4B73A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
total genus 209
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b73A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b73A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b73A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b73A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b73A03
2VF7A 2EEKA 3AW1A 3ZZ5A 1EESA 4UFEH 1Z06A 2ZU0C 3L2OB 3T26A 3ODFA 4Y0AA 2ZEBA 1II8B 3ZVCA 1GHAG 4L9WA 3CS7A 3TH4H 4HGCA 5T3HA 3GFTA 2HDNB 1GMHG 1Z0DA 1S9HA 5J4QA 4A1TA 1IJEA 4OS6A 3OY6U 2ZCKP 5ANRB 4MGIR 1V2MT 4XWOA 1Z6XA 5L3VA 4Q5IA 4HB4A 1U8YA 1NLYA 2A32A 4AN7A 1NN0A 2PKAA 3W3ZB 1ETTH 2QENA 4PANA 2C8XB 5DNYB 2ZR7A 1I4LD 2P16A 2Z9JA 1GHAF 1NPMA 5LD2B 2ZUBA 3TJUA 5F98A 1KK3A 2OESA 4GVUA 4OQFA 4BEJA 3GYLB 1KMQA 2JJ2D 1YHNA 1XXHA 1KIMA 3PV0A 1RVDA 4LJAA 1BTWA 1UTJA 4A36A 2CHAC 1TF2A 2OP9A 1R2QA 5EP1A 5TARA 1E9FA 3L3TA 3EC1A 5G4BA 3HR8A 2GEUA 1JJVA 1P3JA 3W3AA 2LCFA 2ZRFA 1T4GA 2KBEA 4LHVA 1WTGH 3CRQA 1JAIA 3SU5A 1ZNZA 2UVQA 5AJWA 4QL3A 4AKEA 3Q72A 2VBCA 1BRCE 1NMXA 2YWEA 4JLBA 3W8NA 2TMKA 3AK5A 1FZQA 4KFSA 4TMKA 4IDOA 1FJSA 1O3JA 3BFKA 3GLFA 1GZSA 4EPTA 4GAWA 1RKBA 2G4TA 5DG6A 1E6CA 4PFSA 2GCTC 3A87A 3LT3A 2VIIA 1P03A 5J4VA 2YOLA 3KQNA 1G16A 3A88A 1Q1ZA 2W2TA 3JVUA 5EZ5A 1HJ8A 3BFXA 1CIPA 5FBRB 4I8HA 4JLJA 2F9MA 3QKSA 1ZNWA 1V2OT 1DANH 3PUXA 2ODNA 3FKSA 1HE8B 1TEXA 2J0UB 1PLJA 1AE8H 5PTPA 3RMNH 4L16A 4CW7A 1G3BA 2GXSA 4CYMA 3F9HA 2J7PA 4YT6H 2QXHA 4ZKSU 2GVDC 4FN5A 3SQHE 1DWBH 1O36A 1DY8A 3UR6A 4JLKA 2GCHG 3SNAA 3H4MA 2G51A 3B1XA 5DGJA 1YR6A 3QKTA 2IEYA 2O8EA 2SGDE 1JQJC 2QGNA 1A7SA 1Z8IB 1ACBE 1GG6B 4NA9H 4AGKA 3GJ5A 4JVLA 5JECA 1FIZA 2Z9LA 1UBGA 1HXFH 1NSTA 2B5TB 3VQTA 2IJOB 3MCAA 3V3MA 1G8HA 1N8OB 5CJ2A 3DHWC 1UEIA 1Q0UA 2QA9E 2R44A 3SNBA 2AYWA 4MQBA 2BZ6H 1D4PB 1UCYE 1JEDA 1TUIA 2ZFFH 3LNCA 3GLIB 1QDEA 4PC2A 1Z0FA 2ZG0H 1ZU4A 4JVNA 4DEXA 2JLWA 2ZRLA 2WAYA 1VYTA 1P2QA 3X1YA 1LNZA 2XSZD 3W5IA 2ZPRA 4OS4A 4FCTA 2BLQA 5L3SB 1HFDA 1KXAA 1S81A 2QXIA 3SE0A 2FX3A 2ZGXH 2Z83A 1EASA 1E34B 4NZYA 1T91A 2Q3HA 2ZSEA 1LVOA 5EE0A 4LUCA 4Z8XA 1K22H 8OHMA 3SQWA 3HU2A 4M1TA 1UVSH 3MH7A 1Y59T 4HUQA 3B1ZA 4W9MC 3E91A 3LGWA 3SJ8A 3EWSA 1WP9A 3OTJE 2F1HA 4CH8B 4JMYA 3TJOA 1MO5A 5C20A 2QL6A 1QHHB 3VR1A 3MMPA 1N6RA 3EIQA 5EPYA 1NESE 1KKLA 1AQ7A 2ZU1A 2AXPA 3AF3A 2REXB 1HXEH 1T7CA 1BTPA 2PMKA 4BUJA 1TRMA 3OIWA 5EP4A 1A7JA 3BGWA 1OSSA 1MAXA 4CREA 1CLUA 1CJMA 2JDID 5CIWA 4FWTA 3GJXC 3W9YA 4JZKA 4N0DA 1VGCB 4JVSB 5EXMA 3AKEA 3UG6A 1O2RA 4GCHF 3IEUA 3P8NA 2HPQH 1YRBA 1W7AA 2EW1A 3U8RH 2FXRA 4OK3A 4M0LA 2PKAB 1JI0A 2WVJA 2ZZUH 2RDLA 2W6JA 3CW2A 4X8OA 3CIOA 4ITRC 4BE7B 2ZRPA 2ANWA 1NG9A 2RAPA 2B8OH 1KDRA 2UZ3A 4K8BA 1COWD 4FCVA 1G8FA 1NVUQ 1PPZA 1C1UH 5GCHF 4XDEA 2WV9A 5J40A 5HTKA 4RCYA 1ANCA 4HB3A 3BG8A 4OQNA 4DIIH 1PQAA 4FUBA 2RKOA 4XBBA 2JLUA 2YINC 3PLBA 1E69A 3PTBA 4RSPA 4EFNA 4DOQA 1HGTH 2P3SA 1ZIOA 2CJWA 2H57A 2HNTC 4FMDB 3R9IA 4LBVA 1XBTA 4NG9H 1ZYUA 1T9HA 4PSVA 4K1TA 1ELBA 1CR4A 1XTRA 1TADA 4PC1A 1C9TA 1GBKA 1HPGA 2LPRA 2AX4A 2UWOA 1OP0A 5CMXH 2P8OC 1GJAB 2XB2A 4RD2A 2GTPA 2Y81A 1Q1BA 3MU8A 1YR8A 2VGCB 5C2ZA 4DCDA 1C1WH 1QVAA 3FYHA 2WAXA 5M04A 4B71A 1THRH 2ZTZA 1W36C 1DE7H 3K0AA 3LGTA 2O8MA 1AZSC 4OHWA 4ZPXA 2FPKA 5KNBA 5HPYB 1C5NH 2GZ9A 3RMMH 3GCTF 2ORWA 4MNXA 3AKCA 1G36A 1G7CA 2P67A 3NHAA 3VGCC 3QTOH 3AF0A 2O8LA 2XWAA 2ZI4A 4ZDKA 4LGMA 2AXNA 2FOGA 1G3CA 1W4RA 1FN8A 3PCRB 3SU8A 5IHPA 1Z08A 1L4ZA 4BTUB 1RIFA 1TBRH 2FSFA 3X1XA 5G40A 4YM9A 1LHEH 3SUGA 3T1VA 5GWZA 4NFFA 4DRZA 2QN6A 3EWAA 1WXRA 3BB4A 5BYJA 2E87A 2ZI6A 2I6SA 1WBGB 4BFTA 1W36B 1IY1A 2ANMH 2EWWA 1AU8A 5DP5A 5FTJA 4MRNA 2REBA 1XJCA 4I81A 2YWGA 4LHWA 1OS8A 4X8TH 6LPRA 1XTSA 2UZIR 3PMHB 1QG2A 4M9QA 4PO9A 3MU4A 4TT3D 4TLCA 1KSGA 1BB0B 3S1AB 2GDEH 4BLRA 1P05A 1GBIA 3U3KA 2QGZA 1ZMJA 1VG8A 5C4GB 4TSFD 2FO9A 1E2EA 4OS1A 2A5IA 3KL6A 3A7VA 1HH4A 4CIDA 3FP6E 1G30B 1OYTH 5LPNA 1P2OA 3FKSD 2ZI9A 2HUPA 3CH5A 1RXPA 4TY6A 5FX6A 4IXNA 2ZR9A 1M6NA 1P10A 1R4AA 1KSJA 2OC7A 3B8HA 1AS2A 4BFWA 2JLZA 3LQQA 1GBAA 1L2EA 4IDPA 1EFHA 1SQTA 4TLBA 2F4LA 2GK6A 3I62A 1W46A 4UFDH 4O0MA 3EPHA 2PR3A 1G32B 3NZIA 1ZRBA 1IQEA 2BMFA 3C41J 3QZQA 1Z22A 2ZP0H 2BBWA 1WXQA 1HB0B 2BY8X 2BIFA 2ZI2H 3SUFA 5FOUA 1C1VH 4XWAA 1KMHB 4UJ5A 4DY7B 1G8YA 2O8EB 2VWMA 2FOMB 1RS0A 3ZH9B 7GCHF 2IWRA 5BWMA 5TCAA 1RD3B 1OWHA 3SDZA 1PQ7A 2ZA5A 1AZ8A 4M7GA 1F5NA 4O03A 1MU6B 1IBRA 1CGHA 2ANCA 2GEVA 1J16A 2G9NA 3R0FA 3BTGE 5F9FA 1DS6A 3H84A 1EB2A 3NH6A 3SOSA 3BXZA 1S6HA 3RWOA 2QF3A 1P06A 1O31A 1MV5A 1D6WA 4YMTA 2PUXB 1GAJA 1P7CA 1INCA 1QA0A 2XBVA 3QXSA 2QAGC 3Q7PA 1DT2A 1NVWQ 1BJVA 1PPCE 4NSYA 3QE0A 4C0LA 4W7SA 1SBWA 2TGPZ 4LJ6A 2R0KA 1TA2A 2JGNA 1CULC 4Y0ZE 5EZ6B 2ERYA 3TAUA 3LWNA 2GJSA 1M34E 1P12E 1H9HE 1F5KU 1CTQA 1Z83A 1YZLA 5BPEA 3H1TA 4D0GA 4O3TA 2C4FH 1Q31A 3TVTA 1RW4A 3JZ2B 2VP9A 3MFYA 4QBIA 1W0KA 4V0MA 2F9LA 1TGCA 3EIHA 3MJRA 2GJAA 1OJLA 4D4KA 4DBLC 4A9AA 1LMWB 3A36A 4EPRA 2NZJA 3Q8XB 3AVUA 1P2KA 3GEEA 1V2PT 2Y82A 5SGAE 1E96A 4TWYA 3N5CA 1GILA 1ANBA 1F5LA 3D6TB 