4B74A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
total genus 208
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b74A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b74A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b74A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b74A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b74A03
2Z6BD 3D3QA 3UFAA 5HMAA 1ZBDA 1NVVQ 1DLKB 2IPHA 2GCPA 4LYJA 1XKAC 2Z9LA 4WOPA 1DOJA 3AK5A 3LO5A 3NH9A 1QB9A 2HV8A 2GK6A 1ZHMA 2J45A 2GDDA 3WYGA 3TUJC 3SQEE 2R6DA 1E2IA 1EFRA 3ATKA 2GZHA 1AN0A 4TL9A 1LVMA 2IS2A 2YWGA 4JIMA 1CO7E 2VQSA 1CA0B 3U3RA 2GT7A 2BD8A 2HLDA 1O2GH 1A3BH 2ZTYA 1C2GA 3U7EB 4MYHA 1Z8GA 1C2HA 4LBWA 2VH5R 3R0FA 2R6AA 1UTPA 3Q85A 1HAGE 3WRYC 1N0WA 4RKJB 1P75A 2ZEJA 2FV8A 1MTUA 2W6JA 4Y6DA 5ELXA 2OHFA 1GNQA 4AC9A 4YLGA 4E07A 3IBYA 1MTNC 5CDFA 2OM2A 1A0LA 5GVRA 3T26A 1Z47A 2VEDA 1E4YA 1QGFA 3EWSA 1MO5A 5FBQB 1TPZA 5C20A 2WICA 2FOFA 1JNYA 1SMFE 3W6PA 2F43B 1DANH 3BFVA 2BX3A 2HF8A 2BM1A 2B7CA 2WKRA 4AWXA 5CLQA 3ZYDA 5FH9A 3IIMA 1P3EA 3K9HA 2JH0D 1WBGB 2B6HA 3O8RA 1G3MA 3ESTA 2QUZA 3L0IB 1XPOA 1W0JA 2HCJB 1GMCG 1MKWK 3OF5A 1WUNH 3PUVA 3QENA 3RXPA 2TGAA 1BMMH 5HE9A 3TNTA 2ESTE 3U4QA 2ONJA 1K9OE 2L0XA 4FN5A 1G3BA 1QA7A 3AP1A 1W36C 2C95A 3SC3A 3RM0H 4DT7B 6CHAB 4P0TA 4Q03A 2XRCA 1R8QA 1XJCA 2SNVA 5HGGA 1ZYOA 3LIWA 3RXAA 4DLZA 2NIPA 4XFQA 4AG6A 4P3YA 2PBRA 1NFXA 2ZSBA 4US0R 1S81A 3ZDQA 2BD5A 4DIIH 1U9IC 1MTVA 4M21A 4FU9A 2XAUA 5JMTA 4BEBA 2Q6TA 1IHSH 1A5TA 4KFRA 3TIUA 4MQAA 1PLLA 1Q2WA 3GY8A 1O3KA 2P6NA 2ANBA 4TWWA 2DWQA 1GCDA 2VIPA 6CHAC 2QMOA 1A2KC 1U8YA 3UIEA 1E32A 1NRPH 2QSYA 1R5NA 2O8FB 1H65A 2NU3E 1S0QA 3Q5DA 1FY1A 1TADA 1JJ7A 1CEEA 3A8AA 3SJCA 1O3MA 2EFCB 3DZ8A 1YPLH 1GJ6A 1FX0A 4B73A 3T29A 1XMNB 1WXQA 1G9IE 3GY5A 3BIVH 3TSOA 4D26A 4HB4A 2J9NA 2Q6GA 4PXAA 2O8BB 1GL0E 1W1WA 4KYIB 4HZUA 2D8WA 4NZYA 3UXMA 2ERYA 2QGNA 1HE1C 2BDGA 2V9PA 4ARZB 3TE6A 2AD5A 4YLUA 4BGDA 3HATH 5JCPA 2GZ7A 3UOUA 4GVUA 1KLTA 5JWRA 3RRMA 1W7AA 1E35B 3NH6A 4TL6A 1KO1A 2FO9A 3VFEA 2D62A 1IQNA 4NFEA 1C2DA 3H86A 4LCBA 4LSGA 4C0JA 1XX9A 3CF6R 2F9UA 2Y7XA 2G51A 1VCPA 1NKTA 3CENA 3ENSB 2NZ8A 3CNOA 4GZLA 1ZRHA 2ZU2A 1I4TD 1GJBB 1E2JA 5DE3A 3FFAA 3P8FA 2Y80A 2OXCA 4JBWA 3BGWA 4BFSA 3VKHA 1NFWA 1G21E 2PZGA 3QKUA 3IIKA 3N70A 1MMJN 4QGFA 2BLVA 4HZIA 4KXFB 3SGBE 2CLDX 3C4JA 1C5QA 3MYWA 5DYIA 