4B73A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 209
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b73A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b73A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b73A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b73A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b73A03
2YZ2A 2AX4A 5KNBA 1FDPA 2XB4A 3E70C 3WNCA 3TH2H 1J70A 3L0IB 5TB5A 3GY6A 4DC9A 3HWSA 3QVVA 3LH5A 2C95A 3PG5A 1Z6EA 1PQ8A 2VF7A 4C0KA 2ZYUX 1E79D 2D7CA 1A2CH 4IVPA 2OCVB 4JK6A 4IFBA 5A8ZA 1HAYB 3VNVA 5JECA 3KNXA 3I4LA 1XEWX 1BTXA 3BOSA 2JIZD 3KB2A 3B2EA 1VCIA 5BN5A 1C5WB 1TPZA 1VITH 2FSGA 4O2RA 3QY0A 4NCJA 4FVBA 5FBEA 3RU4T 1OYQA 1ZR0A 3FP6E 1WA5A 2FZZA 2VHJA 2QP9X 3T2NA 1RIWC 4AX9H 3U69H 2F9NA 1E2GA 2GJ9A 1MKWK 2QT0A 4HAYA 2G52A 4JKYA 4P4SA 4K8OA 1EX6A 1N25A 3L0OA 4IDQA 1P10A 4BAHB 3W6NA 3NTUA 2OSBA 3GFOA 4LV8B 5J4YA 3PM3A 3ZZ8A 2LPRA 1ZD9A 2XNIA 3N2EA 1CT4E 2P3TB 4YM9A 1GSIA 3GCNA 2ZITA 3MAAC 2PGBB 4WMFA 4DW2U 3HKIB 1SGEE 4IW3B 1SGFA 5JJLA 3IIMA 4TWYA 4MQAA 2ZJ2A 4LY6A 2A2XH 2TIOA 1FTNA 4ZUHA 4LJ4A 1TNLA 1XXHE 4TMVA 1O2KA 2A30A 5DN6D 4IXMA 2GEUA 4AFQA 3E6PH 2VVCA 1GHBF 1QDEA 1BMMH 1C1PA 2ZQ1A 2V1XA 3EA8A 3RXFA 1W0KA 3B5JA 4GHQA 2ULLA 2O8EA 4BTTB 1FIWA 2PTCE 2IL1A 1KKMA 3WMFA 1GJBB 4OS7A 4FXPA 2IHBA 3D8BA 1OXTA 3AVOA 3SJ9A 1YGCH 1SKYB 3OTPA 3UKDA 2Q6TA 3VGCB 4FUBA 3B1VA 3CX8A 1C5XB 4YDHB 1ZNYA 3FP8E 1C5SA 3P6ZB 2C9CA 4A0HA 3PUWA 1Z29A 3FMOB 1IQMA 5FBWB 4RZ3A 2VVUA 3CX7A 3P4YA 3ADCA 1AMHA 1W7AA 3T1TA 1OH7A 1SVIA 1O3DA 4ZKRU 4OHVA 2V54A 3RXQA 1E0SA 3AP1A 4C30A 2ZU1A 3SYJA 3BTEE 3TIUA 3NEYA 5T6DA 1SZPA 4XVRA 1YQTA 2J0UB 2SGDE 4QBHA 4DLUA 1OS8A 3QK1A 1GBKA 3EW9A 2NO0A 2DPXA 1T3SA 4YMSA 2YOFA 1A2KC 1FP6A 3ZQJA 2UZ3A 4KV9A 4Z0KA 1WCV1 4F4IA 1H65A 1GI4A 4AKIA 2NU3E 1ZUNB 4O25A 2ZU4A 4KYIB 5EQSA 4AYTA 4X1NU 3S0NA 3QOFA 2V0BA 1NKTA 4II7A 2H2ZA 2G1JA 4XSHA 1TLDA 3U44B 3RU4E 4QM6A 2D2EA 4MDEA 1O3CA 3GCHB 1R8SA 3OTJE 1SVMA 4LZ4B 1N5IA 1T8NA 2AHOA 4F92B 2X2FA 2WUBA 4OM9A 4QGGA 1CF4A 4Y0VA 3SU2A 3SJIA 3ATIA 3CPJB 1VTKA 1C1QA 3BTTE 1ZINA 4L15A 5FR2A 2R0LA 3ZZCA 4K46A 5H68A 2AH4X 1Z0FA 4K8BA 4ESHA 4Q1CA 1V2ST 2HT6A 4SGAE 4HAWA 5B30A 2X1VA 5C5NA 4M1MA 1O5DH 5CJ2A 3A7XA 3QVUA 1EPTB 4QFMA 2PT5A 3ZYEA 3PMAB 2F55A 1O2VA 2O5VA 1F0UA 4I99A 2JJ1A 1MTSA 4PHGA 2KJQA 2MSCB 4X0WU 2LCFA 1ZMXA 1W49A 2EI7A 3D49H 1UVSH 2R9PA 2J3EA 3I78A 1GBBA 2ORWA 2GDJA 4DSUA 4NZYA 4RSGA 1ETRH 3BFKA 3W3AA 3TAUA 4L9WA 3UFAA 1GMDF 1NN3A 1FLEE 2YC4C 1AU8A 4O03A 5CHAB 4LV6A 1J16A 3SS8A 3RMNH 4JJZA 1C5LH 1AGRA 1SLUB 2QCYA 3QKSB 3VXEH 2VSXA 3PCRB 4NCYA 3UTUH 1VYUA 3IPYA 1TX4B 1U99A 4RZXA 4ZHMU 4HLUA 3PUZA 3RANA 2ZFTA 2V4ZA 4RJLA 3RNLA 2ZO3H 2BY7X 4UKDA 1TONA 1EAWA 4ZAEA 1SGQE 4EPYA 1MMJN 3DHWC 6CHAC 1UBCA 3PYHA 1GFIA 5JS7A 5M04A 1BMFA 4PC3A 2H9TH 3BD9A 4A15A 3UNRA 3P4XA 1TEXA 1C4V2 3I5XA 1EFCA 2NQ2C 3SJZA 1MO6A 5KPJA 1BYUA 1NY6A 1DICA 4IFEA 1E1QA 2JJ2D 3TBKA 2WMNB 2Q6FA 3ZLJA 2Q21A 4CHAC 1V43A 1XTKA 1SGTA 4FUCA 3Q3JB 1IHTH 4Y8ZA 3SV2H 4TYPA 5AJXA 3T5DA 1MU8B 4TZ0A 2A7JA 4Y7BA 2AFIE 2ANMH 5A5GA 4P3YA 4LJYA 3KKPA 1QY6A 8GCHG 4EAQA 1V5WA 3A1SA 4BZQA 1N0UA 1ZMLA 4JSYA 3A8AA 1JAIA 4D4MA 2D4HA 1O2JA 1G17A 5TV2A 4Q21A 3OESA 1YLCA 1WXQA 2R65A 5A09A 1EB2A 4QBIA 3VAAA 3TH5A 3GEEA 4Z1MA 2J2UA 2PKAA 1ELDE 3MH7A 1KDQA 1DO0A 3Q3YA 1VCMA 1QJ6B 5L8VA 2W6IA 3LH1A 2UKDA 1NRQH 3Q72A 3KXIA 1GI0A 3AVQA 3S69A 1O32A 3H2YA 2WSMA 1GHAG 4JSTA 4WVFA 2GCNA 5FOUA 3PWBA 1IJEA 5B6OA 2IEZA 4KTCA 1XEXB 2N1BA 1FMLA 3V12A 2BDAA 1CRPA 1XUHA 2Z9KA 1R0WA 2ZFFH 3MNBA 1K1MA 1P9RA 4JL6A 4EJSC 1O38A 1G4AE 4CIDA 3KZ1E 3SOSA 4KBFA 2V7QD 4MTBA 1J17T 3OIYA 4MPXA 1KNXA 5DP7A 2ZSDA 5TCCA 3SFVA 1SLVB 3U8OH 2W26A 1MD7A 2QXJA 3RSOA 5EXNA 2AL7A 4NIYA 4IMZA 4P4UA 3TNSA 1AIPA 2D26C 1Z1IA 2ALVA 1U8YA 1O3FA 4E5UA 2FJUA 1GI5A 1Z6JH 1TAWA 1P11E 1P09A 4IOMA 3ZZUA 1F0RA 5BN3A 1A7JA 1F2TB 2FU5C 1EK0A 1R5NA 1KXBA 4WMDA 3RXKA 2QG6A 3T12A 2VIIA 3V00A 4A9AA 3M6AA 4NG9H 1ELEE 3O8CA 1LQDB 1G5PA 1TRMA 1NU9A 3KF2A 3UOPA 3ZZ3A 1SQ5A 2N42A 4DIIH 3QSYA 4LHVA 1OJLA 3KN2A 2ZPRA 3BH7A 4AKHA 4N3NA 2IF0A 2R6FA 2GZAA 1R4AA 2BC9A 1XPOA 4OS5A 3I77A 4B6EA 2H5CA 3LH3A 2QN5T 2CK3A 4QNMA 3VB3A 3KIDU 2O52A 2O8UA 4NPHA 2YNAA 1P3JA 4LHWA 2XBWA 2DCUA 1Z06A 1J15A 2W0SA 1NVWQ 3LQQA 1GRQA 5FCKA 5E0HA 3K65B 3WRXC 2I3BA 2MMGA 3CPHA 2W2TA 4GRAA 3ZS8A 2BLVA 1J14A 3FHTA 3ATWA 3FZZA 4Q7XA 3LBIA 1G4UR 2FOAA 1O2ZA 3OE7D 1GJ8B 1O5FH 1R0YA 3SJAA 1GL7A 4PXAA 4TYYA 1IN4A 4OHXA 1QHYA 3Q9LA 1IY1A 1U0HC 4Q9IA 1KTSB 5EXSA 2CGAA 1W36D 4X2WA 1ZM7A 2ZGCA 1G8FA 1SHZA 3UXMA 4RN6A 2IYUA 2ZGHA 1GI8B 5JSZA 4HDQB 5C4GB 3E5HA 4MKHA 3Q76A 4H1UA 2G5NA 3FMIA 3GPLA 3PTNA 3ZV8A 2RMKA 2NU1E 1OWKA 4ZKOU 4NCNA 1ZC3A 1GRNA 4DCTA 3LGUA 1DDJA 3EQ0H 5FBIA 4YT7H 4GUXA 1X8KA 1FNMA 1C1NA 1OP0A 2P5SA 1KLIH 1C2DA 2WPKS 3LXRA 4ABHA 1QG2A 1GTVA 2GVZC 5DYIA 3IEUA 1S9DA 4HZUB 5IHPA 2WWIA 1GWNA 4FINA 4Q18A 2YOGA 4LV5B 3RRMA 2ZVPX 1TMUH 4QGHA 1T8OA 1LHDH 1CU1A 2SHKA 3H86A 1V2WT 2ZI3A 2ZRHA 3B8HA 3O47A 2HNTE 5HTKA 2H9HA 4UFGH 3Q3XA 3BB3A 4K81B 3MWJA 