1TQ0B 3ZVDA 2ZE8A 1G41A 2R9PA 3P26A 1UJ1A 4Q7YA 5DGXA 1P3EA 3PO1B 3KKOA 2LKDA 1LPGB 1W48A 1S1CA 1N8OC 4E22A 2J45A 4CEHA 3EX7C 1G4UR 4IVRA 2A1DB 1GL7A 3SC3A 4Q1EA 5AHGH 3KXKA 3UOUA 2ZYVX 4M1MA 4PZLA 4GBMA 1C5ZB 1H9LB 3UANA 1OWDA 2JJ8A 4Q9KA 1VCIA 1K21H 4A0GA 5CYPA 5JWOA 1SXJE 2NGRA 3TK6A 2IPHA 1F60A 4ZCLA 3TGJE 2BVXH 3AAVA 2CLDX 3U7EB 1Z6GA 2NO0A 2RCNA 2WWYA 1DLEA 2XITA 1ZD1A 3MGCA 1GBHA 5AK0A 3E8LA 1BIOA 1DOJA 4UXHA 3P8OA 2CJIA 2IF2A 2VIPA 3EG5A 2A5JA 1B7XB 3NEJA 4GSYA 3TK5A 2HLDA 4HI3A 3I78A 1EJMA 3EAJA 1GI6A 2R9VA 2BJVA 4DKXA 2ZJOA 4DLYA 1YLDA 1YCPK 3VNUA 2XWBI 1CR1A 1QQUA 1TONA 3BORA 4LV5B 3SO3A 4Z1MA 4TYNA 2CNWD 2CHAB 1HJAC 2XJ9A 2RHDA 3FZDA 2AEIH 1QHHA 1O3BA 3BBPA 2NU2E 4YONB 1Z7KA 5KO2A 5HGGA 3M35A 5K8TA 2GXAA 1P9RA 3OEEA 5TVKA 1NF3A 4XIGS 4FW9A 5FBWB 4IW4E 2WWHA 1ZOMA 1GRRA 2DB3A 2D62A 1NN6A 1GCTC 4U00A 4ZCMA 4ZI2A 1V2JT 3ESTA 5E0HA 4KFUA 4WXIA 1VHLA 1JR3E 4UJ3A 4OHZA 1AVXA 2CDNA 2QRZA 1GWNA 1KZ7B 3M0EA 1W44A 3ADKA 2WIBA 3VKGA 1KXDA 4ASUA 3WNCA 3F9FA 4JLVA 3GJ4A 4Q47A 1TE0A 3K1JA 1HV7A 1UTKA 1RYFA 1DVAH 2AGGX 5JMTA 3U7GA 1VDZA 1DTSA 3CH4B 1GJ4H 2GHIA 3CRRA 3IQXA 3ZVAA 1Z2AA 1N2CE 2WOJA 2Q6GA 1HDTH 5EQRA 2RGNA 4V02A 1VYVA 1KJZA 4MRRA 1SVMA 1D9IA 1GJ6A 1GBFA 4MH0R 1FAKH 1XD2B 3BFVA 4O25A 1FAXA 1KI6B 4LPKA 2BMGB 2CF9H 5J5CA 4FINA 2J41A 3R9WA 5P21A 1FY8E 4KP0A 3UNQA 1CJUC 1RGQA 3VB5A 4I1SA 4JL5A 3SU0A 3LBHA 4B33A 3P92A 2ZTSA 2BBTA 1S1MA 1KI2A 3RXIA 3OX7U 3RDZA 1FFHA 1HRTH 1E37B 4FMCB 2XCNA 3CRW1 3ZV9A 3NCLA 4I8JA 1HIAA 4Y7AA 4X8VH 1N6KA 2F9BH 2KBFA 4KODA 1MD8A 3EGKH 2PJRA 3KTAB 5A2MH 1N6LA 4HEJA 2ZR0A 2V8OA 3WRYC 1E2KA 5AJYA 1GP2A 3SBEA 1UK2A 1O5CB 1GHZA 4R8TB 4U01A 1OKKA 4X8UH 2GETA 2VPPA 4MDSA 2JEOA 4CZ2A 1QQ4A 1XEFA 5J47A 3CS0A 6CHAC 3AW0A 3C5HA 4KSBA 1E2FA 4V0ME 1Y3WA 3KKPA 2LKCA 1C5WB 1G3IA 2Z6VA 4MG3A 1OFUX 2WYGA 4X8SH 4C2UA 1PZNA 3U1JB 3GMTA 4URXR 1EFCA 1PLKA 4IRUB 2ZXUA 1EWQA 4QFMA 3BTHE 1UKZA 2X2FA 4G5QA 1ZCAA 1YBWA 4PPQA 2QSYA 2OLGA 4XWKA 1SGIB 2VF8A 5G53C 1A4RA 1JIRA 1JEEA 2G0NA 3GLGE 1GVKB 5G41A 4GZLA 4GMDA 4M9XA 2NU0E 4DUGA 2NO7A 4IEIA 1YPGH 4YXWD 1X8LA 3I3SR 2HLDD 5FBVB 1IQMA 3P27A 3A7YA 2UKDA 1R0XA 5FL7D 1JR3A 4YLGA 5EOKA 3C14C 5KYKA 5TB5A 1TNDA 3FHTA 2Y7XA 4Q4LA 1BHXB 3VB4A 4HLUA 1GMHF 1WTHD 3BTDE 2WV5A 3K9GA 2OE2A 3AV0B 2WWIA 2YC4C 1RZ3A 1ELOA 3RXPA 1P2UA 2GJ8A 4D4MA 3PUZA 3LY5A 2GBLA 1W0ZU 3CKLA 4NIXA 3RXHA 1OYQA 5JSZA 1ZM2A 3TH2H 3A84A 1HQCA 3IBGA 3Q85A 1UVTH 2HF9A 3LGUA 2EYUA 1TAGA 3VR3A 3D65E 3RP2A 1WE2A 3PUYA 1LO6A 1OHHA 1K5GA 1UK3A 3LXXA 3MH6A 3VHXA 1HE1C 1O3MA 2BD9A 3CM0A 1L4DA 4XSKU 2B0FA 5FOXA 2AR7A 2QM8A 1SLWB 4KU4A 2BD5A 3FP7E 1C5VA 1I2MA 1AUJA 4BGDA 4F7WA 2BX4A 3P32A 1QRZA 3QN7A 2B21A 3MFJA 1SGTA 2WYJA 1XXHE 4ZI3A 5KOYA 4DCTA 3Q5DA 1FPHH 2P6UA 4M9FA 3FDIA 1ZYOA 2YKGA 4EDHA 1MO6A 4PQYA 4RKJB 3QOFA 4KTCA 1GDDA 2WPKS 3UNSA 1AK2A 1MABA 1C2FA 1GVNB 1IY2A 1H8ED 3JVVA 2GKVE 1TU3A 3F3YA 3TSZA 5JHHB 1BYUA 4I1VA 4B47A 1AJEA 3A8BA 2FFHA 4RKOB 4AFZA 3Q3XA 4Y8YA 3RLWH 4NMMA 2QMEA 4DT7B 2JLYA 3ZDQA 4XVQA 2QTHA 2A5DA 3QBVA 3THOA 1P72A 2BMJA 4IOLA 4NYJQ 2PZEA 1CBWC 1AB9C 4A1XA 4LXBH 3C15C 4L15A 3KQEA 3SGAE 5L2YH 1YZGA 4X1SU 2BM0A 2XNSA 2QT0A 3E0PB 2IC5A 1CA0C 3N70A 4TL6A 5K0HA 1FY3A 4B73A 4MNWA 3NXPA 1XMNB 4FUIA 1KY9A 1MR3F 5JI2E 4PC6A 1XZPA 3MRSA 1JBUH 2FFQA 3IHLA 1AS3A 2DWPA 3GP8A 3THWA 3ICEA 2HVXA 4PPGA 3MG9A 2YOFA 4LPSA 4F4CA 1ESAA 3SGBE 1W0YH 1KJYA 1NMZA 4UNNA 1SULA 3B1YA 1GI8B 3FZZA 3AUYA 1XPRA 5ELXA 2WINI 2H5CA 3I1FA 4Q4AA 1T4UH 2IJD1 1TYNA 5C46F 1OH7A 2I3BA 1IQLA 3SV2H 3AVOA 3EZ9A 1E2HA 2CF8H 3MWJA 1OP2A 4HYYA 1U0HC 1HY3A 4BZQA 1TTTA 3SZEA 4D9QA 2ZGBH 3UK6A 2CHQA 1FN6A 3T29A 1UFQA 3IILA 4MKIA 2Q6DA 1FNMA 2QRNA 5J4HA 1XXFA 1E9EA 3VPKA 1JPNA 1LQEA 1DAMA 3VB6A 2VSXA 5IK2A 4P33A 4MYUA 3R7WA 1T8OA 5CDFE 2C77A 5DHAA 4FU9A 1TGSZ 3GICB 2P2LA 1Q20A 1GDQA 4C0AC 4ISOA 4RCZA 3BIUH 4HI0E 4MPUA 2AS9A 4H42U 4OM9A 5DP3A 3KEEA 1XTJA 3TGIE 2ZYTX 1GG6C 4TQAA 4BEBA 1IQGA 1TMTH 3A8CA 3AEZA 4F91B 4IN2A 1A5TA 3NC1C 3NPSA 3AP2A 4LBYA 1VGCC 3KQDA 5D3MB 1S82A 2AH4X 3K0SA 1L4UA 3SJAA 2GKSA 1JQLB 4DB2A 2K1QA 5DISB 5JCPA 1PPHE 1NS3A 4YOJA 2J92A 2F83A 1W4AA 3CR8A 3SI7A 4FUEA 4JLAA 4P3YA 1O3HA 4R2HA 2P5TB 1L1GA 3KJGA 2ZFPH 4JBYA 1QY6A 4MRPA 4HAWA 3X1DA 1YM0A 1NZQH 2ZU4A 2OFWA 2Q1JA 4X2WA 3W94A 4UFFH 1UVPA 1EAUA 5EE3A 3UNRA 1XZQA 1D2MA 2V7QD 3NKVA 2UUJB 2H5EA 1MKYA 1UDXA 3GLHA 4UXIA 4QHTA 1L1NA 2SGQE 3KIDU 2XYAA 2OLKA 3KJHA 2XZPA 3ZZCA 1Z8FA 3ASYA 7LPRA 3M5OA 3UXMA 2JJ1D 3BV9B 1TGNA 4KI0A 4FVBA 1G8PA 4HB0A 2IWHA 5GVSA 3UWIA 1HAIH 1LF0A 1TEVA 4R9UC 2FEQH 2XZOA 1OW3B 1J90A 4TT3A 3AVQA 4ZDWA 3I72A 4M21A 3QF4B 2PUQH 4RI0A 1ZHMA 2IEZA 1ZNXA 1P9WA 1GWAA 1DO2A 5A8XA 1DXWA 3DZ8A 4UONA 1TB6H 1FMLA 2P65A 3T25A 3D8BA 4I4LA 4A6LA 2VP2A 1BCUH 2BDAA 4XJXA 3DMNA 1XEXB 3PG5A 3KQKA 9LPRA 3S69A 1C5OH 3QZRA 3VKHA 1ZPZA 5LBIA 4ABIA 1AO5A 4KELA 1EXMA 3GY2A 5FTNA 5EODA 2FSHA 3KN2A 1PQ5A 1IAQA 1GL6A 2GESA 1TPPA 5GADl 2C9OA 1AZTA 2EI8A 3LA6A 1YKTA 1ZJ6A 1TX6A 2J94A 1O3FA 4PO1A 3MHWU 3ZVEA 3MMGA 3U2QA 1GJBB 1KY3A 4HFPB 4UNRA 5JJKA 