4B71A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
total genus 197
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b71A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b71A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b71A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b71A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b71A03
5JJKA 3N70A 4NCYA 1W10U 3AK5A 4M9XA 2BTCE 1W4RA 4AG2A 3ECCA 2BDGA 2D2FA 4RFSA 1R5BA 1A0LA 1QBNA 1OFHA 4KITB 2GJAA 4BOHA 1BT7A 4BUJA 2F1JA 2QXJA 1S6FA 2VVCA 3UPEA 5L3SA 1TAGA 5KSOA 2ZU3A 1IJEA 5DI9A 3B5JA 1KJYA 1KYIA 3QKSA 2WAYA 2O8FA 4I81A 4LHWA 1NF3A 3L8YA 2KAIB 2G8TA 1RKBA 1LTOA 4TT3D 1WBBA 4MGKR 4YXWD 1NRJB 1G41A 4BNRA 3T27A 2BCJQ 5FTNA 3LA6A 5FPSA 1GUAA 5C1UA 1N5LA 3A4NA 3BRWD 3HU3A 2FPMA 5AUOB 5KPDA 2C8VA 1ZRKA 1OPHB 4NMMA 1ETUA 2O8LA 1Z6XA 3AVPA 1TX7A 2NOAA 2GDDA 5CITA 2B0FA 3A86A 1SGNE 2XRCA 4KHZA 2WWGA 3RNLA 3LKWA 1IQLA 1Z7KA 1K1PA 2KJQA 2YOFA 3P95A 1A46H 2PX0A 1AZSC 1GDDA 1GL1A 1UDXA 4RKEA 3AVZA 2VIQA 1KXCA 4Y6DA 2ZP0H 4TMZA 9LPRA 1Z47A 5EQRA 4M9QA 2VWNA 3SV9A 4NWLA 3AP3A 4CEIA 2XWAA 4VGCB 1E38B 3GFTA 1SGWA 3H7TA 5DPAA 2X77A 1VJ9U 4IC5A 2C5LA 1DSUA 2EEKA 4QC2A 1ZNXA 3EZ9A 4D82A 4M53A 4JLBA 4XJXA 5H70A 3LRPA 2F7SA 4Q7KA 1CO7E 4IOMA 1HY3A 3BK7A 2QXGA 1K28D 2WUCA 3TSWA 1MZAA 2BQWB 1K1NA 4D2IA 2ZKSA 1GL9B 1LVMA 4C9BA 4Q4HB 3MU0A 3LVRE 4OS2A 2VO1A 4BLSA 3VB6A 2VSOA 2GVZC 3TW8B 1G7TA 3ZLJA 3AAVA 1CA0C 1AA9A 5FI0B 4NYJR 5CLLA 3BTDE 4Q18A 4OBEA 4CDGA 4R71A 1ZNZA 1O0DH 1YZQA 2UUJB 3ZVCA 3M5LA 3IIMA 2QXHA 5JFGA 4D7GA 3ATLA 3C16C 3UWOA 5FTMA 3GJ8A 3SHFA 2ZRHA 3SUGA 2IUUA 5HTKA 4UFGH 5LBIA 2RGEA 3U7GA 2G6BA 3B7GA 1O2GH 2C77A 5G41A 4RJLA 4YM9A 5BRRE 2C96A 4FUFA 1GJ8B 3ZDQA 2VQSA 2P2LA 1P7CA 1YR7A 5FOVA 2OM2A 2ZS8A 1BBRE 3U2QA 3DFJA 1NMYA 3RS7A 1TA2A 1G37A 4MYCA 3PV0A 3QE0A 1IQFA 1DY9A 4XWOA 2BY8X 3MI4A 5CHAB 4IDHA 3Q5DA 3OX7U 1TF5A 1M1YE 3M4YA 1XD9A 1SZPA 3MCAA 4Q1FA 1KGDA 3GCNA 2IYVA 1N8OB 1RFNA 3BTME 2UWOA 3TMKA 3OY6U 4A0RA 3RSLA 4EQ6B 2O8WA 2VVVA 1Z0JA 3PENA 4JL5A 2IYZA 4ZHMU 1KI6B 1GHBF 2AH4X 2RA0A 2XXLA 1D3QB 2DYKA 3K0CA 4I7YH 2OESA 4FU7A 4IS5A 2ATVA 3VU9B 3MMGA 2G4UA 3LBNA 1HUQA 1US8B 3SC3A 3M7TA 4LZ4B 3B1YA 3GCHC 1Z3IX 3QY0A 3CPHA 1OP2A 1QJ7B 1JAHA 3M3TA 3CWZA 2W2XA 2VP9A 4XWAA 1RFLA 2SGAA 1C5TA 3GYMA 5FAHA 1G20E 4HFPB 2SFAA 2WMOB 1G9XA 4GI7A 5E3HA 4EDHA 5P21A 1JMOH 1S3SA 3KKOA 3UR9A 3QX5H 2I1QA 2FSFA 3KL4A 3P27A 3L2OB 3D3QA 1UVUH 2MMCA 1Y59T 3MH4A 1ETSH 4PHHA 4JVNA 1D3PB 1MBQA 4Q7ZA 1VYTA 3W3AA 2YC4C 1G32B 4LI0A 5JI2E 1UPTA 4MYTA 1G3BA 1SVIA 2PSYA 3EX7C 5JRZA 4PXAA 1S85A 3TNFA 1NG9A 5KPJA 1AQUA 1FNNA 3ETLA 3WYGA 2PLFA 3C14C 2CLSA 1GSIA 1IXZA 4Q47A 2AR7A 1LKBA 2VHTA 1BRCE 2P6NA 3CO5A 3M3SA 1GJ6A 4CEHA 2CF9H 4ARZA 2KE5A 4B1TA 4XTCS 2GDEH 5D3QA 2A4GA 4GMXA 1HAVA 3SU6A 4LPKA 4TYQA 1W14U 1ZZZA 2HLDA 2VEDA 4MPXA 4NIWA 3DPUA 2PWXA 1CJTC 1NJGA 1OP8A 4XTRA 4IBLH 1E1QD 5EXLA 4QFMA 1TPOA 2FMXA 1NC6A 1R0YA 3P4XA 2QPAA 1TQ2A 1VJAU 4ZI3A 1CIPA 1EASA 3FP6E 1RYFA 1P62B 3GY3A 2J92A 2XNSA 1S84A 2WV5A 2ZJZA 4U32A 3WHLA 1ZW6A 4QHYA 4JMYA 4LSGA 3KKMA 1FZQA 2WSMA 1KI9A 3DM9B 2C3SA 3RS4A 1NY5A 1F92A 2ZFQH 3TH2H 1ZBDA 1GP2A 4B3DA 3AP1A 1XD2A 1V2WT 5JPMH 1FPCH 1FX0A 1LS1A 1RE0A 2R6GA 4P0TA 1YZTA 1LB1B 2SGFE 4DEXA 2AERH 3ZZ7A 2ZI6A 1R0ZA 5EU8A 2FFBA 2OLGA 3Q7QA 1O2RA 4XBCA 1CSOE 3EAJA 3LGYA 3SGQE 1XEXB 2HXYA 3UREA 1JXOA 3LH5A 4Z54A 3CRRA 4Q1BA 4K8BA 4I8GA 1EJMA 2HDNB 2RMKA 3ZIAA 2ZJBA 4A4DA 1B0FA 4PO9A 3WY8A 2WSSD 2OCVB 4K1EA 1S82A 4IN2A 3PVSA 6GCHG 4P32A 1GCDA 5EPNA 3K6YA 3CBQA 4R2IA 3A37A 2VIWA 2DBYA 4ABGA 2ZRGA 1SLWB 2DWQA 5JB8S 3FPAA 2QSZA 3AV0B 3A8BA 4XOIA 4IGDA 4AKEA 4X1NU 3HYTA 4G1UC 5CHAC 1KK0A 1ZMNA 1L7VC 1PLJA 1GPZA 1M34E 5IRCD 1GJBB 5IF9A 1CT2E 4W9MC 1N8OC 4JMPA 1N0WA 3PUXA 5HKKD 1R4AA 3I61A 2XBXA 3OE7D 4GOKA 1C1WH 2NZJA 3T12A 3MWLA 3SQXA 3MAAC 3U7EB 1AIPA 2GAAA 3NDBB 4WY3A 5TMPA 2FA9A 4IXNA 3TSOA 1S9HA 5SZHB 4WZ6A 2HF8A 3THYB 1O2VA 4ABAA 2NO1A 2CGAA 1T8OA 4II7A 2V35A 2W2VA 2BDYA 4HDCA 1F0RA 2W6JD 1OXTA 1HFDA 2VHQA 3NPSA 2A7CA 2KBEA 5JS7A 1W36C 2Y6TA 3N5CA 4A7IB 3SFZA 2IS1A 1NTPA 1WSSH 4TPIZ 4Q00A 1T8UA 2A7HA 3U98H 5EP3A 1BMMH 3SV2H 2I4IA 2X1VA 3A8DA 3EC2A 4MDFA 1DITH 1AY6H 3VKWA 3FP7E 1GBHA 1XUHA 2A31A 2ORIA 2GXSA 1Z1IA 2B6HA 3PV2A 2FV8A 4O9VA 4YLQH 1NFWA 4RD1A 1GBKA 1IN5A 4K46A 1YRAA 8LPRA 1UJ1A 1NY6A 3LJJA 3SW2B 1TNJA 2CMKA 1G36A 4MTBA 4D9RA 3NVAA 5EP1A 3W5IA 4EPRA 2ZGBH 5JWHA 5EE9A 2R9VA 1H9LB 3T1OA 1TPSA 2LWIA 1T8MA 4XH9B 3QGNB 1G5RA 2XBYA 3IO5A 2HV8A 1A82A 1DG3A 3ZVAA 2AXNA 4RSPA 3C5CA 3RXDA 1XX9A 4DDWA 4AZ2B 1HDTH 2H8KA 1JALA 2JJ1A 4LZZA 2ZDVH 4JLAA 1HXFH 2EI7A 1KTTB 1E98A 2QENA 3I92A 3UMRA 3UNSA 3DKPA 4DXAA 1FV9A 3TGKE 4XSHA 2HXSA 2LNCA 4B71A 4NYMR 4Q2KA 1XCGB 3A85A 1W2KH 3CLVA 1GIAA 1ZSKA 2XTNA 3ZVNA 3ZZCA 1M74A 5ETXA 4HZUB 3S69A 1DAKA 4B2IA 3PMHB 1WDTA 2VU8E 1SLXB 3K70B 3B9FH 5L3RA 1DG1G 3FGNA 2YNBA 2Y5FA 4NZLA 2H5EA 2JATA 1MT0A 4LHYA 1SGPE 4MYUA 1KMQA 4YOJA 1Z8FA 2ZA5A 4CBOA 4LYFA 3T2NA 2IS6A 5F2EA 4CGZA 1O3YA 2PKSB 5E0GA 2C8WB 2PZGA 1U8ZA 121PA 