3GY7A 4MRPA 4F7WA 4ZI2A 4CT5A 2PHBA 1O3BA 1SHKA 1JJ7A 3U61B 4V0MA 4HEJA 4UXJA 3GLIA 2PCJA 3ZH9B 2PL3A 1O2SA 4X8OA 4U02A 3BTME 1IQLA 1DAHA 1O2HA 3PLPA 1Y3AA 4JVSB 4TL9A 1J7KA 1A46H 3A4LA 1K5DA 4W5JA 2DHRA 4PAOA 3SNCA 3A87A 1HAHH 2CXXA 3O8RA 1EATA 2B7BA 4QG7A 1RTKA 1P01A 4QGFA 3FTQA 2R0KA 1DXPA 5EXMA 4E07A 1O5BB 1UDWA 3U60B 4BZXA 1ESTA 2ANYA 4P31A 2F83A 4B43A 3PMBB 1D8TA 4A2PA 4A1VA 4YZUA 5DP4A 1HT2E 4I32A 4LK4A 1W14U 3ZZ7A 3VMFA 1E6CA 4UXIA 3FB4A 4DLRA 3MWKA 3LX8A 1H8HA 1NRSH 4CVNA 4OL0A 4B73A 6GCHG 2HVXA 3C27B 3D62A 2QTHA 4TWZA 4U01A 5B2ZA 1VITG 5A0BA 2UUKB 3VB7A 1KHTA 3E8LA 1ZMNA 3B78A 2AYWA 1SLWB 4ZCIA 1C5YB 1NLZA 2VWNA 1MTNC 1CT0E 1EOLA 3R3GB 1DWDH 3LT3A 1LVYA 2OAQ1 4OS2A 2QMEA 1H9IE 1UO6A 2QSZA 3RLYH 5JEEA 4KI0A 2WTUA 1KI6B 2ZEJA 3SOPA 2O8FA 1Y5UT 3GDVA 3VKWA 3RMLH 2ZRNA 1T8UA 2RHDA 3P26A 1GJ5H 4DZZA 4NU0A 1BIFA 4EQ6A 3CS0A 1RRKA 3RXJA 3UWKA 3LONA 2A32A 4FU7A 3VB4A 3SYLA 2NTYC 2FOCA 2IXFA 2BWJA 1XFAA 4B2BA 3LFUA 1YCPH 1QIXB 1KTTB 2KSQA 1SFIA 2CV3A 4R9UC 1MCTA 1P5ZB 4A6XA 1UJ2A 1OF1A 4AGKA 1TMBH 1FY3A 2STAE 1C9KA 4Q7LA 2VRWA 1COWA 3QPUA 2QAAA 2ZU0C 1UBGA 2XX3A 2R2AA 3C4JA 2PMKA 2QIQA 1QBKC 4JVLA 5FBQB 7ESTE 621PA 4EKDA 5EE5B 2GKVE 1EFRD 1O3LA 3B85A 3PFIA 1B23P 1V2JT 1A1VA 1CJTC 1F48A 2G51A 1Q1EA 1LF5A 2VSFA 4V02A 4MG3A 2K5UA 4URUR 3S9AA 5J4LA 4JLOA 5EJEA 4MKIA 5KSZA 1ANBA 1PYTC 1C5TA 1GBDA 3FGNA 2A3RA 1RFLA 1SL3A 1ZGVA 5CK4A 1FI8A 3RLWH 4DBLC 1BOFA 3OEED 1AO5A 3X1ZA 3F1SB 4KFRA 4G5OA 1MT0A 4D4KA 2WJHA 2ZAOA 1YPKH 4D9QA 2VP4A 2KAIB 1Q31A 2ZU3A 5JWHA 2D74A 4FCWA 2BD5A 4Q47A 1S1CA 3HGPA 1P75A 1KMQA 2Z9IA 2JLRA 3THWB 3BWDD 3VXFH 2CNWA 3ATMA 4A8JB 4F4JA 3PEYA 2V3OH 2CHAB 1ZNZA 2IS6A 4ZV4A 2WV4A 1JR3A 1ZJKA 2CL0X 1H4WA 1YHNA 5TJXA 1RC8A 2QTFA 2CLSA 2JAQA 3WYGA 4E03A 1UKVY 3FKSA 2W58A 1GG6B 4TYDA 1EX7A 3PVSA 3X1XA 1YR6A 1PV4A 1ELCA 3RS7A 2VHTA 1XKAC 4ASUD 1QB6A 1CEEA 4DHEA 4ZDIA 5C2ZA 1DAIA 4HUQB 5JHGB 1ZRHA 1UFQA 1AWHB 1U8AA 1P6XA 1OSSA 3FE2A 2TGTA 3UNQA 1KMHB 2J1LA 4PPQA 1GBEA 2H7VA 3QX5H 1KZ7B 1KXEA 2GCHF 1A5GH 4Z6AH 1E98A 2FX4A 1E2LA 2BTCE 1TQ0B 4VGCC 2FIRH 2X8AA 1IJFA 5HE9A 1FIZA 2C8ZB 4W9MC 4H6SB 1C5OH 3C5HA 5EE1A 3RHFA 1QR3E 1SVSA 3ADDA 3RRZA 2YWGA 1EZXC 2GAOA 1G3EA 1MV5A 4CDGA 2PX3A 2QQ0A 5KU1A 3X1YA 2WPMS 3MO3A 2O8TA 3KDSE 4A2WA 1QG4A 1F0SA 4PHHA 1UPTA 4G01B 1D2EA 1HFDA 2Q6DA 3SHAH 5AHGH 4BAMB 4E09A 4S2EA 1TAGA 1D5CA 4EIWA 1TE0A 2BVNA 1THRH 4C0AC 2VP5A 5DGXA 2XSZD 2ZECA 2ZEBA 2WVJA 3I92A 1KO7A 2WM9B 3CP7A 1SLXB 3NKVA 4OI2A 1DX5M 1NIPA 2AS9A 1DAEA 2XXLA 4NGAH 1SGWA 1QB1A 2EWWA 2BKEA 5DLQC 1GL9B 3AAUA 5FTNA 4KGAA 2IC5A 4IKEA 1K1JA 1RRFA 3U1JB 2QY9A 2O8DA 3A86A 1T3LA 1R0XA 1ZTKA 1TQ6A 2ZTYA 4QL3A 3NH9A 5HE8A 1W3CA 3S9CA 2ODBA 3NEJA 2PWXA 3HK3B 1ZYOA 2KWIA 5KNCA 2C8WB 3R0FA 1QCPA 5BRRE 3OYPA 2Z6BD 2XBXA 3F8TA 2J4IA 4PFSA 4AK9A 1WV7H 1NLYA 2A4QA 5JB8S 4H6TA 4PROA 4JLKA 2CL6X 4NYJR 1GITA 1HH4A 1E2NA 5J4KA 1DE0A 4XTCS 1EPTA 1Y3UA 3ZVMA 1CGHA 5C18A 2OXSA 2A0QB 3FMPB 2QROA 1HAZB 4CT4B 1BTHH 2J46A 1ETUA 4WZBE 3L0SA 3IBGA 4PAMA 2OFXA 1NO9H 1K28D 3PO1C 1A61H 1OKKA 1SQAA 4KSBA 2DE8A 1E9SA 5E95A 3QIAA 4IDPA 4DURA 2VP6A 3TJOA 4ZKEA 5E0GA 3U3JA 1QA7A 2FOFA 1GDUA 1SB1H 4YLUA 2YHSA 1LF0A 3SHFA 2ZDMA 3MFJA 1ZM3A 2ANCA 3VHXA 5KHOC 2ZM5A 1A5HA 4E05H 1VCNA 1GGDC 1KSJA 1G9XA 3K9HA 2Z3DA 4HATA 1HIAB 4LJAA 1HAVA 1D3TB 4C0JA 1FY1A 2GV7A 1LVOA 2A5YB 4G0NA 4AI6A 1Z6YA 3EC1A 1W10U 1V2MT 1N6HA 5K8TA 4ITRC 1ZTJA 3IDQA 1TYNA 1DPOA 1XTQA 4QT8C 3ADBA 4KJZA 1MZAA 5TARA 1OXXK 1N6OA 1MKXH 1E0AA 2QMUA 4LHXA 1SOZA 4V0NA 4B3FX 1JR6A 5HPYB 3LU9B 4WH6A 1D2MA 1NS3A 1NLFA 4LDJA 1JALA 4LJ5A 5BYKA 2RGNA 1UHBB 3MO6A 2ZPSA 3KUCA 4ON9A 2GJ8A 3AP3A 4OBEA 1UKYA 3QEOA 4DCSA 4OHZA 3SUDA 2WZQA 1GVNB 1JRSA 4JJKA 3K0FB 1LPGB 1NFXA 3T61A 4AGJA 4JZIA 4DCDA 3KKNA 4ILEA 1C5UA 1PPBH 1G1MA 4TLAA 4AZ2B 3OFND 5HKKD 3QKTA 2REOA 4AYXA 2PV9B 2RA0A 4Y6DA 5FUWA 1BRBE 2F1HA 4O9VA 3QXCA 5EGMA 2FESH 2D06A 2QEQA 2A5AA 1AFQB 1FZQA 1GBAA 3GCGA 3SI3H 4URWR 5AF9H 1FY8E 2RGDA 1RJXB 3I72A 4KELA 4MPWA 3TRFA 1IQGA 2I1QA 4GNKA 2CF8H 3MMGA 2REXB 2A5FA 2QC2A 4D6PA 1M7GA 5GJWC 4K8YA 4ZKSU 3MU0A 2GAAA 4LBZA 2GHIA 3KJIA 2TMKA 3RXDA 1NVVR 2ZTZA 3HU1A 1AB9C 2WOJA 1HUQA 1EKBB 2ONJA 1HAGE 4ARZB 2FF7A 4GHTA 3BORA 421PA 1XJCA 2CMKA 4FMCB 1HYQA 3UMFA 1TU4A 4ZDJA 4AG1A 1YRBA 5F9FA 2P67A 2GX4A 1QL9A 3L8YA 4MKGA 3TKLA 3P32A 2FE4A 2ZWLH 1IY2A 2AKYA 4DY7B 2OILA 3NG1A 1JECA 1NN5A 3BIVH 4OJKA 1LVMA 3SJCA 2JLZA 3RM0H 3TJNA 3GOVB 1L0ZA 3TLXA 3GLGA 5E3HA 1RRCA 5K7RA 1R0ZA 4XD7D 3EAJA 2ZE8A 4C0BA 1ZSLA 4TSFA 3K8YA 4MVNA 1DSUA 3SN8A 1XVOA 1NN0A 2OFWA 2ZQ2A 3KTAB 1W36B 2G1KA 1ELTA 5IT5A 3SNBA 4UJ5A 4EDHA 3SGAE 3LRPA 2R6AA 2JLSA 1NZQH 5CIQA 4Q1BA 3AVWA 1ELFA 4OK3A 2FFAA 3M5OA 2CJWA 3SQXA 4WJG2 4PANA 2HLCA 5JI3E 3A88A 4X6OA 1G6HA 5EE3A 1YR8A 1GBIA 4KFUA 1O5AB 3LQRA 1R10A 4D82A 1KK2A 1W5TA 3IEVA 1W8BH 4OQLA 1H8ED 1KIMA 1XU4A 4JLBA 1N2CE 4TYWA 1E2DA 3CF6R 4MITA 1X3SA 1CE5A 2QT1A 3NIBA 3QF4B 721PA 2C03A 2IWRA 1RW4A 1TRNA 1LCYA 2ZFPH 3LJJA 1QZXA 1WBDA 2AKAB 1SGNE 1XWIA 1FUKA 2VH6A 2J0VA 1G5TA 3LWNA 1FUUA 