4B71A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
total genus 197
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b71A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b71A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b71A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b71A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b71A03
3BV9B 4FUFA 1LHFH 5C1YA 1HYLA 1NPMA 1QJ7B 3C15C 1LVOA 2ZGBH 4D7FA 1ZYOA 1RTFB 1LHCH 1GMCG 5E8EH 3TGPA 1TGTA 3TU7H 1RIWC 3U3MA 4FUCA 3LJJA 3D62A 1IY1A 2GNOA 1Z0IA 1HAYB 5J4SA 3KEEA 1C2IA 5GNDA 2H9TH 5HKKD 5DP4A 5GJVC 3LKWA 5TDHA 2OXSA 1TE0A 2XCNA 3SDZA 5C3NA 3SQWA 3L82B 1O3JA 1LFDB 4YOIA 3FKQA 1ZNZA 3FE2A 1GI3A 3TNSA 1SVOA 1Y5BT 3A86A 5FTMA 3AK5A 3T1QA 1YRAA 4AFQA 3BTEE 2ZUDA 2UWOA 5KNDA 2ODBA 1KSNA 1JEEA 3QPWA 1QA7A 4A5TS 2QF3A 2KAIA 4ABGA 4WJG2 3DM9B 1KAOA 4NCKA 3MUFA 2TBSA 4URVR 2IL1A 4Q1DA 4NYMR 3HP1A 2QN6A 4TLEA 1E0JA 5GPIB 4GCHF 4IDQA 3VR1A 2W7SA 1Z28A 4V0LA 2PT7A 3ZD7A 5JB9S 1ZMXA 1MUEB 3IPXA 1XBTA 2P93A 5FCRA 3MRSA 2EI7A 2HNTC 2A5GA 2OCAA 1W36B 1EZSC 4IHQA 2FM2A 2GCHG 1ZJKA 3I92A 1OFUX 1N5KA 5EZ6B 5M04A 3RNLA 2IPHA 1GBJA 5CK4A 3DEFA 2OLKA 2QRNA 3KNXA 3VKGA 4O3MA 2WUCA 4HLUC 2FO9A 2ZKSA 4AK9A 3CZQA 3SI7A 4HGCA 5FI0B 1K21H 3A87A 3BN9A 3SW2B 1P04A 3THXB 1YP9A 2ZFRH 2VH0A 1P10A 3Q3XA 5EGMA 4M9XA 3JVUA 2SGAA 1FUUA 2QXHA 1YCPH 2Y80A 1RRCA 2ZXUA 1WP9A 5AWFC 2FESH 4H6SB 3VGCB 4M1TA 4XTRA 3DOEA 421PA 1GBAA 1DUAA 4M1MA 4TLAA 2J0UB 2KBFA 3UWIA 3TJOA 4VGCB 2R44A 2DPXA 4GRAA 4RKFA 2FS9A 1TALA 2RA0A 1MQ5A 1AWFH 1FN6A 2FGJA 2ZANA 2WJIA 5K0HA 1TRNA 5EPNA 3PEVA 3TGIE 4BRWA 3ZVNA 2BY7X 4H42U 2Y8EA 3VMFA 3SNDA 2OBLA 1VYVA 3B1ZA 1J7KA 1XX6A 4TYQA 1ESMA 5C5NA 2JETC 2A5KA 1FQ3A 2F9VA 3BG4C 4HLDA 3NWUA 3PVSA 2XRCA 1W2GA 2ZRLA 3H5CB 2GXQA 1S3SA 2YWFA 3H7TA 1EAWA 4ZCLA 1SHKA 1THSH 1LTOA 4E05H 1S2MA 5FOVA 2BX4A 1AJEA 1ETUA 1P3CA 4I32A 2OFOA 2JDIA 4LBVA 3BRWD 1V2ST 2GZAA 1BTYA 5HE9A 1GCDA 2H8KA 5ABWA 1NT1A 4BASA 4EPVA 4P4UA 3U2QA 5DN6D 1IXRC 2GMTB 3STIA 4WF8A 3BGWA 2ZROA 2C93B 4E22A 3TVJB 1EASA 2EA3A 1IQFA 4OS5A 1EFRD 2GT8A 2CHAB 2HUPA 2QI9C 2C8ZB 2X2FA 1P12E 2RA3A 5HTKA 1DAFA 1G4AE 4YMSA 3T1VA 2C78A 4MGKR 1PQ5A 4NCIA 2Q6FA 2YINC 1G3BA 4HUQA 1PJPA 3N2EA 5JECA 3UR9A 1BDAA 1P5ZB 4CIDA 1FY5A 1SSXA 1LKBA 1TMUH 1C5OH 5FFMA 4LV6A 1TF2A 3SYNA 4HLQB 3ICQB 4DEXA 1G16A 1FMLA 4OQMA 2G5NA 2ZRIA 2JASA 4Q7XA 1TBRH 5B6OA 3GOVB 3RRZA 3IG6B 2RMKA 1CRQA 1SXJB 1CS4C 4BXWA 4Q02A 4YOJA 1L1JA 4NL4H 2PZFA 4G1UC 5JCZA 3SJ9A 3H1TA 5EXSA 3DHKH 2NU2E 4AYTA 3DZDA 1C2EA 1JXOA 3KXKA 1D3TB 1N6NA 4ESHA 3A7XA 1C5SA 5EP4A 4HLCA 1S1CA 2A7CA 1V2KT 3IKJA 4XD7D 4U01A 4DB2A 3U3RA 1G5RA 4V0OA 5KOYA 2FI3E 2H1LA 3NWJA 1J16A 4CRDA 3B1YA 1JPJA 2WYJA 2PJRA 1OKXA 1VCPA 1TX8A 5FTKA 1AFQC 4NCHA 2QY0B 1Z8GA 1ZU5A 3MSXA 2TPIZ 8ESTE 4BTIB 1YCPM 4AYXA 3LVQE 3I1FA 1YPMH 2QXIA 3PUWA 5JSZB 1KSFX 1Z0JA 3B2EA 2XOKD 4JL5A 2ZRJA 4ASHA 1HAIH 1GILA 2ZSDA 1ARBA 2QP3A 4E5UA 3RWOA 4RY2A 1SKYE 3DZ8A 1P2SA 4ZXXH 2FOFA 1MRNA 4WIAA 3KKOA 1TQDA 3M3SA 1TQ7B 1CEEA 1ZJ6A 2ZGXH 2GK6A 2P3SA 1R8SA 2J5XA 1O34A 5BW8A 4J1YA 4K1SA 1U9IC 5JHGB 1FIWA 3MU4A 4U2WA 2C3SA 1K1OA 4QHTA 2VVUA 4ACAA 5A8ZA 1AVWA 1OB5A 2FLRH 1NY22 2W0MA 2F55A 3UFAA 3GCGA 2J92A 3UY9A 2IS1A 1AFQB 4I1UA 4DDVA 3MWJA 1UEIA 3ESTA 2AH4X 3PB1E 3DFLA 2PSXA 1GI6A 2NO9A 2VH6A 3VXEH 1QL8A 2ZYUX 4I8GA 4PHGA 5GVRA 1C1NA 3KJIA 2HWLB 4FI3C 2ZQ5A 2A5YB 4JVNA 1UTKA 4X2VA 1LCYA 3SZEA 1KO1A 2W26A 5CHAC 3FZZA 2Q21A 3K53A 3Q72A 3A1SA 2Q9BA 1Z6JH 2RGAA 4M2LA 1P2KA 4NYMQ 3ATMA 2MMCA 1MTNC 1T8OA 4BLSA 2BMGB 1ZM9A 1TADA 2FSIA 3FWYA 3W5IA 3PWCA 1VCOA 3WRXC 3OY5U 4LSGA 3LQQA 1KLTA 3OF5A 1M6NA 3IILA 1P09A 3BORA 1U81A 2OP9A 1BMFA 4DT7B 1EPTB 3TLXA 1MH0A 4JMPA 2WWGA 2ZU0C 3Q5EA 4PC3A 1KSGA 5FHTA 3ND9A 2CVFA 2RCNA 3BTGE 1MQ6A 2IS6A 1AS0A 3HU2A 1KI9A 2IUTA 4HUQB 4MKHA 2XXAB 1HAGE 1P2OA 2HPPH 4QT8C 1SXJD 3RHFA 1MAYA 3BJIC 3TIUA 2WPKS 2BVNA 1P9WA 4BLTA 1ZTLA 1RFLA 1O2ZA 4I1SA 3DPUA 4C0SA 3W95A 4R98A 4X8OA 1NIPA 3AV0B 4IDNA 2AHOA 4OYHA 1WAYB 3RC6A 5SZJA 5JEEA 3M36A 4JMYA 3TW4A 5FOXA 2JLSA 1JR3D 3SNBA 3QJYA 1G9XA 1DY9A 2GJ9A 4KELA 4HB2A 1A4RA 3RU4T 3KN2A 1TRYA 1AIXH 5FL3A 2H7VA 2TMKA 3B85A 1T4GA 2G0TA 3QPUA 3JZ1B 1MZAA 3KQUA 1Q0UA 2XAUA 3U7EB 5PTPA 1IQIA 2J2UA 1E9CA 3A1TA 4JVMA 1ZINA 2H9HA 3S0NA 3OEHD 6CHAB 1MTWA 2ZR0A 2N42A 3SS8A 3AVPA 2J45A 4KU4A 2F3TA 1MD8A 4AURA 1DBSA 2JEOA 3KB1A 1IN5A 3TUZC 1TIOA 3RMNH 2JETB 3ENSB 2ZJAA 2SGDE 1BB0B 3AUYA 1F0SA 1EFUA 2Y7XA 3P8GA 2OBNA 4TMXA 5K8TA 1CE5A 5J4YA 1GHBF 3DVLA 1NSFA 3W6NA 4EPTA 1O2JA 4HAYA 1CR1A 1GMHF 4MPVA 3UOUA 1E1RD 4NHOA 4U5XA 4IC5A 1BRAA 1O5EH 2ZHEH 1PLKA 2G81E 4P4SB 1XZPA 1MKXK 2CJWB 4B3DA 1KDQA 3CO5A 1D6WA 1T8LA 2ZQ1A 1KI6A 2QMHA 4BFXA 3AVQA 4ZDWA 3EGKH 1S0RA 1GDNA 5SZHB 4AG5A 1R10A 1L4ZA 2XZPA 2SNWA 1GHYH 4KHZA 5C46F 3AVWA 4Y8YA 1VGCC 5EQQA 1T8MA 4II7A 2FH5B 3B9PA 2BEKA 3M5LA 1EFTA 3RWMB 1Q3TA 3M5NA 1XPOA 4LJ9A 3BOSA 1G6HA 4X1SU 2ZRPA 4TYWA 3RXKA 2ZWLH 1C4U2 3I29A 5SZKB 3EA8A 4A0RA 3ZZ4A 4IW4E 3QBTA 4X2YA 4XWOA 3GCTF 4DIDA 4RD1A 4DOQA 4NU0A 2WIBA 2C98A 