4B71A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
645
structure length
645
Chain Sequence
b'GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 197
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b71A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b71A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b71A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b71A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b71A03
3NBXX 3MO6A 2F9VA 4BXWA 1R0XA 3I3SR 1ZOMA 4AG6A 5CMXH 1QBKC 2Z9GA 2OSBA 4M9QA 3E1SA 1FAXA 2GD4B 1TEXA 3QXHA 3PUYA 2BBWA 4TZ0A 4H6SB 5BXQC 1IJEA 2AGEX 5CJ2A 2OCBA 2ZETA 4MUBA 2WPKS 2QG6A 2ZHQH 3M61U 4OS6A 5IYTA 2ZHWH 1DUAA 5BN3A 5CJPA 5FFMA 1M7BA 1C1TA 5L6NH 1N6HA 3RRZA 1Z08A 1P11E 2WWIA 2BD8A 2BZ6H 1N6LA 2ZU3A 2NU2E 4AZ2B 1M9UA 4JK5A 4HB2A 1HDTH 1C4U2 3CPHA 4I7YH 3ZVGA 3F8TA 1S3SA 4FCVA 4EPXA 3AK5A 2ZI5A 2G88A 1AGJA 2ODPA 4A0RA 1NSTA 3U7GA 1CHOF 2ASEA 1EASA 1GL0E 4MUAA 4Q7MB 3NZIA 1E2FA 3KKOA 4YMSA 1O2XA 5AFYH 5HXFA 2Q3MA 1KDQA 1FPCH 2CK3D 1D6JA 1NLFA 1NN3A 2OP9A 1TPOA 3PUXA 1BJVA 4V0ME 1U99A 4PO8A 1C5ZB 1OYTH 3KQUA 3W8NA 2OCAA 1P2KA 1G291 2XNIA 4ILEA 5EE3A 2ZYVX 2W6ID 4ZKEA 2G5NA 3BIVH 4K3JA 3LU9B 2VHQA 4B2PA 4Y8ZA 1VG1A 4IFEA 5T6FA 1AD8H 4RD6A 2JLWA 4NYMR 4D0GA 1E1RD 1T5LA 3IGFA 2FPLA 1XM1A 1BOQA 3VB5A 2C3SA 1GHWH 2XWBI 1GNRA 3BAFA 4DLUA 3TSOA 2F9OA 5L3SA 1KSFX 1Y3VA 3GEEA 4FXPA 4A36A 4DCVA 3B23B 2HJGA 2PGQB 8KME2 4NIYA 1P2QA 4JLMA 3STIA 1TRNA 3TR5A 3FE2A 4I1SA 2QAAA 1GDNA 2QT1A 2OEPA 2GZAA 2IC5A 4A7IB 3AP1A 3IO5A 2GZ8A 3GLFE 4HAWA 4NIVA 3F3YA 2QBYB 3M0EA 2ZGBH 3I29A 4Z6AH 3BK7A 2CHQA 1A1VA 1GAJA 1G8HA 4IMQA 2O8UA 4JS0A 1E69A 3BBPA 1PPCE 1FQKA 3B7GA 2CV3A 2YWEA 4I4LA 1L4DA 2DB3A 2QPAA 2IXFA 2WICA 1XTQA 4HAUA 1ANEA 4ZIRA 3FHTA 2FJUA 4CH8B 2ZQ2A 5J4HA 2PH1A 4LJYA 2FOFA 4UFDH 3C16C 2ZI7A 2R3YA 1XBTA 1QHXA 1OJLA 1Y59T 4ERNA 1C4V2 2FOAA 4CRFA 1Q3TA 2WPJS 1O39A 3H7TA 1GHVH 2BD5A 3K9HA 4AN7A 4EPVA 4CR9A 1NVUQ 4B2AA 1Z83A 3EASA 1UTJA 5KPDA 2IUSA 2RA0A 1T8UA 3P26A 1XEWX 1E2KA 1JIRA 3KN2A 3PTBA 1ORFA 2PEYA 1VJAU 5CM9C 3ZZAA 4HLDA 1GNQA 4CEJB 1GJ5H 2EYQA 4QNRA 3VGCC 3FVQA 1G3MA 1O36A 4OS5A 3B82A 3VR4A 4AX9H 5FPTA 3V3MA 4K1EA 1O3NA 1BYIA 2ZRHA 3K0CA 1AKYA 1CBUA 3C4JA 1V2LT 4LSGA 4NCIA 5JEEA 2J9RA 4UE7H 4D26A 3P8OA 1C2HA 1I4TD 4DB4A 1C2DA 1ZMLA 3TR0A 2R6CA 1MO5A 4QBHA 4TYWA 2C78A 2F9BH 2ODQA 2Q6GA 3QPWA 3VEQB 3U44A 1NVVQ 2H9TH 1Z06A 3A8CA 3VU9A 4A0HA 3GLGE 1YC0A 3Q3KA 1O2MA 2ANWA 2HLDA 3VX3A 2XC4A 4DLTA 4DLSA 3LPRA 1E2MA 1DY8A 1G9XA 1W0YH 3STJA 3EGKH 4M8NE 1U6QA 2V0BA 3SUDA 1Z0IA 4IDQA 3MH6A 1GVNB 4DRZA 1TF2A 2QRZA 4TL8A 1MUEB 1WSSH 1N6IA 1NMXA 4AYWA 3RMNH 2NO0A 1IXZA 3ZIAD 1X86B 3GDUA 4FMBB 1GI6A 2V3OH 4MKIA 4J1YA 2Z9JA 2VNTA 1QY6A 2EFHB 1AK2A 2GEVA 5CIQA 2O0KA 5HMAA 1B5GH 3UIRA 4Y8YA 4PQRA 2D8WA 2ZSFA 4CRGA 2RGEA 2R8RA 1EAUA 3IIKA 3PEVA 3UWIA 1FMJA 1N6NA 4MITA 1KY9A 4JKYA 4YMWA 4HI3A 3SU8A 2FX4A 1OB5A 1GHYH 4YC7A 2P94A 3GQBA 3WYAA 4CT5A 1QCPA 2VYFA 1NZQH 1FTNA 1AWHB 1IQLA 4JYCA 4LYFA 3GISB 4FUIA 5EE5B 2IEYA 1FY5A 3EPKA 2B9LA 3T1TA 3GCHB 1QHGA 2LCFA 2K1QA 1TF7A 2VL7A 4M2LA 4VGCC 3CP7A 1XEXA 1K1NA 2P6RA 4HZUB 2YHSA 4GHQA 1VJ9U 2UUKB 3Q00A 3B6EA 2PSXA 2AN9A 1F2TA 1IQKA 1KI6B 3LV8A 1Q20A 1TE0A 4IGDA 3LD9A 3O47A 1FW6A 4EQ6A 3A87A 4X2XA 5JS8A 4YMUA 3L3TA 1FZQA 2R2AA 3E0PB 4AFSA 2STAE 3U1JB 4D8NA 5KSOA 4NWLA 4TLEA 1P2JA 2VTKA 4MPXA 3U6BA 3SJCA 5JHGB 1VYTA 5K7RA 1O2YA 1G4AE 4RKFA 2RCEA 2ZU2A 4HZIA 4KFTA 1G7SA 1JQLB 3ZYDA 1IY2A 5EXNA 4CRAA 5I25A 4GI7A 4B76A 3AQ4A 4A2WA 3U61B 3EA0A 5G4BA 2X2FA 1EK0A 2A78A 3I78A 1VR1H 1AS2A 4K1TA 1HJAC 1UVUH 1E2GA 1N5KA 3SZNA 1K9OE 4TN1A 4HB0A 1WTGH 4JL8A 1RC8A 4B33A 1HAPH 1R5OA 4WZAE 2GJAA 1UTOA 1IY0A 3A81A 2UZIR 1S82A 1J70A 3R9WA 4FUHA 1OWEA 3AKDA 3MG9A 4AKIA 1WAYB 1K5GA 3MWIU 3LX8A 3SOPA 1LFDB 4JL5A 1R0ZA 1KIMA 1LO6A 2GZHA 1YR8A 3EPLA 4KVGA 2ZDLA 4BWYA 1AZZA 3GY8A 4UFFH 2FI4E 4V0MA 1DUEA 7GCHF 5JB9S 2YKGA 5TJXA 2OESA 1KLTA 2UZ3A 4BAKB 1V2VT 1YZLA 5H68A 3NEJA 2FFHA 3OF5A 3R7WA 3W6OA 1Z2CA 1WOFA 5K8LA 2ERXA 4ARZB 1NMYA 4MNVA 1O2RA 3AVUA 3SBDA 3PJRA 1LKBA 4YZUA 1N0UA 4GBMA 4GZMA 1PPGE 1DAEA 3H2YA 4EIWA 2OZEA 1HURA 1N6OA 3BV9B 4FU9A 4PTLA 5TB5A 3ZVRA 1AQ7A 3OEHA 2FO9A 2BJVA 1KO7A 4XH9B 4D0LB 4XDEA 2SNWA 3KKQA 2FGKA 4BFXA 2RGXA 4MGIR 4FVDA 1TAGA 3RS0A 1RIWC 1GDDA 1NP6A 2PL3A 3ND9A 3H4MA 4WIAA 4B6FA 1SOZA 3OY6U 1KI9A 4QJ4A 4IC5A 2VHCA 1FNIA 1E9AA 3GLFA 4ZCMA 1O3PB 3W95A 2VP0A 4WAUA 2BVXH 4LJ4A 1G1MA 3CPJB 1O2HA 3NIBA 5FHTA 4N1AA 2WBLC 3MHWU 1E2DA 2V35A 1WBBA 4JYTA 1MTNB 1TNGA 3T1OA 1BBRE 3A4LA 4MKFA 5F3WB 2CHVA 1O2NA 1GI7B 1M2OB 2H17A 2OXCA 1II8B 2A4RA 2D26C 4Q4AA 3TE6A 3REFA 3U5ZB 1KSJA 3SORA 4BFVA 4CRBA 2ZPTX 4UNQA 4AIIA 4F49A 7LPRA 2A5JA 5EXLA 5K8UA 1GVLA 2ZSBA 3K0FA 1J8AA 4EJSA 1D3TB 4TTRA 5LDDC 2FGJA 4A0FA 2OC7A 1OV4A 1KXDA 1HAIH 4UNPA 2ZXUA 4BFUA 1M7HA 3NC0C 2QF0A 1BRAA 1JR3D 4DUGA 2OCPA 2OC1A 1ZTLA 1WQSA 1ONBA 2RAPA 4KTCA 3MI4A 1AQYA 2YOHA 1T4VH 3HGPA 2J92A 2XXAA 5A5GA 3RLWH 4LOAA 1GBJA 4WXRA 1NFYA 1TUEA 1V2TT 3E3TA 1MABA 1C1NA 4B2CA 1TPPA 5JSZB 1P0SH 