5CITA 4OHYA 1Q3HA 5FFMA 1O3GA 2J7PD 3MFYA 2FOHA 3U1IB 1O0DH 5FUVA 1NROH 5DI3A 1SR5C 3A1TA 5FX6A 2OD3B 5EP4A 4OKSA 2VHQA 3DM5A 1NRJB 1S85A 1GM5A 2IJD1 4YXWD 2THFB 1EB1H 3Q8XB 4U30A 4Y79A 2JDID 1P2MA 1HBTH 2Z94A 1E1RA 3BSQA 3OIUA 1DG1G 1GBMA 3A8CA 1KTVA 1CR1A 1RJ9B 4ISLA 2I1VB 3AF2A 2WWFA 3EASA 2IF2A 2BQWB 3OAAD 3QTOH 5IRCD 1N6RA 1IXRC 1H1BA 3T1VA 3UQVA 1ZJDA 2BBWA 1IAQA 1GCTC 1FL9A 2Y5GA 1SXJD 2JLXA 1C1MA 1E2QA 3PUVA 3QXHA 2GP9B 4ABDA 2Y7ZA 1S3SA 1GI2A 5C20A 1V2VT 2GGVB 2WAYA 1EXMA 3MJHA 1D6WA 3NXPA 3SZEA 1RRPA 2PTNA 1BJUA 2J9NA 2BDTA 3Q5DA 1E2KA 1VYTA 4JS0A 4RFSB 1M6NA 4RD4A 4DJZB 3B60A 2H17A 1ZM2A 4FUHA 5P21A 3X1WA 2ZTXA 4WY3A 5LPEA 4TPIZ 1S0RA 3SI7A 4Q7MB 4XWAA 2R62A 2D1JA 2KI5A 4JZ1A 2GWHA 4MPUA 1TA2A 1XTIA 2BIFA 3IQWA 4PO8A 2BD4A 1HY3A 2OCYC 1NFYA 3FDIA 2HRVA 2ZDAH 4HTCH 4OYHA 1T8TA 4PTLA 4D81A 3K70D 1FQ3A 1Q12A 1A2BA 4DVAU 1S9HA 4M21A 3CX6A 2XZOA 3CONA 3LGIA 4AFSA 4ASHA 2ZR9A 5KNDA 4J0QA 4PAQA 3U98H 5CE1A 1XXHA 2XTNA 2YOLA 4PPFA 4A2QA 4B34A 2RGCA 1S81A 1XMJA 4XE4A 4A82A 3W8NA 2QTVB 2QI9C 1XCMA 3QE0A 3VX3A 1ELOA 2ZGXH 1LDTT 4JLDA 1CA0B 5IK2A 4EPVA 1VDZA 3JZAA 1TF2A 3L82B 4LUCA 3GEIA 1C1WH 1AZ8A 1CULC 2Q9AA 1DAKA 1DUAA 5EODA 3B7GA 4M9SA 1W44A 3GLFE 2TBSA 4Q4AB 1G291 5LDDC 2Y7XA 4HLUC 4UONA 4RKOB 1G18A 3CR8A 8GCHF 1G7RA 1QTFA 3BTFE 3IGFA 3ZVGA 4UFDH 3QENA 2R9VA 2VA8A 1KXCA 4W5HA 1YKTA 4IOKA 2D3WA 1PQ5A 1OYTH 3AVVA 2IYSA 1EAUA 4P33A 4IBLH 3VU9A 1TADA 2FEOA 1ORFA 4N1AA 4KVAA 5E7MA 3STJA 2AMPA 5CMXH 1R7RA 5GJVC 2QA5A 4HZIA 5DN6A 1FNNA 1HV8A 1O3MA 4TMTA 5TXGA 3SBDA 4B75A 1OKXA 2GCOB 1CR2A 4Y10E 1OFIA 1P9UA 2G9NA 1SVOA 3MG9A 4PQYA 8KME2 1FFHA 2WJVA 2F9MA 1GHAF 1CR4A 2BY9X 5ESTE 3WNBA 3ODDA 1W4BA 1E36B 2G3YA 4KODA 2BLQA 5DISB 4TTPA 1BTUA 1W7XH 4ZXYH 1ZNWA 3QXSA 2VIPA 1EUFA 1QRWA 4W7SA 3LBHA 3GJ0A 3JVVA 1DELA 4UFEH 4TL8A 1KY2A 1CR0A 1VJAU 4CREA 2ZJ8A 4URXR 3CIOA 4L16A 4B1TA 2P2LA 2ZJOA 4HGCA 2GCTC 2ZF0H 1TGSZ 4EJSB 1Q2WA 2I6SA 3K6ZA 2VINA 5FL7D 1CHOG 4UJ3A 5J4HA 5JYIA 4BLRA 3B1XA 5JLJA 3TPIZ 1W0JD 1UK3A 4FUEA 3UMSA 1XTSA 3PJRA 2QAJA 3NHAA 1G7CA 4I8GA 3A1WA 2WSSA 2J41A 2Z3EA 3OY5U 1A5IA 1HV7A 3SU3A 4P4TA 3SU8A 2VO1A 1Y3WA 2QPAA 4QXAA 2XZLA 4KXFB 2Q0HA 2I6QA 1NTPA 3AW0A 1GJ9B 2AEIH 4H9GA 2ZANA 4D25A 1C2LA 2N46A 1QQUA 1GMCF 1TGCA 4JZDH 1GNPA 2NO6A 4Z54A 3BH6A 3ND9A 4PX9A 1OFUX 2IYYA 4M1SA 4B3CA 1KJWA 1QHHB 1MQ6A 4B71A 4BLQA 5EP2A 4K60A 5JEDA 1O2TA 3ECCA 3U4QB 2RGXA 1THPB 1TIOA 5EZ5A 1V2UT 2EA3A 3TQCA 1TGBA 1CHGA 1QRXA 1OWDA 4MLFB 2HUPA 2NO1A 2RGGA 5F2EA 1X8LA 1EZSC 1QRZA 1IHSH 1MOZA 2FOMB 4YT6H 2G88A 1EAXA 4NA7A 1NBME 5AFYH 3RMOH 3CRQA 4NWKA 3CLVA 4CRCA 3IKJA 1U9IC 5EXXA 4CEIB 3CENA 1ZGIA 2C78A 1O3OA 1YVDA 4B35A 1EAIA 3GDUA 2WBLC 1VGCC 2BMDA 2BZ6H 1T9HA 3THOA 1QVAA 1E2IA 4Y8YA 2SNWA 1JXPA 4DLWA 4CW7A 1E37B 1SGRE 1X1RA 1XZPA 1US8B 3A89A 4RI0A 5AUPB 2YNBA 4WBSA 5E2PA 3BBPA 1NP6A 1WYKA 5KOYA 5L3SB 4BPBA 2ZYVX 1TPOA 5CYOA 4NE2A 2KBEA 1QF9A 4MUAA 2Q6GA 3MOCA 4DXAA 2QNRA 2PH1A 4DEXA 1JAHA 4RSPA 1F6BA 1NG1A 4FMCF 4GP6A 3EPLA 2DB3A 3THYB 1SKYE 4MGKR 2OHFA 1OV4A 4TL7A 1ZZZA 3QBTA 1XP8A 3QKRB 1DWCH 2C8YB 4KVGA 4DSTA 5HZKA 2FSIA 2AMDA 2EFEB 2GMTB 2CF9H 1P3EA 2Z9GA 2FTMA 1W0KD 1M7HA 4N0DA 3VFDA 1U94A 4HLDA 1BBRK 1ZAKA 3E2IA 3HDTA 1MRSA 4YESB 2WPIS 2IW3A 4KITB 4HLQB 2Y5FA 4X8HA 3DFJA 4NL4H 1ZHPA 2ZHDA 5KDLA 1O3KA 5E2OA 1N6PA 1L7VC 4WXIA 5DP9A 1E99A 4PZYA 3R9XA 3GYLB 1SKQA 2BD2A 4TYNA 5L3QB 5SZKB 1SGFG 1QB9A 3NUMA 3AAVA 2QSYA 4Q5IA 1BCUH 1PFXC 2F9UA 1AFEH 3RXCA 3SUGA 2JKHA 3SNEA 4JLVA 1II0A 1BHXB 5C3NA 3RSLA 1CS4C 4DJTA 3SR0A 4H42U 1ONBA 3G5UA 1A4RA 1XMVA 2ZSAA 4MRSA 4DG4A 1TNJA 3M1IA 3R7WA 1FN8A 3C14C 1KO5A 3T29A 2H57A 2V6IA 1P06A 2D62A 1GILA 3ZZ4A 3H84A 1S6HA 2G77B 4DCNA 1C2EA 3U7HB 4ZCMA 2CEAA 1KY3A 1Z22A 3NC0C 4LYHA 4B3GA 2BVXH 1GAJA 1K8RA 2GEVA 3EZ7A 3AK5A 5LGOA 2BM2A 3LA6A 4XVUA 3GY5A 3OF5A 4LX0A 1L4UA 3MU4A 5G40A 2ZCKP 2Z4SA 2R6CA 2FPLA 3GISB 4XIGS 1CXZA 3TSWA 2XRCA 3TLOA 1S84A 3KB1A 1G3DA 2HGTH 1C2MA 1JOUB 1E34B 5CK5A 4NHOA 6GCHF 1KXDA 1YPGH 2QP3A 1XEWY 3C8UA 1VITF 4NFEA 3SC3A 2BD7A 1TFXA 1T3HA 1MH0A 1OWIA 1F5LA 3MWLA 1THSH 2G4TA 4LJ8A 1UK4A 4B2LA 3M61U 1U0JA 4X2YA 2Q3HA 1RTFB 2ZRGA 3T35A 1N5KA 2OAP1 1K1OA 1P0SH 1UVPA 1XD8A 3NHBA 2Z0MA 3GEHA 6Q21A 4TQUS 3CH5A 5H4IB 3ZS9A 2FDCA 2FPKA 5GJBA 4NYMR 4LYJA 3MHWU 4HB3A 3EARA 3K0FA 1K22H 1CVWH 5DNYB 4EFMA 1V2LT 1ZSKA 1NU7B 3BG4C 1ZJ6A 3UATA 1NN1A 2A5JA 4XBDA 1YP9A 1WTHD 2WPDA 3A84A 1GIAA 1M9UA 3MU5A 4NMMA 3UIRA 5D3MA 3QBVA 1DEKA 4Q03A 2UWPA 2FN4A 4GT1A 4PPGA 3KQDA 2VEDA 3M7UA 1O3JA 3U2QA 1SC8U 1OWEA 2ZI2H 3UUZA 2FPMA 1T5LA 1LKBA 3RRYA 5FHTA 1Z0AA 2J87A 1C5VA 1ZIOA 4D0NA 2PJRA 4DSOA 2XTTB 1I4DD 5J4SA 5G4BA 2HLDA 2ATXA 2J7KA 2R6DA 4GOJA 2P3FH 1YZLA 2ZJAA 3OZXA 4M1KA 3X2SA 1YJ5A 2GXUA 3QLPH 4DDUA 3G01A 4OGYA 3LGYA 5DHAA 5FR1A 2QN6A 2FODA 5K8IA 1L4DA 3SNAA 4C7OA 4ARZA 3CRRA 3UR9A 2XJ4A 4A0GA 3W5JA 4CRDA 1Z8GA 1ZU4A 4YLGA 1DARA 4G3XA 1WOFA 1T31A 1ZIPA 5C1XA 3QGJA 4DVGA 2PUXB 1GHVH 2GCHG 1P05A 4UFFH 3U9AH 1QBVH 1VJ9U 4UDWH 2IXEA 1BMFD 4GLYA 3D7MA 4NWLA 5LD2C 2GF9A 2Y8EA 2IS4A 