4B73A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 209
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b73A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b73A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b73A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b73A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b73A03
1YR6A 2ZCKP 4QOSA 5FR2A 1EOLA 1ZINA 1G8YA 4FXPA 4PZYA 2FI3E 4UNNA 2WPLS 1NBMD 2R6GA 3OFND 1A0JA 1VMAA 2HNTF 4RKOB 4G0NA 2WSMA 2WJVA 1XTKA 3K0EA 2FA9A 3G01A 2YWEA 4HB2A 3LH3A 4BFWA 3B9FH 1O3YA 2BJVA 1D9XA 5ESTE 4YDHB 5DI3A 4Q1BA 3E8LA 4M1TA 1K2I1 2PTCE 1BOQA 2D62A 3SBEA 3F5FA 2QXHA 5FX6A 1OWDA 2XTZA 2ZE8A 4IXNA 1ZBDA 1N6OA 3KL4A 3TGJE 3C8UA 3CIOA 3RNLA 1OW3B 3QPWA 4NIVA 3FP7E 4H42U 1AN0A 5KOYA 1KYNA 1ZTKA 2LPRA 2GCHG 4OGYA 4DCSA 3TJZA 2P6NA 1HYQA 4X8OA 1ZTLA 1EFUA 1C2EA 1ID5H 2WOJA 3GJ6A 1RFLA 4LUCA 4BLRA 3BWDD 2XNIA 3D23A 1AE8H 1NIPA 3W6NA 3FOZA 1Y3WA 5BQ5A 3MJRA 2BKEA 2A3RA 2G55A 1YPEH 2ANMH 4R71A 1GBTA 3LQRA 4XBCA 1KO7A 4ESTE 1IQJA 3KDSE 5FL7A 5EE5B 3GY3A 1PFXC 2VWOA 3BTHE 4GHQA 2VP5A 2YVUA 5JWHA 1O5GH 2E9SA 1ELCA 4L16A 2XW9A 2ILNA 1JPNA 2XTMA 1S6HA 2BX4A 4M1OA 2GXAA 5TARA 1QQUA 4JLNA 1EKBB 4FUIA 3AF4A 3GJ5A 1DO2A 4OS6A 3FKQA 5EP3A 4PO1A 3RLWH 3IG6B 2GMTC 3RXLA 2HCBA 1LPZB 2RAPA 1S9DA 2GXQA 5G3YA 4LJ7A 1QL9A 2D2DA 3TLOA 3ZZ3A 2JLXA 4INLA 1Z0JA 5L30H 2FFQA 3OSYA 2BVSH 2H5CA 1T3LA 3TR0A 5EXLA 1Q44A 1GMHF 2R2WU 3V4FA 1KOFA 5F8XA 1DDJA 4F4IA 3V7TA 5AFZH 2C98A 5H70A 1AY6H 4DCDA 1FX0A 3B1ZA 2FNAA 2P3SA 2CHAB 4WXVA 3FHCB 3ND8A 4RFVA 2SGEE 1ZMXA 3QUMP 2O52A 4Q1AA 1P2SA 1DPOA 1YZKA 5CLQA 1HURA 4AN7A 1NSTA 1SXJA 5JEEA 1T0JB 4E05H 1OP2A 4FUDA 1QRWA 4UXHA 4BWYA 3PEYA 2PMDA 4X1RU 1AD8H 3ZVNA 1PJPA 1T5IA 2HPPH 3D65E 2A9KA 5M04A 2JLYA 2WPIS 3FWYA 3MI4A 4M7GA 3CONA 2VH6A 2F9LA 2QL6A 2ZKSA 1GM5A 1TA6A 4JVNA 4B34A 4HB3A 2B7CA 2ZI2H 3RXIA 3C4JA 3Q5DA 2LWIA 3CH5A 4BPBA 4JBYA 1VHLA 1W36B 3ADKA 4LYAA 1U8ZA 1HE8B 2AL7A 2H5DA 4ISNA 1UDWA 3W5JA 4AYYB 1O2XA 2PR3A 5T6DA 3WMFA 1HAXB 1QCPA 1Z22A 3KXIA 3ZZTA 4ERNA 4FMCF 5E95A 2QUZA 1P04A 1C2KA 3M37A 4QL3A 3SYNA 3AUYA 1W7AA 1RZ3A 4QBIA 2J7KA 1PPCE 4JYCA 3UMFA 3RRYA 1C5WB 1EAWA 3TJNA 1C5XB 3VU9A 2VVVA 2XNSA 1O2SA 4WZBE 1GG2A 4UXJA 4FIDA 3RUOA 2RGNC 2G1JA 3VKHA 2BMJA 2RCNA 1WA5A 5DISB 2CF8H 1NN5A 5FR1A 5FPYA 3E6PH 1ESTA 1MKYA 1T4GA 3B1VA 4TTRA 3MU5A 5KTYA 4NZLA 1SQ5A 3EQ0H 5HZHA 2B6HA 3CPEA 4HB4A 4RVCA 3BTME 4NCIA 3KB2A 1DSTA 1HXFH 4PZZA 2Q1JA 5FOWA 1N6LA 3T06B 2TGAA 3SS8A 2Z3EA 1FTSA 1NN3A 1E9FA 4AFQA 2F43B 6ESTA 3CR7A 1TF7A 1TNGA 1YCPK 2QE7D 1V2WT 2WJGA 2OHFA 1XFAA 4B44A 1J2JA 3S69A 1YPMH 1AB9B 1KSFX 2STAE 3EA9A 1G7RA 4B43A 2IHYA 2ZU5A 5FTLA 3BB3A 4B3CA 5HXFA 1O3LA 1BKDR 3THYB 3HPRA 3TIUA 3ODDA 3HR7A 3E1XB 1OIWA 2ZANA 4LV5B 4IGDA 3MH5A 2RA0A 5LGOA 3GEIA 1NRQH 1KSJA 1L4YA 1V2TT 2ZYWX 2C95A 1ZM7A 3SV9A 2W26A 3ZIAA 4AURA 1KO1A 2J0SA 4NIXA 2F1JA 2FSHA 4TQUS 1O5AB 5JWOA 1NG1A 4GL2A 2OBLA 1CR2A 5EW1H 1IONA 2P8OC 2FPMA 3M3TA 3T5DA 2RGNA 1JWTA 5DE3A 1F7ZA 4Z8YA 1O5DH 2REBA 4ZKDA 3QZQA 1FUUA 3LLUA 1S0RA 2BDIA 4FCTA 2ZFPH 4EPXA 2WYJA 2G1KA 3V4RA 1UCYH 1A0LA 4JMYA 5CITA 2BY9X 5GADl 2QT1A 4MNYA 2PZFA 1J15A 1W36D 3LJJA 3P1JA 4KTUA 4AKIA 2HF8A 2ZIQH 1F2UB 1N5KA 3I1FA 3SGBE 4AG5A 1MRSA 1CULC 1SFIA 4DCUA 4N0EA 2ZEJA 2OZEA 3EGKH 1QB1A 3CNOA 5EW2H 4AFZA 3TNTA 2PEZA 1TABE 3DT0H 3EW9A 1COWA 4PXAA 5DP9A 4DGJA 5EODA 1EX7A 1RRKA 2BDTA 5J4VA 3SNHA 3QG5A 2FV8A 1CA0B 2PKAB 4I81A 1MKXH 1GL1A 1M7BA 2ZO3H 1CJKC 3H1TA 1OXXK 5PTPA 4I4LA 1KKLA 1SGEE 3BAFA 4IN2A 3GQBA 3WP1B 3VR1A 1VHTA 5L3QA 4AG6A 3AM1A 1G41A 1K8RA 4CBNA 1MT0A 5C4GB 3I61A 2GNOA 4HSEA 2P16A 3FZDA 4IBLH 5BW8A 2CV3A 2JLSA 2FEQH 4PHFA 2FPLA 5L3SA 3PG5A 3RS7A 1NFUA 1TBQH 1O5CB 1IN6A 4Z51A 2J0UB 4AYWA 1E79A 1QA0A 4YDSA 4BE7B 4QFMA 1RTFB 4BFYA 3SNCA 2C9OA 3Q85A 2SFAA 3SU1A 7GCHF 4NONA 3EG5A 3IQXA 1NIJA 2P3FH 4C0SA 3MYWA 2G83A 4TN1A 5AF9H 2JH5D 2ZQ5A 3RMMH 4JT2A 4A2WA 1JR6A 2BQ6B 2XEXA 1P05A 4YXWA 4IRUB 8GCHG 4PPQA 5G3ZA 521PA 1BMAA 4KTCA 4RD3A 1HFDA 4C0AC 4LV6A 2IEYA 4MRPA 2O8UA 1EPTC 3WNBA 4TL8A 1TQ2A 2FOGA 1BRAA 1QGFA 2A1DB 4DT7B 1JOUB 2GV6A 3RLFA 3NEJA 3QSYA 1AHTH 2BXUH 5D3MB 1KI1A 5EXXA 2ZQ2A 4KI0A 3RXOA 4NA8A 1AGJA 3RDPA 4KLZA 2OE2A 5GVSA 2VA8A 3DZ8A 4E7NA 1MQ5A 4M1WA 1E69A 3LAWA 2DWQA 5DYIA 1P12E 5HE8A 3ATIA 3REGA 5CMXH 2B7DH 1LS1A 2RH5A 1N5JA 2QBYA 1IQIA 1TALA 3RXRA 2GF0A 4ZKOU 3N5CA 3DVLA 4V02A 1SVWA 2Y5GA 3TH3H 4A0GA 3OIUA 1JEEA 1OE0A 1P73A 1ZW6A 2ZJ5A 1YKSA 1GBCA 2VIWA 3SJOA 2DFLA 2YINC 4NYMR 2G0NA 4DIHH 1Z07A 2PH1A 3RS0A 3B1XA 4IOJA 2A78A 1C1UH 3ZVAA 1EPTA 4A2QA 4BUJA 4U01A 1UKEA 2JLZA 2J92A 1RIWB 2WTUA 5ELXA 2AK3A 1LMWB 3QZRA 2ZFQH 5DPAA 4S35A 2WWYA 1M1YE 2NU0E 4B1TA 3KHVA 2ZJZA 1KNQA 1EESA 3OIYA 4A0HA 3E1SA 1W0YH 4I32A 3RXKA 1FOEB 3PEVA 2VP4A 5IF9A 2PT5A 2QAAA 4Q7MB 3I29A 2H8KA 1O87A 4WVFA 1NTPA 4B3DA 1SHYA 4UKDA 4IMQA 2RGXA 4OQXA 3R9WA 3DDCA 2KE5A 1P9WA 3MD0A 2V35A 2OV2A 1G2MA 2GESA 2G81E 1NRJB 5FTKA 2ZG0H 3U7GA 3EPHA 2A4RA 2MSEB 2GKVE 2IPHA 4VGCC 2J7PA 2ZRKA 2AYWA 1IJEA 2YHSA 1SQAA 4CRAA 2FI4E 