4B73A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
645
structure length
645
Chain Sequence
b'GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 209
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b73A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b73A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b73A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b73A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b73A03
3MG9A 2SFAA 1O3DA 4MNVA 3GCHC 3UK6A 2HPPH 3SGAE 4A2QA 2ANBA 3T61A 2YWEA 3W34A 2R8RA 5EP3A 1JQJC 4CRGA 4WH8A 1P6XA 4QGGA 2D62A 3DA9B 2GCTC 2PBRA 3THYB 1BB0B 2DE8A 2XC0A 2ZFTA 1T8MA 1UEJA 1RJ9B 3NHBA 2BY5X 1TNGA 2GGVB 3K0SA 5BWMA 2CGAA 1SVLA 4D0NA 2IK8A 1S6FA 4DT1B 2V6IA 1KSGA 5B2ZA 4Q02A 2VBCA 3RXHA 3DZ8A 1I4DD 4K81B 2R44A 1G7CA 5DI3B 3GFOA 4RZXA 1XTRA 4QJ4A 8ESTE 1OWJA 1JBKA 5AFYH 2P5SA 2YWFA 1C5WB 4OHWA 2GZAA 1ORFA 3MO3A 2CMKA 5F03A 4CGZA 4TMKA 2BBWA 1XBTA 1GHZA 2A45B 3FGNA 1VITF 2MSDB 4OJQA 4YOGA 4P33A 2FTMA 5JBQA 3B1YA 5G4BA 4AB9A 4TTQA 2JETB 1YZUA 4CH8B 3TGKE 1NVWQ 4L5BA 5DP7A 3TK5A 4XWOA 4Q7LA 2Y81A 3TRFA 1EAUA 4Y8YA 3I4LA 3VNUA 3K2UA 1VHLA 3AP2A 3BEFB 1TX4B 2QXIA 3SZNA 5JS8A 1OE0A 1VZQH 2SGDE 4AGKA 1G3DA 1D6WA 3BB4A 4A1XA 4RVCA 4BTTB 5LGOA 1BS1A 2WIBA 3HGPA 1SXJA 1XUHA 2XRCA 3UATA 4TL7A 1GL9B 4A2WA 3BTGE 1W2GA 3QI2A 3H4MA 5EXPA 4FMDB 1LF5A 2ZITA 3A1UA 2VRWA 1HV7A 4DDWA 2A1DB 1JXPA 2C9CA 3LLUA 4KLNA 3U44A 1TNKA 1CLUA 2XJ9A 1VG9B 4FCTA 5HE8A 3ZV9A 4PZYA 2Y6TA 3TGPA 4DUGD 3DT0H 3RWMB 3AB3A 2WOJA 3RXDA 1W48A 1II8A 4K8BA 3ENSB 3ZVEA 3AQ4A 3ADDA 3THWB 3NBXX 3ADBA 1MKWH 1Q1ZA 4MRVA 1KNQA 4AOQA 3KQUA 3UG7A 3EZ7A 2OV2A 4FCWA 4DIHH 1G1MA 3JZ1B 4IXMA 2HLDA 4H9GA 3BC1A 4J1YA 3CR7A 3BH6A 1SHHB 4WIAA 1HURA 4CF7A 1Y3WA 4JZDH 4LYAA 1LPZB 5AJWA 3PMBB 1EB1H 2Q3HA 2Y5HA 1LVGA 1SGQE 1GI5A 1S84A 1Z5ZA 1BMFA 4D4MA 3WRXC 2C03A 2BEKA 2H1UA 4A0RA 1L8QA 2WUCA 2FPKA 3A6PC 5F8ZA 4HZUB 1ETSH 1V6DA 5D3MA 2AERH 3VU9B 3F6UH 2IS4A 1AWFH 2WWHA 2RCEA 2XWAA 2BVNA 2ODBA 2P3SA 3B7GA 1AN0A 5FL7D 1A5TA 4JKYA 3R3GB 1O2LA 2QTFA 3AP3A 3DZDA 2VH5R 1YLDA 1KSFX 1GG2A 3OY6U 2OQUA 2D3WA 1TTTA 3X1WA 3TITA 4N3NA 1OYTH 3QKTA 2R3YA 4DLSA 1PFXC 1PLLA 1OT3A 4QM6A 2G51A 2OLJA 1O2XA 4K1TA 4UE7H 1E9AA 1DWEH 3W9YA 2WINI 3QO6A 1KDTA 2QI9C 3TBKA 2J4IA 2V54A 5JECA 4AYVB 2IYVA 5F8XA 1XP8A 4DEXA 2BBTA 3GLHE 5AF9H 1U94A 3H2YA 1AM4D 4CREA 3SUFA 1NG1A 4A1FA 1DLEA 5C1UA 3PUYA 1QQ4A 3EDXB 2ZR7A 1HJ9A 1P2NA 2ZFRH 1W5SA 3NVAA 4HDOB 4EPXA 2FODA 2SHKA 3FDIA 1T9HA 1A82A 1MBMA 5AJXA 5DK1A 4ASUA 4Z51A 1WBGB 1LHFH 2ZJ5A 1TMKA 4KVGA 3THXA 3AKYA 4WY3A 3F3YA 4QJ5A 2BD7A 1HGTH 2OP9A 2VHTA 1H1BA 1ZJKA 1BUIA 2JATA 1ELCA 4KTUA 1C4Y2 1S5SA 3V3MA 1OYWA 1T4UH 1ZNYA 3AASA 1UHBB 3PYHA 3U7EB 4RJLA 1AQ7A 3MWLA 1OB2A 5LB4A 2VF8A 1OSSA 3A89A 7KMEH 4O2LA 2WM9B 3SZRA 1M6NA 2WJHA 3ZS9A 1COWA 3K0EA 1ID5H 1BOQA 1GPZA 4HAXA 3IG6B 1I4LD 2GK6A 2QENA 1C1OA 4AX9H 4NYIR 5EE1A 1DAIA 1PVOA 2K1QA 1CU1A 4LHZA 2P94A 4BFZA 3A83A 4IMQA 4QXAA 1TQ0B 1AE8H 1G3MA 3KFXA 4C0KA 3DEFA 2R9VA 3K09A 1TMTH 1TGSZ 1ZINA 1P01A 1AK2A 4P4TA 1E0SA 2CJWB 5E3HA 1RXPA 1BMAA 2P6NA 4L9WA 3LXRA 3EPHA 3RS4A 4PSVA 2ZSAA 1F48A 3BTEE 4JLOA 2BBOA 1ANCA 4D4LA 2C8XB 4II7A 4PAMA 5EU8A 3FHOA 2XB2A 4ESVA 5H1YA 3OYPA 3SJ8A 4LBWA 2BX4A 3B5JA 1P11E 4OS5A 3BIVH 1BTZA 5AK0A 1PQAA 1T3HA 4B3CA 2RB4A 2ZHQH 5CHAB 2WAYA 4RKJB 1LVOA 1U9IA 1G4AE 1Z6TA 4BLPA 3QUSA 4A82A 1Z6YA 3U69H 4HZHA 3A88A 2R6CA 1E9RA 2GETA 3NBYC 2IS6A 2NO6A 1HYLA 4TY7A 1Q1BA 4TSFA 3KN2A 1ZJDA 1QJ1B 2VP6A 4HLUA 3KNXA 2G00A 1X8KA 1AJEA 2FV8A 4YM9A 3NIBA 2Q6DA 3PV0A 1N6IA 1DE0A 4KBFA 2W3IA 1T8TA 1JQLB 4AG5A 1AQYA 1AVXA 1E2EA 2QM7A 1NNEA 4FU8A 2OD3B 6ESTA 4I8HA 3TKLA 3K0FA 3PMHB 1CT4E 2PT7A 4C7OB 1ZGIA 2VHJA 3CPJB 2GDDA 1SQTA 1F6BA 3A58B 3MNCA 3GLHB 4LRWA 2CMYA 1C1VH 1VYVA 4LHVA 4MKIA 1S9DA 4Q7XA 2VIIA 5DNYB 3PUXA 3REGA 1DITH 1EX3A 4U2WA 1FN8A 2H5EA 4OS1A 4HUQA 1YGCH 3LOXA 2HDNB 2HJVA 1O2QA 5CITA 4ASHA 4DW2U 3MO6A 4D82A 1S82A 1OXUA 1GSIA 4Z1MA 1IN7A 3L6PA 1RC8A 5SGAE 1EFHA 1P57B 3VXFH 1YM0A 5JBCS 2P6UA 4PC7A 2ONJA 2WPKS 3B9QA 5IDKA 1NS3A 3NZIA 4IW4E 4Q03A 1GI8B 1TA6A 4BAQB 3UXMA 3QVVA 1O39A 1J8AA 1SOZA 1NT1A 1S1MA 1W44A 1TWXB 1T6NA 4A0HA 2AK3A 1OP0A 1W47A 3GY2A 1G291 2OC1A 5AFZH 3E8LA 2OC0A 2PLFA 4R71A 3CM0A 1QJ7B 1GGDB 1VGCC 2TRMA 3GJXC 4BLOA 1J2JA 2ERXA 1QJ6B 1WB9A 1BYIA 1GNQA 3SW2B 1J7KA 5JFGA 3SJZA 1P2OA 1V2VT 5E0HA 2EFDB 2ZGCA 1CTQA 1DAHA 1TNLA 2IS2A 3LJOA 2GXUA 3ZVAA 4NG9H 3GMTA 4KODA 2PJRA 2SGQE 4QHTA 1VKJA 2G81E 1RYHA 2C8ZB 1KI6A 3SGQE 2P3UB 2ZTXA 2ORWA 1WDTA 2IYWA 2BZAA 2BD5A 3A8DA 3A7YA 1ZIOA 2C96A 2P6RA 1D5CA 2XBWA 1ZOMA 3ATMA 3UFAA 1O37A 4YESB 3U3OA 2ZR9A 1V2UT 1PJRA 3KJIA 2H18A 1XD2A 3TMKA 3DHKH 5A8ZA 1JJVA 5CDFE 1TQ2A 2XOKD 4S35A 1F5LA 2BV3A 3H86A 4EQ6B 2YJTD 1HAYB 1KO8A 4TN1A 2CV3A 4PTLA 4NYIQ 2BY7X 5JBTA 2J0VA 3ND9A 1F2TB 4KV9A 2HVXA 4I33A 1VPLA 2A5FA 1FN6A 4CW7A 2NMVA 4DCSA 4PPQA 4PAOA 3RLYH 3GCGA 2BMFA 1BTXA 4IEIA 4ZMAH 4MYCA 1VCPA 2FMXA 1Y3UA 1A1VA 1TADA 1TNJA 2D1JA 1OSNA 2GBLA 1D9ZA 2JDID 1S9HA 1LHGH 4WVFA 4W5WA 1JB1A 2BD9A 1P9SA 4OK3A 