4NYIQ 1SZPA 2YV5A 2EFCB 1JALA 1E9EA 1NMYA 4ZUHA 1OIVA 4WVFA 1AU8A 1XEXA 4NCJA 1A0JA 4IVQA 4C30A 1DWDH 1LPKB 1RZ3A 2NPIA 3LW7A 1AE5A 4PQFA 2J9RA 3GLIB 1XXHB 3ATIA 1ZAKA 3B8JA 2IOTA 1AB9C 1MO6A 2PTCE 2FPZA 1S81A 4H4FA 2QV1A 1P9SA 3D6TB 4FWIB 1D9ZA 2EI6A 3AVVA 1F6BA 2Y6TA 3GD7A 1YPGH 4O3TA 2RGBA 4HDCA 3SV2H 1O3KA 1V2PT 3DMDA 3CPJB 2BWJA 1GNQA 2VSFA 1OPXA 4E07A 1ORFA 1OYQA 3DD2H 2G1KA 2WV4A 4W5WA 2B9LA 1O33A 5DISB 1SVPA 1GITA 4U02A 1C1SA 3FMIA 5L3QB 1SQTA 1BBRH 5CDFA 4TN1A 2C04A 1W2HA 2ZFFH 4A9AA 4DRZA 3T06B 2H9EH 1M7GA 9ESTA 1YCPK 1EB2A 3PTBA 1TWXB 3RXIA 1S6FA 1TPAE 2H2ZA 4LV5B 1FY3A 3O8CA 3TIFA 4F93B 2J41A 2IUSA 1Z5ZA 2G1JA 3LGUA 5AUOB 1H9HE 4I81A 5L6NH 2O8DA 5AJXA 3GJ8A 2O8CA 1GAJA 3BD9A 1J70A 1SOZA 2BB4A 4FXGH 1ESAA 1A3BH 1XUGA 3VAAA 1V2QT 4KGAA 4K3JA 1HGTH 1ZMLA 2IBMA 5I46H 1NP6A 3AAVA 2YWGA 1VCWA 2A9KA 3FYHA 1GBTA 1JPNA 1FAXA 1O2GH 4ZI3A 1GMDG 3C5CA 4OQNA 4PC1A 2DE8A 3GLIE 1S96A 1P4SA 2CK3D 1OFHA 4LV8B 4EPXA 5J4HA 3PYHA 1SGCA 2MMGA 2UZ3A 4P4TA 3SHWA 3EC2A 1W7GH 4CRFA 2FN4A 4GMDA 1PPFE 1TMTH 1DOAA 3P95A 1KO7A 1CBWB 4HATA 3CR7A 1GHWH 2QTFA 4Y0ZE 4Y0YE 1C4OA 4AIIA 5F9HA 1UKYA 4OI4A 1YHNA 2AR7A 1JXPA 4PSVA 1G30B 1OWDA 1CVWH 4AB9A 3LW8A 3RM0H 3UWOA 2IWRA 4Q21A 3UKDA 5FBIA 4MDSA 2ZNKH 2A7HA 2CNWD 3T15A 1WQSA 4QC2A 1U90A 4JVSB 1IN4A 1K1IA 1TBZH 5DK1A 4JK5A 1M7HA 4JL8A 2HRVA 2ZIQH 4FUEA 5DP3A 1YKSA 2JIZA 1IN8A 1OV4A 4L9SA 2BLOA 2V3OH 1XF9A 3SOSA 1XJCA 1A2CH 4Q1FA 5KSZA 4JZFH 3PEYA 2SFAA 3D3QA 3A82A 1O2RA 3DFJA 4AD8A 2CHAC 3RLWH 3AF2A 4ABHA 2PFEA 2G6BA 2GV7A 3QVVA 1GP2A 4OI2A 4P3YA 4R2IA 3H84A 3ZZTA 1NNEA 3EAQA 3R8CA 3EWSA 1ZRBA 5HKKA 1O87A 2ODPA 2IYWA 3H09A 1LKAA 2ZJ5A 3BE4A 4RD0A 1KI2A 1ODFA 1KTSB 4AORA 1DAKA 2PL3A 3MOCA 3RVBA 2GKVE 1D5CA 4X1NU 2IS2A 5JSZA 2EFDB 5JWRA 2XEXA 3K9GA 3IQWA 4O03A 2R8RA 3QGJA 3A84A 3KQNA 1Z1JA 1TA2A 4L4UA 2SHKA 2TGAA 1X86B 2PX0A 1TABE 1WTGH 3B23B 2NPFA 5GVSA 1Y3UA 2PGBB 1NL3A 4N3NA 1RC8A 4MKIA 4D4KA 2BBWA 2GAAA 2QGRA 3EZ9A 1E2IA 1C2GA 1G19A 3GLHE 3VR6A 5KTYA 1QHXA 1Z63A 1TX4B 3C14C 1SXJE 4PZYA 3SR0A 1AMHA 1UK4A 1DG3A 4H1VA 1ZGIA 4KVAA 3MWKA 2AGEX 1YR6A 1W47A 1OPHB 3ZZBA 3P6ZB 4XOIA 1V2OT 1N6IA 1HV8A 1TU3A 5L3QA 2PKAA 3X1XA 2O8FB 3LBIA 2R3YA 1KXEA 3F5FA 1O3CA 1SGPE 1ZSKA 3CZPA 4CEIA 1DAEA 1B5GH 4D80A 3DA9B 1K8RA 4A1VA 1ELTA 2OC7A 4JJKA 1XKAC 1QB6A 4NIXA 1NVWQ 2K5UA 2ZPTX 4CYMA 4ZMAH 3SHCH 4DUGA 2C8YB 4P33A 3K0AA 2Y82A 2R2MB 1H9LB 5CIWA 2W5EA 2GVZC 4A6LA 4QHYA 3QKTA 1NC6A 4R0IA 2OUAA 5GADl 3M7UA 3ZGXA 2QU8A 3B8HA 2CE2X 3QGNB 4IVPA 2HT6A 1SGFG 2WWFA 4ZKRU 4HDOB 3AP1A 2AFHE 2VU8E 2XTTB 4URWR 4Z8XA 2XNDD 3PTNA 1NLFA 2FXRA 2DFTA 3I8XA 2XSZA 2FMXA 3L0OA 2RDLA 1ELDE 3WP0A 2ZE8A 4V0MA 3K8YA 1COWA 1RW4A 2ZGCA 2G9NA 5HXFA 4XIGS 2V54A 5CLQA 4RVCA 3FB4A 4BFVA 1UCYH 2ZVPX 1BTHH 2GEVA 3MWYW 1XJQA 1DY8A 3KQCA 4DLWA 1D6RA 2P59A 3UIEA 4ZH8A 1TNLA 1PFXC 1P2MA 1S0QA 1FXYA 4BAKB 1G8GA 2BKUA 1OLOA 4M9FA 1CGJE 3SV9A 2CK3A 4H6TA 2HOBA 5DI3A 1LW7A 1O2SA 2PSYA 1KTTB 3MFYA 5C5OA 4OQLA 2C96A 1SLVB 1GSIA 1LS1A 2FPMA 1TX6A 2Z9JA 2Z94A 3VX3A 3GY2A 4KI0A 1GJ8B 4PAMA 2VP5A 3UANA 3PIRA 1CT0E 4ZCIA 2F1JA 1YZQA 5EXTA 4Q1CA 4X1RU 3A7VA 2ZHQH 5HCNA 1R4AA 1CJKC 4U7DA 1O2IA 2Z4RA 3DHWC 3UMRA 3NEYA 3AM1A 3Q00A 4BNRA 3MG9A 2WWYA 3OYPA 1TBQH 2ZCLP 3F68H 1E1QA 1DSTA 4PTLA 2CF9H 1NBMA 2ZRKA 3NKKA 5KNCA 2GCTB 4Q5IA 2ZS7A 3H86A 1B0EA 1NFUA 3M1IA 4AFSA 1X8JA 4KAXA 5J4KA 4QOSA 3U69H 2WM9B 3UUZA 1C5TA 2B8WA 1AD8H 1UVUH 3TQFA 2GJ8A 4B33A 3AW1A 4MNXA 3CX8A 3VNUA 2V6NA 5EUMA 2RGNA 4E06H 3K6YA 3RS2A 3TR0A 1GJCB 3UREA 5C4GB 1TAGA 2FEQH 4KV9A 1O2NA 3L8ZA 5KU1A 4JYVH 3PV4A 3WBJA 1K1JA 2ZE6A 4NYIR 1OIWA 2BXUH 2Z3EA 3RXUA 2DBYA 3AKEA 1GI5A 2A32A 3F9EA 4KO8A 5A8XA 2PBRA 2XZLA 1N6XA 3NDBB 5LPRA 2WKRA 8OHMA 1WMSA 3TE6A 1QJ6B 2BBOA 1IONA 1Q1BA 2NG1A 2FOMB 4I33A 3HATH 4VGCC 4ERNA 3B6EA 1O32A 2FPLA 1KDRA 2FSHA 3O8DA 3GLGE 1C2JA 4HI3A 1ELGA 1SQAA 5FPYA 1N5LA 4V02A 2X19A 1WU1A 4HFPB 2GX4A 2G00A 1BT7A 3FMFA 3RXGA 4BLRA 2ZQ2A 4TPIZ 1L2TA 5JPMH 4ILEA 1GOTA 1AM4D 2HXYA 3GYMA 1RIFA 1NFXA 3CPHA 4B43A 2DWPA 3V12A 4B2PA 5FOTA 2NU0E 2BIFA 3U1IB 4C0AC 4CEJA 1N6LA 1H8IH 1GHZA 1BHXB 1KI4A 2XJ9A 2FWRA 2RG3A 1UTQA 1XXDA 1C4V2 5C67A 5EZ5A 1GJAB 3QK1A 3EZ2A 2O8EB 1X1RA 5J40A 3IHLA 4TZ6A 3R20A 1E4VA 1V2NT 2AGGX 2GKSA 3TH2H 3T1TA 2Q6GA 1XMVA 4D4LA 3OEED 5TCAA 1DWCH 1F7ZA 1VYUA 1U8AA 1KNQA 1PQ8A 1UKEA 1IBRA 3LLMA 3IIJA 3A58B 1EUFA 1K1MA 1II8B 1OXVA 4AY2A 3AKCA 1B0FA 3QF4B 1XCGB 2WUBA 2VWNA 3RMMH 1UCYE 3LGYA 3BAFA 4WXVA 4LDJA 1CR4A 4LJ8A 3UOPA 3BWDD 5KSYA 1SGTA 2HALA 3BTHE 4K8BA 2BEJA 1FNNA 2BYAX 2CGAA 1I2MA 1G7CA 4BGDA 1AKYA 3PEWA 2C4FH 1Z7KA 3NH9A 1JR3E 1RTKA 3L8YA 2PZGA 4GAWA 2XB4A 1FQKA 2ZREA 1G3EA 3FZDA 4ARZB 5C1UA 4KBGA 1WA5A 2Q3MA 2HLDA 1OH5A 4QJ3A 3PLKA 2BM0A 1C5LH 4Q4AB 4CHAC 4MVNA 4BFTA 2YWHA 4DCTA 2BDGA 2V8OA 3FOZA 1RXPA 1MU6B 3TVDA 1TPPA 4F4IA 4TYPA 2CN0H 2GT7A 1ZPZA 4Q9IA 1G7RA 4UQOA 5FUYA 2VJ1A 1HUQA 4Q48A 1CXZA 3SUEA 2YOFA 2WOJA 2O8BA 3OE7A 3EG5A 2HLCA 3FFAA 1NU9A 1H4WA 3ZV8A 1NMXA 3UMFA 1INCA 3ZZUA 4C7OB 1ZM7A 3ADKA 3MO9A 5EXMA 1MR3F 3ETLA 1D2MA 