3FFGA 5EXPA 4K2YA 2FX4A 4JZFH 1XU4A 3SUGA 4ABIA 4OHYA 2QC2A 2H2ZA 3K53A 4BOHA 4V03A 4O3UA 1O2LA 2QSYA 4QRHA 5DP4A 4ITRC 2QV1A 2O8EA 1A3EH 2NIPA 5HPYB 5DGXA 3DKVA 3A7TA 2DBYA 2WIAA 4F92B 4C2UA 5FUXA 2OCYC 1YZGA 2XTNA 1DXPA 2HEIA 3EPKA 3Q76A 3GFTA 4JLAA 5TMPA 1VCQA 2GHIA 3SV6A 4PC2A 5FOTA 2A2XH 2DHRA 1C5VA 1US8B 1FPCH 1KGDA 4B75A 3CNNA 2FO9A 2VP0A 5HCNA 3CW2A 4DVGA 2R44A 4ACBA 2WPDA 2R6AA 4QM7A 3OTPA 2A30A 4ISHH 5EE1A 2PKSC 4A1FA 2ZUBA 1NM6A 2HJVA 4PC7A 1XD2A 4BEJA 4ZDIA 4IOKA 5AFYH 3GLIA 1MTSA 5ESBA 3EA0A 1JBKA 1UTQA 3GCOA 1UO6A 5CK4A 3R20A 2DR3A 3L2OB 7ESTE 5J4YA 1IY0A 2O8FA 1KLJH 2Y80A 1E2EA 4M22A 1BTPA 4Y10E 3UREA 2IS1A 4PFSA 3ZVGA 1WTGH 1RJXB 3E90B 2XJ9A 4WA7A 3BIFA 1PV4A 2RKOA 3IBGA 1O3DA 1DY9A 3ZVBA 1HH4A 4JZ1A 2F3TA 1XCPA 4KAXA 1PPHE 1RS0A 2PSXA 4HAUA 2RDLA 2JLWA 1W2KH 2HYDA 1V2ST 2BLWA 2UZIR 1S8FA 2WV5A 1JR3E 2D2FA 3U7FB 1W4BA 3NZIA 2O5VA 4I8JA 4D4LA 1BIOA 3ADBA 2ZHQH 3GYLB 4QM6A 3EZ7A 4C0HA 1AN1E 1QIXB 1J8YF 2QYIA 2HUPA 1GITA 3I62A 5JS7A 3RXQA 2C9YA 2Z4RA 1PQAA 1UFQA 2FEMA 1JQJC 2ZDVH 4HAVA 3UMSA 1CGHA 2BDCA 2XSZD 3QKRA 2BHRA 2Z3DA 1EB2A 1E4VA 4EPTA 4KU4A 1C2LA 1EASA 2IYYA 5HGGA 4ON9A 1T8MA 2FOFA 5FPSA 3RM0H 2J41A 5HMAA 5C2JB 2H9TH 4HFPB 1K1LA 5B6LA 3IITA 4AGKA 5FI0B 3T25A 3I73A 2V6JA 2AEIH 5EUQB 5GJBA 5HTKA 1BMFA 3BTEE 1FDPA 2F9BH 3I3SR 2CK3A 1TPSA 1GL0E 1CGJE 2F83A 3UUZA 4DURA 3BEIB 1Z0FA 5K8LA 1JAIA 4O97A 1DAGA 2GXUA 2B8OH 4HZUA 2HXYA 4FMBB 5B2ZA 3MWIU 2OCPA 1J9CH 5JB8S 3GLIE 1CJVC 1VCOA 2GEUA 1KY9A 1TRMA 3SHAH 2UWLA 1UVSH 1GCDA 5DIFA 4D82A 3B1YA 3KQLA 3THOA 1GJDB 1N6YA 4EDHA 4UNRA 4FUCA 1KI6B 4XD7D 2VGCB 1FPMA 4ESHA 2VF7A 1GPZA 3GMTA 3X1WA 5EU8A 1DM4B 2J9NA 1KDTA 1LKBA 3M5MA 1UVTH 4P4SA 2C8WB 3NXPA 2ZETA 3FPAA 3Q8XB 1UJ2A 2QQ0A 1FAXA 3RXGA 1KLTA 2BQ7B 2ZF0H 1PPGE 3NTUA 3GD7A 5SZJA 3CRQA 3RC8A 1BTXA 3OEED 2BMGB 1DAFA 4ZH8A 2FZLA 5TVKA 4L4UA 1SGTA 5LBIA 1P57B 3G5UA 4DDUA 2NU3E 1ZPZA 4GP7A 1AE5A 4L9SA 4GNKA 4CVNA 1W0KA 3LWNA 8ESTE 4URZR 1Z2CA 2VBCA 1AKEA 2QTVB 4TL6A 1XRJA 5TXGA 2ZRPA 1F0SA 1GHAF 5FXLA 3MWJA 4AG1A 1NROH 5JECA 3TUZC 1B23P 1O2HA 1N8OB 2XXLA 3NUMA 2JJ2D 4WMFA 2LKCA 3RMNH 3HR8A 1KDQA 1Z0AA 2PZGA 1HCGA 1XUGA 2IHBA 3CPJB 1AGRA 3VB6A 3V13A 3X1DA 4IC6A 2PL3A 2ZRBA 1N25A 1RD3B 3ZZ8A 4RZ3A 2AFHE 4FUGA 1CHOF 4LBYA 1ELFA 4D6PA 2FYRA 4NPHA 4O0MA 4D2IA 2IUUA 1CKEA 1ZIPA 1VITF 3U8RH 5A2MH 1E94E 4YOJA 4LJYA 1G7SA 2P5SA 2OM2A 3IGFA 1FTNA 2FOCA 1Z47A 1M2OB 3VXEH 1X8KA 4TTQA 4LK4A 1G18A 2UWOA 4Y7BA 3DHWC 2WOOA 1NLFA 3KCGH 3S9BA 1DWBH 3KUDA 4BLPA 1FY5A 4LZ1H 1KYIA 4TWWA 3KUCA 4ZIRB 3A36A 1P61B 6GCHG 2P6UA 1XZQA 2YJTD 3ZVEA 4NYIR 2MMCA 1GDDA 1IY2A 2WJIA 4D0GA 4F91B 4TT3D 4DLWA 4AOQA 1KKMA 3A8DA 1TX7A 4DEXA 3UTUH 4CHAC 2KAIA 4IEIA 2GCTC 5FAHA 2ZI3A 3A58B 2BX3A 2ESTE 5LPFA 2YWHA 1HAHH 2QZ4A 1GFIA 5C1UA 3QOFA 2LNCA 4OK5A 1TNIA 4YT7H 4IDOA 5CK5A 1RXPA 4GOXA 1Z1IA 4J1YA 1CF4A 4D9QA 1AUTC 1WAYB 2GILA 5JHGB 5A8YA 1CGIE 3WXMA 2ZJOA 3R9XA 1NNEA 1ZMJA 4IOMA 2ASUB 2CCJA 2QXGA 1KO4A 1CE5A 1FL9A 3RS4A 2VO1A 2SNWA 3DD2H 1AFQC 3PUWA 2ZU6A 5BYKA 4YMWA 1N0WA 4A0FA 2WWIA 1QHGA 1XMSA 2WJJA 2DFKB 3SU3A 1TMKA 3BE4A 4CEIB 1DVAH 2VTKA 1P72A 4VGCB 2GDEH 1YRAA 1XVMA 2W58A 1IAUA 5C1YA 3L0SA 4U00A 1R0XA 2EFGA 1BRBE 4XTCS 4QXAA 4GDFA 1ZU4A 1GBKA 1VJAU 3TLXA 1KI4A 3PFIA 1GHBF 3QGNB 1C1YA 3LX8A 3GLFA 2XNDA 3AUXA 3D31A 1AGPA 3M3SA 2VINA 2EYUA 1VTKA 4PHHA 2P0EA 3HGNA 3NBFA 1T8UA 2ANCA 5BRRE 1T3SA 1V2QT 3EPJA 4DOQA 2AMQA 3REFA 3AGPA 3FHOA 1D3DB 3QPUA 4OI4A 1OKXA 3ZZ7A 3KQKA 3AKCA 3RMOH 4PC6A 3W95A 1WMSA 1C1VH 4D8NA 2UUJB 1O5BB 4E7RG 2R9VA 4GI7A 1GI0A 4B3BA 2O8CB 1F2TA 3A82A 2A5KA 3CF2A 1FZZA 1O2QA 2YYZA 1Z6AA 3HK3B 4FVBA 1NMZA 4A9AA 4AKGA 1IXSB 1JXMA 1O35A 2FS8A 2IOTA 2ZR0A 1L8QA 4KBGA 2BLOA 4PAOA 3ATWA 2ODNA 2CNWA 1CEEA 2I1QA 2KJQA 3T29A 4ZUHA 1XTJA 1OKKD 2QN6A 3I4LA 4B33A 1H8DH 3LDAA 2IYWA 1VZQH 4DDTA 1OWIA 1KZ7B 3T1TA 5DHAA 4R98A 1FLEE 4KYUA 1MABB 2V1XA 3FKSD 2QMUA 1BOFA 3CPHA 1HGTH 4R2IA 2UKDA 1E2LA 5AJZA 2Q3FA 3L33A 1F6BA 1UCYK 4PZLA 2WAYA 1Z6XA 1CIPA 1QL7A 3VB7A 4AB9A 4GSYA 3PMBB 3P20A 3PLPA 3U4QA 1Y63A 5DI3B 3U3MA 4FXGH 4NL4H 1FJSA 2C4FH 4HUQA 1NFXA 1O3OA 5T3HA 1SC8U 2QI9C 4Y0VA 5KSPA 4Q7XA 4DLZA 1C1PA 1T4UH 3GLHA 5A4JA 2OLJA 1K6MA 3A86A 621PA 4KHZA 2QN5T 1QHHA 4ABDA 1KSNA 1RTLA 2GP9B 2ZDMA 5JI2E 4UJ5A 1C2MA 2IYUA 2YOHA 4XWAA 2UUYA 5IDKA 1XCGB 1ZNWA 3M61U 1J8MF 4MYTA 1JBUH 4LCBA 1KZGB 1QBNA 2WUBA 2GCOB 2RGDA 4YM9A 1XF9A 1GL7A 4FU7A 1OSSA 4LDJA 2ZRLA 1DAMA 2ZA5A 2JLVA 1S85A 4GBMA 1WOFA 3OEHD 3A4MA 4L15A 3QDZB 2QCYA 721PA 4I1OA 1DEKA 2IWRA 1Y3VA 2DY1A 2JDIA 2DWOA 2FM2A 2G8TA 2FH5B 1W4RA 3T15A 3SJZA 2J0VA 3SQXA 3O8CA 3AVPA 1GAJA 3FANA 2FPKA 1LNZA 1AM4D 4CREA 4PQYA 1ANBA 1E9CA 4LC1A 1OWJA 5EUMA 3HWSA 2TPIZ 3AQ4A 1O3BA 3MU8A 4GPTA 3GCHC 1W4CA 1AA9A 2IYVA 3FAOA 1Q12A 1SGFG 4BLSA 2CN0H 1FP6A 3AKEA 1TU4A 2WPKS 4B2AA 2ZDNA 2PUQH 3W8NA 3GPLA 1D6RA 1EWQA 1P9SA 1QBVH 3MNBA 5H1YA 1EFTA 4IMZA 5EXSA 4CDGA 1GJ4H 1VDZA 2GVFA 6CHAC 3OZXA 4HZIA 2GJ9A 4QNMA 4URXR 2VSFA 3K0CA 4PX9A 2GZ8A 1F0RA 1FW6A 3CRMA 1OYWA 3UK6A 3I5XA 5JFGA 5EQSA 1FX0B 