1GKUB 4BOHA 4GPTA 3TPIZ 2R0KA 3VMFA 1UKYA 2VVUA 1HUQA 2GTBA 1HIAA 2IXEA 2ZCKP 2GAOA 3K9LA 3GLFE 3UMFA 2NTYC 5LD2C 4A4DA 1OIVA 3Q3JB 5DKMA 3CRRA 5JB8S 1YE8A 1ZRBA 1C5ZB 4DLYA 4WMEA 3BTTE 3H7OA 5HTKA 3W95A 3Q85A 4Q7ZA 2ZJYA 1O2SA 5CM8B 4X1PU 1WAYB 1EWRA 4ZO4A 2XBYA 3PEVA 3S9AA 1G3UA 1WBDA 2VWNA 3FMFA 2G83A 3BG4C 3S1AA 3EIEA 3KKMA 4MLFB 1HA3A 4UQOA 2ECKA 1JEEA 2GILA 1SVPA 3X2SA 4CR9A 1N5KA 5J5CA 1GBAA 2TMKA 1L1NA 5GPIB 1CHGA 3ASZA 2TBSA 3AVPA 3QKRB 4GLYA 1C5PA 1NN1A 3HPTB 4Q7MB 1DAGA 2H9HA 2P3TB 3V13A 3TAUA 5EQSA 5DYIA 2WVJA 3FHCB 3TNFA 2F9OA 1RFLA 2LKCA 2KAIA 3FP8E 3ZZDA 4BRUA 2FDAA 2GJ8A 1KY9A 2R2WU 5FUXA 1C2MA 2FP7B 2QUZA 2QG6A 4DHEA 1US8A 2BC9A 4NCNA 5D3QA 3I5YA 2ZI2H 2J34A 2FE4A 1IQIA 1D4PB 2CHAC 2RGCA 3ZZ5A 1AIPA 5GCHF 4A0GA 2BOHB 1RTFB 3K0CC 3MSXA 1TRMA 4Y7BA 2WPJS 5KDOA 2F1JA 2O52A 3AVUA 1R5NA 3TQCA 1TF7A 4GBMA 3D31A 1C4U2 3VB6A 2OZEA 3ELAH 3RMOH 3UWOA 1DTSA 2QF0A 2FOFA 1NIPA 5EXSA 3SNBA 1K9OE 4DURA 1C5RA 2WWFA 3EQ0H 5LPEA 4HEJA 3OZXA 1E96A 4TY6A 4FXPA 5JRJA 5KTYA 1C9PA 4PZZA 5CM9C 4IC6A 2QT1A 4D0LB 1PPFE 2P16A 3TH4H 4V0LA 4FUHA 1O35A 3IBGA 1HAPH 1YPHC 4O3UA 1OHHD 4CEHA 2AGGX 2ZYTX 3OAAA 1HLTH 4JL8A 2FYQA 1V2ST 5IK2A 4MDFA 1YZNA 1TIOA 4R8TB 5CYOA 2QAGA 4K69A 2QMUA 2HF9A 2HEIA 3KL6A 3A8TA 5EOKA 2B8WA 3RM2H 4UONA 4CVNA 1E9SA 2RGGA 5GWZA 3MMPA 4Q4HA 2THFB 1ZM3A 4JLNA 4FWIB 4D81A 4KU4A 3C14C 1N8OC 5L2ZH 4WXPA 3TLXA 4IVRA 1MTNB 1ZJ6A 1TOMH 2IN2A 2SNWA 2D8WA 4DIEA 3QXCA 3ADKA 1EK0A 4WVPE 1A2KC 3GLFB 2J9RA 1VCWA 1Q2WA 4QFMA 2ZQ1A 1R8QA 2EI7A 3EZ2A 4BQSA 4BTUB 2DFLA 1F0TA 2ZJ2A 4Q9LA 2HYIC 1CR0A 4ACBA 4ZCLA 3SUDA 1HXFH 4HB4A 3CRVA 3FMIA 2PT5A 2WIAA 5KNDA 3U6KA 1DVAH 4P4SA 1GDUA 2GT8A 1G7RA 5DP4A 2XEXA 1JR3D 2REXB 1V2RT 2ZIQH 1E4VA 1IHUA 2F9VA 5JHHB 4NU0A 5FI0B 2HNTC 5FOUA 2XZLA 2GZ8A 3UREA 2NGRA 2ZGXH 2V7QA 3ZYCA 2DYKA 4L4UA 1GJ5H 4ZIRA 4UFEH 2CLDX 2ILNA 3OIVA 4CT4B 2GXQA 1BT7A 2VSXA 4W9MC 1Q31A 9ESTA 3ITIA 2OBQA 4LBYA 1P04A 3G5UA 2B7DH 3N7OA 1GL6A 3ZH9B 5EUQB 4B2IA 2BOKA 3MH6A 2D4HA 4ZDJA 2X77A 1T31A 4P31A 1S1CA 1VJ9U 3M37A 2BYAX 2E87A 1QB9A 1ODFA 3A4NA 3THYA 3GJ6A 1RJ9A 3KXIA 3DFLA 1TABE 2V6NA 4EFMA 1XKBC 1P2TA 4DT1A 2YOFA 3FFAA 4B48A 3SNDA 3HU3A 5J47A 2VGCC 4US1R 1O3EA 1N1LA 3KTAB 1JR3E 3IIMA 5DI3A 3T1QA 3KJHA 2GJ9A 1PPHE 1KDQB 4A7IB 4Q1AA 3UOPA 2RMKA 3EARA 2LKDA 3B85A 1V2PT 4ISOA 4TMVA 1R0ZA 3UR6A 4B44A 4WZAE 1P7CA 1O33A 1P3EA 4AYXA 1SKYE 1ZPBA 1G5PA 1WXQA 1KKLA 2OC8A 1E2QA 4LV5B 4QBIA 1RRPA 1RD3B 2YV5A 2EFHB 1XZQA 1QVAA 2BDIA 1CJUC 3H0KA 2F9BH 2WWYA 2L0XA 3DM9B 2G77B 1C1WH 1ZPCA 4F4JA 1NZQH 3DUXH 5AVDA 2DHRA 3FAOA 2J2UA 1XEWX 3RUOA 2CL0X 1O5AB 1AB9C 1O87A 4O9VA 1IQPA 3HPQA 2J0QA 2VF7A 2OM2A 2EQBA 3WMEA 4C4PA 4NP6A 1O38A 3ZVBA 1MQ6A 1RYFA 1C2LA 1GI9B 1W7AA 4YO9A 5IDVA 1KK3A 5ANRB 3WY9A 1E79A 1QBKC 1RIWC 1YVDA 3W6PA 4MTBA 1IAUA 1JOUB 4DC9A 1P2QA 5E0JA 5LPFA 3ZD7A 2RKOA 3O47A 3RSOA 2IX3A 4TYWA 2B92A 2ORVA 4M53A 1CF4A 3B60A 3MO9A 2PZFA 5HKKA 3ATWA 4LV8B 4OGYA 4Y8ZA 1GFIA 4MRRA 2BD8A 4DIIH 3RXJA 3IEVA 1C1MA 5GVSA 2XNDD 3QTVH 1N5LA 2CLCX 4H6SB 1XTIA 1P9NA 3JZ2B 1XU4A 4EPVA 3HU2A 8KME2 2H16A 3THWA 1SGFA 2ZFSA 4Q9KA 4YOJA 1EQ9A 2HPQH 1SQ5A 2FI4E 1UK3A 2G8TA 3FWYA 4O0MA 5KDDA 3EAJA 1MQ5A 3U4QB 2XCNA 1CEEA 3KZ1E 2AK2A 3CX8A 2JLSA 1DY8A 4DSNA 3WBJA 4NL4H 1Y3VA 2GEUA 3LBNA 2FYRA 4M9XA 1LHDH 4KCGA 4GP7A 5E2OA 3U98H 1V2WT 1DWBH 2ODQA 4YMUA 1T7CA 1KZGB 4HZUA 3T35A 3W6NA 3NDBB 3ZV8A 3EA9A 4X0WU 1IN6A 3TUIC 1VGCB 1C1QA 1AI8H 2OK5A 1CGHA 3VU9A 2WUBA 4F7WA 4KHZA 4EDHA 1QVRA 3TH5A 4YLUA 3K09C 1SZPA 4I31A 4L8GA 4I8GA 1KI7A 2PUQH 1NMYA 3NWJA 3LT3A 2N42A 121PA 1P2MA 3TLOA 4AFQA 1AS3A 4URUR 2BDAA 1NJGA 1ESAA 4ESTE 4MYTA 4WBSA 3EA8A 5HM9A 1BIFA 2WPLS 1EXMA 4WZBE 1SHYA 4B43A 5CJPA 3SYLA 1C1UH 5CB6A 1KDOA 3QK1A 4NMMA 3TSWA 1R0XA 4PPGA 1P02A 2YOLA 4Z6AH 4JSTA 2ZCLP 3HYRA 1MO6A 3SFZA 1AFQC 5EZ6B 2NOAA 1U9IC 1NVVR 1UADA 3X1ZA 1A46H 5LBIA 4FUDA 3ZS8A 1K1PA 5DSZA 1SKYB 2P95A 4IKEA 3BORA 5K8IA 4NA8A 4QOSA 4CHAB 2FZLA 3RS2A 1YPHE 2BY9X 1ZSLA 3BERA 1LVYA 4IN1A 3EPJA 4G5GA 4LZZA 1UBFA 3CPEA 2ZU1A 1ZM4A 4XD7A 4Y71A 2NWNA 4DCTA 4YTAA 4HLUC 1QRAA 1MKYA 2ATVA 4MG3A 1DY9A 4J0QA 1KJYA 1PPGE 1Z0DA 3TSOA 1C9TA 2GF0A 3KQBA 3MD0A 1VJAU 2C3SA 3AW1A 1SBWA 1C2EA 1GI0A 4B33A 5C2JB 3FZDA 4ZPXA 3AUXA 1HAVA 4WXRA 1W0KA 2NO1A 3CO5A 1AMHA 2AGEX 4DLXA 3P32A 1TMBH 3T1VA 5A5GA 4CEJB 4Z8YA 1YQTA 1BTHH 1UHBA 2AMDA 4UNSA 1LS6A 1VCOA 5LD2B 4KP0A 1P2SA 3AVTA 4PQRA 1MD7A 2XXAB 1DARA 4HDCA 2IJD1 2F9MA 3WNBA 4DXAA 3IHWA 1MAYA 2EYUA 3U3JA 2V9PA 3GY3A 2VLIA 3R9XA 3QGJA 1E0FD 2AD5A 2QPOA 1T8LA 3VGCC 2O8DB 3F9GA 2HLDD 1UO6A 1MTWA 4X8HA 1A5IA 1P2KA 4OKSA 2YINC 3VR6A 1C2KA 4AIIA 2ZE8A 3RU4E 5AUNB 5HE9A 1QB6A 4X1RU 3BG4B 2HNTE 1BMFD 2CJWA 3QEJA 2BM1A 3C15C 4MRNA 3ND8A 4US0R 1GI1A 2ZREA 2ULLA 4DLTA 1Y3AA 2V0BA 4MUAA 3URDA 4DRZA 2ZKSA 3HWSA 3UIEA 3STIA 4E7RG 1TBRH 2STAE 3N70A 4FU7A 4BAOB 1WXRA 2ZO3H 4IVQA 3SJKA 2NU2E 5L6NH 1WBBA 1BJVA 4D8NA 4OYHA 4WZ6A 4UDWH 2A5GA 3TJUA 4DG4A 3ZDQA 5C46F 2GZHA 4Q9IA 1SVKA 4FU9A 1MH0A 1THRH 2OBOA 4CRDA 5B58C 5FTLA 1O5EH 3F9FA 3TQFA 1NI3A 3L43A 5L3SA 