3X1YA 1XKBC 3LA6A 8GCHG 3OFNA 4V02A 1EESA 1L4ZA 3WMGA 3OEEA 2IYYA 4RFVA 1F2UB 4NPHA 2HNTF 1C1UH 3ZJYA 4Z0KA 2ZVPX 3EXAA 3LQRA 2IYZA 3RU4D 3UNSA 2ZP0H 1G3BA 1O38A 4O9VA 2ZU1A 2J0UB 1SGQE 2XBWA 1KY2A 4IN1A 1P03A 1RKBA 4MPWA 2NOAA 2VWNA 2N46A 1FAKH 4FUGA 4WMFA 3ZV8A 1O2LA 1EZXC 2B7BA 4ABIA 4DLYA 1ELTA 3RNLA 5DHAA 1AGRA 3LGWA 2JLUA 2FZ4A 3IKJA 1DAMA 4TT3D 2AX4A 3GLGA 1JQJC 5DN6D 1Q12A 4NG9H 5AR1A 5DGXA 1KI1A 3QKRB 2ZI2H 3T28A 5T6DA 4B34A 1ELVA 4LZ4B 3A86A 2OXSA 4PHHA 3R8CA 4YDSA 1G18A 3GCNA 2ZAMA 1W0JA 1C1QA 1Z22A 1T8OA 1N25A 2GMTB 1V2OT 2ZDMA 2ZRBA 4P4SA 1OIWA 4JZKA 2ZI6A 3F68H 4O3MA 4X1SU 1QRWA 1KLJH 3DMDA 2Q3FA 4Q7KA 3M1IA 4LHVA 4WWYA 4ESTE 1DEKA 5GDSH 1PLLA 4W5JA 4HTCH 4W9MC 1E2EA 4JZIA 2BWJA 1RD3B 1P2VA 1CR2A 1MTSA 1KI8A 1OIXA 1NKTA 1ZJDA 1IBRA 2GBLA 4CEIA 2WKQA 2GCTB 5HTKA 5FXLA 3SS8A 3ZZ4A 1E2JA 2CCJA 2QNRA 1KNQA 3RHFA 4RFSB 4LBZA 4GDFA 2IS6A 3AVVA 1LCYA 4POAA 3ECCA 2OLJA 1V2MT 1J9CH 1PV4A 4IOKA 1THSH 3SJOA 2F55A 2F3CE 3KKMA 3M5LA 1E9SA 3CRVA 1F5LA 1YE8A 5FTKA 2FMJA 4XWAA 4X8LA 3EAJA 3CF2A 3BEIB 4CEHB 4K81B 2RGBA 2E1RA 3SJ9A 1AKEA 3QIAA 2ODNA 3LBIA 3THWB 3CX8A 3DFLA 1HRTH 3OIUA 3OIWA 5FTLA 1RW4A 2OQ5A 4RY2A 2JLQA 4THNH 1A82A 5DLQC 4JIMA 1E36B 1W11U 1XCGB 3BFXA 5LGOA 2OCYC 1US8B 1G5TA 4CZ2A 1TQDA 2XJ4A 8OHMA 4ABDA 1SQ5A 1R0YA 3MLEA 3U7EB 4NCJA 4OQMA 2Z0MA 1AKSA 1QRZA 5B6LA 4Y10E 3B1XA 1G6OA 1DXWA 1UCYK 4BAOB 1N0WA 1EXFA 1PQ8A 2ZPRA 4Q18A 5DP6A 3GLIB 5FPKA 1NF3A 4A1XA 3AAVA 3LT3A 1XMVA 5G3ZA 1S5SA 2P3TB 1FQJA 2BY9X 4UEHH 2NG1A 4O97A 1P5ZB 1SLWB 1P01A 3RXLA 1LS6A 5HKKD 1BBRH 3TGIE 2OT3B 2B92A 2PZGA 3SI3H 2AEIH 1SGIB 3P70B 1YCPK 4QM7A 5F03A 8GCHF 3TH3H 3B60A 2ZRMA 4X2VA 3ICQB 3ODDA 1D3DB 2H5EA 1WBDA 4HI0E 3DMNA 5EXMA 1RRGA 3ZVEA 1ZIOA 1N1LA 3SU1A 5BW8A 1QHYA 2EFDB 1CXZA 1MTUA 4DDTA 1AFQB 3B1ZA 3OAAD 1OWDA 1Q1BA 3ETLA 4PC3A 3QX5H 2GGVB 2ZCLP 1JALA 3RXVA 1CS4C 2LPRA 4P4TA 1BT7A 1G37A 1IY1A 2XBXA 4LPKA 1HAVB 3VXFH 2WWXA 3TVJB 4XVRA 2NGRA 4OI2A 2FOCA 3SO3A 3AUYA 1NIJA 2JLRA 1P9SA 2GK6A 4ZI3A 3RM2H 1EX3A 4Z51A 1K2I1 2ZFPH 5DYGA 5HM9A 2CHAC 5DH9A 2J95A 5DISB 4NFEA 1XX9A 3BEFB 4IDHA 4FWTA 3WXMA 3M7QA 1C1MA 1FLEE 3K0CC 4AKHA 5GCHG 2BY6X 3VXEH 5E7JA 2F9UA 3SE0A 4Z1MA 5AJZA 2RA3A 2DFLA 4X8TH 4BECA 5K0HA 4HGCA 5E95A 2G5VA 1GGDB 3I8SA 1MCVA 3JZAA 4JBYA 1UHBA 1LNZA 4GT1A 2H92A 3QZQA 4WZBE 1RVDA 1G3CA 2A5GA 5HZHA 2HWLB 4NYMQ 1SSXA 2WSSA 1LHEH 1TPAE 2EC9H 2GJ8A 3K2UA 2PZEA 1W12U 2FP7B 2ZQ5A 2D2EA 2FE4A 3ZVDA 1GBBA 2OAQ1 2BB4A 2AMQA 4C4PA 1D3QB 1AZTA 3EZ9A 2YNMA 1O2UA 2CLDX 4LHXA 1YLDA 1DVAH 1O3JA 4GPTA 2A2QH 1QF9A 5JI3E 2VH6A 3SDZA 1HYLA 3SV7A 3WYFA 2QSZA 3RXCA 1CO7E 1C5YB 2AYWA 1VGCC 4Q9KA 3RC5A 2O52A 4AB8A 3FVFB 1JMOH 4JVMA 2O8BB 2TGTA 1YPMH 3UK6A 2F83A 1R6BX 1T3SA 5FCRA 1WDTA 4LHYA 1TNHA 3W34A 1CGJE 3MWJA 2GJ9A 3BH0A 3PB1E 5EXPA 5EJEA 1NNEA 3EYDA 1ZGVA 5JCZA 1ZTJA 5JHHB 2GAAA 1KO4A 2IS4A 1KMHB 3UMSA 1K22H 3BXZA 2VPPA 5G40A 1A61H 1GHXH 2ZAOA 1VITF 1SGDE 3F9GA 4E06H 1SQTA 4QBFA 4KXFB 3LDAA 3HKIB 3Q9LA 2VIPA 1RXPA 2DR3A 3QENA 5AFZH 1TALA 2D1JA 2YWFA 2F7SA 4HAVA 2QBYA 1MRSA 4O03A 3ATMA 2Q6FA 3UWOA 1SG8B 2BKEA 2PW8H 2GDDA 2EI6A 4Q9IA 2ZHEH 4TQ9A 1GJ8B 4OHVA 6CHAC 1QHRB 3LDXH 1FP6A 1Z3IX 3Q5EA 1U9IA 2BXUH 4NBSA 4BZPA 2P3UB 4MRSA 1XPOA 2BDHA 1P04A 4OK3A 1CE5A 3KXIA 4D2IA 3SHCH 2HRVA 1LDTT 4I8HA 1G36A 1OHHD 2ANCA 4QNMA 4DJTA 1XTSA 4URZR 1BRCE 1SPJA 4OKSA 1OP2A 4PX9A 1R8SA 2C96A 3FP7E 4TQAA 4ESVA 2PKSB 3QG1A 3SQHE 4B3BA 1SGTA 2C9OA 1IQEA 1AJEA 2QAGA 2D2DA 1C1OA 1EJAA 4M0LA 1JI0A 3BJIC 5DJ7A 4D82A 1N8OC 3MOCA 4ISOA 3P4YA 2IUTA 3RDPA 4C0SA 1K28D 1VCQA 4Q1CA 1ANBA 1RZ3A 3TNFA 1UBGA 2CL7X 3CH5A 1NT1A 5GWZA 1OS8A 2A30A 3TH2H 1UBFA 4KFRA 1BYUA 4IOMA 4Q66C 1R5NA 1GRQA 2V55B 2CNWD 1K21H 4TQUS 5JMTA 1K1PA 3K0AB 1RIFA 1J99A 1NLYA 1D9IA 1Z47A 1S9HA 3Q8XB 1OPHB 3V7TA 4EPTA 1VCWA 1A5IA 1Q3XA 5C4MA 5F9HA 1HAHH 3SGBE 1EP5A 5EW1H 1X8KA 2A2XH 1GJ7B 4FUJA 1SBWA 1J8YF 1HBTH 1NRSH 3R0FA 1G64A 3FMFA 3CRW1 1C5RA 1D3PB 2ESTE 1J90A 4JYBA 3Q3JB 3M5NA 3BOSA 3AF1A 2ZI4A 3B8HA 3ADDA 2FF7A 5BWMA 3ZVMA 4MYUA 2AK3A 3RRMA 1XKAC 2F43B 1JBUH 1WQVH 1EFHA 1XWIA 3NWUA 2BOHB 3GFPA 1ELDE 1P09A 4GSOA 2H18A 2H16A 4NIWA 2W6IA 4I8GA 2XGJA 1U2RA 4E7NA 5FPYA 1BS1A 1O3IA 1KK2A 3KZ1E 5EODA 2GV7A 3LGUA 3THYA 2ODWA 3TBKA 1E1RA 2ZR0A 3IEUA 1AS3A 4D25A 3KDSE 1CVWH 1B0UA 2VIWA 3NKKA 1OWKA 3AVZA 3AKCA 4AY2A 2B7CA 2BDIA 3LWNA 2P67A 3OHMA 3A83A 4PQFA 4W7SA 1BTZA 4D9QA 4JSYA 5EXXA 3NUMA 5AJWA 3VPKA 2MMGA 2H57A 4D7GA 3AVWA 3P92A 4EJSC 3S69A 1SGYE 3TW4A 3M37A 3SV8A 2YYZA 2JH0D 3RXDA 2BXTH 2IS2A 2QORA 4HEJA 3ZZ8A 1MKYA 1SHYA 1MU8B 3SQEE 2QXJA 4QHYA 2FEOA 2Z83A 1IXSB 4H9GA 2F9NA 1YRBA 2YZ2A 3AP3A 4X8OA 1CJVC 3TSZA 1ZMNA 3W94A 5EU8A 4HZUA 4US0R 5JBTA 1O2KA 5B2ZA 3U98H 4A6XA 2PWXA 1QBVH 3QEOA 1QQ4A 2J7PD 3R9IA 4DW2U 1NRJB 2Z6BD 4DIIH 1KI6A 1KSHA 2QTHA 2ZRJA 3AVOA 4JLJA 3TQFA 1C1WH 3U3KA 1JEEA 2G83A 4L5BA 1TNKA 1NTPA 1FY4A 2EFGA 4BUJA 4OHZA 1JR3E 2FPKA 1C2MA 4MGKR 3M6AA 3MMGA 3GLIE 2O5VA 4JYUH 3CNOA 2QA9E 1TBRH 4AB9A 3CPEA 3BN9A 2XWAA 3O8CA 1KTSB 1P60A 3A82A 5EPNA 3FTQA 1P3EA 4AFQA 1OXTA 1F6BA 