2JAQA 1DVRA 1O0DH 2ONJA 2AIPA 3A4MA 5FOUA 3L6PA 4DLVA 4X8TH 4UNPA 2BVRH 1XB2A 2Y5GA 4Q7MB 2PCLA 5E0GA 1QHNA 1QHGA 5JLJA 1AZTA 1IHSH 2P3UB 2ZU1A 1F0UA 2D62A 2W6JA 4FINA 4XSHA 5JI2E 1JB1A 2BY6X 3GFTA 2HNTE 1GM5A 2ZA5A 1IQKA 4P31A 1BTWA 1KI7A 4Y6DA 4OI1A 4H9GA 1W13U 2ASEA 5F98A 4NWLA 1NS3A 2LWIA 3U7HB 1NRNH 4EQ6B 1YYY1 4C3ZA 1EWRA 1GI0A 1XTRA 1SGFA 2YJTD 4D9RA 3IHWA 1N8OC 2EFGA 2CE7A 1EPTA 2JH6D 2FEMA 2V6IA 3N2IA 4NWKA 1VCNA 3PITA 4NONA 4LXBH 3A8CA 2CV3A 3D23A 2XBXA 3VB6A 1CIPA 4RI0A 4IS5A 1DELA 4MGZR 3V4RA 3U9AH 1WQ1R 4FMDB 4FCVA 2DFKB 1Q1EA 1NTPA 2ZJYA 1Z06A 5DP7A 2BZ6H 2BDIA 3LH3A 3HPTB 2QE7A 1WYKA 2FFHA 3GY6A 2VP0A 3VNVA 1O5CB 4IXMA 2Z9GA 4JCNA 1P2VA 3P92A 1EX6A 2H1UA 3EZ7A 2QZ4A 1HXFH 4GHQA 1IHTH 4EFLA 2DCUA 1OKKA 2O8MA 4DDTA 4NMMA 4WW0A 4YMWA 2STBE 1NBME 1QBOA 4Q9HA 3KGPA 3PJRA 1BBRK 2ANYA 1VPLA 5DSZA 1O30A 1P03A 4LX0A 2FX6A 3AB3A 2JJ2D 2IYSA 5JFGA 3K9HA 4C0LA 1SULA 1RRFA 5I25A 4TQUS 1ZOMA 4TTPA 3CNNA 3KCGH 1HCGA 3T5DA 1XTQA 4AB8A 5LH8A 1SVSA 4Q7KA 2J38A 2ANMH 2ZSBA 5CITA 4Z0KA 2GILA 3MNXA 1A2KC 4Q7JB 4AYYB 3M3TA 1GJ4H 3GLHB 2ZDVH 3M4YA 3RLFA 2A4RA 2ZRBA 4CT5A 3ZZAA 1YGCH 1CQQA 4B6FA 3T5GA 5AJYA 4W7SA 1VG0B 3OIWA 3K0CC 3T2NA 3BTDE 4TYDA 3N5CA 2WPIS 1IY0A 4TPYA 1G3MA 4UXHA 2R0KA 3BTFE 3THYA 1IQGA 2FIRH 3WBKA 3L0SA 4M4SA 1KXCA 2WPLS 2ZDAH 4LJAA 2ZCKP 1Z6TA 1XD9A 1P05A 2GV6A 4AFUA 1GBBA 1LF0A 3LXXA 3P32A 5EW2H 2P3FH 2ZTYA 1K22H 1IQJA 1NLYA 2OQ5A 2PKSB 1R0ZA 3H4MA 4RZ3A 4I8JA 3MLEA 1VDZA 3F9HA 1C1UH 3CS7A 2OSBA 3PM3A 1GUAA 3ZZDA 1V2RT 1BKDR 1FY4A 5DP6A 1KXBA 4D0GA 2HEIA 2BV3A 1OP8A 2J4IA 2VGCC 4Q4HA 4G5QA 1UVPA 1WB9A 3UATA 2XTMA 821PA 4BRUA 1GG6B 1F2UB 2IJD1 1DG1G 1QHYA 3KTAB 2CMYA 2ZR7A 5H4IB 3I73A 4ABAA 3RSLA 4KXFB 2P6NA 4ZROA 1KY9A 1KZ7B 1TQ6A 3PO1C 3SU4A 4LRWA 3KX2A 4B34A 1OP2A 3LA6A 3N7OA 3RU4D 4YQFA 1DAGA 1KMQA 3LT3A 2NMVA 1KSHA 1U94A 4YO9A 1LVYA 1X3SA 2I3BA 2B7BA 2GZ9A 1JI0A 1JIRA 4D8NA 2CL6X 1Z6GA 2ZHFH 4R71A 1C5YB 4JVLA 4QM7A 2V7QD 1A5HA 4A2PA 4JBYA 1GBCA 2VIQA 1FMGA 2BQWB 2A4OA 2XX3A 1QHSA 4TWYA 1GL9B 4I1OA 2IEYA 3WRYC 2REXB 1U9IA 1J2JA 4TMVA 4NZYA 1KKMA 2QG6A 2BZAA 3RS0A 1RIWB 1T0JB 2VBCA 2R9VA 4GL2A 2I1VB 4DIEA 4D9QA 3WY9A 3JZAA 1P3EA 1GI1A 4JT4A 2F91A 2D7DA 3MMPA 2BMFA 4I4LA 3BIVH 2FOHA 4KBFA 1H8ED 3ODDA 3UNQA 4DT1A 3KL6A 3NBXX 3UXMA 1WOFA 1S84A 1N6YA 3Q3KA 3UK6A 3JZ2B 5AVDA 3GEHA 2C99A 5JI3E 1FP6A 2J94A 1P2TA 2XWBI 1GNRA 5FX5A 3SUGA 1E2QA 2D2EA 1SBWA 2C03A 3QY0A 4HSEA 1NO9H 1IXZA 1XWIA 2F6RA 3EASA 2A4GA 4LGMA 3UG6A 4YMUA 5T6GA 3BSQA 5G40A 4M1YA 3TGKE 4WBSA 1GG6C 1S4QA 1C9PA 2H57A 3PMHB 3U8RH 3BB4A 3KKPA 1HAOH 2AEIH 1FX0A 3WHKA 2CLCX 1SVIA 2A2QH 3CWQA 1ELAA 2VO1A 4TWWA 2BC9A 4MH0R 3J81k 2AGIX 5GJ4B 4ASUD 4C4PA 1EFRA 1C9KA 4ZO4A 3BS4A 2G0NA 3L2OB 3D49H 3QE0A 3MWIU 4TMTA 3KKMA 4KSBA 1FJSA 2SNVA 1MO3A 2WPMS 1NVUQ 2A7JA 4NIVA 4GLYA 1Q2WA 4DBLC 3FVFB 2WPDD 1J9CH 1E9BA 4K60A 2BTCE 4XWKA 3K9XB 4U30A 2OUKA 3V0XA 1QCPA 2QAAA 1OT3A 1EQ9A 1SPJA 2Z9KA 2ZJOA 4Z1MA 1TGSZ 4A0HA 4ZDIA 1O3BA 4FU7A 1TQ0B 2N46A 3GJ7A 3GDVA 1C1QA 2B6HA 2OAP1 4F49A 2NGRA 3AF3A 3TK6A 4ISHH 5L3RA 2IYXA 2OK5A 3Q8XB 3NKVA 3D31A 2PV9B 3P8NA 2QF0A 4O3UA 4DDUA 2VP9A 3K65B 4AG6A 2Y5HA 1JBUH 4S35A 2SGQE 2Z6VA 2HPQH 2JCSA 4DCSA 1E99A 1AO5A 5IDVA 4Y0AA 4AG1A 2WKPA 1B7XB 5F9FA 1O39A 2ANBA 4OHZA 1TPZA 2RB4A 4NPHA 3TUIC 1MRSA 2ZFTA 1GJ6A 2WSSD 4NA7A 3A4LA 1JAHA 1P60A 2IWHA 2QXGA 3T62A 1QNJA 4A1TA 2QGZA 1GIAA 2VTKA 1LB1B 1DO2A 1IQPA 3KQLA 1N6RA 4Q47A 2HLDD 4G0NA 3SNEA 1GBLA 3CP7A 1NY6A 1Y3VA 2OESA 1MTSA 3G0HA 1BMNH 2KJQA 2BXTH 5EP3A 4BQSA 621PA 1ZM3A 2F1HA 2FTLE 4ISIH 1PPZA 2HJGA 1PJRA 3RSOA 4BFUA 2IYRA 4UEHH 1BYUA 1O2TA 2EYUA 1MZDA 2WWWA 3SU3A 2A5IA 3NPSA 2B8OH 4B44A 1G6OA 1F5KU 4ABFA 5AJWA 1L1NA 3KHVA 1X1SA 3EPJA 4BOHA 1F5LA 4ZKDA 1JRSA 2FOAA 3QTVH 4V0KA 4PC6A 1BTZA 1JIMA 2EFHB 4X6PA 2FNAA 1E2LA 2IF0A 1ZSJA 4RKJB 2QTVB 1O3HA 4QNRA 3A36A 3U44B 3PLBA 4URUR 2HYIC 4X6OA 4IDHA 2XC0A 1TGNA 1ZR0A 4HZHA 1AUJA 4TL7A 4EDHA 1OXUA 4Q80A 3GY5A 1OJLA 1G3CA 5D3MA 1GBMA 2IA5A 2AWOA 1C1VH 4WZ6A 1XUJA 2J34A 1QHRB 1NJFA 2QT1A 3GEIA 1MCTA 1D3PB 1O3GA 1O5AB 1R5NA 4UKDA 1V6DA 1XPRA 5T6FA 1UTNA 5TMPA 3KJGA 1R5BA 1EAUA 1QB9A 2GETA 3VKHA 3UMSA 1GVNB 1N3BA 4ZKOU 1KYIA 4BZPA 1G2LA 2CHVA 2CF8H 4QBIA 1W44A 1E2KA 3ONWA 2GP9B 4B6EA 1K1NA 2QAGA 5KPDA 5HM2A 2F7SA 2VHUA 1U2RA 3E3TA 3SUFA 5FX6A 1HIAA 3SZRA 3T26A 4RD4A 5EUQB 1W4AA 1Z8FA 1OHHA 2VA8A 2QMUA 4GMXA 4F92B 2ORIA 1IM2A 5JHHB 3FHTA 1H8HA 1AVGH 4OHVA 4Z54A 2GBLC 1NZQH 1GHAG 4IOKA 1C5ZB 4CDGA 1YR9A 1DLEA 1MBMA 1CJVC 2DE9A 3C1KA 1DICA 3RC5A 4C0BA 1XTSA 4B2LA 3FMOB 2GCOB 3EA5A 2V4ZA 2O9QA 3U4QA 4GUXA 2PUQH 2Z5FA 5EPYA 4CRBA 3QKRB 3OTJE 2Q9CA 3C5HA 1FI8A 1FTNA 2YC4C 1SLUB 2NTYC 2OG2A 4NE2A 3QXSA 3RXCA 2ZZUH 1O3LA 3B9FH 4HTCH 1AY6H 2GD4B 1XD2A 4DJZB 3NDPA 1V5WA 3ZVCA 1SVLA 2A3RA 2QM7A 5LPFA 3GQBA 3A83A 4JLPA 4UFDH 5B64A 1NKTA 1R0XA 2XXAA 1ETTH 4FCWA 2NU4E 3FDIA 4LJ6A 5AK0A 4BUJA 4UJ3A 3HYRA 2ANKH 3TSZA 1MKYA 3L0PA 1YPKH 1V3XA 4L5BA 4A8JA 5DO4H 4DCDA 4X8SH 2ZGJA 4B73A 1HFDA 3Q7PA 1BTUA 4IC6A 3BFXA 3ZJYA 1C1WH 4EAQA 1V43A 