4B74A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 208
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b74A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b74A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b74A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b74A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b74A03
4JLPA 1GPZA 1ELOA 1GSIA 3Q3YA 2E9SA 1NO9H 1TUIA 1HAXB 5LPRA 3ADKA 2CNWA 1M9UA 2GCOA 1IY2A 3A84A 3HYTA 4PTLA 3K0EA 1M34E 2FF7A 3PMBB 3GLHB 1NM6A 2HCBA 2EW1A 4K1EA 2RA0A 5CJPA 5C1YA 1RPZA 3K6YA 1KK0A 1GDUA 2WJJA 4XD7A 1V2UT 1WRBA 1KK3A 4IRUB 4S35A 2H9HA 1E2IA 1KZ7B 2KBEA 4Q9LA 3M3VA 2A32A 4IN2A 1MZDA 3IUYA 3DO6A 5TMPA 2BD4A 3QN7A 1NRJB 4V0OA 1YPHC 2Y5HA 2A5GA 3PUVA 1GGDB 3QTVH 1JQLB 2SNWA 4IS5A 5JDUB 5EXMA 2PTCE 3KQLA 2CL6X 3U1IB 1GAJA 2IK8A 2IWHA 4DSTA 1MTNB 1DAFA 2OC8A 3NK8A 1EJMA 1KKLA 1FXYA 2VIVA 4HAWA 4PPQA 1NIPA 1Z5ZA 1SGFG 1P02A 1I2MA 5FL7D 3TK5A 1CJMA 4Q00A 1ZSKA 3GJ0A 3VKGA 2NU1E 2ZUBA 2H5DA 1GWAA 3TNSA 2FOHA 2AL7A 1G3DA 4AG5A 2HGTH 2ZR7A 1KI4A 1NL3A 4MUBA 2FYRA 4DHEA 1IQFA 1DLEA 3P26A 3HU3A 3AKEA 2ZYVX 3P8NA 2MSDB 3KEEA 3DT0H 5DGJA 1HAGE 4NYMR 3SYLA 3U61B 3NH6A 4H1UA 1V2ST 2VPPA 1D3PB 3V4RA 1VCPA 2BZAA 3DHKH 4ON9A 5SZIA 4NHOA 1OWHA 1EFTA 3H4MA 1NVVR 4U7DA 2ZYUX 3FMIA 3WNDA 4VGCC 3MU5A 2CXVA 3PITA 4ZO4A 7GCHF 2JETB 4DJZB 5EE5B 3IHLA 5L3SA 4AC9A 5AJVB 2A45B 2BM1A 1OWJA 1RIWC 3BH7A 1RJ9A 4NIWA 4WY3A 1XD2A 2FLBH 1TF2A 3KIDU 2AD1A 1NG9A 4CDGA 2H1LA 5AJXA 3GY8A 3A1UA 2W6JD 1UTMA 3LJJA 5IDVA 3NUMA 2FI3E 1XD9A 2BD3A 5DP9A 2WJVA 5LB4A 1HAIH 1QNJA 2V9PA 3BRWD 3BK7A 3DMNA 3C27B 1JJ7A 3VEQB 4MQAA 3EX7C 1S9HA 4R71A 5FBEA 3LXXA 1RC8A 3CR8A 2ZGXH 1Y5UT 4X2WA 4C7OA 5BXQC 1GL6A 2ZPSA 2V3CC 1OFTA 4TYQA 5E8EH 1LVMA 1AKYA 4BEJA 2PZEA 3AF3A 3M37A 4QHSA 4CYMA 4Y0YE 2FMJA 3RXBA 3E0NB 2QPTA 4TTQA 1TFXA 2WKQA 1A2CH 5FI1B 3ATIA 1C1TA 3FDIA 3R7WB 3TE6A 3NBFA 1U9IC 5FTJA 2W26A 2HWLB 4NFEA 2UUKB 3GFTA 3BIUH 2F3CE 4ARZA 3SGBE 1G5TA 2DFKB 1VG1A 2HJVA 2VWOA 3NTUA 1IXRC 1TBRH 1DM4B 1FZZA 1RXPA 4HUQB 821PA 3F8TA 3AP3A 1GBHA 2W2TA 4LC1A 3U2QA 2WV9A 1O2LA 1ZPZA 2GD4B 4TL6A 1C4V2 1DAEA 2VBCA 2ZHWH 2VF7A 1HPGA 1N25A 1O3GA 2Z6VA 1V3XA 3HWSA 5FTNA 3CF2A 1OV4A 1C5OH 1CJVC 2DBYA 2QF0A 3T26A 3R9WA 5AJZA 1KI7A 1MKYA 1NPMA 3GY7A 5DO9A 3NIBA 2A4OA 4WJG2 3Q5EA 2J38A 4WXPA 2BDBA 2OG2A 4B35A 3WY8A 3KHVA 1SQOA 3DEFA 4KTUA 1GJAB 1TQ6A 4DIHH 2O0JA 4Y71A 4Q1DA 5JEDA 3B1WA 1XCPA 4MYHA 2FOEA 1GMDG 1A46H 1XJQA 1TYNA 2H17A 1R5OA 4QNRA 1WQSA 3D7MA 1MTNC 2WMNB 4TQAA 1UKZA 1P10A 1II9A 2W7UA 4C30A 4X1QU 1PQ5A 4RKJB 1UFQA 2YVUA 1TA2A 2AH4X 2BOKA 1RS0A 1UHBB 1BMAA 3GCTG 2BJWA 4R2HA 1B5GH 1P9RA 2C98A 3PMHB 3SOPA 1C5NH 3E1SA 5J4QA 4YXWA 221PA 2MSEB 2GT7A 2JLQA 1C2JA 1LKBA 5AJWA 1BRAA 2QSZA 1O2OA 4B2AA 3P1JA 2GXQA 2ZEJA 1G3CA 3OTJE 3TAHA 1TNKA 2X2FA 3X1ZA 2OFWA 3PYHA 1R2QA 3TU7H 4PSVA 2JLYA 3SHAH 1OIWA 3M1IA 3BB3A 3QBVA 3I5YA 4OHVA 3RUOA 3QF7A 4M9FA 3RRZA 2UWLA 4KTSA 3O8DA 2ZTYA 1CA8B 2ANMH 2PKAA 5EUMA 2QA5A 1OB2A 3M5OA 4N0EA 4LSGA 2JJ1D 1SFIA 1Y3AA 3EARA 1UTQA 1E2KA 4V02A 1FDPA 1P8VC 1LKAA 5GJWC 1TNIA 4Y8ZA 1LY1A 1U6QA 2J9NA 3SYJA 5H1YA 1T32A 4FUDA 1NFXA 5UKDA 1BBRE 2ZJBA 1UTPA 4O03A 4BRUA 1VGCB 2GXSA 2VP2A 1EKBB 1FL9A 3BC1A 1MBMA 1ETUA 5JRZA 4YM9A 1V2LT 1P9SA 4DOQA 1H4WA 1OYYA 1TAGA 3HJNA 3H2YA 5FX5A 5ELXA 4G5QA 1GRNA 5GIBA 1UK3A 8GCHF 3BTGE 5DP4A 2W0SA 1CP2A 4Y76A 1XB2A 1BT7A 1SULA 4O2LA 4Q21A 1SGQE 5IHPA 3A8CA 2VIOA 1NY5A 4EDHA 4OQXA 3SJIA 3KKOA 3QLPH 3B5JA 3QSYA 2IEYA 3UNRA 3PM3A 1QHGA 2ZI7A 1GBAA 4G5RA 2AWOA 1EAIA 4OI0A 1M74A 3QENA 2FEQH 1VCQA 4Y6DA 2BV3A 2GCOB 4DZZA 1CRQA 4BNRA 1YLCA 2M5TA 5JCZA 1T3SA 4ESVA 2QBYA 1FONA 3ZZ5A 4US1R 4GFDA 2QE7A 1FV9A 4HZUB 1FY3A 3NHAA 2ZU4A 3FYHA 1NTPA 4UDWH 2H9TH 3OEHD 4DCDA 3KQEA 1W48A 5JJIA 3GLGA 5A5GA 2DE8A 4MRSA 2OXSA 2V6NA 1HXEH 4WVFA 4JK6A 3BBPA 1MH0A 4W5JA 4QM6A 5D3MA 1OT3A 5KOYA 2G0TA 2F43A 1OPXA 2G6BA 1S3GA 1SZPA 5GWZA 3B23B 4MKGA 5CM9C 1RW4A 2ZE7A 3LBNA 3LQRA 4E7RG 3SW2B 3GJ5A 1W8BH 1Z6YA 3RS0A 1YZUA 4OGXA 3B7GA 4Q18A 4B73A 1G37A 2XC0A 4AKHA 3ZD7A 3ZZAA 5G40A 2Q0HA 3ZVNA 4Q7MB 1C2MA 3P6ZB 3OSYA 3SNAA 1XTKA 3KQBA 1C5PA 2B8WA 4LZ1H 1TQ7B 1PPCE 1PJRA 1J99A 4WH6A 1EXFA 1UTOA 2BM2A 4TLEA 2QGZA 3LDXH 2FEMA 1TX8A 2W7SA 3OE7A 4V0KA 4OQLA 2GVZC 1HE1C 3FOZA 2Q21A 3W95A 4OGYA 1WCV1 1JAHA 2HEIA 2BCGY 1A5GH 3F3YA 3UK6A 2BKEA 1EPTC 4YT6H 4OS2A 3ZZUA 4CF7A 5FCRA 3L8YA 3SJOA 4HI0E 2ZVQX 4QBGB 3SI4H 1F5LA 4C9BA 4D7GA 1KNQA 4FIDA 5JRJA 2FFBA 1IXSB 1GBTA 1L4ZA 4A6XA 4RKOB 2RGEA 3AVQA 2OFOA 3FPAA 3A58B 1ZJDA 3AVXA 2GCNA 5HGGA 2AMDA 1DEKA 1W0JD 3GMTA 2W5EA 4IOLA 4D80A 3ZH9B 1SKYE 3A7YA 1ABJH 4JSYA 5L3SB 2DR3A 1AQYA 5JBBS 1TEXA 3OZXA 4ZKSU 1RJ9B 3ZVEA 1G3EA 2QGRA 3EASA 4D0GA 3EA0A 1CT2E 1MABB 1GJBB 7GCHG 4WOPA 3U7HB 3IKJA 2Z4RA 2PFEA 5H4IB 3A81A 3VHLB 3FP6E 3K9XB 2BMFA 3X2SA 1WF3A 1QRXA 1CTQA 1I2DA 1GM5A 3D6TB 3ODDA 1X1SA 1VPLA 5BYKA 4V0MA 1E2PA 3UFAA 2ODQA 2ZRPA 4XD7D 4AWXA 3P8GA 4TTRA 3IG6B 1KKMA 3EG5A 1G3QA 4RD6A 5TXGA 1GBEA 1Q3HA 4OKSA 1GMHF 4BFUA 3U1JB 5DG6A 1W46A 2N42A 4IOJA 1W2KH 