4B73A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
total genus 209
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b73A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b73A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b73A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b73A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b73A03
5K8TA 4FWTA 3GLFE 4XWOA 4ABHA 3GFPA 3JZMA 1SLWB 2ULLA 1D9IA 4Z8YA 2GWHA 3HKJB 3LDXH 3LNCA 4DEYA 2OXRA 1LS1A 1ZR0A 1G1MA 1G32B 4CRCA 1N25A 2FI5E 5BN3A 5CLQA 4RD3A 1WAYB 5CDFA 1PUJA 1WB9A 1DX5M 2IWRA 2OK5A 1AFQB 1M7HA 3CF0A 1V5WA 2ZDMA 5HM2A 3VB7A 4C0JA 1AD8H 1SXJB 1P09A 2XW9A 3ZZ6A 1LW7A 1UKYA 3ODDA 1DADA 2C9YA 1M7GA 1ZOMA 4IRUB 2YHSA 1Z8IB 2PGQB 1F92A 2C99A 2XZLA 2O8TA 2R6DA 5CIQA 2FZ4A 1BTXA 4BXWA 3Q7PA 4EAQA 1LB1B 3RS7A 3E1SA 1XEWY 2GK6A 4X1SU 2F9UA 1THRH 1C1NA 2M5TA 1ZYUA 5L2YH 3U8OH 4YOJA 1BH2A 1P61B 1RTLA 1Q20A 3MU4A 1C9KA 3UMRA 1ZU4A 4X8MA 1KTVA 4FI3C 1VYTA 1P2QA 2PUXB 3EIHA 1OYWA 1HUQA 1OJLA 2G4TA 3RLFA 3AF2A 5G41A 4Q9JA 1VIAA 1D8TA 1SMFE 4FUHA 1GJ7B 2A4QA 1VGCC 4YDHB 1LS6A 1QRZA 2WKPA 3KEEA 1EFHA 4QHYA 2GRJA 2QSYA 3U4QB 5EXSA 1C5VA 1GKYA 1V2RT 1IN6A 1X3SA 1JR6A 2GKVE 1YZUA 4I8JA 1KO5A 4Z6AH 1P2JA 2ZE7A 1ELVA 3RXOA 1OXXK 4DIEA 1H9LB 2HVXA 3R0FA 1RFLA 3BIUH 1SXJC 1FMGA 4HDOB 1G20E 2IYUA 2WWHA 1F2UA 4K46A 2RCNA 3OFND 4XSHA 1OXGA 2CHQA 1IXRC 1AKSA 1VCNA 1GUAA 1BT7A 2PL3A 3CRRA 3TVDA 3AP2A 1GI1A 4CRGA 3P8NA 2WHXA 2ZRLA 1LQDB 1N0WA 3SQXA 2GDDA 4KBFA 1G19A 5FBLB 4CRBA 4ZIRA 4Q7ZA 5F8ZA 2SGQE 4GFDA 1AZSC 4HZIA 4QBFA 1ZM9A 1Y5UT 1NI3A 4GHQA 1JIMA 2P3TB 2CE7A 1AE8H 4H4FA 4A1TA 5HM9A 4KVGA 3ZH9B 4X8OA 1UAAA 3AASA 2O5VA 4DOQA 4GOXA 2W3KA 1EZXC 1ZD1A 4P3YA 5TARA 2CHGA 2Q3HA 1O3HA 2WV9A 1NTPA 1E94E 3BXZA 2I6SA 2QP4A 2AHOA 2ZRFA 5DP6A 1FQ3A 3FTQA 1J8AA 1KJZA 1U98A 2PCJA 3MO3A 1S8FA 3LY5A 3F8TA 2AWNA 4QJ4A 5FOXA 1C1UH 3GD7A 2AMQA 3RXTA 3NH6A 2YOHA 1MZAA 4LZ1H 3MNXA 1C2MA 5EQSA 1FPHH 1TPZA 2ZG0H 1AS3A 1NMYA 4Q66C 3ZZ5A 1V2VT 1LVGA 1E9AA 4I8GA 2BM0A 1TGCA 2C8XB 3ZS9A 1XUIA 4AK9A 3GP8A 2R2WU 3MFJA 2H17A 1L1NA 2XNDD 3OESA 4MDSA 4R0IA 4D7FA 1S0RA 1MH0A 2VF7A 3RXCA 4BXSA 2WSMA 1CJVC 2NO9A 2E87A 3UPUA 4ZXYH 3M5OA 3GCTG 1DS2E 2CLDX 2BJWA 1GBJA 2GCTB 1ZNWA 4W9MC 3FVQA 3U4QA 4TLDA 4ABBA 3LXXA 3LV8A 4OBEA 3TUIC 2BY7X 3SI4H 4XE4A 1QNJA 1P60A 3FP7E 3IUYA 3GY2A 4TL8A 1XX6A 4Y8XA 2BZ6H 1XEFA 5F8XA 4TL9A 4RFSB 1U2RA 2XXLA 4TYPA 821PA 4A7IB 1T3LA 2PKSC 3M35A 2Z43A 4ZCIA 1OH8A 1ZD9A 3QDZB 3VKWA 1ELOA 2OC8A 4B47A 1YZQA 2XBWA 2P6UA 2JJ8A 2ZJBA 2BKUA 1EB2A 5HE8A 2GV6A 3GEIA 3VR5A 3RXVA 5JBCS 2ZRBA 1MBQA 4BTTB 5JWHA 3EPHA 2OFWA 5JRJA 1ZUIA 1BIFA 2ZJ8A 3A81A 5CMXH 4JIMA 4XWAA 2NO6A 3T35A 3M7TA 4CYMA 3TJVA 3TGIE 4Y7BA 1D5CA 3URDA 3NBFA 2DR3A 1P7CA 1Z0IA 4BFTA 2REBA 4NYMQ 4M1SA 2BZAA 3UIRA 1O5DH 1GG6C 3DKPA 3AW0A 4NSVA 1EXFA 1JOUB 1XCGB 1JQJC 5J4VA 4TLAA 2Y5FA 2HYIC 4DURA 1D3TB 1NSTA 4EPWA 1G7TA 4GT1A 1P02A 5EQTA 4JJZA 4IHQA 5JRZA 2ANCA 1OE0A 1FPMA 4ZKSU 5PTPA 5FOVA 1O3NA 3M61U 1LY1A 1E9CA 1QA0A 2G52A 1W4AA 2Z6VA 4ZMAH 2OINA 2FE4A 3CM0A 2EI6A 4HAYA 1CBWC 2OV2A 3BN9A 5HMAA 1PPBH 4NU0A 1PPHE 4WA7A 1SVOA 2BDIA 1ABJH 521PA 4BFYA 2YINC 2ZRMA 1O3EA 1MV5A 4BEBA 3UOUA 1PV4A 4O2LA 1KI6A 1QGFA 4TZ6A 3A83A 1OFIA 4DLTA 2VGCC 3G01A 1QL8A 4F4IA 4U2WA 4UE7H 2ZPTX 1GBBA 3UREA 2REXB 2D7DA 4JLOA 4RI0A 3MTYA 4LHWA 1P12E 3NKKA 2QQ0A 4DC9A 1F5LA 3BWDD 1UKZA 4DGJA 3A7VA 2XNDA 2C95A 2IUTA 3ATWA 1E2HA 1O2SA 2OC0A 3OF5A 1Z47A 1XZQA 3KB2A 4B1TA 1V2MT 1OKKA 2AX4A 1OWEA 1E0KA 5FR1A 3GLHB 3EA8A 3TR5A 3T62A 5A4JA 1LPGB 2XBXA 4V0LA 1MTWA 2GXQA 5FBWB 1XTJA 4R8TB 1U0HC 1L7VC 1OXUA 1H65A 5C2ZA 1NT1A 1D2EA 1JBKA 1O2NA 1K1LA 1FDPA 4HAVA 1HAXB 3W8NA 2ZRNA 3SEAA 2FZZA 5CJ2A 1CF4A 2QMHA 2GJKA 2ZJAA 1ZLRA 4B3XA 5DLQC 4H6TA 2FOMB 2PSYA 2HLDA 3U7FB 2A7QA 3LVRE 1NRQH 2Z9JA 4KFUA 2ZTXA 4R98A 2QN5T 3I8XA 2ODNA 3K70D 1KLTA 4A2PA 1HAOH 1D9ZA 2IF0A 3NWJA 4AKGA 2Q9AA 1F2UB 4OS2A 1D3PB 1T5LA 2ZRJA 1Q1BA 3T1OA 1CQQA 3T06B 1KJWA 2KAIA 4JL8A 4HGCA 1M2OB 4A36A 2O8UA 3WNCA 1OPHB 2QORA 1CO7E 5AVDA 1SXJE 2ZQ5A 2A45B 4B3DA 3EWSA 1YVDA 4A1VA 1OV4A 1O2LA 3SZRA 1OKXA 4Y7AA 1K22H 1ZJ6A 3B8JA 2GMTB 3I29A 4X8TH 2F9MA 4IDHA 1TX4B 2GCHF 3KX2A 3H5CB 1R7RA 1K1IA 3U8TH 1GDDA 1ZSKA 5F2EA 1ZUNB 2WSSA 4NE2A 2W00A 4D82A 4PAQA 4B75A 1Z3IX 2OUKA 1CT0E 4K1TA 4FIDA 3AVQA 1NROH 3AKYA 3C15C 3EG5A 3MU5A 1TX6A 3AM1A 3IHLA 2EVWX 3D7MA 1W0JA 2VHQA 4EPTA 4LYJA 2AFHE 2K1QA 3Q9LA 1DVAH 1OP0A 1N6HA 2CK3D 3P4XA 4Q9IA 2WJGA 1GJAB 3SS8A 1G5PA 1NJFA 3WYGA 3K9GA 4NWKA 4Q47A 1P3EA 3QN7A 2ZYTX 1DITH 1Z71A 2FX6A 3EZ9A 2NO0A 1XP8A 5IK2D 4INLA 3KQDA 3U3RA 3TVJB 3PUVA 3T25A 2PLFA 1YF4A 3RRMA 3E0NB 1N8OC 2A5KA 1ID5H 1K1NA 1KAOA 2FFBA 2F1JA 1GBCA 2ZJZA 1X8LA 1NNEA 1AO5A 3A88A 2Y5HA 2A32A 1E79D 4E03A 4NZQA 4NIYA 1NN0A 2SGPE 3TQFA 2QM8A 4V0MA 1EASA 3CRMA 1E96A 1GBEA 4Q7MB 5A8ZA 2OXCA 4EKDA 1ZRBA 1FP6A 1O2GH 2CCJA 1ZIOA 1OSSA 2VRWA 2J2UA 1VDZA 1YPKH 4JZEH 3ZVGA 1O3IA 7GCHG 3U7HB 1WU1A 1IHUA 1BKDR 3MO6A 2XC5A 2FF7A 1Z0DA 3KQUA 3GJ7A 5IK2A 2PJZA 1IQHA 3BTWE 2H9EH 4EQ6B 1YCPM 1IOZA 