2IT1A 4DLUA 2CVFA 1N6XA 2F7SA 2N1BA 3QBTA 3KQBA 2N46A 1HAVB 2QQEA 1SC8U 3DFJA 4K46A 1Z3IX 4C30A 4ZKEA 2XAUA 1XX6A 4E07A 2QXJA 4BAKB 3A85A 3M1IA 1IQFA 2BY6X 2OCYC 1Q1EA 2A7CA 4BQSA 1PPFE 4ARZB 2O8CB 1CHOG 5CE1A 2AFIE 5GXPA 1OIWA 4GOKA 3BK7A 1F2UB 2EA3A 4AFSA 3V00A 2SGAA 3K6ZA 1P73A 4HZHA 1DE0A 4D9RA 4BAOB 1TNIA 2FI4E 3SU4A 1C1MA 3THXA 4M8NE 4ZIRA 2EVWX 3AQ4A 1TX7A 1ZIPA 2HYIC 3ZVBA 1CT2E 2O8CA 4NYIR 3E1XB 2B8TA 4DG4A 2WPIS 4MDFA 2THFB 3GCGA 4LBWA 1NSFA 3UUZA 3B8JA 1UM8A 2QPAA 4LZZA 4DCUA 4Z8YA 1EKBB 5DI3B 4Y11E 2BXUH 1ZVQA 4BAMB 3NBXX 4Y76A 2Y6TA 5CHAC 5EE1A 5DSZA 2VQSA 1VITF 4NIWA 5EG4A 2QXGA 1ORFA 4JBXA 1IM2A 4JZ1A 1SHYA 4R0IA 1NY5A 2ZETA 1BDAA 4FMDF 4X2XA 2NMVA 4I33A 1ZLRA 4B3BA 2BDTA 1Q21A 1QBNA 2ZSAA 2AL7A 1C4U2 3UKDA 1DM4B 3EZ2A 1ELTA 1A61H 1XD9A 1Y5UT 2JETB 4SGBE 1VKJA 3K0FA 2BD3A 2HOBA 1R10A 2QTFA 2F1JA 3B1VA 2GF0A 3RVBA 1J7KA 3PUVA 2J34A 1U99A 3GEHA 5DPAA 1T5LA 4GT1A 4A0RA 3LGVA 4KVGA 1PYTD 3LAWA 5B2ZA 5CYOA 1D9XA 2ATVA 1ZBDA 2VWLA 4C0HA 2GV6A 3ATWA 1N1LA 2ZWLH 3EE0B 4Z0KA 1C5RA 3L33A 2OFXA 4PSKA 1S0UA 4JZIA 2W5EA 2QMUA 2WSSD 4C0KA 4KVAA 2F3CE 3HWSA 2HT6A 4AURA 3VEQB 2XC5A 1U9IA 2G52A 3PV4A 2XTTB 1NL3A 1RJ9A 4YMSA 2O8DA 2I6QA 4MPXA 3FMFA 3ELAH 1T31A 2OBOA 3X2SA 4JZFH 2BY7X 2GDJA 2GF9A 2R3YA 2KB0A 1SOTA 1JR3D 1E9CA 2J0VA 4G3XA 2FM2A 5HZKA 1GNPA 1EAXA 3I5XA 3QENA 2IW3A 2F9UA 1Y3AA 4CEJB 5T6FA 1T3LA 1CO7E 4XFQA 3FFGA 3MU1A 3TGPA 1ZPBA 1YF4A 2IBMA 1HV8A 2Z5FA 4B3GA 2F1IA 2ZE7A 3L82B 1MBMA 2FOHA 1SPJA 1KI9A 1TQDA 4DLZA 2YWHA 3QLPH 1CA0B 2PJZA 1KDPA 2ODEA 2G88A 3O8DA 1UTMA 2YNMA 1R7RA 2O8BB 1AGJA 3RC6A 2J1LA 1G37A 1AWHB 4A2QA 1II0A 1E9SA 2CCGA 4XD7D 1OP8A 1QG4A 5EGMA 1YKSA 4KLNA 2NZ8A 5EXPA 1E0FD 4MKHA 3KDSE 1Y5BT 4CBOA 4EKDA 1QHXA 1GMCF 2FV8A 3ZVRA 5AJVB 1DAHA 2AFQB 2RGBA 4V0KA 1US8B 1BS1A 2IYYA 3B7GA 2IL1A 1KOFA 2ASUB 2VJ1A 2L0XA 3LU9B 1YR7A 3PFIA 3ASZA 4Q9LA 2F9NA 2AMDA 2VU8E 3WY9A 1EJNA 2PGBB 4Q7JB 4PXAA 1G3DA 4BOHA 1O3YA 3UPUA 2VH0A 3M5MA 1QL7A 4U2WA 4YDHB 1XUKA 4ABAA 4FIDA 3F68H 3VU9A 3HGNA 3V4FA 3RNLA 3BS4A 5KDDA 2VHTA 3G5UA 1EZXC 1TMUH 4WXPA 1Z07A 1C1RA 3LLUA 1KTTB 1G7RA 2DFNA 3QXHA 1NT1A 2FI3E 2P6NA 2G81E 5JBQA 1ESBA 1XU4A 2PSYA 3TUJC 2BB4A 2Y5HA 5FOVA 4K8YA 1SHZA 2FA9A 2ZRHA 2ANKH 1P2MA 2ZS9A 4DB4A 1W5SA 3Q3KA 1U94A 1B0UA 1Z63A 1MQ5A 2J0UA 1ZJDA 2BOKA 1PV4A 3L0IB 4TYDA 2H9EH 4F4IA 1NJGA 3ZZBA 1A5IA 1AWFH 4DDVA 1E1QD 3T61A 2ZNKH 2QNRA 4OJKA 1Z0JA 1ZSLA 3FKQA 1Z2CA 2ANYA 1UHBA 2A7QA 4B32A 1LW7A 4MPWA 3ZZ7A 4U32A 4WXVA 5DP4A 4DLVA 2AFHE 2ZRDA 4TL8A 4F93B 2BZAA 4HTCH 1QR3E 4P4TA 2IOTA 3NK8A 4HATA 4OHXA 5FPHA 1IQPA 1NBMA 1V43A 3GY6A 4WA7A 1ZNYA 2CJWB 2J9RA 3IWMA 3HPTB 1KDQA 2WZQA 2J3EA 2HXSA 1AFEH 1C1SA 2GCNA 2GCTB 2GXQA 4AG5A 3DPUA 1WQ1R 3THYB 1CR0A 5JJLA 2ZCLP 4A82A 1GGDC 4K81B 3X1WA 3MWIU 1QHSA 4XVUA 3QPWA 5EJEA 2PLXA 1ID5H 2GZAA 1A3EH 3AGPA 3THWB 2ESTE 4YMWA 1CE5A 1WU1A 2GRJA 1VHTA 1UTPA 4NU0A 1FUJA 1ZUIA 1A1RA 4D0LB 1SGDE 2DBYA 4EAQA 1SXJC 3DEFA 2CVHA 2BTCE 4US0R 1F48A 2QC2A 1KI4A 1NRRH 1E4VA 1G291 1G3EA 3BSQA 2WJHA 1UBFA 3SFVA 3LOXA 4U5XA 1CT0E 1NBMD 3CP7A 1ZW6A 5B64A 4Q21A 1CRQA 1C5YB 3I32A 1AD8H 3VHLB 4I8GA 2XNDD 3FWYA 4M4SA 1X3SA 1CJKC 2R2WU 1O3LA 3URDA 2Q9BA 1V2UT 2W3KA 4ZV4A 1DLKB 4RZ2A 1VCNA 1OWIA 5A0FA 3IKJA 3Q5EA 2EI7A 1V6DA 2W0SA 3QSYA 3LQRA 3K70D 4WMFA 5T6GA 2LWIA 1BTHH 3T1QA 3R7WB 4I99A 7GCHG 1TQ2A 4G1UC 5L8VA 2WPJS 1K2I1 3UY9A 1FQKA 3AF2A 2PL3A 5SZKB 1DPOA 2XOKA 4ISIH 4NGAH 1OHHD 4KXFB 4EJSB 4QM7A 1VECA 4AGJA 1L2TA 3E70C 1UMAH 4B1TA 2A2QH 4Q7MB 2OHFA 4TYYA 2CCKA 4F4OC 4TLEA 1FONA 4AKGA 5JZVA 2VHCA 4D26A 4TMTA 1BBRK 1QRAA 1O38A 1QCPA 3TLOA 1GFIA 1G19A 3KFXA 2B7CA 5GDSH 3VTKA 3TIUA 2R2AA 1IY0A 3SBDA 3TJNA 2K5UA 1E2NA 2EQBA 1MRSA 3UWJH 1Z6EA 3VB7A 2O0JA 5DIFA 5AFYH 3THYA 4NBSA 2OUKA 5TDHA 1IQJA 2QEQA 3U5ZB 5AVDA 1YR9A 1KDOA 1O3GA 3PV2A 2FLBH 1YVDA 3DUXH 3HYTA 3IEVA 2VTKA 2A5YB 1Q22A 2OQ5A 4H4FA 1RYHA 2QZ4A 4NA8A 4PHHA 4KV9A 2W3IA 1ETSH 1O33A 3RXDA 3UIRA 2F43A 1AA9A 3EPJA 1GJDB 2ALVA 1A82A 2ZIAA 3TGKE 1KXEA 2BM2A 1WRBA 4LK4A 5FR1A 3U6KA 1W2HA 2O8TA 1V5WA 4A6XA 2V3HH 3MTYA 2PX3A 3GLIE 4RFVA 1U8AA 3V9PA 3T12A 1CR2A 1RTFB 5FPTA 1EP6A 3WHLA 3W8RA 3P1JA 1QGFA 4YXWA 4Q7LA 2OT3B 2PEYA 1KYNA 1GUAA 4RKEA 1R5BA 3B9FH 1GI0A 4HAZA 5GJCA 3M3TA 2XCFA 5LH8A 1PUIA 2BVRH 1W1WA 2H5DA 1GBJA 1O30A 3CBQA 1E2PA 4X2YA 4KO8A 4OI2A 3QDZB 1MQ6A 3E0NB 4GCHG 3BEFB 1UAAA 1VITG 1T3SA 4DVGA 5A4JA 1V2KT 4KCGA 5KDLA 1CRPA 4K2YA 4KITB 2C03A 2CHVA 1EATA 1AHTH 1HUTH 3KJIA 2G5VA 2WWWA 4MLFB 5C67A 1SGFG 1TWXB 1O34A 1MOZA 1GHBG 2QU8A 1D6JA 1G17A 3RRZA 3SR0A 3WMGA 4OBEA 5EXXA 2ZHEH 2FSIA 4URUR 4TLAA 3QG5A 1MKXH 5CM8B 2OQUA 1E79A 4TTPA 1BTXA 2C96A 4FU8A 2CXVA 4KTUA 1U90A 1T8UA 1US8A 4AYTA 1XKAC 4LJ5A 3PEYA 1X7AC 4TWWA 1ZU5A 1UCYH 1NFWA 3AKYA 4ZDJA 1OB5A 4IFBA 4BRUA 2ZJ2A 3T35A 1G2LA 2PEZA 2VP5A 4DURA 5IK2D 4URZR 5TJXA 4GOXA 2JETC 3OEHA 1XVOA 2FX6A 2QMHA 5CLQA 3K70C 1N6PA 3KX2A 1SGEE 1QFKH 3QI2A 1CBWB 3QXJA 4MNVA 4OJQA 2GZ7A 4AY2A 2ZF0H 2XOKD 1HBTH 3P8GA 2C8YB 4RZ3A 2HNTF 5FOSA 1J70A 2VL7A 1MD7A 4BZPA 2TGDA 4AZ2B 4QG7A 4WY3A 