1DUAA 1ODFA 3QXJA 3MU4A 1RIFA 4WF8A 1EZSC 2PL3A 3QXHA 1ZUNB 5JSZB 1GWNA 3TRFA 2AMPA 4DXAA 2GWHA 4LYJA 4R7ZA 1OYTH 1KYIA 2RGCA 2GHIA 4PZLA 5HE8A 2IYXA 2MSCB 1O38A 4GI7A 2C99A 4Q9IA 4NCHA 4NPHA 5JJLA 1K21H 4ARZB 1N8OB 4YO9A 2DY1A 4A0HA 4UFDH 3F1SB 3U98H 2VHUA 2NO7A 3TGPA 3KFXA 2B9LA 3F9EA 4HUTA 1QBVH 4F4CA 2JH6D 1NESE 5HM2A 4DSNA 1QBKC 3NBXX 3WBJA 1R0WA 3ZQ6A 5H70A 1RZ3A 1UJ2A 5JBTA 2CGAA 1T0HB 1ZGIA 1KY2A 3C15C 4DIEA 2NZJA 3STJA 1BIFA 4LV5B 5B6LA 5FBIA 1NKSA 5DYGA 5E2OA 4E07A 3RDPA 2OFXA 3WRXC 2VHQA 3AV0B 1D4PB 1TBZH 1KJYA 1A0JA 4X6PA 4UD9H 4TT3A 1O30A 3WMEA 3VNUA 3KX2A 2IL1A 4ZIRA 2P16A 2WWGA 4Y8XA 3ECCA 4URWR 2QN5T 3EPLA 1O5BB 1G17A 1YZNA 2IWRA 5L2ZH 3R9IA 3K9NA 4JYCA 5J4VA 4JS0A 2HPPH 3RMNH 4UXJA 1IQIA 5HTKA 2ZVPX 3G0HA 3P8OA 2XTTB 3SUGA 4FUJA 1XCGB 3MO3A 1YGCH 4NA7A 2TIOA 5E3HA 1MZAA 1QL7A 1C2LA 1W5SA 2QPOA 1NU9A 1XKAC 4ZPXA 1IN7A 4ASHA 1GL0E 4MH0R 4DLYA 1Z6EA 2ZTZA 1KTVA 5A0AE 3MNSA 4UFFH 4KP0A 5LH8A 2H92A 1ESBA 3K0AB 4NDZA 4JL5A 2AK2A 2Z94A 3ICQB 1CBWC 5HKKA 3HU2A 4NP6A 3U3RA 4D7FA 2ONKA 4UFGH 5FBLB 1HYLA 3PO1B 1FNNA 2BX3A 1IJFA 2BMDA 3KCGH 1QHIA 3TJUA 2BIFA 2BOVA 3AH8A 3M7TA 5EW1H 4AX9H 1Z22A 3U8OH 3WRYC 3AF4A 4W7SA 1ZR0A 2OBQA 4RCZA 4KVGA 5J4HA 2ONJA 1QQ4A 1PQ8A 5TDHA 1HT1E 4FCVA 3URDA 4DURA 8KME2 2ZQ5A 3UREA 2PKAB 2OK5A 9ESTA 1C2FA 2O0KA 2BLWA 2OLGA 4E05H 4WZAE 4WIAA 1MCTA 1W49A 3Q3JB 1Z06A 2PLRA 1GTVA 4UNNA 4TTPA 4YLUA 2GF0A 1KTSB 1FUKA 2ZZUH 3K2UA 2X77A 2ZETA 4HAYA 4X6OA 3VR1A 3ZV8A 4LDJA 1QL9A 4M9QA 1OFUX 4LYFA 2IF0A 3T62A 4PO8A 1HUQA 3RXFA 4B3FX 2XNDA 1AVXA 5FPHA 1NRQH 3TBKA 4CRAA 3W8NA 1COWA 4CRGA 1ESMA 1FX0B 1P2NA 8GCHG 4ZKOU 1DSTA 1RRFA 2BQ6B 3SU4A 4XSKU 3M0EA 1QHHB 3WY9A 1TOCB 4DDWA 1A82A 4CH2B 2FI4E 2SGQE 1OWDA 5BWMA 4IW4E 4I1UA 2UWPA 1BA8B 3Q72A 3WMFA 4UJ5A 2DYKA 2VSFA 2ZWLH 4QRHA 4Y7BA 5EPYA 4NSVA 3GJ8A 2IS4A 2OC7A 1II8A 4OQNA 1TGNA 1E2HA 2QBYB 2WSMA 4PC2A 3ADDA 1IN6A 2GZAA 2N46A 3THXA 4MG3A 3L0IB 4AB9A 1CVWH 1O2WA 4TMWA 4IW3B 1Z8RA 3ZZBA 2Y80A 1CJUC 4YXWD 2ZHFH 3GLGB 2FN4A 5FR2A 2CMYA 2AXNA 1SQ5A 1GJ8B 1AZSC 3BTTE 2QP3A 2VSOA 3GICB 5JBAS 4GT1A 1TQDA 3A7VA 1HT2E 3EDXB 3RU4E 4II7A 4N0DA 5SZKB 1NLZA 1QA7A 2F43B 1UMAH 5A8YA 1D6WA 3PENA 3LY5A 2C96A 1Z6GA 4BGDA 1YM0A 1XBTA 2F3RA 3RS5A 3EYDA 1E0AA 4A1FA 1EJNA 4BLSA 4FXPA 1XP8A 3P95A 2C78A 4X6MA 5DHAA 3B82A 1E2MA 1N6NA 5EP2A 1XX6A 3D23A 2OQ5A 4TMVA 2ODNA 2W6IA 1VECA 1E32A 1EK0A 1N0WA 2FGKA 4JVSB 1TNLA 2CHQA 1DG3A 2Q3HA 1TNDA 1NMZA 2WAYA 1KI2A 4Q4HA 1ZMXA 3I78A 4IHQA 5JHHB 1BOQA 1E4YA 2UZIR 2HT1A 4AIIA 1XUFA 2GZ9A 3P70B 4ZKRU 1GBJA 2QXIA 3FFGA 4WZ6A 5FR1A 1ZZZA 3I77A 1J17T 3ASYA 4ABAA 3OIUA 3SHCH 3BTQE 2EVWX 1KJWA 1X7AC 5DK1A 3DM5A 5GCHF 4MDFA 1N0UA 4CGZA 421PA 4NCNA 4CREA 1C2IA 1KMHA 2OBMA 4JKYA 1E4VA 3PUXA 2FYQA 1YJ5A 5C20A 3SBDA 4LOAA 1VZQH 1T6NA 3TAUA 2TMKA 2ORWA 3ZZ6A 1ZLRA 1SBWA 3TGJE 2UZ3A 4X2XA 3A83A 3GJ6A 1Y63A 2UUJB 3BG8A 2VIDA 3R20A 2R6FA 4MPWA 1KXCA 1CBUA 2F9MA 1FUUA 4ISNA 4U32A 3BB4A 1OWEA 1G18A 4K46A 1UBFA 1US8B 3HKJB 2ZRGA 3CP7A 2YOLA 1P75A 4JLKA 1DUEA 2GMTC 1EATA 3A6PC 1ACBE 1GKYA 4RY2A 1KAOA 1ZM7A 4I99A 3U8RH 1K28D 2O8BA 4SGAE 1IN5A 3RC3A 2QTVB 2AX4A 2FLRH 2QG6A 2IYUA 1Q1ZA 5F8TA 5JBQA 5F9HA 1P0SH 3A4NA 4A9AA 2FX6A 2ZRJA 1ELBA 3SYKA 1HAVA 1O2QA 1YPEH 3TLXA 4C2UA 1UEJA 3I32A 3ZVDA 4A1TA 1DXPA 4V03A 3KB1A 3LGUA 3I1FA 4JIMA 4EFLA 3ODFA 4M53A 4HSEA 4ZDIA 2ZXUA 3ZGXA 2B21A 1GNRA 4N1AA 3T5GA 1OYQA 2F1RA 2ZCKP 4TYDA 1KLTA 5F8XA 1TNGA 1TPPA 1RE0A 3GLHE 3OIYA 2PMKA 2BM0A 1DE0A 1XUIA 3ZJYA 1OLOA 2AYWA 3NHBA 1W4AA 3MD0A 4HLCA 5DP8A 4GP6A 1E0FD 2ZDLA 3OE7D 2FO9A 5J47A 1MKWK 2AFHE 3SC3A 2ZE6A 4M0LA 4CIDA 1IN8A 2C3SA 2C8VA 2THFB 3KF2A 1QQUA 2F9VA 1FOEB 2TBSA 3URCA 2WPKS 4TMZA 3EA8A 1P01A 1W4BA 1OXUA 2PBRA 4NYJQ 1KLJH 2VIWA 1NBME 1GI6A 2BDCA 3GCGA 4FUFA 1ZW6A 2OCAA 1E34B 1W4CA 2OESA 3QOFA 4JL8A 2H1UA 2VQSA 1VHLA 1V2MT 2QXGA 4D82A 3A7TA 1BTXA 1XU4A 5LBIA 3QVVA 3TH5A 2GRJA 4IDQA 4B32A 4TL7A 3A8DA 2GV7A 5HM9A 1UCYK 1EGAA 3U7FB 3ATKA 1GMCG 1KDQA 3MHWU 2VRWA 1P2MA 2O8CB 3ZVLA 1CR0A 5DYIA 1DPFA 2FH5B 4KI0A 5JHGB 1L0ZA 3RLFA 5DO4H 3TSOA 4NIXA 1S85A 1LF0A 2D06A 3AAVA 4C0BA 3WNCA 1ELTA 1NC6A 1BHXF 4KHZA 3VQTA 1OP0A 3A82A 2FFAA 2R0LA 4QOSA 2G52A 2NMVA 1AK2A 1CHOF 1VMAA 5BN4A 1KSNA 1V2QT 3U44A 3VXFH 3VR2A 1IHTH 4EJSA 4HI3A 4PAQA 2JATA 3V00A 2NO6A 1YR6A 2BWJA 1FY1A 3ITIA 5KNCA 4UJ3A 2DB3A 2PUQH 1KO7A 1C1WH 4L8GA 3P27A 3VKWA 4TPYA 4XDEA 2HNTF 1WU1A 1TE0A 3RANA 1S0QA 2Y5GA 4K69A 4Y0AA 1DDJA 3UMRA 1O2SA 3K9GA 1AZTA 2PMDA 3LRPA 1G291 4TMKA 1ANDA 1GITA 3IILA 3BIVH 3SJBA 1Z63A 4FD2A 1MTVA 3AF2A 5L2YH 1TA6A 2K1QA 1GCTB 2YHSA 1AO5A 4PPGA 1R0YA 2QF3A 1ZTLA 4NZQA 1T8UA 3PUZA 4DCTA 1BRBE 4FVBA 2J46A 1RD3B 5KYKA 4W5WA 5GJCA 1HTWA 1Q2WA 4JLVA 2N1BA 1PQ7A 1SGDE 4WWYA 1TWXB 3BB1A 1LMWB 4PANA 4TT3D 2YC2C 2O8EA 2QUZA 4CZ2A 1C1VH 3B60A 4BFXA 4A5TS 2ZGHA 2CDNA 4INHA 3BFVA 4QG7A 4QBFA 2RG3A 3CH4B 1NMXA 3CZPA 4CRWB 1V2TT 1S84A 4DKXA 4Z54A 4TQUS 3QUMP 1FIWA 1NY6A 1LHDH 2NQ2C 1PFXC 2GJ8A 3T2NA 1EX7A 4BTUB 1IQHA 4X8UH 5E7JA 1MT0A 1FTSA 3V12A 2AS9A 4Q7KA 1Q20A 2FDAA 2RB4A 