2FZ4A 3K09C 1ABIH 1NBMD 4TQ9A 1FNMA 2ZRHA 2JH0D 1TNJA 3KQBA 2NU3E 3DKPA 2VNTA 4P4SA 3PUZA 3SJCA 1ZZZA 4X8HA 3VB4A 3KB2A 2BKEA 1C1PA 3W9YA 5IK2D 3RS3A 4JL6A 3RS5A 4RD2A 2F9LA 3RXAA 1C5XB 5ETXA 1QRXA 1E0SA 4BZQA 3G01A 5DP9A 1XTKA 1NN3A 1E98A 3LU9B 1BRCE 4M9QA 4QGFA 4ITRC 2O8CB 4MITA 3BF6H 3LPRA 2AX4A 4FU9A 3QIAA 3LO5A 3M7QA 1YLCA 1E2DA 1AE8H 1EXFA 8KME2 1KJWA 3Q7QA 1V2UT 2O8DB 8GCHG 1TONA 2BVXH 3ZIAA 1ZNXA 3LX8A 2BD5A 3GY3A 2ZC9H 4Y11E 1S83A 1VCIA 3TH3H 4MRRA 3IGFA 4LHVA 1JJVA 3AF0A 4BLOA 2ZU4A 2D7CA 1MT0A 4HUTA 3QUSA 1T31A 1P2IA 2BM1A 2ODNA 3MNBA 2VHCA 1AWHB 4LHZA 2PJZA 1OYYA 1KLIH 4IJMA 4BAQB 3CRW1 1E2PA 4WXRA 4IW3B 1LHEH 2FWWA 1LF5A 4IDPA 4PHFA 2GCOA 1ZJDA 1ETSH 5JB8S 3K0SA 2C77A 5CM9C 2PH1A 3NZIA 5TCCA 2PW8H 2W6IA 2EI8A 3AKDA 2TIOA 2TGDA 2SGEE 2JLQA 1QZXA 2QCYA 4OGXA 4RCYA 5GJCA 2VINA 4WMDA 3SZNA 2GDEH 2D74A 1YPJH 2GCHF 4LHWA 5KPJA 3P20A 2EW1A 1SOTA 5CMXH 3ZLJA 4E7RG 4KTCA 2Z83A 4Y7AA 3RC4A 1P8VC 1M1YE 4IKEA 1GJBB 3AVUA 2W83A 3FP7E 2J1LA 4CBNA 4V0NA 1A3EH 5FAHA 3Q76A 4OQFA 3V13A 1JQLB 1EK0A 4Z1MD 3QO6A 1EB1H 2YYZA 2GEDA 3VQTA 4LWZA 2VWLA 4URXR 3AH8A 3B1WA 1OFTA 4QJ4A 3GMTA 2ZAMA 4K8OA 1UBEA 2ZI7A 2OBQA 1VMAA 3RXOA 1YRBA 3WHLA 1P2NA 4URZR 5KSPA 2HT1A 2Z4SA 4TYNA 3B7GA 2AS9A 1KNXA 2R6CA 2O0HA 5DI3B 1Y63A 4MNWA 4A1XA 4URYR 1J8YF 4CW7A 3SFZA 2QSZA 2EC9H 3K0CA 1R8QA 4MKFA 3TMKA 5FH9A 1J90A 5FPTA 1Z0AA 1F60A 3ZZ3A 1P3JA 4TL8A 4DGJA 2KI5A 1KY3A 1ELFA 3SNAA 1OH8A 3U8TH 4KODA 4IMQA 4HI0E 2WYGA 2EEKA 1UBCA 3FTQA 3I3SR 1CO7E 3PEUA 3K2UA 3PMJA 1NVXQ 1A0LA 1T8NA 1V2MT 3SQHE 2DY1A 1XRJA 4EQ6A 3RDZA 2FX4A 3Q5DA 3IPYA 2HF8A 1ANKA 1TA6A 2GCTC 5L3SA 1KKLA 4YMTA 5DIFA 3I8SA 5K8UA 1FPMA 5FXLA 3K09A 4RJLA 1A0HB 1GHAF 5H68A 4DC9A 3KIDU 1ZC3A 4ARZA 3GY4A 2WAYA 1KK2A 2GXUA 2XGJA 2CBZA 3S9BA 2QAGB 1MD7A 1XZQA 4MUAA 1L4YA 5AJZA 4FD2A 1E38B 3HK6B 3RXDA 1BMFD 3KFXA 4HAXA 1RVDA 1EFHA 3GCTG 4UE7H 3RXTA 1HIAB 2XC4A 3NVAA 4C0JA 2VEDA 2ALPA 2H5DA 1IY2A 1K1LA 3CH5A 3WYGA 3G82C 4PC7A 2ZS8A 5FBLB 1A7SA 4FUHA 2F9BH 3RXPA 3ZDQA 1GL0E 3ZQJA 4X8VH 2LNCA 1ANCA 4B75A 1O3IA 1KK1A 1VHTA 1SGRE 3LGWA 2NO1A 4HZUA 2F3CE 2BVSH 2GESA 1E9FA 5DHFA 1QHHB 2HCJB 1P73A 4JS0A 2XTZA 1DDJA 4ABEA 2PLFA 2IYZA 4JT2A 1HTWA 4GOXA 3PXGA 1UTPA 1YU9A 4KYIB 3QX5H 2R3UA 2CHGA 2VP2A 1T3LA 2A2ZA 3LY5A 1IQEA 1Z08A 3CF2A 4PZLA 2ZF0H 4QL3A 4BFSA 3THOA 3QF4A 521PA 3UPEA 3GJ6A 4M22A 1WBBA 2FG5A 3TH4H 2HDNB 2WJHA 3NHBA 2C9OA 2ZU5A 4JBXA 1AIPA 4GSOA 4WH8A 1G5TA 3NCLA 2OCYC 1MABA 5AF9H 1BIFA 4HZIA 2PZEA 3AVOA 2J87A 5AR1A 1KMHB 4QFMA 3X2SA 4EJSB 5C4MA 1QVAA 5KYKA 2RAPA 5G3YA 1NG9A 2VHTA 1FY8E 4I8HA 2ZECA 4YMVA 1UBGA 3QEJA 3CR8A 3VX4A 4OBEA 2P5SA 2REOA 2ORVA 4BFYA 1T6NA 2GVDC 2C8VA 1GDQA 5TJXA 2BCGY 4WVPE 5FPSA 1TRMA 5JBAS 1GBHA 4DSNA 1VCMA 2CCKA 1CT2E 5F8XA 2X8AA 1IAUA 1IOEA 4JYBA 4EFNA 2ZHWH 1F5NA 3LFUA 4A2WA 2JDID 1OH6A 1BHXF 4Y0VA 4O97A 4O0MA 3LBNA 2V7QA 5E0HA 4GP6A 1YPLH 4BAHB 2X77A 1HE8B 5E7IA 5JWHA 5JZVA 1F48A 3M37A 1W1WA 1SQ5A 3ZVLA 4X8LA 4XVRA 3TPIZ 3GCOA 4OK3A 1I4DD 3NG1A 4RFVA 2AWNA 5F03A 3RM2H 4EJSC 5HE8A 3LGTA 5SGAE 4OM9A 3CB4A 3ZVFA 1Z1IA 4WA7A 1WF3A 3LLUA 3WNCA 4H1UA 4XBDA 1R0WA 1K28D 1O3EA 1DM4B 1L8QA 1VJ9U 4MRSA 3BERA 1HURA 4C2TA 3E2IA 1N0UA 1JWTA 1AKSA 4A7IB 2IW3A 4O25A 3KXLA 2PT5A 5CIQA 3URCA 3W90A 2FDCA 1HAHH 3LONA 2GJAA 3EPHA 3BIUH 4DZZA 4IBLH 1ESNA 2QGNA 1M34E 4ZIRA 2OINA 3K1JA 2ESTE 1H8DH 2GWHA 5FBQB 2W2VA 4RKOB 4K2YA 3BTKE 4NKRA 4Q4AA 5JBTA 2WIAA 2D06A 3D65E 2NU1E 2H5CA 1G64A 1Y5UT 2F83A 2XSZD 2BHRA 3QDZB 4QBGB 4LBYA 2V35A 4NCNA 2ZM5A 4YDSA 1QR3E 4OGYA 2WKQA 1IN6A 2AMDA 1RKBA 3RS7A 2A31A 1UKVY 5BYKA 1CBWC 2D2FA 4C7OA 1R6BX 4MQAA 3ADBA 3QEOA 1DSUA 1Z6XA 2VWMA 4TMWA 4WZAE 1Z0DA 2D2DA 3PQCA 6GCHG 3REGA 1AHTH 3TNFA 3EPKA 2OCPA 4HB3A 2NO7A 1OX1A 4E09A 1AFEH 2REBA 1QQUA 1KXAA 4SGAE 2E9SA 3PO1B 3AQ4A 2E87A 2KBEA 1NN6A 4Z8YA 2VIOA 4PPFA 4TLBA 1AKEA 2GK7A 1HAPH 2GCPA 1W4BA 2WWXA 2NOAA 2K1QA 2HCBA 1TB6H 3GCHC 1GG2A 2QPTA 3DUXH 1CU1A 4ACBA 3MNSA 5FBRB 2KAIB 1E79A 1E37B 4B32A 2X1VA 1DANH 1FL9A 1OW3B 1BRUP 3QG5A 5FBVB 3W3ZB 1C4Y2 2ZS9A 3CNOA 2Z3CA 1AZZA 3EIEA 4YM9A 1G7TA 3QKUA 1MAXA 4N0DA 2F43A 3GLHA 1JOUB 1DAIA 1SQOA 1UDXA 4V0ME 3RRMA 2BDTA 1PQAA 2ZYWX 3U44A 4NZQA 4JJZA 3L43A 1NJGA 2TGPZ 4HYYA 2RGDA 2OHFA 1SGDE 4WXIA 3T5FH 5A0CA 1XVOA 2I1QA 2UZIR 1UMAH 2YC2C 4C9BA 2AIQA 2P94A 3GLFE 3U61B 3CF0A 1E2GA 3L3TA 1YF4A 4QHSA 4KYUA 1GJDB 2UUYA 2QAJA 1C2FA 3QENA 4WOPA 2WTUA 4YC7A 1RS0A 4XJXA 2D1JA 1QDEA 2PCJA 3PLPA 1BQYA 3W3AA 1TMBH 1TOMH 4IN2A 1CA0B 2JKHA 7KMEH 3HK3B 2ERXA 1J8MF 1CSOE 2F4LA 3SQXA 1O2UA 2Y5FA 1DPOA 4KTUA 3LV8A 2OBMA 1BMLA 5LPEA 4GNKA 3IO3A 3UPUA 1C2DA 2QPAA 3ZZ9A 4MG3A 1E2MA 1DXPA 6Q21A 1EPTC 1S9HA 1F0RA 5A4JA 2BY9X 3I32A 1KDPA 5C1BA 1GVKB 2ZI5A 3FFBA 1BMAA 2VSXA 1IAQA 3UTUH 4Y8ZA 1NRRH 1QG2A 5CB8A 5KDDA 1DUEA 2GTBA 1O2KA 3A81A 5EODA 3SU1A 3ZZ8A 2ILNA 2PHBA 4NBSA 1DEKA 2IYUA 2QBYB 2FYRA 5FBEA 5DGXA 4X1PU 1FPCH 1ANEA 3OFNA 3GJ5A 2FDAA 4AG2A 2C8XB 1QRAA 3SJOA 2O5VA 3LC5A 3TJUA 3CX7A 2Q3FA 2Z43A 2P6RA 2CL0X 4JLNA 4DLZA 3K70D 1MABB 2ZRDA 1G36A 3RAPR 4NA9H 1XP8A 