3E0NB 1FV9A 2F1RA 1G8PA 4RKJB 2P95A 2HLCA 4JK6A 5B6OA 3GOVB 6ESTA 3GY6A 1FIWA 5DK1A 1CF4A 5JBBS 5KSYA 3NDBB 121PA 2C8XB 3K0EA 5HZKA 5C18A 4AURA 3RU4E 1KDQB 1ESAA 4OK5A 1YPGH 5SZHB 2PMKA 2Y5GA 3F1SB 3A7YA 4PO9A 4JMYA 3JVUA 3M35A 1CBWB 2QQ0A 1Z1IA 1LMWB 4F4IA 1HJ9A 2ZS7A 1IOZA 2BD2A 2A45B 5IDKA 3D3QA 4GZLA 3OY5U 3UKDA 2YOLA 2ORIA 4C2TA 3BTME 3T5FH 4OS1A 5DP9A 4EFLA 2DFTA 1NN6A 3G82C 3PLPA 2GBLC 5J4VA 2NU1E 1TYNA 4GMXA 1ELEE 3ELAH 2WKRA 2IYWA 1OSSA 2NO7A 4ZAEA 5FBWB 4MNYA 2ZU0C 4ARZA 4H6TA 4ZKDA 2BDAA 2QXIA 1G5PA 2OXRA 3PCRB 2ALPA 2ZUDA 4MGYR 4N0DA 2JLSA 1AGPA 4X1RU 3QNUA 2OG2A 1DWCH 2WOOA 4KAXA 3JZ1B 3T2NA 4ZH8A 1U94A 1NLZA 1B0EA 3ZIAA 4C0JA 1KTTB 5KNDA 3ZVFA 3U4QB 4X2WA 1AM4D 1EUFA 5C2JB 3SYJA 1FL9A 2UKDA 1B0FA 3ATLA 1AY6H 1YLCA 2YWGA 2ZRPA 1PPHE 2VRWA 4KBGA 4Y0YE 3S9BA 4LV8B 1ZNWA 3TGPA 1MKWK 3RSLA 2Z9IA 2EI8A 2LNCA 2PR3A 2Z4RA 3TAUA 2OLKA 2I6QA 1MQ6A 1KKMA 1FTSA 2VVVA 3HPQA 1MD8A 3QXSA 4RD3A 2QGNA 5P21A 3QVUA 1BMFD 4UD9H 1II8A 1E37B 2OFXA 4IXMA 3SU6A 1V2ST 1TRYA 3T26A 1LPKB 3RXOA 3KF2A 3RC8A 2DCUA 2IL1A 2XNSA 2BQ6B 3ADCA 2QIQA 2FZLA 1XUFA 2A0QB 3ZZUA 4OQXA 3B9FH 4GAWA 1V2JT 3T61A 1AHTH 4AD8A 2AL7A 2HCJB 2J5XA 1ZAKA 4NMMA 4MH0R 4HUQB 3TITA 1YU9A 3IITA 4AORA 3VHXA 3KQKA 2RGCA 1PYTD 2FEQH 4JLVA 1E35B 2WPHS 2FOMB 5DP8A 2ULLA 3A84A 1WA5A 3P6ZB 1T4GA 4DIDA 1DO0A 1BRBE 2BX3A 1OXVA 3K9XB 1UVSH 3TSWA 1C5NH 5JSZA 1J15A 2XTTB 4RD1A 1JPJA 4HAZA 3KQCA 3Q7QA 2QL6A 2YC4C 2ZJZA 2Y7XA 1X1SA 1F2UA 1W49A 1TTTA 3CS0A 1AUTC 1MKXK 1MCTA 3WP0A 1V5WA 1TU4A 1FP7A 3UWJH 4WMDA 1A0LA 2WPMS 4MLFB 2CMKA 2ZRAA 1BQYA 5F98A 5T3HA 4RZ3A 1T3LA 2P16A 2BC9A 3GJ3A 3U7HB 4YLGA 1HB0B 4QGHA 2FX6A 3REGA 1OE0A 1SC8U 4M1KA 4FMCF 1EP6A 3D62A 2DWOA 2OLGA 1JB1A 4YMTA 2XZOA 3W9YA 1FPMA 1EZUC 3IPXA 1GI5A 4M53A 1Z8IB 1T5IA 4GCHF 4LJ6A 1AB9B 2Y80A 4JJZA 1G19A 1VYUA 4NCNA 1IAUA 3IBYA 5AUNB 4FU8A 2OD3B 1W2HA 2H8KA 2O0HA 2J0VA 2XSZD 4LCBA 3Q76A 4SGBE 4JJKA 1E34B 2G52A 4AFZA 4K8OA 1SGRE 2BM2A 5BYJA 4RSGA 1O31A 3X1ZA 1GBEA 1PPBH 1Q22A 2BBSA 3DKPA 1ELOA 3AM1A 2CVHA 1YR6A 5L3VA 4QG7A 3QOFA 2C4FH 1S8FA 3RXBA 1UJ1A 3RXHA 4WMEA 5KSPA 3ASYA 4S2EA 1QBNA 1BMNH 4PPFA 3KGPA 3AVQA 2FI5E 2BDCA 4O2LA 2WWGA 4E07A 1EXMA 1Y63A 1TGSZ 5FPHA 2VU8E 2A7CA 2PLXA 3H1TA 2WPDD 3D6TB 1OYQA 5TVKA 5JS7A 1O2SA 1J8MF 3LBNA 1GJBB 3FFAA 5C4GB 3IILA 4RFSA 3KX2A 4S35A 1E0KA 3C5CA 1ZNXA 4Q19A 1IONA 4BEJA 2QC2A 5F8TA 3SYKA 2R62A 1RJ9B 5J4SA 5EG4A 1LB1B 4OI4A 4Q9LA 1KLIH 3FP6E 3TVDA 4XBDA 1Q1QA 2EWVA 2Q21A 4KODA 1OFUX 1YZKA 1XUIA 2VHJA 4CEHA 2IF0A 4GFDA 3D8BA 2DE9A 1C9PA 4WXVA 3SNDA 3F0TA 4O3UA 3P17H 1G20E 1K1IA 1GL6A 1C5PA 4EQ6B 3WBJA 3B85A 3MU0A 2ZI9A 2RGNA 2Q1JA 4Q47A 1US8A 4NIXA 4FMDB 3HKJB 1K1MA 4FUBA 2AIPA 6Q21A 2J7KA 3DM9B 2ZJYA 1WUNH 4PAQA 4BLRA 4V03A 3BIUH 4OK6A 1EZSC 1SKQA 1IAQA 3CW2A 2WYJA 2B8OH 2FS9A 2YWHA 1NRPH 1TUIA 1JR3A 4NCYA 1RYHA 1P9NA 2BDYA 4B2IA 3GLIA 1RPZA 1ZD8A 1ZM3A 1Z0AA 3FAOA 3TW8B 1G21E 5FBVB 1N8OB 2C90B 5JCPA 4X8VH 2FPZA 2FODA 3EE0B 2HF8A 3E8LA 3DZ8A 2R3UA 4B3CA 4BFYA 1U9IC 2GXUA 1F0SA 3SHAH 2IYLD 4UJ5A 1XUHA 3S0NA 1UTNA 2JKHA 2A3RA 1F3OA 5JBAS 3G01A 4GRAA 1H8DH 2GX4A 2FI3E 3S7HB 1XFAA 1X6VA 2VH5R 3T27A 3AAUA 2ZM5A 2STBE 2FWRA 2HNTE 4TLAA 3VB6A 1C5OH 4K5ZA 4TWZA 3R3GB 1AN0A 1GBTA 2QAGC 3SFVA 4QJ3A 5L3QA 1F5NA 2MSDB 2YVUA 3GY4A 1OLOA 4AYYB 1IN7A 3DEFA 1HAVA 3CRQA 1V2UT 4MKHA 2FOLA 1S81A 3TH5A 4Q7YA 1DS2E 4TT3A 5GJVC 3HP1A 5DN6A 2J45A 1R10A 3RWOA 1O3BA 2VH0A 3TLOA 1CLUA 5LD2C 3AF4A 1NS3A 4TZ6A 2GP9B 1E2NA 1NJFA 1JAIA 3M36A 4LXBH 3LKWA 2JH6D 5FUYA 3LQQA 1JECA 5IF9A 2ZS8A 1XMJA 3GLFB 3PMJA 1UVPA 2WUBA 5CYOA 3I92A 1NO9H 1TIOA 1MU6B 4XWOA 2BY7X 3UMFA 4JLDA 4HB4A 3EC2A 1OIVA 2PJZA 1Q3HA 5J4QA 1QA7A 1YCPM 3EZ7A 1KYIA 1C5QA 1SFQB 2QZ4A 3CRRA 4PXAA 3TUIC 1GI2A 2ZEBA 4L9WA 2OHFA 1TMTH 4BLSA 4PZYA 4OQNA 1W4RA 2PHBA 2GHIA 4CGZA 3BTKE 2ZJAA 5FUXA 2DPXA 4NYIR 5JWRA 1A4RA 1H65A 4X1PU 4DLVA 1YRAA 1N6KA 3K0FB 4ZKOU 1AU8A 3W8RA 1J16A 1BIFA 3I4LA 4WJG2 1EPTB 2WJVA 1VHLA 4WW0A 4URUR 2H9HA 1GUAA 4EFNA 5CHAB 4Y0ZE 3EIHA 3TH4H 1BHXB 5TCCA 2AKYA 2QU8A 3Q3XA 1XEFA 3QPVA 2FEMA 1YZNA 2TBSA 4DSTA 1AI8H 1SGEE 4X2YA 4WH6A 4BE7B 3KJGA 3ZQ6A 2TGDA 1XD9A 2O8BA 2HYDA 2GT8A 1XTIA 1ZU4A 1XEWY 1HYQA 1L4YA 1Z29A 1KJZA 2OK5A 4Q01A 4MYCA 2IEZA 1Z8JB 2ASUB 2AD5A 5H1YA 4HSEA 4AI6A 5EQSA 1CEEA 1FX0B 1KMHA 2QGZA 4DBLC 1KO1A 1G6HA 4AWXA 2GVFA 1ETSH 3KQHA 2ZU5A 5E7IA 4H42U 2Y5HA 4F91B 2KB0A 2X2EA 2GRJA 1UEJA 3THOA 3DL0A 2AD1A 3GCHC 5HKKA 2ZGJA 4BNRA 3F9HA 3B9QA 2GNOA 1OT3A 1JXPA 2Q9CA 4YO9A 3MU8A 2PBRA 1UDXA 4YXWD 2QF3A 1ZC4A 5FUWA 1U81A 1KJYA 5JBCS 3U8OH 4KV9A 3RXAA 1SQOA 3CUEF 5CM8B 4MRVA 2ATXA 1DG3A 1TQ6A 1TNIA 1TEVA 2YOGA 2ZYUX 3OAAA 1BITA 1OFIA 4MQBA 4KSBA 2ZPQA 3HR7A 5C67A 2AFQB 5FOUA 3C14C 1NPMA 1XMNB 1SHHB 4M1OA 4IFBA 3BTDE 4WVFA 2A31A 2FOEA 1TMUH 1S9DA 1VG9B 1TPSA 3W3ZB 1HXFH 2FFBA 3VKGA 4KTSA 2A5AA 3EA9A 1ZIPA 4NKRA 2HCBA 1TOMH 4EPWA 4FVBA 4KFUA 1E99A 4OHWA 4I81A 1ZUHA 4B32A 4IMZA 2WWHA 1NL3A 1GPZA 2WIAA 3M5OA 3DOEA 2VJ1A 3DDCA 1NRQH 5LPRA 2C8YB 3HDTA 2TIOA 1KK1A 3QF4B 4A1FA 1YPKH 2RGAA 4M9SA 3SU3A 3HK3B 2B8WA 