2IBMA 3K9GA 4BFXA 1KJWA 5H70A 5C18A 3CPHA 1DWDH 4TWWA 3ONWA 1ZNWA 1SLVB 5KHOC 1FDPA 1ELOA 3OY5U 4Q1DA 2GKSA 1KY2A 5BYKA 1T4VH 1D3DB 1OIXA 2W2XA 4AURA 5EPNA 2B7BA 1J15A 4QT8C 4NE2A 2IYQA 4EPRA 2TGTA 1CR4A 3GCOA 1FL9A 2PKSC 2VJ1A 3KCGH 2CF8H 2ZFFH 3HKIB 2GD4B 4O97A 4ERNA 2D2FA 4MQBA 2KWIA 4W7SA 4ASUD 1G64A 1DUEA 3KKOA 3REFA 3WNCA 2H9TH 5ELXA 2CHGA 1FFHA 1MAXA 3LONA 3CF2A 4PSAA 1O3IA 1JJ7A 1RFNA 1W13U 2A30A 4H6TA 4I8KA 1O3NA 1L1JA 2OCVB 1SVWA 3NWUA 2GDJA 3ZIAA 1EAIA 4X2XA 1UK2A 1NLZA 1NO9H 4H42U 1N8OB 1TEXA 3MNBA 1QL8A 1COWD 3BGWA 3MH5A 1UVSH 1NVVQ 4TWYA 2BCGY 1T5IA 3LNCA 4IDPA 1U8AA 4M9QA 3P26A 2EFCB 2Q3MA 4JLKA 2CVHA 4BTIB 4L15A 1XMVA 1ZM7A 1IONA 4MVNA 2Z4SA 4Y6DA 4C2TA 1NN6A 3ZQ6A 2XAUA 4Q48A 1S8FA 2CXVA 2OG2A 3BWDD 4OK5A 1K6MA 1C1PA 3EYDA 1K1MA 1FNMA 2OXCA 2OXRA 4MKGA 2QA5A 5H4IB 2VP9A 1QCPA 2WSSA 1DX5M 3DD2H 3MMGA 4X2VA 4LJ4A 1XUIA 2ZS8A 3LY5A 4ZKEA 4IOJA 4I7YH 1K5GA 3M5LA 2ZEBA 4OJKA 1WU1A 5EODA 1HAXB 2FEQH 4CRAA 2W2VA 1BTPA 3B82A 3ZZCA 1F92A 4Z54A 1UTNA 2W58A 2QU8A 1OXGA 3M5OA 1GG6C 4NA9H 2CEAA 4TWZA 3B23B 2PX0A 3GJ7A 1Q1EA 3SUEA 4TSFD 2WJVA 4YONB 5F9HA 2FLRH 3CH4B 4A0FA 1OIWA 1NU9A 4E5UA 2ZG0H 1F2TA 1N0UA 3T15A 3K1JA 4G5SA 1TQDA 1TRYA 4R9UC 2X8AA 3FFBA 3A7XA 1W8BH 4GVUA 2ZSDA 1KGDA 2EFGA 1VYTA 3G82C 1RTLA 5DHFA 4ISHH 1YCPH 1VR1H 3QTOH 1GBMA 4TMXA 3KHVA 1BJUA 4Q9HA 3I3SR 3FYHA 1SOTA 4MGIR 2FMJA 2CDNA 1IOEA 2F3TA 1BRAA 3BIFA 4DKXA 3UQVA 4ABJA 1J9CH 5KDLA 3NXSA 2SGFE 1TF2A 2GRJA 1ZUIA 1BQYA 2XNIA 3GLGB 1CULC 3NH9A 4AKEA 3CRW1 3FZZA 2RGEA 3UNQA 3HYTA 5TCCA 1JR6A 3A87A 1ELVA 3BXZA 4Q1EA 2W2TA 4Z1MD 2AKAB 1SLXB 3SGBE 1SL3A 2OBNA 3KQHA 4LZ1H 3SJ9A 2AFIE 1MRNA 1K1JA 1TA2A 1UM8A 2SGAA 3RMMH 1JALA 1TLDA 1FMGA 2ANWA 4E03A 4ESHA 3MH4A 2QTHA 1LY1A 1PQ5A 4X8MA 4JLPA 4TMTA 1AB9B 1PPBH 1ESTA 2KSQA 1UCYK 2J7KA 4MRSA 2VP0A 3CWZA 4NCHA 2QCYA 1WYKA 3LV8A 1XUGA 2V6JA 1E2HA 1QR3E 3MFJA 1MU6B 5F9FA 1RIWB 2W7UA 3QKRA 1WTHD 3K70C 1BA8B 1O3JA 2HOBA 2XGJA 4HB2A 1CR2A 2ZRJA 2HT1A 1LMWB 4URZR 3EXAA 3BBPA 3SQWA 2Y7XA 1QBNA 3P8FA 1ZRHA 4X8TH 1R5OA 1W10U 2F3RA 4BANB 5SZKB 2NU0E 3SHFA 2QY0B 1ELTA 3GDUA 4P0TA 2BY6X 6CHAC 3KB2A 5EQRA 4X6NA 3SV7A 1KI4A 1OWEA 4MUBA 1K2I1 3QUMP 2OBLA 2O8FB 5BRRE 1NKTA 4NFFA 2NO9A 1DPOA 1L0ZA 1THPB 1DT2A 2AWOA 1P05A 3R8CA 1KO4A 3B1ZA 1X6VA 2ZDAH 5GVRA 4THNH 2FX6A 1KIMA 1LVBA 1IQLA 4ZDIA 2XJ4A 2FOHA 2WPDA 4WXVA 2QQEA 4AB8A 2CF9H 1RIFA 4ZI3A 3LBIA 1SGPE 1UBEA 1E0JA 3MGCA 5HCIA 1ONBA 1XXHB 2WOOA 1ARCA 5CDFA 1CA0C 1EB2A 3NUMA 4K1SA 3VB4A 2I3BA 4B73A 5F2EA 3GLIB 1IY0A 2HYDA 2ODNA 2FS8A 1W7XH 2VWLA 2FFAA 1Z0IA 1T8UA 2OFXA 1SGIB 5TJXA 3RYTC 1QHNA 1W0JA 4FVBA 1HFDA 2ZTYA 3SJIA 1R0YA 1QGFA 1K5DA 3T06B 4TYYA 3SU0A 3U9AH 1WF3A 1NFXA 1P75A 4G3XA 1OXVA 4DEYA 5CMXH 1NESE 1RRKA 4GDFA 1ZC3A 1ABJH 5A2MH 1PUIA 1GJ4H 1C5XB 4AN7A 4R2HA 2V3CC 2ZGJA 4Q00A 3FFGA 3E3TA 1BIOA 4DJTA 1NL3A 4IDNA 1AFQB 3RANA 3CKLA 4AD8A 3UPUA 4UNNA 3GLFA 4TLEA 5JYIA 3SHAH 3R7WB 3A84A 2JETC 1R0WA 3C16C 4IDOA 4KFUA 1CA8B 3L3TA 2PSYA 1N6HA 1MO4A 1CQQA 1P73A 4R2IA 5FH9A 1AZSC 4DDTA 3NKVA 3D3QA 2Z3DA 4LSGA 4W5JA 1O2GH 1DAMA 2IWHA 3C27B 1G8GA 1A4WH 2ZRGA 3OSYA 4RZUA 4D9RA 3SU1A 4I81A 4B76A 3RXBA 2WKQA 3B8JA 621PA 1P9UA 4IEEA 3H84A 5C1XA 2PEYA 4JLBA 5FUYA 1XF9A 2VA8A 2OC7A 1AKEA 1IQEA 4BASA 5B64A 1DVRA 2JDIA 2I1VB 2AWNA 3U7HB 3U61B 1NROH 1IXSB 2ZJZA 1H65A 3N5CA 721PA 3MU4A 3HK3B 2H17A 1ZMLA 4RD6A 3VR5A 1VECA 5FOVA 5FCRA 2IL1A 3U60B 4X1NU 1LQDB 1CE5A 5EZ5A 3PEYA 1RRFA 1U90A 3GY5A 4LOYH 2F83A 3VGCB 4B1TA 2ZRFA 3TH3H 4GPGA 4K1EA 1TF5A 1X1SA 2G1KA 3FKQA 2IJOB 1B5GH 1XTSA 4AG6A 3TR0A 5KU1A 4D25A 5BXQC 1C5LH 1C5YB 3EC1A 1E35B 4BZQA 1XCPA 3MYWA 2V4ZA 2V55B 2C93B 1KXFA 1F2SE 1SB1H 3KTAA 3E16B 1G9XA 1Q22A 5GJWC 1O3AA 1KDQA 4INHA 4XBBA 1C2FA 3PR1A 5P21A 4GT1A 4FW9A 1FJSA 3JZMA 4EJSB 5IK2D 1PZNA 3VPKA 2ONKA 4ZHAA 4TZ6A 4MRPA 4HZIA 1YYY1 2GJKA 1GCDA 1F7ZA 2NQ2C 3B1XA 2N1BA 3W5JA 2UZIR 2AXPA 1XCGB 1UBGA 3NKKA 3RXPA 4JJZA 1MO3A 1NC6A 4IOKA 3KF2A 5DO9A 1KXBA 2ZE6A 1G2LA 2Z43A 1AY6H 1KIGH 1TGTA 3RLFA 1G41A 3D8BA 2C8VA 1BH2A 2D2EA 3QIAA 3I32A 5GJVC 1BTWA 1ZIPA 1WA5A 4ZXYH 1BHXF 3HGNA 2AGIX 2UZ3A 2KE5A 3K70D 4YMTA 4HTCH 3RC6A 1BYUA 5G41A 4KLZA 1TQ7B 1GHYH 2HLCA 2QMOA 1W5TA 2A7HA 3HPRA 4TPIZ 4QGAA 4JLMA 3BF6H 2PKSB 1OV4A 2ZI6A 2NZ8A 3QG5A 2WJIA 2XZPA 3F0TA 2F9UA 5BW8A 5EP4A 4IJMA 1OKXA 1MMJN 4Q21A 3B1VA 1INCA 4K8OA 2FGJA 3PEUA 4PC1A 4A2PA 4OI2A 3CH5A 5T1VA 4U00A 3E91A 1FXYA 3LH5A 1GM5A 1ZNZA 5TMPA 1W46A 3HATH 2R6FA 2PEZA 5FI1B 1FNIA 1C2IA 3P4XA 1PYTC 5KSZA 4QNRA 3KQCA 4LBVA 1K21H 2JLXA 2OCBA 4L9SA 3A7ZA 1C5MD 1Z8FA 1F60A 5EJEA 2A9KA 5KSYA 3U4QA 2J3EA 1NM6A 3O8BA 1GJ8B 1MCTA 1G8PA 3EZ9A 3W3AA 1G19A 3WP0A 2ZETA 2BQ7B 3CF0A 3RAPR 2QAAA 5T3HA 5HZKA 4ABGA 4M1KA 1L1GA 4V0OA 2QL6A 4ZUHA 4AKIA 3AVZA 4G1UC 4C0QC 5FCKA 4Y7AA 5FBQB 1W36B 2AMQA 1OW3B 3U3KA 1NJFA 4K2YA 1SVOA 4SGBE 1FAKH 1CBUA 4MPXA 4DGJA 3QF4B 1IJFA 3GEEA 4LJ7A 1DANH 2I6QA 3EWAA 2AR7A 4W5HA 3PUZA 4V0MA 2P93A 1E9BA 2HGTH 2OBMA 2FEMA 2HJGA 3V9PA 2B6HA 1KTTB 1DO0A 1CJVC 4JVMA 2HT6A 3IGFA 2Z83A 2CE7A 2IWRA 3M3TA 2ZRMA 2GDEH 2ALVA 