4W5WA 1T31A 4A82A 4F92B 1AI8H 1Z83A 1GDQA 4IGDA 4INHA 2W2XA 1OHHA 1JAIA 4Q4AB 1C5UA 2PMDA 1GBTA 4M1OA 2WBLC 1E3MA 5B64A 5DGJA 1Y3AA 3WY9A 2X2EA 2VB0A 3OE7D 4N0DA 1UTKA 4NBSA 4DZZA 2CXXA 1UTQA 1A1VA 4URUR 1JBUH 1C1TA 2BDBA 4FUIA 1ZUHA 1E2QA 4IOLA 2FODA 1TNLA 3I62A 2J38A 4OI0A 1C4Y2 3L43A 1RIWC 1N3BA 7GCHF 2A5IA 1WRBA 1AZ8A 1TQ2A 1W1WA 2A3RA 1ZNXA 3KJEA 1US8B 3ZVDA 1UBCA 3C4JA 4NIVA 4UDWH 5HKKA 4NL4H 1JEDA 1HE1C 4RKJB 2ALPA 2ATXA 4RD6A 1FMJA 1EFRA 3B9FH 4WVFA 3GCOA 2DWOA 4JYTA 1KK1A 1Q22A 4NWLA 1P3CA 3QK1A 2YJTD 2NMVA 2G88A 4OQNA 2G0NA 5TDHA 1SULA 5AWFC 1Q44A 1E1RD 2F7SA 4ISNA 1DUAA 5IRCD 3A36A 1G21E 4C3ZA 3AVZA 4ESVA 3SN6A 2DHRA 3WP1B 1GNRA 3UFAA 3MJRA 2FFQA 4MNWA 4EFMA 3VB4A 2AERH 3DOFA 4B2PA 3RWOA 4M0LA 1TNGA 1PQAA 5EZ5A 1RPZA 1ELTA 2ZR7A 1ZHPA 2XJ4A 5EPNA 1FY4A 4VGCC 1UVUH 1W14U 1UMAH 2EQBA 4X2XA 3DPUA 2FLBH 3GFOA 1DELA 2C96A 3D8BA 1MCVA 2YOLA 1D6JA 4XOJA 2FS9A 1JMOH 4DSUA 3R9XA 2DPXA 4ZDWA 4CEIA 3BG4B 5DKMA 1SXJA 1MRNA 1H8EA 2IS2A 3KQBA 1SGYE 2GBLC 2YWFA 4NSYA 1XJCA 3OEEA 5F9FA 2J9RA 4K8YA 1OB5A 4DDUA 1YBWA 3RXLA 3RSOA 1SGNE 1ZRKA 4KLNA 2QE7D 2DFNA 3A1VA 4BRWA 3KF2A 3V13A 4D4LA 4F93B 1HE8B 2ZU6A 3UIEA 4V0OA 1ANDA 3RU4E 2ZU5A 1XNJA 6LPRA 1UF9A 1DLKB 3SO3A 3BS4A 1T3SA 3KJGA 5DYGA 3THXA 2BLQA 4Y0YE 3KKPA 5GJWC 1F2TB 4XD7D 1XTKA 5AJYA 2Z9IA 2OCVB 3FAOA 3V0XA 1QVRA 1CULC 2NWNA 5E7JA 3LW7A 3X1DA 3RXDA 1O2OA 3WBJA 3LWNA 5FCKA 5K0HA 3MD0A 2YZ2A 5FTLA 2OQ5A 1HT2E 2I1VB 3VU9B 4TY7A 1JQLB 1J15A 1I4DD 1G8GA 2WOJA 3WRXC 3IEVA 1GGDC 2R0LA 3SNEA 4A6LA 1HJ8A 2PLXA 3MNBA 1CIPA 3GLGE 1XMIA 5FTJA 1CHGA 4C7OB 1AFQC 4H6SB 1E0JA 1BDAA 4TWWA 1ANKA 4P0TA 3TSWA 1BMNH 3NH9A 5JJKA 1U8ZA 1VYUA 3Q3JB 4GPTA 5FXLA 1O34A 1P57B 1XTQA 1FP7A 4KTUA 1E9BA 1C1WH 3F9GA 4A0FA 3K9LA 3A7XA 5H8WA 5KDLA 3VEQB 4BLQA 3MFYA 5JS8A 4GUXA 4AKEA 4HI0E 1AVWA 3OY5U 1OWHA 2FOCA 1CXZA 1L0ZA 4IVQA 5A0AE 1NZQH 5K8UA 4JBYA 1ZHMA 1TU4A 2QAGB 4B34A 2I1QA 1IQKA 3Q77A 2J9NA 3ZVEA 2ZECA 1E2IA 2V3CC 1G6HA 2OE2A 1W36D 3E91A 5T1VA 5CYOA 1O33A 3PWCA 3JZ2B 1BOFA 1OLOA 2A5JA 2W6JD 2JATA 5CHAC 1DBSA 1T91A 2QG6A 3KUCA 2BBOA 2ASEA 4Q19A 3FP8E 2ONJA 1B23P 4GI7A 4F4OC 3VB5A 1F0UA 5IDVA 3SV6A 4OI2A 3U7EB 1NP6A 5FPTA 2C4FH 5GJBA 1P03A 1XKBC 3BG8A 3FZDA 3MMPA 3CZQA 2A4GA 2GVFA 5SZHB 5SGAE 3NPSA 4HLQB 3PUXA 4B2IA 3DUXH 4QXAA 3CB4A 4C0QC 1KO7A 3RS3A 1G5TA 1W36C 1K2I1 1SLVB 5JWRA 3EA5A 2B8WA 3LD9A 3IKJA 4IW3B 4US0R 3AF3A 1YU9A 2OEPA 1C2JA 1L4DA 1HPGA 3K0EA 4PPQA 3SE0A 4JMYA 1X8JA 2VQSA 2GVDC 4IVPA 1YM0A 1NU9A 1YR8A 3TE6A 1NLYA 1ZRHA 3GEHA 4IMZA 4X8HA 3BTQE 4OHVA 1QHIA 4YXWD 2BWJA 4HDQB 2ZDLA 1Z0KA 4FCVA 1AY6H 1TE0A 3K09C 5JJIA 1NRNH 1XXHA 3UNQA 2PKAA 3PFIA 3SYKA 1ELAA 2I6QA 1BTPA 3REGA 3QEOA 4G5OA 1AWFH 4XBBA 3MNSA 1QRWA 2ERXA 2VF8A 4BLRA 2Q6DA 1P9RA 4Y11E 2EC9H 1O3BA 2WPKS 3Q3YA 3U3MA 1N6OA 1IJFA 5HZHA 1VHTA 3UXMA 4PSKA 1EPTC 3LGVA 1QHXA 1IOEA 3BB4A 2ASUB 1ZW6A 3ETLA 1B0EA 4EUNA 2GMTC 5JLJA 1U94A 1GNPA 2SGEE 1ETUA 3GCTF 3DHWC 2R62A 4DUGD 1DAEA 4LX0A 1QG2A 1EFUA 1XPRA 3UPEA 1LO6A 3BSQA 3QUSA 3W6PA 3CPHA 1ZM3A 1YZGA 1SGWA 2L0XA 4AB9A 5C67A 1D6WA 3LOXA 1EFTA 3DM5A 3PXGA 4M1YA 5AJZA 1KMHB 5FOSA 2O52A 3VR4A 2WVJA 2IYWA 2J59A 1G3QA 3EXAA 3DZ8A 3ECCA 2BD4A 1YZKA 1OYTH 1VKJA 4QGGA 1UK3A 4XBCA 4EIWA 2BC9A 4K1EA 1GMHG 1VMAA 4B2BA 1ZYOA 2WJJA 2FS8A 4LJ5A 2RB4A 2VEDA 2HT1A 1GIAA 4TT3A 2DWQA 3OAAA 2PH1A 2C04A 2P2LA 2WV5A 3BORA 1QURH 4SGBE 2KBEA 1KY2A 2YV5A 2PWXA 3B9PA 2QBYA 2XNSA 4Q1CA 2OCBA 1TWXB 2ZHDA 1L4ZA 5FBIA 2ZCKP 2BEKA 3MSXA 3HKIB 5J47A 4LYHA 2OFXA 4GCHG 4BAOB 2CMYA 1GNQA 2WM9B 4M1WA 1AU8A 1RFNA 4ISOA 3BG4C 2OLJA 2XSZD 3D65E 4YOIA 3LKWA 1EKBB 3IIKA 1ZSJA 2P6RA 5FCRA 2B92A 2ZAMA 4DLXA 1ZCBA 4U7DA 1JECA 2C90B 3ZYEA 4QT8C 2XWBI 1A5TA 4NCNA 1FMLA 1A2BA 6CHAB 1K21H 1FIZA 1RE0A 2MMCA 4LXBH 1QG4A 1CU1A 1G7SA 1C1PA 4NYJQ 2XTMA 4X6NA 3A86A 4BTUB 2V3OH 2HRVA 4D8NA 1EJAA 2QP3A 3D3QA 1RVDA 3FMIA 4QL3A 1NFXA 2GZ9A 2ZRDA 4KFTA 5E0HA 4NFEA 4F49A 1G17A 1TOMH 4OJKA 3A87A 2ANWA 1TGNA 1VJ9U 2W83A 5EZ6B 4GAWA 2AK3A 2OBMA 2ZDAH 4D2IA 1QCPA 1SGIB 2J5XA 1W47A 1UPTA 4ACBA 4HLUC 2QEQA 1A0LA 4LOAA 4PQRA 4AFQA 2JLVA 2VH0A 3IWMA 4AN7A 3MI4A 1G2LA 3N7OA 3VU9A 2OUAA 3NC1C 5DE3A 2O8BB 1MBMA 2W0MA 1BTUA 3EW9A 1TYNA 1MTVA 2YOFA 2H57A 4WWYA 4LJ7A 4W5JA 3REFA 4YZUA 2KI5A 4WZAE 4LJ6A 1GRNA 3BIFA 4O2RA 4CEHA 1W11U 2DUCA 4JZFH 4LHXA 5KSYA 1LVOA 3QQ5A 3QTVH 4LOYH 1XCMA 2G4UA 5B30A 1VCPA 2J94A 1KSJA 4Q21A 2EU8A 5DI3B 2JETC 5KSZA 4TTQA 1V2QT 3EASA 4JMPA 3BOSA 1R2QA 4PR0A 3VX3A 4Q1AA 2ZGCA 4GSOA 1E99A 1DWCH 1ESAA 1C5WB 2Q21A 5KTYA 4HUTA 2ZU1A 2WPIS 3WRYC 2Y7XA 5DK1A 3M0EA 1TAWA 2N1BA 1NY6A 4KJZA 2VWNA 1E2NA 2ORWA 2W26A 2Y80A 4OM9A 4QBGB 2BY5X 8GCHG 1GOTA 1M1YE 2YVUA 1INCA 4NCYA 1DWBH 1PQ5A 3VGCB 1CSOE 4EPYA 3TJOA 2WMNB 3CENA 5DP4A 3PQCA 3UNRA 3SV2H 1VCMA 4WJG2 3W34A 4LRWA 3QUMP 3CPJB 1IN8A 1PLLA 5DH9A 5JB8S 1ZPBA 4OS1A 4Y8ZA 5D3MB 2Q9CA 2ODBA 2V6IA 5K8IA 4TYYA 3VMFA 2IXFA 1AB9B 1XMNB 1J9CH 4AG6A 1ZMXA 1AFEH 4PZYA 4WOPA 3KQHA 5GJ4B 5EP3A 1O5BB 1HJAC 1YHNA 1G8HA 1E0FD 1LMWB 4DLSA 1FAKH 5L3VA 1RGQA 3S9AA 3SNDA 3TMKA 4MGKR 