1TAWA 3NH6A 3VR1A 3K0AA 4DHEA 4B73A 1LPGB 3PFIA 4G0NA 1BOFA 3AGQA 1T32A 2F1IA 2R44A 5B64A 4UJ3A 4ACAA 5E8EH 5HCNA 1HAZB 4TMTA 2WWYA 1MH1A 1O3CA 5BQ5A 2KSQA 4BTTB 3U7FB 1THPB 2ZE6A 4EAQA 1YZGA 4U30A 4IDNA 4RD2A 4ABFA 1J2JA 1K6MA 3BIFA 2D7DA 3SJBA 5DSZA 1P9RA 1SVPA 4Q9JA 3LONA 2FYRA 5CK5A 4FUEA 2OUKA 2QTFA 2ILNA 1F7ZA 1YP9A 2CJIA 1GJ4H 1VCNA 1UK3A 1SLVB 3LC3A 1AKSB 2JAQA 3UANA 2FMXA 2JA1A 2ZA5A 1HY3A 1SVOA 2WVJA 2F43A 4RJLA 1CR4A 1X1RA 1LHCH 1NI3A 1Y8TA 5EP3A 3IDQA 1C1PA 3FZDA 1U0JA 2ZSEA 1RE0A 1HQCA 3CR7A 3QTVH 2C93B 4UXJA 2PV9B 3AGPA 3OESA 1QG2A 4TYQA 3EA7A 1UTKA 1O5CB 1Q21A 1P61B 4MRNA 3SJ8A 3SU4A 2JGNA 1MTNC 2QXHA 2NIPA 1WB9A 4YOIA 1A7JA 3K09A 5HR5A 1UCYH 1XD8A 1FN6A 1GWAA 3NBFA 3A8DA 4CDGA 4ZV4A 2H6MA 2WZQA 1TMKA 3DA9B 4TPYA 2XX3A 1MV5A 4KHZA 1OKKD 3MJHA 1XCPA 3T5GA 3NVAA 4TY7A 1FI8A 1GG2A 3ITIA 4LHWA 2ZPSA 4DEYA 2O8CB 4U00A 3T62A 1QJ6B 2G51A 3T5DA 3MU5A 3RANA 1YCPH 3LX5A 3TQCA 3ZQJA 3I5XA 1CSOE 4NONA 3DOFA 2Z43A 4B47A 4M1WA 5EE9A 4IW4E 2IXGA 4NH0A 4YTAA 3FKSD 1KDTA 4URYR 4JYVH 1XU4A 5GJ4B 1DANH 2ZHDA 2VIIA 2HF9A 2FS8A 5HCIA 2V8OA 5DHFA 2EI7A 4BRUA 1PPZA 4RN6A 4Y0AA 3U2QA 1CKEA 1J17T 1MO3A 4KBFA 3KTAB 3IG6B 2ZSDA 1AS0A 4PSAA 1CR1A 1OHHA 2VVCA 1C2LA 1S84A 2EFCB 3MO3A 1DVRA 3GCTG 2P5TB 3ICEA 4IDPA 3PR1A 4UNSA 1E9CA 1S6HA 5FOTA 4KYIB 4H1UA 1UHBB 1C1RA 5JECA 4GL2A 4PPNA 1GBKA 2GAOA 2VP2A 3E16B 1CGHA 1S0UA 1G7TA 5SGAE 4OM9A 3NG1A 2J34A 4LZ1H 4L4UA 2JIZD 1E6CA 3VQTA 4TMWA 1ESNA 3U69H 1O87A 1XUGA 2Q0HA 4XSGA 3RC3A 2YNBA 3LGTA 4MQAA 4ISHH 2ANYA 4U2WA 4DSOA 2HEIA 4WY3A 2BMDA 1KGDA 4CRWB 2Y81A 5JJKA 1YHNA 3CZQA 1DDJA 5E2OA 1WTHD 2UUYA 3MH4A 2CNWA 3RUOA 5KOYA 1JXMA 1W36D 4QM6A 3AVXA 1RGQA 4M1SA 1P8VC 2UVQA 1NIPA 1EWQA 2QSYA 2AMPA 4JLPA 2GMTC 2FLRH 4Q1AA 3OZXA 2DBYA 1ZNZA 3TUZC 5AUOB 4RZ2A 5E0JA 5SZIA 2CBZA 4OS4A 2CE7A 4NZYA 3EDXB 4FD2A 2W3KA 1EZQA 2TPIZ 2FPMA 5C1UA 3TK9A 2HUPA 2GCTC 3HJNA 4NTZA 1M74A 3H5CB 4IJMA 3ZH9B 2QMOA 1ZC3A 2IYSA 4EPRA 3L2OB 2FTMA 1GCTB 3GJ6A 4LJ9A 4AYTA 3GD7A 4ABAA 4CHAC 4LV6A 4BFSA 1ZCAA 1Y5UT 4WBSA 1NVXQ 5T1VA 3KJEA 2VB0A 2IYRA 4FUFA 5FTNA 4LHZA 1XTKA 3P4XA 5CB6A 3RRYA 1OXGA 1YPHE 5E4FA 4DB2A 5FI0B 3QEJA 1XXFA 5J4KA 4IVQA 3U4QA 5DI3B 1UKEA 1HV7A 4AGJA 1NFWA 4ASHA 1JR6A 2KE5A 3A85A 2GJKA 2HALA 1TX4B 1EFRD 1GL7A 3PUWA 2NU0E 4R71A 3GMTA 3ZZ5A 2RGNC 2N42A 1FOEB 4G5QA 4YM9A 1CJMA 2ZROA 1VKJA 9ESTA 2ZGHA 4URVR 1Z28A 1C2EA 1FN8A 4DDWA 1FDPA 1P72A 3VKHA 5KDOA 1MD7A 2C9CA 5JEDA 1YYY1 3RP2A 2O8DA 4NSVA 2R6FA 2JH5D 1T0HB 4M1TA 2PSYA 4ISLA 3TJNA 4E22A 2FTLE 2AWOA 3OIYA 4LOYH 1G30B 1O33A 1EB1H 1SKYB 2QAGB 4BAMB 1CJTC 3PQCA 2R0KA 2NWNA 1KXFA 1EX6A 1D2NA 2WWWA 1M8PA 2ZE5A 1UTQA 2AGGX 3D65E 2QXGA 4HUQA 1XX6A 3TU7H 3E1XB 2UUJB 2J7PA 3QSYA 4P32A 1JJ7A 5L2ZH 4PSVA 4RD4A 5LD2B 4BXSA 5ETXA 1T8NA 5AUPB 2ZTZA 4U7DA 1AMHA 2IF2A 1HAYB 1TABE 2O8FB 1DBSA 1DM4B 1T0JB 1AFQC 2OBQA 1PUJA 3SNEA 2PMDA 2WKPA 1YQTA 2FU5C 1VITH 1A3EH 2BVRH 4BANB 4FN5A 1J14A 3RXPA 2H7VA 1A7SA 4X6OA 2VLIA 2GCHG 2BEJA 5EUQB 3X1WA 3HU1A 5JDUB 1E38B 1O5FH 1Z0KA 1DTSA 4GOKA 3RXUA 5CB8A 1VZQH 4AG2A 2I1VB 2A5DA 2Z9LA 1ELFA 3RMLH 4C7OA 1JRTA 2BCJQ 2LKDA 3QI2A 3FKQA 1BRUP 3GLHB 4AYXA 5L30H 1XUJA 1NVVR 4O25A 1HE8B 1UK2A 1DAFA 4JZDH 3OU0A 1RJXB 1SR5C 1JEDA 1S85A 2ZYTX 2BY8X 2EA3A 3DHKH 2WJYA 1GGDC 2BMJA 4KITB 3THYB 2FOHA 2OBMA 1Z6GA 4U5XA 5DP4A 2W58A 4TLCA 1CJUC 1AA9A 5JJLA 1P73A 5KYKA 5FAHA 521PA 3LIWA 1ELGA 2ZCKP 1YKSA 4JL6A 1QHHB 1TMBH 1N5IA 2I4IA 1V6DA 2IYTA 3GY2A 3KCGH 5I46H 4DCSA 4FXGH 2GXSA 1ZPZA 1BTHH 3CRMA 4UXHA 1ID5H 4ZXXH 3ZVLA 1U8AA 3GDSA 2IOTA 2MMCA 5IHPA 1BIOA 1CJKC 1D9ZA 1S96A 2PGBB 4Y76A 3PO1B 4Z54A 4PHTA 2ZC9H 5IDVA 1E1QD 4ABYA 3PG5A 2ZO3H 3ZYEA 1V2KT 4GLYA 1RJ9A 7ESTE 1Q31A 1OKXA 1UADA 4Q00A 3BEUA 5JRZA 3PMBB 4Q1DA 4RZXA 5TMPA 4WXIA 1QA0A 4GOJA 5CK4A 2F1HA 1OWJA 2HGTH 1W13U 4JVSB 1ARCA 2F1JA 4DT1B 5TXGA 1N6XA 4U01A 1W0KD 5BN4A 2RDLA 1BMFA 4E03A 4I8JA 2ZJ8A 3HU2A 5GADl 3P1JA 1G5RA 3CLVA 3RMOH 1T8TA 6GCHG 1ABJH 2DFNA 3EX7C 4WA7A 4II7A 4C0AC 1AIXH 4TLDA 1L0ZA 4XIGS 5J5CA 3A4MA 5CE1A 4WVPE 2SGPE 5C46F 1C1SA 4NZLA 2VF8A 3SV2H 4FUDA 3CR8A 1J7KA 3MFJA 5AHGH 1S6FA 3MMPA 2LWIA 3LC5A 5JPMH 5FL7D 3F9FA 4B3XA 3N7OA 3AF0A 4W5WA 3QXCA 5EP2A 2HVXA 3QTOH 2MSCB 1DWDH 1O3HA 1TNDA 1QJ7B 4K2YA 2FFAA 3E5HA 4L8GA 2IA5A 3B1VA 1P57B 2FFQA 1GBCA 1QHNA 2XOKD 4EKDA 3L43A 3C27B 4A82A 4KI0A 2ZZUH 4MRRA 3ZDQA 1O0DH 2W7SA 4GP6A 2TGPZ 4FUCA 1ANKA 4NGAH 1YBWA 1GG6B 4M1MA 3ZZBA 1F48A 3ZZCA 3N2EA 3KQEA 3HYRA 4MTBA 4B35A 3CB4A 4AG5A 2IJOB 4F4CA 3H84A 3W6PA 4TPIZ 1IN8A 4C0LA 5LBIA 1MOZA 1FFHA 3ZD6A 4PR0A 5KU1A 3NDPA 2PKSC 1B23P 3SI7A 2XTMA 4WXPA 2RKOA 1LVBA 2GEDA 3A1VA 1ZHRA 2WV4A 5DIFA 2ZJ5A 2YNAA 3A37A 2KJQA 4BFWA 1F5RA 5FH9A 5IT5A 3TVTA 3GCOA 4NA7A 3AF3A 2ZU6A 1Z0JA 3LVRE 3I5YA 3EIEA 5EQQA 3X2SA 2A5IA 2ZRLA 4ZDJA 3LJOA 2XSZA 4JBWA 4ASUD 3O8DA 5C1YA 1NN1A 2AIQA 2BD3A 1NKSA 4DGJA 1BH2A 1ELBA 1Z1JA 2PZFA 4JLAA 2ZRFA 5JWHA 1CGIE 2J46A 1EFCA 4INLA 2NZ8A 3QUSA 1R7RA 2J59A 3FWYA 2VIDA 4B74A 2G6BA 1RTLA 1WBGB 1NRNH 1PQAA 2CHGA 3RXIA 1Y5BT 1QB6A 2J2UA 1Z6JH 1G3RA 5LB4A 1XJQA 1VG0B 