1G8HA 5FR2A 1SGCA 3KQLA 3OEHD 3DPUA 1GG6B 3I8SA 2P0EA 2PLRA 4RD3A 1DG1G 4NCIA 4RCZA 1O34A 5E7MA 4C0BA 4KFSA 5DP5A 1O3HA 3GISB 3GY6A 3TW8B 2R2MB 3QXJA 3RXCA 1US8B 5JWOA 4GI7A 4OM9A 3BV9B 1W49A 5JEDA 4EKDA 3L8YA 4X8UH 4TL6A 1MZDA 4IMZA 5EUMA 1U0JA 2A31A 2QRZA 3ZZBA 3Q5EA 4ISLA 4NWKA 4KSCA 4Y11E 1XRJA 5JS7A 4DCUA 3S69A 2BKUA 1E79D 1BRBE 3IEUA 2ZA5A 2WJJA 1Y8TA 2ZVPX 4TYNA 4WF8A 1NFUA 2UWLA 3WYAA 2A5DA 1IOZA 4U7DA 1E2JA 3WMFA 5G3ZA 1ANDA 5HKKD 5FTKA 1AUTC 4A92A 3KFVA 4CEJA 4JZFH 2A7QA 2IUSA 1W1WA 3VQTA 3BTQE 2VQSA 3A1WA 2XXAA 5EQQA 3BRWD 1G37A 4OS2A 3MUFA 1ZYUA 1QHXA 4BZPA 3OE7A 2A78A 2W00A 2GJAA 4JZ1A 2O8DA 4BLQA 2R62A 2ZYWX 4IBLH 3NC0C 2O8LA 1XPUA 3UKDA 2FU5C 1V3XA 3AF3A 3RXVA 1N6PA 1EJAA 3LWNA 1DWCH 2GHIA 1N0VC 2C8YB 2ZTZA 1QHIA 1E1RA 5JSZB 2WYGA 3IKJA 4ABIA 2CN0H 1KLTA 2RGNA 3M3VA 5C4MA 1IQFA 3P20A 1YR9A 1A4RA 3M4YA 2BXTH 1KI9A 3K70B 4IHQA 2RHDA 4OQFA 4KELA 5EXNA 1AWHB 1S3GA 1FI8A 4B2BA 2BY8X 5EGMA 1QURH 5GNDA 5JEEA 2RCNA 5G40A 4IFBA 3Q5DA 4HAWA 4JBXA 2ZTSA 2KJQA 1EASA 2IT1A 1Z63A 3ZZ7A 3LGIA 1KTVA 1GHBG 2AXNA 1XD8A 2GV7A 1LO6A 1GWNA 1FV9A 3BS4A 5T6FA 5G53C 1LB1B 1A61H 5J4LA 3U3MA 4A1VA 3DM5A 1LDTT 1PLJA 3R0FA 1HY3A 4HI0E 1S83A 1UK4A 3P1JA 1M9UA 1SFIA 4BAMB 5BN4A 2IC5A 3LVRE 3A86A 4F38A 4PAQA 2O8WA 1P03A 1NLYA 3BTFE 2FIRH 4XD7D 2OAQ1 2E9SA 4MNXA 1Q3HA 1SGTA 4MKHA 2Q21A 4TYPA 1CA0B 3VR3A 5A0CA 4CT5A 3SU2A 2FOEA 4NIWA 3RXQA 2ATXA 1GL0E 1TAWA 1HE8B 3I62A 2CNWA 2F1HA 1Y3XA 1XB2A 2PV9B 4NPHA 1O2MA 5E7JA 2ASUB 2FI3E 1PYTD 1YR7A 1DICA 1OKKD 1A0JA 4IXNA 3A1VA 1LKAA 4DCDA 4QM7A 1QHRB 3MLEA 4JMPA 1W0KD 3SHWA 1MH1A 1O2KA 5C1BA 2J95A 1YZQA 1I2DA 4FUBA 2N46A 2O8BA 4URYR 1XCMA 2R6AA 4D4KA 2PX3A 2ZU4A 2BVSH 3B6EA 5C4GB 3NXPA 5DN6A 2ODYB 5JZVA 3MRSA 2YKGA 2O0KA 2R6DA 1M34E 1N6OA 3P4YA 5IHPA 2FZZA 4DLUA 1MTSA 2ESTE 4TQUS 2JASA 3CIOA 1LCYA 3QNUA 3ODDA 4G5QA 1UCYE 2BB4A 1P60A 4JT4A 1VTKA 4FUCA 2ZE5A 5J4YA 3SE0A 3TSZA 2AHOA 1BRCE 4NYJR 1WOFA 3F68H 4Y0YE 1GIAA 3DMNA 4ISIH 4BAKB 2ZGBH 3B78A 2D7DA 5ABWA 2C8WB 1U99A 3SORA 3D6TB 1K1NA 5KSPA 5GJCA 2F43A 3T1TA 1ZM9A 4DZZA 3V4RA 2UUFB 1UBCA 2UKDA 3TJNA 1A3BH 2P59A 2Q9AA 2NU4E 5ETXA 1TFXA 3CONA 4Q47A 3LJJA 2V35A 1KJZA 1Q0UA 3EWSA 5AUQA 1FUKA 2FM2A 1Z83A 2JH6D 3TJZA 4H1UA 4F93B 2NU1E 3O8DA 1D3TB 2BM2A 2H8KA 3GP8A 1FY1A 4IN2A 1YZGA 1VCIA 3P6ZB 1OP8A 1NRJB 1ELDE 1GHWH 3S9CA 1G5RA 2PZGA 3BFXA 3NG1A 1ZTJA 3L33A 1XPRA 3Q3KA 1L2TA 1OLOA 5DP6A 1V2TT 1WP9A 2VU8E 3LQQA 1XD9A 3QPUA 2ZNKH 3PLPA 3AW0A 4JK6A 1ELGA 1G3QA 4MPVA 1P3CA 2ZU5A 3P70B 2ZEJA 2FXRA 4HLQB 2AKYA 1BMNH 4KJZA 2JKHA 1H8IH 1G7TA 1TX8A 1W4AA 1E2PA 4O3MA 1UTOA 1GNPA 1CP2A 4O25A 2ZFQH 2VO1A 3HK6B 3WYFA 1QHGA 2GCPA 2ZM5A 6GCHG 1XX9A 4CBOA 4NHOA 1BOFA 2OSBA 4ABDA 3LGYA 1O3BA 4Y8XA 1ZZZA 2XBVA 5AJYA 3KB1A 1A7JA 3GLGA 1R8SA 1DM4B 3S0NA 1EATA 4DLVA 4CZ2A 4D6PA 5DPAA 2J5XA 3M7TA 1DOJA 3SJCA 2AL7A 5EQTA 1TEVA 1FMJA 5L3RA 4X8OA 1P5ZB 4RSGA 1KXAA 4G5OA 4OI1A 1J8MF 2OT3B 1ZHMA 4U5XA 3FPAA 1C1RA 1EUFA 1WV7H 3ZIAD 4KITB 3VXEH 4KFRA 4M1WA 1FP7A 3KX2A 4Q7JB 3S7KB 2BD2A 1SQOA 2FFBA 4PC6A 9LPRA 3TU7H 3VAAA 1SHKA 3SZEA 1EFRA 2DPXA 3T29A 3UMSA 2QXJA 4MA4A 1SFQB 3B9FH 2PUXB 3GYMA 1MTNC 1XVOA 2ZU6A 2G5NA 2W6JA 4AG1A 3W90A 4S2EA 2EVWX 4JS0A 1O5DH 2H5DA 1UTJA 1QHSA 1ZAKA 2F9NA 4IS5A 4BFYA 3P8NA 4KAXA 3A1TA 5DIFA 1KAOA 5FBIA 4B3GA 1HAIH 2Y80A 4U01A 4KVAA 2QXGA 2WSSD 4BFUA 2XNSA 2F91A 2AD1A 1QFKH 1BBRK 2IYLD 3PG5A 4ITRC 4FWTA 3PUVA 2HCBA 1XJ0A 1LPKB 3KEEA 5DP3A 3P27A 3MWJA 3EA0A 4OL0A 2P67A 2RGXA 3MWIU 3TGIE 1IY1A 4C0SA 1WUNH 4FCVA 1II0A 4KYIB 3A85A 1D8TA 5GADl 3M36A 2O8FA 1NN5A 4RD4A 1HAVB 1J17T 1MCVA 5EP2A 3CP7A 3ZD6A 4RFSA 3QLPH 1U98A 4B2CA 3AKCA 1E9EA 1EX6A 4VGCB 1B7XB 5TARA 2ZRLA 4UFFH 3VB7A 2SNVA 1H8DH 5IYTA 3RXAA 3VHLB 4V03A 5HGGA 3IPXA 1AGRA 1JIRA 3VB5A 5GJ4B 3RXTA 1R2QA 4FI3C 5C1YA 2O8EB 1GI2A 2QP3A 1EJNA 1XXHA 2ZJ8A 4NYJQ 1ZTKA 3HJNA 3VNVA 3FANA 1O5GH 1O3CA 3U8OH 1FPHH 3GLIA 4M1TA 1QF9A 1DOAA 2IW3A 5CIWA 3E90B 2D06A 2GA8A 1S85A 1KI3A 3A8BA 3AGQA 1E34B 2WPMS 2ZRCA 4TMZA 2VIQA 1FAXA 3RS7A 5IT5A 1Z8IB 3T2NA 1Z28A 1MKXK 2GXSA 2IHBA 1UKZA 4NGAH 4HLCA 3QWCH 3EA7A 3RNLA 3SBKA 4LBZA 2SGEE 4JBYA 2FEOA 2FSHA 5FBWB 1QHHB 1ZW6A 4AK9A 1N5IA 4CRBA 3BN9A 2DWPA 1O2IA 1DS2E 3R7WA 4DIDA 3HDTA 2XC4A 3PWCA 1TU4A 3LX5A 4M9FA 5E7IA 1YZKA 4LYFA 3QGNB 2Z6VA 1ARBA 1BTUA 5L3SB 3A1SA 3RWOA 4Q01A 4ZKNU 3HKJB 3K0AB 5BQ5A 3BTDE 4B47A 3D49H 1G5TA 3KUDA 4X6MA 2EFEB 1GVLA 1PPCE 2F9PA 3V7TA 1RE0A 4JMYA 2V3HH 4GAWA 1XPOA 1HB0B 2XW9A 1EAWA 3GEHA 3RXEA 1ZD9A 1D2EA 1C1NA 2BLQA 2H1LA 1OH7A 3ZZ0A 1XUFA 5J4QA 3IBYA 3O8RA 4YT7H 1SSXA 2F9LA 1CIPA 2ZIAA 1GVKB 3SR0A 3QJYA 5CLQA 3K65B 4JYCA 5E8EH 4FD2A 1F5KU 4JK5A 2GMTB 1C5NH 3TVJB 4V02A 2A5JA 2JJ8A 3P92A 4AG2A 1IHTH 3UOUA 4V0KA 2J0UA 4Q4AB 3GDVA 1AO5A 3RP2A 5GDSH 3OTPA 5TDHA 1ABIH 5HCNA 4Q18A 3LDAA 1KXCA 3ZZ6A 3T25A 3RXLA 2WPDD 1GJAB 2YOGA 1VCMA 1FONA 5AUOB 2A5AA 2RAPA 4ABAA 2Q1JA 1HAZB 2G88A 4P32A 2GVDC 1GRNA 2CL6X 1XJQA 4US2R 1C5SA 3UIRA 1P9RA 2B8TA 2QQ0A 4RKFA 2FX3A 1PV4A 4PXAA 2CLSA 1EOJA 4NYMR 2J41A 1HT1E 5EXMA 3C1KA 3QBTA 5DG6A 4JZIA 2QSZA 