4M8NE 2BY9X 3JZMA 1YLCA 4FINA 3EDXB 2AMPA 3I4LA 2EFDB 1UTLM 5CK5A 4GDFA 4C4PA 2O8CB 4DDVA 2FN4A 1G2LA 1F0SA 3ZD7A 1PQ7A 4QJ3A 3SU3A 1OH8A 2FTMA 1NS3A 3VR4A 1HLTH 3NTUA 1MKYA 4GPGA 1C1PA 4A82A 2ZVQX 5IK2A 4A2PA 3SBDA 3IBGA 1QB1A 3B82A 1YR6A 1E9DA 5EP2A 1O3CA 2ZPSA 3RLFA 3LJOA 1Y3VA 3MYWA 1ARBA 3EIEA 2BDCA 3RU4T 2HEIA 1SGFA 1XU4A 1NRPH 1Q1BA 1OHHA 4DCNA 1FPHH 3U7FB 2CVHA 4R7ZA 3CW2A 1ZJKA 5AJVB 1MQ5A 4O2RA 3W8NA 1Q31A 5KU1A 4BFZA 1PPBH 4PO1A 2RGGA 1B7XB 2Q6GA 1CQQA 4MH0R 5FTLA 1L2TA 1FAXA 3VPKA 4UNQA 2GJSA 3LC3A 2O8TA 6GCHF 4X1PU 2CHVA 3CX8A 1ELTA 3SI4H 1L4DA 2O0JA 1ZHMA 3H7OA 5HE9A 2QMUA 4L8GA 4C3ZA 5HPYB 4QRHA 2J9RA 3RS2A 4MNXA 3GCTG 3AEZA 2IK8A 2O8DB 1MV5A 1OXVA 1WQ1R 4NZQA 3MWYW 3B1XA 2A2ZA 1Z8IB 1YC0A 3SNAA 1ZD1A 4YMWA 1TBZH 2BJVA 1W1WA 3ZH9B 2QRZA 1G3UA 2HNTF 4IFEA 2WPJS 2Y7XA 1G8HA 2FPKA 4DUGA 3I3SR 1FMJA 3F3YA 4DDUA 4KODA 2BVNA 1OB2A 5TXGA 1UDWA 3GLHB 3TH5A 1KO4A 2H5DA 4CRCA 1MTNB 1TNDA 4KVGA 2Z94A 2PL3A 1JR3D 1M8PA 2KBFA 2KWIA 2G4TA 1S0QA 1P9NA 4JYBA 3C27B 3MOCA 1TADA 2CL7X 1BQYA 2C2HA 2J2UA 3AAUA 4I1SA 3FANA 4OI0A 2FWWA 3P70B 1W12U 3AVUA 2P3UB 1RTKA 2CDNA 3D65E 4KSCA 1XMNB 1G16A 1WCV1 1GI2A 1AGJA 3AKEA 2IUTA 821PA 3KTAB 2WTUA 4OGYA 2RHDA 1W5SA 4LUCA 1V6DA 3KGPA 4YLGA 1EFTA 3SQEE 5CYPA 4W5WA 2FOLA 4LK2A 1YR9A 4DHEA 2EW1A 3SV7A 2HCBA 4LOAA 3SJIA 3DHKH 2GCPA 1KDQA 3QF7A 2Q6DA 3Q3JB 1F48A 2BVRH 2YVUA 1EJNA 2Q6TA 2A7JA 1AKSA 2RGNA 1OXSC 3KDSE 1TNHA 1FOEB 1S1MA 2QM7A 3UANA 5B6OA 3KXIA 1ZU4A 2G88A 3HYRA 4XSKU 1BTUA 3SJAA 2VHCA 2UZIR 4WW0A 4W5JA 2YWEA 2JLWA 2C9CA 3GJ3A 1QRWA 1DX5M 3QZRA 2BDBA 2ZRMA 1H8EA 1GAJA 3K70C 2DFKB 4PPFA 1OF1A 5C2ZA 3KB1A 4O3TA 1RTLA 4ESTE 5DHFA 4BLOA 4C0JA 2NQ2C 3RDZA 2MMGA 1BITA 2PKSC 4PPQA 1CGIE 5JEEA 2BB4A 1RRFA 4DC9A 2FIRH 1BHXB 4TTPA 3LVQE 3TJOA 4AC9A 2BEKA 1D2NA 2OHFA 1O3EA 1Q3HA 1YRBA 4XIGS 5K8IA 1T5IA 4N1AA 3U1IB 1SG8B 1SHKA 4JYUH 2J94A 1P75A 4GL2A 1OH5A 1W36D 3QVUA 2ANMH 1CT0E 3GLGB 2OFXA 3SJBA 4YT6H 1ZC3A 1ZCBA 1E2DA 3NG1A 1U0JA 4EJSB 1IOZA 2V6JA 3RP2A 4TLCA 2BYAX 1UTOA 1EOLA 1EWQA 2FZ4A 4AN7A 2BVSH 1HEIA 2WPHS 2EQBA 2QAGA 5HYOA 2ODBA 4O97A 3DKVA 1TQ0B 1SHZA 3RC4A 1LNZA 4Q9HA 1NT1A 3BF6H 1E2EA 4PR0A 1E2KA 3B8JA 1O3JA 3RXUA 1O3PB 4ABHA 5JRJA 4ZKOU 2FOBA 3SE0A 4DGJA 2GZ8A 3L0IB 5DN6A 2OXSA 4D7FA 3RANA 1Z6EA 1L8QA 1NIJA 5F03A 4BXWA 1ELVA 2K1QA 3D31A 3T06B 1UKYA 4IVQA 3EPJA 2BLWA 2EFGA 4Q9LA 2FOHA 2ZI2H 4E05H 4DLZA 3MNSA 2JH6D 1VCIA 5EQSA 3FZZA 3WRXC 1FZZA 2D2EA 3WMEA 2QP9X 2HJGA 1GBDA 1E4VA 5BYKA 4NZYA 2W0SA 5J4LA 5AR1A 1HNEE 1HB0B 2Q1JA 3MH7A 2F1HA 4Y76A 2ZI5A 1CGHA 1KDPA 1GJ4H 2ZAMA 4JVMA 1EAUA 4WH6A 1OYTH 3THXA 3CONA 1XXHB 3TBKA 3A7TA 2C03A 2YYZA 4KV9A 2IL1A 2YKGA 2IYLD 4Y0AA 1EXFA 3PFIA 1DLEA 3EW9A 1TRYA 1E0FD 2GP9B 1O38A 4NIVA 3UWJH 4NYMQ 3TLXA 5FBIA 2XCFA 3GJ0A 3WMFA 1BDAA 1SKYB 4FUEA 3HJNA 1VCNA 3M7UA 3VR5A 1ZC4A 2F4LA 3AVTA 3JZ1B 2XAUA 2OC1A 1IN7A 2TIOA 2VWOA 1C1UH 4I31A 1UTPA 1GJDB 3KJIA 2QRNA 1VZQH 1OB5A 2GEDA 3JVVA 1NU7B 2J7PA 3M1IA 3K09C 4Q4AA 1AI8H 3UIEA 4G5QA 3OFND 1X8JA 4BFWA 3GP8A 1QJ6B 1A0HB 1NN3A 1WE2A 2ZM5A 4ZI2A 4A1TA 4DLYA 2P3FH 4P4SB 1AD8H 1KJZA 1TEVA 3L6PA 1VIAA 1X86B 5M04A 2BQ7B 1AHTH 3A81A 3B78A 5JJIA 2PEZA 3SV6A 2OILA 3A7WA 1ELOA 5EP4A 3GMTA 2CE2X 2IWRA 2MSDB 1O3GA 2OBNA 4Q21A 1O2KA 4V0KA 2VP6A 5JBCS 2PGQB 4BRWA 1QHHB 5GVSA 2O8EA 3E0PB 2ZCLP 4DT1B 2YOLA 4A0FA 1E0SA 1W4CA 3ASZA 3O8DA 5A8XA 4QM6A 1O3OA 5HXFA 3SGAE 1JR6A 2HGTH 1LPGB 2ZVPX 1PPGE 4S35A 1U98A 3A83A 2RG3A 1WB9A 4H1UA 4LCBA 3TH4H 1EZUC 4HAZA 3I5XA 1EX7A 5TY0A 1P57B 3NZIA 1C5PA 3RLWH 1T4VH 1QRAA 1O3BA 4JZIA 1FW6A 4WXPA 1UF9A 5LH8A 4Y8YA 1XX6A 2LKCA 4DB2A 4CEJB 3W8RA 3IWMA 3GCGA 5FCKA 2P5SA 2JDID 3EZ7A 3B13B 4KBFA 1Q2WA 1HJAB 3IHLA 2P0EA 4Q7LA 3BEIB 2JA1A 4AORA 2ZIQH 1TF2A 3T28A 2O8EB 3K9XB 2JLZA 2ZRBA 1R0XA 3SOSA 1FQKA 4HB3A 1G1MA 1SQOA 4H6TA 3IILA 1KYNA 3A6PC 4Q1DA 5KNBA 3A89A 5CJ2A 1G19A 3ZYDA 1NLYA 3DHWC 5D3MA 2C4FH 1SR5C 5L2ZH 4HDQB 1UVPA 2XOKD 4LJ8A 1C5QA 1C5SA 3TIUA 3NWJA 3R8CA 2W6IA 5K8UA 4ZAEA 3Q85A 1AIXH 1OSSA 1ZOMA 1LMWB 1NSFA 4DB4A 1WCZA 1J70A 2WYJA 1TF7A 2JLRA 1FIWA 2ZZUH 4RI0A 2WPIS 1V2ST 2QCYA 2ZO3H 4DSTA 4C7OA 4MQBA 1UM8A 2RGAA 1HXEH 1O2XA 1R5OA 1Q0UA 3AF2A 3H2YA 3VQTA 5B64A 1OXXK 3AH8A 3GDVA 2FESH 2DWOA 2IJOB 1EFUA 2C8YB 5JZVA 3LGWA 1MABA 5C46F 1DELA 5TDHA 4DRZA 1J7KA 1ACBE 3PROA 2V9PA 3QXSA 4A2QA 2PTNA 2QZ4A 2Q21A 3IPYA 3RXOA 2BBWA 1Q20A 4AK9A 1NI3A 2P67A 2VP4A 3BTQE 4QJ5A 3R20A 4PZLA 3T29A 3KUCA 1C9PA 4JLOA 1TWXB 1PQ8A 4MG3A 1P3JA 1TA6A 2P8OB 3M36A 1Q21A 3MMPA 4ABFA 1TYNA 4NKRA 1ID5H 2O0KA 2V6IA 2H9TH 2X2EA 3SYKA 1RIWB 3L3TA 1EFRA 2ANKH 4X8SH 4HYYA 1X8LA 4KSBA 2ULLA 4MKGA 3KQUA 2QI9C 1FL9A 1HIAB 3VFEA 4BECA 1RW4A 1TTTA 4DSNA 2Z9LA 4OS5A 5FL7A 1Z0IA 4FWIB 1SGFG 4PANA 1T32A 4JZEH 3TLOA 2FE4A 1EOJA 5DG6A 1KTSB 4XD7D 1AN0A 3SN6A 5CLQA 5EXNA 2DY1A 2UUYA 1H9HE 3KKNA 1UKZA 2XSZA 1TRNA 1FLEE 3RXRA 1SVOA 2D7CA 2A5KA 4D26A 4B76A 1GJCB 1XMVA 4TY7A 4M1SA 2D7DA 1QHYA 1FONA 2GVFA 3ZS8A 1BTPA 2FX4A 3RXKA 2CN0H 3LH1A 4LC1A 3OTJE 3KZ1E 1TNKA 2ODYB 1QA0A 2XYAA 4F7WA 1EXMA 1SVWA 4HI0E 