3SNHA 3AP3A 3K8YA 1FV9A 3B5JA 5TCCA 1T4VH 1OV4A 2OK5A 2W3KA 1CGJE 4TSFD 4NU0A 5C5OA 5DK1A 4YT6H 1NG1A 3TW4A 5FPHA 2BVXH 721PA 4K3JA 1A0HB 4MA4A 2OINA 2J41A 2J7PA 3CRVA 5M04A 3MWJA 2PZEA 4EQ6B 1O5BB 1C1QA 1GOTA 5EE9A 4I7YH 1F6BA 2ZHDA 1P2VA 3T1OA 1RC8A 1E9BA 3RS7A 1D3DB 2VGCC 4HUQA 3DL0A 1PQ5A 4PAOA 1GGDB 2QAGB 3B82A 1THRH 1YP9A 2PCLA 4GOJA 4WZBE 1UTOA 1XEFA 1OYQA 2HPQH 3K70C 1OH5A 1S2MA 1DBSA 3BTQE 3TH4H 3TAHA 1GKUB 3ASYA 4X2VA 3VQTA 4QJ4A 1EXFA 1UF9A 1GBAA 4Q9LA 3RXQA 1AUJA 1ZGVA 2A2XH 1AS3A 1X86B 3FTQA 1G3EA 3SZEA 3ZV8A 5CJPA 4LJ9A 1ESTA 3TGIE 3EX7C 4EPVA 2UWOA 2ZA5A 3SUGA 2LNCA 2VHCA 3AKDA 3E1XB 1RFNA 4CRFA 1FZZA 3A1TA 1WDTA 1J2JA 2O8FA 2Z9IA 3FVFB 2ZRFA 3I5XA 4ZI3A 2EI6A 4JLKA 1TQ0B 1O3PB 2ZSEA 2AR7A 1AWHB 2I4IA 5HCIA 3NKKA 2VP5A 1GBTA 3MG9A 4CH2B 1FY4A 3ZVEA 4MDSA 3UMRA 1VG0B 4ZUHA 2C8YB 5JI3E 1P2TA 4OKSA 1SGRE 1NN3A 2V55B 4ISLA 4FI3C 1KY9A 1A46H 3ZIAD 1TNHA 3L0PA 1LS6A 2GK7A 3BTTE 2FE4A 4C0AC 4MGIR 3ZVRA 1Z0FA 3KKMA 1JEDA 3GCNA 3PV0A 1HURA 2GNOA 4DKXA 1BMNH 1KI4A 3Q77A 3V7TA 1YKTA 1GJ8B 5HPYB 4MTBA 3IQWA 2C8WB 1PLKA 2GCHF 3CWZA 2ZU6A 4AX9H 2QM8A 2ZJZA 2PL3A 3O8DA 1JBUH 1WB9A 1LKAA 1UFQA 4DLUA 1IN4A 2OG2A 5KHOC 1Q31A 2UZ3A 1CR0A 5G41A 4POAA 1EXMA 3MGCA 1GBMA 4I4LA 4TL8A 3ATMA 2FMJA 3QVVA 4V02A 2DFTA 4OHZA 1JMOH 1G8YA 2PH1A 2D2EA 4BAKB 4DBLC 4C7OB 1K1LA 4AYTA 2H7VA 1QHGA 3VKGA 2QMUA 1WAYB 3NG1A 3W8NA 1N6YA 1KJWA 4BTUB 2JCSA 1KXDA 4HDQB 1AFQC 3RU4E 1DELA 4NE2A 1CHOF 1QJ7B 1XEWX 1O2SA 3EZ2A 1KI6A 1K1IA 2MMGA 2IYSA 3ZVNA 3K0CA 2CHAB 4P4SB 4KLZA 4MUAA 1E1QA 4EPXA 1AVXA 2F91A 1OFIA 1SHYA 3IHLA 2AD1A 3SJAA 4D0GA 3M3SA 1SVSA 3VR6A 1E2MA 3NBZC 3EA0A 4OS2A 1NF3A 4QRHA 2H6MA 1PUJA 3SQHE 2BDIA 3LGVA 3A86A 5JBCS 4Q7LA 4TPIZ 3A4MA 1A0JA 2K1QA 2XITA 1EB2A 3REGA 1VCWA 1OHHD 4YOJA 1AZTA 4D80A 4BZPA 3FB4A 3UUZA 4FUHA 1BRAA 1LY1A 2BV3A 3AF0A 1O32A 2ZRDA 2FOGA 1V2OT 3GMTA 3HK6B 1T8TA 5F8TA 3K0AB 1Z28A 5CM8B 1IBRA 1DT2A 3G0HA 1Z6XA 4ZAEA 3UR6A 2BBSA 3QEOA 5AUQA 1N6RA 5H1YA 1XUHA 2ZRHA 5GDSH 4G5RA 4X2XA 1C1NA 3RUOA 2A7CA 2F9BH 4ABIA 5JWOA 3LV8A 1OHHA 2ZYTX 1EJAA 4NPHA 3RHFA 4F7WA 1E9FA 3PJRA 1VHTA 3HR7A 2BEKA 2GETA 1BIOA 5JEDA 5EXPA 5BXQC 1BRUP 2F9PA 4F4JA 1NMXA 3QDZB 2LCFA 2XWBI 2AWNA 3E1SA 2D2DA 4URZR 5HCNA 3QKSA 1YPJH 5CM9C 5GJ4B 5DO4H 4J0QA 1A4RA 1G2MA 1K5GA 2FF7A 2WVJA 5TMPA 3WY8A 3BJIC 3HP1A 1ZMJA 2YOHA 1R2QA 5H4IB 4J1YA 1GUAA 