3GY7A 1GI1A 1C5MD 2JJ8A 3VB5A 3FVQA 5F8TA 1C5LH 4NSVA 2WM9B 5JWRA 2V7QD 2BKUA 4HB0A 4US2R 4YT6H 3A7VA 4TLDA 4NTZA 2CEAA 4DIDA 1P10A 1OFIA 1SXJB 1GKUB 3OIWA 2G51A 5E2PA 2X77A 1KAGA 3GLGA 1G36A 3IUYA 2YC4C 1ZYOA 5L8VA 2XX3A 4TMTA 2H16A 3DFJA 4P4TA 5H4IB 3SUEA 1G1MA 2Z9KA 3HJNA 1MMJN 3ELAH 1PQ8A 3GOVB 3CZQA 3EXAA 3ZVCA 3SHCH 2A2QH 4L8GA 1IQHA 4W5HA 1O39A 2BOHB 1AS3A 1G6OA 4JKIA 3KTAB 1GI5A 4X8SH 2VP6A 3SE0A 2VQSA 3LGIA 3K09C 1BRCE 1GTVA 1W5SA 3UQOA 2P2LA 1WU1A 3B8HA 2AMDA 1A7JA 4MITA 4MVNA 3M5NA 3QI2A 1O2IA 3SQEE 4BTUB 1DELA 4QGGA 1NFYA 3RWMB 1E0AA 1RTKA 2JASA 4B48A 4FCWA 3BOSA 3VHLB 5A0BA 4QG7A 2E87A 2ZS8A 1PLLA 4FU9A 1V2LT 2QGRA 2FDCA 2Y7ZA 4JLDA 1X86B 1ZU5A 2A32A 5UKDA 3P8GA 4US0R 4EKDA 4KITB 1J14A 5HM2A 1FY1A 2RG3A 1GMHG 1E2NA 4Q5IA 3WMEA 1EB1H 5JHHB 1OHHD 4D7GA 2CCKA 4NIYA 4B3GA 2N46A 4OHWA 2FWWA 3U8TH 4TWZA 1T6NA 2EVWX 1ZM9A 1NVVR 1ESBA 1HAVA 3QKSA 5L2YH 5FL7D 4ISLA 4QBHA 2O8BA 4P0TA 1KK2A 2CCGA 3UWKA 4AGJA 3BFVA 3C5HA 1MH1A 3FMIA 1DWEH 3TVTA 4CHAB 5JLJA 3VHXA 3TK1A 2PHBA 3AKDA 1HAOH 1E32A 1ZOMA 4TL9A 3GCTF 2CLSA 4ZPXA 3P95A 4BLQA 4Y76A 1EUFA 1GJ8B 1ESAA 4PO8A 1C4Y2 3ZZ4A 4XVUA 2O9QA 1WQSA 1W5TA 2ZRIA 3DA9B 4NZQA 4BAKB 4Y7AA 4UFFH 3K09A 1YZUA 5B30A 2VIQA 3SR0A 3RXHA 2CXVA 3T1QA 1DVRA 1GVKB 1KK1A 1GBFA 1ZTJA 3PWCA 4UJ3A 3QENA 1GSIA 2ZI6A 5AJWA 5CM8B 2WWXA 4B2LA 3IPXA 2HALA 4RFSA 2VRWA 3VR4A 1C1MA 1TA2A 1KMHA 2NPIA 1BYUA 1C4V2 3KX2A 4H1UA 2FP7B 5DHFA 3W5IA 1M7HA 5GXPA 2ZVQX 1G3DA 3BEFB 5EQRA 1BHXB 1M8PA 1C5PA 3SUDA 2ATVA 2B92A 5EZ5A 1SXJD 2ONKA 2BY6X 3TQFA 1P5ZB 1GP2A 3BRWD 3SJKA 3OESA 1QB9A 1OLOA 3IIKA 3BFKA 2PGQB 1O3IA 5EXNA 1X6VA 1CXZA 1XP8A 1GZSA 4Q7KA 1QHRB 3LVQE 1D9ZA 2BOVA 3CRW1 4B32A 2PUXB 3P32A 3UIEA 1GBLA 3E5HA 3GJ8A 3CS7A 5B58C 4C7OA 4RKFA 3A1VA 2ANBA 1KI3A 4AI6A 4ILEA 2Y5FA 1OYQA 1F5NA 3UOUA 1GI6A 3LKWA 3A1TA 1HPGA 1NP6A 1S4QA 2VL7A 4X8MA 1K9OE 2AFQB 4IS5A 2D8WA 3N2EA 3QK1A 5LD2B 1C5NH 1G7CA 3PITA 2V4ZA 4IC5A 3A7WA 3CWQA 2Q3HA 5IDVA 2CVFA 1BBRE 2BD5A 1GDQA 1GVNB 1GL9B 4MKHA 1KDPA 2CDNA 1C1NA 5L3QB 1CU1A 5J4HA 3SJ8A 1HJAC 4I99A 2Q9AA 1SKQA 3RU4T 4M4SA 1VITH 1JI0A 3LLMA 2EYQA 1MZAA 1HRTH 4CH2B 3S1AB 1GBJA 1CP2A 5BXQC 3PTNA 2XOKA 3A7ZA 5JZVA 1VCIA 4R0IA 3FB4A 3F9FA 3PV5A 1UVUH 2XCNA 4Y8ZA 4URUR 1NBMA 2HPQH 5EQQA 3OFNA 1O3CA 4GSOA 4KFSA 2TRMA 1P60A 3C15C 2CJIA 1LDTT 4AFUA 1GNRA 2JA1A 4M8NE 5LH8A 4I8LA 2WJHA 3ADCA 1CT0E 4UFDH 1SGYE 2FFBA 2DPXA 4H9GA 1E36B 2JAQA 2GAAA 2BMDA 5DP3A 4EPYA 2B8TA 2JH6D 4M9XA 3QF4A 3OAAA 5I46H 3NH6A 2JCSA 2F9PA 4YMUA 5AUPB 4FUBA 3BG4C 4Y11E 3FDIA 1SKYE 1HAPH 4QHYA 2BBTA 3LXXA 3TKLA 5J4LA 1O3JA 1O2VA 3KGPA 3ZIAD 3WYGA 3MRSA 1BDAA 1EX3A 4OJQA 2RCEA 3NPSA 3SN6A 5AJYA 2A31A 1DX5M 2O0JA 2YC2C 4MPXA 1G3UA 1W47A 2EC9H 1Q2WA 4ZAEA 2HRVA 1G32B 3SBDA 1KK0A 3SHWA 2BMEA 1KXEA 1ZHMA 3IIMA 3W6OA 3AVOA 1P9RA 3G0HA 3KKPA 4EFLA 1FI8A 2GVDC 1ZD8A 4A15A 3LPRA 3T27A 2QU8A 2QA5A 2QBYB 2RA3A 2PFEA 3I72A 3VX4A 1Y3YA 1XDBA 4NWKA 7GCHG 1NKSA 4TMKA 8KME2 4YLGA 5JEDA 4ZMAH 1COWD 3GYMA 4YTAA 3KJEA 5C3NA 1T5LA 2BBWA 1SLUB 2ODPA 2Y7XA 1J99A 3LVRE 1ZHRA 2GAOA 1IY1A 2BEKA 1E1QA 2IYQA 3PJRA 1D2EA 1U8YA 3DOEA 2XC5A 2ZJAA 3U3RA 4YMVA 1U9IA 1VGCB 5A5GA 1HEIA 1AWFH 2THFB 3VX3A 2GJAA 1YBWA 1P09A 5HKKD 3BF6H 1GMDF 4OQLA 1SVKA 4LI0A 1ZYUA 5D3QA 4MDSA 5GJVC 2EFHB 1SVLA 1NBME 5FTJA 3QBVA 3ZD7A 3BSQA 1UTJA 1SGIB 2V6NA 3SUFA 3VGCB 2UVQA 1G37A 1E79D 1MU6B 1G2LA 3O8DA 4XJXA 1ZSLA 1W12U 2STBE 1KK3A 1DITH 4JYVH 1SOTA 2R6CA 2R6DA 4DLTA 2WYGA 1AU8A 4X8UH 2D74A 1LTOA 1RIFA 2ZE5A 2FGJA 4DDVA 1TF2A 1ZP6A 2IT1A 2KI5A 3SJBA 1QJ1B 1RE0A 4X2YA 5KDLA 4LOAA 1O32A 3CP7A 1XEXA 3LC3A 5AJXA 4ASUA 4OS7A 4YXWD 2B21A 1DBSA 1XD8A 3AKYA 3WBKA 3ICQB 3JZAA 3O8BA 5LPEA 3M35A 1FY3A 3U44A 4KVAA 1YLDA 1NVUQ 3AB3A 4C4PA 1W14U 2ORIA 2D7DA 4JSTA 4FMDF 2Y6TA 4DCVA 2O8EB 2ZSEA 3WYFA 1Z8FA 4HAXA 2CHAC 1MZDA 2QXIA 2NO9A 1NPMA 1LVBA 1PLKA 4A8JB 4OQFA 3VTKA 5P21A 4ZKRU 3UOPA 4XSGA 1W44A 3RXUA 5LPRA 2FWRA 4X0WU 3LOXA 3P6ZB 4K1TA 3I8SA 4LJAA 1II9A 4C3ZA 2W5EA 2NMVA 2Q6FA 4PSKA 4CT5A 2BZ6H 1DE0A 3THXA 1OH8A 2XJ4A 3ICEA 2BD2A 5GWZA 5KDOA 3W6PA 4Z8XA 1LQDB 3IWMA 3TJUA 4ZI3A 1O2KA 3LBIA 1XD2B 1IQLA 1UKVY 3P4XA 1Z8RA 5SGAE 1Y8TA 3QLPH 3THWB 4G3XA 3P17H 1SGRE 5GVRA 5BYJA 2PTNA 1W36C 2O8TA 3QN7A 2PW8H 4JYBA 3LIWA 3RU4D 1ZLRA 4WMEA 3LXRA 3S9AA 4JJZA 1N6RA 3DM5A 5EP1A 1HYLA 2ZTSA 1XMVA 3X1ZA 4HUTA 3SHFA 2RMKA 1A61H 2ZU3A 2QAGC 4ZI2A 2ZU2A 2EW1A 3GJ4A 5TDHA 2ORVA 4TQ9A 4URVR 4TL7A 3TE6A 1BB0B 3GY6A 3T34A 3U69H 1ANDA 1KIMA 5EG4A 3MO6A 5FPTA 3NDBB 2FS9A 9LPRA 5J4QA 4Q4LA 3Q5EA 4I1VA 1DAIA 4IDHA 4O9VA 1N6HA 3FMFA 4PAQA 4Q4JA 4INHA 3RABA 5HE9A 3SJIA 3AAUA 3SGAE 4A4DA 1LVGA 5DLQC 3A1UA 1DOJA 3IO3A 4BZPA 4JMPA 7LPRA 2F9OA 1TQ6A 4ZROA 1UKYA 2AR7A 4MYHA 2WMNB 5J47A 3AF2A 3NBZC 4MNVA 2D26C 4OHVA 2FSIA 3LV8A 1OXTA 4IXMA 3U6BA 3VFDA 1X8LA 1G19A 3UATA 1MO5A 1Z7KA 1MU8B 5E7JA 2ULLA 3RS3A 1THRH 2VH0A 2BBOA 1SGDE 2J7PD 3WY9A 5JYIA 1TPZA 3PEWA 1V43A 4E06H 3FMPB 3MOCA 4NU0A 5FBEA 1IXRC 1VIAA 2GF9A 3OTJE 1AB9C 1UJ1A 1FAKH 1IN4A 2YNBA 1DARA 3K0AB 4BAOB 3DEFA 2BVNA 1BITA 3VFEA 