2ZROA 3K09C 4PHTA 4Q4HA 2EEKA 1E1QD 2P0EA 3E1SA 4AYVB 2XNSA 1BRAA 4MYCA 4YMVA 4RCZA 1BOQA 4JLJA 1KKLA 4NCHA 1M7BA 1QQ4A 1HAIH 2C3SA 1G19A 4URYR 2ZP0H 2GJKA 1ZRBA 1N1LA 1FTSA 1A0HB 2QAGB 2NO9A 4LJ9A 1KO4A 2YINC 3CPEA 3GLHB 3DOFA 3F9EA 3PEVA 3NVAA 1ZUIA 3S1AB 4A36A 2ZRIA 4BOHA 5B64A 2AIQA 5DP3A 5BPEA 3ZZTA 3AKCA 1W48A 4C9BA 2W6ID 3KKOA 2XC0A 4PZZA 4TL6A 3VGCC 1SXJB 1F5NA 2AD1A 4CBNA 1CLUA 1ZW6A 2CE7A 5K8LA 3ZZ0A 1QRAA 2BX4A 3NBYC 3W34A 3C15C 1O5CB 3PV2A 2P93A 3P8NA 1BT7A 3PB1E 1X7AC 1TNHA 3SORA 2IPHA 3HPRA 1NMXA 2YV5A 4IHQA 4IN2A 2WIBA 2F91A 4X8SH 3TU7H 2BJWA 1FV9A 5LPNA 3EIHA 1ZPZA 1XF9A 3AKEA 2I4IA 3TR0A 2QV1A 4TLCA 3U3KA 3SJOA 4DGJA 3HPQA 2LKDA 1S1MA 4BEJA 3ZZAA 2VB0A 4K2YA 1Q22A 1BTZA 1E2FA 4EPTA 4KTSA 1AKEA 1ELVA 4LHZA 3K70B 2BY6X 2QE7A 3PTBA 3WMEA 2ZHFH 2CCGA 2W3IA 4NH0A 4M1TA 1F92A 2QENA 3KEEA 4OI0A 1QVRA 1EZQA 4FU9A 1Z1JA 1YPMH 2BEKA 1PQAA 2RDLA 1FUJA 2WPLS 3U7FB 1HCGA 1KAGA 2WMOB 1UEIA 2HPPH 4B47A 1FAXA 5EOKA 3WXMA 3EIEA 5AUQA 3GCHC 4DCUA 2WWXA 1J99A 3IUYA 2VLIA 3X1DA 4ABGA 2ZIQH 4QJ4A 1UMAH 4D0LB 2QPOA 1N5JA 3VKGA 2Y81A 4YLQH 5C4MA 1O31A 4ZDWA 2J34A 1F2UB 3U3MA 4BRUA 1FPHH 3TMKA 1UTKA 3VEQB 1XMIA 2CK3D 3FFBA 2NPFA 2P94A 5DKMA 3RXHA 1HE1C 4MQBA 4M53A 3IITA 1E2HA 1YPHE 3I62A 2ZR7A 1KZGB 1EFUA 4X1QU 3WY8A 1GWAA 1KSNA 4I1OA 1EPTC 3SU4A 4KFSA 2XBYA 2HXYA 1NRRH 3EZ9A 3QPVA 4Y7AA 3RXEA 1Z2CA 2VWLA 2NZJA 5DGJA 1II8B 5EU8A 1N0VC 3LLMA 4CF7A 1HYLA 1ZLRA 4A1FA 2OC0A 2OQ5A 1II9A 1N6XA 3SQWA 2ALPA 2UWLA 3M0EA 4CH2B 2FX6A 1QHGA 2HWLB 1MKYA 1TWXB 4RD0A 1ZM4A 2O9QA 5CHAC 1EJMA 5FAHA 1KK3A 2F1IA 3CR7A 2PSYA 4QHSA 2IHYA 8ESTE 1OP8A 1O30A 4V0OA 2A45B 1GJAB 4JMPA 3NDPA 3LY5A 4BFUA 1G32B 2BDCA 2C96A 2B92A 3KKQA 2FA9A 3TGJE 3JZ2B 1W0YH 2JLUA 2F9VA 1BJVA 1DVRA 3FANA 3W8RA 2ZHWH 1TABE 3KQHA 3QXJA 3IO5A 3UNSA 1S2MA 3MLEA 2F1JA 1AKSB 1BRUP 1RS0A 1FAKH 2F43A 2PZFA 1PUIA 4Y0ZE 3HU3A 1Z28A 5JZVA 4C2UA 2BYAX 1T91A 3Q3KA 2R6GA 5JPMH 4Q1EA 1ZP6A 3CUEF 4WVPE 2EFDB 3THXA 1L4ZA 4PO9A 3QG5A 1BHXF 1RYHA 3B9FH 2IYWA 4CEJB 2RGNC 1ELGA 4L9SA 4DT1B 5HMAA 3SGBE 1D9ZA 2WWYA 2C9YA 3IQXA 2FV8A 2B8WA 1C2GA 1LTOA 3ZZ6A 3AGQA 4RD6A 4RD1A 3RS4A 5FUYA 1RFNA 1GCDA 3WYAA 4ASUA 4BFSA 1P9SA 5CDFE 2RCEA 1OH6A 3DFLA 1L4YA 2CL7X 2DY1A 2UUJB 4ERNA 2BZAA 2AWNA 1TTTA 4RVCA 4Q66C 1RZ3A 3EDXB 1L1JA 2NG1A 4R8TB 3DD2H 3WYFA 1GJ4H 3LNCA 4INHA 3A82A 5BW8A 3AF0A 5EQRA 1SGIB 1AB9B 1CSOE 3U3RA 3CZPA 2PBRA 2FFQA 1N8OC 1HAXB 1H8HD 3I5YA 3QUMP 2IYXA 4A6LA 4QM7A 3QKUA 1LKAA 5KYKA 4Y76A 2BX3A 1P4SA 3LGTA 4ZIRA 2WV5A 2ZU6A 4QOSA 7LPRA 1G3BA 3WHKA 4ZKDA 3OU0A 1PPCE 1SFQB 1O5EH 3P70B 2EU8A 4Q01A 4D9RA 1LV7A 3WNDA 3KQEA 4ISHH 5JWOA 2XSZA 1W4CA 3SHCH 5ESBA 1Z83A 2FYQA 2OXRA 3OHMA 3MNCA 1HEIA 3I29A 3IIKA 1B5GH 4L5BA 4MDFA 2WKRA 4TLEA 1AWFH 5DE3A 2Z83A 2ZS7A 3KL4A 2STBE 1QL7A 2QM7A 1EQ9A 5F8XA 2GZHA 3RS2A 2ANBA 2O8CA 3P8FA 5B6LA 4XH9B 1TRYA 4FU8A 1BH2A 1E9RA 1TMTH 1W47A 3M7TA 3N7OA 3K9XB 4UEHH 4OQFA 1COWD 4PR0A 4IN1A 5H70A 3R9IA 2AGEX 5DH9A 3RLFA 4YMUA 3SJ8A 3KXKA 2FOLA 4NZLA 2QQEA 2O8EB 3RUOA 3IPXA 3B1YA 2ZCHP 1EJAA 3L33A 2ZDVH 3GJ3A 4NSVA 2ZE7A 1ZYUA 3UK6A 3EA0A 1AVWA 5E0JA 4PPNA 3C1KA 4FIDA 1MTWA 3BRWD 2P5TB 2OQUA 4KLZA 3SBKA 2QL6A 4UXHA 1ZNXA 2IA5A 1M8PA 2GK7A 5FTKA 3ZVAA 4U2WA 1FX0A 2JH0D 5JJIA 1KK1A 1Y3YA 1VKJA 2CXVA 3TW8B 4SGBE 2WPHS 1Q1ZA 1Z0IA 1G37A 3ZYDA 4A0FA 4M2LA 1A5TA 1O37A 1XJQA 2CNWD 5EE9A 5G41A 1HTWA 2BMFA 1YPHC 2GVFA 1PZNA 1TEVA 1IHUA 2F9PA 3PITA 4HAUA 4BLOA 2A5DA 2R3YA 1JR3D 5LB4A 1O2WA 3SN6A 1GMHG 1A82A 3FKSD 4JBWA 2D8WA 1RGQA 1AGJA 4FVDA 5HGGA 1T6NA 3ZV9A 3AQ4A 1S96A 2ONKA 1OXGA 3BK7A 2H1LA 4GMXA 1YF4A 5IYTA 1VPLA 1QHIA 4QJ3A 2H5EA 5TVKA 1OXUA 2BDYA 4JCNA 3KJGA 1J90A 3QPWA 3KFVA 4AD8A 4BE7B 4C4PA 4NP6A 2V3HH 1DWEH 1FONA 4DOQA 2QGNA 2QF3A 2ODPA 4FWIB 3ASZA 3A4MA 1IOZA 3AUYA 2BBTA 1G20E 5JDUB 7GCHG 1KDRA 2ZRCA 3REGA 1T32A 5C1UA 4WOPA 1HXFH 4Q9KA 3FHOA 3SU5A 2FS8A 3A83A 4B33A 4O3MA 3HKJB 1GI3A 4LBYA 3E1XB 3B23B 1XMSA 1QL8A 3RDZA 1RE0A 1DO2A 4FMDB 1E0FD 2ZJBA 2WIAA 1UTMA 4M4SA 2F3RA 1AS0A 2OFOA 1KYIA 3UQOA 1ETTH 2J92A 2Q1JA 2EVWX 3DKPA 4PC2A 1OFTA 4QBGB 4B2PA 1XD2B 1ACBE 1D3DB 4QRHA 3U5ZB 1G36A 1XUJA 3TSOA 4NCIA 4DLYA 2W2VA 1W7GH 5A4JA 1DT2A 4EPRA 1TPPA 5GVRA 2F7SA 1UM8A 1OSNA 4YQFA 1HPGA 1OHHA 3DEFA 1SVPA 5LPRA 5JCZA 4F4OC 3SI4H 4BUJA 4ZDKA 1YZUA 2BQ7B 4NYJQ 3SV8A 2ZI5A 2RCNA 5E4FA 5SZHB 4AKEA 3ZYCA 9ESTA 1Q44A 1P73A 2VP0A 4FI3C 4US0R 5I46H 5G3ZA 5EE0A 2ZYWX 1BMAA 1ZCBA 3TNTA 2G0NA 2SFAA 1OWJA 2IS1A 3I61A 1W5SA 1WQVH 4Q4JA 3RYTC 4K3JA 1P02A 2QY0B 2HALA 2JA1A 2VL7A 2FG5A 4X6NA 4QKQA 3QI2A 1TA6A 2NU4E 1U8ZA 2ZQ5A 2BXTH 5GCHG 1U6QA 1Q0UA 2JEOA 1SGPE 3UMRA 2OCAA 5T6GA 5EQQA 1DLEA 1A3BH 3LDAA 2ZU5A 4ZHLU 3U6KA 5GIBA 5AK0A 3RS0A 3RWMB 1N3BA 4IRUB 2IWHA 5D3QA 3PLKA 3P1JA 5FH9A 3C5CA 2YOHA 2BMEA 3HATH 2RKOA 3RRNA 4LCBA 3O8BA 5A0AE 1NFWA 2OBOA 3K1JA 1GBTA 2D2FA 1KAOA 3I73A 4JL5A 3FHCB 3BERA 1EOJA 1NKSA 1OKKD 3DMDA 1XUKA 4M0LA 2RGBA 1DOJA 2IJOB 4DKXA 1HLTH 3TGKE 1AUTC 1YCPK 3TGPA 1TQ4A 1G8HA 3GY2A 3LAWA 2GJSA 4GBMA 5DO4H 2GV6A 4AURA 2DWPA 3BAFA 4X6MA 1O3IA 3D6TB 