1E32A 1O3PB 4ISNA 1ZYUA 2WSMA 1KIMA 1KAGA 1A5IA 4PFSA 1EZQA 2GDDA 1KY2A 1J14A 2AYWA 1E9RA 4R8TB 1VIAA 1G3UA 1EGAA 3VU9B 1F3OA 1XPUA 1XNJA 2WJYA 2WSSA 1V2WT 1UKZA 2OD3B 2ATVA 1GHVH 2O8LA 1DWEH 1QG4A 5T1VA 2ZI6A 1DARA 4DVGA 721PA 3A89A 2V3CC 2BBTA 3V3MA 4XVQA 2VL7A 1NN1A 4PR0A 1SFIA 4ESVA 1OYWA 4DDWA 2IS4A 4U00A 1GJ9B 3I61A 3KQHA 4M1KA 2P5TB 1UJ1A 3KKNA 1OWHA 3S7KB 1N6HA 4RKEA 4Y79A 3EE0B 1S6HA 1O2MA 1NN0A 1HBTH 2ZFSA 1SFQB 4GT1A 2FOCA 4NYJR 1HY3A 1W46A 1N0WA 4DY7B 1C5WB 2YZ2A 1FUKA 1QJ1B 4OI0A 1FZZA 4ZCMA 1YR7A 2FZZA 4INKA 5HMAA 1AS2A 2VQSA 1BTXA 4A82A 4Y7BA 2OM2A 4B2AA 3LH5A 2A1DB 5FL7D 2QEQA 5IK2A 2QQEA 8GCHF 1AN1E 1K9OE 2JLXA 4CR5A 1T3SA 3H2YA 5DKMA 2W3KA 5EE5B 1O37A 5E7MA 2DYKA 3LVRE 1K1PA 4NP6A 4GP7A 3PMBB 1BIOA 2CHQA 2ODWA 4A6XA 2RGNC 1OOKB 3FHOA 3O8BA 2CJIA 2GGVB 7GCHG 2A5DA 2ANCA 2ZI3A 3GLFB 3SV6A 3LAWA 3VKWA 3TW8B 3U3KA 1GI4A 3KXIA 4LHXA 4UFFH 1RE0A 1NFYA 3ZQ6A 3RDPA 3CH4B 3RC8A 3GJ0A 1AVXA 2PEZA 4TTRA 4AKGA 5L2ZH 2R2WU 2XW9A 1ZD1A 1CGHA 1XEWX 2QE7D 3NC1C 1RYHA 1I4TD 3UNRA 1GDDA 1A1VA 2JJ8A 1JBKA 4HB4A 1W11U 4NIWA 1VCQA 5EP1A 2C8WB 5EQRA 3CX6A 2YNAA 1ARCA 3R0FA 5ELXA 4A1FA 4YXWA 4AI6A 2ZSEA 3PUVA 2ZFPH 4YLUA 1DAHA 1I2DA 1K5GA 3G5UA 4CBOA 1M8PA 3K70C 4PANA 3KTAA 1LMWB 1TNKA 5EXPA 1A2BA 1H1BA 3M5MA 5IHPA 1FMJA 3U7GA 4INHA 1QHHA 1O3DA 5DN6A 1WCV1 4MDEA 2FFBA 1U8ZA 2F9UA 5K7RA 1EAXA 4BEJA 2FLBH 1G2MA 3LDAA 4FVDA 3MCAA 2ZJ2A 1KO8A 4DIIH 1ETRH 5L3VA 4G5SA 2FTMA 2AKYA 1RRPA 3K0FB 2Z9IA 1DLKB 4CH2B 5LB4A 2ZTZA 2A4QA 4LC1A 3S1AB 4KCGA 1OS8A 2QY9A 1VG8A 1F2TB 2ZYVX 1A5GH 2QA9E 1P7CA 2ZPRA 4KFTA 3RP2A 1YZLA 3BK7A 1Q1ZA 4A6PA 3A1UA 3PENA 2THFB 3KL4A 1WXRA 1XX9A 1GKYA 3BG8A 1OHHD 1F5RA 1N25A 3V00A 4K8YA 1FOEB 2HYDA 4LJYA 1E9AA 4ZKSU 3RMOH 1ZHRA 1N8OB 2O0JA 1OWJA 2V1UA 1T32A 2OBOA 1BJVA 4SGBE 3AASA 2Q3HA 2WINI 1TNGA 3A8TA 5JJLA 2Z3DA 4F4OC 2ZTSA 3SBEA 2ZP0H 3NIBA 5A0AE 1PPGE 3OAAA 2JATA 1MU8B 1DITH 1NIJA 2QRZA 4CHAB 3ATLA 3P8FA 1KZGB 1KI3A 2WOOA 1P9NA 4LI0A 1IJEA 2GTPA 4TSFA 1O2VA 1TF5A 2RHMA 4V03A 3OU0A 5EW1H 4A4DA 4LJ7A 2ZR9A 2GA8A 3WYFA 1IN7A 3AF4A 3IQXA 1W36C 2BQ7B 2FOEA 2IHYA 1LVBA 1DVAH 2E1RA 1C5NH 1GI9B 1HT1E 4DLXA 3ZZCA 4DIHH 3VFDA 1BOFA 2G55A 1QY6A 2GXAA 2R9PA 1PZNA 1SC8U 3LDXH 1BA8B 1P0SH 1II8A 3ZVAA 1O3MA 2VF7A 2P3TB 1AI8H 1ZNYA 3M61U 2JLVA 1OWIA 1LQDB 1O2XA 3LGIA 1QQ4A 3M7TA 2VSOA 2QMEA 4CZ2A 3FANA 1PLJA 2ODQA 3MWLA 4OK5A 1NI3A 4FUGA 2GF9A 4I8KA 2A30A 1EZXC 1SL3A 1SXJC 4QNMA 4UNRA 1HT2E 2R6DA 2FI5E 1A82A 1TOCB 1G18A 1LPZB 3W94A 3NK8A 3S9CA 2JJ2A 2HNTF 3AUXA 2NZJA 1WUNH 1ZUHA 2VVVA 3W5JA 3P1JA 1DOJA 2F1IA 3KQDA 3MH7A 4XVUA 4D7GA 4OS4A 1WCZA 3SUDA 2VIDA 3SU2A 4OL0A 1RRGA 3LNCA 1W4RA 1E0FD 4XH9B 1TTTA 1FZQA 1RD3B 1SVKA 4X8MA 4BFZA 2PLRA 4HEJA 5DG6A 1E79D 5F8ZA 1FDPA 2B21A 3B60A 2FSFA 3KF2A 1DE0A 4N0EA 1Q1QA 5EE9A 1NRQH 3THXA 5A5GA 1YJ5A 1MBQA 5E3HA 1KDTA 3BIFA 2O0KA 1NRSH 3RMLH 2DFNA 2BY5X 4OK6A 2R65A 1WBDA 1ZLRA 3T28A 4NFFA 1EP6A 2J3EA 2PUXB 1T9HA 5G53C 2YKGA 1NRJB 2W00A 2C9YA 2R6FA 3NBYC 2FODA 1Z6EA 4E7NA 2AK2A 4XBBA 3A37A 2KSQA 2WBLC 4RN6A 4Z51A 1H8HD 4FMDF 1UTMA 3ZV9A 4MNVA 1C1MA 1G3IA 4A0FA 2DB3A 5JCPA 2WPHS 1LQEA 4HAWA 1XDBA 1O2WA 2IXFA 4JLOA 3HGPA 2NO0A 1XCMA 2I6SA 1ANDA 2DHRA 1GGDC 1UO6A 1E2HA 1CKEA 1P61B 3AVZA 4PQYA 1AGJA 1NKSA 1C2HA 2BMEA 5EXXA 2UVQA 3TVTA 3CONA 1D9IA 2FF7A 1H8EA 3PV0A 1UJ2A 1GNPA 2R6GA 1E2NA 3SORA 4AC9A 1AK2A 1GBDA 1PPBH 3Q3JB 2ODEA 2OZEA 4J0QA 3QXHA 3GFOA 2F9OA 1LY1A 1NN5A 2EU8A 3BTME 4BWYA 4HAVA 1T7CA 2VP4A 1O38A 5DYGA 5IYTA 4XSKU 1TEXA 4MLFB 1P62B 1GRRA 1O3AA 1XMNB 3I72A 1L0ZA 3CNLA 4LK2A 2W6JD 1AQUA 4TT3A 1GGDB 2FGKA 2L0XA 2IYQA 2ZDMA 1KO5A 4FMCB 5E2OA 4IXNA 4AYWA 5UKDA 3T61A 3TNTA 1W12U 4X6MA 4TMZA 4FN5A 4CGZA 1RPZA 9LPRA 1E34B 3MO3A 2EFEB 1P6XA 1Y3WA 1W0JD 1TLDA 5DGJA 1CR2A 1F2UA 4LBZA 1O2YA 2FFAA 4UXJA 1S5SA 2AMQA 2BD8A 2C90B 2CL7X 3EIHA 2BD9A 2PMDA 1BMMH 1GCTC 2FOBA 4AOQA 4TZ0A 1ZIPA 1TUEA 3IDQA 4PSKA 2JIZD 4XBCA 5AHGH 3MJHA 4FUJA 3SO3A 2O8EA 1TNHA 2BJWA 2PEYA 1S8FA 5DP5A 3LX5A 3OIVA 5IDKA 1KJZA 3X1WA 3FPAA 4ZI2A 2YWEA 3SN8A 2GRJA 3HU1A 5CJPA 3OSYA 2YHSA 1W0KA 4RZXA 3REFA 3EXAA 4DLTA 2B0FA 1IJFA 4MKGA 2WV9A 2QAGC 1MTNB 1DE7H 4MPUA 2MSDB 4TLDA 2QQ0A 1ZMNA 4PSAA 2UWPA 1JQJC 4C0KA 2BOKA 5JWOA 5TB5A 1CJMA 3SFVA 4U32A 4OHXA 1GL7A 3PV2A 1U0LA 1G32B 1MKXH 2GBLA 3ZVGA 4LYHA 2OT3B 3QSYA 2P65A 4TMKA 3QQ5A 5B30A 1ZRHA 3A88A 2IEZA 3K9NA 1M2OB 1ID5H 4JLVA 1EP5A 1WXQA 4LK4A 1OXGA 2AERH 4GBMA 4IEEA 5C18A 4NA8A 4YESB 1FNIA 2XBWA 1GPZA 4M21A 1UK3A 2VIWA 2WPJS 1E9DA 4GPGA 4LOYH 1VG1A 4Q18A 2FOLA 1N5IA 2WICA 3RXJA 1WE2A 4LC0A 1ZU4A 4CRCA 1PYTD 1V2TT 3QNUA 2RGXA 4YLQH 1EJAA 1W14U 2OQUA 3OIYA 4CEHA 1P72A 1XMIA 1YC0A 2VWOA 1Y3XA 4B47A 4A36A 1AN0A 2I6QA 1S85A 4G5OA 2CNWA 3T34A 3MFJA 3TLOA 1EZUC 1VG9B 5A8YA 4BECA 1OF1A 3O47A 4WXPA 1O3OA 5CK5A 4JLAA 3SJIA 3CRVA 2ZE5A 3GYLB 1EJNA 3GY7A 1BH2A 1IQNA 2PX3A 2FFQA 1DX5M 3A7ZA 1EX3A 3QPVA 3CF6R 3HGNA 1A7JA 1EOJA 4XOJA 4DJTA 1E0AA 3ZZ6A 1QGFA 3SV8A 4OKSA 5G41A 1BOQA 1O5BB 1Z2CA 4JLDA 2GVFA 4RZ2A 4BAMB 1U6QA 4Q4HB 4IOMA 3AVTA 1Z3IX 3LGVA 5FUWA 4YZUA 