2NWNA 4LDJA 5SGAE 4YT7H 1BA8B 1VPLA 2ZIAA 3T34A 2WM9B 4ZKNU 2ZS7A 7ESTE 3ZZAA 1E9SA 2EFHB 4AG2A 3BB3A 2FMXA 1MBQA 4NDZA 3LX5A 1ZJDA 2GBLC 5GIBA 2W7UA 5CK5A 2P8OC 3WMFA 2KI5A 3K1JA 1GDNA 4ESTE 2VP4A 1DVAH 4B3DA 1ZNXA 3SV2H 3AP2A 1PPFE 2STBE 3PROA 1RTKA 2QXHA 1Q44A 2BCJQ 3ZZDA 1C2KA 3MFJA 3FAOA 1HAYB 2OLJA 1TX4B 4KI0A 1ZD1A 2FU5C 1AFQB 1T0JB 1TQ4A 3ZVMA 4AZ2B 2VNTA 4FVDA 3P6ZB 2G6BA 5CHAB 1GKIA 1HAHH 1P9WA 2WPKS 3RMNH 3BERA 2YKGA 2HPPH 1YLCA 4ZMAH 3AAUA 2GF9A 2FX6A 1E9AA 1AHTH 1NU9A 1DITH 1XTIA 1SLUB 2H5CA 4I32A 1C5WB 3MJHA 1XJ0A 4SGAE 1ACBE 3MH5A 4C7OA 4MNYA 4UJ5A 1TWXB 1G20E 2ORIA 1FDPA 4RFSA 1D3TB 2ZFPH 1WSSH 1WCZA 1AFEH 2H1UA 5K8LA 1O3JA 4V03A 2WOOA 1OKKD 3OY5U 1SOZA 1KDPA 1FUKA 4NWLA 4MNWA 4PZYA 2ZJ8A 1O2MA 3LPRA 1KGDA 1KXAA 1RXPA 2WPMS 4ZCLA 3JZMA 3K0AA 2W2VA 4MG3A 1EP5A 1V2PT 4RKEA 2QPTA 5E2PA 2AH4X 5DO9A 1AKEA 3N7OA 2NQ2C 3F1SB 5AWFC 4UNPA 4TPYA 3C5CA 4Q9JA 2PGBB 2AK3A 2XGJA 1BHXF 5EQSA 1NT1A 3QF7A 2XC0A 2A4RA 3BH6A 1CA8B 3ZZTA 4ISIH 2OUKA 2GVZC 1O38A 3FANA 1CVWH 3KQBA 3B78A 1TNIA 3U8OH 4LZ4B 4IW3B 5GCHF 2VIVA 3SGQE 5B30A 1P2QA 4AG1A 2WPJS 1O3GA 3RDPA 2GEVA 2JASA 2CDNA 1Z6GA 3VTKA 2VSFA 4BE7B 2CK3A 4AKHA 2A5FA 4C4PA 3MNBA 3KGPA 4F92B 4BZXA 4RD6A 1MH0A 3MMPA 3QZQA 1K8RA 2NPIA 4W5JA 1L4YA 1SGFA 5DP6A 3GCHC 2XSZA 3LAWA 1GRNA 4RVCA 2YJTD 1LFDB 4YLQH 4G0NA 4TSFA 3U3KA 4AI6A 1D8TA 4D81A 1YPKH 3RXFA 3DMDA 3DT0H 4K69A 2CV3A 1K6MA 1YQTA 2O8EA 2BM2A 2CNWD 4HLCA 5A8XA 5K7RA 2EA3A 4ABDA 4JK6A 1NVUQ 1SI5H 1MAYA 4OYHA 3AUYA 4LC0A 4DXAA 1TUIA 1F0SA 2PTNA 4ASUA 4FUFA 5HKKD 4X8VH 4RD2A 1EAUA 2VRWA 1TOMH 1XDBA 4IMQA 2Q0HA 4NHOA 5EQQA 2GXUA 2ZI3A 1FL9A 2XCFA 4ZROA 4AGJA 2O0KA 4YDSA 1L8QA 1N6XA 4WAUA 1RFLA 5AUPB 4M9ZA 3MO3A 4YC7A 2XJ4A 5TJXA 2HRVA 3CO5A 1XU4A 3MU0A 1MTNB 3ECCA 1KJYA 2QRNA 3AW1A 3KNXA 5FTNA 3R7WB 4QNRA 2OP9A 2GMTB 2DE9A 2A3RA 2JIZA 4OQFA 5J40A 4ZKDA 1SGDE 4HI3A 1FPMA 1V43A 2ZKSA 3B1YA 1TRYA 2PEZA 1JR3A 2GF0A 4A1TA 5SZJA 3R20A 2AMDA 3HR8A 1ID5H 1OP2A 4Q4JA 1EX7A 1AIXH 3RXDA 1GILA 4Y0YE 1A7JA 1NL3A 5FOXA 4Q18A 2P95A 1ZAKA 3J81k 2QTFA 2P16A 4L9WA 3T27A 2RB4A 3A1WA 3WY9A 3TLXA 3WMEA 4FUIA 1C2IA 2GXQA 1NRRH 1M7HA 3D7MA 2AHOA 3B13B 3DPUA 2XXAA 5HYOA 1KHTA 2O8LA 3ZZCA 2FZLA 3C1KA 1Q1QA 5KTYA 2W3IA 2PR3A 1XVOA 3VHLB 5E3HA 1DOAA 2ZE8A 4GSOA 4BXSA 5EPYA 1TRMA 1FPCH 1N6OA 3OX7U 4M9QA 3SJKA 3SU4A 1H8ED 3GCGA 2BHGA 1EX3A 4KV9A 3SYJA 