5SZJA 4DVAU 2EYUA 3ZDQA 2JJ2D 2TGPZ 1W5SA 2F4LA 4BQSA 1O3JA 4JK6A 2IUSA 5L3QA 4Y8YA 1W48A 3ICEA 2BLOA 1KLJH 1UDWA 2NO7A 4IKEA 5LDDC 4JS0A 2BY6X 1E1RA 1N6YA 4FWIB 4DCTA 2ZJ5A 2GZAA 2GEUA 1CTQA 4LBVA 2PKAB 1G2MA 4PANA 2H2ZA 5BW8A 1GI0A 3KQCA 3GCHC 1MOZA 2KAIB 2WWFA 3IPXA 1TNDA 4L5BA 3AAUA 3KL4A 3NHBA 1Z1IA 3T1TA 2ZYUX 2DE8A 1SFIA 5J4YA 5GVRA 1G8PA 1LTQA 3LPRA 2EFEB 1CEEA 3VR1A 4KU4A 3RAPR 5DGXA 2IHYA 4KTSA 1ESNA 3ZZ8A 3MUFA 1C5XB 2BYAX 4K3JA 1SR5C 1GL7A 2YC2C 4TPIZ 2V7QA 4LV5B 3HATH 5TY0A 2EFDB 3AGPA 4HI3A 1IY2A 2FH5B 4YLGA 2OFOA 1OP2A 2W7SA 3RUOA 1G64A 2ZRHA 4ABIA 1GMCG 3THOA 1YLCA 2GGVB 1Z8GA 5ESBA 3ZV9A 3EE0B 4H42U 1U81A 3UANA 2DBYA 1TPSA 1TUEA 4UXIA 2A5DA 1IXZA 4JK5A 1RRKA 2CHVA 3LC5A 1G41A 2IBMA 2KBFA 2REOA 3B82A 3RS0A 4AY2A 1EG7A 1GCTB 3L33A 2PW8H 1GI9B 1K1OA 2THFB 2CCKA 1TU3A 3N2EA 4WH6A 4K69A 2R2MB 4C30A 4UEHH 3K0CC 1SG8B 2DFKB 2ZYVX 4MRPA 4BFUA 1KI2A 1G3EA 1GCDA 2BIFA 2BY9X 2LKDA 1XDBA 5FTNA 4OHXA 2VP6A 3PV0A 1XD2B 2F3RA 2VP4A 2XOKD 4B71A 4AG1A 1GMCF 3KL6A 1SZPA 2ANMH 1O2KA 5CB8A 5G3ZA 3BTTE 5G3YA 1XTIA 1NG9A 2FFAA 3GLIA 1FX0A 1A0HB 3D6TB 1MKXK 3QY0A 2JDIA 2NPFA 1TA2A 3AF1A 3Q72A 4I4LA 4R7ZA 1YPHE 2JLQA 1BCUH 1K5DA 3SNAA 1VG1A 2CHAB 2DYKA 1U8YA 2WWWA 4RJLA 8GCHF 1P2SA 3CLVA 4UNQA 1C2FA 4WXIA 1FTNA 2W6IA 1PUIA 3IO5A 5EXXA 4PC6A 2PCLA 3IBGA 1WBBA 4AFSA 1C1OA 3TSOA 3OEHA 5C1BA 1ZPCA 3VHLB 1GJDB 4MYCA 2Q6TA 3CX6A 2NU2E 5JBQA 3PENA 2VIIA 4AIIA 2QGRA 2IXEA 1E0AA 4ISIH 1KGDA 2P16A 1NIPA 5EPYA 1VGCB 4YMUA 2P3UB 3TLOA 1E2LA 3PB1E 3QPVA 1SQ5A 3GJ4A 4MPWA 4CT4B 2V8OA 1DY9A 1T6NA 1BBRH 1W10U 1KDRA 1TGTA 2RGDA 3CX8A 1SGTA 3L2OB 4BFVA 2H1UA 1O3FA 2G81E 1NF3A 1AB9C 4GRAA 2OLKA 2J3EA 1ZC4A 2ZE8A 4DJZB 4M1KA 3LBHA 5FR2A 1IQNA 2WKQA 1SLXB 1MABA 3TITA 5KSOA 2VIDA 5LB2A 1MUEB 1UADA 2CL0X 3SHFA 1TUIA 1UVTH 5TV2A 1LHEH 1N6XA 2P65A 2HXSA 4NCHA 1JALA 3IGFA 2Z3DA 5EXMA 2BQ7B 3M3SA 4HB2A 4MUAA 3TRFA 1RJ9B 2UWOA 1GKUB 1KY9A 3CS7A 2GZ7A 1R5BA 2AMPA 2ZI2H 2UZ3A 2FX3A 1A5IA 2Y6TA 3RVBA 4Q1DA 1N6PA 3H7TA 4M1MA 3SI7A 1TLDA 1W46A 3RXJA 3KZ1E 1DOJA 1VCIA 4YC7A 4C7OA 2PLRA 4FMBB 4XVRA 2FYQA 4X6PA 1HUTH 1TQ0B 1XTSA 3CS0A 2FOAA 4PO1A 3BB1A 4EDHA 1DO2A 2AWOA 1E79A 1BS1A 2WTUA 1G8FA 1HEIA 2IS1A 3WNBA 2BOHB 1N0VC 2O8CA 4M7GA 1P3JA 2BHGA 3K0FB 1KNQA 5P21A 3BEUA 4DSNA 5EG4A 1XZPA 2V9PA 1I2MA 4JKIA 3I73A 1WBGB 3SU3A 1UHBB 3U69H 3LLUA 1XVMA 4E7NA 3LBIA 4A9AA 2ZRCA 1IY0A 1O2MA 4BLOA 2R6CA 1K9OE 1KO8A 4Q02A 4IFBA 3PLBA 1XEXB 3AW1A 5JCPA 7LPRA 1QHSA 3SGQE 3P17H 4BZXA 2EWWA 3U9AH 5HKKD 4A6PA 4FD2A 5C5OA 3CZPA 1C2LA 3M7UA 1DM4B 3QGNB 1R6BX 1H9IE 3PIRA 2A7HA 4X8VH 3Q7QA 1UCYH 2QP9X 2ZREA 5B57C 3BEIB 2KJQA 3SUGA 1OH7A 5HXFA 4II7A 3HGNA 5EGMA 3Q3XA 3FWYA 1GVZA 2ZI3A 1IN7A 1GJBB 2Y7ZA 1GG2A 1SHYA 4L9WA 2GCOA 1W2HA 3E70C 5A8XA 3GCGA 4IDQA 4TWYA 2BDHA 1VITH 3TGPA 5UKDA 2GVZC 1V2ST 4R9UC 2Q0HA 2R6FA 4JZ1A 2V54A 2ZANA 3IBYA 2F1HA 1P4SA 2FSFA 4ASHA 2ZXUA 3KGPA 1JI0A 4AWXA 3U6KA 2CJIA 1VIYA 1TRNA 1XXDA 3I32A 2P94A 3VB3A 2JIZD 3F0TA 3HU2A 4Q1FA 4KSBA 2QAGC 3AK5A 3D23A 1KXDA 5EUMA 3EPJA 1DSTA 2BVNA 4G0NA 1QJ7B 2VWMA 1CGIE 3KXLA 1HGTH 1ELEE 1KAGA 4TLBA 1ZGVA 2WPDA 1TQ6A 1Y59T 2ZPSA 2QE7A 4URWR 4QBIA 4WVPE 1TGBA 1XMSA 2LCFA 1RYFA 2ODQA 3FANA 3QO6A 2Z3EA 3RXHA 3LO5A 3SU8A 2ZSFA 1BRBE 4TN1A 1QA7A 1KZGB 2GJAA 1NN3A 2ALVA 2HYDA 1D2MA 4BWYA 3TKLA 4CRDA 1L1GA 1GDNA 3A8AA 4M22A 1C5RA 3FFBA 3MU1A 3UOPA 3L0OA 3M5NA 4MYHA 5FPHA 2GBLA 3SN8A 3SGAE 3AH8A 4OGXA 1MO5A 4IOKA 2F43B 2DY1A 4KSCA 4FMDB 2G1JA 4LZZA 1EP5A 4LJ4A 2JKHA 1KTSB 2O9QA 2IWHA 5M04A 2ZZUH 2BDTA 4BRUA 1ZCAA 1Z22A 2W2TA 2H16A 1TFXA 2GK7A 3T5DA 1W2GA 2QYIA 4IEIA 4LBZA 4RY2A 4LBYA 2OT3B 2OLGA 2ONKA 1Z29A 5G40A 3QWCH 3ATLA 1TONA 1V2TT 1QDEA 1FX0B 2RGCA 4M9SA 1TF7A 2NQ2C 4IFEA 1C2DA 1S3GA 1EESA 3H7OA 1FJSA 4KYUA 4QGHA 1AQUA 4CIDA 3R8CA 4OYHA 4E7RG 1OXTA 3N2IA 5F3WB 1GHBF 1AGRA 1EP6A 2BBWA 3SUEA 1C4V2 3RRZA 3U8RH 1J16A 3ZVMA 1GBFA 2FPKA 4Q9KA 2ZRGA 5DP3A 1NIJA 1OB2A 2IYQA 1CT4E 4WIAA 1KMQA 1ZZZA 1ZSLA 1J8MF 4AYTA 1KHTA 1F0TA 1AUTC 4DLRA 3PO1C 3EA9A 2FSHA 4A2QA 1C1SA 1O87A 2BBSA 2HOBA 1TPPA 4JVNA 4M9ZA 1CKEA 4U01A 1YP9A 4MKHA 4ARZB 4BLTA 1ELCA 2QU8A 2HT6A 4X8UH 1M74A 1FNNA 2DB3A 2HXYA 1N6KA 1MO6A 2PSXA 2O0JA 2YWEA 3A7YA 3K70C 3WHKA 3ZS8A 1TF5A 5AFYH 3Q5DA 5FI1B 2G55A 3RANA 4TSFA 2IYRA 2P95A 3GFTA 2ZKSA 3OIWA 3GY6A 1WTGH 4GPGA 3FGNA 4TLCA 2ZM5A 5KNBA 1H4WA 1P75A 1ETTH 1O3AA 4XVQA 3GICB 3OZXA 2FX4A 5AUNB 1O5EH 3EA7A 4LWZA 4YQFA 4RSPA 5EXLA 2W7UA 1GILA 3HU3A 5ETXA 3O8BA 2HUPA 1SGPE 2FEOA 2YNMA 4VGCB 1HTWA 4X2VA 3I4LA 2VWOA 5EP2A 2ZSAA 1K1PA 2MMGA 3GY8A 2CF8H 3HWSA 4HFPB 2XAUA 5DPAA 4GOJA 3TUJC 4UONA 3IO3A 1NBMD 3K53A 5JHHB 1L4YA 3BFKA 3HDTA 1SBWA 2B7CA 1OFTA 4QFMA 4WXVA 5TVKA 2D8WA 3MU8A 1OKKD 4CEHB 2F9PA 2Z4RA 4MPXA 1PQ8A 2H92A 3VR6A 4GZLA 5TCCA 4BAKB 3A1SA 5H1YA 2OC7A 1LVMA 3IILA 5F98A 5CHAB 2CXVA 5DN6D 3A7TA 3K8YA 1P8VC 1A4RA 1O32A 2F1RA 4G1UC 5GJVC 2JJ1A 4N1AA 2B8TA 3K9XB 4IEEA 1UHBA 1N2CE 2GESA 1QHHB 3PLPA 3HR7A 6GCHG 4ZDIA 3RXSA 5DSZA 1MU8B 4L9SA 1OP8A 4OS7A 4IOJA 2AEIH 1OWDA 1WQVH 3SOPA 3DOEA 1KYIA 1AZTA 3SV9A 