2ZWLH 1JPJA 3BK7A 4EJSA 1BCUH 2C77A 1ZNXA 2A4RA 1MOZA 1L4UA 5AJVB 4A1TA 1DELA 1NVXQ 3U3RA 4N0DA 3DHWC 1W0JD 2VIVA 4B75A 4R7ZA 1P09A 1SG8B 3SV6A 3W8NA 1UAAA 1GCTC 2GT7A 4XSHA 2ERYA 2NPIA 1NY6A 4BWYA 1TQ6A 1JXOA 1X8LA 2Z9KA 3QZRA 3RC5A 4D26A 1M8PA 3U7GA 1XEFA 3QZQA 1Z71A 1YZLA 1CJMA 3LQRA 4ABBA 4MITA 1WQSA 1XTQA 3FVFB 3M35A 1S0QA 1KDRA 1KK1A 1E37B 3PLKA 4MYHA 1KSNA 4BZXA 3M61U 2VVVA 3A82A 3GQBA 1NN0A 1LQEA 3OTJE 5DE3A 4K5ZA 2XXLA 1J16A 4XFQA 3C4JA 3PJRA 2GCOB 2I4IA 5FFMA 1BTYA 2GZ7A 1RKBA 4CHAC 1JRTA 5A8YA 1WMSA 1GWAA 1O3GA 3RXSA 1JI0A 1KYNA 2HALA 3CNLA 4D0GA 5AHGH 2HWLB 2JJ2A 1KI2A 4A5TS 2BJVA 3KQKA 1Z22A 2D74A 3F9HA 4Q5IA 5TY0A 1TQ4A 4ABYA 4D9QA 3DKVA 4QGFA 4MNYA 1TNHA 4QG7A 3SYJA 2EYQA 2GVFA 2W6ID 2ZI3A 1KMQA 4LX0A 4Z8XA 1NTPA 2IA5A 3T26A 3GYLB 2W5EA 1N3BA 3QPWA 5L8VA 4PO9A 4C0JA 1T4GA 2YNMA 2IYYA 1N6XA 3V4FA 1TBQH 4IFEA 4DSOA 3PENA 1EFUA 3MU5A 2IF0A 2RHMA 5LPNA 1Y5UT 1RW4A 2UUYA 1AZTA 1KI8A 4TLAA 2R65A 2ZZUH 4AFSA 1IXZA 3FKSA 4E05H 1Y5AT 2Q3FA 1QDEA 1L4YA 1V2KT 2ALPA 2B7CA 4GSYA 1V2OT 3CWQA 4AFUA 3QF4A 3QN7A 2C9OA 1QB1A 1O30A 2PGQB 1Y5BT 1JNYA 2JJ1A 2QMEA 3Q00A 4LDJA 1FQJA 1QG2A 2IYRA 2GKVE 1W14U 3M7QA 4HAVA 4B71A 2BEJA 2RGNC 1E2KA 2G55A 3K9XB 1M1YE 3SYKA 4Q2KA 2OAP1 3AVOA 3PVSA 2ZPTX 5KO2A 1Z3IX 4QJ3A 5DH9A 5DYGA 2GEDA 4NKRA 3A81A 2G3YA 4LOAA 1V2NT 1GHBF 2WKPA 3RRMA 2Y82A 4MQAA 4C30A 2AH4X 3QQ5A 2QV1A 1Q1QA 3PITA 2PCLA 1Z08A 2AS9A 1PQ7A 1Y59T 4TMWA 4TLBA 4PFSA 1MD8A 4C9BA 2QF3A 1IN8A 1IQGA 1V2MT 2WSMA 5SZIA 3EGKH 1IN5A 1OX1A 3GJ8A 3RRYA 4INKA 1JAHA 3CRMA 2XTMA 3KXLA 3F8TA 2D26C 1GI4A 2W0MA 1ZHPA 4X2YA 4QC2A 2ZROA 3K8YA 1GBJA 1GOTA 1GI6A 4BFSA 4XJXA 3MI4A 3IQWA 1O2OA 2C90B 3TIFA 2QNRA 2QA9E 2FOGA 1N25A 3MOCA 3RDZA 4D7FA 4URVR 1C1SA 4C3ZA 4A8JB 1GDDA 3EZ6A 1N6RA 2IUUA 4NYMQ 4JIMA 1G3CA 2NG1A 1GBIA 1KSHA 3CW2A 1S96A 3LH1A 4AWXA 3U5ZB 4AKHA 1ACBE 3RS5A 4CIDA 1LNZA 3EE0B 1N0WA 1Z0FA 5PTPA 2BVRH 1CRQA 2OESA 4GOKA 3PUWA 5A0FA 2H6MA 4JZKA 4XIGS 1WSSH 1P0SH 3CNNA 1KKMA 3LW7A 2Z6BD 1V5WA 2QM8A 3OF5A 4XWAA 5EE0A 2O8TA 3I8XA 1TBZH 2R6GA 5ESBA 2FOCA 3X1YA 2VTKA 1E1QA 2YYZA 1TAGA 3D23A 4D4JA 1RZ3A 3I29A 5FPKA 3I77A 2Q0HA 5JSZA 1ANEA 1OS8A 3LGWA 3VKHA 3L82B 1C9KA 1HJAB 1Z8RA 1MT0A 2VPPA 1A1RA 2XTZA 3KIDU 1ETRH 3UY9A 3MTYA 1KHTA 4B3FX 4BXSA 1DXPA 1JAIA 4JVSB 1ZSJA 3LDXH 4B2AA 4CRFA 2W26A 2RGDA 1V43A 1C2JA 3LBHA 4RFVA 2F1RA 3SU5A 1DSUA 3PTBA 4LY6A 4WWYA 4Q4LA 2Z3EA 3LX8A 2A5IA 4RKEA 1CBWC 2QE7A 4HDQB 4E7NA 4BEJA 4X8LA 4TPYA 3EPKA 3N2EA 4B2LA 2JLQA 1EFCA 1OPXA 1IBRA 2KBEA 2GNOA 2H92A 4F91B 3BH0A 1Q44A 2J92A 1MU8B 2DFTA 1OH5A 1HUTH 3PQCA 2QAJA 2BX3A 2ZUDA 2O9QA 4PHFA 4I1OA 2PTCE 2QZ4A 4ABFA 6GCHF 3W5IA 3SU6A 1P12E 4ZV4A 1Z8JB 1NRRH 3VKWA 1X7AC 2FGKA 2IF2A 2GCNA 3T12A 2WPIS 3RM0H 2P2LA 2ANCA 2BHGA 1O5CB 2FDCA 1VCQA 1ELEE 3U1JB 4ISNA 3QX5H 2PGBB 2ANMH 1G20E 2G6BA 4AKGA 4V0ME 4JYTA 4HSEA 4XWKA 2BQWB 1M7BA 1O3FA 2P8OB 1T8OA 2WMNB 1Y63A 1W11U 2BZ6H 4TYQA 1HYQA 3GD7A 5BN5A 2CHVA 1UVOA 3OHMA 5CIQA 1NN3A 2C9YA 2OHFA 5G3YA 3BE4A 2XBXA 1ZLRA 1GRQA 1SQAA 3QENA 2O5VA 4PC3A 1UJ1A 3PV4A 821PA 3OE7D 1CRPA 3FTQA 5KNCA 3RXIA 5JI3E 2MMCA 2EI6A 3RU4T 3OEHA 3NEYA 4OQLA 3L0IB 4M7GA 1KSJA 2ZGHA 4NSYA 5ESTE 3MU0A 5A8XA 4FMCB 3T5FH 3QKSB 5A09A 3ATIA 5J4KA 3CENA 1A0HB 1E1RD 4FMCF 1S0UA 4LGMA 4LJAA 4M1OA 2ZHWH 4YXWA 1JWTA 2G5VA 2PW8H 1Z6JH 4JZEH 1E9CA 4UXJA 1WQ1R 2HUPA 2QBYB 1ELFA 4YDSA 1BBRE 1N6YA 1O3KA 1XJCA 4FMDF 3SI4H 1ETUA 1EKBB 1E6CA 1E0AA 1H8EA 2REOA 3ZZ8A 1CSOE 1S0RA 1AE5A 1SI5H 3K9NA 3AVYA 1XKAC 4X6OA 4A36A 2WBLC 1L2EA 4GZMA 3ZZ9A 4JJKA 4I1UA 4URXR 4AI6A 4B3BA 2TPIZ 4F4CA 3BG8A 3LA6A 1SGYE 1CT0E 5B30A 3FVQA 5B6OA 4BNRA 2OLGA 4LZ4B 2VH0A 2QPAA 1WTGH 1A5HA 1QL9A 2JA1A 1QBOA 1E94E 1TE0A 1O3YA 2A32A 1HAHH 4P3YA 2FWRA 3C5HA 2MSCB 3F1SB 1ZUNB 3IHLA 3C5CA 4ZCIA 1GVZA 2JLUA 1FY3A 1VIAA 1Z6AA 4FUJA 2ZDVH 2FFQA 4RD2A 2DB3A 4H4FA 4YDHB 1EGAA 1P72A 3SBDA 2CNWD 1ZUHA 5DO4H 5FOWA 1SLUB 1KO7A 2QPTA 1J99A 2F55A 2J45A 5K0HA 1LW7A 4Q1CA 3TAHA 4LC1A 1GCTB 1LVMA 2CE2X 3PEWA 2CXXA 1P06A 3VFEA 1XXDA 3TGJE 5DN6D 3B13B 4ILEA 1MUEB 3T34A 2WJGA 1FUUA 2WHXA 1OH8A 2PTNA 2VIOA 3MH7A 3EG5A 2PMKA 3NH6A 1E2GA 4C0HA 1B0UA 3L0SA 5JPMH 2F7SA 4BRWA 2FSFA 2ZRDA 1FIWA 5FR1A 2ZRIA 4C2UA 4UFGH 3MWYW 2CVFA 1GJDB 4NIVA 1E32A 4HFPB 3SN6A 5E95A 2GEVA 2A2QH 1TRNA 2WICA 3W3ZB 2BMEA 1XVMA 4FUEA 4GL2A 1WCZA 5BN3A 4M2LA 4PO8A 5EP1A 2OLKA 5SZHB 3A4LA 2JLZA 1YHNA 3UG6A 2BD3A 3RU4D 2R0LA 4BEBA 3SO3A 4OHXA 3ZZTA 1EPTA 1ZM2A 2WV9A 1VITH 3NBZC 3DOFA 1G9IE 1KDPA 1Z1IA 1QBVH 3Q72A 3EZFA 1YKSA 3R20A 1C2DA 1YZTA 1LFDB 2CCGA 1DE7H 1H4WA 1E9DA 2ZRAA 1IAQA 2Q9CA 3K6ZA 1VG1A 1A5GH 1UFQA 4URWR 4I8LA 4E22A 3TJOA 1OKKA 4TLDA 3BTWE 5DHAA 1V2LT 1TU3A 2VIPA 1TGCA 3SQXA 2NO7A 5FX6A 2BLWA 5JDUB 1UKVY 2JLRA 1KTSB 4KTSA 1BITA 1F2UB 2CBZA 2ZI9A 1DXWA 1ZMXA 2O8EA 4QBFA 1XXFA 4BECA 2J38A 3ADCA 2Q6GA 1F0SA 1MKWK 3DFJA 1BO6A 2Q6FA 2G4TA 1XWIA 6Q21A 1DADA 4I99A 1SVIA 4PQYA 2TGPZ 2OFWA 4OHVA 2PHBA 4MPWA 5C5NA 2X19A 3SU4A 4PX9A 2BWJA 1GMDG 4G0NA 3EA5A 1XNJA 2IUTA 2PZEA 2IS1A 1HCGA 1Z07A 3IWMA 4X1SU 2PSXA 1GHAG 3AVWA 2BD4A 