1VZQH 1O3HA 1GI7B 1S6HA 2NZJA 3U5ZB 2J59A 2JLSA 2O5VA 5K0HA 4PO1A 1OP8A 2IEYA 1D9XA 3LONA 5FBEA 2PCJA 4QBIA 3NTUA 4DLYA 4YDHB 3TQCA 1W5SA 4RFSB 4KYUA 1FAXA 1HRTH 1G3IA 1LTQA 3EGKH 4XSGA 3ZYCA 4HLUC 2ZJ5A 4KLNA 1EFCA 1XXHA 1CBWC 1PPZA 3FZDA 4INKA 2ORWA 2FFQA 1ELDE 1K2I1 3MWIU 3C16C 1P01A 1XEWY 5AJZA 1BDAA 2P6UA 4B71A 3EZ9A 3D49H 3OY6U 3A8CA 4B2PA 1S82A 2CL7X 5BWMA 4RJLA 4YTAA 3IQXA 3A89A 1KAGA 3I72A 3VXFH 5JBBS 1IN6A 3UNRA 1OSSA 2KWIA 3U44A 1S4QA 2BVRH 3R8FA 3CW2A 3GLGE 3DFLA 3FMPB 3EC2A 2B7DH 3U8RH 3IPYA 4FIDA 1YLDA 4K1SA 2JGNA 4QGHA 1O35A 6Q21A 1GMDF 1K1OA 4X1QU 2RHDA 1N8OB 2GV6A 1G1MA 1H9HE 2Y5FA 1ZNWA 4I8GA 5AR1A 3RC4A 2QENA 3D62A 5FUWA 4NH0A 5H68A 3SOSA 2VH6A 2BD3A 4B2LA 1K28D 4Y79A 3OIVA 1BZXE 1BYUA 2ZQ2A 4D2IA 3AQ4A 5E95A 3SOPA 1GCTB 1QY6A 3SUDA 1EAIA 4C30A 2GGVB 4NZLA 3B9FH 4X6MA 1FOEB 4LJ5A 3DHWC 1V2WT 1RVDA 1EKBB 3DD2H 1G5TA 2A5JA 5LPRA 1DLEA 1GM5A 3FVQA 1C5RA 3KN2A 1QF9A 5GADl 1E37B 2BWJA 2O8MA 1T5IA 2P0EA 4NL4H 1X8JA 3QBVA 3GJ6A 1CGIE 2O0HA 1EJMA 5EXXA 5BYJA 5EG4A 1EX6A 1C1PA 1E9DA 4AKIA 1E2LA 2Z9JA 1T9HA 4NCIA 1KDQB 1BJVA 1W44A 2R44A 2XJ9A 2ZRJA 1KJZA 2WBLC 4OJQA 1AD8H 2WJIA 5DISB 5DLQC 1DDJA 2WINI 4R0IA 2STAE 2IYUA 2J87A 2W6ID 1P06A 2WSSA 1KK0A 4M8NE 4D7FA 2ZRMA 1WCV1 3GOVB 1ZW6A 1GNPA 1C1UH 4BFVA 1XD8A 3GY7A 3UWIA 4JLBA 3EAJA 5DJ7A 4RD4A 1FNNA 2ZUDA 4TYNA 4C2UA 1W2HA 3AH8A 3BC1A 1GWAA 1HNEE 1CGHA 3U7GA 2FX4A 4YO9A 4BTTB 1W10U 2QTHA 5DP4A 3B7GA 1FFHA 4IOLA 4JVNA 1V2VT 3AASA 6GCHF 2J2UA 4ZHMU 2ONKA 1FW6A 2QROA 4BFYA 2FXRA 4G01B 1G6HA 3HU3A 4G1UC 5C1BA 3MO9A 3DA9B 4NYJQ 1XUKA 3T06B 3K0CC 4ASHA 1P72A 2F9NA 2XZOA 3B9QA 1Q22A 1NBMD 4IFEA 3I4LA 4A0GA 4A8JA 4D0LB 1BYIA 3T1VA 5FTLA 3BOSA 1E2KA 4QG7A 1DPFA 4EAQA 3S0NA 1BBRH 1EZXC 3TKLA 4Q1CA 4IXNA 4JYCA 5F9HA 1CTQA 3C27B 5JPMH 2ZRLA 1VCMA 1T3SA 2A45B 2V7QD 3SNBA 3M7UA 1E98A 1GJ5H 3A8DA 2HNTF 1VG1A 3TNSA 4LJAA 1IXZA 1NBME 2C04A 4N0EA 1ARBA 4X8TH 4ABAA 1YCPK 2FIRH 1Z6EA 4U00A 3K70B 3E16B 3NBFA 4JVLA 5EZ6B 2F1RA 5EE3A 1K1NA 2ZE6A 1PVOA 1YPMH 3PUZA 3CKLA 1KYIA 1QR3E 2BDBA 4JVSB 1EGAA 1TGCA 3GJXC 4DCTA 4XBDA 1SHZA 3BIUH 1JALA 4LJ6A 2R9VA 1AQUA 1C5PA 1EAXA 1ZJ6A 2VO1A 4FVBA 1PQ7A 4Y8YA 5KDDA 2FOMB 3RAPR 1K1MA 1DWDH 1CT0E 1RRGA 1WV7H 3AKEA 1AQ7A 2HJVA 3KJGA 1OLOA 1AKSB 5KPJA 3CPEA 1BS1A 1LVGA 3TITA 3CR8A 1GL9B 5AF9H 4HI0E 3BWDD 2B8WA 2F1IA 2RGEA 4HEJA 4ZCMA 1QL8A 5TY0A 