3A 3LQRA 1IM2A 2VSFA 2G00A 4LHXA 3RXGA 1AS2A 1O2KA 2IPHA 5GJCA 3OY5U 2V3CC 2OM2A 2ZPRA 3V12A 2R6GA 3QPUA 2O9QA 3U60B 5JS8A 1KKMA 1HFDA 4XBDA 1G6OA 1EX3A 2OEPA 5EE0A 1AKSA 2BY7X 1IN5A 4DY7B 2ZRFA 4Y10E 3PUYA 3M5MA 1TAWA 2AK2A 1E2FA 3KKQA 5DN6D 1AQ7A 1O3DA 3B1ZA 1OXTA 4TMXA 3S9AA 5HR5A 1ZC4A 3TU7H 3ATMA 1V6DA 2BD7A 2BVNA 4NZYA 3A1SA 1P2SA 4FMBB 1NTPA 2P93A 3V4FA 3UANA 3B78A 2YNBA 2A4OA 5IDVA 4M1KA 5ESBA 3HGNA 2CF9H 5HMAA 2OC0A 4P4SA 1UKEA 2FIRH 2EYQA 4Q1DA 2FPKA 2FH5B 3EPJA 1R6BX 3EWSA 4NL4H 3ICEA 2GA8A 1Z0JA 3HJNA 1AGRA 1SLWB 1VCIA 4BZQA 1P2IA 1FOEB 1YQTA 1OSNA 2XBXA 2TIOA 1FY8E 3OTJE 1C5WB 1IQKA 2Y82A 4M9QA 4OI2A 3ZZDA 1SVMA 4K1EA 4JK5A 3VHXA 4D9RA 1MTNC 4A0HA 3AV0B 1M6NA 4IDQA 2V6IA 3MWIU 1FY5A 1O3LA 2H5DA 2HNTE 1IQPA 2FOAA 3M5NA 3F6UH 3EA7A 3UTUH 6ESTA 2FF7A 2QZ4A 4E07A 3DDCA 1LO6A 3AEZA 3P8GA 3FKQA 1MABA 1U98A 2Y7ZA 2PKSB 2GDDA 1GNRA 3THXA 3I8XA 2DFNA 2FU5C 1A0JA 5FBEA 4A6PA 2F55A 2VVCA 3SNEA 1AJEA 2ZRJA 4JLAA 1WQVH 3EA0A 5LPFA 4CHAC 2Y5GA 1BOFA 2GX4A 3WMGA 4IDOA 4EFMA 1HBTH 2IYSA 2LKDA 2BM1A 5G40A 4KTUA 2H5EA 1CO7E 3WHKA 1SXJB 3U1JB 4R2HA 1EWRA 2BCJQ 5CHAB 3URCA 4I8LA 1ZMLA 3GD7A 2GZ8A 2LCFA 5FXLA 2YNAA 3H4MA 1N6PA 5J4HA 2CCKA 1XF9A 5LBIA 1GDQA 4XD7D 1XUFA 1KDQB 4GCHG 5EQRA 3PQCA 4LCBA 4NDZA 1TPOA 4BQSA 4CBNA 2D74A 3MNXA 4Q5IA 1BKDR 4BAKB 4CBOA 1YCPM 4CR9A 4YXWD 1R0YA 2ZCHP 3UWIA 2I4IA 1FAKH 1KSNA 5FPTA 4JT2A 1T8TA 2IUSA 2A2QH 4ZI2A 2CLSA 2ERYA 4ABGA 2BLVA 2P65A 1Q21A 3A7TA 1H65A 3QUSA 3R8FA 3OAAD 2OE2A 1WBBA 1GBMA 1JI0A 4C0JA 4ZKEA 4TL9A 2A4RA 4O0MA 1GJ5H 4OI4A 3PG5A 4BFXA 2HALA 5EGMA 1Z06A 3U7EB 3T1OA 1G9IE 1E2PA 4BRUA 4FVDA 5C1YA 2WZQA 4AKHA 3N2IA 1BMFD 4B3BA 2VHJA 4LOAA 1CEEA 5G3YA 2N1BA 3U5ZB 3K0SA 