1GHAG 1JPNA 1SZPA 3MWYW 2JETB 1GRNA 1PLJA 2X77A 3SBEA 4Q1BA 1C2FA 1OF1A 2WPDA 1P2SA 5DYIA 1L7VC 5EQTA 2WUCA 2R6DA 3I77A 1N6YA 1I4LD 2BLWA 9LPRA 2AMDA 1WF3A 3IO3A 2GKVE 3K53A 1OFTA 4NHOA 4PANA 3AKYA 2BD4A 4BLOA 4HDCA 3MNBA 1ZHPA 4G5RA 4DWJA 4IHQA 5FOSA 4BPBA 5DG6A 2QPTA 2BDGA 1BTYA 3TJUA 1EPTA 4MPUA 1XZQA 3BS4A 3FPAA 4G01B 1GITA 4PC6A 1LTQA 3KL6A 1MKWH 3FMIA 4JZ1A 3L8YA 4NZQA 2FZZA 1IN6A 1NN5A 3AASA 2JJ2D 1AZSC 2CL6X 3RU4T 4ZDIA 1W46A 2W2VA 4IC6A 1O3KA 2F91A 2C95A 3AH8A 3NKVA 1TRMA 5JZVA 2EFEB 3TGJE 2XZLA 2XJ9A 3PWBA 1IJFA 1UM8A 2OBLA 3W90A 2BLVA 2OFOA 4NSYA 1C1YA 6GCHF 4LI0A 4HAXA 4I1OA 2ZRNA 1PQ7A 1OH5A 1C2KA 1NESE 4K69A 3U8RH 2VBCA 4TYYA 3LRPA 3X1DA 1E2QA 3LH5A 1G9IE 5HGGA 1E32A 5DKMA 3A8TA 3FMOB 1C5LH 1QL8A 1IN4A 5ANRB 1XPUA 2BMEA 4LYHA 2VF7A 1FX0A 3KFVA 3JZMA 4KSCA 1P2MA 4I8LA 1F60A 1W0ZU 1A2KC 5E2PA 2IN2A 3TUJC 5B30A 1CT0E 2VSFA 4QBIA 1ZYUA 1G8FA 3WBKA 3A1SA 4QKQA 3CZPA 1P05A 3IUYA 4PPQA 1T3HA 5HE8A 1MR3F 3LOXA 1YVDA 4DCTA 1QBOA 1MKXH 1C1VH 2RCNA 1P6XA 1NMZA 2FSFA 1Z6XA 1Z8GA 1O3AA 5FOWA 1KDPA 5JYIA 3EG5A 4CBNA 4INKA 5ELXA 1EATA 1QGFA 1SVLA 2FESH 1L1JA 2RGGA 3ZZDA 1G3DA 1NY6A 5L2YH 3OE7D 2D3WA 5HM2A 2J0SA 1SKYE 4HFPB 2ZDVH 2SNVA 4CRCA 1BMLA 3RLYH 4JKIA 4XBCA 2O8MA 4KFSA 1CHOG 1LF0A 3GICB 1XJ0A 1EJNA 2C2HA 1Z7KA 5C2ZA 4BEBA 2W0SA 1IOEA 1AE8H 5KNCA 4BOHA 3B13B 3G0HA 1SXJD 3KJHA 2D74A 1O3OA 4PQYA 1COWD 3A7VA 3TNSA 1O3YA 2W26A 1WE2A 1YR9A 1HAXB 4V0NA 1DS6A 4OHXA 3UOPA 1AO5A 1TQ7B 1GI8B 4P4UA 2A1DB 1P75A 4CHAB 1X8LA 1KOFA 1CBWC 2CCKA 1HUQA 3UXMA 4ABBA 2C98A 5KDLA 4H4FA 2ZI3A 4IVPA 4OHYA 3QF4A 2QQEA 3QBTA 3U3JA 1GHAF 2UUFB 3FYHA 2ZDAH 4NP6A 2TMKA 3UR6A 3MFYA 4KTUA 1P62B 3T12A 1EKBB 3U1IB 2OC8A 1MQ5A 1ZZZA 1EOLA 3GYLB 2OILA 4Q1FA 5FR1A 2IK8A 2P3FH 4TMXA 5EQRA 5CLLA 1LS1A 5A0AE 5C1BA 1GJ6A 1XUKA 1L8QA 1GOTA 1W2GA 3M3VA 2Z4SA 3L33A 1C2GA 2NTYC 4QC2A 3GLHE 2ZJ2A 2VP4A 2IS1A 1N5LA 1PZNA 4LBVA 3HPRA 1D8TA 2BHRA 5PTPA 3AVPA 2BD9A 1ETUA 2NZJA 4F4JA 3WP1B 1P10A 3GY7A 3M4YA 1TB6H 4C30A 3NPSA 1V2WT 3BH6A 2ZF0H 1SHKA 2AKAB 3VB3A 3D7MA 3FFBA 2BIFA 1DFPA 4DVAU 4Y79A 1HA3A 2XCFA 4LZZA 1ZUIA 1WP9A 2ZIAA 1HT1E 2W7UA 2PX3A 2G55A 1V2NT 4RKOB 2C8VA 5IK2D 4I33A 5GNDA 2YC2C 1HGTH 5KDDA 3CH4B 2QI9C 3C8UA 2DE8A 3KQLA 4A92A 1BUIA 1CRQA 1G2MA 1KIGH 1QTFA 1D4PB 3UNQA 4A15A 3THXB 2X19A 1MTVA 2BLOA 4XBBA 3LLMA 4D9RA 3SQWA 1A0HB 1II9A 4GNKA 3BG4B 1QVAA 4X1NU 3I1FA 3BH7A 1E9BA 1XPRA 5F2EA 5L3QB 1TNLA 2O8CA 5AJVB 2IJD1 4C0HA 1ZM7A 5DP5A 5C5NA 3TK1A 1UO6A 4FW9A 2O8WA 3KXKA 2KAIB 4OJQA 1W48A 3RSOA 1BDAA 3M7UA 1W2KH 3RMMH 3KL4A 2EU8A 4YXWA 4U32A 1AVGH 1EFTA 1QR3E 1P7CA 3CX7A 1WYKA 2W5EA 2IPHA 3HPTB 5CLQA 1GJAB 3T29A 1XZPA 3P32A 4JZFH 1NSFA 3GCGA 3U3RA 4ZMAH 1QB9A 5LPNA 4HLUA 4IOJA 1Z0DA 1NRRH 4MGZR 4NL4H 1QDEA 5E0HA 1N2CE 3SV6A 2PKAB 3KTAA 2QRNA 3RXFA 4PHFA 3VX4A 5A0CA 3SNAA 1FPHH 4QJ5A 2VP5A 1ZP6A 5FTMA 3EZ6A 4JT4A 5B57C 4NCHA 1NROH 1LVGA 2TRMA 4BZQA 3C7KA 2A4QA 5GJBA 1SXJB 3IIMA 4R8TB 1PPFE 1E9DA 1C5XB 1E79D 3QGJA 3SV9A 3MH5A 4US1R 2Y5FA 2BD7A 2O9QA 4TL6A 2Y8EA 5KUTA 1DG1G 2P93A 1W7XH 3LNCA 3DUXH 1ZRHA 1MMJN 3EARA 3A8BA 1AB9C 2BJWA 3RXQA 1G8GA 3RXKA 1KXCA 1EAIA 3SJIA 5HPYB 2ZFFH 1Q44A 2OAP1 2BOKA 1QVRA 1QJ1B 2W6JD 1PQ5A 3W6NA 4EFMA 1ESTA 2GA8A 3K70D 1K1OA 1O2GH 2F9PA 1O2IA 2FH5B 3VAAA 3RRNA 4UFGH 4DVGA 2D7CA 2WV5A 1NFUA 3SGAE 1OW3B 4G5SA 4M1YA 1BJUA 3SOSA 4KELA 5H4IB 3SI4H 3AV0B 3AP2A 2ZUCA 1WRBA 2VP9A 3MWLA 2JDID 1C5WB 2G4UA 2WINI 1A0JA 2JJ1A 2ORWA 2NPIA 3CIOA 1QRAA 1E0AA 3LW8A 1AIPA 5T6GA 3LVQE 1P3CA 4B3FX 4XTCS 2HXYA 1UF9A 1LW7A 4D76A 1KI2A 1O5EH 1CULC 3C15C 2V1XA 3A1WA 4IVRA 1HV8A 4X6PA 1S1MA 2ZKSA 3KFXA 1UKYA 3EWSA 1RTFB 1A4WH 1EX7A 3LGIA 2RB4A 3FFGA 2CLSA 1VCMA 3GPLA 3SN6A 3MYWA 1GKIA 3M3SA 2Q6TA 1ETTH 4BAQB 4NA9H 4IDOA 3A6PC 4BFZA 2K5UA 3IQXA 1DICA 2MSEB 5DI3A 3SN8A 1XNJA 2R9VA 3KHVA 4Q4HB 1UFQA 4RVCA 3K9LA 3PVSA 1W4CA 1EOJA 2NU4E 3B5JA 1OKKA 1P2UA 3DZDA 5FI1B 1G3IA 3RLFA 2V3CC 1SB1H 5EZ5A 1FNMA 3V13A 1MRNA 5C1XA 3ZZ9A 2CXVA 1KTVA 4EDHA 1V3XA 2BLQA 5EE0A 2WMOB 4R2IA 4NDZA 3I61A 1HT2E 3V4FA 2ZFTA 4IS5A 2ZRGA 3VR6A 3QDZB 1YR7A 1PYTC 1BZXE 1GKUB 2A2ZA 3FKSA 2FOGA 3UG7A 2AK2A 2OM2A 1INCA 7KMEH 2A7HA 5FBEA 1GDUA 1MH0A 4MDSA 4B1TA 4LK4A 2ERYA 3SQXA 3T35A 1SQAA 4FU7A 5A2MH 1S4QA 7GCHG 1JXOA 5GCHF 2B8TA 4C3ZA 1UDWA 3RXGA 5GXPA 2ZITA 1E3MA 1VCPA 1DAKA 1ELAA 4ZKSU 1W5SA 5FBRB 3G5UA 1Y3XA 5EXTA 1KKLA 1AVWA 2O8FA 4DEXA 3UIEA 3HK6B 3BE4A 2QE7D 2ANKH 1K1LA 2JIZA 4XWKA 2ZFSA 4DC9A 5FOXA 3TK5A 2AWNA 1SOTA 1MBQA 1I2MA 1L4UA 3VFDA 1TA2A 3TKLA 2IHYA 1TX7A 3CONA 5CYPA 3BFKA 4ZDWA 1V2QT 1GNPA 2ZRIA 3S1AB 3OTJE 3V4RA 3CENA 1EFUA 2H2ZA 3K70B 1TNJA 2WSMA 3LH3A 5G53C 4UKDA 1KSNA 2CK3A 2BVNA 3A80A 2ZFQH 1WCZA 3GLHA 4I32A 2WWFA 1IHUA 4A9AA 2Z3CA 1HFDA 5JRJA 2BVSH 4Q4JB 1E2HA 1N5JA 5AK0A 4AG1A 4KYUA 1TPZA 1AZ8A 1UVTH 1VIYA 3QKSB 4Q80A 1YZTA 4O2RA 4AYVB 1XJCA 4L9SA 3B2EA 3Q7PA 4IKEA 1YPHC 2Y7ZA 2B5TB 1TX6A 3PV5A 3I32A 3E90B 3IEVA 1GKYA 3VHLB 2BY5X 1HH4A 4PSKA 2JASA 1OFHA 4HZHA 4D80A 2DYKA 4CVNA 3AKEA 4WF8A 1I4DD 5DO9A 1E4VA 1O2TA 1EB2A 1QHHA 3KB1A 4DT7B 1TGNA 4Q7JB 