2ALPA 1ANCA 1G4AE 2ZSEA 4XTCS 1FW6A 1QRAA 1J70A 1ZMLA 5FCKA 3RXUA 2OBOA 1QJ7B 1GHBG 5CDFE 1Z1JA 3RRNA 1FY8E 1AI8H 4JVMA 5JLJA 1HYQA 4JMYA 4GVUA 1V43A 1RRPA 3L0SA 1V2RT 1GJ4H 2FA9A 1SL3A 1KNXA 1IAUA 2ULLA 1HB0B 5HKKD 3PLPA 2OUAA 5T6GA 1B0EA 3LVRE 2RGGA 1P06A 2FU5C 2WIAA 4I7YH 1T31A 2ZYTX 2GCTB 1EZXC 2GEDA 1S82A 1P12E 2QEQA 2ZI9A 1LVBA 2IOTA 5GXPA 1II0A 1J8AA 1P61B 4JVLA 4WXRA 1TUEA 2D2FA 3MNBA 3LNCA 2QM8A 1CLUA 1U98A 3GFOA 2YWGA 1H9HE 1SLVB 1VJAU 3Q5DA 1NT1A 1KXDA 3AUXA 3T35A 1SGTA 2BY8X 2V4ZA 3BOSA 2XCNA 1EFHA 2B0FA 2QROA 2A7QA 2P8OC 1BMNH 5BPEA 1UVPA 3IPXA 5EQSA 1MKXH 1XEWX 2G77B 1R5NA 5GADl 1ELFA 3JZ2B 3DHWC 2IYLD 2WUBA 2D3WA 4KYUA 1Q1QA 3DKPA 4XVUA 2XCFA 2KWIA 1YPJH 5AFZH 1F7ZA 4F4JA 2UVQA 4HAXA 4WW0A 3GDUA 4CT5A 1BKDR 5LD2C 3C7KA 4OJKA 1H8EA 2ZPQA 3ETLA 3JZMA 2RGAA 2XNDD 3AVOA 2ZDKA 3QQ5A 2ZFQH 1COWD 3PTBA 1O3IA 1KMHB 4ABHA 1ZU5A 1UPTA 3SJAA 1BYUA 1E69A 1P9NA 5T6FA 1UBGA 4K8YA 1BCUH 2OLJA 1E0KA 1EAWA 1NN6A 4LWZA 3VR5A 2G81E 3UANA 1CJTC 4XBDA 1KSGA 3GD7A 3HPTB 4M22A 4OS4A 1QIXB 1NJGA 3L2OB 3MMGA 2V35A 3LFUA 2JLRA 2ATVA 3EA5A 4LUCA 1C1PA 2Q9AA 3SI3H 2ZGCA 1DS6A 2XAUA 1M7GA 1F60A 4B1TA 2O8BB 2HCJB 1O33A 4QL3A 4BANB 1GCTC 4GAWA 4GUXA 4KJZA 2J4IA 3I73A 1LW7A 3QBTA 2IF2A 2RCNA 3QUSA 4LHXA 3ZYEA 4GNKA 2P6NA 5FL3A 3PG5A 3U5ZB 1W0ZU 4KVAA 4MKHA 1NN0A 1O3JA 3WBKA 3MGCA 2V54A 2ZI6A 2GJKA 3ND9A 5DHFA 2GXAA 1BO6A 2FOGA 4AFUA 1OH8A 1LFDB 2QY9A 3RXMA 1HUTH 3PEWA 1JRTA 4BAMB 2WKRA 4BQSA 2LNCA 3EWAA 3GEHA 3QG5A 1G7SA 1V6DA 4W5HA 2AK3A 1GHYH 4FUGA 3OX7U 3LWNA 4FUCA 1F2UA 4A0FA 4J0QA 1BHXB 3SU3A 5E0JA 1LB1B 4ZXYH 2GXUA 1FP7A 3D31A 1E2DA 1NVWQ 4GHQA 2BVSH 2W6ID 1XUKA 4E03A 3C41J 1N3BA 4GHTA 4JT4A 2ZRHA 1CO7E 3CO5A 1WOFA 4B3BA 2PX3A 2ZRAA 2C9YA 1ID5H 4B47A 5EE3A 3HPQA 3ZZ4A 2C5LA 2ZRFA 2MMGA 2ZECA 1N6PA 3OY6U 2RGXA 1SG8B 2VHJA 1FNMA 2RDLA 1E38B 1Z08A 4IOMA 3MOCA 1D9IA 2OC0A 3KL4A 3SS8A 1EAXA 1IHSH 1W12U 3CM0A 1YU9A 4AYWA 3IDQA 1E1RA 3AVZA 2JLWA 3VPKA 1ZRKA 2RH5A 5DN6D 5H68A 2C9CA 4RVCA 3LH3A 1JXPA 2VL7A 3SQEE 2ZJYA 1C4U2 4IBLH 3M7UA 1XPOA 1SQTA 4B3CA 1KSJA 1ZNWA 5GDSH 3UY9A 1TF5A 3I62A 2FMXA 4GDFA 2STBE 1ZSLA 4LJ7A 4LJAA 5FTLA 2Y81A 4JLJA 4US0R 3W5IA 5EE9A 4KO8A 4ABJA 1RTKA 1KXBA 6ESTA 2YWEA 5L3QB 3KQNA 2QMEA 4LPKA 1Z0IA 4YLGA 3BSQA 2G3YA 1E1QA 5FL7A 2R6DA 1ESNA 1GHZA 3TK6A 1SKYB 1WQVH 3U44B 4UXIA 4M9XA 3L6PA 4LZ4B 4XWAA 4RFVA 3F5FA 4NSYA 3MYWA 1P2KA 1G7RA 1CHOG 5FXLA 1L4DA 3TQFA 3PFIA 1YKTA 1TQ0B 2QV1A 1ELVA 1CGIE 3EZ6A 1Y3UA 4NTZA 3SGAE 1BRUP 1M7HA 5B58C 4ITRC 3M4YA 3T61A 3TLOA 1P9UA 4PHFA 2Y7XA 1EP6A 1IONA 2H8KA 2XSZA 4TWZA 1O3KA 4S2EA 2ZS9A 1BIOA 4BAOB 2GVDC 4AFZA 5HXFA 1Y59T 2EWVA 3EQ0H 1ZM3A 3Q00A 3AW1A 3LW8A 2AEIH 1KDTA 1ELGA 2ZDNA 2BVXH 3L8ZA 3C1KA 3EAQA 4L9WA 1O2TA 3Q7PA 3OY5U 4YOIA 3ZV9A 3E3TA 3LO5A 2BQ7B 3S9AA 3UR6A 1A1VA 3U8TH 1E9CA 2GBLA 1UK2A 1P73A 4RN6A 2BDAA 1GVLA 2F4LA 1ELDE 2B8TA 3ZVFA 4DIIH 4UNQA 1QG2A 2O8EB 1O3YA 4MYUA 2H16A 1OXVA 2XTNA 5C4MA 1B0FA 2RHDA 2FFHA 3VB5A 2PKSC 3HGPA 2ZE8A 3OIWA 1MU8B 3BEFB 1A0HB 2A7CA 1Z0KA 3WP0A 2C8YB 4ZMAH 3GPLA 3F9HA 5FHTA 2XTZA 1XTQA 4JJKA 4BAHB 3LH5A 3KJIA 3BEUA 3VKHA 1NVVQ 1PUIA 3LKWA 4FWTA 1ZUIA 5FUWA 1HJ9A 1IXZA 1O3CA 6CHAC 4MRPA 4A8JB 1JOUB 3CRMA 1CSOE 3QF4A 1NBMA 2CJWA 2BLVA 1Y3VA 5TV2A 4P0TA 1SMFE 4BLRA 1DLKB 1AFQC 4KSBA 3MU1A 1SSXA 4GMXA 3IO3A 1C5MD 1R6BX 2WWFA 3RYTC 2FE4A 2V1XA 1P5ZB 1AGRA 1QJ1B 1SVLA 2CCJA 4ESHA 3UWOA 4NFFA 4THNH 2GGVB 1JXOA 3S7KB 1LS6A 1PPHE 1TLDA 5KU1A 1DXWA 3SYNA 4Y0VA 3CS0A 2DPXA 3EIHA 1O3FA 6GCHG 2B92A 4HB2A 2A4QA 3PV0A 2F9NA 5FOUA 4EQ6B 1EQ9A 4GL2A 3V3MA 2IPHA 2VLIA 2EFHB 4E7NA 3VFEA 3VFDA 3T1OA 3M3TA 2Z6BD 4UFEH 1OP8A 1U94A 3H09A 5FFMA 3MH5A 4TLBA 4B3DA 4JLMA 3VX3A 1Q22A 2YJTD 1G9IE 4TLCA 2J34A 1TX6A 2ZAMA 1JR3E 2WYGA 1XCMA 3IWMA 3H0KA 2ZJZA 4JYUH 2VF8A 2F1IA 1UVUH 4F38A 1AY6H 4PO9A 2XXLA 1YBWA 2BY6X 1Z7KA 2H6MA 4KAXA 3CNNA 2BMJA 5FOWA 4C4PA 3U3OA 2J92A 3RXEA 1HURA 1QHRB 4NCKA 3DA9B 4X8OA 1G6OA 1E2JA 1SGEE 5ESBA 1NJFA 1BQYA 1GL7A 4PQRA 2FJUA 1XMVA 3TNTA 2V55B 4EJSC 3FMPB 4DGJA 1XTIA 2ZREA 4LHZA 4MPVA 3KJHA 2FNAA 2XB4A 1FAKH 4EPVA 5F8ZA 1M7BA 5CJ2A 1E2NA 3K8YA 1WSSH 1E9EA 4CR5A 1E2FA 2NU3E 1MU6B 5GVRA 3PROA 1NIJA 1JEDA 5FOXA 4DLSA 1MO4A 1QVAA 2JIZA 2GCPA 4PXAA 1DWEH 4LV8B 3RXVA 4KYIB 4Q47A 4YOJA 3VMFA 2VTKA 3IEUA 4D81A 2W58A 2JJ1A 4GSOA 3CRVA 4R2IA 1E9SA 3SDZA 3RC6A 2GETA 2ZAOA 3M7QA 2E1RA 2GA8A 2B6HA 2PUXB 3ZZDA 4LXBH 3SR0A 3LGWA 5FPYA 1C5UA 5JEEA 2RGNA 1K1OA 4RZ2A 2ZANA 4AZ2B 1KI3A 4Y7AA 5FTMA 1X1RA 1TBQH 4EFMA 1OXXK 1DADA 3CPEA 2W83A 1BBRH 1SXJA 4BRWA 2GKVE 1QF9A 1GL9B 1TU4A 5CDFA 1ZCAA 1XVOA 3RXRA 1GJ6A 2Z3EA 1YCPH 4XSGA 2WUCA 2QA9E 3SHFA 2AGEX 1SGCA 3GLGE 1GI9B 3RC5A 1ZAKA 1E2EA 2F7SA 1ESAA 4DEXA 4UXHA 1P62B 2PV9B 1GG6C 1N6YA 5B30A 1XTRA 5FPSA 3QK1A 1E2GA 4OS7A 1XD8A 1Q31A 1IQEA 1GP2A 3LBIA 1R5BA 1UCYE 4AOQA 1CGHA 1JEEA 3U3MA 2ZC9H 4D76A 1SLXB 3LBHA 1SVKA 3DL0A 4F92B 4W9MC 5EODA 1W5TA 2PCJA 3TGKE 3KJEA 2QP4A 3NC0C 5EJEA 1H8ED 2ZHQH 2TPIZ 1N1LA 2YOGA 4L9SA 2XC5A 1O3PB 1BH2A 4PC1A 2CBZA 2IUSA 2TGTA 2FOLA 3L0OA 2F9LA 1BZXE 4X1PU 