2AYWA 2ZU0C 1L8QA 2IYYA 3KFXA 3OY6U 4HAXA 1FW6A 2A4QA 3IILA 1NSTA 1P9NA 1ZNZA 5EXXA 3LLUA 4M9ZA 3Q00A 1MKWK 4DSTA 1KGDA 3VR5A 3DEFA 4US1R 1S2MA 1XWIA 5JI3E 2H9HA 2FSFA 1AKYA 1XXHE 3D6TB 4XE4A 4XIGS 2IS1A 4YOJA 2JJ8A 1TOMH 3NDPA 2HT6A 3LW7A 3GCNA 4GHTA 1TL7C 1KJWA 1FFHA 5F8XA 4YT6H 4TWWA 3C1KA 2PCJA 1IN8A 3B9PA 2A2ZA 3MAAC 1JEEA 5E2OA 1SLXB 2BTCE 4GCHF 4A82A 1IQGA 1P05A 2DB3A 3SJKA 1FPHH 4IC6A 2MMGA 3BH7A 1HJ8A 1ZM4A 3O8CA 1NY6A 1DTSA 4PXAA 3EARA 1SFQB 3U3RA 4D6PA 4LK4A 3BIFA 2VF8A 3EZFA 1HQYE 4BFUA 5L2ZH 4Q9LA 3MO6A 2D8WA 4X2VA 2ZVQX 5KSZA 4FUHA 4MTBA 2GAOA 4BPBA 3ZD6A 2QYIA 1NI3A 3CR7A 3QBTA 3QF7A 2GKSA 5KSPA 1P75A 4JLKA 1OP2A 4JS0A 1THRH 3G82C 3G01A 3GCTF 4PC3A 3A8AA 2EFGA 1GHBF 3NG1A 3I5YA 3UK6A 2XJ9A 1P62B 5IDKA 2OCAA 3KN2A 1E1RD 2OBOA 2PLXA 1DDJA 2ZSBA 2A45B 2ERXA 3FMPB 2XSZA 5LB4A 5DPAA 3I72A 3OYPA 2NU3E 5TV2A 3QE0A 2NTYC 1NFXA 3PEVA 1JJVA 2GMTB 4BTIB 2I6SA 1O31A 4ZCIA 4ZDWA 1YRAA 3A80A 1XTQA 1P3CA 1UTJA 3PTBA 2QG6A 1LHFH 2G4TA 2WKRA 4Q66C 2DHRA 2VF7A 4JLPA 4IOJA 3MO3A 2WJIA 1SGDE 1VG9B 4MNXA 1OKKD 3FOZA 2LNCA 1UTPA 1YR9A 4TZ6A 4DEYA 2F3CE 1NKTA 1WTHD 1MD7A 4B34A 1N6KA 3AVYA 1D5CA
chains in the Genus database with same CATH superfamily
2QB5A 2EHJA 3KHTA 4F6LA 3HJTA 2STBE 2A7CA 2ZI6A 1LK7A 5LU8A 5KC9A 3BUSA 4WEOA 5EZ5A 3T7TA 4YO9A 2GCOB 3HGPA 1KWGA 3CMMA 2JLRA 3ROXA 2DE9A 2OC9A 3RJ5A 5J9FA 4KN8A 3FMIA 3ITNA 2G81E 1TC1A 2IUYA 4FFWA 4V0RA 2DPGA 1P3DA 1PL7A 3CUUA 1E89A 3X43A 2NUTB 4XIYA 3JYNA 1V16B 1QTIA 2F2TA 1U1DA 3VR1A 3K16A 5T8KC 4ACAA 3IDQA 4BNUA 3AR5A 1CZUA 5C17A 1WZIA 2OT3B 4JBIA 2OCKA 4K9OA 4X8LA 1ZS9A 1UC4B 2VDKB 1PJLA 4OTZA 3AV3A 5KYWB 3T1VA 3H6HA 5B6IA 4K6MA 4EEKA 5BSFA 5HBGA 3IOMA 2PCLA 1CY6A 2OZEA 