2IJOB 1KLIH 4LI0A 3JZ1B 1UBFA 3AAVA 1N5KA 1RZ3A 5KNDA 3RU4T 3TH3H 4FXGH 5IYTA 4TZ0A 3ZVBA 2IEYA 4NIWA 3U44A 4GDFA 1SOZA 1ZNYA 2VP5A 1F48A 2CL7X 3B60A 3MWLA 4PZZA 2FOGA 4FUGA 3B1YA 1Q3TA 4DCSA 2RGBA 1HAHH 2IUUA 1UJ2A 2EW1A 1CA0B 1Z6YA 3CONA 2QXIA 2FSGA 1E2EA 1ZTLA 1VCWA 3TH2H 2GCOB 4AURA 2AXPA 2WPJS 1IM2A 1OT3A 3PUZA 4X8LA 5EE0A 3ZZ9A 5JDUB 2NZ8A 5DHAA 3L3TA 3JVUA 3RRYA 3LJOA 2NIPA 4B3CA 1KSFX 2TPIZ 2HCJB 3LGWA 4JL6A 1GI3A 2VJ1A 2R65A 3NUMA 3ADCA 3QF4B 1P05A 3SV7A 2ZIAA 1LHFH 4DEXA 1C1YA 2YKGA 1FZZA 1LKAA 4ZKRU 3HYRA 4JLKA 1XD9A 1TNHA 2X19A 3RC5A 1RTFB 3K6ZA 2XSZA 4RSGA 4S2EA 5L3RA 1IY1A 2G83A 2ZU3A 1AJEA 3RXBA 4OK5A 4B6EA 3SZEA 1DPFA 4KI0A 1W7AA 1JJ7A 4O25A 1RJXB 1GI6A 1BB0B 3TVTA 3FB4A 3AQ4A 2ZI4A 3V9PA 4FVBA 4LJAA 1SGEE 4OK6A 4LC0A 3OY6U 2Z0MA 4Z54A 3T29A 4ISHH 3H84A 1DDJA 3A4NA 3HPQA 4KFRA 1HY3A 1DLEA 2W6JA 5HCNA 1XB2A 2GX4A 3JZAA 4L16A 1YPHC 1PPGE 4A1XA 2UVQA 1R8SA 1WQ1R 1SKYE 1LCYA 2Y82A 1H1BA 2FI4E 5GNDA 3N5CA 1BTYA 2CEAA 3THWB 1Z6GA 3PO1B 2BD8A 2BX3A 2F9NA 4TPYA 1MO3A 4A92A 1YPJH 4WH8A 4FU9A 4D0LB 3KIDU 3SJIA 3URCA 1NFUA 1OYQA 4OQXA 2JLSA 4EFNA 3TR0A 1AK2A 3BTEE 1RIWB 2VNTA 3SQEE 3W95A 1P2MA 2ZAOA 4IN2A 1JRTA 2A4OA 3UKDA 1II9A 1DVRA 1FUJA 4MLFB 1AM4D 4DLUA 4H9GA 4Q7JB 3QKSB 5D3MA 1M6NA 2WUCA 3HK6B 2GZ8A 2JA1A 4OI1A 2WIBA 1IJEA 3FFAA 4LHYA 1KJYA 2GJSA 3PR1A 2J95A 3U1JB 3ND8A 3OSYA 3RXIA 1CJUC 4KP0A 8ESTE 5EJEA 3TJNA 2QL6A 2O8WA 2C9OA 1K5GA 1GAJA 2J34A 3P8FA 4YESB 3A8TA 2FPZA 5EQQA 2FGJA 4IVRA 3WXMA 3U3KA 1W0KA 1YR7A 2PHBA 1GWNA 4C0SA 1NESE 3DEFA 4Y71A 1KSGA 2P5SA 4B3FX 1HIAA 3MWIU 2VHCA 1UBEA 2ZITA 2QPAA 2RGAA 2OAP1 2AR7A 3F1SB 1C5TA 1NKSA 3DT0H 3SZNA 2W0SA 5G53C 4UQOA 1NY22 5BYJA 3UY9A 2VHUA 3RS5A 1SVIA 2R3UA 4B74A 3AP3A 2UUFB 1KO4A 2NU1E 4OS6A 1NVXQ 3TLXA 2ZJ2A 3KFVA 4Q18A 3RLYH 2A2QH 4LYFA 2IYVA 1G3CA 1DPOA 2Z83A 2FDCA 5BN4A 4A5TS 3G0HA 1CRPA 2HCBA 1MAXA 3NEJA 1IQFA 1R5NA 4B6FA 3TK5A 5BWMA 2A4RA 1U9IC 4GLYA 1SGQE 2ZU0C 3BEFB 4PC7A 1W36B 1BRUP 3ESTA 3DHKH 4I7YH 3ZQJA 4P4SB 1A5GH 2FV8A 1GJ5H 2OBLA 1EFRD 3EA0A 2GCNA 2ZPRA 3GDSA 1X7AC 4YT7H 3ONWA 4ZI2A 1HCGA 1GRRA 1P11E 1E2FA 5E7MA 4IDNA 3P26A 2AK2A 3SU5A 1JR3D 5BN5A 4LBWA 1Z63A 4EJSB 2A78A 3QPWA 4TMKA 3VTKA 4GHTA 1S6FA 3PEYA 1H8ED 2IYYA 1RJ9A 4A0GA 4HUQA 3VFDA 1DAMA 4B48A 3NEYA 2A1DB 2D2FA 2A5FA 2G51A 3R9IA 5IT5A 4FUBA 3X1YA 2IN2A 3RXPA 5J4HA 4QOSA 5GJCA 4NG9H 2WKRA 4G3XA 1J7KA 1O2YA 4ZIRB 1EPTA 1DAKA 3U3OA 1E4VA 4AYVB 1IQEA 1LHGH 1TPAE 4KHZA 1Z6EA 3B85A 2WYJA 4IOMA 1XEWX 2CK3A 3K65B 2QY9A 3ZVRA 1RC8A 2TBSA 4DLWA 5KPJA 2IX3A 2ZC9H 1OSNA 1RW4A 2IK8A 2G0TA 2KE5A 2QMEA 3C1KA 1EWQA 2RGEA 2FU5C 2IXGA 2RDLA 5C3NA 2V7QD 3TJZA 3QBVA 1G7CA 5EW2H 2FZLA 2ZDNA 4TL7A 5JWOA 1QTFA 5FTKA 4B35A 1NN1A 4BPBA 2IYLD 2IT1A 3FMFA 3QOFA 4ZDKA 4ZROA 2CJWA 3R9WA 2DFTA 5DP5A 2NPIA 4MKFA 3E0PB 4TYWA 3TBKA 1TMTH 1O0DH 4M9XA 2WJHA 4E09A 1QQUA 3DO6A 4UNNA 3DVLA 3RXFA 4Y10E 4HB0A 1O3PB 1CGHA 2SFAA 1GI4A 2FDAA 1GJ4H 3ADDA 1QBOA 1FLEE 4D0GA 3LJJA 3VGCC 4C0BA 4BUJA 4QJ3A 3ZVAA 2CGAA 2MSCB 5LB4A 1VG9B 4Y6DA 4GOKA 1ESMA 1HAYB 3K0AB 2JH5D 1ELDE 4WAUA 3GDUA 1SGCA 3A58B 3VPKA 2V1UA 1G16A 4RFVA 3CNLA 2UWLA 5KNCA 3R8FA 1Z2AA 2DWPA 2ODEA 1BRAA 3O47A 1ONBA 1RRCA 3SU2A 3ZZTA 3S0NA 1E2GA 1HAGE 4LK4A 1T5IA 3HR8A 2X1VA 3F9EA 2KSQA 2ZQ1A 3QXSA 4O9VA 2V55B 3MJHA 1E98A 4P31A 3VXFH 1P2UA 1FPCH 1N6RA 1TQ4A 3RHFA 4ITRC 3TU7H 3CW2A 1KI8A 4DG4A 1II0A 4I8HA 1NJGA 4QC2A 2IS4A 3UNSA 4GNKA 2SHKA 2GT7A 1DO0A 3O8DA 5SZIA 4XOIA 1KIMA 1NKTA 1Y63A 3C5HA 1LPZB 1DE0A 2JLRA 4FUFA 1E35B 1E1QA 4LJ9A 1YE8A 1IAUA 2FM2A 2ZO3H 4RZ2A 3UWIA 4UNSA 3KTAA 4Y76A 1Q1ZA 3ODFA 3IHWA 1GITA 3SBDA 1M7BA 1XCPA 2CF9H 1O2PA 4OHWA 4INKA 1P9SA 1YC0A 1GZSA 5A2MH 4YT6H 4XTCS 2JIZA 5AUQA 2ILNA 5L6NH 3RC8A 2GXSA 4Q03A 1XRJA 2BDGA 4QBHA 3SU6A 1E9RA 1WQSA 2GT8A 4LV6A 3UR9A 1JNYA 2JLWA 2W6ID 1Q3XA 3B8HA 4HZUB 3AUYA 2V4ZA 4C2TA 4TY6A 3BH0A 1P6XA 1A46H 4MQBA 4CRWB 2GCTC 2OO7A 1AIPA 4A0HA 5FBRB 2O8BA 1R8QA 4IDOA 3PMJA 2OP9A 3OIYA 2G5VA 4DCVA 2ZIQH 2H5EA 1HQCA 3KQNA 1NSFA 1T8TA 1SOTA 3QKTA 1BYIA 2VIPA 1Z8JB 3ZZDA 3FHTA 3CKLA 1NM6A 4MPVA 1SXJD 3R20A 2IYZA 5T3HA 1CJTC 2AD1A 4JLPA 1HAVB 3MHWU 3SJZA 1A1RA 3WYAA 3C8UA 1THPB 5ABWA 3FZZA 2QCYA 1KXCA 1MU6B 1TPOA 2LKCA 4N3NA 2F3TA 1Z5ZA 2SNWA 2RA3A 4R2IA 1T8NA 3CH5A 4UXJA 4BE7B 1Z6XA 4I32A 3P70B 2QAGA 1WUNH 2PJRA 4ABJA 1BBRK 1NBMA 1C5SA 2ANKH 2FPMA 2J46A 5FUWA 4GSYA 3R3GB 2QRNA 4HTCH 4RN6A 5DYIA 3OYPA 1UCYE 4FCTA 4MUBA 2D4HA 4URZR 1YPLH 4FVDA 1E2DA 4JVLA 5HTKA 2ZFFH 4ZKEA 5EP4A 3B13B 2QMOA 1P10A 5B58C 2QMUA 1VR1H 1OF1A 4KLZA 4F38A 4MNYA 3RDZA 3DM9B 4YO9A 3L82B 1O2RA 1TOCB 2O8FA 2TRMA 2BD3A 1QRXA 4Q7KA 1C5QA 2BY8X 3PROA 4GL2A 1Z2CA 1GBKA 5CK5A 4R2HA 4TT3D 3OTJE 1SQTA 1HAZB 2ZUBA 5KPDA 4H1VA 2PEZA 1MKYA 1IN4A 1AHTH 1E38B 2G77B 2ORVA 4CEJB 1GHZA 1LNZA 1TGSZ 1TTTA 4X1PU 4IXMA 1KO1A 3AB3A 2R8RA 3BE4A 2BQWB 2FMXA 1UM8A 1HB0B 1T4VH 3OU0A 4X1QU 5FL7D 4DSOA 1SHZA 4TMTA 1DAIA 4JT4A 1AWHB 3MMGA 1ANEA 2F43A 3RXQA 4QNMA 3U6BA 1JIRA 1RTKA 4PPGA 4XTRA 1SFQB 2ZFRH 8KME2 4JYVH 3GJ8A 3KUDA 2ZR9A 3TJUA 2J0UA 1TBRH 3ADBA 