3T34A 1TALA 3OEHA 1AE8H 4D4LA 1MBQA 2F1JA 3ZZTA 2IS2A 1NSFA 3KXIA 2AIQA 3CX7A 3C5HA 1FIZA 1O5CB 3RXGA 2ZUDA 1SVOA 5HZHA 1F0SA 1NVXQ 1FY5A 4OL0A 1PV4A 1DICA 1NVUQ 2CLSA 2ASUB 1LF5A 2DE9A 1O3AA 4Q03A 2QN6A 1G3MA 3KL6A 1PZNA 1ZYUA 2QZ4A 2Q6DA 4BECA 1O3MA 1FQJA 3W3ZB 1S83A 2IYWA 3RS2A 1FQ3A 3O8CA 4TYPA 2IYRA 521PA 1IAQA 1PPFE 2TGDA 4X1NU 2W00A 2R0KA 1S3SA 4ZDWA 1G7CA 4M1KA 4AG2A 2Z0MA 1HCGA 3PLBA 1TONA 2GZHA 5L6NH 1C1NA 3UMSA 3SOSA 4D8NA 1C9KA 1O2KA 2SHKA 2FOMB 2QM7A 3FKSA 1P2OA 1LPGB 3MAAC 3ASZA 2C8ZB 1FMJA 3MG9A 2ZRKA 4X8SH 4LY6A 4BFTA 3T1QA 4KGAA 3E90B 5ABWA 1FPHH 3FB4A 2WZQA 1FPCH 1QHYA 1BJVA 2D4HA 1A4WH 4URZR 4KLNA 2EU8A 2O8DB 2CF8H 4G1UC 5F3WB 2HLDA 1D6RA 1QFKH 1TRNA 2ZSAA 4PC3A 4XSHA 2GX4A 3RU4D 1BTYA 4RZ3A 2FOBA 3A7WA 4M4SA 1R10A 2ZRMA 3RS3A 1AUTC 2FZZA 2F55A 1QHXA 3NEJA 3EZFA 3GEEA 5AHGH 4YESB 1KI8A 4A15A 4MGZR 2Q6TA 4YMVA 4D0LB 1UTLM 1XFAA 4DDUA 1N6IA 1E6CA 1O3EA 5DP7A 3SN8A 2WOOA 4X8VH 1G64A 2OINA 4HZUA 1C2GA 3CX8A 4D9RA 4DJTA 3DFLA 2G88A 2C9OA 2W2XA 3TR5A 3V4FA 3CWQA 1E1RD 1L4UA 2BHGA 3UG6A 1JIRA 1I4LD 3CRW1 3K0SA 2PLFA 4Q66C 2PLXA 3UATA 3PMAB 2EI6A 4HAZA 2QGNA 1KY3A 1F5RA 1VCMA 3QZQA 2AERH 4PQYA 3K70B 1X8KA 3WYAA 4YMWA 3OAAA 3QF4B 2CJWB 2VYFA 1U2RA 2CL0X 2BMEA 3SFVA 2FX4A 2XBYA 4BAKB 1GBLA 3FP8E 3SJCA 1GHAG 1L4YA 3EW9A 3ZZ7A 2GJAA 5E7MA 4IC5A 1YZGA 5IYTA 5T1VA 1G9XA 2F9UA 2IYSA 4NG9H 3AAUA 1PLLA 2PX0A 4BZXA 4WH8A 3SNDA 4ABEA 3KDSE 3T5FH 1ARBA 4UKDA 1E1QD 2TGPZ 1O2UA 1ETRH 1OIVA 2J2UA 3GDVA 1Z6XA 1VITG 2BZ6H 2BB4A 2BBOA 5EXTA 3TIFA 4CRCA 1IHUA 3TVJB 5JB9S 4U5XA 3F68H 2SGFE 3M5LA 1SPJA 1T8TA 1ZSJA 1EB1H 1ZHPA 1DX5M 1WXRA 3QEOA 1KSHA 4UNRA 3ZZ0A 1C1MA 3OEEA 3THYA 4JLBA 2A5DA 2QRNA 1TABE 3TR0A 4E06H 2SGAA 4M9SA 2V3HH 2VVVA 1E3MA 3VU9B 1WQ1R 4MPUA 5H8WA 4DLZA 2P5TB 2XSZD 4D4JA 3K9LA 2ALVA 3TH3H 2BYAX 2DWOA 1YLDA 3RLYH 2BLOA 1DE7H 2J94A 2SGDE 4B2PA 1ZCBA 2AN9A 1IOEA 3KB2A 2OBNA 3RNLA 2GCHF 3GJ7A 1C5YB 3SV9A 4EFNA 4FCWA 2VIQA 2REXB 2PGQB 4WMFA 2O8FA 3MFYA 1ZU4A 4IFBA 2ESTE 2OAQ1 2H5EA 2JH0D 1FI8A 1XPUA 4O25A 2Z3CA 4F7WA 4LHVA 2Z9KA 3EA7A 1Q0UA 3B9PA 4DT1A 1MABA 5A0FA 2R44A 3A36A 1UBEA 3IBYA 2Q9BA 4EIWA 1S0UA 2BY9X 3U3KA 3I72A 4U30A 4QGGA 1EP5A 1E0SA 3SU1A 1FJSA 1N5LA 2G55A 1C1OA 3ADBA 5FOSA 2IT1A 3UPUA 3TNFA 2OT3B 1K5DA 1LVGA 3RRYA 4INLA 1T3HA 1G16A 5F03A 2ZI4A 4MNVA 1TNJA 1KZGB 1ZNXA 5EZ6B 2STAE 2CMKA 2OUKA 3BN9A 4U00A 4OHXA 3I8SA 2XGJA 1N6XA 1A3BH 2BD2A 1N5KA 3W6OA 1OWIA 121PA 2WJHA 5EUQB 3T25A 2D7CA 3VGCC 3K70D 1QB6A 1E79A 4DLRA 5JSZA 2G1JA 1OXSC 2XJ9A 1QDEA 1NBMD 3AP1A 3TGIE 5J4KA 1UEIA 1V2WT 4WAUA 3LT3A 1HQYE 3V13A 1E2LA 4RSGA 2JASA 3RMMH 1NNEA 1P3CA 2CCGA 2XZLA 5BN3A 1UVOA 1C2EA 4A2PA 1GNQA 4I4LA 4LBZA 4RFSB 1S1MA 1KIMA 1O35A 4G5SA 3RM0H 1BOFA 1J90A 3AASA 2GBLC 1W0YH 3QKRB 1FTNA 1DFPA 1Z0DA 2GTPA 2DHRA 1NZQH 1W36B 3FZDA 1Q1EA 4QJ3A 4NA8A 2JEOA 1Y5AT 2CHAB 5JS7A 3DVLA 1OF1A 3AKDA 2XWBI 1SXJB 3GISB 1T4UH 1HEIA 4LBYA 3AVVA 4KFUA 4R98A 1J16A 1OXGA 3A37A 5LGOA 5EE1A 2GZ8A 4X2YA 2QCYA 3JVUA 1S0RA 4ACBA 1FMGA 3MJRA 4F4IA 5C2JB 1E2QA 3PEUA 3GOVB 3ELAH 1C1QA 1ZD8A 1GGDC 1DO2A 4CRFA 5G4BA 4JSTA 2JJ2A 1IQNA 4HFPB 2XITA 2ASEA 1GOTA 3A1TA 1GBKA 5TCCA 8OHMA 4DUGA 5HCNA 4BFYA 1HA3A 3GEIA 1EXMA 3A8AA 4FU7A 2P93A 2XBXA 1LV7A 3NDBB 2HJGA 1MTUA 2WKPA 3MWIU 1QHNA 2L0XA 2VP5A 2XB2A 2A5JA 3QVUA 5JWHA 2EFEB 2OCPA 3PJRA 1LTOA 3THOA 1C5SA 5EG4A 3MMPA 2QIQA 3K0AA 2B7CA 4ACAA 2GEVA 2Q6FA 4NH0A 3UPEA 3GCHB 1JR3A 2WPLS 5T6DA 5EOKA 2V0BA 4INKA 4IXMA 1LQEA 2MMCA 1KY9A 1BTWA 4KSCA 3AVYA 1GI2A 2WBLC 2WIBA 4HLUA 1XUHA 5CHAB 1QZXA 1GI4A 1AVWA 4CBOA 1RJXB 2JIZD 1W7GH 1RTLA 3R9XA 3EZ7A 2CHGA 1LHEH 3LLMA 1AQ7A 2IN2A 1ZJKA 2JETC 1DY9A 4PHTA 2P3FH 1KDPA 3T1VA 4DB4A 2FSIA 2OCYC 4TZ0A 3CZQA 3FFAA 1SGRE 1WUNH 1XEWY 1NI3A 4C2TA 2BBSA 5FAHA 3G5UA 2A3RA 2ZFSA 1P4SA 2H2ZA 4XWOA 4ASUD 3NKVA 1T4VH 5DGXA 1SGNE 5A2MH 4P4TA 1E96A 1KK2A 2X2EA 1X3SA 1SXJD 1AKSB 2VP6A 3TW4A 3R8CA 3C8UA 1SOZA 1JECA 4I8HA 1F2TB 3AGQA 2P2LA 2FXRA 4DLTA 2UUFB 1C1UH 2GDJA 5FH9A 2B8OH 1HLTH 2FDCA 3OESA 4WMDA 1FX0A 1L1JA 3ZVBA 3SBEA 3VNVA 4Z0KA 3EPHA 5J4YA 1QVRA 1QHHA 2CHVA 4TMTA 1IBRA 2OILA 4PX9A 4PPFA 5AUQA 2JGNA 1JWTA 1UM8A 1PPZA 2AMQA 4H9GA 1T7CA 1KI1A 1IQPA 3ADCA 2YKGA 3UWIA 1UBCA 4IDOA 1DTSA 4K81B 3U6KA 1QBOA 4IMQA 1GI8B 4SGBE 2ZTSA 4MVNA 2VGCB 2ZFTA 7ESTE 5AR1A 1K22H 1Z71A 1A7JA 4Q7LA 4GOKA 2NU4E 4DW2U 1ZC4A 3M36A 4KTCA 3TK9A 4MGIR 1NN3A 3ZVAA 4H4FA 4Q01A 2RGNC 4TWWA 5KHOC 4YONB 1XMSA 1VITH 4OJQA 2SNVA 2F6RA 3VAAA 1QRWA 2PJZA 2CHAC 2ZJ2A 3EPKA 4CEIB 1DBSA 4GZMA 4MYCA 5G3ZA 2HNTE 1SXJC 3NWJA 3B8HA 2FIRH 2ZDAH 1GUAA 2A0QB 2A31A 2GZDA 1G6HA 1K8RA 1GHWH 1F0RA 5BN5A 4DVGA 3SFZA 3JVVA 2ZE5A 2A5YB 4AKGA 3G01A 1XEXB 1VCIA 2I4IA 3S1AB 4DB2A 1P2TA 1QBNA 1FN8A 4ZI3A 3N5CA 4EPXA 1P09A 3LONA 4LK2A 1OYWA 1TX7A 5AUOB 4Y79A 2J41A 2HLCA 4NZLA 1NRSH 3T12A 4KLZA 3CR7A 2KBFA 1THRH 3FKSD 5DP6A 5KDDA 3BV9B 5TJXA 4EAQA 2IW3A 5KPJA 2D7DA 1KO1A 1GI3A 1G21E 3FHOA 1CA0B 4Q7XA 4YOGA 3THYB 3J81k 3GFPA 4K8OA 2BY7X 721PA 1ZINA 1T5LA 3AKCA 4EPRA 1DVRA 4C0LA 2ZQ1A 1YPMH 4BAQB 3BTWE 4MRVA 1KI6B 