3CX6A 4EFNA 3ZVNA 4KKDA 3V12A 1YP9A 2EWWA 1IN4A 2QP9X 1FZZA 4UFDH 1P2IA 1C4V2 4F49A 2ZFPH 1JBUH 2ORIA 4EJSC 4MDSA 3Q9LA 3NCLA 1GRRA 2SGPE 1QHHA 1ZU4A 3KKPA 3TW4A 3CRQA 3B8HA 1W2KH 3PXGA 1GUAA 1SGWA 4KBGA 4LHWA 3NPSA 4Y79A 1S6HA 2FA9A 1AA9A 1TX6A 4XVQA 3DOEA 1P4SA 1G21E 5K8LA 3CB4A 1O2WA 1EFRD 1U8YA 1W12U 2C78A 3SJOA 3SJBA 1IM2A 5B6LA 3BH7A 3IPYA 4FVDA 3ZYDA 1HE1C 2GTPA 1P2UA 2FN4A 4XTCS 1P61B 1P3JA 2DFKB 3K0AA 1P10A 2W6JD 3VX4A 1DEKA 4K8YA 3SYNA 3RRNA 1YRBA 1Z2AA 1GMCG 3KKNA 1AIXH 1YKTA 2FWWA 2PH1A 3UR9A 4ACAA 2ZI7A 4QRHA 3CZPA 1O3OA 1J90A 1QA0A 3AEZA 521PA 1JXMA 3GLGE 3L0OA 2P5TB 2YNAA 1YPGH 2QROA 1AZZA 1ZD1A 4A6XA 4YT6H 4ZCMA 4BGDA 1GMHG 1A0LA 2ZUBA 4FUIA 4Q4AA 2ZECA 5FXLA 1RRGA 2QGRA 4QHSA 4ZI2A 1G4UR 3BEIB 3EC2A 4IDQA 2BKEA 3RDPA 4F4IA 2EC9H 4EPYA 1LV7A 2O8BB 3LH3A 3DVLA 2IYTA 1UCYH 1DFPA 3TK6A 1EP5A 1WRBA 1FY4A 2VHUA 2YHSA 1P62B 2ZSBA 3SNCA 1X3SA 4Q7KA 1A2CH 1FTNA 3ZZUA 1GJ7B 1P2JA 4TYDA 2GVZC 1ZCAA 3SN8A 4XVUA 4GNKA 1H8HA 2BMGB 4GRAA 2AFQB 3KGPA 5FTMA 1LPGB 4UNRA 1K28D 3AP1A 1NRNH 2LNCA 1W36C 2CHQA 2PMDA 3E5HA 1MV5A 2IXGA 1E2NA 3LRPA 3UWKA 4WXIA 2F43B 3D65E 1DPFA 1GBKA 2QN5T 1E9FA 1FPCH 4JCNA 2IXFA 3O8CA 2DBYA 1HQYE 3IO5A 1CO7E 2WTUA 4F92B 1CBWB 1PJPA 4RSPA 1T0HB 4M22A 3Q3YA 2X1VA 4DOQA 5FBEA 2IYXA 1YC0A 4RZ3A 2ZXUA 2VSFA 2BMJA 1K1IA 3TR5A 4ARZB 2HXSA 3NBFA 3QKUA 4MGZR 3GCHB 4PC2A 2V3OH 3I5XA 4NCJA 4MH0R 2Z7FE 4RZ2A 2A2ZA 3TIUA 4CEIB 4M4SA 2BLOA 1TX7A 4KYUA 2TGAA 1XXHE 3T62A 2GCOA 1W0YH 2RGAA 2GCTB 4I32A 4R98A 2C4FH 1VDZA 4NZYA 1GBBA 5FBRB 2G0TA 2KBFA 3GY7A 1GBEA 1S2MA 1KNXA 1TUEA 3GLIE 3MJHA 2JH0D 2A0QB 3S7HB 1Z06A 1FNNA 2EW1A 3QEOA 3DO6A 2EI8A 2CK3A 2JLVA 3BB1A 4JYVH 3ATKA 3HP1A 3L2OB 1C5TA 3F5FA 5H68A 4NCYA 3GY4A 2DY1A 5AJZA 3ZVFA 4E09A 5L3VA 2QXHA 3GFPA 5KYKA 1EXFA 3SNAA 2VP2A 1FX0B 1A2BA 4JSYA 5GJBA 2X2EA 3CBQA 1YPLH 5FOXA 4EUNA 1SULA 2Z4RA 3CS0A 3KXKA 3WBKA 2PLXA 2VP4A 1VHTA 2KB0A 1LHEH 2B8OH 1Y3YA 4ABHA 3F9EA 1FIZA 3AV0B 1G16A 4GMDA 1LF0A 1EX7A 4XBCA 1AKYA 4NBSA 1YPKH 1N2CE 1GL1A 1NBMA 2ASEA 1AFEH 4B3XA 4Y76A 3L8ZA 2JCSA 3LGUA 3URCA 2O0HA 4M8NE 3LPRA 2AN9A 4O2RA 5CB8A 1O31A 4J2YB 2WMOB 3ICEA 5LH8A 2J1LA 1KLIH 4DT7B 2CCKA 1QL7A 3SU8A 1HRTH 1LS1A 5C2ZA 1TPPA 2OUKA 2BBSA 4YMWA 1HT2E 4HLDA 1C2GA 3SQEE 4LHYA 3CNOA 5J4VA 2G52A 3GOVB 1O3MA 2YOHA 1H9LB 5FBVB 2WJYA 1FPMA 2YNBA 2EEKA 3RLWH 1UF9A 4LXBH 4X2WA 3AH8A 4DLRA 1SHZA 3TNTA 3QPVA 2C99A 1F0UA 1IHSH 5TV2A 5J4HA 3ZLJA 2ANYA 2FESH 1G6HA 1EJMA 3A37A 3RC4A 2VEDA 4NZQA 3QG1A 3QXSA 3KQDA 3I1FA 4JLAA 2QGZA 3KUCA 3TUJC 3RC3A 4V0NA 4GSOA 1OF1A 2Q9BA 3VB3A 7ESTE 4TZ0A 3FMOB 1SC8U 1IQNA 1AHTH 2FJUA 2ZJOA 1VMAA 3LFUA 5JCPA 1YPEH 4XOIA 1D6JA 2AYWA 3P17H 3UNRA 3TUZC 2BDTA 4Y10E 1YJ5A 1W4BA 1HDTH 4JBWA 2JEOA 5FX5A 3I72A 4IVPA 4AYTA 2DWQA 3ZGXA 5HYOA 3VX3A 4F4OC 4XVRA 2V8OA 1L4ZA 1PLKA 2QT0A 1OFTA 4RFSB 5LB2A 4OQMA 5L30H 1OWIA 1RTKA 4Q1FA 3UWJH 3PMJA 1CT2E 1RRCA 4EPTA 1QRXA 1TGBA 4CRWB 3ZVRA 4A8JA 4TLCA 3R9IA 4JLDA 2YZ2A 4ZXXH 3FMPB 2ZF0H 3LXXA 3RXKA 1G3BA 2V1UA 1HNEE 1JECA 2VHQA 2BTCE 1IXRC 2JJ2D 2REBA 3ODFA 2JAQA 4IW3B 3BSQA 4I8JA 2DCUA 2ZSEA 3SV8A 5J4SA 1TB6H 2FOBA 1GVNB 1OWHA 4Q66C 5CK4A 2HF8A 4PO1A 1R5BA 2ZJBA 1AUJA 1NU7B 1SGDE 1YCPM 1U0HC 4DSTA 1ELBA 3BAFA 1LHCH 2J94A 4OI4A 1KMHB 4X8VH 2OTVA 1ANKA 2JIZA 1GBCA 1ESMA 3BJIC 1U0LA 5A0AE 1E69A 2J9NA 4NA7A 3SOPA 1WQVH 2ZE7A 4TTRA 2FPZA 1UVTH 4CR5A 2IYUA 5E2PA 2XC5A 2ZRPA 4Y0AA 1YLCA 5EW2H 2WWWA 1J8YF 3SHCH 7GCHG 1BKDR 4GZLA 1ZMNA 2UVQA 3GCTG 2ZU2A 1W36D 1GJ9B 2TGDA 3FKSD 3VR2A 2KI5A 2FF7A 1AS0A 3GJ5A 5F3WB 2CJIA 4YLQH 3RMNH 1W4RA 1MABB 1OJLA 4LJ9A 4AC9A 3EAQA 2JJ1D 2F1IA 4JL6A 5IRCD 4N1AA 1SXJC 1XUJA 1KOFA 1O36A 3RMLH 1NRQH 3NTUA 4AY2A 2ODPA 3IIKA 1NIJA 1ZMJA 5AUPB 4I4LA 1TYNA 5EXTA 2XWBI 3P95A 1GNRA 1FQ3A 1T5LA 2C95A 5HM2A 4NDZA 3UTUH 2RG3A 2XSZA 1LTOA 2ZJAA 4MYUA 1SGRE 4MGKR 1AS2A 1M2OB 5FTJA 4LPKA 2STBE 1VG0B 1ZCBA 5C20A 1N5JA 1QA7A 3OU0A 3P8OA 5EXLA 2W6IA 4BFTA 1SKQA 1B0EA 2QIQA 2GJSA 2ZC9H 1C4OA 3C41J 1HEIA 1YR6A 2ZRKA 3GCNA 1W4CA 3OEEA 1IY2A 2O8CB 1I2MA 1K22H 1CS4C 2J0UB 2XZOA 3I78A 3VHXA 2F3CE 3AKDA 1E2LA 2BIFA 4ON9A 4GCHG 4MNWA 3SEAA 4ZH8A 4EPWA 1OYYA 1SLWB 1QRWA 2ODEA 2J87A 3D7MA 1G3RA 1G8YA 2A5KA 3H09A 4A6PA 1HH4A 2ZAOA 2B5TB 1O32A 1MR3F 3MJRA 4CBNA 1VG8A 2ZVQX 3UWIA 3OIUA 1WE2A 3SBEA 3SNHA 2QSYA 4QNMA 5FPYA 2FLBH 3EW9A 4M1SA 3AKEA 6LPRA 1D3PB 4NSVA 3B1WA 3GPLA 1OFUX 5FHTA 1CXZA 4YC7A 1ZBDA 3DL0A 2WPHS 3A7WA 1GILA 1G32B 2GX4A 3GDSA 4O03A 1M7HA 1BDAA 4U02A 5M04A 4UD9H 3I92A 4OHYA 4BE7B 5JHGB 2HV8A 1UTLM 2G9NA 2XCFA 4BLRA 2HCJB 5JJIA 3OFNA 1F0RA 2PL3A 1R4AA 1O2UA 2J59A 1Z8GA 3A8AA 4Q4JB 5DISB 1QTFA 4TL8A 1E1QD 1T3LA 2Y8EA 5CLLA 3QKSA 1ZGVA 5A0BA 4Q7YA 3FHTA 1FY8E 1QRZA 3KQEA 1Z6XA 1BHXB 1E2DA 1TMUH 2YC2C 2UWOA 2QBYA 5I46H 2ZDLA 4TL9A 1UDWA 5BPEA 3QY0A 4PHHA 4LWZA 2XTTB 4KGAA 3RXUA 1Q3XA 1OOKB 2GK7A 3SJAA 1GBDA 2BDHA 3GEIA 3IDQA 1OP2A 2IHYA 1C1YA 2FZ4A 1UVPA 4DB2A 2WWIA 4I1VA 2O8UA 1TPZA 1AVWA 2YVUA 2VL7A 1FOEB 2UWPA 2QE7D 1EPTC 3WMGA 3I73A 4B74A 3CF6R 1B23P 3SU3A 2FI5E 2BDGA 4IOLA 3LGTA 1T32A 1ZPZA 5L3QB 1W0ZU 2OILA 