4LBWA 1DAGA 3FAOA 1U9IA 1GMCG 2PEYA 3IO3A 4AFUA 1C5NH 1BS1A 2BLWA 2ECKA 3EWAA 1KDOA 1CHOF 4MH0R 1KLTA 3ZVEA 4BZPA 4A92A 1OX1A 1DE7H 3RXAA 2PKAB 1AHTH 1IXZA 1KDQB 4X8VH 4K1EA 1JB1A 5JS8A 3NBFA 2XWAA 2R3UA 4MRNA 4RZ2A 1G30B 4JVMA 5AJYA 3A58B 3E16B 4ZPXA 1KI2A 1P3CA 1UTQA 4WW0A 1U98A 3P8GA 3A7ZA 5EXLA 3QWCH 2ZRJA 1V2PT 3TQFA 1HNEE 3DVLA 4Q19A 3UWIA 5FBRB 4AB8A 4ISIH 4KHZA 1BBRE 5DP5A 3OIWA 2HYIC 4MNYA 2Z5FA 1CO7E 1KI7A 4FUDA 3L8ZA 4B76A 2G4UA 2PFEA 1RTLA 2PKSC 3ZGXA 1TNIA 4INLA 2G81E 3GD7A 3V9PA 4PHFA 3B9QA 1PLKA 4RKJB 3BE4A 3F3YA 4Q00A 2QAGA 1Q21A 1T8LA 2ERXA 4M22A 2CHAC 2O8BB 1TF7A 4R7ZA 3RXPA 3K9LA 4FUFA 1GP2A 2FP7B 2ZC9H 3AVXA 1AQUA 2WWGA 5J5CA 3E3TA 5EP1A 2FOEA 1GG6C 2VH5R 1P2NA 5JFGA 2UWOA 2HDNB 3TR5A 1AE5A 1OWHA 5GVSA 4G5QA 1FJSA 2WWHA 2BBOA 3ZZBA 4BFYA 5GWZA 1WQSA 1QNJA 1HQYE 4DUGA 1XUGA 2RHMA 1P2IA 1TNDA 2CHGA 3ZIAD 3CRMA 2PLFA 3BC1A 1O87A 3SQHE 3PROA 2GT7A 4I1SA 1VGCB 2VIDA 3U8RH 2FH5B 2C99A 1IQJA 2XXAA 3CF2A 3ZVBA 1YLDA 1WE2A 2FNAA 2XCNA 3K9GA 3GLFA 4OK5A 3NBXX 1KNQA 1BO6A 3EA7A 1YU9A 3DZ8A 5FTMA 4OQXA 1EZUC 2W00A 2Z3CA 4I1VA 2FEQH 2BM1A 1DS2E 4M1OA 2AXNA 3SZNA 3LXXA 7KMEH 4CEHA 2ATVA 3AKYA 4AOQA 5F8ZA 3GDSA 2QMOA 3PIRA 2ZTSA 1MBQA 3ZVCA 1PVOA 3RDPA 4TSFD 2WV9A 121PA 1R5BA 2BBSA 2CHQA 1MO4A 1VG9B 5ANRB 4BANB 5KDDA 2UZIR 1W0ZU 3EC2A 2WWWA 2ZKSA 4KP0A 3VR4A 2CCJA 2IT1A 3CW2A 1MABA 2WJYA 2Z9LA 4KTUA 1Z6GA 2B7CA 2XTZA 4WZ6A 5HXFA 2XZPA 4OS1A 2K1QA 1G64A 4YC7A 4TPYA 3SEAA 2ZI6A 4FUGA 3OEHA 2FI5E 2B21A 5J47A 3ZZDA 1OIWA 3MWYW 1XTJA 2JETB 1ZHMA 2OBNA 2YC2C 2GKSA 1Z8IB 1PLJA 4B2IA 3CB4A 2GBLC 1PPFE 1BITA 2VWMA 1JBKA 1LW7A 5EP3A 1C5QA 2IOTA 1V2NT 1YZTA 1EP6A 3MO9A 2ZI7A 1OFHA 2WHXA 3J81k 4BTUB 1U90A 2VHCA 4ABBA 1PUJA 1L2TA 3ONWA 4X8LA 3LKWA 4JYVH 3ATKA 1ZM9A 2BLOA 1AM4D 4RZUA 2ANWA 2HV8A 1XXFA 1ZCAA 4UNNA 2ZJ5A 3G0HA 1BMLA 3GLIB 3B8JA 1MH1A 4PSAA 3T26A 3FYHA 1DS6A 1VG8A 1GHZA 2XBVA 5CLQA 4UNSA 2BDGA 3T1QA 3U7GA 1O3HA 2QGZA 3EPJA 3KJHA 1HUTH 2ZDLA 1UCYH 1XCGB 2E9SA 5FOSA 3SGQE 2JLYA 2CDNA 1LY1A 3WP0A 2IYTA 3F0TA 5DP6A 1RVDA 3CH4B 1DY9A 4BNRA 2VGCB 2FXRA 2M5TA 6ESTA 3W9YA 2BY8X 2V8OA 1NBMA 4Q48A 2C90B 3CO5A 1GBHA 1GNRA 2X19A 1O2MA 3K09A 4CRBA 3KFXA 1N6LA 3BIFA 1AN0A 5JBBS 2F6RA 3MI4A 4V0KA 5L30H 1XUFA 3ND8A 1VHTA 2D2DA 3M7QA 4ESTE 1EJNA 4AKGA 3AV0B 4PSVA 2OK5A 2ZRLA 2BOHB 3RXOA 4JBYA 3TITA 3BEUA 1L2EA 3TJZA 3LBNA 1P12E 5C5OA 1R8QA 4WAUA 3TK1A 2GZDA 3ITIA 2PSXA 1ZMJA 1E96A 4DT1A 4F4CA 1RIFA 3DPUA 3BG4B 3AF3A 1K9OE 1MRNA 3TUZC 1SGYE 1UVUH 4A1XA 4NONA 4KLNA 2JLVA 1JBUH 3EZ2A 5B58C 4D7FA 4CZ2A 1O3YA 2VIWA 2O8FB 2F9LA 1KYNA 1SBWA 4FMDF 4S35A 3QO6A 2PW8H 2XNDA 1SULA 4EQ6B 4NBSA 2GVDC 1YPLH 2WJGA 4TTQA 1YZGA 3A85A 1CBWB 1QHXA 2FSFA 4PC1A 5FTLA 3RXLA 4HI3A 1AFQC 4HI0E 2W83A 1GKIA 1ZPCA 1V3XA 4MNXA 2DFTA 2V1UA 1E94E 1UKZA 3NH6A 1LPZB 1IY0A 5J40A 5IK2D 2XW9A 4W5WA 4GOXA 1TPSA 2H1UA 1C1VH 2XYAA 3NWJA 1UTNA 2P3SA 1E2JA 1VCPA 1YE8A 4Q9HA 1WP9A 3EAQA 4OHWA 2J0UA 1ZU5A 3CNNA 2A78A 4LWZA 3DL0A 2AK2A 2BKUA 1YR9A 1D2NA 2C4FH 4J1YA 5LD2B 2GEDA 1AVGH 5ETXA 2OZEA 4I8LA 2X77A 2O8LA 2PGQB 3QJYA 3REFA 5DP8A 2RGAA 4X1SU 1HJ9A 3T5FH 1GHXH 3B1ZA 5KPDA 3PQCA 1UADA 2HNTC 1EWRA 1H9LB 3ZJYA 3U44A 2WICA 2CJIA 1YRAA 4AG6A 2VWOA 2RGEA 4KCGA 1H8DH 1NRPH 3LOXA 3OIVA 1IQIA 3ZZ9A 1FPCH 1RRGA 4D26A 2FO9A 1IQEA 2Q9CA 4XTRA 1W36C 3RC8A 2OC7A 2ZVQX 4R98A 1KXAA 3RU4D 2BEJA 4XBCA 3E90B 2R2MB 1I2DA 4TT3A 5GJCA 1S83A 4LRWA 4BXWA 4IEIA 1GI7B 1WCZA 2DBYA 4TWWA 3NXSA 1J8AA 4JBXA 4IOJA 1LHEH 1D3PB 3UR6A 4WXVA 2P8OB 2Y6TA 4YTAA 1GRRA 5SZIA 5ABWA 5KDOA 3K0SA 4OQNA 4YDSA 3WHLA 1SVKA 4ISOA 2DWQA 3AM1A 4BFVA 4KAXA 4GSOA 2VIVA 1N0WA 1Z2AA 4ACAA 3LLUA 1Y8TA 3RAPR 1PPEE 1GBJA 1BB0B 4RD3A 2WSSD 3UREA 4NYIR 2ODEA 4IC6A 2P6RA 2BCJQ 2VQSA 1FNIA 2ZZUH 1SOTA 4J2YB 1WUNH 3KHVA 1P03A 2YVUA 2BVRH 1BYIA 3I32A 3BB4A 4DB2A 1VG0B 1XD9A 4BLTA 2GXSA 2GT8A 1S5SA 4ZROA 4BQSA 3PR1A 3WRYC 3UOUA 3SNHA 3QKSA 4JLNA 1XEFA 2VPPA 4CR9A 5T6FA 1HAOH 1S0QA 1BZXE 5HCNA 2IS2A 4M7GA 2R8RA 5A0CA 2DR3A 4Y11E 4P32A 5FOTA 4XOIA 1WTGH 4XOJA 3D65E 5AUOB 2JCSA 1E2PA 1PPHE 2O8DB 1V2TT 1EASA 4LPKA 2AXPA 1E9DA 1LNZA 1XTRA 2P59A 1AY6H 1TX8A 2RG3A 1E35B 2ZUDA 1QBOA 5J4QA 4E7NA 4UNQA 2B9LA 3K0CA 3W5IA 4A7IB 1E0KA 2Y5HA 1T0JB 2W7SA 1GDDA 1SGCA 1WMSA 2OC8A 2ODQA 4G5GA 1UTPA 1HE8B 4NZQA 1AUJA 1OH5A 1Q20A 3AH8A 1HJAB 3BEIB 1NT1A 2ZS8A 3ZVFA 2GDEH 1XD2A 2OC1A 1JNYA 2JGNA 1GZSA 1U0LA 3BN9A 2CLDX 5BYJA 3QUSA 2XJ9A 3W6PA 2A5KA 1MO5A 1NL3A 2IEYA 3FOZA 2GJAA 3TK9A 1XMNB 2OP9A 4WWYA 2BHGA 2ZDNA 2W2XA 5FBVB 3EYDA 3JZMA 4WMEA 2V6NA 4K1SA 4JLAA 4TYQA 4AYWA 3R9WA 3HP1A 1AS3A 1YZNA 1CQQA 2ZCLP 1E9CA 4GZLA 4GFDA 5J4VA 1Z71A 1G9IE 4NCKA 3BGWA 4DIEA 3PXGA 1NMZA 1CA8B 2W7UA 1XEXA 2ZJZA 2H5DA 1GL6A 1ETSH 1HRTH 2G00A 5FX5A 2P6NA 1CA0C 1AJEA 2AD5A 4DLSA 1W12U 1SHHB 2KBFA 4Q9LA 3QTVH 1XDBA 1RIWB 1TMKA 1SVLA 3LDXH 2GZ8A 1MO3A 1KY9A 1M2OB 4LYFA 2XOKA 4BFTA 1HAVB 2V35A 2O0HA 2EI6A 1NMYA 4K69A 1Z6TA 4Q1DA 4Q4LA 3PMJA 1O2PA 1GI1A 1JEDA 3CWQA 3FWYA 3DA9B 1MKWH 3P8OA 1EFHA 2VH0A 4DT7B 2ZXUA 3R20A 3IG6B 2EYQA 1K21H 5GDSH 5B57C 1Z8FA 4JVNA 