4JL5A 2BQWB 3S7HB 1T8LA 3TW8B 1BIFA 3JVVA 2H7VA 1IBRA 1KI2A 4HZUB 4QHTA 1CBWC 1E9RA 4NA7A 4B6EA 4F4CA 5KHOC 1P2QA 3SZNA 3C7KA 4Y8YA 1H8ED 2QAJA 1TUIA 3H4MA 5EOKA 1BCUH 1W13U 4UE7H 2WPDD 2A4OA 3WRYC 4M9SA 4RY2A 2FLBH 3E70C 2XWAA 2Z83A 4ABYA 2WWGA 1SB1H 5KYKA 2VJ1A 3NKVA 3BXZA 2J38A 3MFJA 3ZZBA 2W6JD 4DXAA 4IDQA 1ZNXA 1N5IA 3ZYDA 3R7WB 3RXPA 4QHSA 4AYTA 1U0LA 4K8BA 3SZRA 3A85A 4BNRA 4LBVA 3H7OA 5TCAA 5GJCA 5B57C 3P70B 4LRWA 4EFNA 1O3KA 4ESVA 4UNQA 1QG4A 1ANEA 1C2DA 3PROA 1CJMA 3ATMA 4JT4A 1ZRBA 2IS4A 1LPKB 3X2SA 2Q9BA 3BFXA 5L6NH 3DMNA 1K1OA 4EIWA 1CA0C 4HDOB 5FOUA 1EXFA 1VPLA 1V2KT 2ZJ2A 3QTOH 1RRGA 1DS6A 2F9MA 1PJRA 1P2NA 2ZRJA 4OS4A 3BG4B 3EDXB 1P7CA 1KXFA 1U8AA 2ODQA 1UK4A 3CRRA 1TNKA 3MO3A 3GCNA 1OXGA 4I7YH 4RD2A 1C1RA 4DW2U 4MQAA 1KDQB 4X1QU 1Q1EA 2EWVA 1R5OA 2Q21A 3M4YA 1YLCA 1E99A 1W4AA 3T62A 4GPGA 4Q7LA 3VPKA 1S9HA 4OS5A 1TGCA 2ZROA 1ZVQA 1CR4A 2OUKA 1O2ZA 2PEYA 1GJ7B 1Z6YA 3QXHA 3ASYA 4DHEA 1KI9A 3CBQA 3EZ9A 4LHWA 2QP4A 3RXTA 3QUSA 4NYMQ 3A87A 3OF5A 3TUIC 1HA3A 3OE7A 3PCRB 1AQ7A 1II0A 1KJWA 2WZQA 2FDAA 3HU3A 1EZUC 2UWPA 4LHVA 4ZCMA 1BMFD 2CK3D 3DL0A 4LY6A 4GFDA 4Q47A 1ZMLA 1SVOA 2W7SA 4O2RA 2N42A 1MTWA 2G88A 5CB8A 3GEEA 1R7RA 2EFDB 1EAIA 5FBVB 2XB4A 4LBZA 2XC4A 2QY9A 2FE4A 4OBEA 1R5BA 2QA9E 2R6FA 1G16A 4JVSB 2HLDA 1EWRA 2ODBA 3L82B 3LT3A 1GHAG 1HNEE 1O2JA 2HLCA 2F1HA 1NLYA 3Q00A 1QJ6B 2NPFA 4BFTA 1FMJA 1O30A 1K1PA 3ZYCA 2KAIB 4EQ6B 4YMSA 1O3NA 4DSNA 1T32A 1O2WA 2FODA 5EXTA 2O8LA 2HDNB 5GCHF 2ZFFH 5TCCA 1GI9B 3L43A 1N6XA 4I8GA 4Q4HB 2C8ZB 4I1SA 4KTSA 2GK7A 3RP2A 3K6YA 1LY1A 2SGAA 4ISIH 4CR5A 1XXFA 1DAKA 1TUEA 4POAA 1SBWA 1CHOG 3GJ3A 2CL6X 3IBYA 1TONA 2YNAA 4B74A 4UEHH 2J45A 3SJCA 1VITG 4YOIA 3VMFA 3M5LA 4X2VA 1W0KD 3LGYA 1VCPA 3Q3KA 4BAMB 1X1SA 1W0JD 3H5CB 1B0EA 2FX6A 4LJ6A 1TX6A 1KSHA 3EX7C 1O3MA 2GV7A 1B0UA 4A6XA 4Q7ZA 4G5GA 3PQCA 3M0EA 1G8FA 3U3KA 4K1SA 3MMGA 3ZZ9A 1D2MA 4EJSB 1IN7A 3MJHA 4PPGA 1XUKA 3MG9A 4K5ZA 5DO4H 1ZNYA 2WVJA 5IHPA 3KXKA 3MU1A 1Y3XA 1ZZZA 3AVYA 4NCNA 2F91A 5FCRA 4B2BA 5AK0A 3CF6R 1AZTA 1BRUP 1V2OT 3KXLA 1GCTB 2GETA 2FLRH 4JSYA 1RIWC 3PLBA 2P5TB 3A84A 4HI3A 4OGXA 1Q22A 1OB2A 2OEPA 5BPEA 2YOFA 2C78A 4JLMA 3GLFB 3ZZUA 1HBTH 1XPOA 1GG6B 4UQOA 4Q9JA 2TIOA 5DJ7A 1FQJA 4LJ8A 2CGAA 2O8MA 3P26A 1SLXB 5EXMA 1GBEA 1TIOA 3CX7A 1DG1G 1K1IA 4RI0A 1K1MA 3SGQE 3GDUA 3QBTA 3NWUA 2TGDA 4PQRA 3HPTB 2BDAA 3SV7A 2J59A 3SV8A 1EZSC 4IVQA 3QGJA 4C9BA 1GRRA 3BG8A 2F9NA 5EPNA 4JLPA 3T12A 4P3YA 5G41A 4JZEH 1F2TB 4B2PA 1JXOA 3K9NA 1P11E 3RMLH 4RSPA 4DIEA 4LBWA 4TMVA 2R3YA 4OI0A 1JALA 1D5CA 2AXPA 2KBFA 1W8BH 2OBMA 2QAGB 1LHEH 4X6PA 1C1OA 4H4FA 3MO9A 2H1LA 1H1BA 2SHKA 2J2UA 1G4AE 2ZQ1A 4K46A 1PYTD 4Z54A 4ZV4A 3K9XB 1ZNZA 2BWJA 3AVXA 2C5LA 2V3OH 1LO6A 4URYR 3EIQA 5AVDA 2C93B 1YE8A 3CZPA 1XEFA 4AIIA 1SQTA 4XVRA 5KSOA 1GHBG 1P62B 2IEZA 4L5BA 4ZCLA 4WBSA 3FFBA 1C1TA 3BH7A 2JETB 3PUZA 2KBEA 2YV5A 4MUBA 4DZZA 1UK3A 2GBLC 1R0WA 2W7UA 1UADA 4YONB 2RGGA 1Z6TA 3GDSA 3U4QB 1AZ8A 1XBTA 2GZHA 1C9TA 3KQEA 4HUQB 2GK6A 1YF4A 1EFRD 1HUQA 4M1SA 5SZIA 2J87A 2TGPZ 4NYJR 5JBQA 2NO1A 1AI8H 4K81B 4WOPA 2XSZA 2ZDAH 2VF8A 2PWXA 3GLHB 3K8YA 1CT2E 1S84A 3TK5A 2P6RA 4NZYA 1Z8GA 1FMGA 1NRRH 2C99A 3K0SA 4B73A 3MAAC 3VAAA 3SN8A 2ZYTX 3W3ZB 3RXEA 2GT7A 5CJ2A 4DB4A 2NGRA 3HP1A 2PSYA 1CBUA 4GOJA 3AF0A 1K1JA 2NO7A 2CJWA 1O2NA 4BXWA 4M9FA 4LJ4A 2C90B 4GVUA 1XKBC 2A7JA 5E2OA 1CBWB 3U61B 4Q48A 1R8QA 2XNDD 1EX6A 1D3TB 1E2DA 5DNYB 2G4TA 1JJVA 1S82A 1OH5A 2TGTA 4K3JA 2QMOA 5K0HA 3B82A 2VHCA 1EJNA 1C9KA 4UFEH 4BFZA 1ZPCA 1SGQE 1GJBB 1Q1ZA 1US8A 4TSFA 3KQDA 1GRNA 2FYQA 2AMPA 1TBRH 1Z83A 1WTHD 3CLVA 2Y82A 1SZPA 3EZ2A 5CM9C 3CR8A 3U3OA 5CE1A 2OCBA 5AWFC 3A1WA 2OXRA 2AD5A 3CM0A 2QM7A 1U94A 2O8DB 5DYGA 4HTCH 3RXVA 1KTSB 1C9PA 4WH6A 1DAHA 3PWBA 3AH8A 1SG8B 1OWEA 2VB0A 5C2ZA 2ZFSA 2IC5A 4MNWA 3A6PC 1ZR0A 1G3IA 2OTVA 3SNAA 2RHMA 3H2YA 1TU3A 2FESH 3T5GA 2QTHA 4M21A 4BZXA 1XTQA 4DRZA 2QP3A 4KKDA 1CO7E 4C30A 5GJ4B 3VKWA 1AWHB 2REOA 2ZC9H 2ZR9A 2GD4B 3QXSA 3R0FA 3Q7PA 1GI3A 1LF0A 2RHDA 2FI5E 3TSOA 2XRCA 3SYLA 3ND9A 3GLGB 2H5EA 3B7GA 4DIIH 2GX4A 3Q72A 1BS1A 1EOJA 1YKTA 2FOAA 5H68A 2HVXA 3DM9B 4A6LA 3V9PA 1GBMA 2VGCC 2WWHA 4AKHA 2IJD1 2W2XA 5FUWA 3MH7A 3QO6A 1KTVA 3GFOA 3TR5A 1HE1C 2NO0A 4MQBA 1HLTH 1R0ZA 3KJHA 1YZNA 4A1VA 2BBSA 4V0MA 1R4AA 2Z5FA 1W49A 1TOMH 1H8HD 4NYIQ 1XUIA 4M9QA 1PVOA 4OS2A 3BIVH 4WY3A 5CDFA 2F1IA 1QZXA 1XUHA 3JVUA 2PGBB 4MRRA 4CR9A 4U5XA 1LV7A 3UPEA 1Y5AT 3ZVRA 1AIXH 2CL7X 2YNMA 1ELAA 1KJYA 2Q0HA 3R3GB 3MCAA 3EWSA 3UWIA 1L2EA 1ZCAA 3WHKA 4GUXA 2YWFA 2YWGA 4JZKA 4C2TA 3SU4A 1OB5A 1LHDH 5FOXA 1Q31A 2BVRH 3CH4B 1NLZA 2WPMS 2I4IA 4FMCB 3QKSB 1N8OC 1CS4C 5CJPA 2JDID 2O8BB 3PO1B 4ZDJA 1VG8A 1E37B 5EGMA 2SGDE 2KB0A 1ZGVA 2DB3A 1TAWA 2KWIA 4ACAA 1YR7A 2HOBA 4XOJA 3CKLA 1U90A 2A4QA 1ZM3A 3UNRA 2FOEA 2CLCX 2ZUCA 2OXCA 1T8NA 4PO9A 1KI6A 2IL1A 1XCMA 1WCZA 1MCTA 1DT2A 1DY8A 2FSGA 3SU5A 1OYYA 2VP9A 5EJEA 1RC8A 2QEQA 1UPTA 1V5WA 1NU7B 1VR1H 3F9GA 1QJ7B 1SLVB 2Z9LA 1FN6A 1ZJKA 1GMCG 4TLEA 1MTNC 3QQ5A 2GZ9A 3X1XA 1AK2A 1O34A 4JL6A 3NG1A 1IQEA 3JZ2B 