1O2ZA 5FPKA 2HLDD 2FFQA 2DWQA 7LPRA 2BBWA 4CW7A 2O8FB 4XH9B 3UG7A 1HJAB 1O5EH 3P17H 2R6GA 1D5CA 3PV2A 1L8QA 4DT1B 3E8LA 4BFSA 5DJ7A 1US8A 4ZKEA 1S2MA 2Y82A 2FESH 3EC1A 4JLDA 3BFXA 2UKDA 2WPJS 2J0SA 1CIPA 1LCYA 3SE0A 2Q3FA 4WXVA 4AG1A 3GLIE 1W0KA 2ZJ5A 1VGCC 1O37A 1K1IA 4M7GA 5B6OA 1BMFA 2W0MA 5DKMA 2BDIA 2BKUA 2VU8E 5DP5A 1VYVA 1Z8GA 1PUJA 2IUTA 1TB6H 3OAAD 3NG1A 3P4YA 1WDTA 4XJXA 2J0UB 2QQEA 1AD8H 2QPAA 1HRTH 4AFSA 3KKQA 4IVQA 2OSBA 3FZZA 4LYHA 2QSYA 1HAHH 3EZ9A 3TKLA 2OO7A 3QY0A 1IN4A 5KNBA 3QDZB 2G4UA 5CM8B 1BTZA 1HBTH 3ZS9A 4MUAA 4PHGA 3R0FA 4DCNA 1S6HA 3TUJC 4UEHH 1GMDF 4ZV4A 2VGCC 3W90A 1XXFA 2Z9LA 3S7HB 1W1WA 1OXTA 1KIGH 3BTME 1SC8U 5EGMA 3OEED 3ZVRA 3F0TA 4MTBA 4AGKA 3CF6R 2ZHEH 3M5MA 2B7DH 3BTEE 1QURH 2G51A 1GDDA 1ELAA 5C18A 1EB2A 4JKIA 2KE5A 1TOMH 1IY0A 3GCTF 2JLUA 1EPTA 2OP9A 3B8JA 3V7TA 3IIMA 4B3GA 1KO4A 2DFNA 4FUEA 2V3OH 1U0LA 3UWKA 1RRKA 1TMKA 5KO2A 4BUJA 4DLVA 3FHCB 2BXUH 3QGJA 3UMFA 1MAXA 3GDSA 2O8CA 2VIIA 3QPVA 4VGCB 4OM9A 4KCGA 5I46H 2PW8H 5JFGA 4OI4A 2P67A 5FBVB 2FSHA 1RIWB 1NRRH 2QAGA 2R2MB 1L1GA 1NLFA 2HDNB 1YR9A 2W3IA 2ZFRH 4YMUA 1IQMA 5EXLA 4OK6A 4NYIR 3NCLA 2ANYA 4IJMA 1F0TA 5TB5A 1KXFA 1M6NA 4KITB 3KNXA 1SKQA 4ERNA 1P3JA 1YKSA 3E5HA 1MQ6A 1VYTA 1E79D 3B2EA 2FOAA 4HLQB 4ZCLA 3W5JA 5DE3A 3RSOA 2PZGA 3H5CB 4A2WA 1W4RA 3RS4A 2GESA 4JZFH 1RVDA 3E16B 4HDQB 1O3DA 1G32B 4PC6A 2K5UA 1YC0A 4TYYA 3AVPA 2ZCHP 3F9FA 4GSYA 2FPMA 1DSUA 1A1RA 1A61H 4F93B 1HJAC 1MO3A 1R4AA 4B75A 2IYTA 4RCYA 1JMOH 3MWLA 4B2LA 5KSOA 2BY5X 3P8FA 3I92A 4C0QC 2J87A 2ZFPH 1OH6A 4LHWA 4GCHF 1Z3IX 1RFNA 5EXXA 2J0QA 2ZU2A 3FE2A 2ZRBA 2GAAA 2IXGA 1ZNZA 5EPNA 3OF5A 3D8BA 1E98A 3LA6A 1YF4A 1BMMH 4TL8A 1WMSA 1TRYA 4GPTA 4AGJA 5LPEA 1G3IA 4UE7H 1GBBA 1G8GA 4BEBA 4OHWA 1ZPBA 4FW9A 3GY5A 4A1XA 4MGKR 3W9YA 3DUXH 3E6PH 1S9DA 1EFRA 2O8MA 3TW8B 2IJOB 3PV5A 2V1UA 4X8HA 5AWFC 1PQAA 1MQ5A 2YWHA 3IPYA 2JJ2D 1WA5A 1NF3A 1JBKA 4WA7A 2OZEA 5ANRB 3B85A 3Q3XA 2VH6A 1GI5A 3MH7A 3EIEA 2O8LA 2C03A 4DUGD 1Z6AA 1RYHA 2YC4C 4BPBA 1XXHB 3PEVA 1QB9A 3FAOA 2ZDMA 2AKAB 4XTRA 1N8OC 3C16C 3P4XA 3PUYA 3BH0A 4EPTA 3SBKA 4Q2KA 3Q3KA 4ZH8A 4AKIA 4O2RA 2ILNA 1SHZA 2B5TB 5CMXH 1XTSA 2ZROA 1O2JA 1WV7H 1LO6A 1DAGA 3LC3A 1GBMA 1JR3D 3SJZA 2J1LA 2GJSA 3SV8A 1P03A 3CENA 2EWWA 3EAJA 2AHOA 3BAFA 1V2JT 1F5NA 1T0JB 4WXIA 3T06B 4QBIA 1U81A 1C5WB 5CB8A 1DS2E 2ZJOA 1A5TA 4PHHA 2CE7A 1KO5A 1QJ6B 4M8NE 1GBFA 4FVDA 3BJIC 1O5FH 3K0CA 3CRQA 1SR5C 2FPZA 3IEVA 2Z9IA 4ZI2A 3BH6A 4UQOA 3RXQA 4WZBE 3IO5A 4HB4A 4NGAH 1J15A 2XBVA 3U4QB 1KI9A 2XJ4A 3T29A 4Q02A 4RZUA 1ZRBA 1TQ4A 3PXGA 3I8XA 4QGFA 1IQLA 2P0EA 1LVOA 1NS3A 1TX4B 2OBLA 4HEJA 1AJEA 5K0HA 4OK3A 2WM9B 5DSZA 2VB0A 1AVGH 4I8LA 3W3AA 4G01B 2ODBA 3EGKH 2ZIAA 1BTHH 2F9OA 4AB8A 4U2WA 3NVAA 1N6HA 1OS8A 4Q7YA 2LPRA 1VG9B 1CHGA 4LJ5A 3TK1A 1Z0JA 2WVJA 4A7IB 3PO1C 1YZQA 1ZP6A 4BOHA 2PZFA 1AMHA 2AD5A 4B74A 5TVKA 5CITA 4X0WU 5EP3A 2VIPA 1AQUA 4NL4H 3I61A 5SZHB 3SJ9A 5DN6A 1XWIA 2NG1A 1W2HA 3UUZA 4PSAA 1LHFH 4Q9HA 3CF0A 4HLUC 4GMDA 1TPAE 1UKVY 1GDNA 3CX6A 3PUWA 4TL9A 3MO6A 2WOJA 2WINI 1OH5A 4TN1A 1WBGB 3RLWH 4Q4LA 4A0RA 1VCNA 2D1JA 3UNQA 3AF1A 4KV9A 1AS2A 1ZHMA 4QBHA 4I1OA 3MNCA 4BLQA 4LJ6A 3LXRA 3PCRB 3FMFA 2ANBA 1E9FA 1N5IA 2C90B 2XEXA 4HDOB 1XZPA 2CVHA 4P33A 4LJ9A 4P3YA 2R62A 2XWAA 1N6LA 1P7CA 1H8IH 5HPYB 2RGDA 1G5PA 3L3TA 1O2VA 4YMTA 4DVAU 4AORA 3JZAA 5K8LA 4YMSA 1FP6A 1BMLA 1GMHG 3MI4A 4I31A 1W7AA 1A3EH 1Z8FA 2Q6GA 4Q1FA 1K6MA 1GBCA 3HR8A 4ILEA 2DFLA 5FTKA 4BASA 3MTYA 4DCVA 1U0HC 2CK3A 2IX3A 2C93B 1TAWA 3SN6A 3QXXA 1XUJA 4FUBA 3BIFA 2GV6A 4Q4AA 4BLOA 4H1VA 1TU3A 2XRCA 2PCLA 1GL1A 1XJCA 1XMNB 3LW7A 1OP2A 3B1XA 2V6IA 1P2SA 3WHLA 2XOKA 3RSLA 1E35B 3W34A 4CEHA 3B78A 1G5RA 1JPNA 3FVQA 2ZPTX 2WV5A 4AI6A 1WTGH 2P5SA 4AYYB 2YWFA 2IHBA 2VH5R 4K3JA 4US2R 1MO6A 3B9FH 1NROH 1SVMA 4PR0A 4Q1EA 1DAHA 3QNUA 2FWWA 1GVNB 3CPJB 5BYJA 1EPTB 4JT2A 1E9RA 1VYUA 2A9KA 4IXNA 9LPRA 3RXAA 4A36A 1R0ZA 2ZA5A 3UOPA 3VB6A 1XMJA 5CK4A 3SQHE 3AGPA 4YLQH 1W47A 1Z8IB 2AGGX 5GPIB 1KDRA 1Y3XA 5C1XA 1MD8A 4XOJA 2OXRA 4ABIA 4AN7A 2FSFA 5LB2A 3VB4A 2X8AA 2WAXA 3ZD6A 5A8ZA 3B9QA 1A0LA 4AYVB 4QGHA 1MTWA 4TYNA 4HAVA 1AN1E 2F91A 2I1QA 3UWJH 2FPLA 1Z6JH 3KTAB 4WMEA 3VR6A 5ETXA 4NBSA 3KGPA 2J45A 2QAGB 1VG8A 5EQTA 1TIOA 3S9BA 5L3QA 3QJYA 3DFJA 3MJHA 4TWYA 1R8SA 1W0KD 3KKMA 3A1VA 3N2EA 2GDDA 4JZKA 1D2NA 4AKEA 2PT5A 4OBEA 1GZSA 2PSXA 1BMFD 4OI2A 1YR7A 3U7EB 1VR1H 4D4KA 4LBVA 1ZPCA 2SGPE 4CH8B 3EXAA 2ATXA 4JYTA 1OKXA 3BF6H 2CJIA 2VO1A 4L15A 3IITA 4Y11E 1U0JA 3TH2H 1J8YF 1JR6A 1H8HD 3C5CA 3T15A 2WPDD 1SVPA 4LX0A 3GLIA 4TY6A 1U8AA 5FUVA 3IQWA 3QI2A 5EXNA 1G19A 4X8MA 1ZRHA 3ZIAA 1G36A 4XBBA 2EEKA 1TPSA 1YCPM 4XFQA 4FU8A 4B43A 1FLEE 4LHYA 4I8GA 3MH4A 3AVTA 4Q9KA 5C67A 4GCHG 1ZNYA 2XYAA 2Y7ZA 2R9VA 3OFNA 2BJVA 5DP3A 3SUEA 1J7KA 3EIQA 3NXSA 1LDTT 1DT2A 2ZDVH 4TLDA 1ZMJA 4X6NA 4RI0A 4AD8A 2ECKA 1SGYE 2HUPA 3CIOA 1G3BA 1AIPA 1MH1A 2O5VA 2GAOA 2YYZA 1K1MA 4QJ5A 4LBWA 2Q3MA 3F6UH 1O3LA 5A4JA 3AEZA 1Z47A 1AKEA 2VVUA 1KDOA 3TVDA 2G4TA 4BFZA 1YRAA 3SU2A 1N6RA 3SEAA 1XM1A 3FMOB 1EX6A 2P59A 3DZDA 