4U5XA 2IYLD 5CB6A 2F3TA 4NSYA 4ZO4A 1V6DA 5HCIA 3KQLA 1E38B 1LQEA 1GVLA 1TQ7B 2OESA 1A3EH 4OS4A 1F2TA 1WRBA 3RXBA 4JL8A 3GFTA 1C2IA 3BH0A 2HJVA 2OM2A 3GJ5A 1BTPA 1SI5H 2GZ9A 1JQJC 1D6RA 1YBWA 1RKBA 3VQTA 3A8BA 3KL6A 3DOEA 2OE2A 1DOAA 5FXLA 4FCTA 3KGPA 2VHUA 3QNUA 3A81A 3GJ8A 1UK2A 1KJYA 3D3QA 4EFNA 1PPZA 4C0LA 2C8VA 2W6JA 1GG2A 4I8JA 4JYCA 3AVZA 5AR1A 3TK6A 5JCPA 4HFPB 4IJMA 2WPJS 3A7WA 1QURH 1GKYA 4NYMQ 1IN7A 3TK5A 4FMBB 3RS5A 4ABEA 4AC9A 1MUEB 1PYTD 4M1WA 3MU1A 3EIQA 2ZA5A 3MH5A 1NVXQ 2BD8A 5F8TA 4JLPA 3KQKA 1CGJE 1DSTA 1ZSJA 1N8OB 1C4Y2 1NC6A 4LXBH 3G82C 3HK6B 1OIVA 3A36A 1O2IA 1O2RA 1NY5A 5LPFA 1JJVA 3GCTG 1GJDB 1HQCA 5GADl 3QQ5A 5GXPA 3MRSA 2G0TA 5FL3A 2ERYA 4HB0A 3FVFB 4Q1AA 1YYY1 5JBCS 2NOAA 2FYRA 5KUTA 1HB0B 2H18A 2J9RA 3ZVNA 3HGNA 3FKQA 4NTZA 1T0HB 1SVWA 4I8KA 5CB8A 5E8EH 3OY6U 2EI8A 1JRTA 2O8BA 1TBZH 5JBTA 2J45A 3RC6A 2W3KA 4US1R 1FQKA 2J94A 2HEIA 4HSEA 1UKEA 1XCPA 4B74A 4IDOA 1A4WH 3PUXA 1S3GA 1TX7A 2QYIA 2P65A 2QF0A 2WPDD 3FPAA 1JXMA 3M5LA 3NPSA 3EA5A 3KQBA 1LVGA 2JJ8A 3U3OA 1E3MA 3GLGB 1UTLM 1TU3A 1JIRA 3M4YA 1T4GA 1C5PA 1VHLA 2GF0A 3VNUA 1O2UA 3LPRA 1JPJA 4IW4E 1P72A 5AWFC 4IDHA 2HLDD 4XJXA 4HZUA 2WOOA 3NDBB 2G83A 3UWOA 3P17H 1ZBDA 1SQTA 5AFZH 5I25A 5DI9A 5BQ5A 1X8JA 1V2RT 5FPKA 1TL7C 2FDAA 4FCVA 4MNVA 2CJWB 1WXRA 1FXYA 1OYWA 1LHFH 1OIXA 2FWWA 3EGKH 2BB4A 2J0QA 3JZ1B 1A7SA 1SSXA 2ODNA 1GVZA 3TNFA 3DDCA 4WXPA 1GJ7B 2OG2A 2A2QH 1YKSA 1ZD8A 3LX5A 4R71A 1PJPA 1P9WA 3KQNA 3SE0A 5DIFA 5HM9A 1JWTA 1YPJH 4CRGA 3VTKA 5AUNB 4CYMA 5DSZA 1GMHF 3GLHE 1NFUA 3GFPA 1A1RA 5EUQB 5DI3B 2IUSA 4GAWA 2ZFQH 2QRZA 2C04A 4DDWA 3LD9A 3VKHA 3KUDA 1E4VA 2AWOA 2TGDA 4OGXA 1S6FA 1E79A 4I81A 1N5LA 2YNMA 1SXJE 3GJ7A 4MDSA 3N5CA 2PZGA 1YZKA 2FLRH 3NCLA 1W2GA 4L8GA 2C8XB 2GMTC 2MSEB 5FOXA 2P6UA 2JIZA 5CDFA 3F5FA 3W90A 2B8TA 4BGDA 1BA8B 7GCHF 4D4LA 2FFBA 2KE5A 3UIEA 4YOJA 4TLBA 3GYMA 4Y71A 3IHWA 3VB5A 1DLKB 3IIJA 2V6JA 6CHAB 1MR3F 2YWEA 5KSYA 2OUKA 2H92A 3NZIA 1PQ7A 1E0JA 3E0NB 1GDNA 1RYFA 4NIVA 1IM2A 1NN6A 3V0XA 4GCHG 1KI6A 1MBMA 5EPYA 2FM2A 1UCYE 4CHAB 3DZDA 3LW8A 1S8FA 1MTUA 2P16A 3M5MA 4AG2A 3PV5A 2HCBA 4KBGA 1N6YA 3BTWE 4NIXA 4ZH8A 4O3TA 4X8MA 3SUFA 5HM2A 4QBFA 3GJ4A 1WSSH 1Z0KA 1KO1A 2SNVA 3MJRA 1T4VH 5EW1H 3F9HA 2ZRAA 1HXEH 3TSZA 1JEEA 1C1UH 3A1UA 2AN9A 3RC3A 3DT0H 2QE7D 3K9NA 4QNRA 4XFQA 3SV6A 2VP9A 4PSKA 3KQCA 4LJ7A 2ZETA 3BTKE 1KO8A 3UPEA 4MGYR 4LYAA 1CT2E 2VIQA 1C4U2 5FPSA 4LJ6A 1Z0JA 4MGZR 2FPZA 4YOGA 3VPKA 1XXHB 2Y82A 2Q3MA 4U32A 3F6UH 2C93B 1U2RA 4BFZA 2DE9A 5GCHF 4IVRA 2HF8A 3M35A 2ZIAA 2WAXA 3FFGA 3K2UA 1D9IA 1ZD1A 1P7CA 3SFZA 4IXNA 1XB2A 3HYRA 1TQDA 2QORA 1GHYH 1F2SE 3SU0A 2QMHA 1EXFA 1XPUA 1EGAA 2FOBA 3EA9A 4BLSA 2KAIA 3PWCA 1ID5H 5L3RA 3HYTA 4FXGH 4ZI3A 3A8DA 1V2OT 1RPZA 3EWSA 3THWA 3LO5A 3W6OA 4A8JA 3ZZ5A 4JIMA 3H09A 3SW2B 3H0KA 5TY0A 3RXVA 4AIIA 1DAFA 1O2OA 5G53C 1UTJA 1C2KA 3U7EB 4G5RA 3DKVA 3RP2A 3LJOA 1BKDR 1T4UH 3ZD6A 1O2GH 2GETA 9LPRA 1VECA 4PZLA 3V7TA 2TGAA 1KI9A 5E7JA 4TMKA 3OX7U 5DJ7A 1O2NA 3T34A 2PCLA 3VR2A 3VU9B 4UQOA 5KSPA 3UANA 1TNGA 1GNQA 4HUQA 1F7ZA 4BAOB 1G5RA 1OYYA 1SQOA 1KMHA 1R6BX 3L0PA 4HLCA 1VR1H 1T8MA 3HU2A 2J0SA 5JWRA 1IN6A 3O8DA 3HPTB 3VHLB 2ZGBH 5DHFA 8LPRA 1KLJH 2CVFA 2LKCA 4LC0A 4MA4A 1O3NA 4U00A 4F93B 5LB2A 1E4YA 1G3CA 2WJIA 4KSCA 3U8TH 2R44A 1Z07A 4I4LA 1OH8A 4KKDA 5C2JB 5CIWA 1TOMH 3U6BA 1F60A 2HCJB 3FMFA 3T27A 4MPVA 1LS1A 3GJXC 1GOTA 2ZUBA 1JMOH 2A9KA 1ZVQA 5HR5A 1OE0A 3ICEA 3Q77A 5JBQA 4KO8A 1MCVA 3STIA 2IBMA 5L3VA 3NBZC 2ZPQA 1AKYA 2FSHA 4A6PA 2PKSB 3RXMA 2OLJA 4XWKA 1E69A 2XAUA 1E9FA 1AK2A 1UF9A 1Y63A 5KO2A 3NK8A 2XTMA 4LSGA 1CP2A 8OHMA 5EPNA 3VR3A 1R5OA 2W5EA 1Y5AT 4JZKA 4K5ZA 4LZ1H 2RH5A 1K1PA 3GP8A 1IAUA 3NC1C 3K53A 1MAXA 1C1YA 5TCAA 5HYOA 1ZC4A 1O39A 1F5RA 1B7XB 3KQUA 4HDOB 3F68H 3P95A 5FUXA 5C46F 2GRJA 2XEXA 1LS6A 1XBTA 2QAGC 4GPGA 4I8HA 4BLPA 4C2TA 4POAA 2F1RA 5TMPA 3PV0A 1TUIA 4XWOA 2J38A 4ZKNU 2WYGA 2OINA 1YM0A 2GBLA 4LGMA 5T1VA 3BS4A 2SGEE 4JYBA 3V4RA 1SXJC 5GNDA 4ISNA 3LC5A 5L2YH 2A4OA 2ZPTX 1GBLA 3MWIU 3URCA 1QJ1B 1E2EA 4RD2A 3QXXA 1UEJA 3BEFB 2JJ2A 2IUTA 3AW1A 2E87A 1V2KT 1LHGH 5IDVA 1GVKB 1FQJA 4ESVA 4XBBA 2EQBA 4PQRA 1UDXA 1LHCH 1AN1E 3BF6H 4PO1A 1PLLA 1OXVA 4A1TA 2VYFA 4UNPA 4MRRA 3K70C 3NKKA 5GJ4B 1UBFA 1O2QA 2AMQA 3VFEA 1HA3A 2Z43A 3LIWA 1HIAA 2SGFE 3MTYA 2B5TB 2NMVA 3S9BA 3URDA 2A2ZA 2GTPA 2W0MA 1O3EA 4MUBA 3RWOA 2A7CA 1G3UA 3GICB 4B44A 2B8OH 2E1RA 4Z8YA 3TVDA 1MAYA 1G7TA 3UWJH 2NIPA 4QC2A 1IQNA 1P2VA 3HR7A 2GNOA 2JH6D 3V4FA 3MNXA 2AIPA 1DADA 2EW1A 3P20A 4KFTA 3GY3A 1GI9B 1Z0DA 2AR7A 2AGGX 3TUJC 1O35A 1T7CA 1ODFA 1E32A 2Z7FE 2J5XA 1P2QA 2FI4E 4Z8XA 1INCA 2V7QA 1AIXH 1UHBA 1H8IH 2J95A 2H6MA 1M1YE 2NU2E 1D4PB 4AWXA 4PC6A 4RFVA 1MTNB 3IHLA 2ORIA 4IS5A 1HT1E 1C2HA 5BN4A 3HR8A 2GESA 1VIYA 3VX4A 1GUAA 4GI7A 3KJEA 3SV7A 2BM0A 4U7DA 1IQPA 3M5NA 3K0AB 3SU6A 3CNOA 3SYNA 4X1RU 1G6OA 2G6BA 2JJ1D 1N6KA 5L6NH 4K1TA 3SDZA 2BDHA 2NGRA 3R7WB 5FPTA 2G8TA 1ZPBA 4HAXA 4GDFA 3CZQA 4X2XA 3DMNA 1UBEA 1TX6A 3MGCA 4CRAA 1NESE 1EG7A 3T1OA 1MQ5A 2A1DB 1LFDB 3OSYA 1DANH 1GJ6A 