3DOFA 2QGZA 1KI7A 1BCUH 3DDCA 4MDEA 5LB2A 4CRDA 1DLKB 4K1TA 5HZHA 2WPKS 3K0SA 1O3KA 3MO3A 2RB4A 1Y3XA 3LC5A 4CT5A 4SGBE 3V3MA 1A3EH 4LOYH 2FSGA 2NU1E 3WNCA 3X2SA 1IBRA 2BM0A 1RGQA 4EPWA 4FUJA 2O8BA 4EPYA 1ZPBA 4B3CA 3SYNA 3IIJA 1GI1A 1VR1H 4ZKEA 3BTTE 1AUTC 1OWIA 4AG6A 3HGNA 3WYAA 3BFXA 2GXQA 4ZKSU 4FMDF 4JLPA 2OUAA 2GCOB 3P4YA 3A80A 1ESTA 4MITA 2C99A 3ZVBA 3MNCA 4H42U 2GXAA 4ZHAA 3NEJA 3C8UA 4FXGH 3E5HA 1WOFA 1C2FA 1GVLA 3VFDA 1SI5H 5GCHG 4A1VA 3PWBA 4O3UA 2TMKA 3K9LA 5JSZB 1LV7A 1CJKC 4L4UA 3EPHA 3DFLA 3C41J 4WIAA 3DEFA 2SGEE 1II8B 1GGDC 1E36B 5ANRB 3ZZ9A 1P3EA 2XB4A 3VEQB 4I4LA 5JDUB 2XTMA 4C0AC 4QGAA 2A5FA 1Z06A 5KDLA 3RRYA 4JYVH 3RXQA 1IQKA 3W90A 1G8GA 1EZXC 2JASA 4RZUA 2ZJOA 1U9IA 1CVWH 5F8XA 5TVKA 5B30A 5EXSA 4CHAC 4JLJA 5DNYB 1G21E 4CZ2A 3RXIA 3BWDD 1OT3A 1SOZA 2ZS7A 1Z29A 4HAXA 1E9RA 1ANBA 4B2BA 4NH0A 4WXRA 4E22A 4KYUA 2Z4RA 3ZQ6A 1MRNA 4D4JA 1KXBA 1XDBA 1AE5A 4DCTA 2ANWA 3UWIA 3RC5A 2UKDA 3ZZDA 2BMEA 3FVFB 2BHRA 1I4TD 4TLDA 4KVAA 2VWLA 2ZAOA 1NVVQ 1ZUIA 2BMJA 2ZGJA 3QOFA 1O2NA 1EB1H 1J2JA 1G6OA 1O5EH 4AYYB 1QFKH 3M5MA 1K6MA 3P20A 4RD4A 5GADl 3JZ2B 4J1YA 2J0VA 1GJ9B 3SZNA 4QL3A 3SUDA 1XEWX 5L6NH 4UNRA 3F1SB 2CCGA 2H57A 1DTSA 1O30A 1KZGB 3MWKA 3VGCB 2TRMA 1YVDA 1KIMA 1P3CA 3OYPA 1UKEA 4FXPA 3GLIE 4UFEH 3UNQA 4B34A 1N5KA 2E9SA 5DO9A 4DUGD 1UBGA 3URCA 1K22H 2NPIA 2IXGA 1NPMA 5FOXA 1O5CB 1SLVB 4CR9A 4A36A 3EA7A 3TJUA 3P8NA 5CJPA 3TK5A 2FZZA 4JK6A 2BC9A 1G7CA 2THFB 4CRGA 1F7ZA 1W0KA 3PEUA 2AEIH 2J7KA 4MNWA 2NG1A 2P8OC 1U2RA 1P04A 5L3QA 3TPIZ 3L0PA 2FYQA 2HVXA 2B7DH 2ODEA 3KX2A 5KNDA 1IOEA 3VX3A 1RIWC 2WZQA 3QPUA 4JLMA 2W7UA 1JBUH 2ZDLA 1E69A 2VVUA 3CPJB 1Y5UT 3PG5A 3W5JA 4NYIQ 1LDTT 1ZNWA 3T1VA 4IOLA 3QG1A 1GMDG 1HH4A 1TU3A 1G3IA 3FKSD 4X1QU 1C4U2 3P92A 3CRVA 5HCIA 2W3IA 2ZWLH 2QPOA 2GF0A 2GILA 4F93B 2WBLC 4FUDA 2QTVB 3T61A 1EX3A 5I25A 3PB1E 2F91A 1OW3B 2VNTA 4IC6A 5E95A 1P4SA 1UCYK 1CHOG 1W4BA 4B2LA 2C98A 2FX3A 3O8CA 2J1LA 5C67A 3WNBA 4OK3A 2HNTE 1HTWA 2FOAA 3RXSA 1P2SA 3IKJA 1RRGA 2R2WU 1HT1E 1HJ8A 1TNLA 4GSOA 4JKYA 4CREA 3N2IA 2H1LA 3GJXC 1XB2A 1O2TA 4ZHLU 1GBBA 4IJMA 1KSNA 1QHRB 1DARA 2F1RA 1Z07A 1B23P 3B1VA 3CX7A 1P10A 3VKHA 3RHFA 2CHGA 4IN1A 3T26A 2LPRA 3BH7A 4D0LB 4MNVA 3VB7A 1XZPA 4IVPA 2Z5FA 4LV8B 4TZ0A 2FGKA 3D49H 1KMHA 4K5ZA 2ZRJA 1P05A 2BV3A 1FPMA 2A78A 3SJKA 1DO2A 1P02A 1UKVY 1I4LD 3B23B 1B5GH 3KXKA 2RH5A 2BD4A 4OHWA 1E2GA 2QL6A 5B58C 4GHQA 3CENA 2KSQA 4X8MA 2H16A 3LDXH 3E70C 4DIIH 1O39A 5T6FA 2XC0A 2Y5HA 4AG1A 3CUEF 4LJAA 3EYDA 4Q1AA 4MPVA 2XB2A 3LO5A 3NUMA 4THNH 5T6GA 3DMNA 4RD6A 1OPXA 3VHLB 4BEJA 3A7YA 2BBTA 2RGBA 1RTFB 1Z0KA 2ORVA 1XD8A 1GTVA 3K6ZA 1CRQA 4B43A 1VCQA 3R3GB 1NFXA 3QBVA 2ZSFA 4MNYA 5GCHF 1KXAA 1T5LA 3RXBA 3E1SA 2AXPA 1GBIA 3ENSB 1GNQA 5FX5A 2CLDX 1QVAA 4HB0A 4ZO4A 4WZBE 4M7GA 2Y82A 1NMXA 4IDQA 3GJ6A 5DN6D 4YESB 1O3FA 1SQ5A 2Z9GA 1Q22A 2CJIA 3B1WA 2Z3DA 1W13U 1BOFA 1KI2A 2PMDA 4ACAA 2N46A 2OFOA 3A1SA 2Z7FE 4I1OA 2QAAA 5DLQC 2Z9IA 4M1OA 3V4RA 1O2HA 1C9KA 3GFOA 2Z6VA 3ZVRA 2Z3CA 1S6HA 1BYIA 4DCUA 3KIDU 4ZCMA 2VHJA 4M1TA 1Q3XA 2HYIC 5DHAA 1GDNA 4X8TH 1GBCA 3LX5A 4Q5IA 2QN6A 2Q9BA 3BH6A 2HYDA 4C0HA 4DCDA 1UHBA 4Q9JA 1ESBA 4NWKA 3QKTA 3VGCC 1ZMXA 1S0RA 3SU2A 2GCNA 4RVCA 1P9UA 1Y63A 1ODFA 1BMNH 5JECA 1GBTA 1SVSA 4LDJA 1NRNH 4UJ3A 2ORWA 1E0KA 2OBLA 2R0LA 4TMXA 4LHXA 3SZEA 1T0JB 4B75A 2R3UA 5J4YA 4GNKA 2RGDA 5A0CA 4Z8YA 2A4RA 2FO9A 1GI6A 1YPEH 1V43A 1IQHA 4US0R 4Q80A 4A8JB 1ABJH 4B73A 1JR3E 2WSSA 1JAIA 4AFUA 1CR2A 1W2HA 1W46A 5C2JB 1TPZA 2CE7A 5FUVA 5AFYH 3GY5A 3QO6A 1UTKA 1L1JA 3NHBA 2J7PD 1NO9H 1LS6A 3PUVA 4RZ3A 1ELBA 1IQJA 1ZLRA 1AQ7A 3PQCA 5ESBA 4ISOA 2BD9A 5L30H 1DVAH 4TMKA 2YNAA 1SGRE 4FUBA 1KI4A 3OZXA 3UPUA 2ODPA 1DUEA 4DLXA 3BTEE 5GJWC 2G0NA 2QE7A 1JECA 1OIVA 1E99A 4K8OA 1AB9B 1TE0A 1O5DH 2J38A 2H7VA 1KAGA 1RXPA 4EUNA 1O3LA 4IXMA 2EWVA 3WYFA 2P93A 1OFIA 3QENA 3U5ZB 2GXUA 2R62A 1YF4A 3ZZ6A 3N7OA 2QMOA 1SHYA 1C5LH 1SL3A 1M7HA 4BZQA 1QBOA 1Q1QA 2FEMA 3OE7A 5DJ7A 4KYIB 2F9BH 4TQ9A 2JEOA 4B74A 3GLIA 2PJRA 3LW7A 1MRSA 4I8LA 3S9CA 2Z83A 2HALA 1E0AA 5E7IA 1X7AC 1W44A 2R6FA 1SGQE 1BA8B 2ODQA 2E1RA 3PEYA 5HGGA 4NA9H 4TN1A 2W6JA 5C1YA 4OJKA 3WXMA 4CYMA 1OSNA 1W8BH 1EKBB 4DLUA 1MR3F 1OIWA 1WAYB 2QGRA 3R7WB 1YCPM 3PV4A 3EZ6A 2C95A 4LY6A 1YPGH 3GPLA 4Z1MA 1CHOF 5JWOA 3RMOH 3TQFA 3LU9B 2Q3MA 2QBYA 1DPOA 1V2KT 2ZJYA 1C2EA 2XZLA 3K2UA 3FMOB 5GJVC 1TPAE 2FFHA 4HATA 1CULC 1GMHG 1HGTH 1BIOA 2QXIA 8GCHF 4L5BA 4X1RU 3GLFB 3KJHA 2Q0HA 1ETRH 5DP5A 5C5NA 2ASUB 1CBUA 1KSGA 3T62A 1AVWA 1E34B 4P3YA 3H1TA 2OAQ1 1HAGE 5JMTA 1TLDA 4HLUA 2ZU2A 3RRMA 1VG0B 1YCPK 1RIFA 2FJUA 2ZYUX 2DFLA 4U02A 1XUFA 2EI8A 4ABEA 2YNMA 3ZYCA 1AK2A 2UVQA 2BQ6B 1ZTKA 4GCHG 2ALVA 3LBHA 4XFQA 5T3HA 2WWWA 2W6ID 1NU9A 4IEIA 2IYRA 1YLDA 3A1WA 2BMDA 2F6RA 3SYJA 1ZJDA 4AYVB 1QRZA 1DANH 1N25A 4BQSA 8KME2 2WWYA 1MKXK 4LWZA 1WBGB 4JYCA 3U4QB 3QNUA 3EAQA 1GHZA 3V0XA 3SO3A 1D9XA 1THRH 3T1TA 5JB9S 2A5AA 5TCCA 1IY0A 1SVMA 1DAFA 2BDIA 2A1DB 1CA0B 1GKUB 1C2IA 4ZIRA 2R8RA 4IOKA 3MU1A 1DAGA 4N3NA 3ODFA 3UQOA 1CR0A 1KI8A 1AE8H 2TPIZ 2OXCA 