4YTAA 1UDWA 1I4DD 2BLQA 3KKPA 3NH9A 4A8JA 5KSYA 5J4LA 3QTOH 2A78A 3A7XA 5C5NA 5GJBA 1DG1G 1FQKA 3MO9A 1E9AA 4HB3A 3ICEA 3GJXC 1DAMA 4MRRA 1IJEA 4ZHMU 3GCNA 3KQUA 4FUIA 1O3OA 1SXJE 2Q1JA 3RXDA 4QM7A 2FI5E 4R8TB 1SGIB 4NIVA 2HALA 3ONWA 3U60B 1XNJA 3AW0A 2VA8A 1DARA 3MH6A 2RHMA 3GYLB 2WJYA 4IVRA 2G0NA 4OI1A 2QP9X 4Y10E 2O0HA 5L3RA 2JLSA 4BTTB 4QFMA 2D2DA 2BX4A 3QGNB 1I4TD 1NG1A 3IIKA 1O5DH 1ZBDA 5AF9H 4AK9A 5TARA 2WSSA 4Q48A 2ORVA 4QC2A 2ZS8A 5DISB 3IBGA 2ZRNA 2A2QH 1NP6A 4EQ6A 2WJIA 1O32A 5T3HA 5A0BA 4HLDA 1CBWB 2D8WA 5JZVA 4B33A 1MKWH 2XZPA 4X1RU 5JB8S 3CRRA 3BTKE 1NSTA 3OYPA 2QRZA 4Y0ZE 1D3QB 2LKCA 2CCKA 1TNHA 5M04A 2XXAA 4UNSA 1KSFX 1QGFA 2JJ8A 1YVDA 2OM2A 4JBXA 4TSFD 2F9BH 1WYKA 2PEZA 5FX6A 1TMTH 2YZ2A 3TSWA 1VJ9U 5HE9A 3RXKA 2Q9CA 1AGJA 1NFWA 1SVWA 3MWYW 4HZIA 1EAUA 1H1BA 2FG5A 2GJ9A 3REGA 4DG4A 2QAGC 3E2IA 1XD2B 2FSGA 4ZKNU 1S8FA 1UCYH 1LPZB 1O5AB 2CNWD 3LDAA 1TL7C 2ZP0H 5IK2A 1Z1IA 2BMGB 1EFRD 4KFRA 2VWLA 2EFDB 3FGNA 5GCHG 4ISIH 4KELA 1XUGA 1HH4A 5K8UA 1LQDB 1UVSH 4HTCH 2ERYA 2QNRA 4MNYA 3DM9B 4BZQA 1G41A 4C7OB 1G1MA 4QT8C 4FMCF 5KSZA 4ZCMA 2R3UA 1BTUA 1C2DA 2FZLA 4PFSA 2KJQA 1NFUA 3A8TA 1AZZA 5AFYH 3AM1A 1GKIA 4NCIA 1GJ5H 1JAIA 4A0GA 1G2MA 2RA3A 5EW2H 2PT7A 3M3SA 2AKYA 2FTLE 3AF0A 1D6JA 2G1KA 2C4FH 1XX9A 3SU5A 3LU9B 1YZTA 4JBYA 4WVPE 3SNBA 1P2VA 4L5BA 2X19A 2BDHA 3QWCH 5B57C 5DNYB 1SGWA 1SHHB 1KOFA 5JPMH 3PTNA 3GY4A 2Y5FA 4XBCA 5C4GB 3A85A 4EPWA 1GRQA 1W2GA 1W44A 4E09A 1XTJA 1FNIA 3E0PB 5DH9A 2CL7X 4A82A 5E2PA 1P3EA 3A1WA 4IFEA 3SUDA 4A2QA 5EZ5A 1G8YA 2A5FA 3RS7A 4ZKDA 2GILA 2QORA 1Z2CA 4FINA 1AZ8A 2FTMA 2QTFA 3RXSA 4XIGS 3AP2A 3PMJA 1PYTD 2ORIA 3K09A 2PEYA 4B44A 5JS8A 4Q4AB 1SLUB 2GTBA 4URXR 1QA0A 3SNHA 4LGMA 1KTTB 7KMEH 4MRNA 3GYMA 3SJ8A 3B1ZA 4ISLA 3Q9LA 3TPIZ 1HFDA 3ZLJA 3RP2A 2ANKH 2ERXA 4X2VA 3THWA 1GMCF 1NN1A 2F3TA 2A5AA 5F98A 2ZCLP 5E7IA 1P9WA 2EYQA 3W94A 4CEHB 3SV6A 4GPGA 1BRCE 3HK3B 3CKLA 1V2VT 1YZKA 1GRRA 2P65A 4CRBA 1O3HA 1L1NA 1MUEB 1Y3WA 3M61U 1Y8TA 4QHYA 2IEZA 1RGQA 4WBSA 3VTKA 3WMGA 3SHWA 1UDXA 1K5GA 1KK1A 4Q9JA 2GCTC 4E22A 3MRSA 4OS5A 2A4RA 5JJKA 4YDSA 2IYYA 3KQCA 5FUXA 4R0IA 4B2BA 2HYDA 2IS1A 2ZRCA 4A6LA 1FPMA 3ZQJA 4B71A 3ATMA 2IS6A 1CR4A 3QPUA 1DELA 2CXXA 4NWLA 1D8TA 4GZLA 2AFQB 2YNAA 5KTYA 2BBTA 5CIQA 3K0CC 4LJYA 1X8LA 2REOA 2BCJQ 4B34A 5KDLA 5JI2E 3ZZ9A 2FM2A 5G41A 1PYTC 4IEIA 2XX3A 1YQTA 5B64A 3A86A 1BB0B 1XF9A 1YPLH 3ESTA 3QXCA 1X86B 1W7XH 3L43A 4JVNA 1W13U 2H57A 1KYNA 3TUZC 5K8IA 3QG1A 3K6ZA 1RRGA 1Z8JB 3RVBA 1P2UA 2VWMA 1C2HA 2ZO3H 1G8HA 4LRWA 4ISHH 3NPSA 2GMTB 2TGAA 2R65A 1NLYA 1KMQA 1G20E 4TQ9A 3HYRA 4Z8YA 4FI3C 4JK5A 1Q44A 2H5CA 1SHYA 2BQWB 3A1SA 1C5ZB 1O2YA 4NKRA 1O2PA 3S9CA 1VHTA 3U7GA 3OTPA 1GI0A 1EWQA 4OS1A 1WTHD 5BRRE 3LAWA 3FWYA 2YV5A 2RCEA 3VX4A 1D2MA 2RKOA 1MMJN 3NKKA 3KXLA 3PWBA 2O8DA 1O2XA 1A4RA 3KUCA 3LD9A 2CK3D 1ZM9A 3EPJA 1U99A 5DIFA 1EG7A 1ZD1A 3GLIB 1MOZA 3N7OA 2JDIA 1C9PA 1U90A 1E9DA 4B2CA 5K7RA 4IOKA 2WWXA 3FTQA 2WPMS 2ZKSA 2BDGA 2WPIS 1FZQA 1GVKB 1FFHA 3V0XA 4XE4A 1ONBA 1YR8A 2JA1A 3B1VA 3CWZA 2JLXA 4C0KA 3D49H 4PSKA 3QX5H 2XOKD 2HF8A 3SZEA 3M6AA 4ZDKA 3H86A 4A92A 3X1YA 1TGCA 4G3XA 3D3QA 5FBWB 3RXTA 4R9UC 1GHBF 4LK4A 3LJOA 2I6QA 3RABA 4ABBA 1XXDA 1LNZA 3O8BA 1YPHE 1MRNA 2P6UA 3MWKA 4M2LA 2KB0A 4MKIA 1ETSH 2D62A 2QMHA 4V0NA 3HK6B 8LPRA 3BWDD 2WWIA 4I32A 3MFJA 2ZF0H 4KFSA 1P6XA 4AG6A 1TMBH 4BFWA 2WJGA 2IXEA 1C4Y2 1H9LB 1B7XB 2Z9GA 4Q1BA 1RRCA 2WTUA 2P3SA 2BHRA 3NBZC 5D3MB 1WCZA 2CEAA 4FN5A 1OIXA 1YYY1 1G3RA 4C0HA 3FANA 3GY2A 3OHMA 3PR1A 1K1JA 3BTHE 3L0PA 3D65E 4LV6A 1KJZA 3CUEF 4Z1MA 4IEEA 2G9NA 1ANEA 4EUNA 4NU0A 3A8BA 1WB9A 4QGAA 2Y8EA 1O5GH 2EI7A 4J2YB 3Q77A 3P32A 1CR2A 1O3BA 3AK5A 4EKDA 2HNTC 2TRMA 2QY0B 1OSNA 1XEFA 3CONA 4K5ZA 3X1DA 4ZAEA 2BTCE 4NE2A 1XVMA 4XOIA 5FOTA 4FMCB 2ZI3A 4LJ4A 3GLFE 1PVOA 5F2EA 2YINC 1OE0A 3QEJA 3BTFE 4ESTE 1SI5H 4MKFA 3RXIA 3GJ3A 2ANWA 5CK5A 1PPEE 4GLYA 2NOAA 5EU8A 4MNWA 3SZNA 1GJ9B 1DWBH 2F1HA 3KQKA 3VU9A 1T8MA 1TMUH 4X8TH 4DY7B 1D9ZA 4Y8YA 4O0MA 1H8DH 2JH5D 2UWOA 2A5KA 4IVPA 1FAXA 2QMOA 4URUR 2C95A 1VIYA 2XXAB 2VNTA 4U01A 3LQQA 5GNDA 4KODA 3RC4A 3DOFA 1DWDH 2RAPA 1SOTA 2A5IA 2VHTA 1VG0B 3ZIAD 2ZTXA 2FOFA 1QHSA 3E70C 1XKBC 2PR3A 1OKKA 1HAZB 1TADA 5EXSA 4I81A 5LPNA 1AHTH 1INCA 5J5CA 1N6KA 1G8PA 1NU7B 4YC7A 2YOFA 4QJ4A 3BERA 2YNBA 2FWRA 3LVQE 3OFND 5CYPA 1HIAA 3LH1A 4DDTA 1YRBA 4LOYH 2Z9JA 3NWUA 3SORA 2XW9A 3MUFA 4LCBA 1TGSZ 1Q12A 1GVZA 5DI3A 1QY6A 4Z8XA 5G53C 4CEJA 3VB3A 1J8MF 5E0GA 1RKBA 2QE7D 5L3VA 2RMKA 1UTNA 4OHYA 3I4LA 2ZRIA 5AK0A 5AUNB 1OFHA 2FPKA 1Q3TA 1FY4A 4Q4JA 5E4FA 4RKFA 1P2JA 2NTYC 2AR7A 1AGPA 3ND8A 1P05A 4PPNA 1V2OT 1S1CA 4OS6A 3SQXA 1HV7A 6Q21A 4IDNA 5FI0B 4JZEH 3AUYA 1JBUH 4MDSA 3TUIC 1AS0A 1T8NA 1V2PT 2W2VA 3EZ2A 2JLZA 3ZDQA 2ZRDA 2AFIE 1VTKA 1N0VC 1HAPH 4I8JA 1R7RA 1GILA 2E87A 1MTSA 1DANH 1BTPA 2NGRA 2PH1A 3GY6A 4M21A 4GOXA 4E5UA 5KDOA 4C3ZA 4RFSA 4G5GA 3W6PA 3FVFB 2CF9H 2LCFA 1QG4A 2O9QA 1GBIA 1YPKH 4MGYR 4I33A 2A30A 4NMMA 3QKRA 2H7VA 2WSSD 1A5IA 1G3UA 3GQBA 4OQMA 4I1SA 1C9TA 1BITA 1XXHE 1SVIA 4HATA 