2FS8A 2Q6TA 3TKLA 4S2EA 5JBQA 4DG4A 3IBGA 1HQYE 4Q7YA 4GZLA 3TJNA 4CRAA 4RCZA 3NXSA 2Z6BD 1ZVQA 1LO6A 1OKKD 2P16A 3SYJA 1A61H 2V0BA 1V2VT 3SU8A 1PQ7A 3SGBE 5JRJA 3VB3A 2IYLD 1ELEE 3FVQA 3Q85A 2WJGA 4Y8XA 3RXHA 2GZDA 1GRQA 4B3GA 3VB5A 1YZGA 5EU8A 1VJAU 5LBIA 1PLLA 2PGQB 1VECA 5JEDA 2WJVA 4K46A 3AEZA 3TK9A 4QGGA 4Q01A 2QC2A 3ND8A 4I8LA 1V2JT 3HKIB 4E03A 1CR0A 3B1VA 1OFIA 2G3YA 4GFDA 1SI5H 2BCJQ 3T35A 3VHLB 3GLGB 2QL6A 3OY6U 4XSGA 3RABA 3LC3A 4ZKEA 1FUJA 1E0KA 1NSTA 1P01A 1P11E 4ZHLU 1FIZA 4UONA 4ABIA 4IOLA 4EPWA 2OXCA 1FFHA 4JZEH 3F3YA 3RS4A 4JZIA 4M7GA 1GBIA 5CYPA 3MH4A 4D0NA 4DCNA 3U4QB 4ABJA 2ZI4A 2YVUA 1IXSB 2W3IA 3M0EA 2VIVA 3K0FA 3QBVA 4TSFD 1DO0A 3VR4A 3OEHA 1GVLA 4O9VA 1GMHG 1II9A 5L2YH 1BS1A 2QM8A 1CP2A 3F9FA 4DKXA 1EESA 3P4YA 4BE7B 3S7HB 2FX3A 1QL7A 1G8HA 2IX3A 1UHBA 1G3QA 3ASZA 4D82A 1O3NA 3SHFA 3WXMA 4X0WU 1J99A 4ABYA 3AKYA 5BN3A 4B3XA 1HAVB 2HF9A 5TVKA 4QM6A 3LIWA 3CUEF 1BITA 3V9PA 3OE7D 4A0GA 2ZU6A 3AVXA 3L0IB 1EKBB 3FFGA 1X8LA 2G4UA 1UK2A 1KLJH 3SI4H 3WP1B 2J46A 1ABJH 4JKYA 5K8LA 3IEUA 1Z83A 1SXJA 3E0PB 2J95A 1Z8IB 4X1QU 1N6OA 1OB2A 5EOKA 2A5JA 1W0JA 5AJVB 1KYNA 1DADA 1JR6A 5BQ5A 4DLRA 2F9NA 3BEUA 3FHCB 2BX3A 1OE0A 4FW9A 2VIIA 1BO6A 4LJ4A 3SN6A 1RGQA 4UFEH 1JRTA 2C9CA 3FMPB 1U0HC 1ZHPA 4IOJA 3MU1A 3HWSA 4QRHA 1W0YH 4G5RA 2IHBA 4JLKA 4A8JB 2NQ2C 4DHEA 3QOFA 1PUJA 2OC8A 1K2I1 4PZZA 1TMKA 5JMTA 1FX0B 2BD7A 1TX7A 3I62A 4ISOA 1HA3A 2EYQA 1SR5C 2FEOA 2ZI2H 1HEIA 3PR1A 2WMNB 1M74A 1TGCA 4DLUA 5CJ2A 4AX9H 3TH5A 3LD9A 3MU8A 3VTKA 4AYVB 4LPKA 4Q19A 4AFZA 1A4WH 1OXTA 5H70A 2ECKA 4PPQA 3MO6A 4I7YH 5FPKA 1C2KA 3C4JA 5CB6A 3RXMA 1XMSA 2YNMA 3T12A 1XVMA 1FY1A 2D4HA 4JKIA 2PR3A 1W7XH 1NVVQ 1R7RA 2ODYB 1TGBA 5ESBA 3MH6A 2XITA 5J47A 2QMOA 5EXNA 3TJVA 3EIQA 1THPB 1T4VH 2ONKA 1GHXH 5E4FA 1G4UR 2RHDA 3QLPH 2WJJA 4CRWB 5FPHA 2ZEBA 4JLJA 2BDYA 2IT1A 2XOKA 1GBKA 3K70B 3EQ0H 3HYTA 3E5HA 3ZVBA 1E3MA 1MV5A 2LKDA 3OZXA 2CEAA 2DFLA 5EJEA 1VTKA 2BY8X 1Z29A 1FW6A 3FKSD 1CT4E 1NF3A 2G88A 2FYQA 3R8FA 3BFKA 1II0A 4JYUH 4MQBA 4CEHB 3BTTE 1QBVH 2MSEB 1ZD8A 1ZTJA 1HXEH 3WMEA 2CVHA 1LS6A 3BXZA 3KZ1E 2QUZA 5SZIA 2XZOA 1HNEE 1W2KH 3S1AA 4IFBA 4US2R 1N2CE 1CRPA 2GCNA 3TK1A 3R7WB 4ZPXA 2O8WA 4F38A 1YZTA 5FUXA 4NDZA 4MYHA 5L8VA 4UJ5A 4OQXA 5EE1A 1QL9A 1W8BH 3URDA 4RSPA 4G3XA 4BLQA 1UTOA 2GDJA 3QG1A 1SG8B 1Y3YA 1PUIA 4KTSA 4OJKA 4B3CA 1O5GH 5ESTE 2GAOA 4OS7A 4EKDA 4PAOA 2NO6A 2IN2A 4O2RA 1O2QA 1FQJA 1XUKA 1DS2E 5JRZA 1A5TA 1XFAA 2V55B 3C7KA 3LOXA 1UF9A 2OILA 1XUFA 3OAAD 5DYIA 4RD6A 3E8LA 4B76A 3ZYCA 1C5UA 1HJAB 2Q6DA 4Q03A 4NCYA 5A09A 3GJ4A 2F9PA 2ZGHA 3B5JA 3E0NB 4FCTA 4YDHB 1SGIB 4XTCS 4MYUA 1SKYB 2B7CA 2EVWX 4OHWA 4D25A 1HJAC 4BTTB 5A2MH 4WZBE 1CJUC 1E96A 4Z6AH 2ZU2A 1KI8A 1TQ4A 1W4CA 1O3FA 1NVVR 2YOLA 4NIYA 4PROA 5GCHG 4LPSA 1KO4A 2CLSA 1BZXE 2FE4A 1LVMA 4G01B 3Q9LA 3EC1A 2X2EA 4FMBB 1O2PA 4K5ZA 1Z2AA 2VP6A 5IT5A 2XB2A 4MDFA 2VLIA 4J2YB 1KDOA 4JLBA 1OXXK 1XD2B 2ZHDA 3MMGA 3OESA 1F92A 3I4LA 3U60B 3SC3A 1GZSA 2Z7FE 2F9MA 2WZQA 5DH9A 3CBQA 1Q3XA 2MSCB 5FOWA 1KDQB 1Q22A 5EXLA 2IYVA 3P26A 4C0HA 1SGWA 1J17T 1MMJN 5BPEA 1JJ7A 4OJQA 3NTUA 3RYTC 3B78A 2FSGA 3A1VA 1OH7A 3MYWA 2VHJA 5B57C 1D6JA 3KJHA 2RKOA 2VH5R 4NG9H 3K0EA 2YOGA 4X8UH 1CBUA 3GJXC 1L1GA 4GVUA 3ZZ0A 3PWBA 2W58A 4NTZA 1B23P 3NEJA 4ASUA 2IF2A 3KUDA 2O52A 5JJIA 2KWIA 1G3DA 1EXMA 2JLYA 3SV7A 1O5DH 2FJUA 4W5HA 2ZSFA 3ADDA 3V7TA 3F0TA 2SGPE 3LH1A 1NRPH 4MRVA 1HJ9A 1EX7A 3PV5A 3IITA 1ELOA 3TSWA 5JS7A 3SJZA 3R3GB 1MOZA 4A2QA 3FP6E 2VHQA 3A80A 5JYIA 2OCBA 5P21A 4B71A 1F2TA 3ADCA 3U6BA 3R9IA 1LHGH 1QF9A 1ZBDA 3IUYA 2P8OB 2ULLA 5HYOA 1HAZB 3SQEE 1W48A 1KHTA 3QUMP 4AGJA 3FAOA 4QGAA 1KXDA 3ZH9B 3THYB 4FUIA 1G20E 1ZD9A 5DLQC 1EATA 4FU8A 2BDBA 4LYFA 2QP4A 2QTHA 1US8A 3RXBA 3RXFA 4THNH 2AD1A 1Y3AA 1G8FA 2QXJA 1UTJA 5KDOA 1DWBH 3MU5A 1UFQA 5CE1A 4PAQA 1A46H 1S3GA 1ELCA 2P67A 2QP9X 2FPKA 3IWMA 4ZDKA 2VPPA 1K5DA 2G52A 3D7MA 5C2ZA 5LB2A 2ZDKA 4DWJA 3E16B 3SHAH 3PUXA 1TNDA 3B9QA 4LY6A 2XTNA 4LJ5A 5C1XA 3E70C 5A0FA 2WMOB 4FWTA 3QKSB 4D6PA 1C5QA 5GIBA 3WY8A 2D26C 1GMDF 3ICEA 2YNBA 4GHTA 3WMGA 1S82A 2I4IA 2CJWA 1LPGB 2XNSA 2ZVQX 1IQHA 3UIRA 5E2PA 1S9DA 3F9GA 4QBFA 3EA7A 3FP8E 2QROA 5FOSA 4US0R 2BD2A 3R7WA 4ZIRB 3QXJA 4MA4A 2JJ1A 5HZHA 1C1RA 1NESE 2WV5A 5K8IA 2WWIA 3MI4A 2A2XH 3VU9A 3B13B 4QG7A 4MRNA 4UFGH 2BM2A 1D3DB 1UADA 3RANA 1KGDA 1ZHMA 3N70A 1T91A 1IHUA 4DUGD 2AD5A 2W6ID 3MU0A 3L33A 4AZ2B 1HE1C 4M8NE 1LNZA 4D81A 1B0UA 3EPLA 1QA0A 1O2OA 1K6MA 4EPYA 1Z22A 2ZPSA 1HRTH 1HH4A 5JBCS 3Q3YA 5TARA 4M0LA 3P70B 4WMFA 3JZMA 4W5JA 1E1QD 3KDSE 5BRRE 2ZE7A 2VF8A 1KK3A 4UNQA 5GXPA 5DI9A 2RGCA 4CH8B 1Y5AT 3UR6A 3RXSA 1Y59T 1TYNA 3C8UA 3C27B 3SNHA 1ZM2A 3CRQA 3KKQA 2TRMA 1HV7A 2XCFA 1P2UA 1ZW6A 2AXPA 3F6UH 1E9SA 3BH7A 3AP3A 1DXWA 4MNYA 4BTUB 5BN5A 1UEJA 1TNIA 1YVDA 2OCVB 2Q9AA 1DT2A 4PPGA 2WHXA 4LUCA 1PV4A 1HYQA 4PO1A 1JECA 1XD8A 3U3OA 2ZU3A 1SHYA 4NSYA 4B2BA 3D8BA 5E0JA 5GJBA 4C2UA 1BTPA 4R9UC 5FTJA 3C41J 4TQAA 3LXRA 4JZ1A 1VYTA 4YONB 4YTAA 5GWZA 2ZJBA 2R62A 1GL6A 3U98H 1G21E 2DWQA 3EA0A 1ZSLA 2ZUBA 1QRWA 