4B35A 3AASA 5AJXA 3QWCH 1BT7A 2PZFA 1WA5A 2YHSA 3J81k 2FN4A 3BAFA 4FUFA 2CL6X 2BX3A 1CSOE 2BC9A 1VCPA 1XCMA 2CLCX 2G4UA 3EIEA 3HK3B 3FMPB 5DE3A 3ZQ6A 1G4AE 1OV4A 5FTKA 1YCPM 4INLA 3OIVA 1P0SH 2AK2A 3AVYA 4A5TS 1HLTH 3B82A 221PA 2BY5X 1SLUB 2H9TH 1W2GA 1DG1G 4LOYH 1F2UA 3FTQA 4BRWA 1HCGA 1ZSKA 2RG3A 2CGAA 1K8RA 4LC0A 3PEWA 1N25A 4ZHMU 2J59A 3JZAA 9ESTA 1F2SE 4IC6A 1AKSB 4OGYA 4Z1MD 1UTLM 1SVKA 3RU4D 3ENSB 4Q18A 3MU0A 1OXVA 1KTVA 2GAAA 3FMOB 1GL9B 1TA6A 4IEEA 5F9HA 2OK5A 2VIOA 2FSGA 2FPMA 4FUGA 3RU4E 1SHKA 1FZZA 3ATLA 1XKBC 4NE2A 3MYWA 3O8CA 1FNNA 4GDFA 3FANA 2Z9IA 2YOHA 1MTNC 3B6EA 4M9SA 3A1TA 1GI7B 2IX3A 4PTLA 5A0AE 3K0CC 2ZVPX 1X86B 4K1EA 2C98A 2NQ2C 2QA5A 2ZFTA 1C1TA 1NIJA 1O5FH 2QP9X 1P3CA 1QL8A 3SYKA 4IDNA 4B6FA 1RE0A 1R0ZA 1P61B 3RRMA 3MO3A 4M9ZA 5JPMH 5C5OA 3SS8A 1PLLA 3LVRE 2CMKA 4YTAA 2G8TA 1EFTA 3U3RA 1N6OA 2VWOA 1LY1A 4D80A 4IOKA 1QJ7B 4G5GA 2GCOB 4WMEA 2IS2A 2VLIA 5HM2A 1A4WH 1JRSA 2ZREA 1RRCA 3NG1A 1F0UA 2OC1A 1N6YA 2BMDA 1DOAA 1OLOA 4TPYA 3RRNA 1P04A 3ZZAA 5FTLA 1TQ4A 3AF4A 2PV9B 4ABYA 5C2JB 2STBE 1G9XA 1H8HA 2WWFA 3BH7A 2A7JA 2NWNA 1NFYA 1T5IA 4A8JA 3D62A 2EYQA 4IGDA 3PMBB 1OXUA 3QEOA 4DLWA 4Q01A 4EPYA 1SZPA 3HU1A 3W6PA 5IT5A 1U8ZA 1HYLA 2OUAA 3DOEA 3F1SB 5FCKA 1HAOH 5EW2H 4TMZA 3BTFE 1NI3A 4JLOA 2V35A 4MGKR 2BV3A 2VYFA 2P3FH 2BY9X 1TMBH 2BCJQ 3TNTA 3OAAD 1SXJB 2GZ8A 2XTZA 1ETRH 4GHQA 3L0PA 1DUEA 2ZU3A 5FUXA 4HAUA 4G0NA 1NC6A 2WTUA 1PJRA 5F8XA 1TNKA 4IC5A 1O3AA 3SGQE 2ZJYA 1TX8A 4IFEA 1W8BH 3RXTA 2OCVB 4A2WA 3P95A 1W4CA 3KJEA 1G21E 2CMYA 5K8IA 1QA7A 3L0OA 1Z1JA 2TRMA 1CHOF 3GJ3A 1S9DA 5F8ZA 4CHAB 5ABWA 3OHMA 3SFZA 1AIXH 1ZGVA 1FY1A 4LJ9A 2IUTA 2DFLA 4Q1BA 1QL9A 3KUCA 4GFDA 2IS4A 4NONA 3CZPA 5JS8A 1O2WA 4PC3A 3TUZC 5L3QB 2CHGA 1P9UA 1VZQH 5EQQA 3EA8A 3BD9A 3RS2A 1DSTA 3GCNA 3SHWA 3SJCA 1VJAU 4C7OA 2BLOA 1NRPH 3EA9A 2DCUA 1E79D 3NBFA 3A8AA 5I46H 3S7HB 3SZRA 3ZZ8A 2AN9A 2F91A 1XM1A 1W2KH 1CGIE 5DH9A 4X1PU 3HPQA 3ZD6A 3B60A 1MCVA 4HB2A 3Q9LA 3U44A 5CK4A 2GV7A 4NCHA 1N6HA 1Z8JB 4DWJA 2FNAA 1AN1E 1ELEE 5JBTA 3AVPA 4AK9A 1KTSB 4OS7A 1QBVH 2RGGA 2X1VA 3ZYEA 1E9RA 3D3QA 3Q3JB 3FP8E 1TNHA 4NIVA 4KAXA 3BN9A 5HZHA 1ANEA 1Q2WA 4HAYA 5FUVA 1UKEA 2AWNA 4AWXA 3A80A 3MAAC 4Q1AA 5JCZA 4FXGH 4BANB 3DT0H 4U02A 1GPZA 5CJPA 1JWTA 4CVNA 4P4SA 2ZI3A 1SR5C 2ZRMA 2PGQB 4JL6A 5DK1A 1FY4A 2QP4A 1YPEH 3QPVA 3OESA 2OXRA 5G3YA 4DZZA 2FU5C 3AVXA 4ZHLU 2P6RA 1LTQA 2GEDA 1NG1A 5F2EA 4Q1CA 2PKSC 4C0SA 4WAUA 3ADDA 2Z3DA 4Z54A 3ZIAA 3K65B 2XNDA 1ANKA 3RAPR 1GNRA 4ZKDA 2OBMA 1K1LA 4D8NA 2OV2A 5AFZH 1QRXA 2YYZA 4YDSA 1N0UA 1FNIA 2ZJAA 4NCJA 3U3JA 5CDFA 1WMSA 3DL0A 3HR7A 3JZ1B 2VIVA 4PPNA 2HALA 2QI9C 6Q21A 1DWCH 4BNRA 3TNSA 1KLIH 1SSXA 3QVUA 1KAOA 2IYQA 2MMGA 5AJZA 2D2FA 2V4ZA 4OI0A 1BMFA 3UWOA 3V13A 3GLHB 2XBYA 4B44A 1WAYB 2D7DA 1O39A 1W49A 1GDUA 2PTNA 5AUPB 5J4KA 1NVVR 2PWXA 3ITIA 2ZJ8A 2F9PA 3SN6A 3WHKA 3SHCH 1M8PA 1VCQA 4X8MA 3RABA 1HT2E 2WWGA 4Q7XA 3DFLA 3KHVA 1E9DA 3WYAA 4DLSA 2GCHF 4P4UA 3GPLA 1CA8B 4M22A 2IYLD 4DDUA 4ZKNU 2C90B 1VTKA 4CRWB 3NDBB 3CB4A 4MUAA 4QHSA 4CRFA 1P60A 4KSCA 1NNEA 2GVFA 2JH6D 3VR6A 1KXCA 4O3UA 5DP7A 2IXFA 5E4FA 2AIPA 1O3DA 3C5CA 4ZMAH 1O2TA 4IDHA 1V2RT 5JBBS 3RS0A 1AMHA 3GDSA 1Z6AA 3LDAA 1BMFD 3SBKA 4ISHH 1KXBA 1LQDB 1G1MA 2ZRJA 3H5CB 1XD2A 2IYWA 1OYWA 4CRCA 1P75A 1UVUH 4BAHB 1CQQA 2A2XH 4DLRA 2ZE5A 1QIXB 2W7SA 1OPHB 1G18A 3PWCA 4C3ZA 1R6BX 1SQAA 1KO7A 2QP3A 4RD3A 5CK5A 4YT7H 1E2LA 2C2HA 5K7RA 1NM6A 2FGJA 2ZIQH 5H70A 1E9AA 2IA5A 3GLFB 4AIIA 2OTVA 3GOVB 2Q21A 2CBZA 3SUDA 1K1NA 2XGJA 1GBLA 1EGAA 1OSNA 2JLRA 2C95A 3KZ1E 2FPLA 2JCSA 1RRKA 4B3FX 3M7UA 2VVVA 1OXSC 1ELCA 2WPDA 1O37A 3MNSA 1KHTA 1EX7A 1EFRA 2YVUA 1ZHPA 4K8OA 1G3UA 2FG5A 1AB9B 2IUUA 1XP8A 3K9NA 3PENA 1YCPH 2C8VA 3V12A 4HLDA 2DY1A 2QG6A 1TRYA 5AUQA 2ZRCA 1FPCH 5FPSA 3QF7A 3OEED 3SW2B 3K6YA 1I4TD 2D1JA 3CR7A 5C3NA 3Q7QA 1P6XA 4I32A 3H7OA 3ZVMA 1H1BA 1KNQA 1MMJN 1YZTA 1ELVA 2SGPE 2IUSA 5GJWC 3URCA 1QJ6B 3EA5A 1KSFX 1PPGE 1XTKA 1OXXK 1VMAA 1C5TA 1W4BA 1DPFA 3ZVFA 1F2TB 4BFXA 1KY2A 1KZGB 4P31A 5EE5B 3B2EA 5KPJA 2ZYUX 1ZM4A 2ZAOA 3TBKA 4JSYA 5DN6D 1EPTA 2VRWA 1OWJA 4B2CA 3W6OA 2ZFSA 4KHZA 4MKFA 1E2JA 1TX4B 2JDIA 1H8EA 1JXOA 3GJ7A 5JFGA 1ZC3A 2PH1A 3V7TA 1EXFA 2ZDLA 4U7DA 4JYVH 4B75A 4X1NU 1F2TA 3CNOA 3AAUA 1FL9A 4DIDA 2OCPA 1AKEA 2A2ZA 3F5FA 3LDXH 1M7GA 5FBIA 1QB9A 3STIA 2WJJA 1A0HB 1SI5H 1GMCG 4C0BA 1UF9A 4QRHA 2FTMA 3CX6A 4LV8B 1DXPA 2BEJA 1CKEA 3AM1A 4BECA 1MKXK 1G3RA 3IIMA 2C5LA 2CNWA 3S0NA 1JAHA 2VP0A 1C1QA 1ZINA 1YGCH 1JXPA 2P59A 2XBXA 4IMQA 3BTQE 3SJBA 2QCYA 4S35A 1JJ7A 5FBQB 5DP9A 4XSHA 3Q77A 5FR2A 4EJSC 3BTKE 4RFSB 2Z9GA 2MSEB 2EFGA 2ZQ5A 1NTPA 2XRCA 2RH5A 4FMBB 1HJ9A 1GBMA 2VH6A 5JWHA 1OKXA 4ISNA 1OXTA 3R8FA 3PYHA 1KI7A 3KQUA 4TTQA 1GHYH 3PROA 2N42A 4J2YB 4DW2U 1KYIA 3KXIA 4LSGA 1YP9A 5B6LA 1KSNA 1FP7A 1T0HB 1HAGE 1S5SA 4PAQA 2QUZA 4YOIA 1T4VH 1RFLA 5B30A 1SLVB 1UBCA 5TCCA 1ZM3A 3K53A 2AMPA 2BVSH 3ATMA 1HAVA 2QAGB 4LY6A 5HCNA 1ZD9A 3EARA 3M7TA 3M3SA 1T6NA 3KF2A 4WZ6A 4Q19A 1DWDH 5F8TA 2BLWA 3BG4B 3MNBA 1QF9A 5TY0A 1J8MF 3JZMA 2BD8A 