5K8TA 4TQAA 1OH7A 3RXEA 4B48A 4RD0A 2EI6A 4Y79A 1FUUA 4HUQA 1SGYE 3OEEA 1LF5A 2A5GA 3U61B 2QT1A 1ONBA 4LJ6A 1WMSA 4K2YA 5DP9A 1J8AA 3A58B 1EFRD 2R65A 1XF9A 4CRFA 1NMZA 1W7AA 3IPXA 3KUDA 2VH0A 3MUFA 1OJLA 1F2UB 6Q21A 1NZQH 2ZYTX 1W4AA 1GHBG 2FDCA 5FL7D 1E2NA 4DEYA 2PV9B 4FMCB 3RUOA 2VBCA 1EX6A 3TJZA 1P61B 4LJ7A 4NONA 5JCPA 4WF8A 4AGJA 3WBKA 1QHGA 1QNJA 2OTVA 4CH2B 1W7XH 2V1UA 2PT5A 3LV8A 4A8JC 3G82C 3HP1A 1ZTLA 4JJKA 2XSZD 3S0NA 3FTQA 2J46A 5LD2B 1G5PA 2FF7A 1UEJA 1QBKC 2NO9A 1N6OA 2DFNA 1NKTA 2GX4A 2H9HA 4XSGA 1T3HA 1HV7A 4BAHB 4DLWA 2D1JA 3FFAA 3AF0A 4I33A 1HURA 1YKTA 4Q7MB 1ABIH 3S1AB 3E3TA 2WIAA 2OCYC 1T8LA 1PVOA 1VCPA 1KY3A 2ZQ1A 2OC8A 5DO4H 4DLTA 5C3NA 1O34A 3VTKA 3TE6A 1AB9C 1OV4A 3RXJA 2J0UB 2FEQH 3GCHB 2UUKB 2G3YA 2BX3A 3B85A 2G1KA 5LPNA 5DSZA 4ERNA 4TYYA 1ZJ6A 3ATIA 5I46H 1V5WA 2I1VB 3UG6A 1GG2A 2R6AA 1VGCB 2XXAB 4WMDA 1S96A 3GICB 1O2JA 1DXWA 4JKIA 1O2LA 3WMGA 1P12E 1AS2A 4MDSA 3RC3A 2AIPA 2QORA 1HRTH 4JCNA 3BIFA 2BZAA 2HWLB 2AD5A 4OQLA 1ZM7A 1VITF 4L16A 2AFQB 3ZYEA 3BBPA 3H86A 3HGPA 1QCPA 1YPJH 1LCYA 1FN8A 2XZPA 4DW2U 3VB5A 1F5LA 1HPGA 2OINA 1V2NT 1RS0A 3W3ZB 3PEWA 3ZGXA 1FY4A 4UKDA 4Q4JB 1DE0A 4LJ9A 4A9AA 3AVQA 3QLPH 2R3YA 3ZZAA 5BQ5A 2IBMA 2ZI9A 1A1VA 5TB5A 3P8FA 1P09A 1E79D 1JR3A 3QPWA 1XEFA 5DKMA 2BOVA 1Z6JH 5EQTA 4QGHA 2BZ6H 3Q3XA 1WBDA 2H2ZA 2VP5A 1Y5AT 2EC9H 2Z0MA 4PC3A 5E0JA 3QXHA 3I1FA 2BD8A 2ZR0A 2VHUA 1IONA 1EGAA 2ZU4A 2O8MA 3F0TA 5DP8A 1XJQA 2ZDMA 3NKKA 5K8LA 1ELGA 4OYHA 3RMMH 2P94A 2Q9CA 1MQ6A 2Z6BD 3OTPA 2BCGY 2SNWA 2ZJ2A 3DD2H 1TMUH 4RFSB 4BANB 1OWHA 2ZFTA 1XFAA 4PX9A 4DLRA 2YC2C 4QM7A 5KOYA 3TSZA 5L3SB 5G53C 1AJEA 7KMEH 4TYNA 1QL7A 1GMHF 3UTUH 1KK2A 2CCJA 3QKSB 2O8FB 3LQQA 2F43A 4HAUA 1SQTA 4OK6A 4E7NA 1Z22A 3LXXA 3CNNA 2GCTB 1O32A 2BM2A 1DEKA 4X8LA 2C9YA 5C1BA 5F8TA 1Z1JA 2ZI3A 4QBGB 1O36A 5FOSA 1EPTA 3ICEA 1RZ3A 5FX6A 1O5GH 5ABWA 3MO6A 1TBRH 3M37A 4K60A 2ZANA 2ZHQH 2WWXA 2EA3A 2GZ7A 3R9XA 4GCHF 3QJYA 1HAHH 5ESTE 5LPRA 5EE1A 2FNAA 4P4TA 4M1MA 2G52A 3PIRA 4HLUC 1JIMA 1W0KD 3RSOA 4OJQA 2JLYA 4G01B 5DP4A 3A82A 4D9QA 1QF9A 2GJ8A 1A7JA 2G1JA 1NN6A 1X6VA 3FFBA 2REXB 3MSXA 4CEIB 1PQ5A 1OXUA 4BASA 1OFTA 2ZIAA 4I8HA 1XUIA 4AG5A 4NTZA 2ZFPH 1N5JA 4MA4A 5DIFA 1EK0A 3IHWA 1DAIA 3CPEA 1XCPA 3OIWA 1ZNYA 5BW8A 4U00A 1C1RA 1R8SA 1RJ9A 2HNTC 4U30A 1AGPA 4I8KA 4WH8A 4M4SA 1LVYA 1NM6A 2W58A 4NCJA 4BRUA 3BG8A 3CZQA 1EB2A 1HQCA 1G4AE 2BKUA 1T0HB 1F0UA 2G0TA 1BMLA 1QZXA 1F2TA 1BH2A 1MUEB 1TUEA 5LD2C 4UJ5A 3CB4A 2AYWA 3UWKA 3TR0A 4MUAA 4PAQA 1GL0E 1N6XA 3RMLH 3W6OA 1EESA 5DP7A 1VCWA 1A2KC 1AVXA 3B8HA 1AVGH 2OAP1 3V12A 1AKYA 2EYQA 1VCMA 2QTFA 4R0IA 1O37A 3ADCA 1ANKA 2DUCA 1XZQA 3CNOA 1TOMH 3SI7A 2NO6A 2ZE6A 1M9UA 5EOKA 4JIMA 1AKEA 4DIEA 1R7RA 1XTQA 3RS5A 1O2MA 1W36B 3DL0A 3PYHA 3PITA 3X1XA 3ATWA 3F68H 1VGCC 5KSYA 3RABA 4KXFB 4I8JA 1G17A 2OLKA 2R2AA 3BD9A 4X6OA 2B9LA 1UBCA 1C5OH 3KNXA 3BH0A 2IOTA 5EXPA 2SHKA 2X8AA 1H8HD 1D6WA 1YKSA 1QTFA 3F9HA 1GOTA 3TK6A 4QBIA 2WWFA 1FUKA 3LIWA 2N1BA 1GWAA 2NPFA 3OSYA 4OS7A 1GMCF 2H92A 1UO6A 1DWBH 4R9UC 3SUEA 2BVXH 1LKAA 2ZDAH 3H0KA 2AS9A 1L4ZA 1ZVQA 3THWA 5EZ6B 5DI3A 3AASA 1Y5BT 4Q19A 1W7GH 1EAXA 2J4IA 2JIZA 3KXLA 2F9LA 4X2XA 5BPEA 5KSPA 5EUMA 1MCVA 1J15A 5EXTA 1A7SA 4CR5A 2V54A 3R9IA 3BTKE 1JXPA 3SHCH 1N2CE 2GTPA 1SGCA 1O2IA 4V0ME 2EFCB 5EJEA 2Z9KA 2H9EH 4BAMB 1G9IE 2IEYA 1UCYH 1FJSA 3OFNA 2PKAA 4D6PA 2FYRA 1W48A 1MCTA 1J90A 3IITA 4HSEA 1E96A 1G8FA 1Z8RA 3IQWA 4DG4A 3VR3A 1VITH 5FXLA 1KDTA 1C1VH 1C5RA 4TSFD 4FU8A 1HT2E 4GZLA 4OI4A 3B60A 3U3MA 1JEDA 3MNBA 4A1XA 2CBZA 5GPIB 1PPEE 3DOEA 4X6PA 2ZXUA 5KTYA 2PFEA 4V02A 2VH6A 3QF4A 1WU1A 4ZKNU 3HU2A 1OP0A 2QTHA 1IM2A 4INLA 3QVVA 1TGNA 4X8UH 1KK1A 1W49A 1IHSH 3DZ8A 2X19A 3CIOA 2GCTC 2H1UA 4CEHB 2V1XA 4ARZB 5JYIA 4YMTA 3W94A 3M35A 1QHNA 4PPGA 1HAVB 1A2CH 5E4FA 4IHQA 1WQSA 2BDHA 3GOVB 1C5XB 4HEJA 4UDWH 5FBEA 2OQUA 4WXVA 7GCHF 4I32A 4XBDA 3PMAB 4OGXA 5EQQA 4X2WA 1W0ZU 4Y0YE 2ERXA 3LONA 4Z51A 4MUBA 2QYIA 4KFTA 1A61H 2QP3A 4Q7YA 1C5UA 5SZKB 4CW7A 1GDUA 1Y3AA 1DPFA 2ZF0H 4URZR 1ARCA 1BS1A 2JDIA 4KJZA 3W6PA 1EAIA 2ZU1A 2A2XH 1QL9A 4ABJA 1YR8A 1C5WB 5CDFE 1Y3WA 2Z3EA 1TQ6A 2IYUA 1FUJA 2ZR9A 1XVMA 1K1JA 2CHAC 1XD2B 3SNBA 4NPHA 4ZXYH 3C7KA 2XJ9A 4DVAU 1XBTA 1EAWA 1WYKA 5E7JA 2AD1A 1FX0B 2QE7D 3VHXA 4BTIB 4PHFA 1YPKH 3E0NB 3REFA 2GEUA 1IAQA 1QDEA 2P59A 1SVKA 2JLXA 3RXHA 1BHXF 1P2UA 1GI4A 5FTJA 3LT3A 1BRBE 2AGEX 2DWPA 1Z5ZA 2VP0A 1FIZA 3OAAA 2XOKA 4B2PA 4JS0A 2YV5A 3RXGA 1E0JA 3D6TB 3I73A 1KSHA 3N2EA 3PLPA 4LBZA 5FBRB 1KLTA 4B3XA 4GOXA 4D8NA 1IQGA 3UKDA 1T4UH 2V7QA 3WBJA 3CS0A 4A6PA 5H4IB 2NWNA 4WWYA 1GRQA 2D26C 2JJ2D 3QKRA 3A8CA 4M1WA 2BWJA 3P32A 4MRVA 4QT8C 2QAJA 2WWIA 4B3BA 1TBQH 2GCHF 3OHMA 4YOGA 2JGNA 1YBWA 1IQIA 2WM9B 2FDAA 4Z1MD 3V4FA 1NKSA 3TUIC 2D62A 4WAUA 4A92A 1E2LA 1ZHRA 5CE1A 4AD8A 4Y8ZA 2ZEJA 5EXMA 2RCEA 4D0NA 2OV2A 4FMDB 2W2TA 2PUQH 3OY5U 4BZPA 3GISB 5FTKA 2PMKA 1GI3A 4ISLA 4TWWA 2D06A 5FOWA 2XCNA 4CH8B 2PCLA 1H9IE 4B44A 2GZHA 3AF3A 1C2JA 3HR7A 3TVJB 5A09A 1T3SA 3U44A 4KFSA 4Q7JB 1WQVH 3ADKA 2MSCB 4F91B 3K0CC 3DM5A 