1MQ5A 4Y79A 4CDGA 3KKOA 1S0QA 4AKIA 4V0NA 1K6MA 1Y5AT 4RZUA 3RWMB 1TEXA 4I1UA 1T8OA 1UK2A 1AA9A 4U02A 4V0KA 1WCZA 3K9HA 1TEVA 3A7ZA 1BTWA 4UXHA 1GGDB 1MTUA 2F91A 3OFNA 1EOLA 1P72A 2GA8A 2QT0A 5IF9A 1G37A 3V00A 4DIDA 4JYBA 4F91B 3NIBA 4HLDA 2Z7FE 1FI8A 4O0MA 1Y3WA 4NONA 3MH4A 1UDXA 4JJKA 4UKDA 2BCJQ 1SQAA 4QM6A 2J0VA 5FBEA 2C77A 3SNHA 2ZSDA 1W4RA 5SZKB 1GM5A 4DY7B 1N0UA 3QBTA 4X6OA 2A5AA 1A7JA 3ZZ3A 4TYQA 4PHHA 3EC1A 4DW2U 1XTRA 4DLYA 3PTBA 4MH0R 4CREA 1J99A 2HNTF 1T4UH 4X8SH 1IQPA 4TTRA 5HCIA 2XXAA 2WAXA 1HAVA 2O0KA 4ASUA 1GKIA 2ZVPX 2V1XA 2XZPA 3P95A 3EGKH 4RKEA 1EAXA 1UEJA 3U7GA 2JETB 1MT0A 3WHLA 4B76A 4O3UA 1O3DA 2GZDA 4XDEA 3UQOA 3UTUH 1N6NA 1T8MA 4KKDA 7KMEH 1TMUH 1AKEA 3SUFA 1KDTA 1XVOA 2GTBA 1W3CA 1FONA 5CDFE 1IQMA 2SGDE 4QGFA 3ATKA 3T34A 1S0UA 2QGZA 1KTTB 2BD7A 4E05H 4GP7A 1XFAA 2AN9A 4OL0A 2QF0A 1Z6TA 3F5FA 2XGJA 3SORA 1CE5A 4ABAA 1O38A 4LYAA 4TQ9A 4AD8A 1VTKA 3QSYA 8OHMA 4A8JC 1KKLA 3QXXA 4OHYA 1P9UA 1GHAG 1GJ8B 2BDCA 3NXSA 1T4GA 4QHTA 5FH9A 2B5TB 1G30B 3CNOA 1BO6A 1EX7A 3UG7A 3HJNA 3LW8A 5A0FA 2CBZA 4WZBE 1X86B 1LFDB 1R4AA 4WXRA 3EARA 2C8VA 2ZGHA 2NGRA 3KKQA 4QRHA 4KVAA 4NA9H 1UFQA 2QN6A 2JAQA 1U8AA 2XX3A 1I2DA 1Q2WA 3CPEA 4MRVA 1BUIA 1KIGH 1V2NT 4U5XA 4EPRA 4X1RU 1HH4A 2OC1A 5DHFA 2VGCB 3RXGA 2XTNA 2GHIA 3BERA 1Z0JA 2OBOA 1WXRA 1UTJA 2H18A 2AH4X 1U90A 2ANYA 2O8MA 2ZRIA 4HYYA 3W6OA 1KK0A 5FUXA 2QPTA 1RIFA 5EUQB 3AKDA 5JHGB 1QHRB 2MSEB 2WSSD 4DT1A 2FOFA 2A2XH 2NO1A 1XM1A 2IPHA 2O8LA 3MYWA 2EEKA 1F2SE 1E32A 3A1UA 2G1KA 4Y0VA 4DLVA 2ZQ2A 1PJPA 5GIBA 5E7IA 1Y8TA 2IEZA 3P8OA 2W2VA 4PAMA 2R9VA 1I4LD 5LPRA 1AQYA 1E9FA 4B2CA 2GF0A 3AGQA 1HURA 2TMKA 1MD7A 1TRMA 1A3BH 2VVVA 4YMVA 4BOHA 3PTNA 3A4LA 1P2KA 1TQDA 1JR3A 3I78A 2N46A 1GI2A 1CP2A 4CR5A 3FKQA 5EXTA 3HU1A 1HFDA 1IQLA 4U00A 2IYTA 3NBXX 1TMBH 4AB8A 1X6VA 2D3WA 3CIOA 3TUZC 1SVKA 1O5CB 4MA4A 1FY5A 2CL6X 3ZYDA 3GMTA 1OXSC 1L4UA 2C8WB 3GLFB 1YR6A 4CRFA 1P73A 1AIXH 4KBGA 2BM2A 2I4IA 3CX7A 1GHYH 1W12U 1F0RA 2BXUH 2D74A 3ZZ0A 2WPMS 5LPNA 3TAHA 9LPRA 4K60A 2OCAA 2QM7A 3SC3A 2SNVA 5GCHG 2JGNA 5LPEA 1E2JA 5HE9A 3SHAH 4ZKOU 1DE7H 3GJXC 1CR0A 5FBQB 1O35A 1TNIA 2PGBB 2CVFA 2JJ1D 2EI7A 1C1MA 1H9HE 3CRVA 2BLVA 3UWJH 1GHWH 5F6MA 1H8HA 1BMLA 5J40A 1P9NA 1DAGA 2RKOA 2CNWD 4A0RA 5J4KA 1ANCA 1W0ZU 2VHTA 3U2QA 4DXAA 3LGIA 3RNLA 3DFJA 2HV8A 4D4MA 4Q7YA 1SI5H 2FOBA 3SYNA 3TSZA 2XEXA 2BOVA 1G3IA 2PKSB 4EJSA 4WXPA 3PUWA 1MKWK 4AX9H 3SQHE 5HPYB 5LD2B 3GYLB 2VVUA 4UNRA 2XOKA 1T7CA 5AUOB 1YPMH 1GL9B 2A2ZA 2O8DA 4MNXA 3L8YA 4HUQB 1CGJE 1DAFA 4MRSA 1IN5A 4I1OA 3A85A 4AYWA 1SL3A 1C2HA 2F1IA 3B78A 1FUKA 3L0SA 5J4SA 4L15A 1HIAB 2ZHFH 4JZKA 2VIWA 3C27B 2BDAA 3HK3B 3D62A 1B0FA 1PFXC 3OIUA 3UQVA 4WMEA 4OJQA 3QI2A 3FVFB 1GMDG 1KI6B 1DTSA 1EAUA 1QHYA 4HZHA 1CBUA 2F83A 3GJ3A 5AJXA 2ZROA 5J4LA 1EJNA 1R5OA 3BFVA 4NA8A 1MTNC 2R3YA 2V6NA 1YKTA 3A84A 1B7XB 2VHJA 1UTMA 3ZZAA 4KO8A 4C2UA 3T12A 4NHOA 5DISB 5HYOA 1AKYA 4HLUA 3GY4A 1TRYA 1DARA 4AYYB 2GV7A 4ZV4A 2F55A 5KYKA 3QENA 4YXWA 3U3JA 1JXMA 4KCGA 2F3CE 3ENSB 2G8TA 2IJD1 1TL7C 1SSXA 1G8YA 3BH6A 3LXRA 3W6NA 1Z8FA 4ON9A 1I4TD 4B33A 1C2IA 1NVWQ 2Z9GA 2ZI6A 3LDAA 4X2YA 2GDJA 4C4PA 5L3QB 4RZ3A 2ZYWX 4A8JB 1EFCA 3WMEA 4ABFA 2P3SA 3ZZBA 3H1TA 1S96A 2ZWLH 1YZLA 5CITA 5TXGA 2R2AA 2FWRA 4PO9A 4B2AA 1FUUA 4PXAA 2H6MA 4RKOB 2ODWA 1W0KD 3PLKA 1BRCE 3L8ZA 2V3HH 1ABIH 5H4IB 4NYMR 1UTOA 4CRAA 5GCHF 2QSZA 1ODFA 1O3YA 3NHAA 4MG3A 1O3MA 4TQUS 5JFGA 4GMDA 2VIVA 5B6LA 5L8VA 1YLDA 1AN0A 5LPFA 4MDEA 3FOZA 2H5DA 2LWIA 4CH8B 4MPUA 1NS3A 5DN6A 3LQRA 4NYIQ 4G5GA 1OS8A 4FUJA 4B73A 4K1SA 3M3VA 5JEEA 4YDSA 2TGAA 3VFEA 4URVR 3TNTA 3P92A 1S6HA 4UJ3A 5C1YA 3RU4D 1C9TA 1S2MA 2ZRKA 2XB2A 3L0IB 1O2IA 3T26A 4OQFA 3KB1A 5T6FA 1TF2A 1G36A 3C16C 4LDJA 1TALA 2QI9C 1FW6A 2FEQH 1HLTH 1C2EA 1FNIA 3U1IB 4NGAH 1G7RA 4LPKA 3RYTC 2VLIA 2FIRH 8LPRA 2VH6A 5LD2C 1BJVA 4BLSA 2ZR0A 2WWGA 2A7CA 4BZQA 4IDPA 2AMDA 2R0KA 2B6HA 1IHTH 3A1TA 3B7GA 2MSDB 1ETSH 3QG5A 2ODPA 1YJ5A 4CBNA 4NCIA 1ANBA 3QG1A 1DFPA 1Z0AA 2K5UA 3MWYW 4NMMA 4PTLA 4TQAA 1A4WH 2PX3A 9ESTA 4D26A 4B44A 2O8EB 5EW1H 5ESTE 4ZXXH 2OTVA 1B0UA 2E9SA 2VIOA 2ZDKA 4POAA 1YZTA 1XMJA 1NL3A 1IAQA 3TH4H 4I8KA 5B2ZA 4XSGA 1GJ6A 2HDNB 2QUZA 3CBQA 2ZPQA 4Z51A 2JCSA 3B2EA 1VYVA 2BDYA 3T1VA 2VIQA 2BTCE 2A9KA 2P6NA 3QF4A 4FINA 2WUBA 2OAQ1 1RXPA 2OBQA 1L2EA 1G3RA 4X0WU 5EODA 3TAUA 2HF8A 3DMNA 4LCBA 1BITA 1TX8A 3TW4A 2FLRH 3RC3A 2AXNA 3X1WA 3THYB 1GMDF 1ZMNA 2GCPA 3U5ZB 5K7RA 3M37A 4A15A 3A80A 4D0NA 3WMGA 3E90B 1MZDA 4YLUA 1NU7B 3KNXA 1N6LA 4AGKA 3KHVA 4IW4E 1W0YH 1ELGA 1G9XA 1G3UA 4NYIR 3SR0A 4N0EA 1EK0A 2PEYA 4C0LA 1V6DA 2ERYA 5BXQC 4M2LA 4AGJA 1EZSC 2ZHWH 4V0ME 1K8RA 4IMQA 5EP1A 3S9BA 5FX6A 2XZOA 3SI3H 3S1AA 1SVSA 3B1ZA 2HF9A 2GAOA 3ZYCA 5FPYA 1E2KA 2P93A 2FO9A 3MGCA 3QZRA 4CF7A 2B8OH 1S5SA 1JAHA 2AYWA 1SC8U 2BD9A 3GCHB 2R9PA 3KN2A 4JVMA 4JL5A 1WDTA 1HAIH 4CBOA 3EPKA 3RXRA 5C1XA 3SDZA 1EX3A 3TNFA 3W9YA 3EX7C 1E0SA 3L6PA 1KK2A 2PT5A 1SQOA 2C03A 4MDFA 2RGNC 4RD4A 1GVKB 2QXJA 1DG3A 1ZC3A 4MRNA 3I5YA 4TMWA 1SKYB 4JSTA 3NZIA 1SGDE 3TH5A 3QZQA 4KV9A 1D6RA 