4D7FA 3UATA 4YO9A 2O8WA 3LC5A 4Y10E 2OFOA 2FOBA 4WBSA 121PA 4IN1A 3ZZ0A 1UK4A 1D2NA 5FBEA 4S2EA 3QUSA 4JK5A 1AQUA 2PLRA 4TLDA 1MAYA 2KWIA 1E0JA 3AGQA 1U2RA 3H09A 4D4LA 3RXKA 1ZM7A 4NFEA 3FHCB 3K9XB 1C2MA 2SNWA 1K1IA 4DSUA 4ABFA 3TH5A 5JHGB 1SKYB 5DI3A 3M5NA 4RZUA 1EFUA 4LZ1H 1ZD8A 1HJAB 1TLDA 1HT1E 5C1UA 3S9CA 2OAP1 3LW7A 4TN1A 4E7RG 1QTFA 1G6HA 4TZ6A 3FGNA 3WRXC 1EWRA 4WWYA 1E94E 2DFTA 5LPFA 4BFUA 5JBAS 3SI3H 4UNPA 3T34A 2ZQ1A 4Y6DA 1KK1A 2B9LA 4WXRA 2HRVA 1PPBH 1WDTA 1XPOA 4WF8A 1P2TA 1MU8B 1NFUA 3VB3A 1OOKB 5KSYA 2PX0A 4I8LA 1O2VA 1N5KA 3T1OA 2ZRIA 4TTRA 1GI4A 2PZGA 3NC0C 4BLQA 3EW9A 4A15A 4V03A 1GHBF 4D82A 1P9SA 1ARBA 1D6RA 5KDOA 1LCYA 1P5ZB 3A86A 4X2VA 1R5NA 2Y5FA 1B5GH 1GRNA 1OIXA 2R65A 4FUDA 4MYCA 4KBFA 3I92A 1FMJA 4RKFA 3MWYW 2OXCA 1SQOA 3VR4A 2RMKA 4ACAA 1TOCB 4OK6A 1FOEB 1R0WA 1XX9A 3KQHA 2TIOA 1LHDH 2GA8A 1HUQA 1GJ5H 3ADCA 3WBJA 5CM9C 4DDWA 2Z3CA 3NDPA 4JT4A 3WNBA 3MH5A 1YQTA 5JI3E 1JBKA 2R6GA 6GCHG 2O9QA 1THSH 3ATKA 2AHOA 4UE7H 1W12U 2ODWA 3QGNB 3WYFA 2DE8A 3SHFA 3TW8B 4Z51A 1IONA 3VU9B 3NVAA 1ZMXA 3M36A 3NUMA 1AVGH 4V0LA 1OT3A 4PROA 4IJMA 4BFVA 4WZAE 3VAAA 4TYPA 4PAMA 2H6MA 2Z9KA 1AN0A 1LS1A 4QBFA 2G83A 4X6MA 3N2IA 2FS8A 1ZJKA 1W3CA 4Y8ZA 2BD2A 3QIAA 2FJUA 3TR5A 1E2DA 3KXLA 4C0QC 5DN6A 3AVVA 2HJGA 4HZUB 2QY9A 5F6MA 4LZ4B 4CGZA 4YESB 1HAXB 4WVPE 2FP7B 1UDWA 4U30A 5CHAB 3MH4A 4DCSA 1E4YA 1DELA 1A0LA 2ZTXA 1J2JA 3RANA 2F9OA 4JLMA 5KHOC 5LDDC 2WMNB 1AI8H 2VNTA 3U61B 2YWFA 1MCTA 4K69A 3M5LA 1XEWX 4PPFA 4I1OA 4JKIA 4IOJA 2FLRH 1C2HA 1Q57A 2H1UA 1O3PB 3NWUA 2ZHQH 1KO8A 2AWOA 5DYIA 4O2LA 1EZQA 1NN3A 2ZI5A 1D3PB 1EOLA 1AZZA 1RC8A 1TU4A 1NY6A 5J4LA 1EPTC 2BJWA 4P4SB 3B78A 5H68A 4DXAA 3AUXA 5T1VA 4URYR 1QRWA 1CF4A 3SJ9A 3T06B 2HT1A 3K0CA 1J99A 3QKSB 1DSUA 2ZRKA 1FMGA 4Y79A 4JYCA 4QGHA 2H17A 1TPAE 4F92B 1XJ0A 2F3TA 2ERXA 5LB4A 4LYHA 2ORVA 1COWA 2LNCA 3VNVA 1O3OA 4Q02A 3KQCA 4DJTA 4LI0A 1TQ6A 3IHWA 4ZROA 3MNXA 2GMTB 1BMNH 3R8CA 1ESMA 3IO3A 2GX4A 4WH6A 1JPJA 3TH3H 1GKYA 3A37A 4C2TA 4LWZA 1DG3A 2DWQA 2FIRH 2P3TB 2R0LA 2Q9CA 3QJYA 4JZDH 2VA8A 2J46A 3A6PC 4PZZA 1SVWA 1CVWH 1V2NT 2G00A 2A5GA 2R6DA 2BM1A 3UFAA 2SNVA 4IMZA 3M6AA 4Q2KA 1Y3XA 2B8WA 1ZPCA 3BTTE 5DP6A 5SZJA 3CENA 2QY0B 3U98H 1HAYB 1S0QA 3TLXA 2ZU5A 3GFPA 4D4JA 4QNMA 1XUHA 3RU4T 4HAVA 3OIYA 4BFSA 3REGA 1YPLH 4DT1A 4BLPA 1C1YA 1TPOA 4CEHB 1PQ8A 521PA 3P6ZB 1JB1A 4E5UA 3KFVA 4ABJA 5DI9A 2F55A 4Q48A 2HNTE 6GCHF 2WJYA 3OSYA 2ZSFA 4ILEA 1UHBB 1OF1A 2BDIA 5F3WB 2W2XA 2Q3FA 1SKYE 3C7KA 1H4WA 4Y7BA 2VHJA 3NBZC 4ESVA 5EPNA 1DEKA 4X6PA 1AGRA 2JIZA 2FWWA 4QGAA 5LPRA 2ILNA 4BFZA 1QB6A 2VO1A 2B7DH 3MOCA 1W47A 5ETXA 4GNKA 1HIAB 1WYKA 3VX3A 1KKMA 4MVNA 2C78A 4N0EA 2O8UA 4FU7A 2IYUA 2OBNA 2RB4A 3RLFA 1LVBA 2VH5R 3R20A 2XXAA 4AYWA 3U7HB 3UMRA 1TGTA 1WSSH 2A3RA 4IXMA 3ETLA 4IOMA 3A83A 4Q66C 4IBLH 1BRBE 1NLZA 5UKDA 1JOUB 2ZFQH 2QM7A 1O32A 1C2EA 5HYOA 1SVSA 3MI4A 5BQ5A 1XMJA 3B5JA 1W10U 4IW3B 5JJIA 1V2QT 4D76A 2GVZC 2JIZD 1NRNH 4QGFA 2GD4B 1Q3HA 4L9SA 3PR1A 3GLGB 3UTUH 3RMOH 4CRAA 3RUOA 1BO6A 3WNDA 4ASHA 3CZQA 1KXFA 1YZKA 3DM9B 2WJIA 5KNDA 3RMLH 1VG9B 4LYJA 3TSOA 2EFEB 2JKHA 3ZZDA 4MA4A 4QBHA 1GBCA 1XVMA 5AUOB 1VJ9U 1W0KD 4JLDA 1HAPH 1O2UA 1XMSA 3UR9A 1ABIH 1W7XH 2RHMA 5L6NH 5IF9A 4A7IB 2QORA 2C3SA 2V6IA 1F0SA 1R8SA 1FV9A 4UKDA 3D23A 1X8KA 5BN3A 2GT7A 2CE2X 1B0FA 1X1SA 1Z1IA 3OFND 2BQ7B 2YJTD 4DC9A 3IBYA 3U8OH 4M1SA 2GTBA 1CT4E 2BDHA 4QKQA 3TNFA 1DICA 3TIFA 3WY8A 1EZSC 4TMXA 1GJ9B 5GVRA 4ABBA 5B57C 1D2EA 5LB2A 5JSZB 1KDTA 3Q3YA 4G5OA 1TFXA 1G7TA 3N7OA 5DO4H 4C9BA 1GNQA 4J0QA 1MRNA 1IQIA 2RGCA 3A7XA 5KU1A 3D31A 4C4PA 4II7A 3R3GB 2QIQA 1UADA 4ON9A 1C5UA 2B7BA 3SOPA 1W14U 4PO8A 2OD3B 2PLFA 3OIUA 4OHYA 3M7QA 2Q9AA 1MZDA 1DAGA 1SGPE 3QY0A 4NPHA 1DARA 4MUBA 2A4RA 2EC9H 1RJ9B 4F38A 5KSZA 2G1KA 2HCBA 3VR2A 2PT7A 1TRNA 2ANBA 1Z5ZA 1Z8RA 1IQNA 1UJ2A 3W90A 2J87A 1N6NA 1ZSJA 1VG0B 1A2CH 2O8FA 1J14A 1T0JB 3CPEA 3SJZA 1P2NA 3MWKA 4LRWA 1IXRC 4MKGA 4AKHA 3LBIA 3OZXA 4OL0A 1KMHA 2PKSB 2AGIX 1E2GA 1WF3A 2BMEA 3T5DA 1MO3A 1YC0A 4PQFA 2JLQA 4DDTA 3DMDA 2F6RA 1J17T 1IQKA 3BEIB 1YZUA 1ZM9A 3QF4A 1A5HA 2AGEX 1XPUA 3EPLA 4G5SA 4EUNA 2DPXA 2ZU2A 4WH8A 1E1QA 2BQWB 5KTYA 3IO5A 1VCWA 3A58B 1RIWC 1GHWH 3FPAA 1JRTA 1OFIA 2F3RA 4EPXA 1SGCA 1NRJB 3SV6A 2JAQA 3A1SA 1OFHA 4ZKOU 1H8IH 4OKSA 1KGDA 4RD6A 1SQ5A 2P94A 2ZRBA 3GLFE 1KO4A 1GBDA 3EASA 1BJUA 1NFXA 3U6BA 1O3IA 3TMKA 3B13B 4HAXA 1XUFA 2WPDD 3SNCA 5EP2A 3PIRA 1BKDR 5H8WA 2IK8A 4ESHA 3RXRA 2OBQA 1UCYK 1N3BA 3AVWA 1Q44A 5JEDA 1W5TA 2PCLA 4QOSA 4AG2A 4AB8A 1QHGA 3U69H 1SFQB 1P57B 4FUHA 5KSOA 4ISLA 1CHGA 2ZANA 2O0KA 2QAJA 1GKUB 1RIWB 3UWKA 5AR1A 1M9UA 1CXZA 1NVXQ 1JALA 1GI9B 1L7VC 4L4UA 1ELFA 3AKDA 1NMYA 1YE8A 2SFAA 2FEOA 2PT5A 1TABE 3ECCA 3ND8A 3LX8A 4Y0YE 2ZI7A 4NHOA 4PX9A 4QXAA 3RXBA 3PJRA 2NG1A 2QGRA 1XRJA 3LBNA 3QG1A 4PR0A 3V0XA 2FE4A 4B3DA 3C1KA 4HDQB 1C9KA 2GBLC 4AG1A 2D7CA 5EXSA 3IPXA 2X8AA 1YLCA 2JATA 3GD7A 3E1SA 1RTLA 1TNLA 3VFEA 1SGWA 3DKPA 2OAQ1 1N0VC 1E98A 1ZHRA 4Q7ZA 4R71A 1TF7A 3H86A 2IF0A 4H1UA 3QKRB 2EFHB 3CNLA 2GGVB 3HJNA 3N2EA 2ZDAH 