1IQGA 2IK8A 4HUTA 1QIXB 4OGXA 5EXSA 3H4MA 4NIWA 4A1FA 1HAVA 4TZ0A 2H9TH 3UMSA 5LH8A 5DSZA 2FS8A 3E2IA 2QE7D 4INHA 2GCTC 1LHEH 1UDXA 3D65E 5E7MA 4K5ZA 3VEQB 2QRZA 2A9KA 3AVOA 2GZDA 3PG5A 4URYR 1IJFA 3P8GA 3A4LA 1C1TA 3CS0A 2FZZA 3E0PB 4WXIA 3SHFA 2JLQA 1ZM4A 2G1JA 3D8BA 1SVWA 2OUAA 2ASEA 3M5OA 2ZAMA 3ASZA 2G0NA 2QBYA 1TBRH 2G5VA 1QHSA 2BMDA 5GXPA 2R2WU 1LNZA 3VNUA 3F3YA 3V4RA 3VNVA 1UBEA 3QKTA 1VECA 3AV0B 1IY2A 2Q3HA 1QVAA 3T15A 4A6LA 3KQEA 3HGNA 4GUXA 1ELAA 5BN3A 2JLRA 4JBXA 3VKWA 4Y8ZA 1CHGA 4LPKA 1Y3XA 5JSZA 3WYAA 2XZLA 2XW9A 1SR5C 2R6FA 1G8GA 1IOEA 2B9LA 2V6JA 1CJVC 1G4AE 3UPEA 4GHQA 3FWYA 2VP9A 5G4BA 2BD2A 1EPTC 1QRXA 8GCHF 2WPDA 4D0NA 1SVIA 1TPSA 1O3IA 4DB4A 1ZM7A 3TJZA 1KDQA 4PPGA 1G41A 1ZM9A 5SZKB 2EW1A 4PSVA 2DR3A 2WYGA 2BB4A 2ZCLP 2HDNB 4Q7KA 3ZS9A 3B8JA 5FBVB 1O0DH 3A84A 2KSQA 2JEOA 3P17H 1HIAA 3QOFA 4XD7D 2IT1A 1W0YH 4GBMA 1N6LA 3OZXA 2Z3EA 2RG3A 1Y63A 2GJ8A 5K8IA 1JXMA 2YOGA 1NMZA 1N0UA 2ZRGA 4K1TA 2RA3A 2ECKA 4L4UA 2FEOA 4BRWA 5FBLB 1Z71A 2J34A 4ABFA 4DUGD 2WPIS 1J17T 1ETSH 4ABEA 1RJ9B 4JLJA 1B7XB 2ZU5A 3PUWA 2G5NA 5CB6A 4BPBA 3ATIA 1O5GH 4PSAA 2ALPA 2ZC9H 4W9MC 2ANKH 4GAWA 1L7VC 5CIQA 2NU1E 4XVRA 4DURA 3M6AA 1G16A 2BIFA 3KXLA 1W2GA 4TWZA 2FFBA 1JXPA 4DDUA 4G3XA 2G4TA 2MSEB 3KQUA 4BXWA 3QLPH 3QPVA 2J0QA 4IGDA 1QHIA 1YF4A 1WBDA 3THYA 1Z7KA 3BTGE 1EFRD 1EPTA 5A09A 1XX6A 1ZM3A 1JWTA 2DYKA 2X1VA 1MUEB 3CNLA 4PPQA 1F5KU 1BKDR 3TVDA 4M1SA 1XEXB 1GRQA 2P3FH 4F38A 1D6WA 2QGRA 4NA9H 2BOHB 3EA8A 1Z1IA 2A7HA 1O3CA 3ZQ6A 1MR3F 1J9CH 1G32B 1AZZA 1Z06A 4AORA 2P5TB 2OLGA 3NEYA 3AF4A 1GHVH 3R9WA 1LHCH 1GG6C 3CWQA 3ZD7A 3D23A 2IA5A 3IEVA 1KK1A 1OIXA 1LO6A 1UCYK 3P32A 1WTGH 4JLAA 1C5OH 3FKSA 4D4MA 2REOA 5GJVC 2AFHE 5C46F 2WKQA 4D4JA 3TUZC 1S3GA 3TAUA 1Z0DA 1YPHE 1E36B 2P3UB 2ZFSA 5J4QA 2FSGA 5JSZB 1QBVH 2JA1A 2RAPA 2X2EA 2IUTA 3G82C 3OAAA 2PSXA 1UCYE 4Q00A 2LKCA 3DMNA 4LOYH 1RIFA 4TWYA 4B48A 1MH1A 1G6OA 3WHKA 2FYRA 1VYTA 5LPNA 1AK2A 1SG8B 2BLWA 3LRPA 4DEYA 2GCNA 1KSHA 1GJAB 3MH6A 4GT1A 4AURA 2Q3MA 1XCMA 1XXHE 4AYVB 1D3PB 3LBNA 4B3BA 4Q4LA 1AVGH 1FONA 4NYMQ 1QRAA 2ZJBA 821PA 1Y5UT 3TGJE 3ATLA 4C0KA 4ZIRA 1JRSA 2QI9C 3P1JA 3HYRA 1P9SA 9ESTA 1NI3A 1YGCH 4CT5A 3E5HA 1ELVA 1ELBA 3BG4C 2DY1A 2R0KA 5IYTA 1F92A 4PR0A 2Z43A 4DIHH 4EFLA 2IC5A 1UTLM 5C5NA 5A8ZA 3VX4A 1MOZA 1MBMA 2WPDD 3GFTA 1HA3A 4EFNA 1TYNA 4NCJA 5EODA 2OC1A 3GICB 1BTWA 