4PSAA 2BBTA 2XBYA 3EC2A 1HV7A 2XB4A 4NFFA 2IHBA 2YWHA 4NYJR 1BIOA 3SU0A 4ZUHA 3AVTA 1GBAA 1ZM7A 4D7GA 1P01A 4XH9B 2WV4A 1N1LA 5FHTA 1A0JA 2WJYA 2IF2A 4LJYA 1YZNA 1SHHB 1E1QD 3EZ2A 2XWAA 4DDWA 3LGTA 3KKNA 2FTMA 1XPOA 3ZZCA 5L3SB 1Z28A 1HYLA 4Q4HB 4I8LA 2FI3E 3FMPB 4L8GA 5EE1A 1CT2E 2ZTZA 3QX5H 1EJMA 1DEKA 1E34B 1WMSA 4JZIA 3AF0A 4AC9A 3TNSA 1BTZA 2A5GA 5EOKA 2X8AA 1Y3VA 2NTYC 4D6PA 2CCGA 2QIQA 4LHVA 2NU0E 3W5IA 4YMTA 4I1VA 1M9UA 3U44B 1II8B 1XEXA 4P33A 2JEOA 2WOOA 4PX9A 3C14C 4P4TA 3EPLA 2FNAA 1DSUA 2J92A 2XRCA 3W3AA 4R71A 3QKSA 3Q8XB 2BCGY 1MTSA 3DA9B 5EXPA 1ZHRA 1F6BA 1C5PA 4NA7A 4ESHA 4Q7XA 2QC2A 1UEIA 2GDEH 3BTFE 4MNVA 3GJ0A 2JH6D 2JH0D 4DVGA 3E16B 1HQYE 5FOTA 1QY6A 3GCNA 2G6BA 4Q9HA 3LLMA 1GI8B 1AS2A 1FV9A 3X2SA 1WE2A 1GJ9B 1UKVY 4DBLC 2XXAB 1O2TA 1W13U 3ZIAD 2QENA 2QXHA 3ASZA 3RLWH 2PV9B 4P4UA 3B5JA 1QL9A 3FE2A 1ETRH 3QGJA 4J0QA 2SGFE 1BYUA 4MYTA 4U32A 3S69A 4HLCA 3WBKA 2HLCA 1ORFA 1Z07A 4OHZA 121PA 1DWEH 221PA 1J70A 4FU7A 4FW9A 4A2WA 2BJVA 3RABA 3AVUA 1KI1A 4PC1A 1PLJA 4TWZA 1V2UT 2C9CA 1Z06A 1HYQA 2BLWA 3ND9A 1KDPA 3LGUA 4K2YA 4EPXA 5CYPA 4WF8A 3RS2A 3RMMH 4MQAA 1QJ1B 1G9IE 4UFEH 4D76A 2H9TH 1MAYA 4JLMA 2ZJYA 1XXHE 3BD9A 1O3CA 3SYLA 1GMHF 3QXJA 2HPPH 3GYMA 2IL1A 4BASA 3K0CA 1AE5A 3LH1A 2QV1A 4KAXA 2ZRAA 5GXPA 1GHVH 4F7WA 5EQRA 3B1VA 2H7VA 1UKEA 2VSFA 3AV0B 1ZP6A 2PR3A 4JVSB 3MG9A 3HGPA 1JEEA 2FTLE 5KO2A 1US8A 3SJAA 1ZJKA 4PZLA 4E06H 3PMHB 1XUHA 5JCZA 2XC4A 1VITF 2FPLA 3MAAC 1KKMA 1ARBA 1HA3A 3ASYA 3PJRA 1DY8A 1S9HA 1QIXB 2F6RA 1GFIA 1T8LA 1JR3E 4SGAE 1O36A 2BV3A 4DHEA 1OW3B 4AOQA 3CUEF 4THNH 3ICQB 1A61H 5JBAS 1XMVA 2O8EA 3AVWA 1S9DA 1GHAF 1EXMA 5C4MA 1J14A 3SU4A 4AFUA 1CVWH 3W94A 3TQCA 2P3FH 2FOEA 3GLGA 3R7WB 3M5MA 3K0AA 4LUCA 5ELXA 2ZE5A 1DANH 2OCPA 1GBIA 2RGXA 4B3GA 4G01B 1XD2A 2BX4A 1R10A 5GWZA 5KOYA 3QE0A 3IPYA 1J17T 2CE2X 2BMFA 2BB4A 1QB6A 4J2YB 1LF0A 4DWJA 2XTTB 3ATMA 4DIHH 3PEVA 4O3MA 3SJKA 3GLIB 3I8SA 4WW0A 1NO9H 1TNKA 2A0QB 3B23B 1P2VA 2YC4C 5FOWA 1JPNA 1E2MA 1SGFG 4YLQH 1GI5A 1SVPA 5E95A 3PG5A 2P59A 5JBBS 2J0SA 3PMAB 2RMKA 1WTHD 3U60B 1O3GA 3H4MA 1TA6A 1NN6A 3DZDA 1ELBA 2BD5A 2SGAA 4RD2A 1N8OB 1NLZA 2XBVA 1LVBA 2OESA 2BD2A 2NU3E 2QQEA 4FXPA 4ESTE 4BAQB 3VR3A 2ZNKH 2QPOA 3W3ZB 4K8OA 2CLSA 2GEDA 3PV4A 3KKMA 1ARCA 5I46H 1VHLA 3K1JA 5H68A 5FTMA 5FOUA 2FJUA 3TGJE 1XUKA 4HAXA 4GCHF 4JYCA 4E22A 3A6PC 5TB5A 3RM2H 3KQKA 3UK6A 3ADKA 4US2R 1MKXH 4TMVA 2FOLA 5JPMH 2VL7A 1BBRE 421PA 1C5MD 2FYRA 4OK3A 3GDVA 1ZAKA 1C5LH 2OBNA 4HZUA 3EQ0H 1WXQA 3C41J 2F9OA 4TMZA 6CHAC 3MU0A 2NOAA 5E0JA 1OIXA 1AUJA 4DT1B 4A4DA 2GETA 1EZUC 1YRBA 2BMEA 3NG1A 2FXRA 4YMWA 1F5NA 1GL1A 3UATA 1AZZA 1FTSA 3KJIA 3P1JA 3SJ9A 2GNOA 3CF2A 4AI6A 2A5YB 4JBXA 1OH6A 4IXNA 1ACBE 1S4QA 4Q1BA 3EZ6A 3A37A 2HNTC 4H1UA 1RKBA 2OCYC 5E4FA 2VP0A 4FMDF 4C0KA 2GTPA 1IHSH 3BBPA 1S1MA 3TIUA 1WA5A 3O8CA 2FEMA 4IC5A 1G291 1AKSB 3VNUA 1G3BA 5G4BA 3RRNA 4IJMA 2H9HA 3I5XA 5JJLA 3TGKE 1O3LA 3GLGB 2EFGA 5K8LA 1DOAA 1CS4C 3HYTA 1GTVA 1UCYK 2GZHA 4RCYA 4CH2B 4M8NE 1QB1A 1UVOA 5D3QA 1NPMA 2UUJB 2PTNA 2AFQB 3O8RA 3GEEA 2Z9KA 4DB2A 2HGTH 2OSBA 1KXBA 1WV7H 5DNYB 1FN8A 3VKGA 5KDOA 2ZF0H 1E2PA 2UKDA 2ORIA 1KSNA 2ZCHP 3TK6A 1D2NA 3AVYA 4YONB 1V2KT 4QKQA 2J41A 2RH5A 3ZZ4A 4ZKNU 3I1FA 4BLPA 3K70B 3E8LA 2QROA 3AKEA 3AUXA 1BHXF 1FIWA 3LH3A 2ZCLP 1UO6A 1VECA 1QBVH 2EI8A 4TSFD 1C9PA 4US1R 3E2IA 1SGFA 2ZA5A 2J7PA 3NKVA 3BAFA 1SGRE 3W8RA 3A8DA 1HV8A 2OM2A 2AFIE 4O3TA 3CP7A 2PBRA 1QQ4A 3BRWD 2QBYB 4C9BA 5EU8A 3I61A 2Z9LA 3OEHD 3NXPA 5C2JB 4PC2A 3E1XB 1NMXA 3QLPH 2W5EA 4AFZA 3Q76A 1ZIPA 1Z8RA 2AIPA 1FQJA 2A7JA 5AF9H 3CR7A 4KFSA 5LBIA 4A8JA 3M1IA 4C0HA 1T32A 4XWKA 3VB6A 1KK3A 2J87A 5E2OA 3BFXA 2CN0H 4ZPXA 1E9EA 4W5HA 2CMKA 4HAZA 2QXGA 3TPIZ 4EJSC 2AGIX 1VJAU 2ZHQH 1O37A 3I77A 4U30A 1F3OA 5LGOA 3AKCA 4ZCMA 1HJ9A 3BB3A 2AKYA 3KTAB 2WPDD 2HEIA 1C4U2 4DT7B 2XNIA 4PC3A 1TADA 1SVLA 1Y3XA 3LBNA 5EE3A 1PVOA 3T28A 1EX6A 5BYKA 4KITB 3QJYA 1A3EH 3A1WA 2P8OB 1XUGA 3BH7A 1R0XA 1PPCE 1BQYA 1VCQA 4PFSA 3WNDA 1DXPA 4OI4A 3H86A 3RXKA 1D9XA 3UUZA 1GJCB 1Z6AA 1ZPZA 1W7XH 1L8QA 4LHZA 1EQ9A 1MH1A 5JMTA 2ZSEA 3QXCA 1MABB 1WF3A 3NBYC 2ZGBH 4XFQA 3QKRB 1CR1A 1OIWA 4P4SA 1O39A 4LGMA 3H2YA 4ZI3A 4F4JA 4KTCA 1V2LT 1C5YB 1NY5A 1LF5A 1HXEH 2HLDD 1GL0E 5AR1A 4BFZA 4GMXA 4I99A 1EAIA 3ZVCA 2Z4SA 3SOSA 4RZXA 3OE7A 3UWKA 1KDQB 4FCWA 2ZGJA 1BMFD 4I1SA 2AIQA 3I3SR 4M9FA 3WP0A 2F9VA 2IYXA 3GOVB 1FNMA 2D2EA 4G5SA 2CHAC 1CBWB 2Q6GA 2VP2A 1S1CA 5J5CA 1E9SA 1TBQH 3NK8A 5TJXA 3R7WA 3UMFA 1DAHA 4GP6A 1PYTC 4O97A 4S35A 1YPEH 3SJ8A 5FL3A 2QAAA 3QKUA 4JLDA 4YOGA 2RGGA 1E6CA 5KUTA 5JYIA 2O8CB 3D49H 2XJ9A 3V3MA 1NVUQ 1EATA 1VZQH 2KB0A 2CNWA 4NZLA 2STAE 1RRPA 1THSH 3OAAD 3SFVA 1SB1H 1GWAA 1QHGA 4Z8XA 1G18A 1K1MA 2P0EA 4MITA 5T6GA 6ESTA 3GISB 4D4KA 4QG7A 3PEWA 2WZQA 4GBMA 4B3BA 4CHAC 1JPJA 2TGTA 1WP9A 1DWDH 1ZTKA 4PSVA 1UTNA 4NCKA 1RD3B 2VWLA 4GZMA 4XVUA 3Q85A 3V7TA 1R0YA 3M3TA 1PJRA 4NP6A 1Q31A 3KJHA 4DIIH 2VBCA 1S84A 1YCPH 1N5IA 5AUPB 3M5LA 4CR9A 1MO4A 3JVVA 3P20A 3PEUA 3BTME 3GLFA 4IBLH 4DCNA 1QHNA 1HRTH 4FUDA 3FMOB 