3A1VA 1SG8B 2GK6A 4FWTA 2VTKA 3CRVA 1SGDE 1U81A 4DLTA 1QA0A 2DWOA 4LHYA 2BV3A 3EG5A 1QFKH 1K1IA 3I3SR 4BAQB 1GL1A 2FOGA 1W46A 1KJZA 1KI8A 1OPHB 1C5RA 2XGJA 4FUJA 4AFZA 2MSDB 3Q7QA 3CRW1 1P60A 5TDHA 3TAHA 5GPIB 5IDKA 2ODYB 2IYQA 3R8FA 3GY8A 1GJCB 1BDAA 2F9BH 4AORA 2WINI 3OE7A 3LV8A 3PEUA 3ELAH 1Z7KA 4F91B 1XRJA 3SZRA 4G1UC 4B32A 2XB2A 2UUFB 3TVJB 1KSGA 3KTAA 3UG6A 4JT2A 1C2FA 3RABA 1FW6A 2YJTD 1CJUC 1BTYA 2BMJA 4GMDA 1A0LA 1VCQA 5BXQC 3TIFA 1FP7A 2HPQH 1C4OA 2QM8A 4MRVA 1HJ8A 3CS7A 4ABYA 1OHHD 5D3MB 5JHHB 4THNH 1TGNA 3WBJA 4Z1MD 4Q02A 5AJWA 4DRZA 1GHBG 1XPRA 1DAMA 1KI3A 1DVAH 2VU8E 3JVUA 4VGCB 2UVQA 2FI3E 4GSYA 3QF4A 1IQHA 3ZIAA 2C98A 4YMTA 3AVUA 1VIAA 2BY5X 3A37A 2PUQH 1WF3A 1O3AA 3B1WA 1KIGH 4Q7KA 1DITH 2DFLA 3C16C 3H5CB 1MD8A 2VF8A 4D2IA 4M9ZA 1OOKB 1QGFA 1OP2A 2G55A 2IN2A 4C7OB 4B3DA 1DFPA 1Y59T 3ETLA 3M3TA 2ZRKA 2C77A 4L4UA 2J59A 4ACBA 4PC7A 1XNJA 1TPAE 2ZG0H 3SV9A 4D7GA 2BJVA 1SPJA 1GI6A 1Y3XA 1J8MF 3ENSB 1NJFA 1RJ9A 4EUNA 4XDEA 4KU4A 1C9TA 4US2R 1JIMA 821PA 4DLZA 1DWBH 2O8MA 1EWQA 4Q4HB 2BDIA 2P3UB 3NWUA 2Z9JA 1LTQA 2WUCA 4BXSA 1WB9A 2AERH 4UNRA 3MD0A 4ZHAA 1CJVC 2BOKA 2DFKB 4P0TA 3RXGA 1GL0E 5JMTA 2V55B 3BV9B 2FMXA 3A7YA 4I33A 4NA9H 1Z8JB 1KDPA 4LK2A 2BD9A 2UUYA 4RFSA 1T5IA 4DB4A 3AVYA 4JMYA 3BB1A 3W95A 2JATA 1E2MA 1X6VA 1P8VC 5L2ZH 4TMZA 2QU8A 3AVPA 3SU1A 4WXRA 2OBLA 3ZVRA 3VR6A 1HAPH 1G7SA 1VYVA 1TQ2A 1SMFE 4NDZA 2IX3A 1H9HE 3EZ6A 4BAKB 1NSTA 2B6HA 3LW7A 1Z08A 1ANEA 4FN5A 1VMAA 1ESMA 5H1YA 4EPWA 4TMWA 2FTLE 3WMGA 4IEEA 3PO1B 1FOEB 2QBYB 2ZU2A 5DK1A 4B3BA 3TE6A 4WF8A 1C1OA 4LOYH 4HZHA 2NZ8A 5JJKA 2CHVA 1O2LA 4E22A 4RKEA 3Q7PA 1PJRA 1AZTA 2HYDA 1CTQA 5DO9A 4DLXA 2KB0A 3PV4A 1N6NA 1XM1A 1G3MA 4O3UA 4XSKU 2DFNA 2SGPE 4TQAA 2PLXA 4NFFA 2LNCA 1IBRA 1X1SA 1GGDB 2OBQA 1K5GA 1IQKA 2ZE6A 3AKDA 2VIOA 3T5GA 5DPAA 1XX9A 1C9PA 1AD8H 1EFRA 1AZZA 3ZQ6A 4M8NE 4TQ9A 5FBLB 4OQMA 1GMDG 1WQ1R 4G5SA 3T06B 4XSGA 4Q4AA 1J8YF 3VB6A 3H4MA 1G16A 4DUGD 2QXGA 1YC0A 1OB2A 4I31A 1C5ZB 2QXHA 1J9CH 1ESNA 3TUIC 1TBRH 1F5KU 1CBUA 3SNDA 4OK6A 2F4LA 1IXSB 1Z6XA 1EESA 4Q80A 1P2TA 4YONB 3OEEA 4GL2A 2ZHQH 4I7YH 2ZR0A 1K2I1 1C5MD 3V3MA 3B82A 3DM9B 1NG9A 3I1FA 4XVQA 3TH3H 1G2MA 1IQFA 2REBA 1G8YA 4HUTA 4Q9JA 5JB9S 3M3VA 1O2YA 3K0CC 1P62B 1DTSA 1Q1BA 2EYUA 4IOLA 2GCOA 4BEBA 2BQ6B 1KOFA 4JLMA 3CKLA 4WH8A 1F0TA 2ANKH 2C9OA 1AVXA 2FLBH 1KSFX 1ESAA 4Q1FA 4ZMAH 2ZSEA 1O34A 1NVUQ 3GY4A 1ZUHA 3TJVA 2FWRA 3MSXA 4GPTA 2NPIA 4QHYA 3T15A 3IBYA 4Z51A 1UVTH 5EQTA 1P2SA 3A6PC 2WYJA 4D76A 2OCPA 2QRNA 5F9HA 4FD2A 3BFVA 3K6YA 2ZSFA 1NNEA 4WIAA 1Z8RA 3S7KB 2ZYTX 1YPEH 1CJKC 4F38A 2ZSBA 2CBZA 3AGPA 2GD4B 1W2HA 1E9EA 2V9PA 1XUIA 4D80A 2CN0H 4EJSA 2O0KA 4B6FA 4NIWA 1XX6A 4Q7JB 3M3SA 3FVQA 4JZEH 4AB9A 4DIHH 1ZOMA 4GP7A 3EPKA 1G8GA 1UJ1A 4CRWB 3L2OB 3MCAA 4TLDA 3OEHD 1G41A 5FTJA 3AP2A 2FGKA 1FZZA 4NKRA 2EFGA 4LI0A 2EFCB 3E0PB 4JYTA 2C2HA 1OW3B 1QHSA 1KK0A 2O8WA 4CBOA 2MMCA 3H7TA 3AEZA 1LMWB 4P4SB 3VR1A 4V0ME 3Q85A 2WJJA 3GLIE 4DDVA 2ZRMA 2F43B 2RAPA 1NIJA 3M37A 4AG5A 2F3CE 1QHHA 4FUIA 4HAZA 4URZR 2BVSH 3I8SA 3I8XA 1AE8H 2PEZA 3U4QA 3ATLA 4RCYA 5UKDA 3THXB 3ZD7A 1IONA 3QEJA 2BCGY 2H8KA 4R2IA 1TOCB 4BFWA 5AVDA 4C0QC 3ESTA 3P27A 3SQEE 5LH8A 4M9XA 2OTVA 1L1NA 4CEIA 5F03A 4X6PA 1G2LA 1VCWA 4C3ZA 3GCTF 1LVBA 4N0EA 2HJGA 1MZDA 3FZDA 2OBMA 2GILA 3AUXA 1AI8H 1I2MA 3FP7E 2LWIA 5F98A 4BRWA 3PENA 1XKBC 1FPMA 2ZE5A 4O97A 1HDTH 1P2KA 1US8A 3W94A 2GDDA 3EX7C 4Y0YE 1NBMD 1S4QA 4OS6A 4MNWA 3N70A 5L3SA 1V2QT 4CRFA 1I4TD 2TPIZ 1SHYA 3RXRA 4LC1A 5EZ6B 4CR5A 3A7TA 4HYYA 4AY2A 2TGPZ 1KGDA 1WU1A 3F9GA 3IILA 3C41J 1Z63A 1N6IA 5F3WB 1W2KH 4BTIB 3AVTA 4BWYA 1NM6A 4NA8A 2ASEA 3BTHE 3A8TA 3THYA 1G3RA 1DG3A 4URVR 3QGNB 2B7DH 3T25A 4ZIRB 1S82A 4CH8B 3QKRA 4IVQA 2OLKA 2YWHA 3B9PA 2F9OA 4X2VA 1WDTA 4PQFA 1S0UA 1IOEA 5AJZA 1P9NA 3H7OA 2Y80A 3AF1A 3WBKA 3MH4A 2C5LA 3SUEA 2H9EH 1TALA 1XJ0A 2CCKA 2IUUA 2D7DA 2GZ7A 3MH6A 1QHRB 1GCTB 2IK8A 2XNDD 2XC4A 1L8QA 2JASA 1OLOA 3RMMH 4M9QA 1AQ7A 1VCOA 1W13U 1FY5A 2ESTE 4HAVA 5L3QA 1DM4B 2O8CB 6LPRA 2DUCA 4Y8XA 5EUMA 2HXSA 2O0JA 3EPHA 4GZMA 4B48A 3RC4A 2OCBA 2SGQE 4D4JA 4DSNA 2OV2A 2JLWA 3T62A 2NO7A 2PX0A 1WBBA 2HT1A 4C0HA 2XITA 1J2JA 1IN5A 3UPUA 2PJZA 4F49A 2IYVA 3ZVLA 4EFLA 3DO6A 1TF5A 1KXFA 4V03A 4B3XA 1JI0A 2QPTA 2HOBA 3K0EA 2G5VA 5C1BA 1O2XA 2VJ1A 2CLCX 2FS9A 3V13A 4A5TS 4I1UA 1FX0B 2CVHA 1NPMA 3A4NA 1OB5A 1TNKA 2WKPA 3GMTA 4MGIR 3TJUA 4IC5A 3OFNA 3BTQE 5IF9A 3VR5A 1JR3E 1UAAA 3CF0A 5HKKA 2EWVA 3SHWA 2NWNA 2PMDA 1UVOA 1OXSC 3QN7A 2ORVA 1G3QA 221PA 1LO6A 5FI0B 5A2MH 2HNTF 4YMWA 5SGAE 1M34E 2B0FA 1D6JA 3S7HB 3BFXA 1NI3A 3TH4H 4D8NA 5A8YA 3LGVA 2OXCA 2Z4RA 2BDBA 2JH5D 1AQYA 4TT3D 4MKFA 2BMGB 4WZAE 1NY22 1ANCA 4NYIQ 4X8TH 2VP2A 3BIUH 1HURA 4GCHF 3EZFA 2A5GA 2ZHEH 3L3TA 1Z3IX 3TVTA 3W3ZB 1GBCA 4AN7A 2JETC 2BXUH 4DIDA 3N2IA 1BQYA 1P2JA 1P2UA 1WAYB 1P2OA 3WP1B 3K0AA 4IGDA 4OI1A 3CM0A 4QJ5A 2ZRBA 1X86B 3MYWA 2EFHB 2A4GA 1A0JA 4TZ6A 2ILNA 3TW4A 4BASA 2Q3FA 3M36A 4OI4A 2A31A 1ARCA 2L0XA 1GBFA 4H1VA 4Y0AA 5ELXA 2IYZA 3L6PA 1CRQA 2AK3A 2YYZA 5KTYA 1FMJA 3ASYA 