5CYOA 4ASUA 1C1RA 1LS1A 2VJ1A 2VHCA 5JCPA 2HXSA 1CULC 3AVWA 2O8WA 2BDYA 2BXTH 3NEYA 4CT4B 4TY7A 5I25A 2XBWA 3U69H 3H7TA 1DOAA 4YDHB 3WHKA 2PHBA 4D9QA 2QAJA 4LYAA 4BXSA 4F4OC 3UNSA 1V5WA 5E95A 3AB3A 3TQCA 5HCIA 1MKXK 1SGPE 4KKDA 4A8JC 3T27A 1AU8A 2VEDA 1KXEA 1P57B 1AUJA 1G2LA 2QU8A 4F91B 4ZIRB 3THWB 3K9HA 2EQBA 4F49A 4YT7H 5KNDA 4YZUA 1Z6TA 1UTJA 2C77A 1A2KC 1JB1A 2HXYA 4JYBA 1Z2AA 2WWHA 1X6VA 3MU8A 4NCYA 3A89A 1RYFA 4C0SA 1HGTH 1DVAH 2J3EA 4B76A 1DO0A 1THSH 4D4MA 4O97A 2P8OB 4BLPA 5IK2D 3LC5A 4C0AC 2NPFA 1QR3E 2ZI5A 1RFLA 2OE2A 1Q21A 2IYZA 4P4SA 1TGTA 2JAQA 1GDQA 1KGDA 3W8RA 1GHVH 3N70A 4JCNA 2WWWA 5IDKA 4TYWA 2FP7B 4DCUA 4D0NA 2CN0H 5LD2B 3HKIB 4MITA 2J9RA 4DBLC 3TIUA 1XJ0A 3RWOA 2KAIA 4NCJA 3OIVA 1NKTA 2KI5A 4BTIB 2H18A 3HPRA 2QTHA 3HATH 1EJAA 2QQ0A 1UKEA 1O31A 3UKDA 3BXZA 1XMIA 4Q7JB 3DZ8A 2ZJ8A 1F0UA 2ZHDA 4L4UA 1IQKA 2GNOA 3D62A 3M5NA 1S5SA 3PLKA 3EA9A 2IYVA 1OHHA 2ZU3A 4RD4A 4HZHA 4JLOA 3BE4A 1IOZA 2R2AA 4I1VA 1K1PA 4RD2A 4B6FA 3MWJA 3DKVA 1F48A 2IBMA 3KJGA 2ZU6A 1EZUC 5A0CA 1K2I1 4JBWA 2R9PA 1QCPA 3EE0B 2WPHS 3A88A 2C2HA 3IIJA 5IF9A 1Z29A 2BC9A 2HPQH 1W3CA 2ZGJA 2Z83A 1MRSA 4QNMA 3RXPA 1L2TA 2QI9C 4DEYA 2GK7A 4DSOA 1AKSA 4LI0A 5JECA 2BEJA 2BOHB 1F2TA 1DY8A 4TLAA 3CBQA 3M35A 2SFAA 1JPJA 2ZGBH 2NU0E 2WHXA 3S0NA 3H84A 4M1SA 3Q76A 2QAAA 3T1TA 1O39A 1QL8A 2O8TA 2DCUA 4YQFA 1ZM4A 2ZM5A 4ZDJA 1AM4D 1O36A 2BD7A 3VB7A 1ZJ6A 2ZU0C 3QXSA 2FGJA 5CB6A 3W6NA 1F92A 2ZU5A 2ODEA 5IT5A 1SB1H 1YP9A 2A7HA 2J7PA 1E0JA 4PAMA 3WYGA 4AURA 2R8RA 3CB4A 1Y3YA 1VDZA 3E1XB 4FMDF 2WMOB 1J9CH 2XNIA 4KFTA 4RZXA 5FBQB 3LOXA 3LV8A 2G5VA 1CS4C 5EP1A 5CIWA 2BVRH 5C3NA 3HU1A 3I29A 1II8B 2HT6A 3QKUA 3UQVA 2Z3DA 1JNYA 3SU6A 3HR7A 3THXB 4AFQA 5E0HA 3LIWA 2WWYA 2V6JA 4JMPA 4CEIA 4QKQA 4IDHA 1C5XB 2FODA 621PA 4B6EA 4PZZA 6GCHF 4V0LA 1OSSA 3CLVA 3RXHA 4XVQA 3H7OA 3BEIB 5C1BA 2P95A 1E37B 4DSUA 1KAGA 4JZ1A 2VSXA 4DDVA 1HJ8A 1KO8A 1XEXA 4RD1A 3SJKA 3K09C 3S1AA 2KSQA 1WP9A 1UADA 1JALA 3Q85A 3NZIA 2NO1A 4DT7B 5DPAA 4LZZA 3DMDA 1D9XA 1UJ1A 4GRAA 5PTPA 3O8RA 5F9FA 5SGAE 2PSYA 1TTTA 1TQ2A 4Q1CA 3FP7E 3CNOA 3KQDA 1TF7A 1O2IA 3IHWA 3SNEA 1XZQA 3RMOH 3SU0A 4B2IA 4Q19A 5C1UA 2OCVB 4TMXA 3Q8XB 2V7QA 1ZGVA 2J7KA 4Q4HB 2FEOA 2ZR9A 5KPDA 1H65A 1E36B 3N2IA 3CNLA 2J5XA 6LPRA 2BEKA 1AWHB 1XDBA 1T91A 3SQWA 4K8BA 1LHCH 1YZLA 3STIA 4MLFB 2QENA 3H1TA 2VWNA 1D2EA 3QE0A 1ZD9A 4NA9H 3MLEA 3RHFA 1DITH 1KI6A 1AWFH 4RSPA 5B2ZA 2JDID 5FOVA 3TH4H 2D74A 1GI1A 1S81A 4UNPA 3WNBA 1EX3A 2OLKA 3SV2H 2Z7FE 2IHYA 2X1VA 5AJYA 2EI8A 2OTVA 5FUYA 4B3XA 2IC5A 1PLJA 2NIPA 2RGBA 4DLXA 1KXAA 3GP8A 2AWNA 1ZHRA 2AGIX 4AYTA 4RD0A 4HAUA 1OFIA 1ZM2A 1HIAB 1WE2A 1N2CE 2YOHA 1O2GH 2C04A 2CVFA 3L82B 1C1YA 2QXJA 4Q80A 2A2XH 3UIRA 4HGCA 5DI3B 2ZQ2A 3IGFA 4MPXA 4CEJB 2JKHA 3BS4A 1GFIA 1S4QA 3K0FA 4BXWA 2XZOA 3OU0A 1GJ7B 1CU1A 3T28A 1G30B 3UTUH 1EWRA 4Q4JB 2GF9A 1TGBA 1CJKC 4NONA 4IC6A 3REFA 4EPYA 4URVR 3KFVA 1JXMA 3RXLA 1P2IA 3PIRA 3ATLA 1MAYA 5GVSA 5J40A 2ZSFA 1V2NT 1HAVB 4AY2A 3ZVGA 1VCWA 2CLDX 3PVSA 1C1SA 1N5JA 2PKSB 4CR9A 5DLQC 2J0UA 5G3YA 2DFTA 4Z1MD 4M1TA 1BYIA 1OB5A 2JCSA 1P2QA 1QRZA 3TJNA 2OXCA 4O3UA 1TPOA 2NPIA 1UVTH 1JRSA 4MYTA 1DAIA 6CHAB 3U3JA 4M9ZA 1R0XA 4FU9A 1HE8B 1LVYA 1CEEA 2J95A 2A4GA 3KUDA 2C8WB 3QKSA 8ESTE 3SU8A 1C5LH 3KKNA 1AFQB 5EXPA 2IA5A 3K1JA 3RDZA 3RRMA 4BWYA 3RC8A 4B48A 1NRPH 4MNXA 4NYIQ 4A1VA 4ZXXH 2EC9H 4DLWA 2GK6A 4KBFA 1BS1A 5K8TA 3LGVA 5JBCS 1MD7A 3HDTA 1T5IA 1IM2A 5C5OA 1EESA 1TRMA 3ZZ3A 4ABDA 2ODYB 3UR9A 1L2EA 2HYIC 3TITA 4OQFA 5JWRA 2ZEBA 3TVTA 1T8OA 3S69A 3FKQA 3A4LA 1OX1A 1FUJA 2WYJA 3JZ1B 1CR1A 4JJZA 4XWKA 2NO0A 2GVFA 2NWNA 3K70C 3U9AH 3DD2H 2D2EA 3GLFA 1N6OA 5AUPB 1OKKD 2XNSA 5HMAA 1W10U 4A4DA 3RXOA 2UUYA 4FXGH 5KUTA 2BDTA 5DI9A 2CLCX 2R2WU 2FZ4A 2Z4SA 4A6PA 4KBGA 2CE2X 2EFCB 3NBYC 5L30H 2ZU1A 1KDQB 3A4MA 1WXQA 1C5VA 1JIMA 2GZ7A 4BLTA 3RXCA 5A8XA 1AS3A 4X1SU 4BZPA 2LWIA 1IQJA 4C0JA 4DCSA 1ARCA 4UONA 4J1YA 2NO9A 3SNCA 5HYOA 1ZIOA 3TJZA 3UXMA 4P4SB 3PEYA 5GJVC 2Y6TA 1EZQA 4IDPA 5HZKA 2OD3B 1Y5BT 3PB1E 4Z51A 1CRPA 5C46F 1ZTJA 4M1YA 2VINA 2HVXA 2GP9B 4FMDB 1VKJA 1EOLA 4OHZA 3C14C 2KAIB 4EJSB 1Z28A 2DUCA 4NYJR 3LPRA 3ZVCA 1CGJE 4O9VA 1EFCA 4G0NA 2OHFA 2ZITA 4N3NA 2FX3A 1SGFA 3Q7QA 5BW8A 3BFKA 2PWXA 2G8TA 1R8QA 1AA9A 2R6AA 4JLNA 1M2OB 4AYXA 2VP0A 1ZVQA 4GOJA 4X8LA 4PC7A 4NIYA 1ZC3A 3B1YA 1ZIPA 1W14U 1U9IA 2DWPA 2GEUA 2ZSBA 3QKTA 1W36D 3TJOA 1HDTH 3CH5A 3RMLH 1BBRK 4H6SB 2NU2E 4M1MA 3ENSB 4NWKA 2GKSA 1P72A 1GKUB 4P4UA 1EASA 4IGDA 1YCPK 1E9BA 4DWJA 2QXHA 4D6PA 4GBMA 2W3KA 2FV8A 4PO1A 3BD9A 2W6JA 4PZYA 1F5KU 1B0UA 4I8KA 4RD3A 4XVRA 3LLUA 3ZYCA 4D26A 4ZHAA 3GLHA 5CLQA 3KXKA 2PGBB 4CHAB 2R6CA 3K65B 1LTQA 1P04A 1IY1A 2V8OA 2VP9A 3R3GB 3BG4B 3SZRA 1SFQB 4NYMQ 3LX8A 4FUHA 5LDDC 1ZOMA 1Q57A 3ATWA 1XXHA 1GBDA 4G5OA 4KXFB 1ZYOA 1C4OA 2B7BA 1UF9A 2J59A 4HDCA 1NRNH 1RTFB 2QT0A 3C4JA 2ZPRA 1GG6B 2JLVA 3I3SR 1GHAF 1UTKA 2A1DB 3TSZA 5BQ5A 1PJPA 1F6BA 5KSPA 4H6TA 1DAKA 5EE0A 2VH0A 3ZS8A 2O52A 1Q1BA 3ZZCA 4L16A 1A2BA 3F9GA 3LGYA 1PLKA 4RJLA 1W36C 1BDAA 1CF4A 3VXEH 1ELEE 5TY0A 