2A45B 4FI3C 1T31A 3G01A 4ASUD 3A7XA 1D6JA 4KLZA 2C78A 4U01A 1LHEH 4XD7A 1GITA 1QL8A 5BN3A 3MTYA 1WXQA 4YLUA 3LGVA 5HM2A 1TGBA 1Z71A 1BIFA 3CH4B 4RN6A 4Q9IA 2JLQA 1O31A 4C30A 2Q6FA 2HOBA 2HPQH 3Q7PA 3TGPA 2STAE 2O9QA 1KI3A 2OD3B 3LWNA 4Y0ZE 4DDTA 3M3VA 5JEDA 2B7BA 4ILEA 3TAHA 2GMTB 3CX6A 1GI8B 1H1BA 1U0LA 2FOFA 5DISB 1COWA 1ELEE 3G0HA 1VHTA 4ABBA 1QRXA 1PUIA 1F2SE 4WOPA 5TJXA 1XKBC 4FCWA 4LGMA 3KKPA 1C5ZB 1NESE 1FMLA 2VSFA 1PYTD 1S81A 5KSZA 3AGPA 3PJRA 1C1OA 3PTNA 4V0NA 3ZZ4A 4C0LA 3RC6A 1FMGA 2F1IA 1FTSA 2J3EA 3JVUA 2ZE8A 1SGTA 2FLRH 3QK1A 4BTTB 3LLMA 3OEED 2NZ8A 1CBWC 4MKHA 4K8YA 1SGEE 2JLSA 1MAYA 2AN9A 3WP1B 2FSHA 2I6QA 3S9AA 2Q9AA 4Q9KA 1ELFA 5BXQC 2FXRA 1C1NA 1XMJA 3PR1A 3BTHE 1L4YA 1F3OA 1A3BH 1GL7A 4NBSA 1P6XA 3P1JA 3GY6A 2O5VA 4R8TB 4EFNA 2IYWA 4UNSA 3HDTA 2YJTD 3VX4A 2V3CC 5CK4A 2ZE5A 1YCPH 5K0HA 4QGGA 2JAQA 4JZKA 4FVBA 1N6HA 2IHYA 2CLCX 2Y80A 2ZHDA 2WPDD 1HE8B 4HZHA 6ESTA 5DGXA 3GEHA 5F98A 3FHCB 2W0MA 1A0JA 4E7RG 4HB2A 2EYUA 1XTIA 3SU1A 2G81E 4OS4A 5CYOA 4Y10E 5J5CA 1A5GH 3CRW1 4V0MA 4M1KA 3FAOA 3NHAA 3AKYA 1BJVA 4ON9A 1MKXH 1YJ5A 3TUZC 3SI3H 4E03A 4HUTA 3LNCA 1YQTA 3ZVFA 1CJUC 3PO1B 2GZDA 1EFCA 2C9OA 3NBYC 1U81A 5FH9A 3D7MA 2ATXA 2GT7A 3SJ9A 4DWJA 4ZXXH 3K0EA 1MD7A 2AHOA 3U8OH 1IY2A 4A1FA 1UJ2A 4HZIA 3M6AA 4JVSB 4G5SA 4O2LA 2YINC 1MMJN 4TPYA 3NEYA 3CF0A 2BY7X 1RC8A 5JBAS 2QY9A 4MGYR 4AI6A 1D2EA 4Y7AA 1FP6A 3GY4A 1P06A 4PHGA 2W83A 1UK4A 3U3RA 1N0UA 2J0QA 4PQRA 1EZSC 3T25A 3K0FA 5FBVB 2ZRIA 3GFPA 3SNDA 1DOJA 4KAXA 5FUWA 5FBWB 5EE3A 4DIHH 1BOQA 4YONB 4KGAA 4FCTA 4IMZA 4D76A 4C0KA 4EPTA 2PGBB 1C1QA 1BTXA 2ZITA 2PTCE 1QURH 4NFEA 5C4MA 4MVNA 1GJ5H 1GFIA 1FAKH 2PR3A 1DS6A 4TL9A 1ZCAA 2BJWA 4LV6A 2FLBH 5CDFA 4EPVA 4UEHH 3MWIU 1CHGA 1TQDA 2AWOA 2TGDA 1GBLA 3A84A 4ZV4A 621PA 1L1NA 2KAIA 2BBSA 4E5UA 2H5CA 3URDA 5A8ZA 1QVRA 2V6NA 2FI5E 3BIVH 1T8TA 4A5TS 1M7BA 1P01A 3E91A 1N6IA 3T15A 4NHOA 5AHGH 3ZZBA 4DOQA 2ZTSA 3OIUA 4X6MA 1Z83A 2FZLA 5FFMA 4K69A 4H6SB 1SKQA 3BS4A 1MKWH 1K5GA 2HT1A 3AW0A 3FKSA 2WOOA 1C1YA 1SQAA 3F9FA 2GJKA 5KDOA 2PBRA 4WMEA 1W5TA 2V3HH 4LJ5A 1ZP6A 4BFUA 4O3MA 2BY5X 2ZQ5A 3HPQA 1BZXE 4ZCLA 4TWYA 2OCAA 3EWAA 1EP6A 4GOJA 3SOPA 1QB9A 1UCYE 2R44A 1YPMH 2WJIA 2IYQA 3KF2A 4L15A 3KJEA 1MH1A 2UUFB 1FP7A 2GV6A 4Y0VA 1YPHE 2XX3A 2ZUCA 2GMTC 4D4KA 1GKYA 1D9IA 2ZETA 4C0BA 3AM1A 4OL0A 3U60B 1ZSLA 1E4YA 1MD8A 3PEVA 3RYTC 2D2DA 1HUTH 1NROH 4MYHA 1P2MA 3BIUH 1O3NA 4NFFA 1WTHD 4D81A 2H17A 4DJTA 4DLVA 3D62A 5FOUA 4Q4HA 4TQUS 1XPRA 3J81k 5E8EH 1YU9A 1FQ3A 4ISNA 4DKXA 3BC1A 3V13A 1SXJD 2IYYA 1BRUP 2VF7A 1KDQB 3LGIA 1FXYA 1YP9A 5K7RA 1MO3A 5CM9C 3NKVA 3A36A 3H09A 5DYIA 3U6KA 2XC5A 3HU1A 5JI3E 1AKSB 1B0EA 2BY6X 1VG1A 4JLNA 1DO0A 3M61U 1RPZA 1X3SA 5FUXA 4BAKB 3KKQA 1N6YA 1BKDR 1WA5A 1QY6A 1GKIA 1OKXA 1PPCE 4Q7XA 1RJXB 2FS9A 3Q00A 3PV5A 2G5VA 1GI9B 1ZGVA 4CVNA 1F6BA 2STBE 1I2MA 1NNEA 2P3SA 3UMFA 3SU5A 2CV3A 2VIOA 1IQPA 4PSVA 3CNLA 2PLRA 2XNIA 4LZ1H 3PO1C 1J8MF 5J4VA 2BM1A 1GI5A 3I8SA 3AVWA 1QQUA 3RU4E 5AF9H 3E2IA 4RKFA 2IEZA 5AK0A 1VMAA 5DYGA 3GJ7A 3REGA 1HAZB 2IX3A 1FTNA 4EQ6A 2IYXA 1YGCH 2OFWA 1G30B 3SFVA 5T6DA 4LC0A 1QQ4A 1KI6A 3KFVA 2L0XA 1IN4A 5A2MH 1NN5A 4X6NA 2TBSA 2GEVA 3E1XB 1WF3A 3VB3A 4M9FA 5BN4A 3VU9A 1U99A 2VL7A 4PSKA 1CS4C 2I3BA 1N6PA 2BD7A 1US8A 3M5OA 2Y81A 3TIFA 3I78A 1NVVR 1YHNA 1SLUB 3TR5A 4B2AA 3BJIC 3TVDA 3HK3B 3FWYA 5AJXA 2IF2A 2QAGB 4HAYA 4AYWA 4JLVA 3AVVA 1HA3A 4C2UA 3BORA 2IYTA 2AKYA 3RXAA 1E9AA 4JYTA 3U3KA 3GQBA 4GAWA 2C93B 3L8ZA 2OCPA 1GWNA 2SGPE 5LPFA 1OKKA 1YZNA 1ZPCA 2DE8A 4A0HA 1HJ9A 2EU8A 1T91A 5AFZH 1YM0A 2ZDNA 3KJGA 2JIZD 1IJFA 3P17H 3VNUA 1GNRA 2VYFA 1P5ZB 1QJ1B 5AVDA 4BFVA 3BG4B 1UK3A 2O0HA 1EUFA 2XNDD 3S7KB 1ZINA 3IIKA 4W7SA 4P33A 5GJCA 5G3ZA 1PUJA 1V2LT 2JKHA 3A7ZA 2BOHB 5HR5A 3AW1A 1L1GA 1E2QA 2VIDA 4J2YB 1OWDA 4J0QA 1KO7A 2QROA 1OFUX 2NGRA 1VYVA 1E2IA 2FTLE 1CE5A 4RD3A 3ZVMA 2ZRDA 1NBMD 2IA5A 2Z9JA 4IVRA 4I99A 1Z8JB 1LY1A 4MRNA 4A2WA 3D8BA 2OBQA 5GJ4B 2OBOA 3THXB 2B21A 2VGCB 3OU0A 2GGVB 4A6LA 3RXVA 3C15C 4WXIA 1E2HA 2ZI4A 4BWYA 1UVTH 5GJBA 3LAWA 4NYIR 2A32A 2V3OH 3OESA 2ZUDA 2GD4B 1NG1A 1JB1A 1NP6A 1OYWA 3E90B 2P16A 1XJ0A 3I29A 2ZJ8A 5FI1B 2Y8EA 2ZI7A 4QKQA 1F5KU 2ERYA 2GKSA 3MFJA 3TNTA 4LRWA 2AFIE 4LBYA 1JJVA 3EE0B 1NLZA 2C8XB 4HAWA 4Q4AB 2R6DA 2XTTB 1Z8GA 1Y3YA 4RKJB 4X8OA 2IS4A 4TMTA 3QWCH 5IDVA 3W9YA 2V0BA 1R6BX 5J4HA 1GGDB 4F38A 2QNRA 1ZM3A 2QSYA 1YYY1 1N6RA 4PFSA 4B6FA 4DVGA 4D4LA 4MLFB 1E9FA 1LVBA 1DICA 5IHPA 3W95A 1DSTA 1QIXB 4CHAB 1NJFA 1XEXA 3I72A 1G3RA 2NO0A 2EWWA 1MBMA 1CRPA 1DAEA 1T4GA 3GLHE 2C90B 1FNIA 4TL8A 5LB4A 3BEFB 4WZAE 1ZUNB 4UXIA 1EP5A 4KTSA 1KY9A 3FMFA 1CTQA 2WOJA 4URYR 1TRMA 1ESAA 5JJLA 2RGNC 1AZ8A 3FP8E 1OLOA 1KXDA 4BFYA 4BEBA 3ZS9A 3SS8A 2AIQA 4VGCC 1TU4A 3LLUA 1Z6GA 1PJPA 1JRTA 1XTJA 1GBFA 4PC7A 4MRPA 2XEXA 3OAAD 2V4ZA 3FKQA 3FHOA 3OEHD 1O3MA 1G7SA 1ZMLA 3L82B 3EXAA 2OZEA 2CVFA 2V7QD 1UFQA 1UMAH 3QDZB 2ZC9H 2Q3FA 2QMEA 3GJ5A 4QJ4A 3FOZA 1R8QA 3ICQB 1UEIA 1VCOA 1HV8A 1BTZA 4PTLA 3ZVEA 2VWMA 2FOCA 1D2MA 3IGFA 1QG2A 1N0VC 2WV4A 1O87A 4WA7A 3GEIA 1HQYE 