4MVNA 4UNPA 4K81B 4K5ZA 2FWWA 1FOEB 1O30A 3SQWA 1O2QA 3KDSE 1P62B 2VSOA 3SNCA 4M53A 1CR4A 3M7QA 4XBDA 1T0JB 2CDNA 3BTDE 1GVNB 1N5JA 4J1YA 1HT1E 3OIVA 4O03A 2Q3FA 3SW2B 3C7KA 4JSYA 2D26C 4QGAA 1Q57A 3VQTA 4NTZA 4DLZA 1EOJA 3CO5A 3ZJYA 2C8ZB 3S7HB 4KYIB 3LIWA 3PITA 4RKFA 1NRSH 1OX1A 4BECA 2WIAA 5L30H 1A82A 2BKEA 4AKHA 3CRQA 5ANRB 1N6IA 3NTUA 4LV8B 2UUYA 4JLAA 2IS6A 4PAOA 1EZQA 4Q7LA 2UZIR 2XCFA 1JB1A 3FYHA 3ZD7A 5FAHA 4RVCA 4DDVA 2BVSH 1EB1H 2ZJOA 3KXIA 1JXPA 2B9LA 1S82A 3A8BA 2EWVA 2JLYA 3P27A 2C8YB 3ZV8A 4FMCB 1QR3E 1OXVA 1EAWA 4JBWA 4B43A 2XYAA 3SJOA 1N5LA 2IA5A 4UFGH 2WAYA 1E69A 1BJUA 4Q80A 1L1JA 2AGEX 5C18A 1KOFA 3QXHA 1XD8A 1XU4A 3RC4A 2G5NA 3SHCH 2OG2A 3BTHE 4ABDA 2OHFA 1ZINA 3DFLA 1XBTA 3RM0H 1GL6A 3G82C 1A2KC 3NCLA 3KQLA 2EYQA 1S83A 1AQ7A 1F60A 3ZVLA 1V2PT 3H0KA 1NC6A 3U61B 2RHDA 1MTNB 1BA8B 4G5RA 2FFHA 5HR5A 4V02A 4NZYA 2BMGB 1C4OA 2OD3B 3K6YA 4QNRA 3UG6A 3ZD6A 4MKIA 1ESTA 4LZ4B 4CZ2A 2VPPA 2D1JA 3NVAA 1GRQA 1Q21A 3MWKA 2PMKA 3FDIA 3HPRA 3GY3A 4ZHLU 4OGYA 1XX9A 3RXAA 4DKXA 2ECKA 5A0CA 3BC1A 3UMSA 2V0BA 4CT5A 1TB6H 1BTHH 2X2FA 3GLHA 3OTPA 3NBZC 3K2UA 1O31A 1Z6JH 1II8A 4M9QA 3GY5A 2D62A 5JI3E 1UVSH 3P6ZB 2QTVB 1NG1A 2C2HA 3P4YA 4URXR 1G3DA 4EPVA 1YYY1 2STBE 1GI7B 5B6OA 4IS5A 2ZSBA 4ACAA 3T5GA 1V43A 4L4UA 1F2TA 1ZGIA 1VITG 3BTGE 4A6XA 4JT2A 5A09A 5H70A 2WJVA 3CRW1 4IN1A 4QM7A 1YRAA 2Z5FA 1T3HA 1VPLA 1XF9A 3I92A 1SVWA 4XIGS 1J2JA 3RC6A 2ZFTA 3J81k 2E1RA 1MD8A 2VO1A 5FL7A 3RP2A 3Q5EA 1CJMA 4HB4A 3IQXA 1U6QA 2Q1JA 3S7KB 1C2KA 1W5TA 5JZVA 1O3OA 3T2NA 1Y3UA 1GDUA 4UFDH 5EXNA 4ZH8A 1AMHA 1XXHB 3Q3KA 3VAAA 1ZBDA 2JJ2A 3AVXA 5FX5A 4BTIB 4Q1EA 2WWYA 2IW3A 1E36B 3LX8A 4X1NU 1C5ZB 1LDTT 1P04A 4CHAB 4D9QA 6Q21A 4E07A 1PLKA 3AP1A 1U9IA 5CM8B 2ZU4A 4UFFH 2Z6BD 5AK0A 2V35A 2ZS8A 1SHKA 5AFZH 3M36A 2WPHS 1TBZH 3EAQA 3I72A 1NRPH 2ZVQX 5FUYA 1HXFH 4HAUA 4DRZA 5CE1A 2NU4E 4EFLA 5L3SA 1C2GA 1EGAA 3LA6A 4Q5IA 5KDDA 1GBDA 1UBGA 4RD0A 2B21A 3KQEA 3TK9A 3P32A 3OX7U 1ELFA 3IG6B 3A8CA 2BEJA 2ZUDA 5JBTA 1K1JA 1Z08A 2WWIA 1IQIA 4I81A 3EWAA 5F03A 1NRRH 4ABEA 4A1FA 4BAHB 5FBVB 1H8DH 2ZFQH 4XD7A 3FP6E 2B7DH 2ZHEH 3A89A 2F9BH 5DG6A 1O5GH 1P06A 4YM9A 2GD4B 4JCNA 3SJCA 1ZU5A 2I3BA 5GVSA 4M1TA 5C5NA 1ZD8A 5E0GA 1LKBA 3QPUA 2YNBA 3CNNA 1YQTA 2IYSA 4Q4LA 1Z1JA 2TGDA 1XJQA 4PQFA 2P5TB 2ZEBA 4BZPA 1B5GH 3ZZ7A 1KI9A 4ASUD 4YMSA 3F6UH 3DKVA 1NVVR 3AF4A 4LK2A 2Q9BA 1GVLA 1YGCH 1W4BA 3CWQA 1OFUX 4AZ2B 3BTKE 1O2UA 4Z1MA 2VTKA 5KSPA 1ZM2A 3NDPA 2RG3A 5HGGA 3FFGA 2GXUA 3MO9A 2FGKA 3WYFA 1AVGH 3RMOH 2BVRH 2OZEA 2O0HA 3K9NA 1WSSH 2GILA 4ABGA 3RDPA 5HZKA 3LH5A 3A4MA 3STJA 4JLJA 1R0ZA 1GG6B 1KY3A 2HNTE 2QA9E 3SU1A 1RYHA 6GCHF 2ZTYA 1NN5A 2GXAA 2VVCA 3KFXA 4RD1A 2GCHG 4Z1MD 1KNXA 4C0AC 2Z94A 3LU9B 1LHDH 1OWIA 1COWA 2PT7A 3ZGXA 4B32A 1WCV1 1YCPK 2VH5R 1Q12A 1IXSB 4Z0KA 2D2DA 3GLIE 1C1RA 1W49A 3PCRB 2BXTH 3GQBA 4AYXA 2YNAA 1P9WA 4MRRA 2HJGA 1U0JA 1RS0A 1Q0UA 2AS9A 4XJXA 3RSLA 2BM1A 2PX0A 3QEJA 3DMDA 1W0JD 3F9FA 1PQ7A 3PVSA 2FP7B 4I31A 2G9NA 4OQMA 1MQ6A 1F7ZA 3QIAA 1QBNA 1M34E 3P8GA 1SKQA 3IQWA 3DL0A 1OWKA 1DG1G 1O2HA 3THWA 2HWLB 2UUKB 1G4AE 5JI2E 3LGYA 3LFUA 5DJ7A 1KMHA 1UK4A 4PHTA 1X1RA 1JWTA 1XUJA 1HDTH 4PO8A 3BGWA 4F4CA 2ZS7A 2HALA 4PPFA 1L2TA 3PM3A 1WOFA 3BIVH 4CW7A 2FSIA 1MKWH 3MOCA 2ODYB 1TMKA 2V6JA 2YOGA 1IQGA 1YPGH 4KGAA 3SFZA 3V4RA 1NFYA 3VKHA 3SJBA 2CV3A 4TYNA 1GBMA 3IEUA 3V12A 4RFSA 4TYDA 3BK7A 3QTOH 2NZJA 1Y5BT 1KI4A 5BQ5A 1PYTD 5JS7A 1D4PB 1W2KH 1IQJA 1KXAA 1LHCH 1PPZA 3HPTB 2PFEA 2CVHA 1EPTB 4UJ5A 3W90A 1MR3F 4Q00A 5AHGH 2J0QA 2OILA 4UD9H 2W58A 4V03A 4OS5A 3T1QA 2RAPA 1PZNA 5DI9A 3H09A 4HEJA 4Y0ZE 2GKSA 3VX4A 2C3SA 1HAPH 4D9RA 1UVPA 1W4CA 1Z7KA 1C5OH 2YYZA 4KODA 2UWPA 4DUGA 1FY3A 1BMAA 1H8HD 1QRAA 1GP2A 3UWOA 1O3KA 1MMJN 1A2CH 4MTBA 2ZEJA 4G5QA 2P67A 3NDBB 3FKSA 4TL6A 1OYYA 1ZTJA 4BFSA 4ABYA 1H8IH 2CLCX 1O5AB 1V3XA 3MH6A 1FFHA 2OQUA 2PTCE 4BANB 5DP7A 1O5FH 1GHXH 1NVVQ 1SVMA 2ZUCA 3QVVA 3LQQA 2C5LA 1OH5A 1W44A 3MH5A 1VCOA 3LX5A 2AGGX 2WICA 1ZVQA 1AGPA 1EWRA 1CR2A 2Y5GA 1LV7A 3S9CA 3ATIA 1FZQA 1GHBG 3T27A 2FA9A 2ZDVH 1YKSA 4ARZA 1AS0A 3T61A 1ZM4A 1YR9A 1FXYA 1COWD 5KU1A 1Q1QA 4WZ6A 2FESH 2RA0A 2WMOB 5DIFA 2ZFPH 2Q3MA 2BQ6B 3IIMA 4JLNA 1X1SA 2ZI9A 2BVXH 5EE9A 4EQ6A 1BMMH 1D3QB 3T15A 1KXFA 3GJ6A 1G3MA 4Y0AA 3THYA 3MLEA 1XJ0A 5T6DA 3X1ZA 2J4IA 5A8YA 1O2XA 2HPQH 2R6GA 5GADl 4MGZR 4BEJA 2F9LA 1CHOG 3NC0C 5JB9S 1OIVA 5DI3A 2IOTA 4Q01A 4ILEA 2LNCA 4JZDH 1K28D 4KELA 3SV8A 2ZI7A 1LTOA 3EAJA 1ZNZA 4AG5A 3RXMA 3F68H 3B6EA 4XSKU 3SBKA 2H5CA 5E8EH 2HJVA 3PV5A 4ZHAA 1OOKB 3DD2H 1UTLM 1FAXA 3U98H 3CWZA 1WYKA 2D06A 3S1AB 2D7CA 3IITA 2ANBA 3B9QA 3KXKA 1SLUB 3BV9B 3EYDA 4MKGA 2Y81A 4ISLA 3B1XA 5DP9A 4PHFA 4JLBA 4D25A 5TMPA 3EZ7A 1V2OT 3SUDA 3B1WA 2PZFA 1HBTH 4NIXA 1F5RA 4JLVA 5CIWA 4BFXA 5FPSA 3IDQA 2B7BA 4WY3A 2AKAB 3EZFA 5LH8A 5FI0B 1MCTA 3TK1A 2VINA 5E3HA 3PMBB 1BHXB 1TNJA 1C1VH 1F0SA 4OS4A 2JLXA 4FUCA 1J90A 3EDXB 2W3IA 5C1UA 5BRRE 1U0LA 2ZTSA 2WINI 4AORA 4HDCA 5C46F 2C93B 1O2JA 3LONA 4DDTA 4PPNA 2GJ9A 1E4YA 3F9HA 1GPZA 1V2WT 1XPUA 4GVUA 3VXEH 4ZCLA 2IC5A 