3E5HA 1JMOH 4TWZA 2GJ9A 4EQ6B 3LV8A 1YRAA 2H2ZA 4NZLA 1XFAA 2QROA 1GTVA 2ASEA 2O5VA 1U0JA 1YPMH 3T15A 3RS4A 1FP6A 3EYDA 2XTMA 2REOA 3U4QA 1UBEA 1MTWA 1PJPA 2QT1A 3FFAA 3A7TA 1MABB 2YOGA 3I4LA 4NZQA 1XJQA 1QZXA 4G01B 2G55A 2QAAA 1SXJA 3I29A 1KDQB 2BYAX 1YYY1 2V6JA 4NYIQ 3FHOA 1PUJA 2CL0X 3T1TA 5FX5A 1ZUNB 1U98A 1S3SA 3BTEE 4OHVA 1XD8A 4UD9H 3DA9B 1O3EA 1CJVC 4WMDA 3NIBA 1KI3A 3VXFH 2CK3A 2ULLA 3AP1A 1TL7C 2QSZA 1S0RA 4AD8A 1VYUA 2D4HA 2DUCA 3IQWA 2RGAA 1GDNA 1LV7A 1E35B 1FUKA 4HLUC 5E8EH 4EFMA 3E16B 3CPJB 4ABDA 1G7SA 3CPHA 4FXPA 8GCHG 2A78A 4WIAA 3SEAA 1GVZA 4I1UA 1M2OB 2WBLC 1D5CA 3S9AA 1ELAA 1BRAA 1GOTA 4Q1DA 3CLVA 4NYJR 2HXYA 5FXLA 1BQYA 2G6BA 5IDKA 5BN5A 2GCOA 1GHVH 1EAIA 2QE7A 4PHGA 1TPZA 4QJ3A 3QGJA 1ZRKA 3EZFA 2OG2A 4JLNA 2SGEE 1L4YA 3QO6A 1XCGB 2HGTH 1LPZB 3K09C 2HEIA 4UQOA 1FTSA 5C1YA 4P32A 2WJVA 3ZZ4A 4Q7KA 2C9YA 2TGTA 3RC8A 3WBKA 5EQSA 3CONA 1SGYE 2A30A 2FESH 3ZYCA 1M74A 1Y63A 3GCTG 1UO6A 1NRSH 2FZLA 4DSNA 2KI5A 3HKIB 4TQUS 2JJ1A 4F49A 1GRQA 4A6PA 3SV9A 2ZM5A 2IXEA 1XUIA 2BDCA 2NU1E 1DAKA 1FDPA 1C1PA 3GCOA 3NH9A 1MTUA 3RC5A 1MBQA 1ZAKA 3MD0A 3OF5A 1UPTA 4NSVA 1CS4C 3OE7A 2WIAA 5GJBA 1Z71A 3ZQJA 1O3CA 2P8OB 2BOVA 4FUJA 2ZAMA 2MMCA 2EU8A 1C1NA 1Q1QA 1QURH 4KFTA 5A09A 1EJAA 2E1RA 2NOAA 2ZYWX 4RSGA 1BHXF 1O2KA 1W11U 2ZSDA 2RGDA 1BMMH 3HATH 4C7OB 4LV6A 1ODFA 4CRDA 2A4GA 1JIMA 2QF0A 1AKSA 3NHBA 1ZP6A 4XBCA 4R7ZA 4NYMQ 3VGCB 1AS0A 4G5RA 2GK7A 4CBNA 3TAHA 1TGBA 2D2EA 1XF9A 5KSPA 4DSTA 4ERNA 3RM2H 1EB1H 3PEUA 1QHIA 1IJFA 5EXLA 4XTCS 2I1VB 4PQRA 2ALPA 4M1OA 2WV4A 4YOGA 3SJIA 1FUUA 2FFBA 3KGPA 1L1JA 5FPYA 3GLHE 4AYYB 2H16A 3ZZ6A 2AERH 1FY5A 4JZEH 2QYIA 3K70B 4INKA 3TR0A 4TPIZ 1KK2A 4B2LA 5K8LA 5DO9A 3NBYC 3O47A 2ZJBA 2JH5D 2VINA 1KLJH 2WM9B 2OLJA 2V9PA 3EPKA 4E06H 1N0WA 3C27B 1WOFA 2R6CA 1SB1H 2ZHFH 1HQYE 2IYZA 3SHAH 2XB4A 3RXEA 2GAOA 4H9GA 4YMUA 2WJGA 1JNYA 2ZQ2A 3RXSA 1Y5AT 3R9XA 1T8NA 3IG6B 3AH8A 1WV7H 421PA 5A8YA 4GP7A 4DGJA 1C4OA 3FMIA 4AFUA 2W00A 3KKMA 4LHYA 4CT5A 2HV8A 3QK1A 2ZDKA 3LH1A 4LJ4A 1VIYA 3SYJA 3STJA 4QJ4A 2FOFA 3CUEF 1OE0A 3I5YA 4XOJA 2OM2A 3EXAA 2QAGA 3PXGA 4A1VA 1NIPA 2ZGHA 2ODBA 2VIDA 2A31A 3UG7A 3U8TH 4GMXA 4JT2A 1I2DA 2IHBA 3BG4C 4KTSA 2XTNA 1GM5A 3HGPA 3ATIA 4THNH 3MU5A 4WVFA 1YPHE 1NLFA 3LX5A 4IS5A 1IN8A 4NL4H 4MYHA 2WKQA 1T32A 1LF5A 2DFKB 2WUBA 1IN7A 1J8YF 1SL3A 5CITA 3PMAB 3PO1C 1GG2A 1MTNB 4NWLA 2A0QB 1FXYA 3PLPA 1A3BH 4K1SA 4MITA 4DSOA 4QC2A 4Z6AH 5E7MA 3M4YA 2OCAA 2YC2C 5DYGA 4PHFA 1TQ7B 4OQLA 2J0QA 1O3KA 4X1QU 4M1YA 3K0EA 3C8UA 1QB1A 1E36B 4CR9A 4ZXYH 2XC4A 1Q3TA 2XX3A 3HKJB 1E0AA 1NU9A 2R6FA 4OGXA 2GILA 1TOMH 3P4XA 4JVMA 3MNCA 1J15A 3SORA 1CP2A 2PFEA 2G1JA 1K9OE 3NTUA 3CF6R 4QNRA 3TW4A 1K1OA 4I31A 1BBRE 5EXTA 3WP1B 4JMPA 3WP0A 5HMAA 3OYPA 1QJ1B 1E32A 1Y8TA 1NBME 4K60A 4LBZA 2FOLA 1W0JA 1Z47A 1UTOA 2ZROA 3FE2A 3WMFA 4RD0A 3BIVH 2XEXA 3HDTA 3THXB 4AFQA 4IDQA 1XUJA 3T5GA 5BRRE 1Q3XA 4UEHH 4KFRA 1O2MA 4GPTA 5EUMA 1PVOA 3CRMA 1YU9A 4KYUA 821PA 1FI8A 3PEVA 2I1QA 3SU1A 1F6BA 4DEYA 4JCNA 2QE7D 1UKYA 3T28A 5JB9S 2G3YA 4N3NA 4NCKA 8KME2 1JECA 5J4SA 2Y5GA 4E03A 2CN0H 5FTMA 1GI2A 3GJ0A 5FOTA 5H1YA 1RFNA 5H4IB 1J9CH 4B2AA 3G01A 5E7IA 4K5ZA 4HUTA 4KYIB 1MKWH 4LOAA 3MO9A 5E2PA 1FLEE 2GT8A 1NRQH 3ZVLA 1U9IC 4TMWA 2OINA 4BWYA 2ZUDA 1KLTA 1BYIA 3U3MA 1OYYA 4YMVA 3SNEA 2C99A 1NN5A 4D2IA 3QQ5A 4US1R 4UXJA 1WQSA 2J4IA 2YV5A 1H8DH 2KE5A 1OH8A 3BRWD 5E2OA 3P70B 1Z28A 4LDJA 2OXSA 2BBOA 4IVPA 1JR6A 1D3QB 4PZYA 2G0TA 3SJOA 2J5XA 3S1AA 3OE7D 4YLQH 1EOJA 3EAQA 3IITA 5B6OA 1C5LH 1NROH 2AKYA 4AYXA 3CF2A 2WICA 2V55B 1C5XB 4A0FA 2AD1A 3MWLA 3DVLA 5JRZA 2GJKA 3A81A 3RXFA 2A4OA 2FX4A 4TMVA 4V0NA 3FVQA 1E9BA 2RGXA 5K8UA 1IAUA 3AB3A 1XXHB 3WMEA 5JDUB 2QTVB 3E3TA 2B6HA 4XH9B 1FX0A 3IGFA 5KNCA 4AKIA 5IRCD 1T8LA 1DX5M 5DLQC 3FB4A 4XSGA 4O9VA 3REFA 3ZZ9A 1XCPA 4MPVA 4Q00A 3H7TA 1O5EH 3UPEA 4BTTB 2BKUA 2TGAA 1F0TA 1VITH 1OWEA 4I7YH 1FTNA 3A89A 1UKVY 4RD4A 1QVRA 1K6MA 3KKNA 3LO5A 1G6OA 3AF1A 4X6NA 2PTCE 1OH6A 1LVMA 5GPIB 3E2IA 4Q4AB 3OY5U 3PB1E 1A1VA 1AUTC 4D0NA 4HUQB 3LKWA 3TITA 4JJZA 1ETUA 1FQ3A 3RSLA 4JYUH 2ZPSA 1YZNA 2KAIB 3LXRA 1RRGA 3WXMA 1SGNE 2SGFE 3MJHA 3PLKA 2IXGA 2FGKA 2VSFA 3HU3A 1Q12A 2ORIA 4KKDA 5GJVC 5JEEA 1Y3YA 1GBTA 2VVCA 2BWJA 2W7UA 4UNSA 2GZDA 2BVNA 3CWQA 2PSXA 2W26A 2O8DB 4XOIA 5IDVA 1Z0AA 4OQXA 2YZ2A 2XW9A 621PA 5GJ4B 2KSQA 4AX9H 2WPHS 4X0WU 4BLTA 5FOWA 3H2YA 1ZRHA 3PTNA 3GLIA 1NJFA 2ZRAA 2PMDA 3FVFB 1FPMA 4GP6A 2HLCA 4Q03A 5FI1B 5EW1H 3BB3A 4BZXA 1X6VA 2V1XA 1LFDB 2ZSBA 3KKQA 2NO1A 1XUGA 3SU6A 2O0HA 2BQ6B 2CXXA 2D06A 5EQTA 2ODYB 2ZCHP 4HDCA 3TVDA 2AK3A 2GNOA 4BTIB 3BC1A 2ZPTX 1MKWK 1SHHB 3W5JA 4POAA 3U4QB 2WPLS 2VSOA 3RC3A 1LS6A 3EZ7A 3K9HA 4GSOA 1XDBA 2ONKA 1II8A 2IYXA 1QHRB 1F3OA 3P17H 2D3WA 5D3MA 1E2IA 5HKKA 1G5TA 4YQFA 1CEEA 1R5OA 1WUNH 2YNAA 1C5PA 5KPDA 2IYRA 5JRJA 1AGPA 5C4MA 3ZYDA 2EI6A 1FQJA 1LVYA 3DOFA 5DP8A 3IUYA 3PWBA 4WOPA 3RXOA 4NH0A 3C16C 1T3HA 4EIWA 3U3OA 1C5MD 2VWNA 1PFXC 2RGEA 4KGAA 3RYTC 1D3DB 1V3XA 4UNQA 3A4MA 4ZHAA 1E1RD 3KCGH 3F9EA 4B3XA 3L0SA 2EFDB 2XBWA 3W6NA 1Z6YA 