4UFEH 2O8EB 4XD7D 3AEZA 3NXSA 5BRRE 2ZRDA 1OX1A 1O32A 2ECKA 3DT0H 3LJJA 1E2IA 4ITRC 1H8IH 2PUXB 2Q9BA 1X8JA 3GJ4A 1EPTC 4PROA 4Y8XA 1ZNYA 3E70C 5EW2H 3QF7A 2J1LA 1XCMA 2C04A 4L15A 3P95A 5CHAC 1UMAH 1S83A 4ABEA 3KB2A 1JRSA 4Q9HA 2XBYA 3P27A 4FCWA 4FWIB 3ZZTA 3SJAA 1EFRA 3BTGE 2EW1A 4V0LA 1VIAA 2Q9AA 4X1QU 3FGNA 5J4LA 1FY8E 5LPFA 2A32A 2THFB 4ON9A 2VO1A 4OL0A 1LPZB 2BYAX 2FV8A 2P8OB 3D31A 2ZR7A 3AB3A 1IQJA 1KDRA 4DT1A 1JWTA 1JIMA 3ATWA 1SI5H 3WY8A 5SZJA 1EG7A 3ESTA 1FZZA 2G77B 4Y7AA 5FCKA 1Z6AA 4LDJA 1MBMA 1G16A 3RWMB 1TFXA 4I8KA 3PITA 2DWQA 5KNBA 1R2QA 1YF4A 4V0OA 1TBZH 2ATVA 2FWWA 4D6PA 1E0FD 2OV2A 2G1JA 5GJCA 4MYHA 1N0VC 1MZAA 1RRFA 4Y71A 2BKUA 5GVSA 3SHFA 5DP7A 4JMPA 1UTLM 1G4UR 3BTTE 3SU0A 821PA 1EWRA 2OUAA 3LGVA 2KBFA 1A5GH 3Q3YA 3ATIA 2Y82A 2GWHA 2V54A 3RXTA 4GUXA 2AFHE 3JVVA 4IEEA 4IRUB 4BQSA 5A0BA 4DSNA 1IQGA 1DE0A 3BORA 1O3MA 3UPEA 1DWBH 1ZPBA 3DHWC 2RHDA 1DOJA 1VDZA 3KNXA 1LF5A 2HYIC 1W4BA 2NO1A 2P2LA 2G1KA 3UY9A 2FYQA 3UOUA 4CF7A 1E9RA 2CJWB 5LH8A 3K6ZA 1U0LA 3T25A 4YOGA 1X7AC 4A1TA 5M04A 2GJSA 4KLZA 2JLVA 4NA8A 4KO8A 4C0QC 1H9LB 1P2OA 1ANCA 2CF9H 1YM0A 1SVIA 1ARBA 4R0IA 1HEIA 3MTYA 3SYNA 1XRJA 2BZAA 4PO1A 3LO5A 3SR0A 5EZ6B 2JLXA 2WJIA 1ZSLA 2PTCE 4ZXYH 4OYHA 1SXJE 1VMAA 2VGCC 3N70A 2Z6VA 2UWPA 1LQEA 4PZLA 4NYJR 2XNDD 3F9EA 2WM9B 3SEAA 4A8JB 1P4SA 3DM5A 2GDEH 3VR5A 3FHOA 3NCLA 4I31A 4DG4A 5DNYB 2D06A 3ASZA 4DCUA 2A4OA 1KO5A 1SL3A 1O34A 3QKTA 4NU0A 1NN0A 2VHTA 2ZQ1A 1Y3UA 1SULA 1FY1A 4JBXA 2G9NA 1TQ4A 5FL3A 2O8DB 4Q4LA 3V12A 3EPJA 2R6GA 2ZGXH 3LH1A 3CWQA 4AFUA 1NG9A 2GF9A 1G7CA 1OXSC 3A4NA 1E1QA 2C8ZB 2DWPA 3PMAB 3RS5A 1CA0B 3P8GA 2C9YA 2QGRA 2GEUA 3K6YA 3R8FA 4MYTA 4M9FA 3CX6A 1RRKA 1ZD1A 2J4IA 1BA8B 3DFJA 1XVMA 4IBLH 1LHDH 2DY1A 3I73A 1YPEH 4JLBA 1W1WA 4YLQH 1NVWQ 4C9BA 1U0HC 3GJ7A 4OI1A 1LHFH 1G2LA 5FTJA 1Z2AA 3MNSA 3QO6A 721PA 1DLKB 1GI0A 1W0KA 1AVXA 2ZG0H 2OFWA 1SGNE 3D23A 2BBOA 4YLUA 1Y3YA 2L0XA 3OIVA 1NY5A 4Q7ZA 2WJHA 2FSGA 4TYPA 2D4HA 2VWMA 3SBKA 1SGWA 1SVWA 5A4JA 5LB2A 3HR8A 2G0NA 4ZKNU 1NBMD 1IHTH 4A0GA 2RG3A 1U90A 1GMCG 1DO2A 2J94A 3UUZA 4G1UC 5FL7A 2QV1A 5CDFE 4PHGA 2AS9A 1QNJA 3RABA 4KLNA 1G3QA 2KBEA 2NU3E 4QOSA 1O2OA 3B1WA 3WNDA 4Q5IA 4C7OB 2IYXA 5TARA 2PLFA 1C4OA 2XOKA 4OI0A 1N6RA 1D6WA 4M9XA 3ENSB 1H1BA 1ZRKA 3J81k 4D4KA 4HLUC 3WHLA 3DO6A 1MAYA 1HIAB 4QGAA 1DITH 2AGIX 1O3GA 2ANMH 1RRCA 3NBZC 3LBHA 3B8JA 4OQFA 2PCLA 4Y11E 3EAQA 4DZZA 4M9ZA 4TTQA 4N0EA 2WPIS 3QY0A 3T06B 1SGFA 2SGQE 1BB0B 3SYLA 5A8ZA 4QRHA 5KHOC 5G41A 5IRCD 4GP7A 1BO6A 3SJZA 3KKPA 1Y3WA 2DHRA 3VR3A 3Q72A 1U8YA 3R9XA 1GL9B 2ONKA 2AFIE 4O0MA 1HLTH 1IN5A 3KQNA 4FINA 1CT4E 3A89A 1K5DA 5BN5A 1W10U 1O3LA 4MDFA 4ASUA 1JJVA 3PEYA 2WOJA 3WNCA 4EPYA 1YPJH 3F5FA 2HT1A 4TWYA 2CXXA 3PUVA 4ZHLU 2REOA 3X1XA 1GWNA 1OH7A 1HJ8A 1O37A 3OX7U 5F6MA 2NO9A 2FX3A 4U02A 1PUIA 3BTEE 3RS3A 2XYAA 3Q77A 1GVKB 4AKEA 1VTKA 4XJXA 4G3XA 4BLQA 1IM2A 2O0JA 3RC6A 4P0TA 3VB4A 1VHTA 5H70A 1WV7H 3TK6A 2W2TA 3MNCA 2LKCA 3EC1A 2BDTA 1YZQA 1VITG 1H8ED 2ZTSA 4D0NA 1PJPA 5J47A 3RC4A 5FUVA 2GT7A 3PROA 2ZJOA 5FX6A 3TJZA 4RI0A 1W47A 2ZTXA 1LVYA 1GCTC 4N3NA 1Q1ZA 2DUCA 3ZVNA 3URCA 4F4OC 4UNRA 2XW9A 1ACBE 1A5TA 4YQFA 1FIZA 1OOKB 4HAYA 2JJ2A 4JVLA 1C5UA 3VGCB 4MVNA 1Z6YA 1W14U 2GKSA 1JAHA 4YOJA 3U9AH 1DX5M 4A1VA 1GIAA 1C5MD 3GJ0A 3AW1A 3HGNA 2F3RA 1TQ2A 1ZSJA 3WRXC 4HB3A 1W44A 1H9HE 2QP4A 5EE1A 1N3BA 2OCVB 6LPRA 3L0SA 5G3YA 4QHTA 1TOCB 1DSUA 1MO4A 4OGXA 1RFNA 2F9MA 1Y5AT 1TBQH 1ZYOA 4B2BA 1GBFA 1GMCF 2FOBA 4X6NA 3GDVA 2XRCA 1RRPA 1VCOA 2V1UA 4DIEA 3C41J 2VIQA 3QKUA 3CKLA 1GHBG 3THXA 4ZCLA 2VIOA 5AWFC 1W7GH 4PC1A 2GVZC 2FA9A 1TQ0B 4D7FA 1H8HD 1L2TA 2ZVQX 4GHTA 4OJKA 2W0MA 1ZJKA 1QURH 2B0FA 3LY5A 4LJ5A 1E96A 2HXSA 2KAIA 2G4TA 1R8QA 4D4JA 1SFIA 1HQYE 1YPLH 2G8TA 3L0IB 5BYKA 1C9KA 4ZI2A 1KY3A 4BTUB 3ADKA 1C5TA 3UQOA 4X8MA 3SUEA 1P2IA 2J38A 5CIWA 3F6UH 4J2YB 2IHBA 4TWWA 4WOPA 1WU1A 1W4AA 2HV8A 2PT5A 3OE7A 4HLCA 3VR2A 4ZPXA 2PKAA 2PLRA 1QL9A 2QUZA 1ESBA 3GFOA 4YESB 4MNXA 4P33A 2V4ZA 2E9SA 3MAAC 5D3MB 1SXJA 1ZW6A 4FI3C 4LY6A 2H5DA 1SMFE 1NU7B 1COWA 3QXXA 1P2NA 4G5OA 1O2JA 2EVWX 4BGDA 1PPEE 1CQQA 2QN5T 3CS7A 4KGAA 3TIUA 2BEKA 4KVAA 2A5FA 4QBGB 2SHKA 2XZPA 1W36C 1OXUA 4VGCB 4TTPA 1QL7A 2V7QD 1II0A 3UMRA 1UCYE 2SGAA 1GJDB 4Q02A 3VNUA 4GSYA 3BB3A 3BG8A 5JB8S 1CIPA 2VHUA 1O2ZA 3WNBA 3ADBA 4HUTA 3CO5A 4Y6DA 4CIDA 1FQ3A 4R98A 3W5IA 3ONWA 1R0WA 1FONA 2TGAA 1DAIA 1MZDA 1KZ7B 1W3CA 1O3DA 4ZCIA 3A88A 3P8FA 3CF0A 3L6PA 1G8YA 2CGAA 3EPHA 1S3GA 3KQDA 3ZYCA 3IPYA 4DY7B 1M1YE 1KXBA 4QHSA 1ZM4A 4UQOA 1GJCB 1HJAB 4C2UA 3PLKA 1O2WA 2C5LA 5EUMA 1E9FA 4TSFD 2ONJA 3HATH 2P6NA 2BV3A 4XE4A 3MJRA 4MPVA 3UATA 4FMDF 5K8TA 2A4GA 3PO1C 3QPUA 1GBAA 1ZGIA 3TGKE 1NJGA 2XC5A 1QZXA 4JVNA 4IEIA 1P9WA 5KPJA 4MA4A 2XXLA 1AE5A 1F0UA 3K9GA 1ZJ6A 2QY9A 1BKDR 5CDFA 3IHWA 1GCDA 5IK2A 2JLZA 3QGNB 3MNXA 2VIVA 4TMZA 5AJYA 3ND8A 1GBMA 3RXSA 1KSGA 2SGFE 4XOJA 2UWLA 1JOUB 1ZM2A 4P3YA 1PJRA 4JSTA 2V6JA 3SNBA 3DPUA 2XTNA 4DKXA 1KK3A 1A5HA 3RS4A 1CT2E 4Q4HA 5A8YA 2VVUA 3T1QA 4DSUA 4ACBA 5TV2A 2BQWB 2BX4A 1E0SA 3ZD7A 1DE7H 1GHBF 