1ZR0A 1GHBF 2UZIR 1AWFH 2J0UA 1H8HA 2VHTA 4GI7A 1KKMA 4Q7YA 1IQJA 1SXJA 1K1JA 3SV6A 3OFND 4OI2A 1SGEE 4K8YA 3F0TA 1KO5A 4Z8YA 3U1JB 1NVWQ 1GMDG 1V2KT 2WWIA 3RU4D 4ZKSU 3VR4A 4VGCB 3BFXA 1LB1B 1NG9A 5DHAA 5TB5A 4NYMR 3I73A 4CRDA 3AF3A 2BY7X 4V0NA 3W3ZB 4KGAA 2A5KA 3GD7A 1GG2A 3A1UA 3MH4A 4QC2A 4YMTA 3SU3A 2R62A 1MO4A 3FHOA 2C90B 4K8BA 1C5TA 1O3BA 1XTSA 4MRNA 1TGNA 2KE5A 4MKFA 5DIFA 1Z6YA 3PR1A 1RIWC 2ZTSA 2IWRA 1DX5M 3GY6A 1PLJA 1ELCA 4UNSA 5FOWA 4LBZA 4FUCA 4F93B 4HGCA 1JQLB 4A8JB 2V3HH 4CW7A 7GCHF 4RD1A 5JJKA 2ZQ5A 4HAVA 2VSOA 1E0JA 1NLZA 1O3YA 1G2LA 2FG5A 2LPRA 2JIZD 5JWHA 3S7HB 7LPRA 4DIEA 2GRJA 4WZ6A 2GESA 1XWIA 3UOPA 1SOTA 3SW2B 4LX0A 4PQYA 4IOMA 5EGMA 2JDID 3EQ0H 1OWKA 3MLEA 1Z22A 1HY3A 1ZCAA 3PMAB 5ABWA 1C5UA 2FOBA 3L2OB 2QTVB 2DFLA 1NU7B 5ESTE 1DVRA 1EASA 1A1VA 2JLYA 4KU4A 2NPFA 3CPHA 3LDAA 4TYWA 5TXGA 4AFSA 1L0ZA 1ZSLA 1D2EA 2ZR9A 3UREA 1W0ZU 3UNQA 1KO7A 1HYLA 3ONWA 4V0ME 4NIVA 4ASUD 2ODPA 2QM7A 4NCKA 2HYIC 2AIPA 3A80A 1COWA 4LV8B 5GJBA 2W7SA 3SZRA 1T6NA 5G53C 2XZPA 4JL8A 3FMOB 2WIAA 1JAHA 4ZIRB 1H8HD 5B64A 3SFVA 2Z94A 3K70D 1GI0A 1ZINA 4IVPA 3RNLA 2XSZD 1NJFA 4C0BA 3THXB 3LJJA 1XD2B 4DLSA 1NY22 4DCVA 1CR4A 3KKOA 1C1YA 3U7FB 3I77A 1UBFA 621PA 2IF2A 1P0SH 1C2EA 2VGCB 1P9RA 2OQ5A 2BY6X 3U61B 1YZLA 2ZP0H 2OC7A 4A5TS 4Q2KA 2ZFFH 2Y5GA 3REFA 1LCYA 2O8EB 2ZDAH 3TH2H 3TLOA 3R3GB 4M7GA 4YESB 1ANDA 1T32A 3ODDA 2ZETA 4YZUA 4TMTA 2A7QA 2RGCA 2RGDA 1QQUA 3KTAB 5A4JA 3IPXA 2QORA 2H5DA 2BXUH 1VCOA 3RYTC 2RMKA 2CF8H 4Q80A 2FOLA 1GJ4H 4UKDA 3PUXA 3SZNA 1TTTA 2KBEA 1N6PA 1GVLA 1MU6B 3PLKA 1KZ7B 2FWWA 1O3EA 3AVPA 4KTCA 4LWZA 3HPQA 5J4HA 5F3WB 2GD4B 3DOEA 2XNDA 4GOKA 2NO9A 2XTMA 1KMHB 4PQFA 2VP6A 3KJIA 1IY0A 3IITA 5IK2D 4HLDA 3M5NA 3GJ8A 4I1SA 1U6QA 3A83A 4Q4AB 3MU4A 2VH0A 3AAVA 3IGFA 1PJPA 1DO0A 4M53A 1OWDA 3NHBA 4JSTA 3MNSA 1Z2CA 4H1UA 2VU8E 1ABJH 3TH5A 1Q0UA 4TY7A 3I32A 1EAWA 1XRJA 4C0SA 4CF7A 2Y6TA 1C5ZB 4B34A 1HV7A 4HDOB 2BZ6H 1UJ1A 1ZD9A 2VHUA 4CRWB 3NCLA 2RA0A 3SQXA 1TGTA 1CJMA 2VWNA 2RGAA 2C99A 2GDJA 4MVNA 1FUUA 3B8HA 2GVFA 3LGUA 4I31A 1PPHE 4DJTA 4P33A 3SI3H 3M35A 2C9CA 2TMKA 1T8UA 1H1BA 1TBZH 2JLZA 3FHCB 2QZ4A 1LPZB 1YPEH 2YWHA 3SS8A 1XCPA 1BMLA 1TX7A 1D2MA 2X19A 4DIDA 2A5DA 1HJAB 5JS8A 3I61A 5HZKA 4DSTA 5CMXH 4HSEA 3RLFA 5F9FA 3TK1A 1G30B 2XOKA 3BH7A 5DG6A 3A7WA 4B6EA 1KK3A 3PITA 2A1DB 1THPB 3KQNA 3BTDE 1ZLRA 1QTFA 