1N6IA 1S3GA 3QX5H 4W5HA 3RS5A 4DHEA 4DVAU 3ZVNA 1F92A 1T8MA 2FFAA 4O97A 4M1KA 1GVLA 4ZDIA 1O2IA 4XE4A 4E09A 1Z29A 4Q9JA 1O2ZA 1Y3VA 2XSZA 1OIVA 3M37A 3SN8A 1X1RA 1ONBA 1P4SA 1ZMNA 3LC3A 1BOQA 4JYBA 2H92A 1SOZA 4A2PA 3A4NA 5J4YA 1M1YE 1XMIA 3ODDA 2CL7X 5CIQA 4X8LA 2ZRNA 1G5PA 1GITA 4P0TA 1SVLA 1LHFH 1X8JA 4BASA 1S83A 2R2MB 2Z0MA 1WBDA 4NCYA 4GI7A 3TSWA 3FFBA 5KUTA 4MTBA 3TVJB 1IQHA 4A0HA 1EUFA 5HR5A 4Y0VA 1O2YA 2IYVA 2OSBA 1XTQA 5E95A 3WYGA 1G3MA 2IYTA 4OS5A 4JSTA 1C5QA 1UVOA 3TU7H 4YLUA 3SV7A 1DBSA 2W0MA 1DVRA 3OTPA 4BPBA 4UFGH 3PUWA 3T27A 1XTIA 3ZZ3A 1VR1H 3RM0H 1SLXB 1RJXB 3K0FB 2A45B 2V7QA 3BERA 4DJZB 2PCJA 1E3MA 4RVCA 5HXFA 1U6QA 2ZGCA 3TE6A 1YPJH 2MSDB 3GY8A 1IHSH 1M7HA 4RZXA 1O5DH 4DUGD 4O2RA 1ARCA 1LDTT 4CRGA 2DR3A 4B76A 3LONA 1TMKA 2QBYA 4MRVA 3CX7A 5BYKA 2V3OH 2W83A 5ESTE 3A1VA 2WSMA 3RXQA 2ZS7A 2HF8A 4AOQA 2O8FB 3ZD7A 1LPKB 4K3JA 1HAHH 1U81A 4MQAA 2JJ2A 1KI6A 1E0KA 1BH2A 1E0SA 2ZRGA 4CHAC 3MUFA 4SGAE 1KSHA 3DDCA 1KJWA 1QNJA 1O5GH 4Y71A 1EZUC 2QQ0A 2A5FA 4B74A 3UOPA 3ZIAD 1OB2A 4D7GA 2VIWA 5C18A 4ZIRB 1FIWA 1GCDA 4XTRA 4B2PA 3QKRA 3O8BA 8ESTE 3BB1A 2GWHA 4JK6A 4DLTA 4B6EA 1P09A 1AFQC 2HJVA 3U44B 2ZECA 5B58C 4Y8XA 5ESBA 2QPOA 3DZDA 3RS7A 2ONJA 1NY22 2A5AA 4ZUHA 1O2NA 2NU4E 4LX0A 2FTLE 2FEMA 2FOAA 2FPZA 4H6TA 1BTUA 5FAHA 3W95A 1SGFA 2FI5E 2CV3A 2C9CA 2KJQA 1HURA 5CB6A 3DO6A 1Z6JH 1OXGA 2X77A 2JLXA 2P95A 4TSFA 1GJ8B 2F9VA 4TQ9A 2Z4RA 5DJ7A 3GISB 4D25A 1GIAA 4AYVB 1KAGA 1Z6TA 2BEKA 1XNJA 4NCIA 3SQEE 2Q6TA 4DLXA 1AFQB 5C1BA 3TQCA 1ZC4A 4DCNA 2ZJ5A 4ZH8A 1LTOA 2VVUA 4MRSA 2Z3EA 2FODA 3LGIA 2FOCA 1XMVA 3KB2A 2ZHDA 2ZO3H 1IXSB 2R8RA 3LRPA 1GGDB 5TV2A 5L3QA 2OCBA 1GBEA 1BBRH 5FHTA 1C1OA 3L6PA 2BDBA 4Q1FA 4X8HA 4E7NA 2CK3D 1ZUHA 2QBYB 3A8DA 5IYTA 2ZS8A 4W5JA 2KAIA 4GOJA 3GLGA 5FH9A 2AMQA 1HTWA 1H8HD 3KNXA 1KNXA 2RA3A 1MH1A 1AE5A 1KI1A 3RDPA 5LPEA 1EQ9A 1CU1A 1GMDF 2W2VA 3TRFA 1HA3A 3U1IB 4BLSA 3TK9A 3BF6H 1MT0A 1SXJD 2JLVA 4GL2A 4DIEA 3GY7A 1TF5A 2H7VA 1JXMA 2A5KA 2H8KA 2OO7A 4B48A 3GCHC 3HK6B 3VXEH 1GMDG 2QN5T 1C2LA 1NVVQ 2ZFRH 1GL1A 2MSCB 3VFDA 4AC9A 1SGRE 4JBWA 4Q9HA 1L0ZA 5FFMA 1S85A 1O35A 2ZPQA 2CCJA 3U7FB 1AQYA 3H0KA 2HPPH 5A8ZA 1CBUA 3T5FH 1DAEA 2Q3MA 3RSOA 4A8JC 5LD2C 4GLYA 8LPRA 3QVVA 4INHA 1O3NA 1XEWY 3DD2H 4L5BA 3RXGA 5A5GA 3S7KB 1A2KC 1EX3A 2ATXA 3GJ6A 3EZ6A 4FMCF 2GMTC 2WWXA 3OU0A 1IHUA 1TNGA 4KBGA 5JYIA 2OBLA 1CGJE 4GZMA 1ZGIA 3AVTA 5BW8A 1LHCH 1QBOA 2BDYA 1OX1A 5L3RA 4JLPA 3KB1A 2QMOA 4ZAEA 3GDUA 2HYDA 3TUIC 3PMJA 3CO5A 1DITH 2SHKA 4BXWA 2IYSA 3VMFA 1RPZA 3X1ZA 2A7HA 3NEYA 3PM3A 3QTVH 5AWFC 5JBCS 3CNNA 4M1WA 1RRPA 2Y8EA 5FCRA 4CDGA 1DUAA 1VCOA 2C8WB 3A1UA 1WCZA 3LH5A 3LJOA 4JL8A 3D7MA 2ZC9H 2CLSA 3ZVGA 3L8YA 2ZUCA 4NTZA 1PYTC 4M53A 4LYAA 2GXUA 1UTNA 3TKLA 2V0BA 4BLOA 3BH0A 1A0JA 3Q76A 3B9PA 6CHAB 4WW0A 1NKTA 3RXVA 4HLCA 1OH5A 5GNDA 2ZTYA 1S8FA 1EX6A 4O3MA 1HEIA 1O2GH 3P4YA 1AIPA 3A82A 3LVQE 5JWRA 3B85A 2F43B 1Z8GA 1NP6A 2XZLA 1AVWA 1C2DA 1VG1A 3RLYH 5DHFA 1W7GH 1ZCBA 1IN4A 5CB8A 3TPIZ 1RTKA 2JLSA 4LK2A 1C2GA 1I4DD 2G77B 2J7KA 2M5TA 3GYMA 3GQBA 1S84A 2FMXA 1C2IA 1V2ST 4RD1A 5HM9A 3CF0A 5L30H 1AY6H 2BHRA 3SQXA 1ELDE 1FX0B 3GCHB 2WHXA 1LHGH 1L8QA 3HYRA 1BA8B 4NWKA 1B0EA 2H9HA 2VEDA 4NYMR 1IOZA 4HLQB 2FH5B 4OK5A 2AIQA 1S2MA 1GKIA 2V3CC 1BMLA 2Z6BD 4QM6A 4LCBA 7ESTE 3S9BA 2NPIA 2Z4SA 4Q80A 2XC0A 4A8JB 1XWIA 2XNIA 3AVZA 1TIOA 5E0JA 4PAOA 2ZGJA 1P11E 3IIJA 2ODPA 3ONWA 4CEIB 3SZNA 3GEIA 3BJIC 1G5RA 1VIAA 2X19A 5FUYA 5FUWA 1D9ZA 4TL7A 1F7ZA 3LGYA 1WCV1 1KK0A 3E6PH 1G3QA 3LJJA 1LB1B 1OKKD 4W5WA 1ZTJA 1EPTB 1G2MA 4RN6A 1IN6A 2NPFA 1ZTLA 2I4IA 1ZZZA 4MDEA 3SUEA 1O5AB 3BTME 3QNUA 4B2BA 3AP3A 4A1FA 1N5JA 5SZIA 3P20A 4EFLA 4QHYA 3GY4A 3K9LA 2HWLB 2J38A 3KQLA 1SMFE 1O87A 721PA 1GJCB 4OYHA 1O5BB 1LKAA 3RXAA 7KMEH 2TPIZ 1KIGH 1VPLA 1B23P 3O8RA 1ZMLA 4C0JA 3VKWA 1QBKC 1O2LA 2ZDNA 4WJG2 3SYLA 3IIKA 2O52A 1YZQA 4QJ5A 2Y7ZA 2IS1A 3GFOA 4OI4A 1DADA 4OQMA 2E9SA 1BTYA 2NO6A 4TY7A 4LHXA 2V1UA 5E7JA 2JA1A 3BH6A 1C2JA 5FBLB 2FYRA 1A46H 2BCGY 1TPSA 5EXNA 5DKMA 1P2SA 2YNBA 1LVGA 1NO9H 4ESTE 2X2EA 1F0RA 1O2JA 3IPYA 2QV1A 4ABHA 2EFCB 4EPVA 1YPKH 2PBRA 4R2IA 4ABEA 4EQ6A 1MUEB 5A0CA 4B43A 3LIWA 1EP5A 2Q0HA 3RHFA 2BLVA 3ND9A 4XVRA 2BD4A 3L8ZA 3RC4A 1GSIA 1W0JD 3VX4A 1VCMA 1IXZA 1K5DA 2CE7A 1BMAA 4LJ8A 1F5RA 1GI1A 2WKRA 3KL4A 4IKEA 1EFRD 1THPB 2OZEA 1O0DH 4QT8C 1O2SA 1N5LA 4TYQA 4QBGB 3QUMP 4KLZA 4GRAA 4M2LA 4RY2A 2RA0A 2RGNC 4LC1A 1E1RA 3BEUA 4BFYA 1ESNA 2ZITA 1NU7B 1O2HA 3GJ8A 4B34A 1SFIA 3ZJYA 2J9NA 2IS6A 4CH2B 2PW8H 1P02A 3P8FA 4H6SB 1BUIA 4CEJA 4LJ7A 5FPKA 1QHNA 4N1AA 3TJVA 1MTVA 4CT4B 3K8YA 2FDAA 1KO1A 3LD9A 3RXUA 3LH3A 4MYTA 3SYNA 5TXGA 3QXXA 2W6IA 3UMFA 1DAFA 1YJ5A 3OAAA 1WB9A 1TUEA 2FMJA 3A7WA 4DT1B 3RXCA 3LLMA 3RXLA 4PHTA 2HCJB 2P0EA 4X6OA 1HYQA 2EWVA 1FW6A 4MGYR 5JLJA 1MO4A 3ADBA 3F0TA 1BRUP 2OEPA 1DS2E 1XB2A 1KO5A 1BZXE 4PC7A 2VHUA 4CF7A 3F9GA 5HE8A 1HNEE 2VHQA 1C4V2 4NKRA 5AUNB 4ARZA 1SVOA 2W6ID 1IN5A 4H1VA 3I8XA 2QPTA 3SU3A 1QHYA 4B2IA 1Y3UA 4V0OA 4X1RU 2J95A 4VGCB 4I8KA 4AB9A 2O8BA 1LKBA 3T2NA 2IN2A 2P5SA 4Q4JA 