2VWMA 1OXVA 4DSUA 3B1WA 1E2IA 2Y8EA 3CENA 2OFXA 1ELVA 3PMAB 3LW8A 4Q9KA 2ZSFA 2NOAA 4UDWH 1KMHB 1AZSC 2GCNA 4RD4A 1XPUA 4O3TA 2W0MA 1C1QA 1HAYB 2ZPSA 3NH9A 2ZS7A 1W7XH 2J3EA 3R8CA 4AZ2B 1L1NA 2GJ8A 3OHMA 1IQPA 1UAAA 1U2RA 2C8XB 1TAGA 3KN2A 1P01A 1GDUA 5C67A 4X8LA 1B0FA 3MU0A 1OSNA 2F9UA 4CBOA 3LO5A 4TMXA 2IW3A 4DBLC 1EATA 1OOKB 1W0ZU 4WW0A 3WY8A 2EU8A 3N2IA 1SGCA 3GJXC 4V0ME 4FWIB 3A4LA 4KJZA 1D2NA 4AORA 1ETUA 5EZ6B 2DFNA 5CDFE 3FVFB 3SYKA 5KDDA 3DOFA 3O47A 4JLBA 3GCTG 1VG0B 4GMXA 2EQBA 1N3BA 1O36A 1O5EH 4BFUA 4R8TB 5T1VA 4S2EA 3U2QA 4DUGA 2QM8A 3VQTA 1JR3A 1QG2A 5EP4A 1XKAC 4PHTA 1Y5BT 1DO0A 4MGKR 5K8UA 1VJ9U 4ZKSU 3A80A 4DLSA 4IVRA 4Q03A 1W46A 3HDTA 1NS3A 5L3RA 5JPMH 2FOMB 3UR6A 1QRZA 3BH0A 5C20A 1DADA 2P59A 3U98H 4C0QC 2J34A 4GMDA 4M9ZA 4ARZA 4B47A 1YCPM 2GRJA 2OSBA 2PZEA 5J4KA 1H65A 2D06A 2ZS9A 2CVHA 1O3AA 5F6MA 1L4DA 3KQHA 3HU1A 3GEHA 4A1XA 3PV4A 5JBTA 1JRTA 5C5NA 1EZQA 4INKA 3U7EB 2EFEB 4AC9A 4FCVA 1JRSA 4D9RA 2VPPA 1YZQA 4X2WA 3RRNA 3BBPA 4FI3C 1RPZA 4BFVA 3L6PA 3K9HA 1C4OA 1DANH 1SFQB 2JH0D 2OAQ1 4JCNA 2REXB 1J90A 1O2PA 4JIMA 2V55B 4EPVA 2LCFA 1A5TA 3D62A 4LXBH 3PM3A 2XBVA 4C0JA 5EPYA 1JIRA 2R65A 4CT4B 3QXJA 3OYPA 4OHXA 3GY8A 4Q2KA 5DO9A 4ZDWA 2H6MA 1IQFA 2PCJA 1AZZA 1QVRA 1P3EA 2BM0A 1F60A 1EJAA 1U6QA 1ELEE 4Z1MD 3A81A 2OT3B 1BTUA 4CH8B 1ZPBA 1EFCA 3BORA 4P32A 5FBLB 1F5KU 3SU2A 1BA8B 5LB2A 3BB1A 3K70B 4N1AA 2XBWA 4X8HA 2GJSA 3A8CA 1KI7A 1C2FA 1E1RD 1L4ZA 4RSGA 3WBJA 4CIDA 3NC0C 1XM1A 2ZRCA 1E9EA 1C5YB 3SBKA 3VR3A 5DK1A 1Q3HA 4YOGA 3FMOB 5H8WA 4E09A 2WKRA 1YJ5A 1DXWA 4IW3B 2AIPA 3WP0A 6LPRA 3IDQA 4TLAA 2WJYA 1I4DD 2A5JA 4QNRA 1KY3A 3LFUA 2IK8A 3NC1C 4YQFA 1E4YA 1GUAA 1G20E 1XUFA 4Q00A 3K0FA 1O3PB 4BRWA 1V2RT 2XXAB 4GZMA 4Y71A 2JEOA 1THSH 3GJ7A 3M36A 3MUFA 1LKAA 2H92A 4UFGH 1TX4B 3SU0A 3SQWA 3ZZ6A 1SQOA 2VH5R 2FGKA 1ZUIA 2BY5X 3ZZAA 4XWOA 7KMEH 4Q19A 2ZRMA 1GHXH 1ZMNA 2P93A 2SGQE 5DP8A 2ZPTX 1DAEA 3TAHA 2YOGA 4MDFA 1GJ5H 1D4PB 1PUJA 4I1UA 4D76A 1L0ZA 3T26A 3H7TA 2CHGA 4Q9LA 4OYHA 4MLFB 5CHAB 1Z71A 2XC0A 4IN1A 1MABA 1DWCH 3ESTA 1WV7H 1HDTH 5JRJA 3EA7A 2X8AA 2ZE7A 4IVPA 4U30A 2G52A 2ZU4A 1OWHA 1OT3A 2AGEX 1N5LA 1NN6A 2AN9A 1SI5H 3F9HA 1E34B 3LH1A 2ZPRA 2OC1A 1C4U2 2CE7A 2JLUA 1XEXB 5SZKB 5KNBA 2OC8A 1YPHC 5JJLA 1TQDA 3PLKA 1MKWH 1ZM4A 4LC0A 4GCHF 1V2NT 5JSZB 1B7XB 1BMNH 1NKTA 3S0NA 1S5SA 3U6KA 3U44B 1CA8B 3OAAD 3UG7A 2QF3A 1TEXA 1NVVQ 5LB4A 3C14C 2VWLA 3PUVA 2ZI7A 1IN5A 3K70D 1BBRH 1GI2A 3S9CA 1NMXA 4DWJA 1D6WA 4XE4A 1UBGA 2DWPA 1LHFH 1DE7H 2GZAA 3P27A 4DDWA 4OI1A 3AV0B 2ZE6A 2SGFE 2ZRDA 4JKYA 1E9DA 5F03A 1RW4A 3J81k 1P2OA 3TITA 1T91A 1GMDG 1AKSB 5T6GA 1THPB 1GJAB 2GCOA 3SO3A 1DUEA 3K1JA 1CVWH 4AWXA 1IQGA 1OHHA 1OIVA 1SXJC 3RXDA 1C5TA 3DUXH 1EQ9A 4BZQA 1XEWY 1GIAA 3ZVFA 4A2PA 1MBQA 3C27B 1I2DA 3KQBA 2P3TB 4AY2A 3THXB 1O3FA 1GJCB 2XCFA 3EAQA 3L8YA 3L0OA 4LPKA 2XZLA 3ENSB 1QF9A 1NY22 4FW9A 1S81A 1C2GA 2QRNA 2BD8A 2IS2A 1AVWA 2C9CA 3Q77A 1HIAA 2NU2E 2WWWA 3A83A 2BM1A 1VECA 4IHQA 1OH7A 3HYRA 2DCUA 2NQ2C 3KQUA 1C5SA 1JXPA 1G5PA 3STJA 1F0UA 3EYDA 1E1QD 3NWJA 2IF0A 4Q1EA 1P9UA 1MTNB 3PTBA 4RD0A 4F7WA 5J4SA 2WV4A 2OLKA 1FY4A 2OQUA 5DGJA 4R7ZA 1E2QA 2C8YB 2B0FA 2V9PA 4NIWA 2ZSBA 1MQ6A 5JRZA 3EASA 1RRFA 4NE2A 4TYPA 3PXGA 1G8PA 2ANWA 1PPFE 3PUYA 4NBSA 5JBBS 1ELOA 1LVYA 1TB6H 3KZ1E 3RRMA 1U98A 4XSKU 2VVUA 4BXSA 2ZYVX 4Q4JB 5IYTA 3SFZA 3Q3YA 2K5UA 1N0VC 2C77A 1NT1A 2ZWLH 4KXFB 3TK9A 2BLQA 2ZECA 1Y5UT 2FJUA 4MRVA 4EFMA 2QY0B 4LYFA 2O0HA 1FPHH 1ZD1A 5EE3A 1V2JT 1LW7A 3F1SB 1A4WH 4A6PA 3A8TA 4ASUD 1ZD9A 3BIUH 2ZPQA 3SNDA 1A2BA 4D26A 2ZCHP 2EI7A 3D49H 1E9AA 3BTTE 3ZZCA 4Q4AA 1P4SA 3KTAA 5E4FA 2H17A 3QF7A 5G53C 3ZD6A 1E0KA 4LOYH 3T1OA 1WDTA 1NRSH 4D0NA 3RYTC 1F2SE 3ECCA 3SI3H 4J0QA 1Z28A 3A8AA 4TYQA 4CF7A 5LPNA 4BGDA 2JIZA 2X2FA 5EE0A 4A7IB 1WCV1 4QBFA 1P75A 1LF5A 3AP2A 3UWJH 1JAHA 3ZZ0A 4M1KA 4Q01A 3LNCA 1OPXA 1D3QB 3ZS8A 821PA 1D3PB 3E2IA 2WPHS 4NFFA 3IILA 1XTIA 4XBDA 3U60B 1XX9A 2I3BA 2D7CA 3HGPA 2QRZA 3EZ6A 1XEWX 4KV9A 3ZVDA 4K69A 1R8SA 4CW7A 2OESA 1HJ8A 2DYKA 3BV9B 3KEEA 2G3YA 1YPHE 5A8XA 1GGDB 3RXAA 2PLXA 1G7TA 4FUEA 2ZIAA 4BASA 2ZTXA 4XBBA 4IEEA 4Q1CA 4E22A 2ZRHA 4GOKA 1JJ7A 1JEDA 1OJLA 1FV9A 2QNRA 1IOZA 2EWWA 1TLDA 3A88A 2A4GA 4DT1A 3Q7QA 1KXDA 1T8OA 3LU9B 4DY7B 2QXJA 2A5AA 2OBOA 3AVVA 3IQWA 3AP3A 1DS2E 4TZ0A 2C03A 4KGAA 4QC2A 1NL3A 4O03A 4D0LB 2A45B 1S0UA 3X1YA 4RN6A 2FX3A 3PB1E 2FXRA 3B13B 5LD2C 4LV8B 2HXSA 4II7A 2QTFA 1GHWH 4M0LA 4TZ6A 3UIRA 4GAWA 1SXJE 2P67A 1I2MA 1G3RA 2ZGHA 4OK3A 1K28D 1UBFA 1GNPA 1WBGB 4Q18A 3Q9LA 3QNUA 2I6SA 1S83A 2SGPE 1Z8JB 1V2UT 2VYFA 3SQHE 1BMMH 5B64A 4X6NA 4TMZA 5FFMA 4Y6DA 5EQTA 3GICB 4NA9H 4JLKA 5L2ZH 2IXFA 3STIA 2CE2X 2OQ5A 1NY6A 3HATH 4NGAH 1SL3A 3LGUA 2J0QA 2EA3A 5CIQA 5JS8A 1GBBA 1KXCA 1MBMA 3WHLA 4D81A 5DP7A 1G4UR 1PLJA 3AF1A 1GI4A 4DC9A 4MNXA 2IYXA 1V2MT 4DSOA 1JMOH 3FE2A 1JNYA 2R9PA 1Z63A 3B8JA 4F49A 2QPTA 3KB1A 5BN3A 1VCWA 1PQ5A 1Z0KA 4DCNA 1A5HA 4JYUH 2G6BA 3TH5A 2BD7A 2D1JA 2A5FA 4DJTA 4ZXXH 4WVPE 1GBAA 3NEYA 5TV2A 1II8A 1LQEA 4DSTA 3M7QA 5B6OA 3AVWA 2RGAA 4HAZA 4IFEA 