4H42U 1MR3F 3ZVMA 1CE5A 1CXZA 5HR5A 5A09A 1VITF 1WBDA 5SZJA 4DC9A 3B6EA 4QHTA 4QXAA 1J14A 1EOJA 2EYUA 3SGQE 1QTFA 1C5QA 1AFEH 1G7TA 3VR3A 1NMYA 1U8YA 2OAP1 1SVSA 3PWCA 3CPHA 2EA3A 2ZG0H 4PQFA 1OPHB 1CT0E 1JI0A 1T4GA 4OYHA 2SGEE 1O2NA 3NC1C 1ORFA 1ZUHA 3DDCA 1OHHD 2Z43A 3V9PA 2ZUCA 3MU0A 4ZHLU 5J4SA 1G4UR 1ESTA 2PJRA 4TPIZ 2GT8A 4FWIB 3U4QA 4FCTA 2ZJAA 2ZFFH 4U02A 3LGTA 1OOKB 1YE8A 1O2RA 1O2MA 4Q7ZA 1LPKB 4K60A 3RXJA 3BGWA 3FHTA 3BTDE 1ANKA 3HGNA 2G00A 3K53A 1FN6A 2YNMA 4JLAA 2Z5FA 5AVDA 1SHKA 2CV3A 1C5RA 2I3BA 1O0DH 4K1TA 3A7ZA 2ZRLA 2AXPA 3U6BA 3SUFA 2IXFA 1LHGH 5C2ZA 1AB9B 3P20A 1O2HA 1E94E 2QYIA 4P32A 1MO5A 2BD5A 3GCHC 3IQXA 1XPRA 1JQJC 2J0VA 3MNXA 2A2ZA 3T5DA 2ODPA 1Z0AA 1UAAA 1O34A 5JWOA 5TCAA 1M1YE 2O8UA 2REBA 4M1WA 1ANBA 1MV5A 3X1XA 2J7PD 2GCHG 3CS7A 3RU4T 2VP4A 5CHAC 4BE7B 1K1LA 3NXPA 4LJ8A 1HAOH 4D25A 2G83A 3QO6A 2XC4A 1U8ZA 4POAA 1GJDB 4MA4A 2BVNA 3AKYA 2ZIQH 1F2SE 1ELCA 2FOCA 1GG2A 1UKYA 1GJCB 3RWMB 1OWKA 3LGIA 4IKEA 5CE1A 1CQQA 1TEVA 1T3LA 1DOJA 1C2KA 4CBNA 3K0FB 4ZROA 3R7WA 1BUIA 1DPOA 5ESTE 4JZDH 1GHXH 4Q1AA 3A87A 2VVCA 2HOBA 2OQUA 1D3TB 2QMUA 3EC2A 3ZYDA 2R3YA 2P94A 3L33A 1XRJA 3UIEA 1GNPA 4HUQA 4NZYA 3A80A 5EQRA 1QB1A 1YPGH 3VHXA 4ZUHA 4IMZA 2WV4A 1DWCH 3CW2A 1O87A 3NDPA 1ABIH 1UK4A 2A7JA 2FS9A 1GI7B 1THPB 5EQQA 1HNEE 1WBBA 4ABYA 4CHAC 1H8HA 1Z07A 3SV7A 1P60A 1HQCA 3WYFA 3RAPR 2AIPA 2WPDA 4GP7A 1F2UB 2NZ8A 3RM2H 2PTNA 3BG4C 4JZIA 4URYR 3X1WA 4DRZA 1SLWB 1ZMNA 1CT4E 3QZRA 4HB0A 3QKSB 2I6SA 1AN0A 1OW3B 1Z0FA 2IYQA 1F3OA 4LC0A 2HF9A 2OCBA 1PPBH 1A5HA 4ABFA 2IJD1 2V7QD 4CRDA 1J2JA 5P21A 2XTMA 4IN1A 1W11U 1WAYB 3G82C 3KQHA 4O3TA 4ABGA 1HAYB 2F9PA 4DLUA 2ZS7A 1M8PA 2ZNKH 1UO6A 4K2YA 1G8FA 2OV2A 2HRVA 1NN5A 3QPWA 4FMBB 3LX5A 5IRCD 4Q5IA 1B23P 4O3MA 3I5XA 3SO3A 3PQCA 4JYVH 5JYIA 5F6MA 3KN2A 1UHBA 4Z6AH 3GLFB 1TPZA 1S6FA 2OC1A 3SI7A 4HYYA 1Q3XA 5L8VA 1D3DB 1ZTKA 2ANCA 1EUFA 2GDEH 3WP1B 3AQ4A 3EWSA 2BD8A 2C8XB 3AVUA 3VR4A 5JI3E 1P11E 1X8JA 2P3UB 2F83A 4PAOA 3QIAA 5FBRB 3KZ1E 3KTAA 4M1OA 2ZR0A 1BJUA 1MCVA 4ISOA 1HV8A 4JL6A 1T9HA 1ETTH 3PV4A 3B13B 3FFBA 1KHTA 4K1SA 4DIDA 1NFYA 3MSXA 4BFVA 1C5TA 5CLLA 1E99A 1O3NA 2BD9A 5JMTA 1GIAA 2LKDA 3E91A 3UQOA 2QL6A 1AE5A 5GJ4B 3DOEA 1SQAA 2QT1A 4LPSA 3R8FA 2HV8A 1CA0C 1K9OE 1HY3A 2P3TB 4MDEA 3MCAA 5EP4A 2P6RA 4TZ6A 1GCDA 1H9IE 2ZYWX 3TJVA 4PROA 3TMKA 1YHNA 1FMLA 1PPGE 4D2IA 1AB9C 2ZI2H 1HXFH 4OK5A 3BORA 3GCOA 1VIAA 1K1NA 5FPTA 3GJ4A 2G5NA 1AIXH 2IUUA 2ZSDA 2OEPA 1S96A 1VCOA 1Z83A 3VGCB 4P31A 1L7VC 1OJLA 2I1VB 2D26C 3HP1A 4ZCIA 3WXMA 2H9EH 1KLIH 4CVNA 4TSFA 3UOUA 4V0ME 2QC2A 5D3QA 3GY3A 1W0JA 1EFUA 1IQGA 1V2KT 4RKEA 1NY22 4MQBA 2ODWA 1CKEA 3ZZ8A 1JJVA 1T8LA 2WICA 1OH7A 2FS8A 3O47A 3P92A 5LPFA 3DPUA 2EFGA 1A7SA 4KU4A
chains in the Genus database with same CATH superfamily
3G79A 3PI7A 4JLPA 1GPZA 3AWDA 1GSIA 3HSYA 4WFIA 4ZC1A 3DDHA 5G1OA 2DTEA 1HAXB 1IY2A 4N0PA 4IDFA 4G0XA 5IUKC 5C1YA 1KK0A 1FSZA 1PK7A 1BGVA 2WJJA 5C31A 1UJMA 4IRUB 4S35A 1H2AS 4JLUA 5JTUA 2H9HA 1E2IA 2B1GA 3A1DA 2KBEA 3IALA 4LAFA 1CEQA 2VBIA 4ETMA 5TMPA 4RMIA 3QN7A 3L18A 4V0OA 4BC0A 4LDRA 3LT4A 4ZHQF 5H81A 4LS3A 4IS5A 5JDUB 2R97A 2IQIA 1AV7A 2HA4A 4OUDA 3U1IB 1GAJA 4DSTA 3GLSA 3N8DA 4DLLA 4ZVUA 5JSFA 1GZ4A 5CFNA 1VA5A 1FXYA 3F6RA 4HG6A 4BV9A 1NBWB 1OWLA 4Y1EA 3T3EA 2W8BB 2VIVA 1BU8A 4PPQA 1SGFG 1P02A 5FL7D 2DG2A 1ZK2A 3EVNA 4PQEA 1ZSKA 3VKGA 3JRWA 4QDUA 4MW7A 1ZGAA 2H5DA 2J6BA 3TNSA 2AQ8A 3AOEA 1NL3A 5MF6A 1MJGA 4LMAA 2QY6A 5B7PA 5DRYA 4DHEA 4NK4A 3D7NA 4RM2A 1JWLA 3ISJA 2IEAA 4WN9A 5EIBD 3T95A 1OU4A 1XN1A 3DT0H 5DGJA 4BTLA 4H1UA 3EQ8A 2RAUA 5G0VA 3V4RA 3DHKH 5KQMA 3E05A 1QP8A 2F8TA 1L8XA 1OWHA 3PVCA 3PC6A 2ZYUX 3WV5A 4K9OA 4OUKX 1K6XA 4VGCC 3O8OB 1SCKA 4N3GA 1SKUA 4YI3A 1MGPA 4R1QA 2I4OA 4ZO4A 7GCHF 5EE5B 3IHLA 3EGOA 2D5LA 2BM1A 1OWJA 4C7JA 3FF4A 5TMDA 4EMBA 3ECAA 4NIWA 4WY3A 1XD2A 2FLBH 4H3SA 3CVXA 1YFKA 3HDQA 2X9QA 2WFMA 1PT9A 3I28A 4XM2A 4CDGA 4LZOA 3KLMX 4MWBA 3A1UA 4NJMB 1QAQA 5IDVA 4UM5A 4X1KA 3FNIA 4CMIA 1XD9A 2IHJA 5DP9A 2WJVA 4ZVTA 2XXJA 1QNJA 3ZJ5A 1TQHA 2V9PA 1XC7A 2MJLA 2SKCA 4U9HS 4R71A 3LXXA 3L41A 3WHPA 2I4MA 3QNMA 5I4CA 2V3CC 1OFTA 2OD7A 5E8EH 4UZFA 3NTLA 4BXOB 2OUIA 3V33A 3AF3A 3I6BA 2RGWA 4YO7A 1KRXA 3RXBA 4ZAWA 3ZXYA 4WMLA 4TTQA 2BEWB 2A0XA 1DC5A 1A2CH 1E3JA 1L5FA 3FDIA 3R7WB 1NXTA 1MVLA 1O6FA 1AO3A 4FNGA 4WCFC 3DOJA 2DFKB 1T2UA 3Q12A 3WSVA 3WZ2A 4ZI7F 1J1ZA 3NM5A 4I36A 2GPBA 3WIEA 821PA 2LIVA 3CS3A 5G1NA 4R6XA 2WV9A 1XZ8A 1T1JA 4DL9A 1ZPZA 2EW8A 2R4QA 2AW3A 1WCIA 1SK9A 3IOMA 4KLCA 3RHSA 2Z6VA 3HO1A 4GBJA 1UEXC 3WHIA 1V3XA 5FTNA 5TQ2B 2ZGVA 3ADOA 1P77A 3BXEA 2QF0A 3T26A 4P93A 1QX3A 1GSHA 1HFKA 4A10A 1XRQA 5JAOA 3NP7A 5DF1A 5DO9A 2H9AA 1QYCA 4WESB 3NIBA 4L3OA 1X92A 4WJG2 3Q5EA 4DR3B 4L0QA 2BDBA 3L84A 4BQRA 3FI9A 3B1JA 4P4NA 2J30A 3DEFA 1NZFA 2OQVA 2O0JA 1SOAA 4Y71A 4I86A 2Z95A 3IDZA 5EHZA 3B1WA 1XCPA 2FOEA 1GMDG 1A46H 1XJQA 1TYNA 2H17A 1WQSA 2WMNB 1IC6A 2W5UA 4TQAA 5K7SA 3P9YA 5LKRA 1FLNA 3Q2IA 3ICCA 4U7TB 4JU9A 4M36A 4XFDA 2D7JA 2BOKA 5I7FA 4YY3B 3HQ4O 2VJDA 1HYGA 1K3FA 5J4QA