3SN8A 1YZKA 1L2EA 2OCAA 1Z8RA 4YMUA 1U8ZA 3PO1C 5C2ZA 1G18A 1SVOA 1MKXK 1DUAA 3Q7PA 1MTWA 2JJ8A 1DXWA 1O36A 1GI3A 2HJGA 1W46A 5BYKA 1XXFA 2OILA 3RANA 3TRFA 3MUFA 1GKYA 4M2LA 2WJJA 1GMHG 1F60A 4ZCIA 1VITH 4JVMA 2IYWA 2QY9A 1X1RA 4K2YA 5JBQA 2REXB 3LVQE 5EP2A 2NU4E 3U1IB 1CT4E 1EWQA 2XCNA 1TX8A 2C8ZB 3CONA 3LXXA 1CJKC 2G0TA 2IBMA 1G5PA 1GVNB 1SGPE 421PA 2UUKB 4CEJB 1IN5A 1HQYE 4BECA 2XX3A 3CRQA 3SGAE 4PZZA 1BOFA 3ZVCA 5GWZA 2IUSA 4L5BA 2ZPRA 4M9FA 1CF4A 1PV4A 3UIRA 1FXYA 4Y0AA 3MHWU 3LLMA 1TF5A 1I2MA 2FNAA 1K22H 1C5SA 2O8UA 2A32A 3VB3A 2BX4A 1KNQA 3FFBA 1XD9A 5I46H 1TOCB 3KUCA 3MWLA 3WYFA 5C1XA 2JLXA 4WF8A 1G19A 4SGBE 3EA5A 3QTOH 2H16A 2QN5T 1GJ7B 3QXCA 1NP6A 3FP6E 4Y10E 2EFDB 1G8HA 2XNSA 2DB3A 3PWBA 2IYYA 5KDOA 3MCAA 1HE8B 4A6PA 2QT0A 1HH4A 1C1VH 3KQKA 2WUBA 3K2UA 4FMDB 2NU2E 3ELAH 1E9RA 1S1CA 7KMEH 4HLQB 1I4LD 3THWB 4DY7B 1TPOA 5JB8S 4A2QA 1CLUA 3RXBA 3PWCA 3A1SA 2ZI7A 3SBDA 1F2UA 1CJTC 3PTBA 5IHPA 1N25A 1CHOG 1T7CA 3HKJB 2VF7A 3LWNA 1SXJD 3BH0A 4IDNA 4OS7A 2PLFA 4GL2A 1ZOMA 3RXMA 4MRRA 3ADKA 2A5IA 1L2TA 3GY2A 4JJZA 1BRBE 2DCUA 3I62A 3P8NA 2IUUA 2C93B 1RRPA 3WP1B 2AGEX 3NUMA 1Q1EA 3QIAA 2Z3DA 1UKZA 4X1PU 3C41J 6GCHG 5DGJA 1MO3A 5DKMA 2JATA 4C9BA 1C4OA 1T5LA 4IDHA 1T8OA 5B6OA 2P3SA 2Z83A 4Q01A 1CRPA 4INLA 3AKCA 3LBIA 3NHAA 2QNRA 5C2JB 1Q21A 1VMAA 1DE0A 1RYFA 3I29A 1GI8B 4B2IA 1ZNYA 4BEJA 2V1UA 3N2EA 4ISOA 2AS9A 1NN6A 5BRRE 1EP6A 3ZZ7A 4XVQA 2CE7A 2D3WA 2C4FH 4LHWA 3GPLA 2P5SA 2ZPSA 2FSHA 3ZJYA 3DOFA 2V8OA 4TY6A 2WJVA 5FCKA 2YOLA 2R8RA 2BMJA 3QN7A 3KCGH 2AX4A 3HPTB 4A92A 2PKAB 4Y7AA 3V00A 1YR9A 2F9VA 3FKSD 2PUXB 3DFJA 2BLQA 4DDTA 3CX8A 1GHAF 2O8DB 4OQMA 4U2WA 3ND8A 1RIWB 1HLTH 2OTVA 5LD2B 2MMCA 4GDFA 1TPAE 3BEUA 5J4YA 4JYVH 1MAXA 5EE5B 4OK5A 2ODYB 2C2HA 3SR0A 1YRBA 2W6IA 2K5UA 5KYKA 2GCTB 2CJWB 3DVLA 1OSNA 2WJGA 2H92A 4E22A 2CMKA 5FOVA 3E3TA 2EWWA 4B2BA 1ETRH 3RXRA 3BORA 1SXJB 3KL6A 3TU7H 1R0ZA 2AYWA 1UO6A 4NWKA 2J3EA 1TL7C 1Z2AA 1Z5ZA 4GCHF 4PHGA 1GL1A 1O3AA 3FOZA 2CVFA 2PT5A 5G3ZA 5BW8A 4CEIA 3VPKA 4VGCC 3WHLA 1UADA 4UJ3A 2OXRA 2OO7A 2XTNA 2GAOA 1TAWA 3CRW1 3CBQA 3M4YA 2BEJA 2ZTXA 2BMGB 1DG1G 4K8OA 1OX1A 1KAOA 2J7PD 1FY8E 1RKBA 3C7KA 4MPXA 2FTMA 1AO5A 5L3SB 3B1ZA 1V5WA 3NZIA 2ZGCA 4JT2A 2EQBA 1M34E 1J15A 4JJKA 3THWA 4EJSC 3K0FB 2PX0A 1TEVA 2BMFA 3GDSA 3SU8A 1VGCC 2IYQA 2ZU3A 3BSQA 4NCNA 1Y5AT 4FCWA 5E7IA 1KO4A 3I5YA 3BEIB 