1O37A 1UTMA 4H6SB 1VIYA 5TJXA 1MKXK 4N0DA 2A5GA 3B5JA 3A1SA 3SYJA 2YKGA 2OG2A 3QXXA 1IHUA 1MV5A 3EARA 5DH9A 3VKGA 1C5ZB 1TPAE 3ZGXA 2Z4SA 4FD2A 2ODEA 2BY7X 2QSZA 3KFVA 5HKKA 2AIQA 3TH2H 1S1MA 2ZFTA 1Z1JA 1PZNA 2XWBI 1TQ7B 2PX0A 4TMWA 3S1AA 2NU1E 4Y0ZE 4EUNA 1GBDA 4X1SU 1MO4A 1Z0IA 2AWOA 4LYHA 4DEYA 2OC7A 2ZHDA 5C1XA 3SC3A 2C8VA 4KSCA 2ZHWH 1RYFA 1ABIH 2Z7FE 2B7BA 1H9LB 3AVZA 5AUQA 2C96A 4B2IA 2JJ1A 2F9VA 4LX0A 5KO2A 4BLTA 4JZIA 4O2LA 2IUSA 4KFTA 1XJ0A 2C3SA 2PCLA 3RXJA 2Q6DA 2R0KA 4JS0A 4HYYA 2H18A 2LKDA 1H9HE 1R6BX 2F7SA 4WZ6A 3TU7H 1ONBA 1IXZA 1BTWA 1W3CA 1HTWA 3FHTA 2GWHA 5DP5A 2W2TA 4MYCA 4BEBA 1ZRHA 1WF3A 2B5TB 1NO9H 1YZTA 4G1UC 1VGCC 1MCVA 2BCGY 3H0KA 2XB2A 3AW0A 3PV2A 3AF3A 4KCGA 3C1KA 4MUAA 1ZUHA 4HATA 1A5IA 1QRXA 1T31A 1Y3AA 2WUCA 3ZQJA 4CRCA 1PPZA 2Z43A 4ZKEA 2WSSA 4HDCA 3HKJB 4WF8A 2V0BA 2ZITA 3CX8A 2NTYC 3PVSA 3EA5A 4LWZA 3QEJA 1NZQH 5F98A 2PMKA 3ATKA 5CYOA 4DKXA 4K8YA 3VGCC 2WWFA 5GCHG 1SPJA 4AD8A 4FN5A 2J46A 5FL3A 1ELDE 3PENA 4TQAA 2NO6A 1A2KC 4DJZB 1O2MA 1YU9A 3CRVA 1DPFA 1P2TA 2BEJA 3OE7D 2NU4E 3QY0A 3U1JB 1TMBH 4JYTA 4M1YA 3KKOA 3P92A 2JATA 1BJVA 2Z3CA 2BJWA 2RB4A 3SJAA 4KODA 1TX8A 1HAGE 2VIVA 1P02A 4BTTB 3P4YA 4KSBA 3BN9A 4B76A 4QGFA 1KO8A 4XH9B 4Q9IA 4R2HA 4TYDA 1XTRA 2WV9A 4NCKA 5HYOA 1T3HA 2L0XA 2F1RA 2HLDD 4A82A 4I31A 2GMTB 4XDEA 1NG9A 1G9XA 2OCAA 4TY7A 4ZXYH 2QG6A 2UUFB 1RRPA 5A0AE 3G82C 3DKPA 3KNXA 2A2ZA 3ZVMA 3L0IB 1QHXA 1W2HA 2FN4A 2HF9A 2P3UB 4B71A 2PT7A 1IOEA 2V6IA 1MOZA 3DPUA 3ZS9A 1Y3UA 1XPRA 4A8JC 2N1BA 5KPJA 1C5QA 1GVLA 1MTVA 3MU4A 1U81A 3RS5A 3TMKA 3VU9B 1OP8A 4HEJA 1NF3A 4UD9H 1O3HA 2WHXA 3F6UH 3T5FH 4EPWA 4OQMA 5DN6A 3LJOA 3JZ1B 2XZOA 4DLUA 2ZDKA 4MGYR 5DP6A 3QPVA 3NBXX 1JB1A 421PA 4JK6A 4FUJA 4M53A 5FX5A 1G3MA 1XZPA 5SZHB 2W3IA 2ZNKH 5JJKA 4J2YB 1A4RA 2K1QA 2C2HA 4PTLA 1Z6GA 2OBNA 3ASZA 3IHLA 3IIJA 3ZZDA 3SJ9A 5FBRB 2J5XA 4TYYA 1T4VH 4CEHA 4YLUA 4A36A 1ZHPA 2HYIC 1ZM2A 4CZ2A 1FQ3A 3MNXA 1SMFE 1ORFA 2IX3A 4JLOA 3MWYW 2AGGX 3FZZA 5KSZA 4EAQA 3RXBA 1U0HC 3MNCA 1OFHA 5JCZA 1A46H 4RCZA 2Y5HA 1IHTH 1ARBA 2IYRA 1INCA 4BLOA 2CJWB 3LRPA 3UQVA 3VB4A 4BRUA 4JK5A 2ZI5A 2BV3A 3PIRA 5DG6A 1FFHA 4LYJA 3B60A 2VHQA 1SOZA 1TEVA 4A8JA 3ZJYA 5E3HA 1N6NA 2FZ4A 1T9HA 2OD3B 1NRNH 3NXSA 2J95A 4HI0E 4NCHA 2FF7A 2ZSDA 4OJKA 4LPSA 1H8EA 1Z6EA 1R5NA 2C04A 2IXGA 4FINA 5IK2A 5E7MA 3IPYA 3ETLA 2R3UA 2W6IA 4AB8A 1ZRKA 3UKDA 3CUEF 2BCJQ 3RU4E 4LHZA 2Q6GA 3W94A 2BLVA 2ZM5A 1MAXA 1AIPA 4PSVA 4PPNA 1KDRA 5FHTA 3THWA 2W3KA 3C16C 2H1UA 9ESTA 3TPIZ 1MD8A 2W6JA 4RD1A 121PA 1GJ6A 1ZGIA 2ZU0C 1T7CA 2QENA 3ZH9B 4QJ5A 3ZLJA 3BH6A 4NCJA 3L0PA 1AKYA 2CHVA 3MMPA 4D4JA 4MKFA 1E0FD 1BO6A 4HLDA 1VG9B 2AKAB 3MLEA 1E38B 3N7OA 1HXEH 2ZRGA 2ANYA 2BC9A 3MNSA 1E6CA 3LY5A 5JJIA 2FIRH 3MGCA 2OAP1 1YRBA 3D6TB 1SGNE 1GRQA 1K5DA 2G9NA 1MD7A 4SGBE 2W83A 1QA7A 4MPWA 4TY6A 5FOSA 2AS9A 1TYNA 5F9HA 3MH6A 2AK2A 5L3SB 2FTLE 2P8OB 3ONWA 1XXHA 3TAUA 2BDHA 4XIGS 3V12A 2KSQA 4CEJA 4NKRA 1YC0A 3D8BA 1XUJA 4RJLA 2HT6A 1M6NA 3NK8A 2IS6A 1V6DA 4THNH 4Y79A 1R10A 2IUTA 3VR5A 3P8FA 3W8RA 1B5GH 2OBQA 2R8RA 1UHBA 5TB5A 3MFYA 1QDEA 1TBZH 2ZGCA 1XD9A 3GY4A 4YZUA 1IM2A 1G3EA 4KBFA 4QKQA 5KSYA 4RZUA 4ISOA 1NSFA 1QL8A 3BTKE 2GTBA 2ALVA 1O3EA 4CRBA 2BYAX 3C5CA 3K0AA 3ZV8A 2G5NA 2AGIX 2B9LA 5FPKA 1P3CA 1M74A 1YHNA 2NWNA 1MRNA 2I6QA 2QT0A 2FOLA 3B78A 3RXFA 1UEJA 2ZAMA 2BZAA 4E03A 2ZHFH 4AYXA 1GHYH 3SU6A 4TSFD 1HB0B 2OUAA 3M6AA 1O2UA 5FI1B 4YESB 1O38A 1WXRA 2IYTA 4XOIA 2PBRA 4XFQA 2ZEBA 1IQMA 2F4LA 3Q3JB 4IFBA 5ABWA 1O2GH 5CB6A 1CJUC 1HUTH 2QROA 5FBWB 1L2TA 4X2XA 3RC4A 2GEVA 3LH5A 1SHZA 4LZ4B 5J40A 1GWAA 1ZC3A 4OKSA 4DLYA 2XBXA 1MKWK 3IEVA 2BY8X 5GNDA 5BWMA 4MDEA 1IN8A 1LTQA 4KP0A 1CRPA 2ZTZA 3R7WA 4MA4A 3IEUA 4NFEA 3RC5A 1WRBA 3BTDE 1BBRK 5KNCA 1GL6A 2VHJA 4ZO4A 3SNEA 4QJ4A 3BGWA 2HV8A 4K60A 1W0JA 1P06A 2ZFRH 3IHWA 4PAMA 2Z94A 2BXTH 1DOAA 1KLIH 1YPGH 3BTGE 4ABBA 2GA8A 4GHTA 1KHTA 2GCHF 5DKMA 5IT5A 3NHBA 1M7GA 1RJ9A 3SOSA 1XXHE 2IWHA 1EPTB 2CXXA 1ZCBA 3UANA 1OFTA 1H9IE 1PYTC 3CO5A 3QEOA 1G5RA 4U7DA 3BS4A 4IDPA 3UXMA 1Q1QA 1OXUA 5AUNB 2FG5A 1GBHA 3A4NA 3LC5A 2A7CA 3QVVA 1S0QA 4PROA 3BB4A 1Z3IX 1MO3A 4B35A 1XVOA 2JLQA 3F68H 3BEUA 3BK7A 3WRXC 5ANRB 2EEKA 1KSGA 4AG2A 4MPUA 3UR9A 3T35A 5FOVA 4U2WA 3GFPA 4G5OA 2BDBA 1QVAA 3QE0A 1QHYA 1X3SA 1DTSA 1CQQA 1AO5A 2QGNA 4M1MA 3PMHB 4K8OA 1GBIA 3E3TA 2PX3A 4QGAA 2FOHA 1EAXA 1MH0A 2TMKA 3IO5A 4W5WA 4EJSC 1P2VA 1E0JA 5A0CA 4ARZB 1ESMA 1ZC4A 3U3JA 3I32A 3UPUA 4I8KA 5KU1A 4X8VH 2ZCLP 3AP1A 3TW4A 4FUFA 1LCYA 1KAOA 1EZXC 3DZDA 1E2JA 1G3BA 1GCTC 4TWYA 1O33A 1Q20A 2GZ7A 4P4UA 3FYHA 3KL6A 5FCKA 1E96A 3FP8E 1KO5A 1QBOA 4F38A 2QQEA 4NYJQ 4GRAA 2ZXUA 2IA5A 2ANKH 1A0HB 4N3NA 4EQ6A 3LX5A 3RC6A 1TFXA 4NP6A 2O0KA 1OFUX 1FY8E 1ANCA 1GG6C 1J7KA 3CS0A 4D4MA 1SR5C 1EG7A 1FNNA 2D2EA 2BIFA 1WUNH 1EXMA 4Q4HA 1SLWB 3K9GA 1RYHA 2V3HH 3EA8A 1QB6A 1FMLA 3B9QA 4UXIA 3URDA 1AUJA 2ZGJA 3B85A 3VEQB 3SORA 1SGPE 1XMJA 1L1GA 2SNVA 1QNJA 2GEDA 3GLIB 2WMOB 4DCTA 1W2GA 3ZVLA 4JVLA 4MGZR 4DLXA 1BJUA 2AWNA 2P65A 4PPFA 4OS1A 3UWOA 1EP5A 4JLVA 1EFRA 3TJOA 