4XD7A 2XWBI 3A7VA 5K8UA 1Q3TA 1GHWH 4HB2A 2FX3A 521PA 2VBCA 5EG4A 4GOKA 2AFHE 1HGTH 3D31A 3AASA 1E9AA 4DEYA 3SJKA 1IN8A 1UCYK 3SJBA 1MU6B 1W4AA 2Z6VA 5FCRA 1VZQH 4B2CA 3LVRE 1NSFA 2VSOA 1WBGB 5K0HA 3LC3A 1GDQA 1M74A 3KCGH 5LBIA 4D0GA 2TRMA 3PEWA 2VNTA 1H8EA 1ELAA 4OJQA 2GCTB 1NRNH 2IYRA 2ODWA 3B6EA 4YO9A 2NU0E 4IDNA 4INKA 3LGWA 4RY2A 2VGCC 1K6MA 4JT4A 1Q3XA 1NJGA 3BG8A 1GPZA 5CM8B 3Q00A 2OT3B 4Q4JB 4QGAA 1XZQA 1ELBA 3MNSA 4UD9H 2FGJA 1YZQA 3QZQA 4YOIA 1KI4A 1EFTA 4V0LA 2ZREA 1KSHA 2J7PA 1EP5A 5DG6A 5HZHA 2AGIX 2OO7A 1O33A 3GQBA 5A0FA 1P04A 4RKFA 2ZGJA 1Z6AA 5FOWA 4TMXA 2WKQA 4UE7H 4YXWA 3LVQE 1FY4A 2JDIA 2FZ4A 4E7RG 1KDTA 1XXDA 1O3PB 1PPGE 3QZRA 1F3OA 4A8JC 4FW9A 3RXTA 2RA3A 3E91A 3L43A 5F6MA 3GLHA 2ZI4A 1BUIA 4MYUA 1QBNA 1C1SA 4ZXXH 4LBVA 5CM9C 2ZRDA 1BRCE 1LB1B 3OAAA 3S1AA 3H1TA 5SZJA 3B13B 1NVVQ 2ZNKH 2ZJYA 5FPHA 5CLLA 5H8WA 3RVBA 4R0IA 2FFHA 4O0MA 3HJNA 5JRJA 2PR3A 3FFAA 1TB6H 1DY8A 1JXOA 1Z5ZA 4DLVA 1SXJA 3RM2H 4R2HA 2VVVA 2FZLA 4Q2KA 5AJVB 1CBWC 2ZUCA 3EXAA 4TTRA 4M9FA 4LPSA 4BECA 2OEPA 3BTDE 4B2AA 5T3HA 1AS2A 4WA7A 2CE2X 1JQLB 3Q5EA 3ICQB 4X8UH 1DPFA 1ZRKA 2ZRPA 5JI2E 3QDZB 2PT7A 2XOKD 3RXUA 1ABIH 4ABIA 4X1PU 1JPNA 2GXAA 3PLBA 4A0RA 3UG7A 1Q1QA 1W11U 2DYKA 2XC5A 3IWMA 2FEMA 3MUFA 1P61B 1C1RA 4ABFA 4BFXA 2R2WU 4MYTA 1FMGA 3BJIC 1ARBA 4Q7ZA 4DCVA 1R2QA 5FPYA 2Q9BA 1ZHRA 1Z47A 2BHRA 2JLQA 1TUEA 1ABJH 3KXLA 5EXTA 1BIOA 4GVUA 2A7HA 1Y3VA 4Q7YA 3A80A 1XVMA 1P57B 2A4RA 3CNLA 1OPXA 1OT3A 4KYUA 2X2EA 2PZEA 2A7QA 5BWMA 1YCPM 1AA9A 2PLRA 1ESBA 4JZFH 3RXIA 3ZDQA 1O36A 5JSZB 3F9FA 2W6JD 2ASUB 4ABJA 1C1TA 1BBRH 1LPKB 5G3YA 1F2UA 1BMNH 1RXPA 3ZVDA 2GXQA 2GCPA 1ANDA 1I4LD 2OLGA 1K1LA 3CWZA 1KI1A 5EXPA 3SO3A 4DDTA 2BD3A 1B0FA 4TY7A 4O2LA 1TBQH 2ZRFA 2GA8A 3PMHB 5DYGA 1AGPA 1CKEA 5FI1B 2P8OC 5E7IA 3AB3A 4ABAA 4TN1A 5JBAS 3C7KA 3BXZA 2QBYA 3RC5A 3SYKA 5CYPA 2H16A 1L1GA 1MTVA 2QZ4A 2YWFA 2BOVA 3RS3A 1RD3B 2V3CC 3BTGE 4A4DA 5KSOA 1II8A 2QUZA 2XXAB 4C0SA 1Y5BT 3TGIE 3PUYA 4E06H 3GLFB 2QP4A 3DHKH 1W4RA 3WY9A 1UTOA 3QF7A 4HDCA 4TY6A 2RB4A 3DUXH 3GLGE 3P92A 1AZSC 1YR7A 4ZCLA 5C1YA 3SBEA 4M1YA 2XCFA 2ZAMA 1E1RD 3ODFA 1FN6A 3UY9A 4CEHB 4LOAA 1QJ7B 2OUAA 3T28A 4DWJA 4JKIA 1VG1A 2YKGA 1W1WA 2A5IA 2CMYA 1DXWA 1NF3A 2QXIA 1DBSA 1ANKA 2ZFRH 1B0UA 1CIPA 3MMPA 4AYYB 1CJMA 3KKMA 2SGAA 4MYHA 3KX2A 3AF4A 3QG1A 1C2JA 1O5GH 2QGRA 5CJPA 2P95A 3R8CA 4QHTA 1EX3A 1BTWA 5FOVA 1AKSA 4HB4A 1D3QB 3GJ6A 1MKXK 4CGZA 2IXGA 1Q57A 2ZS9A 1TGTA 1MABB 1B0EA 5FL7A 1G21E 3D23A 2ZFSA 3GCOA 1DUEA 2GTBA 4EPXA 2QA9E 2AFQB 1W0JA 5A8XA 1D9XA 2HF9A 1G3IA 1GKUB 2ZDKA 2FMJA 2ZI9A 4H4FA 4JK5A 4LZZA 5PTPA 1ZTLA 3CBQA 1E9BA 3ADKA 4CEJA 4IMQA 1CGIE 5C67A 2EC9H 1HJAC 3MU8A 5EW2H 3EE0B 1QHNA 4JYUH 3RXSA 1G8PA 5JRZA 1K1NA
chains in the Genus database with same CATH superfamily
2QRVA 3CLHA 3RO7A 1FDPA 2JGDA 1Z73A 3TH2H 4MA5A 3HWSA 3LH5A 2C95A 1U7UA 5C1DA 2XB6A 3X43A 1N78A 2G09A 2DPLA 2RJ3A 3TEFA 4C0KA 2D7CA 1GKLA 3EDOA 2OCVB 1YI1A 4CF5A 3RVLA 1HAYB 1OWPA 1T36B 3F5DA 1EBBA 2FUNB 4L5IA 1E6LA 2PKXA 1LTKA 3BOSA 1BTXA 3G1TA 3KB2A 1USGA 2QHXA 4HWOA 4KUHA 4LQ4A 1VCIA 5BN5A 4RF5A 1ZEMA 1C5WB 2FSGA 5T4EA 3QY0A 2QI9F 9MHTA 1KJ8A 1OYQA 1QO0A 3R3SA 4C04A 2VHJA 4NJMA 4XCXA 3GOQA 4DARA 4HAYA 4E51A 3WFZA 4JJ7A 3W6NA 5BYBA 2HW8A 3DOHA 5J1SB 3GFOA 3SIXA 5H4HA 2C7QA 2OGTA 3OJ0A 4MPJA 5HZGA 1ZD9A 2E1PA 4YM9A 1FS5A 2ZITA 4D6YA 5E7QA 4NJOA 1DCTA 3HKIB 3T5CA 2CV1A 2EERA 1FDRA 3ZX5A 3Q8MA 3VZCA 4J3JA 3M6VA 1BQ3A 4UU7A 2ZJ2A 2OCXA 3RRXA 1DQZA 1NASA 1IQRA 4JN6B 2OWEA 5FBKA 1TNLA 2MSLA 4TMVA 2I6TA 2NT4A 3JYNA 4QTYA 2E48A 5AW1A 6AT1A 2JLCA 1Y8ZA 4HLNA 2FPPA 3HA5A 2X9GA 5MFPA 5H83A 3EA8A 3AI2A 1W0KA 1SC1A 1FIWA 1Q77A 2IL1A 2QVBA 4HC4A 4Z3DA 2IHBA 4A5OA 1GXSA 3QLUA 3BMXA 1XZMA 1QFMA 3OTPA 4FGLA 2NZ2A 3OQMA 3ULKA 1IUNA 3VGCB 1DKPA 4EHHA 4AQDA 3WAKA 1RU3A 4TRMA 3FP8E 3HY6A 2HWUA 2C9CA 5FYQA 4MWBA 1Z29A 1V8ZA 1Z82A 2G9RA 5JCJA 3NPAA 2ZSHA 1OZHA 2W90A 3I9MA 3QFSA 4H7JA 3STXA 5IDQA 2HADA 1SVIA 3ZGYA 3B2NA 4OHVA 2BSXA 3RXQA 1E0SA 3AP1A 3VZDA 3BTEE 3FPGA 2AMJA 2HRCA 3NEYA 1PFKA 4S0XA 2B30A 4J0DA 4QNNA 4EKGA 1SZPA 3QJGA 2H4HA 4XVRA 1Y1SA 4BNVA 4A8TA 2EBUA 3GFGA 4G4JA 3ROTA 4DLUA 1OS8A 3QK1A 2HGZA 3EW9A 2NO0A 4KH0A 4YMSA 2P62A 5FADA 1PDOA 4Z0KA 4F4IA 1E1NA 2HLHA 5BWBA 1L5NA 2JK0A 3QOFA 3DAPA 1H9CA 4LMPA 4Y2JA 4UTRA 5D2CA 4E3ZA 3KAQA 4OGWA 1QGED 3C43A 4CMEC 1O3CA 3F9RA 2BUBA 4RSMA 1SA0A 1R8SA 3I1YA 3OTJE 3N7EA 1IM8A 1IQUA 1N5IA 1CZOA 1T8NA 4Q0MA 4F92B 1H23A 4YCNA 1OPRA 1SCKA 2P2CA 2Z1MA 4UPDA 3SJIA 1LQTA 1C1QA 1CWUA 3C7TA 5T3YA 4ZREA 4CLHA 3BXFA 5FQOA 2B99A 1G59A 2R0LA 4ZAGA 4OYLA 2B5WA 3FPSA 2H4YA 2C5EA 3SC6A 4SGAE 2R60A 4M1MA 1O5DH 4IIXA 1H6BA 3HJAA 3LLVA 2J8ZA 3TDKA 3DE0X 2BR3A 1VMKA 1TIPA 2CVOA 3CTPA 4M83A 1CUDA 4FBMA 4OU5A 1S3FA 3S2GA 1GYQA 1L7XA 3M3DA 4X0WU 5BSEA 4MKZA 4M0DA 3LP5A 3NAMA 3D49H 4OQ4A 2R9PA 2GDJA 4RSGA 1RDFA 4M46A 2DPYA 3FCEA 4EGAA 1ILEA 2P90A 3H3FA 4O03A 4RK5A 4LV6A 1J16A 2PXHA 2CKMA 4JJZA 1C5LH 3AG6A 1IHYA 1WUHS 3WJ2A 5L3ZA 1YMVA 1IOWA 2ISCA 1DXHA 2VSXA 3ZWPA 2OHIA 3GJQA 5DNAA 3ONEA