3U60B 3UQOA 4FCWA 8GCHF 4LYFA 3ZZTA 3V4RA 1K1PA 1CJTC 4CEIA 2CEAA 2RCEA 1Z0KA 3EA7A 2R6AA 2V6NA 1W36D 2R3UA 2XXAB 5EP3A 4A92A 4BXSA 1ANDA 1GJ7B 3M61U 2BD7A 1K1JA 1ESTA 4ZXXH 1UEJA 3K09A 4GHTA 1V2VT 2D26C 3F6UH 4OS2A 4LJYA 2FYQA 4ABGA 2Z43A 4FUCA 5HE9A 2GCPA 3ZGXA 1EG7A 4FWIB 3ZS9A 4XBDA 3G0HA 2GDDA 4ASUD 1J8AA 1P8VC 3GY5A 5EE9A 2OC8A 4HZIA 1DWEH 3A7ZA 2ZDVH 2DHRA 1BOFA 2DYKA 2BOHB 4TYWA 4JIMA 3A1WA 4RFSA 3EC2A 2BHGA 5AF9H 2J0SA 5G3ZA 1E2MA 3CRVA 4AI6A 3DHKH 2TBSA 1OWKA 2JH0D 2ZKSA 1N5IA 2WKPA 1S96A 2GP9B 4URVR 3FOZA 3RXMA 2ZEJA 1YPHC 1DY9A 4JKYA 5FL3A 2AKAB 1DO0A 2VP6A 3BOSA 4Q4HA 4GPGA 3G82C 1U0LA 5L3SA 4EJSA 1R8QA 4CR5A 1P9NA 4FI3C 1O2OA 1IHTH 1UTQA 2W6JD 4NP6A 2DWOA 3A4LA 4AORA 4MGZR 2VIQA 3B23B 1SVPA 2NTYC 3ZZUA 3PVSA 2ZU6A 3EQ0H 1P2JA 1H65A 2VGCC 1BITA 3HP1A 1MH0A 2BKEA 2WMOB 4FD2A 2WPMS 2V54A 5E3HA 3LPRA 2BXTH 4AG6A 1DDJA 5CLLA 3W34A 4OI1A 2BDGA 2IHYA 1K28D 4D6PA 2OC0A 1TAWA 2DE9A 2Z7FE 3NKKA 1AM4D 3EA0A 4QGGA 4HDOB 2C93B 2UUFB 1C9PA 2ODQA 1E99A 4ZCIA 5BN4A 3GY3A 1C5SA 3QPUA 3SNDA 4NIYA 1EK0A 2OILA 3C4JA 2P93A 4GUXA 2C04A 1GHXH 4PSAA 3EDXB 3SU2A 4DCVA 4VGCC 1O2PA 1SGQE 5JB8S 3HPRA 5HCIA 1ELGA 1SKQA 3BIFA 4EPWA 2ZDMA 2JASA 2UWLA 4UDWH 2ZVQX 5HKKD 1C2KA 3DKVA 1M7BA 4FVDA 1XEXA 1D8TA 3OFNA 1NKSA 2FS9A 2NU3E 2R62A 2FDCA 5LGOA 4HZUA 3LFUA 2ZJZA 4YZUA 4F4JA 2WOOA 1OPXA 2NO9A 2XXLA 4ZO4A 3FAOA 3U9AH 1P2VA 3PV5A 1SG8B 1T8TA 2H1LA 3IDQA 1HAZB 1S6FA 3K2UA 3SJKA 1V2LT 4IVQA 2ECKA 2UUYA 2UUKB 2STAE 1TBZH 1AKYA 1G8GA 1G9IE 2P3UB 3K0AB 5I25A 4Q4HB 3UMSA 3D49H 2F1RA 5D3QA 4IHQA 4A4DA 3PITA 4B3CA 4D81A 3NWJA 3B9QA 1H9IE 3TJZA 1V2TT 3UIEA 3VR5A 4YC7A 3TQFA 1P2IA 3A8TA 3NXSA 3SNHA 4ZKRU 1II9A 1BTZA 2BBSA 3I77A 3LW8A 2Q6FA 3QEJA 3DM5A 1W13U 2XJ4A 1MTSA 1TBQH 2B92A 3OEHD 5FL7A 3SI4H 1NN1A 3UREA 3M3VA 1GBBA 2J2UA 5GCHG 2J7PD 4E05H 3ZLJA 2Y80A 2NIPA 2A4QA 3B1WA 1RRFA 1TNJA 1DAIA 2C8ZB 2D8WA 2AD5A 1P62B 2FWRA 3I8SA 6ESTA 3L43A 4URWR 2GZHA 3RRYA 3CWZA 3ZS8A 3MSXA 2FOEA 1TALA 4Q9IA 4NA7A 3PQCA 4R98A 5SZHB 4Q4JB 2WUCA 3T62A 5FI0B 3BWDD 1XXDA 2A9KA 2FZ4A 4JS0A 2VP4A 5EUQB 1K1MA 1OFTA 1C4Y2 5T6DA 1O2QA 1A2BA 1SVIA 1EAWA 2VB0A 5TMPA 1WBBA 3ZV8A 1G64A 3SV8A 4US2R 2ZHWH 1GI3A 2FF7A 1DFPA 3MLEA 3I61A 2ZE6A 3F8TA 4CRBA 1O2XA 5BXQC 2FZZA 2D74A 2PHBA 3CX8A 1A5GH 5C5NA 4TZ0A 5A0BA 5EU8A 5L2ZH 4TL9A 4JYTA 1BIFA 1E2QA 3BTWE 1PPEE 1Z0IA 4WZBE 1D3TB 3E90B 3TK1A 4NCNA 1G20E 3I73A 4NDZA 3RWMB 2WSSA 1ZTKA 3BE4A 4DIHH 1WQVH 1GCTB 1GI5A 3KUDA 4J1YA 1KI8A 3RS3A 4JJKA 1R0YA 3RXJA 4HSEA 1E38B 4XD7A 3GDVA 1ABJH 1MZAA 2W58A 4KJZA 2Z94A 4BAQB 4ACBA 5GIBA 3QKUA 2UWPA 1P01A 1GL0E 4RJLA 4LHZA 3ICQB 3UQVA 5F03A 5JS7A 5C1XA 1S4QA 4MNYA 1IOEA 3MO6A 2D2DA 3QXCA 3Q00A 2H18A 5E0GA 1ZR0A 3KTAA 4L8GA 2G5NA 1V2WT
chains in the Genus database with same CATH superfamily
2VF7A 4JXKA 4M7WA 2EEKA 4BQQA 3AW1A 2PPLA 3BSYA 5JCXA 1SUSA 3ZZ5A 2RHHA 3UT5B 1BVHA 1EESA 3EY4A 3ICPA 4UFEH 3IUMA 4FHCA 3QVOA 4QU8A 2X5JO 1Z06A 2H29A 2BFDB 3SYRA 1YZVA 3OSUA 4JV5B 2Z2ZA 2ZU0C 4YCSA 2CNBA 5DN9A 3L2OB 3T26A 1X38A 5CLHA 3ODFA 2C61A 2V7VA 3QYAA 1LWNA 1EPUA 4Y0AA 4DS3A 2ZEBA 2FW7A 1L1EA 2PUAA 1QLJA 1II8B 3F3BA 3ZVCA 2ZXFA 5T64A 3IDOA 1GHAG 1P5RA 3UEOA 4L9WA 2GPBA 3L46A 3PHLA 4OFXA 5J2UA 1PT9A 2R87A 2Q6KA 4NAVA 5D86A 4RKQA 4ZT6A 2FR0A 3OOWA 3L02A 3CO0S 3CS7A 3TH4H 4HGCA 3V7UA 5T3HA 1AUXA 3FF4A 3KT8A 4MS1A 5ETJA 1NAIA 4ZHQF 3GFTA 3ER9A 2G36A 3E9MA 5SYMA 2HDNB 1GPKA 2D3TA 3W3AD 1BGVA 4RA9B 4FB4A 1GMHG 1BJRE 2HK6A 2J6CA 3BD6A 1Z0DA 1S9HA 5J4QA 4W6QA 3WJ2A 1RMYA 3PXBA 4A1TA 2W5UA 4FFMA 1KMMA 2VXYA 1Z15A 1IJEA 4OS6A 1T0BA 3DTYA 3TZHA 3OY6U 4D57A 1KJQA 2ZCKP 1N2CB 4GD3Q 4Q3NA 5ANRB 2VQ3A 4MGIR 2O20A 4FEYA 1V2MT 1Y8CA 2PKWA 1Z6XA 3OC6A 5FA8A 1I30A 4XWOA 2QKYA 5L3VA 4E4YA 2F4VB 4P6VF 1KGSA 4KPUB 4HB4A 4Q5IA 1JHZA 2AMJA 4D02A 5JADA 1Y6GA 5FV7A 1U8YA 3LYLA 4K86A 1NLYA 4C4RA 3V4LA 4F3NA 2A32A 1A9TA 3TIIA 4AN7A 4XWGA 4DXDA 2X40A 1NN0A 4D5GA 4EGSA 2IZ7A 4U9IS 1DI0A 3IXLA 2PKAA 2GDZA 3P52A 4FKZA 5EHGA 1XZKA 4FFRA 4CMJA 5C80A 1AMUA 3W3ZB 1KQFA 2V9ZA 4O2BF 2H5IA 5C4IA 5FRDA 2A92A 2F3QA 1ETTH 2QENA 2Y76A 3BEOA 4PANA 2W42A 4YJDA 3OT5A 1DKPA 4KMRA 3WQBA 1AQJA 2C8XB 3G1TA 3PQ4A 4HH1A 2G08A 4RA9A 2CN1A 2VPXA 4RU1A 4D9GA 9ATCA 3INYA 4Q3AA 1MB9A 5DNYB 5GOTA 1AVTA 4OXNA 3QE2A 3OLQA 1PJQA 3KAPA 1ZICA 4HXEB 2ZR7A 2X9NA 1I4LD 2P16A 4F85A 1Z8DA 3GGDA 5AVYA 1ES9A 4I6EA 4KXVA 5U4XA 2Z9JA 3DWGA 3S1LA 1P1RA 4D7AA 1GHAF 1NPMA 3PE6A 2Q2NA 3QV1A 5LD2B 2ZUBA 3FYUC 4R2IA 4EB6B 1ZQ1A 3TJUA 3JV7A 2VTDA 4IG9A 4JUCA 3WIOA 1KK3A 4K26A 5HRCA 2OESA 5F98A 4GVUA 3N8IA 4OQFA 4BEJA 4X90A 2I2BA 3PC7A 2Q1XA 4V1CI 3IKTA 5EMKA 1I6MA 5CBPA 3GYLB 3RFVA 1KMQA 2JJ2D 3ZZ1A 3JD3A 2QSJA 1NQ5A 1CB0A 1YHNA 2YIVX 2C7BA 2R85A 3DMFA 1XXHA 2PXAA 1KIMA 2ZWVA 3PV0A 1RVDA 5LWQA 4LJAA 1LI4A 1OX5A 1BTWA 1CYDA 2CGEA 1FS4A 4WNYA 1UTJA 2ZUVA 4UHKA 4XRRA 2CHAC 3STYA 1TF2A 2FP4B 2OP9A 1R2QA 3CJRA 5EP1A 5HYVA 5IW8A 5TARA 4ZMSA 1E9FA 4CM7A 3S5JA 1PJ8A 5JAUA 4RTPA 3L3TA 1WEHA 3EC1A 4RTMA 4YJ2B 5G4BA 2YZNA 1JHRA 1EMDA 2GEUA 1JJVA 1P3JA 3HR8A 4KK4A 4MOWA 4UDOA