1XMJA 4ZDKA 1F5NA 1UTKA 1XEXB 1FY5A 4HYYA 4JL5A 4TT3A 3SV9A 4QHYA 1Z0KA 4AYYB 1D2MA 3SFVA 1AVGH 4VGCC 1DUAA 4WMDA 3GJ4A 1OH6A 3LKWA 2A7JA 2QN6A 4ZKDA 4QKQA 2Z94A 2IOTA 1GMDF 5SZJA 4XTRA 3QXHA 4XOJA 2QYIA 2UUJB 1KZ7B 3V00A 1GHAF 4WMFA 1A3EH 2WWGA 1W2HA 2QGNA 5DLQC 3E1XB 1Q57A 2ZDNA 1XMNB 2B9LA 5JI2E 2PKAB 1IQKA 2D2DA 1V2QT 2EU8A 2ZCHP 4BPBA 3MNSA 4M1MA 1UKEA 1EZSC 1THSH 4YLGA 1GBTA 4HAUA 1UJ2A 3TH2H 3AVQA 4LJ8A 1UMAH 1VYUA 4LV6A 4ZKOU 1OWDA 4K46A 3B2EA 2J7PA 1FW6A 1CGJE 1D9XA 4GHQA 5T6DA 4LHXA 4QBHA 2QP4A 4DCVA 3EPLA 2BQ6B 5C5OA 2C04A 3W94A 1NY22 2BJWA 1Q21A 4D7GA 2ZSFA 3E70C 1QZXA 1AQUA 5EE3A 4C0LA 1P2VA 1ZU5A 3A4MA 4WAUA 2ZS9A 1GMCF 1CJKC 2R2AA 3PO1C 1KXDA 3TK9A 1SXJD 4OK6A 1AKSB 1R7RA 8GCHG 1ZP6A 5CJ2A 5FTNA 3AF1A 4B2PA 4YXWD 2J46A 3AAVA 1NFYA 1M74A 3IQXA 1NSFA 5TCAA 4UEHH 3LC5A 1CHOG 3Q77A 5TB5A 4Q19A 3IUYA 4FXGH 1O2ZA 4M1YA 1W3CA 4B32A 1H8ED 3A8CA 1C1TA 3IO3A 2H9EH 4PHTA 1GHVH 1GMHF 2HRVA 2IYSA 5TVKA 2K5UA 1Q20A 5F6MA 1E0KA 5KNBA 2O8MA 2RA0A 4C0AC 1O2JA 4GOXA 3BIUH 3NC1C 4JT2A 1ZVQA 4XE4A 4Y0ZE 2BDYA 4DJZB 4AZ2B 2YC4C 4RCYA 2ZU3A 1F3OA 4UXHA 4ZROA 4N0EA 1F2UA 1O5FH 2PWXA 3QVUA 2FH5B 3EX7C 2GCHG 1ANBA 2GMTC 3NDPA 3G0HA 1OPHB 2FG5A 4FN5A 3U8TH 4Q9JA 1ZD8A 1G17A 4YMSA 2QMHA 1DS6A 2ZQ5A 3WY8A 5CYPA 2EA3A 2R9PA 1E38B 1R6BX 1TL7C 1SXJE 2JH5D 2ZAMA 4OGXA 1NMXA 4LUCA 3CZQA 1T8NA 1GITA 4PZLA 4MDEA 3FOZA 4RY2A 1NG9A 3GICB 3ICQB 2AMPA 3AM1A 3OIYA 1O2TA 3FB4A 3ZZ4A 3Q8XB 3AVVA 2WAXA 4DY7B 2OE2A 5EXXA 3WRYC 1XM1A 2ANKH 5B57C 2PJZA 3CX7A 1O0DH 3DKPA 1E2IA 1QNJA 4MKFA 3ZJYA 1NLFA 3TVTA 1HV8A 2CHAB 3ATLA 2VWMA 1RGQA 3ZZAA 2ZPRA 2BM0A 5GXPA 4INLA 4JYBA 4DUGA 3STJA 5LPRA 4NFEA 1O2PA 2GF9A 1KXEA 2OFOA 1QHYA 4E07A 5EPYA 3T27A 1G8FA 3KL4A 3FP6E 4RD1A 1H9HE 4O3TA 3SC3A 4PHGA 2OCYC 4B6EA 1EZQA 3N2IA 3HR7A 1WCV1 4QBGB 4C7OA 1JPNA 2V1XA 2ZR0A 1EAXA 3V0XA 1N6KA 5HMAA 4KFTA 2H5CA 3WNDA 2QTVB 3GLHA 3LU9B 4G01B 1SMFE 2Z3CA 1C5UA 4RI0A 5KOYA 4I1SA 1KLJH 1MTVA 2Z5FA 2GBLC 3Q76A 2BHRA 2MMGA 4UJ3A 1OXTA 3G01A 5EG4A 2Y5GA 1ZC4A 5FL7A 1EWQA 1C5VA 2FOMB 4NIYA 2A4OA 4BUJA 3R9WA 4Q1BA 3TJVA 2BMDA 5J40A 1O3PB 2ZDMA 1NKSA 4JYUH 3L0PA 1G7SA 3T5DA 3MAAC 3H1TA 1OFIA 4GFDA 5FPSA 4CDGA 2Z0MA 4PQFA 3EIHA 4OQNA 3PV5A 1TNIA 5JBAS 1O2NA 4AORA 3GY8A 4HGCA 1D3QB 2XTNA 2A5YB 3SDZA 1S4QA 3BTME 3E0PB 3ZVLA 4AGJA 4DLZA 2PFEA 1OFHA 1BBRH 2NZJA 3SQHE 2W3KA 2ODWA 2Z9LA 1SXJB 4X6PA 5UKDA 1K1LA 3AUYA 3E1SA 5FOSA 1EP6A 2WYJA 3HR8A 2HNTF 5DP8A 2O0JA 3LVQE 2FTLE 4BAHB 4U32A 2GZ9A 4XBDA 1VCNA 3TK1A 3PWBA 4WA7A 3H5CB 3QDZB 4Z0KA 3U44B 5JMTA 1CKEA 1YBWA 4NONA 4X8SH 1GZSA 4ARZA 1P8VC 3EIQA 2Y5FA 4LI0A 5HZHA 2G0NA 4DCNA 4M21A 2LPRA 1G6OA 4EQ6A 4CEIA 1II8B 5JBBS 5FL3A 1S81A 2XB4A 4GHTA 3RXGA 1GDNA 1C2HA 2ZANA 3ESTA 5KPDA 3T28A 1E2FA 3EASA 1TOCB 1Q12A 1SGEE 3RRZA 1HBTH 5DP9A 2G4UA 3I61A 1PPEE 3BEUA 4PSKA 3QE0A 2VGCB 2C98A 1UTMA 2Z9JA 1MRSA 5JWHA 5E4FA 3BTKE 2ZU0C 4YQFA 2OUAA 2QC2A 3MCAA 1MKXH 2FSIA 3TVDA 1RPZA 1Z6GA 2P65A 4A8JC 1N6LA 1FX0A 2ZP0H 2FX4A 1UTQA 3MU1A 221PA 5D3MB 1G3EA 4ZHLU 3SOSA 1XTJA 4P4UA 3M1IA 3K53A 5FUWA 1EFTA 3VTKA 3GJ3A 2YWHA 2I6SA 2QAGC 1O2VA 4QL3A 3A7TA 4KXFB 5CK5A 2H57A 3T1OA 1HPGA 5JLJA 3M7UA 4ABEA 1VITG 2NU3E 3LW8A 4HI3A 1Z2CA 5I25A 1YU9A 7GCHF 4UXIA 1UPTA 3GCTF 2VIDA 4U30A 4FIDA 1MO5A 4IGDA 4G5RA 1Z7KA 4Y0VA 4BLTA 1E98A 2VVCA 2M5TA 1XEWY 3QBVA 4FINA 1ZHRA 1Z6EA 3IILA 3MHWU 3PROA 1XX6A 5DGJA 1H8HD 3SI3H 1TGNA 3KJEA 3A7VA 1XMSA 4UNPA 2H7VA 1OB5A 4XDEA 1HJAC 4OQXA 3PMAB 2W0SA 1JEDA 5FUVA 1U81A 5AR1A 3ECCA 2FOLA 2ZHDA 1DLKB 5HPYB 5HXFA 3RC8A 3R8FA 5EE5B 2A4QA 1DG3A 1KAGA 1PQ8A 4IRUB 1EPTB 4UJ5A 3THXB 3FE2A 2ZI4A 1M7GA 1SPJA 1GBFA 4XSKU 4LJ5A 1EZUC 1XUKA 1DAEA 1DSTA 4K60A 1FLEE 4YMVA 4B34A 1CVWH 5DI9A 4A15A 3MU8A 3PV2A 4GCHF 1E36B 2AIQA 1XZPA 4NWLA 1SGNE 4POAA 1XDBA 1SGFG 3LGVA 1ELAA 2OCAA 4LC0A 1TNDA 1D2NA 1YR8A 2Q6TA 2F6RA 5EE9A 1NMZA 2B0FA 4DSUA 2CK3D 3CLVA 4ZAEA 4SGAE 3JVUA 5AWFC 1TPOA 3WP1B 4DWJA 3AF2A 3DMDA 1MZAA 1FZQA 4PPNA 1CR1A 3Q7QA 2WV4A 2JLWA 4OS6A 5HR5A 5JCZA 2BVXH 2DFNA 1YCPK 3TE6A 2QRNA 2BDCA 2DE9A 5JJKA 2FPMA 3VEQB 4WOPA 4GOJA 7LPRA 2P8OC 1OXXK 1KMHA 4HAZA 1XFAA 1YPJH 3M0EA 1AZ8A 1I4TD 2VHCA 3UQOA 3PLBA 3BTHE 3QXXA 2GP9B 2IPHA 1G3IA 2C2HA 3WHLA 3KJGA 4TQAA 4ZDWA 2W83A 1NBMD 1NY5A 5E0GA 3ETLA 1U2RA 2OCPA 1GI3A 1Z29A 4QGHA 2OEPA 4DDVA 2YWGA 1HAOH 5JB9S 2VYFA 1IQMA 2XOKA 3MWKA 4YOIA 3ZVCA 3PO1B 2ZRBA 4MGYR 3M5NA 2IYZA 1RS0A 1MABA 2QEQA 5KSOA 2F4LA 2AEIH 1DO2A 1P9WA 1E3MA 4OBEA 4IOMA 3KKQA 1QIXB 2QORA 1RVDA 1BMLA 2A2XH 2ZDKA 1H9IE 3PTNA 2NPFA 1KI1A 4FUFA 1GHXH 5KPJA 4HUTA 3K0FB 3WXMA 4DBLC 1V2JT 1A7SA 4TTPA 5IF9A 2VNTA 1GBHA 1B0FA 5FAHA 2RA3A 1HTWA 4XSGA 4LJYA 4E06H 1E4YA 3X1DA 2FSGA 4WW0A 3U6BA 4WJG2 1D6RA 3A80A 1TUIA 4JVLA 4HB3A 2A3RA 3TNSA 3ZVDA 1HQCA 1E99A 4HUQB 2BXUH 1O3LA 3WYGA 4PPFA 2ZI5A 2UUKB 2MSEB 1UTPA 4PANA 4HB0A 1OYQA 1NBME 3SS8A 1BZXE 3D62A 4AYWA 2O8CA 2OQ5A 3LLMA 3OX7U 4DVAU 1NRSH 1EG7A 2FOAA 1KK2A 4ZKRU 3QF7A 2ZHFH 3UPEA 1EZXC 2ZQ2A 5T6GA 3U7FB 2CCJA 4JKIA 3OESA 2GAAA 2VIWA 2XYAA 1ZR0A 8OHMA 3OAAD 3H7TA 1GBLA 4CRCA 3KQNA 2DUCA 