1Z6EA 1AWFH 1QHSA 4AGKA 3FANA 1ODFA 4CT4B 3UG6A 3K0SA 3LLUA 2HOBA 1XXHB 3QQ5A 1BTXA 2C8WB 4QXAA 3RVBA 421PA 4AC9A 3UFAA 4E05H 1RIWB 2VSXA 3QG5A 1OSNA 5DPAA 4CEJA 2B6HA 1KK0A 5FBQB 1CP2A 4IW3B 3IBGA 3GFTA 3SHWA 2O8LA 1KZGB 4UONA 4BAHB 1V2RT 3EA8A 2W00A 2OE2A 1UKZA 4KKDA 4HLQB 1NFXA 1W8BH 5JFGA 2CE2X 4ZUHA 1WCV1 4JCNA 4XSHA 4DLRA 1GG6C 3QZRA 1QG4A 2QMHA 4CW7A 4KCGA 1HAGE 2GCOB 5FPSA 1GL1A 1HE1C 2FDCA 4CRDA 2CN0H 2QM8A 3B9PA 1UKVY 4Q7LA 1MT0A 1D5CA 1E79A 1DXPA 4DDUA 3KIDU 1WXQA 3I8XA 2WTUA 2VGCB 4GPGA 4GOXA 1T8MA 4DDVA 4LK2A 4QGGA 2QEQA 2P6UA 1T6NA 5H8WA 4OBEA 1DSTA 3QE0A 1P3JA 3U6KA 3E91A 2GTPA 1NY22 1KAGA 3FMPB 1SLXB 3GJXC 4DLZA 3HWSA 1R5BA 2NPFA 1CTQA 1XD2B 2HPQH 2BHGA 1Q0UA 1LHGH 3NTUA 3S1AA 2BM1A 1IXRC 1YZUA 2CF8H 3K8YA 2QP9X 1XTRA 1T4UH 4J0QA 1MO6A 4Q03A 2W6JA 3SGQE 4Q48A 2WV9A 2XITA 2I6SA 3MCAA 3VKWA 3WY9A 2QY0B 3KXLA 1TX8A 4A6LA 4XOIA 1F2SE 2XB2A 3BRWD 2REXB 2VP6A 4TL7A 3BTQE 4QFMA 1ZHMA 5TY0A 1N6PA 4Q4JA 1U98A 4K46A 3U3OA 1H9IE 1UJ2A 3QVVA 2XB4A 3QKSA 4XVQA 2OTVA 4BASA 1BHXF 4KU4A 1MAXA 1NG1A 2I3BA 3MU4A 4UNNA 2ZR9A 2JETC 3H86A 1KO8A 4LYAA 2JDIA 1XP8A 3NH9A 1P12E 2BBTA 3EWAA 4URWR 2E87A 3UREA 2ZRKA 2C03A 1LV7A 2H9EH 2FM2A 2IYQA 4IN2A 4HDQB 1G3UA 5HYOA 3IWMA 2ZRCA 4Q21A 1O5DH 2GXAA 3RYTC 4F92B 1GI4A 3SUFA 4P31A 3UQVA 5EXSA 1GSIA 2O8EA 5GPIB 1YKTA 2R2WU 1L1NA 5FBLB 2GXQA 5L3RA 1A2BA 5ESBA 2QROA 1QFKH 4OGYA 4Y7BA 2GDJA 2RH5A 1LTOA 3SJKA 5F8ZA 1C2IA 1EAWA 1ZMJA 2OC0A 4M21A 3ZGXA 2FSIA 1QIXB 4H1VA 1OB2A 2C99A 4B43A 5AUQA 1E4YA 1ZD9A 221PA 4LRWA 2Z3DA 4F93B 2IT1A 2CMYA 1SLUB 1BMMH 4K8BA 1AQUA 4FCTA 3GJ5A 1ZR0A 3U8TH 4FMCB 4B71A 3NWJA 2ZE7A 5DGJA 1TGCA 4O3TA 5L8VA 1Q2WA 3E6PH 3N5CA 4TY6A 2CLCX 3LAWA 4TL9A 2HLDD 1O2QA 2C77A 4RD0A 1XTJA 4MKGA 4GCHG 4BZXA 4LGMA 3DKVA 4A4DA 2NO6A 3WMEA 4NE2A 1UVOA 1M34E 1F0RA 1WXRA 2AR7A 4QGFA 2ZSAA 1H4WA 3QLPH 1KI4A 5FR2A 5KO2A 3SFZA 3PWCA 3RAPR 1ZM9A 3JZ2B 1G7RA 1OYYA 2HJVA 1D2MA 2EYUA 1NBME 2PFEA 3BFVA 4B6EA 3ZZ6A 4RKEA 2ZYWX 2OBNA 1TWXB 4Z8XA 2PEZA 3H0KA 5AJXA 3ZVCA 4E5UA 1O3EA 5L3SB 3I62A 4MDEA 1WMSA 1VYVA 2QN6A 3CF6R 1PVOA 4AOQA 1SVSA 3QUMP 4LYJA 2X1VA 2QE7A 3E2IA 1ZPCA 1UTPA 5A8XA 2QPOA 2XTZA 5TDHA 1Q1EA 2OQUA 2ODYB 2HT6A 5E3HA 3TJOA 1Z63A 1OWHA 1DWEH 4NYJQ 3MSXA 2B21A 1IQIA 3QN7A 2JLYA 1P06A 1QQUA 4B75A 3SNCA 3A36A 3PLBA 3Q85A 2H5CA 4I99A 4RCZA 2Z3EA 1OYWA 1IQHA 1OXXK 1TGBA 1GZSA 2GZDA 1QRXA 1KXAA 3C5HA 1A2CH 2HPPH 2W3IA 2BMGB 1EGAA 2NMVA 1LKAA 2J3EA 4PAOA 2Q3HA 3OTPA 4I1UA 2CJWA 3A8AA 3VB7A 3AW0A 3PMHB 4ZIRB 2F6RA 1XF9A 5CITA 5DP3A 2I1QA 2G0TA 4B3GA 2ZJBA 4DCNA 1SGPE 1UBCA 1C5SA 1ELCA 1DT2A 2ZTYA 3PTNA 1UAAA 4IOLA 3BB4A 1FJSA 2ZECA 4PFSA 4PC7A 2ZS9A 2A7JA 2V9PA 4US2R 2YV5A 2QENA 5ESTE 8LPRA 3M7TA 3HYTA 2IWRA 3SU2A 1RYFA 1O5AB 3LXRA 3SW2B 1Z8RA 2A9KA 4BLTA 2FLBH 2FNAA 4A8JA 3NK8A 4UXIA 1F5KU 2R6AA 5C20A 3B78A 4XD7A 4A6PA 1GTVA 1E94E 4M22A 2ZWLH 2PX0A 1I2DA 4TMVA 2VINA 1ESMA 2WAYA 1RTKA 2CHAB 4LC1A 3PM3A 4MG3A 1IQNA 2F3TA 2ZNKH 1UTMA 3GY3A 2G3YA 1D9XA 1RFLA 3M5MA 3PEWA 1THRH 1GMHG 1L1GA 1V43A 3VFEA 4G5GA 5A0FA 4W5HA 3SNHA 3FB4A 1T9HA 2PJRA 5JWOA 1UEIA 3FOZA 4PPGA 2Z5FA 3WMFA 4LPSA 4HATA 5BPEA 1BTWA 3TRFA 5JLJA 3VTKA 2XCNA 2KI5A 3NHBA 1HXEH 2JJ8A 3U44B 2J0UA 4L16A 5C5OA 3VU9B 3PIRA 3BB1A 1KXEA 3DVLA 1FMGA 2GCNA 1GI1A 4B2LA 1EJMA 1O30A 3GCTF 1C5VA 3TNTA 2GCPA 2ODEA 4LJ8A 2D2FA 2JATA 4DXAA 1C9TA 3BG4C 3SUGA 1QB1A 1L2EA 2PT7A 2ODBA 2VQSA 1F92A 1OP0A 1FXYA 1R4AA 5F8XA 3QJYA 1GBIA 2H1UA 3RM0H 2J9NA 1XVOA 3M3TA 1CHGA 5EP4A 4NWKA 3K9NA 1LVOA 4NFFA 3OEHD 5KTYA 3QKRA 4F38A 3RXEA 1CU1A 1O35A 4PC2A 1SVMA 2ORVA 2V6IA 2XC0A 5LPEA 2P59A 4M7GA 1VGCB 3K65B 3GYMA 2ZGCA 3FDIA 1W36B 2JEOA 3QBVA 3NHAA 4EUNA 1B7XB 1PLKA 2FN4A 3RXJA 4CBOA 5GVRA 2W83A 3GEHA 4B44A 1KYNA 3UR9A 2RHMA 4CYMA 3LW7A 4LJAA 1HIAA 1KHTA 1HAOH 1E2LA 4YT7H 3A7XA 1XXHE 3BTWE 1DELA 2R0LA 4LBYA 1GP2A 5EP1A 1DAGA 1CA8B 2VWLA 4F7WA 2IW3A 2CEAA 3PEUA 1SXJC 3WHKA 3A7TA 4M4SA 3A7ZA 3ODFA 2Z94A 1M7GA 2O8TA 2IBMA 4AK9A 2ZEJA 1FUUA 3TPIZ 2IXEA 3ATKA 1GDQA 2EQBA 1GRRA 1SHZA 2IX3A 4XTRA 3PV2A 1XEXB 3NC1C 2J0QA 1UK4A 1ZMXA 1ANDA 3RDZA 2VA8A 1Z8FA 1F2TB 3BC1A 1T31A 4DUGD 4JLOA 3MD0A 3O8RA 4YONB 2QM7A 3THWA 3ZV9A 6CHAB 3VNVA 4A5TS 1T7CA 2YJTD 4BRWA 3CBQA 4QT8C 4B3DA 4D81A 1GBDA 2QP3A 2ZDKA 3NBYC 3OSYA 2N1BA 1BBRK 5C3NA 1NC6A 1NU9A 4OS2A 3OFND 3L0PA 3SZRA 1W7AA 2QAJA 2XNDA 3OEED 1XMIA 5FOVA 2KWIA 1S0RA 4BLPA 1JBKA 2AXPA 2R65A 1GI3A 4ZHAA 5GJWC 5EPYA 2W2XA 3W5JA 5J40A 4NCKA 3A7WA 4WH8A 2A5YB 2QCYA 3KKNA 1IQMA 3W3AA 4JLNA 3CM0A 3ZS9A 5E7MA 1OH6A 3T15A 4JLKA 3V00A 3AVYA 2CL0X 4JT2A 4UDWH 3A1TA 5A09A 1GMHF 2YOFA 1T91A 1ETRH 1D2EA 3URDA 1YJ5A 1AUJA 3TIFA 4R7ZA 1K1JA 3D49H 3DD2H 5J4YA 4URXR 3IQWA 4HDOB 4PAMA 3PXGA 1PFXC 3BERA 3QXJA 1W0JD 3S9AA 1E98A 3NXPA 1GBLA 3V0XA 2DFKB 4OS7A 3PYHA 3R7WB 2R2MB 2EEKA 4ZKRU 3V9PA 2WJGA 3O8BA 1XB2A 2Z7FE 1OP8A 2P0EA 4ABHA 3R20A 3AUXA 1KI3A 3MRSA 1TF5A 4Q1EA 1NBMA 1C2JA 3EIQA 5KSZA 621PA 4OQLA 2ZUBA 4ISIH 1E9EA 1O5GH 2HDNB 3GY5A 3A58B 3QK1A 1ABIH 2IYVA 4MNWA 3UWKA 3MWKA 2GCHF 1G17A 5UKDA 2QMEA 4X8HA 1F0TA 2D62A 1KMQA 