1OS8A 1UCYE 3SI7A 3BJIC 1PUIA 1XB2A 2O8FB 2CL0X 2R2MB 1RVDA 3M3VA 2CF9H 4PC1A 4AK9A 4V0KA 1O0DH 4P31A 2Z6BD 1YPJH 3K6ZA 5C1BA 4EJSA 1PQ7A 2FTMA 1Q21A 2XZPA 2QE7A 1Q3XA 3B23B 1N2CE 2OK5A 2XYAA 3PR1A 4ABHA 1XJCA 1UDXA 2ZRFA 1NVWQ 3QJYA 1P2UA 2ZUDA 1E0SA 3QKUA 5K8IA 2ZGBH 3TVJB 4KYIB 2ERXA 3RVBA 1ZUNB 3V00A 3LGVA 1QFKH 2X2EA 2VIIA 4IW4E 1ODFA 2JETC 3KJGA 5JMTA 5C18A 1J16A 2XAUA 3ZQ6A 4DUGD 1L1JA 1G64A 1JR3D 1QBKC 3SZEA 1FUJA 3K0FB 4G5SA 3VR6A 1KMQA 1CTQA 1C2JA 5F2EA 3TQCA 1VKJA 1F48A 1QHIA 4URWR 3QKRB 1BTYA 1P03A 1C2HA 1BQYA 2HNTC 1QQ4A 2PKSB 4IDNA 4RZXA 1A82A 1QRAA 1EK0A 5E0JA 1K21H 1L7VC 2AD1A 2CBZA 2F3CE 3KKQA 3MTYA 1QTFA 1F5RA 4OM9A 2ZYUX 1NU9A 2A5DA 2MMGA 4WWYA 2YZ2A 1XXDA 3TBKA 5JDUB 4WIAA 3MHWU 5KNDA 2QAGA 4PC3A 1M9UA 3D3QA 5TY0A 4L9WA 4F93B 2EI6A 5FTMA 2MSDB 3B9PA 3HK6B 1ZAKA 1M34E 2G0TA 2FMJA 4MGIR 2V3CC 1C5OH 1P3JA 1E98A 3VNVA 1NY5A 4TLBA 4RZ2A 4WZAE 2QP9X 3AEZA 1HT2E 2HJGA 3RDZA 3KQNA 5EE9A 1SSXA 1P0SH 4TPYA 4C0LA 1JPJA 4HAYA 3QXCA 5C5OA 3EC1A 2ORWA 1N1LA 4XTRA 2OC0A 1OPHB 4JVMA 1MO6A 1X8JA 2VIOA 1TL7C 1G17A 4MYUA 1FNIA 4NHOA 3KQCA 1Z29A 4P4SB 3S7KB 1O2RA 2NG1A 3LONA 4V0LA 2BD3A 2V8OA 8OHMA 1TTTA 1G8GA 221PA 2AHOA 3SNBA 1UM8A 4GZLA 1K1NA 4DG4A 3F0TA 1VG1A 1Z5ZA 2A5YB 2OO7A 1WBBA 3K0CC 2GTPA 1H8HA 3IKJA 1UVPA 1SGFA 4O3MA 2VU8E 4UNSA 2F43A 3AVUA 4H6TA 2BM2A 1OH6A 3PV0A 4WH8A 4LSGA 1WBDA 4MG3A 4DB2A 2ZTYA 2ZR7A 1VYVA 2BB4A 1A1VA 1BHXF 4TPIZ 3GLFE 3E16B 1KY2A 4A5TS 1WSSH 1GVZA 2ZRNA 5HZKA 4QGHA 3RS2A 4FMDB 1Z08A 1AFEH 4CRDA 3THYA 2OILA 1UTPA 4CRGA 1A2CH 1EJMA 4PR0A 1TGNA 1NVXQ 3MWKA 4RD6A 4LZZA 3KKNA 5HCIA 1P9NA 4G01B 3SFVA 3WNCA 5A0FA 4PQFA 4K1EA 4LK2A 4FUHA 1IAQA 3I78A 3AGQA 1I4LD 1A3BH 1VYTA 2WKPA 3T28A 4DVAU 1HIAB 2EI8A 3ZDQA 5K7RA 1S1CA 1TNDA 3I5YA 1QY6A 2X19A 2QORA 1VCMA 1TRYA 2PLRA 1WE2A 2VHUA 1ZIOA 4CRFA 4GCHG 3K9LA 1TQ0B 5KUTA 1P8VC 3LBNA 3NBYC 2Q6TA 2O8DA 1NRPH 3SW2B 3H84A 3TIFA 1F2UA 4OK6A 1YYY1 1DLKB 1K22H 3KF2A 1TNJA 1YGCH 2PJZA 2B8WA 8GCHF 1QHNA 1L4UA 2GT8A 1XTSA 4JLJA 1NESE 2ZP0H 1P2JA 1E2MA 1CLUA 2DE8A 2VWNA 3ZYEA 2D4HA 4WXPA 2FEOA 2J9RA 1FNMA 3EAJA 1GNQA 2A7HA 2PKAA 1WP9A 2FFHA 3PO1C 2ZU1A 3RSOA 4ABJA 4W9MC 2GDDA 1LFDB 2HCJB 1OX1A 1P2KA 1ETTH 1UBEA 4MPVA 3W34A 4Q80A 2HNTE 3NCLA 3EZFA 1YR8A 1TE0A 3O8RA 1AS2A 4KLNA 1UBCA 3KKMA 3GISB 1O31A 1Z8IB 1YR9A 2H57A 3GLHE 1KXAA 2FU5C 1E2HA 4Q21A 1X1RA 1Q3TA 4Q1FA 3V3MA 4Q4AB 1AMHA 4YLQH 2A0QB 2FFAA 1T8TA 1HAZB 4Q7YA 3SDZA 1AQYA 2J0UA 1YQTA 1C1SA 1GMCF 3VR2A 4I8HA 1P6XA 1BT7A 3PMJA 3TGKE 4RCYA 1IHSH 5G4BA 2QF0A 3UNQA 1G3QA 3TVDA 1PPBH 2AERH 1TPOA 1U0JA 3ITIA 5CIWA 2CLDX 4US1R 1OYTH 2FOBA 4X6OA 5JBCS 1SGWA 2RGEA 4GT1A 3UY9A 4B3FX 1G21E 5DI9A 3TUJC 1G30B 2ZVPX 1GJ9B 2R62A 4Q9HA 1O5FH 1ZSKA 1WXQA 1EP6A 2UUKB 1TADA 1XJQA 4X1PU 2AH4X 3LGTA 4CRWB 1F3OA 2FSFA 3PUXA 4U02A 3B6EA 4NH0A 3FGNA 4PSAA 5D3MA 1J70A 1SULA 2GCTB 2I1VB 1IJFA 2GKSA 2WBLC 1N0UA 2W0SA 4MKGA 2Z9GA 1Q57A 2UZ3A 3W3AA 5F8ZA 3RANA 1LB1B 4IOLA 4X6MA 4DT1B 2V54A 3LBHA 2ODWA 5E0GA 2G4UA 3BERA 1HV7A 2VSOA 4RKEA 5C4MA 2ONJA 2F3RA 1I4TD 4MH0R 1FONA 1RGQA 3CNLA 3H86A 1O3GA 5FUYA 4NSYA 4NCYA 3NHAA 2G77B 4ZCIA 5KPDA 3W90A 3FFAA 1NN1A 1EFHA 1TGTA 1QHSA 3KIDU 4AFSA 1GKIA 1FIWA 3LW7A 2ZI9A 3GLGE 1AFQB 2WAXA 2RGCA 4Z1MA 3QVUA 4W5JA 1SVSA 4E07A 3GCGA 2Y81A 1FZQA 4MRSA 2DUCA 1UTNA 4NDZA 4ZHLU 1E2PA 4F4OC 2RGBA 1TF5A 4D7FA 4BAQB 3OX7U 4SGAE 5HM9A 2QMEA 1E1RA 1YVDA 1FIZA 3TSZA 3F8TA 1BH2A 1KJZA 2VP2A 2TBSA 3E0NB 2Q3MA 4QJ3A 1BYIA 4XSHA 1LHCH 1WQVH 1AQUA 2NZJA 2HWLB 3EC2A 2GJKA 1SVIA 4HGCA 2OXSA 1ZJ6A 4U32A 2Z0MA 2W00A 5AHGH 3T2NA 3VNUA 1G9IE 4F4JA 4FVDA 2IYLD 1YP9A 1YPKH 2JKHA 1MTUA 1FP7A 3RXSA 2JIZD 3L8ZA 5CLLA 1ACBE 2DFTA 3T61A 3U7HB 3GY2A 2GDJA 2G00A 1ELBA 4WXRA 3HYTA 4ZHMU 3TNSA 1X7AC 1II8B 4P33A 4JBWA 4HZHA 1YCPH 1QHHB 3SI4H 1K5GA 3UNSA 4OHZA 3K70C 5E8EH 2P95A 1N6PA 1TNLA 2JLRA 1DG3A 2AFIE 3CB4A 5HR5A 1D8TA 3RM2H 4HLCA 1E35B 1FN8A 1OXSC 4BAHB 4YC7A 1FQKA 3R8FA 3TSWA 2WIBA 1F0TA 1TGBA 2GXSA 2A5IA 1HAIH 3CF0A 1GWNA 1E9BA 1AVXA 4D80A 4JL8A 4Q1DA 3FTQA 2OLGA 3E0PB 2VIDA 8LPRA 1Y59T 1S96A 4DLVA 2Q9CA 4JBXA 3CX6A 4TYWA 1S3GA 3EWAA 3LD9A 3MWLA 4NWLA 5LDDC 2BTCE 5GIBA 5F9FA 3WMGA 3NDPA 1C2IA 4FU8A 1E9SA 1H8IH 3ZV9A 2GBLA 4EPRA 4XD7A 3PYHA 4WXIA 3MSXA 2EFCB 1FXYA 4V0NA 1UKZA 1TMUH 1BZXE 4Z6AH 4BANB 3TJVA 1WQ1R 4MTBA 1HQCA 1LS6A 5AR1A 2VIPA 1BTZA 2GCPA 1XMIA 2ZJYA 3URCA 1U9IC 2VHTA 1KIGH 2VSXA 1HJ9A 2GGVB 4PHGA 4BFXA 2CMKA 3OEEA 2CNWD 1TOCB 1UMAH 4C0BA 1TPPA 4ABFA 1G3CA 1VCNA 1OIXA 3U5ZB 4OQNA 4MKIA 4B6FA 4JJKA 1ELTA 4KO8A 5CHAC 2Z6VA 1AS0A 1CR1A 3HU2A 2V1UA 4E5UA 1UK2A 3ADDA 2CHQA 1H4WA 3ZZ5A 1LVMA 1UTOA 2ZI4A 2ZRAA 1R0YA 3RWOA 3QWCH 1G6HA 1V2PT 2J94A 1PPEE 2AX4A 4AKEA 1UVOA 3E91A 1Q0UA 3SEAA 1MUEB 1E2GA 5FH9A 2JJ2A 3NKKA 4ZKNU 3TGPA 4ZHAA 5E7IA 1DLEA 3RXMA 3EE0B 2XXAA 3LA6A 4A0RA 3NVAA 2P94A 4D25A 3GCHB 3LDXH 2BMFA 1YM0A 1AVGH 2ODYB 1OV4A 3B2EA 4BECA 6Q21A 1W11U 1NJFA 1TRNA 1CSOE 5FPHA 1F92A 2ALPA 3SOPA 1UTKA 1LHGH 4O25A 4ABGA 3V0XA 6CHAB 3I92A 4TYNA 4WJG2 3GJ0A 3BTWE 4QT8C 1GI8B 4QBGB 1C5UA 2BDYA 3I77A 