4DWVA 1P10A 2J31A 1XTZA 3T15A 4FKBA 4U6SA 5CLQA 5K7SA 3NBUA 2LDBA 1Y34E 5EJ1A 1ZGVA 3CVJA 4RQTA 4QTZA 1IY1A 4XSKU 1EK1A 4DFDA 2QGFA 4B3IA 2XUDA 5AKYA 2ZTUA 2IBSA 1M5TA 3KCGH 3PRBA 2P8OC 2J0UB 3BXGA 3NO4A 4NYIQ 3DKRA 4Z54A 3ZVGA 3WX0A 1YIDA 3M3SA 1KHTA 2ZPUA 2EF0A 1QRRA 4AB9A 2YHSA 4JJZA 1OZGA 1DE0A 1G64A 1BEUB 1EWTA 3WK6A 2CL5A 4HAYA 3TNLA 2F9VA 3SC2A 2H1RA 2Z04A 4UHBA 2J7PA 3G13A 8ATCA 1XJQA 3Q7TA 5TMBA 2QQ0A 1RKXA 4AYVB 1O2MA 2WJ6A 3P17H 5LPNA 1A9PA 2VDNB 1UPTA 3Q9SA 1UBOS 3O83A 3EE7A 2X6QA 3VB3A 1ULZA 1ZVVA 4D79A 1IYZA 1C3VA 5SV2A 3RXLA 1E4YA 4PYQA 1N4AA 4Y98A 5KYGA 3MTDA 1A7SA 2PKAB 4JBXA 3QG5A 2WWHA 4MV7A 1ILEA 3DUXH 4XWOA 1Y7IA 3OOJA 3DDZX 1BTZA 4ABIA 1HOTA 5JBBS 4R8TB 1XVMA 4NYJR 3IDSA 2HK9A 4URWR 1WUTA 2JLQA 3DOIA 4OK6A 1LDBA 4YO7A 1RKUA 5DHAA 4N1AA 2WAAA 4OV6B 1Z8NA 2WU8A 4P5EA 1TKBA 4KFCA 5EJZA 1ADYA 1PL6A 1J56A 1QFSA 3OIYA 3WNDA 2YXEA 3AFMA 2JETB 3V8RA 3FETA 3C5VA 3BAFA 5B6OA 4KDRA 2AKEA 3H7AA 3JQFA 4N5MA 4GP7A 1U2DA 1G55A 2HYIC 1FDPA 4ENTA 3M0EA 5AVOA 5K0ZA 4E94A 2XXAB 4RDIA 3SZNA 2BDEA 2Q4DA 1QPBA 2Z2JA 3BTHE 3IAM1 2FI5E 1S8FA 2ZQ2A 2P67A 3A7YA 5CJJA 1AUJA 4JOSA 4PN3A 2G4LA 3B1KA 3TD9A 4A2QA 1S0RA 1RMQA 2JI8A 4OP3A 3ZTWA 5LIRA 5I9LA 3JALA 1ECGA 1XZJA 2W9XA 1H3EA 1B0AA 4L5JA 3ZCRA 3EF0A 1OLUB 5CRIA 5DI3A 5DGCA 3RREA 3ER8A 5B6LA 4B80A 4CM8A 3L7OA 4OBXA 2F9UA 1V5GA 4HLUA 4JZFH 4HQ6A 3OSZA 1T4GA 3VR6A 4OB6A 4BO4A 4CMIB 1KTTB 1TRKA 3RAEC 4F4UA 4YJFA 3W3AA 1QBNA 4AJOA 1ZN2A 1BTHH 1QM5A 4B35A 2HRVA 2DQ4A 4UE6A 1SPJA 5BO5A 1QQAA 1P6QA 1QYDA 1E1YA 2V5VA 2XBWA 1AB6A 3KQLA 2CMGA 3EY4A 3OEHA 2ZA5A 1IQEA 5E6SA 4MLFB 2Q8PA 4HFPB 2B21A 5FORA 1NF8A 3T99A 1U81A 1SJ9A 2P9HA 3LKBA 1UWVA 1RP1A 1EUFA 2FP4A 4ETMA 1FIZA