3V4FA 3BC1A 5E95A 3M3VA 3LRPA 2OLJA 5KNBA 3BH6A 1BUIA 2GXSA 2H92A 3A7YA 1RJXB 1COWD 3RRNA 3NBZC 4EJSA 2IK8A 1Q3HA 4DSTA 2ZO3H 1OWEA 2ZRCA 2J7PA 3ELAH 3DDCA 1SGQE 2VRWA 3X1ZA 2PLXA 3SJ8A 4FIDA 1C2LA 4LZZA 3VFEA 3K9LA 5T6DA 3KJEA 1T5LA 4BLPA 3ECCA 3ZS8A 2BBSA 2BD4A 3SBDA 3C16C 1T8TA 1O5FH 1CLUA 3MAAC 1R5OA 5JBBS 3BEIB 4M9ZA 2Q0HA 2GZHA 5DP8A 3EW9A 5DE3A 4DEYA 1UHBB 1QVRA 4IMZA 3TQCA 3MNCA 1VIYA 4PHHA 3QF7A 1P9UA 4WH6A 1KTVA 3QN7A 3TR5A 2QENA 1BBRE 4RSGA 2GEUA 1PVOA 3I5XA 3RXRA 4KVGA 2H5EA 1XCPA 4IDOA 2BJVA 4L8GA 4YT6H 1P9RA 4WY3A 2LPRA 1EOLA 4MTBA 2BD3A 2QSYA 1OP0A 5CM8B 4ZDJA 1N1LA 1Q21A 1E6CA 1YZNA 4ABDA 4UNSA 1G3RA 3U7FB 4Q9JA 5AUNB 2ZEJA 2GF0A 5KDLA 4BFWA 3A1WA 3T25A 2HGTH 1ZNWA 1ZPCA 3ZZ5A 2GZ8A 1EAIA 3GPLA 4K69A 3THWA 1VR1H 1JAIA 2FA9A 3TRFA 1E1RA 2FU5C 2J0VA 4KP0A 1VZQH 4DVAU 4HAZA 2FV8A 1ZCBA 4CVNA 4I31A 4AWXA 1TPSA 5BN4A 2FI4E 3VR5A 4IRUB 2F1RA 4WMEA 3A7TA 1LDTT 1YPEH 1U8YA 3UWKA 2JLZA 3CRMA 4L15A 1ANBA 2STAE 6CHAC 4I1VA 1UBFA 2QYIA 1O2HA 1NG1A 3MH5A 1YR8A 3NH6A 1BRBE 4X2XA 3M5OA 4M53A 1XM1A 4BANB 2H18A 5LGOA 2ERYA 4IEIA 3CWZA 4CF7A 3DOFA 3ZVMA 1ELBA 3H0KA 5AFZH 1TUIA 3AAUA 1E4YA 3A8BA 3PFIA 5FR2A 5KUTA 3EA9A 1VHLA 6ESTA 4LOAA 3RUOA 1NFWA 1AA9A 1JNYA 3IO5A 2P2LA 1J15A 4LZ1H 1OWKA 1FN8A 4DXAA 2DR3A 2NZ8A 1RFNA 4DURA 3UG7A 5BWMA 4JZDH 1BJUA 4DT1B 1S1MA 4JIMA 1SLXB 1TU4A 4EUNA 1ZUNB 4Y76A 2J0UA 4GPTA 3NUMA 4NH0A 1P2JA 1SHHB 2BDAA 1D8TA 2QORA 2XBVA 2JLWA 3SU6A 2ASUB 3NXPA 1RJ9B 2W2TA 1AQ7A 2VGCB 4CREA 4AKIA 2ZAOA 1Q31A 4ISLA 4HZUB 2O8TA 3B1XA 4ESTE 1XMJA 2OTVA 5EE3A 5D3MB 4Q7ZA 1CHOG 3SE0A 2OO7A 3BTQE 2BMDA 4YLGA 1D4PB 4ABBA 4GCHG 2XWAA 1SGNE 4JZKA 2IUUA 5G4BA 4MGIR 4MUBA 1TEVA 5LD2B 1QRZA 4B3BA 3KFVA 4M1OA 2EQBA 2YOHA 1UVOA 2CCJA 2EWVA 5EP2A 2KE5A 4B35A 2OC0A 2AK3A 4DSOA 1CTQA 2W7UA 3AP2A 4ZHMU 2JGNA 2R0LA 3S69A 1NMZA 2PKAB 1UVTH 3KQKA 2V1XA 1Z0KA 2ORWA 4Q66C 4GOKA 3TUJC 3UWJH 3AGPA 4A8JC 1G17A 2XC5A 3HDTA 1G41A 4EPRA 1P02A 2ATXA 4KFSA 1GI8B 1PPEE 1E2FA 2CLDX 4TWZA 5FTNA 4PO9A 5LPNA 5FI1B 1C5RA 5FL7A 4KFRA 1L7VC 4QBHA 1N5JA 3LBHA 5J4LA 2JLUA 3RLYH 4QGHA 1KI1A 4ON9A 1KK0A 3P17H 2XJ4A 1HQCA 3F1SB 1HJ8A 2ZUCA 4NGAH 2IJOB 5BXQC 1TFXA 1UTLM 2OXRA 4FXPA 5IF9A 3E90B 2ZDLA 4N1AA 3KUCA 4XWAA 3GCHB 1YPHE 4CR9A 3GDUA 3PMAB 2CCGA 3T29A 3RXVA 4KJZA 5BYJA 2VVCA 1Q44A 1FP7A 3WNBA 3W8NA 3TAHA 3A85A 3MD0A 1G9IE 2BDHA 2CXXA 1N6KA 1GBFA 3QI2A 2BLQA 5F8TA 1WQVH 1T3HA 5F6MA 3THWB 1OYTH 1BYIA 2FOGA 1SHZA 3CM0A 3P27A 2BOVA 4P32A 3ATKA 2J7PD 5KSOA 1SVWA 2GZ7A 4Y10E 4X2WA 2FMJA 3GDSA 1T8UA 4B3FX 4OS6A 1W10U 1S0UA 3X1YA 3IIMA 4TL9A 4DSUA 1XU4A 1KI6B 4AGKA 5G3ZA 4YOGA 3UQOA 4AKHA 1L4DA 5JDUB 3RU4E 1QHIA 3SGQE 2B92A 2ZRFA 5HZKA 3PROA 1Z6YA 3O8RA 4IFEA 1W49A 4B1TA 1P75A 1YE8A 3SGAE 3ASYA 2UKDA 1HAVA 2ZG0H 1M9UA 2VIPA 5B6LA 1R0YA 3A4NA 2QBYA 4OS1A 2O8FA 4OHYA 3U3JA 3IEVA 4LBWA 4FMCF 2HV8A 2XBYA 5FTLA 1YM0A 2OAQ1 1RTLA 3E1SA 1L4UA 1X7AC 3QZQA 1IOZA 5B2ZA 1Y8TA 1IQMA 3K6ZA 1EJMA 4B2CA 2ZSAA 2ANWA 1XTIA 2A5AA 1O35A 1GHBG 3U8OH 3GISB 4LZ4B 3TSOA 3OX7U 1QBNA 3NBFA 4R7ZA 1F0TA 2ZYTX 1PPCE 2GMTC 3RXEA 4X6NA 3P4XA 1DS6A 1ZUIA 1DFPA 3AW0A 1Q12A 5AFYH 5EG4A 3TGJE 2JA1A 2N1BA 1V2LT 2UUJB 3CS0A 1NROH 1KSJA 2G83A 4MGYR 2FP7B 3S9AA 1FTSA 1QFKH 1LTQA 3M6AA 1XJ0A 2PWXA 3GFPA 1GI7B 4KFUA 1R2QA 1MCVA 1C1OA 1E36B 3BH0A 3E1XB 2ZI9A 5IRCD 3Q77A 1G7SA 1GWNA 4DCVA 1TQ2A 1GI2A 1ZCAA 5L3SB 4TT3D 4JYTA 2C5LA 2ZETA 1W5TA 4UD9H 3GLFA 3W6OA 4RFSA 3ZVEA 1ZTKA 4Y71A 1A1RA 1TPOA 1C1YA 4CEJB 5HM9A 1RYFA 3ZS9A 2VB0A 2BLVA 8LPRA 2EWWA 1T0HB 2IC5A 4POAA 1C5VA 1I4LD 3LJOA 3SYKA 3K0AB 4XE4A 4FUBA 5H8WA 1UDWA 3E91A 4B2IA 5LDDC 3WYAA 1O3YA 4NSVA 4KLZA 4LYAA 2WAXA 3GLGA 5T3HA 3EX7C 2XNDA 1AB9B 1HLTH 4HLUA 1PYTC 3OTPA 1ELVA 4DLYA 3TBKA 3SU0A 4HAUA 4MRPA 1P57B 2WPDA 2V6JA 3RRYA 3GP8A 3OFND 2HVXA 4XD7A 3VB7A 2JLRA 7ESTE 2ZJZA 3RC3A 3LQRA 3W8RA 3VXFH 3IIKA 4M1SA 1G1MA 1GBEA 1GMCF 5EQTA 1T5IA 4HDQB 2P8OC 2NIPA 1RRKA 2B8TA 2J9NA 1XKBC 3PCRB 3T1OA 4D26A 1VITF 3ZZ7A 2PMKA 1CGIE 1WBGB 4JBWA 3SI3H 4Q4LA 3LWNA 2OE2A 1CJTC 4TY6A 3W34A 2ZRMA 1KJYA 1AZ8A 1U98A 5J4VA 4XDEA 4K81B 2CDNA 2ZRGA 1AGRA 221PA 4EFMA 2JH5D 1VGCB 1J8AA 3ZYEA 1XUIA 2BLWA 1JMOH 2A5FA 3ZIAD 5HR5A 5EE0A 1MKWH 1UM8A 2G5VA 3EARA 2H17A 2NWNA 2CXVA 1G5PA 1GRNA 2Z0MA 4CEIB 2AFQB 3HR8A 4MYTA 1G8PA 2W0SA 3MJRA 3SOPA 3CW2A 2D3WA 3SEAA 1GVZA 5GDSH 2V3HH 4B48A 2QN5T 5C20A 1XXFA 2IYYA 4AKEA 7LPRA 3VGCC 1D2NA 1GL1A 2VYFA 1VITG 4FVBA 3SJBA 2R6AA 2XYAA 4PO8A 5A0BA 4ZKNU 4I99A 2B7DH 4JK6A 5CLLA 1THRH 1ESTA 2RGEA 3NC0C 1MO5A 1GFIA 1W3CA 3BB3A 4LYJA 1WRBA 3VR3A 3BFVA 2H6MA 2OEPA 1ZM4A 4P0TA 4IGDA 3BBPA 3BTWE 2A7QA 4LHYA 4GZMA 5TXGA 5AUPB 1HUTH 3DO6A 1TF7A 1M7BA 4A92A 3QVUA 1N6PA 4DLSA 4Q7LA 4D76A 3MTYA 3SNCA 2AKAB 1UCYK 4KSCA 1YKTA 4HB0A 4BEBA 2ZIAA 4D4JA 1LHDH 3CLVA 4UXIA 3EZFA 1HB0B 5GCHF 1XTJA 4NYJQ 3ITIA 1C5MD 1AUTC 4F91B 3GLIA 3VR2A 3BB1A 1GWAA 1BCUH 4JSYA 1LV7A 1KIGH 1MTUA 3QKRA 4Q9KA 2V9PA 1OSNA 2W2XA 4DW2U 2D8WA 4RFSB 1E2JA 4K1TA 2M5TA 2OFWA 1JEDA 4F4CA 3TK5A 2QIQA 2RGGA 3RXQA 1P2QA 1T4UH 1U0JA 1SGYE 4L16A 1MH1A 2F43B 