4LBWA 1GILA 2V3HH 2F9LA 1GBHA 2GILA 2A5KA 2P5SA 2FG5A 2IWHA 5FX5A 2WHXA 1A3BH 1E0JA 5E0GA 1TLDA 4DLXA 3T1VA 2GVDC 5DE3A 2CCGA 3TMKA 3P20A 4R2HA 4NYIQ 3MH7A 4ESHA 3P8NA 1ZU5A 2QA5A 3WYGA 4DJZB 4LWZA 1GI9B 1S0QA 5TCAA 2J87A 2J41A 3IHLA 1G3EA 2BM0A 3CWZA 2YINC 1AN1E 1VCIA 4Q4AB 4RCYA 3ZZ0A 1FMLA 1U8ZA 1GMDG 5AF9H 1CRPA 3PV4A 1O3FA 2FIRH 2G00A 3BSQA 3ZLJA 3Q5DA 1EQ9A 4YDHB 4A2QA 1AFEH 1OH8A 2XBVA 1ZUNB 2VWOA 2ZHFH 3UNRA 4EJSB 2WAXA 3C1KA 4PZZA 3SZEA 3ZZ3A 1FUJA 1Z5ZA 4I1VA 3MGCA 1ZCBA 4C0KA 4FIDA 2VEDA 1V2PT 4DOQA 5D3MA 3AVTA 3TJVA 1ZTKA 3MUFA 1T8LA 3H7OA 3LFUA 4BFTA 2F4LA 2XXAB 4XVUA 2SGEE 4SGAE 1HCGA 1Z0FA 4LV5B 5EOKA 3K70C 1MABB 5ABWA 1YGCH 3L0OA 4CREA 4WZ6A 3BWDD 2B7DH 2JCSA 3OYPA 1GJ9B 3BTFE 3BTHE 3KEEA 4HYYA 2ZU4A 2ALVA 3EW9A 4CH2B 1VECA 3S9CA 3MU1A 2EWWA 2SFAA 1GHZA 4QL3A 3EZFA 3EA5A 2V6NA 3CNLA 2GV6A 2OO7A 1HNEE 1LY1A 1DLEA 2Y6TA 1OWIA 1FNNA 1H8EA 3FHCB 1A1RA 2BDBA 2RGDA 4ZHMU 3GEIA 3K09C 3EZ2A 3CNNA 4C0BA 1QHIA 4TYNA 2XAUA 2PTNA 1ZRBA 3L82B 2VSOA 3UPUA 1UPTA 2H1LA 4KJZA 3GLGB 1DPFA 4ZDKA 4RSPA 2GETA 1ZLRA 3B1YA 1P02A 3AF2A 3KUDA 1DPOA 1MTWA 2HNTC 3S7KB 3H09A 2UWOA 4JZEH 1BTPA 5SZKB 1M6NA 4LJ7A 4LUCA 1ZSKA 3RXMA 2ZCHP 4E7RG 1OPXA 2XEXA 4P4SB 1S2MA 1FUKA 1LQDB 4X6MA 1DOAA 2ZREA 2PCJA 2Z9KA 3TLXA 4Z1MD 4GVUA 2REBA 2RMKA 1SGCA 1DARA 1KDOA 1GVZA 1C4Y2 4ZO4A 2P8OC 2ZIQH 2P65A 4E09A 3HU3A 4CR5A 1EAXA 4TLBA 4CEIB 4Y0VA 3PENA 4INHA 2M5TA 2AXNA 3GP8A 1X3SA 5JI2E 2WSSD 5HE9A 3ZZ7A 2G81E 2FXRA 4XSKU 1BCUH 3RS2A 3BGWA 1O5BB 1HTWA 2QT0A 1H8HA 1XXDA 4IXNA 1XMSA 2GZ7A 2GTBA 2OBOA 2GESA 1K8RA 4DLWA 4YT6H 1A46H 1XXHA 1NM6A 1SGFG 2QTVB 3N2IA 2WJJA 3NEYA 3RS7A 3IIJA 5K8IA 3L8ZA 1VPLA 1KAOA 2AHOA 3VMFA 5B58C 2WYGA 5FBIA 2SGDE 3KQBA 1DAHA 1SVKA 3WRYC 5AVDA 2AERH 2A7QA 3SC3A 5DO4H 5EGMA 1UBEA 1Y3AA 2OINA 1CR0A 3KUCA 3FP8E 4X8UH 1DY9A 2NQ2C 4ZROA 4LX0A 1BMAA 3LGYA 1TL7C 1IQPA 3FZZA 1KNXA 2IUUA 1TGTA 1FY3A 3PV0A 1GMDF 2R9PA 2GF0A 1O2VA 3U60B 2BTCE 4ABGA 1ZVQA 1LVMA 3PUZA 1TA6A 4R9UC 3ZVAA 5D3QA 2QMUA 2X8AA 1XDBA 2JJ1D 4K1SA 2GK7A 1G32B 2GCOA 3UTUH 5JJIA 1DADA 1BTUA 2ZE8A 1ZBDA 1VG8A 1O2PA 3T34A 1KI7A 1TU3A 3ZS8A 2Q6DA 5DI9A 4TYDA 2QYIA 4KP0A 4D4MA 1W5TA 1TADA 2V7QA 3KJIA 4ISNA 4YMVA 1TONA 1Z07A 5GIBA 4TMKA 8ESTE 4RZUA 1GM5A 1XD2A 1Z6TA 3BF6H 1Q57A 1S1CA 1RS0A 4X0WU 4LC0A 4GMDA 1G41A 3LXXA 3TAHA 4B48A 3A1UA 2FDAA 2ZFRH 3EQ0H 3BD9A 4Q7XA 1IQFA 2WPLS 4DURA 2BMFA 5JBQA 3GJ8A 4Z8YA 2CDNA 2AH4X 4K8YA 1HPGA 1HUTH 1WQ1R 1GFIA 4AKGA 3MO9A 1IHSH 4K60A 4A8JC 1E2PA 4DCDA 4D4LA 4X8SH 2BOVA 2WMNB 4V0KA 3K1JA 4Q2KA 1Z71A 1D6RA 2PUQH 2WIBA 2P3SA 4XFQA 2GZ9A 3U3MA 4MRPA 4TSFA 2ANBA 3QWCH 1KJWA 2BCGY 2ZDNA 4BTIB 2CVFA 2BQ7B 3ZVBA 3SU5A 3RXRA 4DIHH 4ABJA 1P2TA 1ZINA 2FSHA 2IYUA 3I72A 1JNYA 4A2PA 5F9FA 1P9UA 1CA0C 2ZANA
chains in the Genus database with same CATH superfamily
3I6ZA 1S2IA 5K3SA 1R0XA 3C6KA 4AG6A 5TQJA 2ABWA 5CMXH 4UM5A 2QWXA 4DMKA 3UM9A 2JFVA 5A05A 5CJ2A 2ZETA 4A5OA 3BZWA 1U0TA 5C31A 3RTGA 5IZCA 3M61U 4OS6A 3B38A 2GEJA 5BN3A 1UC4B 1M7BA 1I01A 1U9JA 4F4FA 3RRZA 2ZT8A 3L8EA 3KYCB 2P0YA 1R50A 1YDHA 2AT1A 1N6LA 2NU2E 1P31A 2VJMA 3CPHA 4G85A 3F8TA 3UYKA 4FCVA 5T57A 4EPXA 3FNQA 4Z2YA 5DU2A 3OZGA 1NSTA 4H2DA 2Z3WA 4NFLA 1GL0E 4PZ9A 1YCDA 3D7RA 1O2XA 1UT8A 5HXFA 2Q3MA 1VLJA 1EE9A 4NFYA 2H1VA 1A9ZA 1LK5A 3IEMA 5SYNA 3R7NA 1U99A 4E7OA 5LDHA 1CS0B 3KQUA 3QEKA 1G291 2XNIA 1AHHA 2G5NA 3DLTA 2VHQA 4RVHA 1ZGZA 3K6SB 4NYMR 4YRRA 4NBTA 4OSOA 1HOTA 1XM1A 1BOQA 3VB5A 1RAIA 1WTAA 1JKJB 2PXXA 5A04A 5KREA 4CV0A 1ECFA 4JELA 1DG9A 1Y3VA 2A1IA 3GEEA 3VR4H 4FXPA 4DCVA 1PT7A 3OQBA 2PGQB 3QU2A 8KME2 2G5TA 1P2QA 5BSKA 1X74A 2QAAA 1GDNA 2QT1A 2GZAA 4P2BA 2IC5A 4A7IB 1M33A 2M6RA 1XYVA 5CBPB 1WW8A 3ZY2A 2GZ8A 3GLFE 3N99A 4NIVA 3AR4A 2QBYB 3VC1A 2VJOA 4CI0B 2KM1A 3LUDA 2CHQA 1L7BA 4GDMA 1A1VA 1AV6A 3BDAA 1MOPA 4IMQA 3MWFA 2C2KA 2ZG6A 2QUJA 3GXBA 4CKCA 2PR2A 1FQKA 3B7GA 2CV3A 4REQA 1DXYA 4IZOA 1ZSYA 2PFGA 3HXMA 4CH8B 3GVXA 5AW3A 4RQAA 4I8DA 2PH1A 2QRQA 4LJYA 1PX2A 2FOFA 3C16C 1LDEA 4ERNA 4MV3A 4Z49A 1Q3TA 3B2QA 2BJHA 2WPJS 3F3KA 1FVHA 1O39A 1GA1A 3DUWA 3AW8A 2BD5A 1I0IA 3DQZA 1PSZA 1MBZA 1V35A 3MNFA 1RHMA 5IM4A 3ZWDA 5CDUA 1OU0A 4JENA 5B58T 4B2AA 1L7XA 2ZBVA 4HH1A 3WWDA 2XMCA 3EASA 4KX5A 1CFZA 2EBFX 1XEWX 5FHQA 3NWPA 1JIRA 1MQ8B 1DRKA 4EELA 3TQIA 4HLDA 3FVQA 1G3MA 1QCCA 3VR4A 3VPGA 3JSXA 4WJZA 3Q2IA 3K0CA 1V9SA 1ZJYA 1V2LT 3QPCA 1JSZA 2OA0A 4LRTB 1AO3A 2O3UA 1C2HA 5C5IA 1C2DA 2QF5A 1MO5A 4QBHA 1RHRA 2C78A 3ME5A 1C81A 3FYDA 2ODQA 2Q6GA 4P98A 2JBWA 3QPWA 3U44A 4HHEA 4G1FA 4MLDA 1P9OA 4A0HA 1LLQA 2IZ7A 5JZMA 3ZY6A 3VNQA 3Q3KA 3R6WA 4IDCA 5JXGA 5E0OA 4YP9A 2RH9B 4RNDB 2PGLA 1U6QA 1QTIA 2C4TA 1ZK3A 3ROZA 1RM3A 4DRZA 4U7HA 1IHYA 4BMDA 2VSQA 3BMCA 4C5BA 1EI9A 1S2DA 1T2EA 3ZLUA 2NO0A 4J07A 1XO1A 3GDUA 1PP4A 4P93A 2V3OH 4BX8A 3IRUA 1CVRA 2DBZA 2EFHB 1AK2A 8AT1A 2NTJA 1B5GH 2Q5CA 1J0AA 5LXTB 4ALMA 2WU3A 3LYHA 1N8NA 2H9AA 2HSWA 1T2VA 3NGXA 3IIKA 4WV3A 4CUZA 4YJGB 4MITA 3DE3X 4JKYA 4YMWA 4HI3A 1YJAA 5EIXA 1ZI8A 1QR2A 3SU8A 4R84A 1IXKA 2FX4A 3QFHA 3SAJA 4K6KA 3GQBA 3WYAA 1QCPA 3OQ1A