3VKGA 1HAGE 2GV6A 3RXFA 1GJBB 3RS0A 4EIWA 1OXSC 2FPLA 4LYJA 3VR4A 2Z9GA 1L4DA 2VWOA 1GJ6A 1NF3A 2ZYUX 4EAQA 4L16A 1CGIE 4LK4A 2ZUCA 3C8UA 4M9SA 2BLVA 3FP7E 1J14A 4DDUA 2NIPA 3IIJA 2WV5A 3RXMA 4HATA 3AAUA 2HXYA 2JIZD 1EESA 1K8RA 2PCJA 1KI6B 4YZUA 1IQJA 4Q4JA 4DVGA 5DJ7A 3IITA 1KYIA 1PUJA 3CUEF 1NVUQ 2FFHA 1C5QA 1F5RA 1NP6A 8GCHF 1L7VC 2XX3A 1U6QA 3PFIA 1XD2B 1T3SA 2ZHEH 1CHOF 1DAKA 1SVSA 3RHFA 2TIOA 4CH2B 1YF4A 2Y7ZA 3M6AA 1NPMA 3MNXA 5K8TA 2GXAA 3ASYA 1C5OH 3RXRA 4X1QU 4R0IA 3U1IB 3M3SA 2RGBA 3MFYA 2CL7X 4NH0A 1YPMH 1II9A 3AGPA 3Q7PA 2P3FH 4JVNA 2JLYA 1OHHA 2XITA 2IEYA 1AGJA 1PPZA 1FQKA 1Q3TA 1SR5C 3QSYA 5EW1H 3UANA 2V7QD 3GFTA 1QY6A 4OHZA 2WZQA 1CJTC 3RVBA 1RJXB 1W7GH 4NZLA 3BB3A 2XSZD 1TPAE 3OIWA 5L3QA 2GCHF 3UUZA 1HJ8A 1HIAB 4DB4A 3BD9A 1OWKA 4MPUA 1MTUA 2G1JA 1XEXA 3E2IA 4H1VA 2J0SA 2E1RA 4ZKSU 5LDDC 4OI0A 2BCJQ 2VB0A 3ZQJA 3NHAA 4KO8A 3OEED 4OS4A 1UDXA 5F8TA 4B6FA 2RH5A 3SUGA 4DLWA 2H2ZA 1O2YA 1DBSA 3J81k 3NK8A 1X1RA 2IEZA 8LPRA 3PM3A 1LTQA 3W6OA 3T5GA 3PB1E 2PKAA 3KDSE 3S1AB 2AFHE 5DGXA 2PR3A 5K8UA 1O2RA 1R10A 3ZYEA 1EOLA 3RSLA 4UKDA 1GAJA 1JR3A 2W7SA 2Z9IA 4M0LA 1BRUP 1J70A 4TQ9A 2AX4A 3PCRB 3UMRA 3ZVGA 3UNSA 5CHAC 1XTKA 2ZRHA 4XH9B 1DDJA 4HAYA 1LKBA 4FMBB 2OINA 1U8ZA 1GKYA 4BFWA 1GDQA 5FOTA 4A9AA 1IJEA 2KAIB 1TONA 1HXEH 5CE1A 3SI7A 4EFLA 5BYJA 3OFND 1NRPH 2GWHA 5KUTA 4UNQA 2I1QA 4ZHMU 4KI0A 5JWRA 5FBLB 1JIMA 1GL7A 4D76A 4LJ6A 4D80A 3RXOA 4JLVA 1AKSA 4WH6A 4LK2A 1VIYA 421PA 4NCKA 4RKOB 4OS7A 2BDBA 3CS7A 2GESA 2LWIA 4IDHA 5FPTA 3U2QA 4LYHA 3Q3XA 3BOSA 3K9HA 5K7RA 2VSOA 1KK0A 3A36A 5TXGA 4NTZA 3RS3A 4RD0A 1Z0JA 3LC3A 3VFDA 1FMLA 5JRZA 3LIWA 3JVVA 1O5BB 3ZVMA 3X1XA 4Q80A 1K1OA 1O2HA 3VR1A 3B9PA 2QY9A 1QQUA 3LO5A 3GJ0A 3BFKA 1GKIA 2ZRNA 1GI7B 4CEHB 3E0NB 2VH6A 1IQHA 2AIPA 2OO7A 2NO0A 3DDCA 2D7CA 3QOFA 2A7CA 1AGPA 1GP2A 1ESBA 2QAGB 1TALA 1N6NA 4KTCA 1D9IA 1NSTA 5JJLA 4M9ZA 3SNEA 2C5LA 1GJCB 1FTSA 2RDLA 4GP6A 2ZPQA 4CYMA 1FUJA 4Q4HB 5C3NA 1TPSA 2WKRA 3P8GA 2BOVA 3JZAA 1NFWA 4TT3D 4BXWA 1JMOH 4IC5A 2ZS7A 2R3UA 3U8RH 4AFZA 2VP5A 3SV2H 1T0JB 3M5MA 2EWVA 3RABA 1ZSKA 1ETTH 3AF0A 2DWOA 4RN6A 4B35A 3PIRA 1UEIA 4LCBA 1KY3A 3E6PH 5A4JA 1G30B 4GMXA 4PR0A 2B21A 1G18A 2A4GA 5L2YH 2DR3A 1DAFA 1E2MA 4GUXA 3NEJA 3LD9A 2JGNA 4PROA 2FS9A 3C7KA 1GGDC 1XMIA 2ZYVX 1Z0AA 3WHKA 2ZPSA 5F98A 1BMMH 1G2MA 5GIBA 1JRSA 1AN1E 2WWXA 4JLJA 1ZRKA 4P4SB 2X2FA 1FP6A 2FO9A 1QG4A 4KSBA 3THOA 3AVXA 2FNAA 5H8WA 1ESNA 6CHAB 1Z47A 3W8RA 3AF4A 3HU1A 5C67A 1KO5A 1X86B 3K6YA 3K0CA 3LAWA 2OXSA 1SVMA 1S3SA 2LCFA 2XNDA 1G36A 4NIXA 1AU8A 1UVUH 1AD8H 2J7PD 5FPHA 1MBQA 4FUGA 2GZDA 4ZIRB 1KO1A 4B3DA 3AK5A 1T91A 3ZZ3A 4D2IA 1X8JA 4A6LA 1YRAA 4K3JA 1ZTLA 3BFVA 1ZYOA 2VINA 3S9BA 4LPSA 1Z1JA 3CR8A 4BLSA 1GTVA 4BFVA 5GCHG
chains in the Genus database with same CATH superfamily
2SFAA 2PLWA 3HA5A 3UK6A 3TM5A 2HPPH 4EGFA 1TAHA 2HSEA 2RK4A 5EP3A 3DZKA 5AJUA 4XSVA 4U0JA 4KW7A 4PZ0A 3OCJA 4FYPA 1QO7A 4QGGA 2D62A 3DA9B 2GCTC 3THYB 2HK7A 3CUUA 4X60A 4FYWA 2DE8A 2ZFTA 4YCSA 1RJ9B 2PUHA 1T4MA 5AI5A 3MF4A 2GGVB 1BU5A 4MVXA 5BWMA 2CGAA 4D0NA 5IN4A 4DT1B 5E0OA 5BUCA 2C3UA 6GPBA 2G5TA 1KH3A 2R44A 1G7CA 5DI3B 4GYWA 1XQ6A 3PXXA 8ESTE 4X92A 1OWJA 1JBKA 4CIAA 1FBTA 4OHWA 3E48A 2OGZA 3MO3A 3AR7A 2PY6A 2IPAB 3HVHA 3HXLA 1GHZA 3FGNA 1VITF 3GRVA 2Q5JA 5HIIA 1PTJA 2MSDB 4LOKA 3E8XA 1GA4A 1MVLA 5BNIA 1SBCA 3DOJA 4ZZ3A 4LX8A 4AB9A 4TTQA 2JETB 3TGKE 4L5BA 4G0YA 5DP7A 1I2ZA 1IHYA 1L7AA 2Y81A 3TRFA 4LQ4A 3QOYA 1VHLA 3AP2A 4XIIA 3BEFB 3CUSA 3BIJA 5JS8A 2Z30A 2P7IA 4QVIA 4WRRA 1QZ8A 3C1OA 3LF2A 2PX5A 1C2TA 4QEKA 4BTTB 3K8OE 1BS1A 2WIBA 1N2SA 3HGPA 1MGOA 2GEBA 2XRCA 4WKOA 2ON6A 4AMYA 3NJ8A 5T41A 5G1OA 2X8LA 1J49A 5EXPA 3KB6A 2HUNA 3ABRB 5TGTA 4LXYA 3SP1A 1QE5A 4L78A 3W9BA 1EWKA 4J90A 1YQGA 2POQX 4KLNA 3U44A 2AEFA 4E4TA 1T2EA 2XJ9A 1VG9B 1EX1A 2YUIA 3DWIA 2Y6TA 1QQ6A 3LWZA 1VI5A 2R8OA 5EZYF 4BC1A 1PHPA 2Z6AA 4BDSA 3S68A 3AB3A 1NQOA 2WOJA 4G4JA 3AQ4A 1X39A 4M9UA 4MRVA 3G1TA 4DIKA 5B7GA 4AOQA 3UG7A 3E35A 2WM3A 5TGDA 4DIHH 2AOXA 3H2BA 4UAJA 1GSOA 2HLDA 2FPIB 4KQFA 3CR7A 2CYBA 4TV8A 4HO1X 4M0FA 3L92A 4K05A 1Y3WA 1SGQE 4TWJA 1S84A 4M0MA 2IX9A 2PGAA 1QRUA 1MPXA 3KYCB 5F2NA 2H1UA 5CB4A 4Z2YA 2WUCA 1SG0A 5F8ZA 5ALDA 1ETSH 1V6DA 1EEXB 4Q3CA 4AIRA 1JBQA 1EFPB 3WWEA 2FQYA 5IXSA 3KJQA 1AZWA 1SVNA 1KYYA 3F46A 1JHXA 2O54A 1AWFH 1CRZA 2XWAA 2BVNA 1F8GA 3R3GB 2QTFA 4OQPA 1UKCA 5IWAB 2XE6A 3DFKA 3OY6U 2D3WA 3P2EA 2KMLA 3HNPA 4N3NA 1QKJA 5KHAA 1OT3A 1RP1A 1IBSA 4L5YA 2OLJA 2GFIA 4AECA 4K1TA 2ZXEA 1E9AA 1DWEH 4J94A 1JF8A 2BGWA 1KDTA 3HUTA 3WKDA 3PC6A 4DEXA 3G9TA 1Y3IA 2G04A 1KL7A 1U94A 5FNVB 1UJNA 1AQJA 3H2YA 1DJQA 3SUFA 1NG1A 1DLEA 5CA1F 4U2FA 3PUYA 1PNVA 1C8KA 3TTTA 3RJTA 2ZFRH 1W5SA 2C88A 3ETNA 4EPXA 3QVWA 2OMKA 1MBMA 1L9KA 3RJZA 4Z51A 1LHFH 1R1DA 2C4HA 4KVGA 2FPPA 2K2QB 3H18A 1HGTH 1KZ4A 3OY7A 2OP9A 4UUOA 1XDZA 1Y5MA 4QNNA 1LJ8A 4DMFA 2JATA 4R9VA 1ELCA 4OYYA 4TMYA 4YAOA 5AI9A 3GLTA 1OYWA 2FSSA 5JXJA 3MWLA 4LVCA 2F62A 7KMEH 4BLWA 1M6NA 1COWA 4DV7B 4HAXA 1EZZA 2PK3A 4G2NA 4ZU1X 3RVJA 3SXUA 2NV0A 1N78A 4AX9H 1RPJ