3EZ6A 2BMJA 4K1EA 5CYOA 4YXWD 1JR3A 3GICB 7GCHF 5FUVA 5HPYB 5JJKA 1KXFA 4NZLA 2XNIA 4PX9A 5B58C 3NHAA 2Y81A 1ZMJA 1YLDA 3DM5A 1YQTA 3AVYA 4IVRA 5EQSA 1IQLA 3W6PA 1E35B 3A8AA 4FUDA 2KB0A 1HDTH 3HJNA 3E6PH 4EIWA 3DMNA 3R9WA 2R2AA 1AZSC 2OFXA 1CA0C 1XXHE 2C95A 1KOFA 2J0SA 4YT7H 1EWQA 1YBWA 1WTHD 3UNSA 2B5TB 1U99A 1FONA 1UAAA 1Z07A 4B74A 1Z47A 1OIXA 2IXGA 4W9MC 3ATWA 5H1YA 3R9XA 3H7OA 2GJSA 4DCUA 1AKSB 1ZRKA 1E94E 1XUHA 5D3QA 1VKJA 3ZVRA 1E69A 2SGFE 3A7WA 3I78A 3GEEA 4BAOB 3HKJB 1YZKA 1CA8B 1SKQA 5GJWC 4Q00A 1O2LA 4Q1BA 1D3QB 2GJKA 2IYTA 5C2JB 1HAXB 1W7AA 1CULC 1GCTB 4CRGA 1DAMA 1CF4A 1X8KA 5DO9A 4INLA 1G291 3DT0H 3PUYA 4G5GA 1N0VC 4QKQA 5KO2A 4A15A 1XXHA 1WDTA 4DB4A 1E2EA 3EAJA 3IBYA 1SGEE 1C9TA 4TLCA 4RD3A 3OEEA 2O8UA 5CHAB 4BXSA 2DUCA 1TAWA 1AGPA 5HGGA 2QPOA 2LKCA 4US1R 1MTVA 1NY5A 2Q1JA 2QNRA 1L2EA 4GI7A 4WWYA 2DWOA 4Q4JB 5J5CA 4KITB 3QZRA 1FV9A 5FR1A 5HCIA 3KQEA 3I77A 121PA 3HU3A 2A0QB 4BZXA 1C5PA 3AGQA 3CPEA 1QURH 4F4JA 3B82A 1RJ9A 3A8DA 4WAUA 2AN9A 4QJ5A 4ZV4A 2Z9LA 3SU5A 4ZAEA 3CRRA 4Q1AA 1WSSH 6LPRA 5JS8A 3EYDA 3T27A 1GTVA 5CDFE 2PKSC 1MKWK 1Z6AA 2J59A 4AN7A 5TV2A 5F3WB 2C2HA 4ZHAA 2ZRAA 5F2EA 3SBKA 3SJKA 1W36D 1SB1H 4PPNA 1ONBA 3U6KA 1VITH 2JJ1D 1EG7A 1Z8JB 3CKLA 1C2MA 3X1DA 2Y7ZA 4PQRA 3MHWU 4ZXYH 1NU7B 3U1JB 2RH5A 1HPGA 1OXSC 4MYCA 1QB1A 2BDCA 3HPRA 2ZRNA 2AFIE 1XEWY 3QTOH 2ALVA 3TJZA 5TY0A 3BEFB 2ZITA 4PHTA 4PXAA 3A6PC 3HPQA 3ODFA 1LVGA 1ZPBA 3GCNA 2AL7A 4IN1A 2OV2A 2ZJ8A 2G51A 5L30H 4XFQA 1CHOF 2AMPA 3M35A 1P06A 3TITA 1Z71A 4MPWA 3HR7A 1EFCA 4JLMA 2G8TA 1ZC4A 5ANRB 1Q20A 1UPTA 2WVJA 3FGNA 2ZDNA 4D4MA 2H16A 4Q9LA 2IXEA 3TAUA 4UNNA 1UVSH 2BOHB 2HJVA 3CIOA 1FAKH 3DL0A 4KKDA 1US8B 3P8OA 4UDWH 4TY7A 1GKIA 1G8YA 1Q57A 1ZGVA 1H9IE 2TGTA 5AUQA 3EDXB 3OHMA 2WWHA 2P6UA 3SYLA 3GJ3A 4M1WA 5DPAA 1O31A 3AF1A 3U5ZB 2O8BB 4Q1EA 1W0ZU 3QXCA 4Q4JA 3BG4B 1NLZA 3SJAA 1D9XA 2QT0A 1Z8RA 1ESBA 1OSSA 1KMHA 3QKSA 4JYCA 4TL6A 3VPKA 5DNYB 3DKVA 2A45B 4Q2KA 3ZVDA 1JXMA 1W0KD 1DTSA 1C1TA 1SVMA 1D2EA 4D0LB 2OLGA 1F2SE 1YPHC 1SMFE 2GHIA 3F8TA 5KHOC 3OIUA 1G37A 5J4QA 3VHXA 5FBWB 2UUFB 2P0EA 2ZPQA 3ZYDA 4PC2A 1WV7H 3GY8A 2P95A 2BHGA 1XEXB 3QXXA 3MGCA 3WNDA 1QBKC 2A78A 3WMFA 1GDUA 2BQ6B 3JVVA 4MPXA 5LD2C 1AS3A 5FCKA 4C0QC 3PG5A 2OC1A 4RZUA 1O36A 2LCFA 2UWLA 1FPHH 1GKUB 4GOJA 4OS2A 1XEFA 2ZTXA 1ZIOA 3EWAA 4BPBA 2UUKB 2XXLA 6GCHF 2J7KA 3RXLA 4CT4B 4O2LA 4GSYA 1NM6A 1W5SA 2AXNA 1MO4A 1AQYA 1ACBE 1TL7C 3FKSA 2PTNA 1H65A 4F7WA 4TYYA 3CENA 1GJ7B 2ZFQH 1ZP6A 4JSTA 3ZD6A 3I5YA 1QIXB 3STJA 5E7JA 1SLWB 4QXAA 4GDFA 4NFEA 2J0QA 1QTFA 4M9SA 1PPHE 1YZUA 2HXSA 4L9WA 3QWCH 4D2IA 2RCEA 1CHGA 3VEQB 2FZLA 2QA5A 3UQVA 1X6VA 1FLEE 2G4TA 2ZCHP 5DJ7A 4KLNA 5DHAA 2CMKA 4TTQA 1DPFA 1GJ5H 4R2HA 1Z0FA 4LCBA 2G77B 2F3RA
chains in the Genus database with same CATH superfamily
1G6KA 3T4PA 3BV9B 2X2PA 4FUFA 1LHFH 4B8WA 4JJGA 1KEPA 5C1YA 1HYLA 4BKOA 3S2UA 4ZEOA 4IIEA 1TQHA 4RMGA 1NPMA 5IJ0A 1ENPA 5GV7A 2P77A 1QJ7B 4FYXA 3CCCA 4E1AA 3C15C 4ZVPA 1LVOA 2ZGBH 4D7FA 4MV1A 4ESOA 4AT1A 4P93A 2ZTHA 5BUQA 1ZYOA 2XA9A 1RTFB 2AZXA 1M1NA 1QH0A 4G56A 4OL9A 3GRZA 2JCGA 2X7JA 1LHCH 2SNIE 1NW5A 1X3LA 3ZCPA 1GMCG 5E8EH 3L8HA 5AVRA 3TGPA 1TGTA 1YKFA 3F96A 4N0QA 3HA7A 3TU7H 4RXTA 5IDWA 1RIWC 2IZ0A 3U3MA 1XLWA 2BLLA 1U7XA 1SBZA 1REQA 2GEFA 2QLBA 3NT5A 4KQWA 2ZUTA 1XKXA 3WNZA 4FUCA 3LJJA 1UODA 3D62A 2P69A 4Q19A 3HFSA 1IY1A 2BFEB 3O03A 5A2GA 3HKCB 5DVZA 4MKXA 5L7YA 1XZLA 2GNOA 2H5IA 1Z0IA 1HAYB 2O7VA 5J4SA 2HHAA 2CMGA 3AEXA 3KEEA 1C3EA 1R27A 1C2IA 5GNDA 2OPBA 4TWJA 4WADA 3A10A 1X87A 2Z3WA 3GA7A 2H9TH 2OUIA 4PVDA 1R6XA 1V6SA 4L8YA 5HKKD 4OHKA 4CKWB 5DP4A 2ZK7A 1RKVA 3TPFA 5KYNA 5LZ2A 3DKKA 2QK4A 4H6WA 1WETA 1QQTA 5GJVC 1YWUA 3TLGA 3LKWA 3H5LA 3CZAA 5HCUA 2OXSA 5TDHA 3WK9A 1TE0A 4BGEA 3VR0A 4F9GA 1SXQA 2XCNA 3SDZA 5C3NA 1VRCA 4CV0A 3SQWA 4A10A 2CGEA 3L82B 1O3JA 2V8BA 3QMWA 1LFDB 4JXKA 4FGUA 4YOIA 2JJYA 3FKQA 1ZNZA 4PVCA 1OWPA 1FSSA 1GI3A 3FE2A 3N2KB 2VNAA 4PX2A 2LCQA 3TNSA 4F4UA 2GR9A 1L5VA 1DLJA 4LGVA 3UFBA 1SB9A 1L7MA 1SVOA 3VISA 3V4LA 4YRIA 1Y5BT 3A86A 1GCIA 1P3DA 2Y0EA 3AK5A 5FTMA 3T1QA 5ICCA 3A1DA 1U9JA 1YRAA 3ZTWA 1X15A 4AFQA 3BTEE 3E15A 5ESRA 4EYSA 3Q3IA 2ZUDA 2UWOA 4MW4A 3SCZA 4YRKA 5KNDA 1ZCJA 2F8MA 1KSNA 1JEEA 1SOWA 1W5AA 1Y4DE 1UMDA 2ODBA 1QA7A 3OZUA 3QPWA 4A5TS 2QF3A 1ZL0A 4ALKA 1V1RA 3LX6A 4WLVA 4N9QA 4WXYB 2KAIA 4ABGA 2AE2A 1XZCA 3GOQA 4UHCA 3HUDA 4WJG2 3DM9B 1XRRA 4ZHSA 3D9QX 2ZCUA 1KAOA 3WZMA 4NCKA 4C5AA 3C48A 3SM3A 5C37A 4GSLA 2IU6A 3UJPA 2EP8A 4M8LA 1DHRA 3MUFA 4PE5B 3PQDA 5C81A 1NW7A 4FYHA 4LAFA 4GGOA 3RFTA 5ADUS 1FXUA 3A9SA 3HNRA 3HVHA 2TBSA 4URVR 1P0QA 2IL1A 5ECDA 4Q1DA 3CEMA 4XYEA 4NYMR 3HP1A 4PQEA 5BNIA 5DN9A 5CNMA 2QN6A 4MOWA 2AZTA 4TWAA 4TLEA 4ZI5A 5JW6A 1E0JA 5GPIB 3RLIA 1NKVA 4D9KA 4GCHF 4TKVB 4IDQA 1LJUA 3DBHB 4FNOA 4F12A 3VR1A 4N9WA 2W7SA 1Z28A 4V0LA 2IZ5A 2GYUA 2ZDHA 3K8OE 2PT7A 4DJJA 1XQVA 1PT8A 4BE9A 1FSGA 1XROA 1XEAA 1EFPB 2BFCB 3ZD7A 3MWFA 1XMXA 5JB9S 1S4MA 3C6QA 5DK6A 1ZMXA 1MUEB 4YPOA 3IPXA 1V8OA 1DJQA 4JITA 3WL3A 1XBTA 2J3IA 5L40A 3WFZA 3EGDA