3UK6A 4JBXA 3THYA 1BTWA 2JH0D 3U69H 4TYPA 5D3MB 3BTWE 2FU5C 1H8DH 5JLJA 1UTNA 4AFZA 1RRKA 1RD3B 3LBIA 2QPTA 3GY7A 4Q4LA 4MPUA 1XTSA 2QAGC 3WNDA 1H8IH 4DIDA 1R5NA 2DPXA 1MZDA 3TVTA 4WMFA 4BGDA 3F5FA 5HM9A 1O2OA 3T34A 3ZZTA 4B47A 4BAQB 4C7OB 1VDZA 3ZZ5A 2PT7A 2WMNB 2F3RA 3VAAA 2PCJA 1C5NH 2ZS9A 3PLBA 2ZPQA 3ZJYA 3CZPA 3ONWA 1LO6A 1MABB 1N3BA 4GBMA 5JBQA 4ZH8A 2I6SA 4IDOA 3KQCA 3KQNA 3GJ4A 2Y5GA 5AJWA 3BSQA 4Q1CA 4TLAA 1G3QA 3P8GA 4ZROA 5UKDA 2NMVA 2CXXA 2OXRA 3BG4C 4NIYA 1ZIOA 4OM9A 3GLGE 1WV7H 3F9GA 2IYSA 4FUCA 4TTRA 4NA7A 4MQAA 3PUWA 2PW8H 3THOA 2WJVA 4FUIA 4FCVA 3LOXA 4GHTA 3BOSA 3HK6B 3GY8A 2ZTZA 2A5DA 1XMSA 4A0GA 4IRUB 1ANCA 1COWD 1ZYUA 4TYWA 1DWEH 2JH5D 2H6MA 4PSAA 1V2UT 3HWSA 3KB2A 1KSJA 2UZ3A 2V8OA 4HGCA 3OF5A 3TK1A 4JSTA 2WPLS 2VGCC 3P8OA 3CKLA 3AUYA 4JVLA 4ESVA 1KTVA 4GPTA 2ZYWX 3LGUA 3FMPB 3RXCA 3H5CB 4AYTA 1X1RA 2QN5T 3BEUA 4HZUA 4M21A 4AWXA 1OIXA 4YC7A 3UOUA 2JCSA 5GVRA 4XDEA 2PUXB 4ABDA 2CL0X 4RY2A 2GA8A 4NL4H 3BGWA 5ELXA 4YMSA 2CF8H 1V2OT 4K81B 3LH3A 1ZHPA 5IT5A 2WWHA 4UQOA 1JQLB 2V55B 2WV9A 4INHA 1I2DA 4S2EA 3NK8A 1G4UR 2ZSDA 2O8CA 5A0BA 5EE0A 2NO7A 3MJRA 3ADDA 1J99A 1K1LA 4F92B 3SNHA 2OO7A 4U7DA 1E79A 1YZUA 3B9QA 2FOMB 2Q3HA 5LDDC 4NYJQ 1L2EA 3UNRA 1B0UA 2VF8A 1JBKA 2O8BB 2F9NA 3AGQA 1AU8A 4IEEA 1XXHE 4O25A 1D6RA 4BFSA 2JLUA 3UFAA 2ZHWH 2ZCHP 8ESTE 4JBWA 1R10A 1T6NA 1Z2CA 2QIQA 3NIBA 3SHAH 1Z08A 3QI2A 3VMFA 4IDNA 3R8FA 1VECA 2FI4E 2ZR7A 4DY7B 1UK2A 2GZAA 5H1YA 3PLKA 1SKYE 3ZV9A 4TY6A 1V2MT 1G64A 1T8NA 3QXJA 3NC0C 1QHSA 4NCNA 1DUAA 2OEPA 4EAQA 1GL6A 4PHTA 4YTAA 4MGIR 3V9PA 2IN2A 3H4MA 3KHVA 1JEEA 2NU0E 2BXTH 2WYGA 2OG2A 1TAWA 4RD2A 2OCBA 3M0EA 4F49A 4IKEA 2FM2A 1HYLA 4H1VA 5HZKA 1ZUHA 2OC7A 2WUBA 1R2QA 721PA 3O47A 4US2R 4LBVA 1KXFA 1VKJA 5AJYA 5LPEA 3EGKH 4G5RA 1M6NA 4GMDA 1SFIA 1C9TA 1E1RA 1RRCA 2LCFA 1GVZA 2BMFA 3ND9A 3CRQA 2IXEA 1AS0A 3C5HA 1C5VA 3A88A 3KN2A 3LQRA 3I5YA 3FZDA 4IFBA 1C2DA 3UG7A 3ZD6A 4DSOA 4K1SA 3W6NA 1BMAA 1VYUA 1PV4A 1P2QA 1PPFE 1E6CA 1N6LA 2IS2A 3RLYH 2O8DA 2ZQ2A 1AWHB 3MD0A 5A8YA 4BPBA 2P5TB 3UY9A 2ZU6A 1FY1A 2F9MA 5JHHB 1S3GA 4TZ6A 2TGPZ 3L0SA 1W11U 4D25A 3K9NA 1UBFA 1LW7A 3SU0A 3SUFA 5FR2A 4Y71A 2ODNA 3Q77A 3GLHA 4FUHA 5EPYA 1O33A 3STIA 2WKPA 3NWUA 3SQHE 1BB0B 3P26A 2C8ZB 4OQXA 2FMJA 3KEEA 2A30A 3PXGA 2W26A 1FY5A 1KZ7B 4GP6A 1C5MD 4DLSA 1GHXH 4BLRA 4BLTA 1YPHC 2CJWA 1SOTA 2HUPA 1GHVH 6CHAB 3NC1C 3PUZA 2G83A 1CKEA 4F4CA 3FFGA 1PPHE 2LKDA 2BHGA 3DO6A 3TGJE 1DBSA 3K09A 4IDPA 4PO8A 1CJVC 2VRWA 1P9RA 1D4PB 1ZPZA 3A1TA 4GP7A 4JBYA 1YZLA 1TNGA 1QHXA 2D3WA 4W5HA 4LPSA 1HAXB 3KL6A 3IDQA 2FPLA 1IXRC 3KTAA 1CEEA 4R2HA 3LY5A 3TGIE 3Q9LA 3Q76A 1C2LA 1L0ZA 2GK7A 3DA9B 1AFQB 5T1VA 1ZIPA 4FMCF 3ITIA 4KBGA 1P60A 3RXLA 2ZNKH 3ADBA 3GDSA 1NVXQ 3UXMA 5L3QB 1GBJA 4FUGA 1O35A 3QTOH 2Z43A 1AFEH 1ZYOA 1OS8A 2J9NA 2QA5A 8GCHG 2GF9A 2VLIA 5FUYA 4YDSA 2GDJA 4IOJA 5AWFC 3SQWA 4ZDJA 1EG7A 1Z6TA 5J4SA 1GDQA 2OLJA 4Q02A 4D80A 1TABE 3ZZ3A 4F4OC 4ZMAH 4LYHA 2CJWB 3UIRA 1RRPA 3U8TH 3NH9A 5J4KA 1T7CA 2EVWX 1GRNA 2PHBA 1MOZA 3IUYA 2W3KA 4KKDA 2G77B 3CWQA 2VIPA 4FWTA 4HAVA 1G6HA 1XTKA 1TALA 2AFHE 3QIAA 2DFTA 3MNXA 5F9FA 1H8HA 4GZMA 4HLCA 1TL7C 2HRVA 1KKMA 5DGJA 2ZRCA 1C5YB 2Z4SA 2HPPH 2DR3A 5CIWA 4D4MA 1E2PA 4M2LA 1CXZA 3RS0A 1V3XA 4UONA 2WIBA 1Z6YA 4AOQA 3ND8A 1SBWA 1XXDA 4OHZA 1O3IA 4E07A 3RXFA 3LX8A 3EA9A 3PM3A 4IW3B 3A8AA 1NFYA 1PZNA 1E9EA 3B6EA 4GRAA 3QUMP 2F3TA 3UUZA 3QEOA 3I77A 6LPRA 2BEJA 2BKEA 3QSYA 4CRAA 1Q57A 4YO9A 2NU3E 2AMQA 1Z28A 1U94A 3K0AA 1U0HC 1KJWA 3GLGA 4U2WA 1FFHA 2DCUA 1FDPA 3MJHA 1W0JA 2VIIA 3ZQJA 1GNPA 1DM4B 4EJSA 2BOKA 1AUJA 1AN1E 4NE2A 1XUKA 1AS3A 1HBTH 1S1CA 4JT4A 1ZM2A 2BDTA 2OK5A 1KMHB 2VSXA 1A5IA 1BYUA 3R0FA 2GETA 1YZKA 4EFMA 3RAPR 1TFXA 3Q3YA 4RKOB 1II9A 2ZRLA 4Z6AH 5C4GB 1MAXA 4TSFA 1A5TA 1QBVH 3BB1A 1JPJA 1ELDE 1JJ7A 1TGCA 2QUZA 4YQFA 2ZG0H 3TNSA 4U5XA 1K1OA 2FI3E 2YZ2A 4UFFH 4QG7A 4KO8A 2PX3A 5KDDA 5LGOA 1ZAKA 1C2GA 1ZRBA 1GHAG 5SZJA 3RMNH 3UR6A 3SJZA 3SR0A 5AJZA 5IDKA 2HCJB 2VB0A 4XE4A 4LBWA 3D23A 3MHWU 4BLQA 4LJ4A 2A5JA 1U9IC 3K0AB 1BJUA 3RWMB 3A7VA 4ZDIA 1BBRK 4LHZA 3IEVA 1GBMA 3SZRA 4AKGA 3X1WA 5KNCA 3AB3A 2NU4E 4CBNA 2VP2A 3EIHA 1N5IA 1OKKD 5E0HA 1FI8A 1SSXA 2BD5A 3EA8A 2PEYA 1KO5A 1VG8A 2K5UA 1P2NA 1TX6A 4URVR 2A2QH 1XXHA 1S5SA 4Z8XA 1DADA 1XUGA 2P95A 1HAPH 1G3MA 3M7QA 4MPWA 4ZUHA 1JPNA 2YWFA 2BD2A 4PQFA 2GZ9A 2GESA 3TUJC 4X8HA 3NXSA 3TU7H 1OYQA 1G8PA 4SGAE 2W00A 2ZCKP 1UHBB 1K5DA 2OQ5A 1VHLA 4L9SA 5KHOC 1GCTB 6CHAC 4QHSA 1IN8A 2CNWA 1VTKA 2VTKA 2IWHA 5JCZA 4JL6A 1XVOA 1DOAA 1TMKA 1VITG 3TKLA 4KTUA 4FN5A 4B6EA 1YPLH 5DP6A 1O2QA 1DY8A 3H84A 5J40A 2JETB 3LD9A 1CT4E 1C1TA 1P8VC 1A1RA 4P4SA 3HR8A 3EPKA 2HLCA 3SORA 4EIWA 4TLEA 1V2TT 1P2VA 1FNMA 1WUNH 4MGZR 1AFQC 3ESTA 1J14A 1XUJA 1IQEA 3MGCA 4LYJA 1S9DA 1DFPA 2JJ2A 4N0DA 2ZRKA 2IHBA 2WVJA 4LJYA 2F55A 4X1SU 2ZYVX 1V2VT 1QHHA 2G9NA 1MTNC 4QNRA 1UADA 2XZOA 4PC2A 3GCTF 4DT1A 1SC8U 1Z0AA 1A5HA 8OHMA 1LPKB 4Z0KA 1GI0A 2BLOA 1XRJA 5C20A 2GHIA 3BFKA 4XVQA 1MO4A 2YHSA 3A8TA 2HLDD 4H9GA 3A4MA 3QTVH 4OI1A 3RRNA 4HDOB 1OWJA 