1ZSJA 1T0HB 2F55A 1KXBA 3WYAA 2H9HA 5J5CA 5JI3E 2GZDA 1GI7B 1NC6A 3EIHA 1ANKA 3A7YA 4X8TH 3M7TA 3Q3XA 4Y0YE 2AKYA 1N6KA 4MRNA 5G40A 2W2VA 3RLYH 3RXCA 3AASA 1HAVB 2FZZA 1OWKA 1FUKA 5I25A 4G5RA 4B3XA 4XWKA 1TGSZ 2BDGA 1HT1E 2WPJS 3N70A 2QIQA 3TGIE 1NN0A 3FP6E 3K2UA 4TT3A 3QX5H 4B2CA 1JECA 2AXNA 2JJ1D 5JBAS 1XWIA 5JB9S 1W10U 3P8OA 2ZSAA 2HT1A 3RC3A 3DMDA 1CJTC 4OL0A 3WNDA 3TRFA 2VNTA 2IYZA 5EP2A 3QIAA 2Z9IA 4UNPA 3KJIA 1MR3F 4Q66C 3L3TA 4PANA 5L3VA 1EAUA 4CEHB 2IBMA 5JSZA 1LVOA 2XGJA 4FWTA 1KTTB 3AK5A 2FMXA 2IF2A 4GLYA 2ZDLA 3GY5A 4Q02A 1S3SA 1W1WA 3GDVA 1O2YA 3OIVA 3GP8A 1IQKA 1DICA 2F6RA 1BUIA 5GDSH 3OY5U 3LQQA 4RFSB 1CHGA 2WSSD 1NFWA 5ETXA 1CR0A 4CGZA 5BN5A 3AW1A 4JZDH 1P2MA 4ABAA 1NMYA 3RRZA 4HAWA 2IYSA 2JGNA 3JZMA 2PJRA 2MSCB 3HKIB 1R2QA 6GCHF 1UF9A 3AVTA 3RAPR 1AKSA 3VB3A 4YMTA 3KFXA 2HGTH 4BFSA 1BTHH 1G291 1NI3A 1CRQA 1DUAA 1KNXA 1IQNA 1QR3E 2XBYA 1SHKA 1TNHA 2QMHA 3BD9A 3W9YA 5C46F 3ATLA 2OINA 4KELA 4Y8XA 3R9IA 1XNJA 1SKYB 4R9UC 2J1LA 2CMYA 4BTIB 3DFLA 4KFRA 2YOLA 3AVQA 1O2OA 1GKYA 1RKBA 4ASHA 2X1VA 4C7OB 2WKQA 3I8XA 2A7QA 2J4IA 4LJ5A 2OCVB 5FBQB 1G8HA 1ARCA 1GHVH 3U1IB 2PV9B 3CWZA 4D4KA 2WINI 5A8ZA 3A89A 1D6JA 1ABJH 1SVMA 1OP0A 2BD4A 4V0OA 1E2FA 2M5TA 1DWDH 1RFNA 3BC1A 1W7GH 2WICA 1NJGA 4AX9H 1G5TA 1ELGA 1J8AA 2ZGXH 1BMLA 2PLFA 1O2TA 4NG9H 3TH4H 3LGWA 5FTNA 1AJEA 1C5RA 1ZJDA 4ZIRA 3F3YA 1RRCA 2QPAA 2BD9A 3C41J 5A09A 2OP9A 2GVZC 3P8NA 1GOTA 2ECKA 3HPQA 3QKTA 3A7XA 4BQSA 5DN6D 1GGDC 4Q7JB 2ZJBA 2NZ8A 1A7SA 2ZZUH 1UEIA 3K65B 1JQLB 3M5OA 3OY6U 1OKKA 2DE9A 1XXHB 2Z9JA 4A92A 4CEJB 5F3WB 4X1NU 3U9AH 5AJVB 1P2IA 1N6IA 3UMRA 1GHZA 1TMTH 2O8WA 3FKSA 4LHYA 4AYVB 1VYUA 4UONA 1GILA 2ASEA 3EIEA 5IRCD 1Z2AA 1UHBB 3QTVH 1S6FA 4CYMA 5GJWC 4LJ9A 1ESNA 1WYKA 1Z0DA 3A8BA 2ZAOA 1SVPA 1CT4E 2QGZA 4A1TA 2VVCA 1TQ4A 3QG1A 3QF4B 2R0LA 1LPGB 3EPLA 3H09A 4W7SA 3BTFE 2G5VA 1U99A 3VXFH 2QPOA 4Y0AA 4KVGA 5CYPA 3ODFA 4G5QA 1XMNB 4IKEA 4LHXA 4WAUA 1GDNA 4CEIA 4TTPA 1QURH 3OU0A 4GP6A 2ZREA 3UG6A 5JCPA 4RKJB 2VEDA 1J17T 1Z6JH 4M2LA 4TLCA 3A37A 3PEUA 1TWXB 5DSZA 5IK2D 2W6ID 2BOKA 4XVQA 1V3XA 2IJOB 1HJAB 4HLUC 2E1RA 1HY3A 1YZLA 4OI2A 4C0KA 3AAVA 1MAYA 1HV8A 3M7UA 2OFWA 3OEHA 1ETRH 1DSUA 3NIBA 2ZHEH 3SU8A 3RHFA 2ATXA 1D9IA 5GPIB 3UFAA 2IXEA 4I33A 1F5LA 1Z06A 1XX6A 4YO9A 1V2VT 2ZJ8A 3U8OH 2FPZA 1WB9A 5T6FA 3BTQE 5K8TA 5BN4A 3DO6A 1W48A 3TK6A 3TNFA 1UTLM 1HQYE 1YPLH 2BVXH 4WMDA 4HDQB 2O8CA 2H9EH 3M1IA 3T1VA 1A5GH 1E2KA 4H1VA 1JIMA 2ERYA 3D7MA 2D3WA 1E3MA 1RJ9B 2OFOA 1DFPA 5FUVA 1C1WH 1S2MA 2R2AA 1ETSH 1EGAA 1KDOA 1KI8A 2XTTB 3RSLA 4ZDKA 3DHKH 2VLIA 4Z0KA 2XITA 3F9EA 5AUOB 4IJMA 4KFUA 1A1RA 1OF1A 2BHGA 1Q1BA 2IN2A 4LGMA 3MH4A 5FBIA 4ABEA 4HLQB 2XOKD 1SHHB 4DLRA 4NMMA 3SV2H 2V7QA 5E0HA 4HLUA
chains in the Genus database with same CATH superfamily
1YR6A 5LZ5A 1ZL2A 4TT8A 3IP6A 1T5DX 4UNNA 5JH7F 5BRJA 1DDGA 2GPJA 2HNTF 2WSMA 2WJVA 3NP7A 3F2GA 2M6LA 4BFWA 2NO5A 5JISA 1YRHA 3FETA 5D01A 1O3YA 1D9XA 2D2IA 4YDHB 2G1PA 4H7EA 5IC6A 3E8LA 1K2I1 3MCUA 1WKBA 3SBEA 3TF5A 1L4KA 5FX6A 2AIRA 1OWDA 2XTZA 3EVDA 1K88A 3D5QA 1N6OA 4UUOA 5TRTA 3HCWA 2L19A 1QFZA 3QPWA 3NBUA 1JTVA 1AN0A 4MA5A 3W05A 3TJZA 5J5AA 1PS8A 2P6NA 1QK5A 4J3FA 5I48A 1ZOSA 2IOYA 4H6XA 3GT3A 1C2EA 1ID5H 3DP7A 4X54A 3ACBA 1W87A 4LUCA 4BLRA 4N6OA 3K9WA 2P6PA 2XNIA 4DNQA 1J0EA 3T38A 4BO1A 3C3JA 4NV3A 1Y3WA 4HVTA 5BQ5A 3MJRA 2RG1A 2IZ0A 1BEUB 4RKWA 4QSMA 3DE7X 2CDAA 2G55A 4BJ6A 3LUFA 3EVCA 2JL1A 4ESTE 3OZWA 1P91A 1IZYA 1PBNA 1NYRA 5JAIA 2VWOA 3BTHE 3A2MA 4DDHA 4GHQA 3ER6A 2C29D 2YVUA 1GCOA 5JWHA 3TOSA 2X86A 5AVRA 2QUHA 3SZGA 1JPNA 2LIPA 3A7DA 1S6HA 3IVRA 3QLUA 1HX7A 3DOJA 3V7YA 3HNPA 5TARA 3USZA 4JLNA 1EKBB 4JH0A 4OP3A 3AHJA 2QYSA 4Z3KA 4GSLA 5AFSA 4O4JB 2HCBA 1Y9ZA 3PFFA 2B8NA 1CB7A 4AJPA 2RHBA 5G3YA 1U0NA 1WZNA 4RTLA 1PJCA 5JZOA 2D2DA 2A3NA 2EXXA 1Z0JA 1EZZA 2BVSH 3TR0A 2NUTB 1Q44A 1KOFA 1WQ3A 1DDJA 3MWDB 2C98A 3AUKA 2P3SA 1X7HA 2JH8A 1QH9A 3PI6A 1A9OA 4RFVA 2YHAA 2O52A 3OCYA 1UJ5A 4G1MB 1HURA 1SXJA 4G81A 5JEEA 5KVSA 1EVIA 3BRWA 1W88A 4FUDA 1BGVA 4BWYA 4QEDA 3PEYA 2J3DA 2YZ7A 4E4TA 3ZVNA 1PJPA 1GO2A 1T5IA 2HPPH 2O50A 2W98A 4NPCA 3MI4A 5LXTF 4ENUA 4W5RA 2F9LA 4YT5A 3W04A 3IUQA 3GX1A 3WLFA 2ZKSA 4XWWA 3ZHRA 3KALA 3RF6A 1Z5OA 4MS3B 2XCQA 4H7PA 2ZI2H 1QLHA 3Q5DA 2LWIA 2VDKB 2FPPA 4LYAA 5AYVA 5KC9A 1FNCA 5T6DA 2QQFA 1Z22A 2WNSA 3W5CA 4OB8A 2H1WA 2Q1TA 2AXQA 5FIUA 1LRKA 3T7KA 3ZZTA 3EPRA 4BN5A 1NDQA 3MK31 3RD5A 1T9KA 1C5KA 1NF8A 4LF6B 3PKZA 3VR5H 3DBOB 1W7AA 4QBIA 2J7KA 5C8ZA 3C3WA 5IJAA 2WTNA 4JSRA 5FF9A 1KYXA 5BNIA 3VU9A 4OSEA 2Z08A 2VVVA 2XNSA 1YE3A 1O2SA 1GG2A 4FIDA 1KU6A 4F3NA 1WA5A 2XB6A 1NN5A 1NA5A 5FR1A 4IHKA 1RC1A 2YIMA 3KPUA 2O2XA 3U3DA 1MKYA 3L79A 1T4GA 4TTRA 4UVDA 1ULAA 2P6MA 1Q7TA 2B6HA 3CPEA 4HB4A 4RVCA 2CNLA 4PIPA 4NCIA 3GBVA 1DSTA 4MXDA 2Q1JA 5IMBA 2FUNB 2JD0A 1RADA 1QQ7A 2PRSA 3KKEA 1TNGA 2QE7D 1V2WT 2Z2KA 2FMHA 3MA0A 1XALA 4L9AA 3S69A 4IIHA 1YPMH 5JTTA 2STAE 1Z39A 2ZBEA 4NWIA 2P0YA 3WK8A 2ZU5A 1Y98A 3HPRA 4EI8A 4KE8A 4O2BA 3TIUA 3ODDA 1JJIA 3E1XB 2ZANA 4IGDA 2OGZA 1SOWA 3FZNA