4X6MA 3GJ5A 4IC6A 5FFMA 2XTZA 4D80A 2ATVA 2B0FA 1HNEE 1NRJB 4I33A 1NBME 4OQLA 2GAAA 5AJWA 1OHHD 2Y8EA 5GPIB 3E5HA 3NWUA 4LPSA 1XXFA 4DJTA 5CLLA 2FMJA 3FKSD 1G6OA 4LJ8A 4CEIB 2AD5A 5DP8A 1UTPA 2N42A 4TLEA 5CK4A 1S85A 4JYUH 2XITA 4YTAA 1DUEA 1KSHA 1ZMJA 2ZRPA 1A5HA 2EA3A 3RMNH 4D81A 1JXOA 2ZETA 1GCTC 2WWXA 4Q4JA 3K09A 5L2ZH 3LAWA 2ZE6A 1TABE 4NCJA 2RHMA 5GDSH 3PWBA 4AG2A 3F3YA 3AEZA 3SHWA 1XKAC 2FG5A 2GF9A 4DCUA 621PA 1IBRA 2G3YA 2ZU2A 2QRZA 2QF3A 3LVQE 1CA0C 2PUQH 1X8KA 4BFWA 1QB9A 1CRQA 5DO4H 4W7SA 2JASA 1TX7A 2O8FB 5BPEA 3GY7A 4NKRA 2TIOA 5I25A 1QZXA 2J7PD 3X1XA 3SNBA 2PZGA 2NG1A 3T5FH 3IIJA 4WMDA 1O2VA 5TCAA 1UJ1A 3FHCB 3QKRA 3BF6H 3K0SA 4BGDA 3EIEA 4WBSA 7ESTE 1KI7A 1FL9A 2ZGXH 3ITIA 2GEVA 3HP1A 2QTFA 1AGJA 1KZ7B 1XUFA 5E2PA 4URYR 4Q2KA 4FN5A 2ZP0H 1VG0B 1IONA 1KDQA 1Y3YA 1TQ7B 1QF9A 3TW8B 3RXUA 2H1LA 2KWIA 1G4UR 4DB4A 2BMDA 3ZIAA 2O8DB 1BOQA 1PPFE 2VA8A 3M4YA 1C1QA 2QZ4A 1ZMLA 1QVAA 2VP9A 3BJIC 4HSEA 3AVPA 3OEED 4M4SA 3LRPA 3MCAA 3ZLJA 2FOHA 1DS6A 4MYUA 3ZQ6A 3ZZUA 3L0PA 1FN6A 1GBHA 1SPJA 5F9HA 3CH4B 1U99A 1W7GH 2PZEA 2ZFSA 4Q4HA 5KHOC 4MGIR 3SYJA 4PQYA 4TTPA 4WMFA 1QBKC 3EIQA 1QFKH 1E9DA 3QNUA 5F8TA 2OXSA 3AVVA 2C78A 2C98A 3E3TA 4LY6A 3PV2A 1CHOF 4FU8A 4QHSA 2DE9A 3KCGH 1P5ZB 2P8OC 2GP9B 5C4GB 1OWJA 1JRSA 1OFHA 2XC0A 1S3SA 2BMJA 3V4FA 3LT3A 1DXWA 3N70A 4HAWA 1KI3A 5IHPA 1QHHA 5JSZB 2QY0B 1P2TA 1CJKC 1FQKA 3TIFA 1LPKB 3UR6A 1F5KU 5DO9A 3RXEA 2R44A 1O2WA 4FUEA 1T8UA 4D4JA 5C20A 2EFHB 1MRSA 1CA8B 1NLFA 5FPKA 1FY1A 2EFCB 4Q4JB 4NDZA 1Z0FA 1QL7A 2J45A 1TAGA 1DICA 3ELAH 3FHOA 3E6PH 3OHMA 5FUVA 3LC3A 721PA 3GLHE 2QGNA 4HB3A 1R0WA 3STIA 2YWGA 1BMFA 2WYGA 3CR8A 4E5UA 4OKSA 4KXFB 4PROA 1P2OA 1PPEE 4ZAEA 5EE5B 1LVYA 1XWIA 4MGYR 2DFLA 3G5UA 1A7SA 1M8PA 4PHGA 1J8YF 1LQEA 5IDKA 4ZKDA 4M21A 1KYNA 2J1LA 5CB6A 1OPXA 3ZVFA 1P0SH 2VSXA 1P2NA 2DCUA 3MRSA 3PUYA 2H8KA 5A0BA 5JEDA 1KDOA 2WJIA 1KXEA 3MNCA 5CM9C 1VG8A 5CJPA 4BAMB 4ZHMU 1ZJDA 1T9HA 3RS4A 3RMLH 3MWJA 4P32A 2JDID 3DDCA 4NPHA 4Q9LA 4BNRA 3QF7A 2R6AA 4DCDA 5JECA 1GBLA 4Q4AA 3W5JA 5A5GA 1ESBA 1DT2A 4FMCF 1CLUA 1E37B 2QT1A 2LPRA 1RRGA 4QJ5A 3WMFA 3SGBE 3A7WA 4CVNA 4ERNA 2BHRA 2JLZA 1QJ6B 2XCNA 2A30A 2ZI5A 4HATA 1Q1EA 1Q3HA 1TIOA 2ZS9A 1RRFA 1EUFA 1O2ZA 3D31A 3VHXA 1G5RA 4NH0A 3CF6R 1WBDA 2J7KA 2QTHA 3K0FA 3A82A 2ESTE 2WPLS 3PYHA 4CEJA 1P2IA 1S81A 3THXB 1FY8E 1W8BH 3VNVA 3QVUA 4B2LA 4CGZA 2JLUA 1BZXE 3MH7A 4ZO4A 4TMXA 3C5CA 4Q48A 2AL7A 2FN4A 4LC1A 3AVOA 2G00A 2A31A 4K8BA 2RGNA 3WY8A 1NFWA 3FPAA 2VYFA 1JJVA 5JSZA 3M6AA 3SBEA 2QA5A 2X77A 1GSIA 1HJAB 1NMZA 2VU8E 2Z3CA 4DSTA 2BOKA 1AN1E 1D3DB 1V2JT 2RCEA 4ZDJA 2CJWB 3ZVNA 3VR2A 4RCZA 5AJVB 5J4QA 4JKYA 2GJ8A 1AVXA 2J0UB 1T0HB 4LSGA 3Q00A 1C5NH 2Q6FA 3GPLA 2QNRA 2QAJA 4X2WA
chains in the Genus database with same CATH superfamily
5K8TA 3G8DA 2C54A 4EZEA 3VYUB 4XWOA 3GLFE 4FWTA 4HXFB 2A9VA 4D9CA 4ABHA 3OHPA 3GFPA 2EGGA 3ND6A 3EXG1 2F64A 1MDBA 4O2BB 3JZMA 4P98A 4QIHA 4Z7OB 1NXVA 5JRDS 3IFSA 1R9NA 4HGQA 1SLWB 4HP8A 2ULLA 3ZBQA 1D9IA 1V3QE 3OTGA 4Z8YA 5GOZA 4CIVA 4YUXA 2CZCA 2GWHA 3HKJB 2RHWA 3GBPA 4E3WA 5KB3A 1NOIA 1VSBA 3LDXH 3LNCA 4W9NC 2OXRA 4DEYA 1LS1A 1PGNA 4V2IA 1ZR0A 2CD7A 1G1MA 1G32B 4CRCA 1G98A 5M29A 1ID8A 3FZGA 1N25A 2FI5E 5BN3A 1LZKA 3PQFA 1T0BA 4HX9A 5CLQA 4RD3A 1WAYB 2AIRA 3KAPA 4Y2QA 4F4FA 2DJIA 1UMDB 2Q3EA 1FBNA 4KOEC 1XDZA 1UT8A 3QUCA 4LWOA 4NMWA 5CDFA 4X91A 1PUJA 1RI2A 3CVOA 5HRAA 1WB9A 1GY8A 3L4BA 1NM5A 2WU4A 1R64A 4P6VF 1DX5M 2IWRA 3D3NA 2GM3A 2OK5A 1AFQB 1M7HA 3CF0A 1V5WA 4EUKA 4IDDA 2ZDMA 5HM2A 3VB7A 2PIDA 4OU4A 1SC3A 3LM8A 5K0LA 5JMPA 3T1YB 2G1UA 1AD8H 4C0JA 1TZKA 1ZN9A 1FU8A 1ZK0A 2C8JA 3GOQA 1QV7A 3UMJA 4XM2A 1OZHA 1SXJB 3CLUD 1P09A 2XW9A 4PRLA 4O4IA 4XIJA 5E8JA 4LJRA 1XTUA 3ZZ6A 3TLAA 1E59A 2BHLA 5DM0A 4LW8A 3EFBA 1SUCA 3G2PA 1LW7A 1UKYA 3ODDA 3VI3B 4AZVA 1CUFA 1DADA 2PZMA 2C9YA 3IDZA 1M7GA 1ZOMA 3LECA 3WAKA 3KDPA 4IRUB 2OBBA 4UHHA 1T1RA 3KLNA 3M81A 1IEXA 2YHSA 1Z8IB 2PGQB 2Z2KA 4RADA 4RU1A 4TUYF 1F92A 4F6RB 3VI4B 4TUYA 3UB3A 1JDVA 2C99A 1SUAA 1D1SA 2F3PA 4LTNA 2BUBA 2XZLA 2O8TA 2R6DA 5G1OA 3TLCA 4NNOA 2FZ4A 5CIQA 5D2CA 1BTXA 5A9SA 3H5TA 4BXWA 1EX1A 6NULA 1IULA 1RQPA 3Q7PA 4EAQA 2R1ZA 2XUGA 5KCZA 1LB1B 3RS7A 3E1SA 3WQRA 5HTOA 2J5RA 3JD3A 4M9RA 1D4ZA 3ZHBA 1ZJZA 1FMCA 1XEWY 2GK6A 2X2OA 4KR3A 5EMKA 4X1SU 2CB0A 2F9UA 1DC5A 3R5HA 1THRH 4ZAVA 1QFXA 1AE1A 1C1NA 2M5TA 1ZYUA 3G9ZA 4YRBA 4FDMA 2EDAA 5FEMA 4DDKA 4EGFA 2P6PA 2ZBDA 3I6QA 3KHKA 1RM4A 4W4TA 5L2YH 3CLUC 4M1QA 4AZTA 3U8OH 1WZCA 1PHRA 4YOJA 1MN6A 5CUQA 5IP5A 5JSHA 1BH2A 3QVSA 3IESA 3VU1A 3PDIB 1P61B 3AB7A 5ADUS 3P96A 3R3JA 4W7IA 4B9AA 1RTLA 1Q20A 5KYUA 3ZBTA 4A5SA 3MU4A 1E58A 4ZTBA 1DKUA 3FI9A 3AW9A 3OY2A 1C9KA 5G4KA 1YDEA 1ZU4A 3UMRA 1T5OA 1P0IA 5JJCA 3U56A 4X8MA 4H6WA 4RHXA 1E5XA 3QPAA 4GPEA 2C4HA 4DGQA 2WHYA 1KTVA 4FI3C 3DNFA 1VYTA 1P2QA 1X15A 2PUXB 2CVQA 1OYWA 2XF2A 3EIHA 1HUQA 4X44A 2RB5A 1OJLA 1Y81A 2ZJ0A 1H66A 2G4TA 3NHKA 4KTTE 2FR8C 3RLFA 4DWVA 3LKVA 3AF2A 4P35A 1FNBA 1Y7PA 3MWGA 5F1YA 5G41A 4FEAA 5IYZA 5CGQB 3OOHA 3IKVA 4KR7A 1M1NB 1OC4A