3A4LA 3GCOA 1SXJE 3QQ5A 1I4DD 1H4WA 4NGAH 4WBSA 4R98A 2WKQA 2RCNA 4PROA 1Q1EA 3HPTB 4B3GA 3U3OA 1JI0A 1IQMA 4CEJA 3RM0H 2F83A 3F9EA 3AP2A 1SVLA 2ZGHA 3K9GA 4OHYA 4KTCA 4E09A 2CK3A 1E3MA 1X1SA 3GLIB 3T5FH 1GVKB 2CEAA 2J0SA 1TX8A 3X1YA 4ASUA 5GXPA 4Y11E 4LHVA 2ZROA 1E2MA 2VJ1A 4GUXA 4FU9A 1NIPA 2G51A 3AVOA 2QP4A 2C04A 1E2FA 2D74A 1SHHB 1M7GA 1PJRA 1N6KA 2ZRAA 1LQDB 1KOFA 1ZRHA 1JRSA 1BMFA 3DZDA 1P72A 5KUTA 1NRSH 1Q12A 2QBYB 2G55A 3IO3A 2OP9A 1SGDE 4DBLC 2J34A 2R2MB 2XWBI 4JJZA 1HAIH 4JZ1A 4YMUA 2XJ4A 2BMGB 1XKAC 4BZXA 3ZIAD 1AZZA 3SEAA 3E16B 1D5CA 5EW1H 2PJZA 3CH5A 3EWSA 1ANEA 4GSYA 3CF2A 4HLQB 4PPNA 4EKDA 3ZVGA 2ZECA 4YOIA 4CF7A 2FODA 5FPHA 1BUIA 1M2OB 3PCRB 3MLEA 3FVQA 1GJ7B 1C4OA 2ZTYA 1LVOA 1GILA 1KAOA 5EZ5A 1P9SA 4G3XA 3Q5EA 3ZVDA 1KSFX 3SJCA 4EPXA 1UTMA 4KFRA 1F0TA 1OWEA 3U8RH 4EJSC 1Z63A 4K3JA 4AFQA 1O5BB 2ZPTX 3EARA 1O3AA 1TIOA 4QBHA 3VNVA 1J16A 3IG6B 2ZU0C 4XWKA 2AK2A 3MG9A 5DP3A 1EATA 5AUPB 4ISHH 2GK6A 1GHAF 4NCHA 4C0QC 1AM4D 4HI3A 4V0OA 3CF6R 3NDPA 5BN5A 1U6QA 3QXXA 3BE4A 1HAYB 1THPB 2WPDA 3EA5A 1HIAA 1TGSZ 5E2OA 3RXTA 2IUSA 4MKFA 3TK9A 1DE7H 4ZIRB 1CR4A 2O52A 4OQNA 1C1MA 2AWNA 2R9PA 4RCZA 4X2YA 1P2TA 5H8WA 1II0A 1XWIA 4GT1A 3U9AH 1TEXA 1QGFA 4AYXA 1VG9B 3MU4A 4Q48A 3RU4D 5BYJA 3EZ2A 4HUQB 2WICA 2FWRA 9ESTA 4DT7B 3WHKA 3VKGA 1F5RA 2B5TB 1LQEA 1HE1C 2DB3A 1GCTC 1G3EA 2W7SA 3AVYA 3LGTA 1MKWK 2UWPA 1KLJH 1JIRA 3KQHA 1NBME 2NIPA 3UMSA 3AF4A 1GMCG 3KQEA 5CMXH 2AMDA 2JETC 4P4UA 2REBA 1MTWA 3GEEA 5FBLB 2FH5B 4FW9A 3EIQA 1GG6B 2F9UA 2G00A 1JOUB 1IHTH 3TAUA 4OKSA 1K2I1 4NIXA 3O8RA 3SU8A 3K70D 2CXVA 3HATH 1NL3A 4POAA 3RXPA 4B2CA 1G8YA 1NFUA 1JQJC 1RYHA 5DK1A 3V7TA 1KO1A 3BERA 4QNMA 2BLQA 2GCOA 3AVXA 3ATMA 4PZZA 3RWOA 4GLYA 1XJCA 1KO8A 2OE2A 5EE5B 4XBBA 1E2JA 1W3CA 2RKOA 3T35A 1V2PT 1GBAA 1S2MA 2JJ1D 3CM0A 3B1ZA 3QG5A 1AO5A 1C2MA 2P3TB 4KU4A 3NBFA 3BTGE 2OC0A 5HMAA 1TUIA 3VR2A 4QGFA 5JSZA 1W2GA 4CIDA 1J9CH 2WJGA 3QBTA 4F4IA 1MO5A 2VINA 2WHXA 1EFHA 1II8A 1QG4A 3DT0H 3K1JA 4JL8A 4OQMA 4OQFA 4UNPA 4XVUA 5CIQA 2A4OA 4G5GA 4URWR 4BXSA 4MRRA 4MKIA 1XXFA 2VPPA 3AKCA 3VXFH 2ODWA 1PQAA 1D3DB 3RC8A 1F5NA 1H65A 1SPJA 4LYAA 3LPRA 1XCMA 2HJVA 1ZGIA 4DCVA 1O3DA 1Y3UA 1CR1A 3STJA 2ZSAA 3K8YA 7GCHG 3K9HA 1U8AA 2A3RA 2GJ9A 5B2ZA 4Y7BA 3IEUA 1OH6A 4F4JA 1IHUA 3RXMA 1GZSA 3SU4A 5TARA 2ZTXA 3B2EA 4CT4B 4UFDH 1D9ZA 1E1RD 1G291 2X2FA 1KKLA 4URUR 2FPZA 4IW4E 5EG4A 1QR3E 2RHMA 5FR1A 4P31A 5EODA 2QG6A 1O2UA 2WJHA 5IK2D 1C4V2 3F6UH 1SB1H 1V2JT 4M9ZA 5F8ZA 4TT3A 5HE8A 3QZQA 1ZMJA 4YXWA 1E37B 4NDZA 2CCKA 3FMIA 2N42A 4C0SA 3QKUA 4D0GA 4UE7H 2WJYA 1HJAC 4RZ2A 2B92A 1OHHD 3HPRA 2EFHB 2BIFA 4G5OA 1SXJA 3V00A 1PPZA 2F43B 3VXEH 1C2HA 2JLVA 3QGJA 2AGIX 2ZE7A 2BBOA 3BXZA 2CHAB 1WXRA 3TJVA 4I1VA 3UATA 3PWCA 4YT7H 4ESHA 3MRSA 2ZRNA 2IF0A 2QGNA 3AQ4A 2ASEA 3IBYA 2FP7B 2R6CA 1DXPA 3SN8A 1XPOA 3TQCA 3RDPA 3U6BA 3FHTA 4RFVA 4UD9H 2BXUH 5TV2A 1EPTB 3EQ0H 4TYDA 1DT2A 3FB4A 1TMTH 4GVUA 3BB3A 4OK5A 4WJG2 2QY0B 1OYYA 4KI0A 2QM8A 4ZKRU 3KQLA 3GLFE 1CP2A 3FDIA 1O3HA 1NVUQ 1FQJA 1ZD8A 1CGJE 4NU0A 1BTYA 2GCHG 2QV1A 3ZZ0A 3CP7A 5G40A 4YDHB 1PYTC 5SZIA 5G3YA 1O2SA 1QHIA 2QT0A 4DCSA 5AUNB 2HT6A 4TWZA 1IXSB 2ZU5A 2J87A 2ZUBA 1SMFE 1HAOH 5JS8A 421PA 5A0FA 1TB6H 1SXJB 3S7HB 1AQYA 4JLDA 2YWGA 1EZQA 5TCAA 2XGJA 1Q1ZA 5FPYA 5EGMA 1SVPA 1OX1A 2WAXA 1V2RT 4TMVA 3QUSA 1G5TA 1D8TA 2FSIA 2B8OH 2ZSBA 2ONKA 3R9WA 1RJ9B 1N6NA 221PA 1NRRH 2NTYC 1UBEA 3SNEA 2QQ0A 1SFQB 1GG6C 1G18A 2A7QA 1P2IA 5DH9A 1EJAA 4INKA 5A0AE 5HCNA 1P0SH 1UTQA 4DURA 1C2KA 7ESTE 1THSH 1F2TB 3IQXA 2BD3A 2RDLA 4LK4A 1O2PA 2WPMS 1E9SA 2CHQA 2GRJA 3RRZA 4AY2A 1LHCH 1MU8B 2KB0A 1RVDA 3EA0A 3B9PA 2P6RA 1R0WA 2O8UA 2VH5R 2QA9E 2ZRFA 3C4JA 3QXCA 4XVRA 4AIIA 2DE9A 1P73A 4DSUA 2IC5A 4AB9A 2YOGA 1KLIH 2J45A 3L43A 4B33A 2SGDE 1NN0A 2IJD1 1GHYH 2ZJ5A 2OSBA 1EWRA 4Q01A 3GYLB 1GHWH 1ESMA 3Q8XB 1E35B 5F3WB 4UNNA 1XNJA 3L0OA 1CF4A 2UWLA 4HTCH 4PZYA 2TGTA 1W0JD 1ZU5A 4H4FA 4PQYA 2ZJAA 3AUXA 2F9PA 2XNDA 2BX4A 1KI1A 1MO6A 1QA7A 2ZFFH 4BFTA 1MTVA 1NN1A 4JZFH 1LFDB 3RS3A 4TTQA 1H8ED 4B3FX 4ZKDA 4KELA 2BDAA 1CU1A 5DE3A 1LHFH 1A2BA 5EUQB 1Z0DA 1NBMA 3ODDA 1AWFH 4ACBA 2IT1A 1S83A 2YWHA 4ASHA 3CR8A 3ATKA 3QEJA 4M9SA 2OUKA 4CRBA 4I1UA 4TL6A 1S8FA 1JNYA 3GY2A 1L4UA 1IN6A 3THWB 2QU8A 5DI3B 1K1MA 5J47A 2QMHA 3PUYA 1ORFA 4DJZB 1A4RA 4JK5A 4OS6A 4FIDA 1CBWB 2AKAB 1LTQA 4ZDKA 4B32A 4Q1EA 1OOKB 1E94E 1ELCA 2J95A 1BRAA 2REOA 4KP0A 2RGXA 2TGAA 2ECKA 4C2TA 3NBXX 2ZHFH 5C18A 2PKAB 1KK3A 3NXPA 1S4QA 3CRMA 3LW8A 2QC2A 3RVBA 1J17T 1NRQH 4URXR 4M1YA 4AFSA 3O8BA 3QPVA 1P9WA 2XW9A 2PZEA 4X0WU 2WINI 2ANBA 2D4HA 3T5DA 2HF9A 1P2JA 1LF0A 3E6PH 3HKIB 2GVDC 3MWJA 1XEWY 2GNOA 2NU2E 4O0MA 4YZUA 1YZGA 1QB6A 3A1UA 2PH1A 2FFQA 1E1QA 4LV5B 1ETTH 3PMJA 3QF4B 1ZM9A 4EFLA 1O2YA 2JJ8A 3SJ8A 4QBFA 3NBZC 4JZDH 1AGRA 2FFAA 1E32A 1FN6A 2Y7ZA 2P65A 1UTJA 5CB8A 1DWDH 2GBLA 4A8JA 5FPTA 3BFVA 5KYKA 2GV7A 1OXGA 1Z6AA 2DHRA 2W5EA 5JBBS 2A5YB 5GNDA 4PAMA 3T5GA 1P2OA 2CNWD 1EPTC 3CS7A 1Q44A 1IY1A 2D8WA 2QEQA 4ISIH 4DZZA 3TH3H 1DAHA 1W47A 2G5NA 3KCGH 2ZDKA 2IPHA 5IYTA 4ZPXA 4OI2A 1LPZB 1W0YH 3W34A 3NH6A 4LX0A 2RA3A 3K65B 5FOTA 1CA8B 3OEHA 1XP8A 5L8VA 2VIVA 1KIGH 1N1LA 1WRBA 3L33A 2AL7A 3AF1A 3VR1A 1ANDA 3ASYA 3DMDA 1KDRA 1S0UA 1KY2A 1Z0FA 2XITA 3ELAH 1XTRA 3SHWA 3SV8A 1A4WH 1TQ7B 3ZVLA 2J5XA 1SXJC 2RGCA 3KQKA 3I32A 2OBMA 1TMBH 2ZRPA 1LVGA 1BBRH 3M5NA 3F8TA 2ANYA 3MFYA 3GD7A 2ZFSA 2ZSEA 3I62A 3MU5A 3I8XA 1KXEA 3E8LA 4KCGA 5C5OA 3G5UA 5JHGB 1ZSJA 5B6LA 5JBTA 1K8RA 1GVNB 3SGBE 4GFDA 1DWCH 2GKVE 2AX4A 4PAOA 4WVPE 5BWMA 3ZZ8A 5FBQB 1NLFA 1ZM4A 4MRSA 4NCKA 3MH5A 3A87A 4KFUA 1MTUA 3FYHA 3LFUA 3KFXA 2FX6A 1Y8TA 4X2VA 3BAFA 4A6XA 4AURA 3JZAA 1IQNA 1MH0A 1MTSA 4BTUB 3R7WA 2FG5A 4XOJA 1NY22 1E9BA 4NA8A 1X8KA 1T9HA 3QN7A 3SDZA 4WVFA 3SNCA 2ANCA 2MSEB 2ZFRH 2CK3D 5FL3A 1TX4B 4N0EA 3QKRB 1SGIB 3BN9A 3X1DA 5FHTA 3P6ZB 1KNXA 1G2MA 3GLFA 3A1VA 5HKKA 2QF3A 2FOEA 3WY9A 1ESNA 1TQ4A 1U8YA 4FD2A 5A5GA 521PA 5B57C 1TGTA 1GMDF 3DVLA 1BMFD 1Q3TA 1O5AB 5L3VA 2ALPA 5H68A 1JXMA 5AUQA 3RM2H 3KQDA 3TW4A 1AZTA 3PTBA 2ZREA 4G0NA 2FS8A 2ZEBA 4NG9H 1VPLA 4IMQA 3MU8A 1XMIA 1O2WA 2A4QA 4E06H 2GAOA 4US1R 2F3CE 1BTHH 2B8TA 3ZZUA 2FGJA 2XC4A 5L2YH 4ZCIA 4NCIA 1OWKA 4TLBA 3AKDA 3EG5A 2QQEA 1LHGH 2EFEB 4PC6A 1P2KA 4A15A 2IXFA 3X1ZA 4V0LA 5GDSH 3ZV8A 1YE8A 3MH6A 4Q03A 2GT8A 1GM5A 2ZPRA 1XPUA 4JT2A 4ABYA 3U4QA 1D3TB 4RCYA 2A0QB 2OT3B 3U44B 1IAUA 4OHXA 2ZGCA 4PC1A 1BO6A 1FY8E 1ZD9A 3C1KA 4YMVA 4UXJA 5EXXA 2ILNA 4QXAA 1Z2AA 3EPLA 1P11E 2YOHA 1SULA 2SGQE 5A4JA 1C1SA 3TJNA 3K53A 4JSYA 3UQVA 2WJJA 3TRFA 2BLVA 1O2ZA 2RAPA 2XBWA 5G4BA 2PLXA 2IW3A 3BTFE 1XM1A 2FEOA 5FPKA 5GWZA 2ZHEH 1J8YF 2F9VA 4BLPA 5J4QA 1WP9A 1ZTJA 2E87A 1ELAA 4TMWA 3DUXH 4ABIA 3UOPA 1V2QT 1K21H 1HYQA 5JWRA 2J59A 1E9CA 1O5FH 5SGAE 3SBEA 1GRRA 1F2UA 2VA8A 1F60A 5FCRA 4QHTA 1JWTA 3U1JB 5CM8B 2PSXA 1AMHA 1INCA 3T1QA 2ESTE 3FE2A 2QF0A 2PZFA 3LDAA 2B7CA 2M5TA 3WP0A 1ZR0A 4RSGA 3EZFA 4FMBB 2B8WA 1PLLA 4AB8A 4NP6A 5E2PA 4L9WA 2R0KA 4AKIA 4M0LA 4LXBH 5F6MA 1G3CA 1FY3A 5KO2A 7LPRA 4OS1A 5EW2H 2CMYA 2FOGA 4NSYA 1P03A 2J41A 1PFXC 4M22A 3S1AA 3SBKA 4ZDWA 3WRYC 3U7HB 3Q72A 2GWHA 2A9KA 5E7MA 4BAOB 4JLKA 1NSTA 2ONJA 1DS2E 4BE7B 1TONA 2P6UA 1UVSH 1TOCB 3SJOA 2J0UA 3BB4A 1PLKA 1GBEA 1GI7B 4B35A 1G3DA 3VB4A 1CLUA 3TITA 4Q66C 4CRWB 2H18A 2XXAA 1CJMA 5F9HA 3NCLA 3U3JA 2XBVA 4FVDA 2AK3A 2CL6X 1HCGA 2ZGXH 3EASA 1WTGH 1UAAA 1MU6B 2GBLC 2GTBA 1U90A 1K1IA 1OE0A 3BV9B 1KDOA 2XTZA 3GDUA 1DAMA 2A5IA 2F9OA 3HKJB 2SNVA 4X8VH 2AGGX 4BFXA 4O03A 3SYLA 4AX9H 4HB4A 1UVOA 1K9OE 1NVWQ 3OIYA 4AGKA 4TL7A 3VR6A 5PTPA 4Q4JA 3OIVA 1LHDH 1G7RA 4UXHA 1GJAB 1T3LA 1VIYA 3MO9A 5CB6A 3S9BA 1DVRA 4QOSA 4NSVA 1EQ9A 1KHTA 4KLNA 3PMBB 3LXRA 1TPPA 3KQBA 1C4Y2 3EC1A 5C1XA 4V03A 3K0FB 2WKRA 5GIBA 1KNQA 3CR7A 1TNIA 4Y8XA 3Q3KA 2KI5A 4OHVA 1DDJA 4RZXA 4ITRC 4AKHA 4HLDA
chains in the Genus database with same CATH superfamily
5L9AA 2KM0A 3EEYA 1IPHA 2L82A 3AK5A 5C8YB 3H9JA 3RREA 4U4AA 3GFRA 1R4NB 1A0LA 1OFHA 5K4GA 4OAOA 4MWGA 4M0MA 2VVCA 2WWRA 3UPEA 1O95D 1SC3A 1TAGA 4GBGA 2ZU3A 1IJEA 5DI9A 3B5JA 5JYEA 4MTCA 3ZE0B 4OA5A 2H0QA 3P0EA 3ZWDA 2O8FA 4I81A 3OWXA 2OHXA 4ZCQA 4Z3KA 5D85A 2HK9A 3ZNPA 1GGMA 3G49A 2BFPA 2QTTA 4MGKR 1B00A 3RJ9A 5JNRA 4YRDA 1NRJB 1G41A 1I1NA 5COAA 4FNOA 2OZVA 2QYTA 4EF6A 1CJSA 1GUAA 5IMBA 3BDVA 3N0TA 2W2QA 1M2KA 3KQYA 2BUAA 4F2GA 5AUOB 1HEYA 4YGXB 3TZEA 3K15A 4CLXA 2QK4A 2ZXEA 4AMBA 2FUKA 1N57A 3G88A 4K9OA 1Z6XA 1P44A 5CITA 2R79A 4EZBA 4HVLA 1RJFA 1SGNE 2XA1A 1NXVA 1F0KA 4KPEC 4KZPA 1IQLA 1T36B 1Z7KA 1D6SA 1GDDA 2YMSB 1JMVA 2F1KA 3HTXA 9LPRA 4M9QA 2C4VA 3SV9A 5H59A 1DXOA 3AP3A 3VDNB 3C98A 3A1NA 5EQDA 3H7TA 1SA0A 2C5LA 3MELA 3V5NA 2QRVB 5IWCA 3L7BA 1M67A 2VNIA 2YV3A 5DNEA 4D82A 5TJ9A 4JLBA 4UC0A 2CYAA 3IDZA 3FCYA 3I9LA 4IOMA 1N7HA 2PUVA 3TSWA 5DVZA 2AZXA 2J3MA 1LI4A 1BN7A 3GEDA 5AK6A 2VO1A 3TFOA 5ARCA 2J5QA 3DLHA 3CZRA 1E7MA 3HI4A 1QPBA 1NURA 5EERA 4ZI7F 1X1AA 4BO7A 5A6SA 4Q18A 4EI7A 5JISA 2J3LA 4CDGA 3ETGA 2ZZKA 3OJFA 4HNGA 1YZQA 5AIBA 2UUJB 1RI3A 1FLVA 4RT0A 5AI8A 1IEXA 3UWOA 3GJ8A 2E4YA 4ZGBA 3IVMA 4EA7A 1YASA 3U7GA 2G6BA 3MTIA 1GG8A 5G41A 4UQPA 1IXYA 4AKTA 5BRRE 1WPGA 4G0PA 4I1YA 2C96A 1SJ9A 4FUFA 1Y3DE 1GJ8B 4GRIA 2FZCA 4NCXA 2O6HA 5FD8A 1KVUA 1P7CA 5FOVA 2I55A 3RFXA 5L6LB 3DFJA 1NMYA 3RS7A 2Q4TA 1TA2A 3N05A 3JQ6A 4CM9A 1IQFA 3KYDA 3MI4A 2CHUA 3C8HA 1M1YE 1LLCA 9ATCA 2BTEA 2FSVA 6ADHA 1SZPA 4Q1FA 1KGDA 2UWOA 4A0RA 4O8ZA 2O8WA 3QKIA 1A8QA 5EKTA 3LY8A 5SYNA 2A84A 5FT9A 1I4OA 4F45A 4I7YH 4WNYA 5JAPA 2NN3C 2OESA 3FRJA 5C17A 4GYWA 3HJCA 3M7TA 3BMQA 4C7MA 4DE5A 1TZBA 4LZ4B 2GPAA 1J24A 2P2GA 1OP2A 1DWOA 1NVFA 3M3TA 5EMJA 2PU5A 3HUEA 3L7MA 1JDBC 1XZBA 4B9EA 3GYMA 4Z7NB 3RBVA 3PUKA 1YLNA 4HFPB 4NU8X 4W6QA 5AW4A 3MUEA 4YPOA 3GQBB 3P27A 3W5VA 3L2OB 1X9HA 4BCCA 4GR4A 3A10A 4GVPA 2MMCA 2X58A 4RVHA 1J9GA 4EYQA 1D3PB 1VYTA 4LI0A 1UPTA 2PGAA 4E15A 2H63A 3DAYA 5C5CA 1G3BA 2PSYA 4F11A 4PXAA 1NG9A 2KLBA 4GH5A 1AQUA 3PE6A 2ZUWA 1FNNA 3ETLA 3WYGA 4ND4A 1L5FA 4C89A 5KX5A 1IXZA 5CHBA 1LWOA 3H99A 1BRCE 2WA1A 1GJ6A 1RI5A 2AUNA 1RT9A 4EBBA 1MIHA 1EUCA 3VUFA 2XE7A 4R05A 2A4GA 1Q7CA 5F33A 1EM8B 1GTL1 1IATA