2JLUA 3D6TB 3EWAA 2DWOA 4DT1B 1AVWA 1V2ST 1IQLA 1YBWA 3THXA 1L4DA 2KAIA 3IWMA 3TMKA 1XD2A 1U8AA 4GP7A 4ZDIA 2J0SA 5L8VA 3LJOA 5EOKA 4CRCA 3UG6A 3KX2A 1SBWA 3VHXA 2PGQB 4JL6A 1B5GH 3GY4A 3S1AA 1BJUA 4KVAA 3LW8A 5LBIA 3RSLA 4Q66C 3RXCA 4KKDA 1W4RA 4DDWA 3RP2A 1XZQA 2IHYA 3FP8E 4UXHA 2WHXA 4NIXA 2YNAA 1II9A 2AK2A 1S96A 4FU7A 1YHNA 2GXSA 4ZDKA 4B3GA 3HJNA 2FWRA 4DSOA 4WXPA 4X1NU 1UEIA 1ZD8A 3X1YA 1ELGA 1LQEA 2F43A 2XNIA 1UJ2A 4V0LA 2YC2C 3RS0A 1T3LA 4LOAA 4KJZA 2WKPA 4H9GA 2LKDA 2M5TA 2WYJA 1O5DH 1TABE 3OE7D 3I92A 2VIQA 4C3ZA 3M61U 4IKEA 4B32A 4TTPA 4TLDA 1JBKA 1O2ZA 5GCHG 1HPGA 1S8FA 3K53A 1FX0B 3QKRA 3TR0A 1NY6A 3SORA 4Q9KA 2ZNKH 4ABJA 2Z5FA 3DO6A 1SHKA 2MSDB 4BRUA 1SL3A 5FL7A 1AA9A 1TRNA 2J92A 5KO2A 5E0HA 2BD7A 4LBYA 2HWLB 3RSOA 4RZ3A 2PKAA 3WRXC 1F3OA 1O2RA 4XOIA 3K6ZA 3MFYA 1NESE 2QQ0A 2VP2A 4BFXA 4CR9A 3BB1A 1P05A 2GILA 2V1XA 3K09A 3QGJA 4PAMA 1QJ1B 1WMSA 1J90A 1O3FA 1QB6A 4BNRA 2JDIA 1ANEA 1O2IA 3WP0A 1HGTH 1TNDA 4EUNA 3TPIZ 1GIAA 3K0FA 4KHZA 3EIQA 1GSIA 1KSNA 1Q57A 3VR5A 5AK0A 1C5YB 2C8XB 5F6MA 1S0RA 1V2JT 2HCBA 1W0JD 1KO8A 2IYRA 1PPCE 1LVOA 2WZQA 2CXXA 1W14U 1SGTA 2CN0H 4FU8A 3CZPA 5ANRB 4AY2A 3BTKE 4O25A 3B1VA 1M8PA 4PPNA 4CBOA 1JIMA 4P4UA 3AVTA 2HT1A 3QXJA 1ZPCA 1O2QA 3LGWA 1C2MA 4PROA 4V0MA 2P2LA 1ODFA 3EXAA 1E2NA 3RMMH 1D6JA 4CGZA 1VGCB 3HDTA 4B74A 5IDKA 1G7RA 4UNNA 1OB5A 1C5VA 2R9PA 5CK4A 1NRQH 1YR6A 3PEYA 3QNUA 1E2FA 4L9SA 2BHRA 2W6JD 2SGDE 2PW8H 3GLGB 4KITB 5F2EA 3HGPA 1ETUA 3CH4B 4TLCA 4R8TB 1GPZA 4X2YA 3RMOH 1V6DA 4LZ1H 5EXMA 1DE7H 3S9BA 5DP8A 2ZE5A 3U8TH 3RS5A 3NBYC 4M1OA 3M7TA 4RSPA 4NONA 1FPHH 3IIJA 4ABBA 1OB2A 1O5AB 4TTQA 1YM0A 1EOJA 2ZI5A 4EPTA 3CPJB 4U30A 3RS4A 3H7OA 1C2LA 3A87A 2F9LA 2G55A 1O3NA 3DHKH 3RRZA 3GLIA 2PLXA 2VTKA 3OFNA 2ANWA 4ERNA 4DG4A 1O3OA 1NS3A 1KIMA 5KU1A 1Q1ZA 1AKYA 4EQ6A 2FSFA 1NVXQ 1G5RA 4CVNA 2G83A 1Z8JB 3CRMA 2QT1A 3TBKA 6LPRA 5L30H 4WZAE 4Q4AA 2ZSFA 1B0UA 4HUQB 1J16A 4O97A 2IYLD 4IDQA 1G8PA 4J2YB 3NDBB 1O5FH 2ZHWH 1TNGA 2Y7ZA 5C4MA 1VYUA 1MABA 1NMYA 2J0VA 2H17A 4P31A 5TVKA 4TLEA 4BLTA 4ITRC 1SLWB 1TX6A 1GI5A 4UFFH 5L3SA 4MYUA 1LS1A 3M3TA 2TRMA 4MUBA 3CIOA 4Q4HA 2Z4SA 4URVR 2A4GA 2OAP1 4A0RA 5LD2C 1Z07A 1OWEA 3EPLA 2CCGA 1A61H 1S9HA 4TLAA 1BCUH 3TSZA 1ZYUA 1GFIA 2ODNA 3JVVA 3F6UH 1MD7A 4QJ3A 4JYBA 4CIDA 1W0KA 1W3CA 4B75A 3C14C 1NSFA 4BASA 2UUFB 2WSSD 1W11U 3NPSA 5DI9A 3UNSA 3S1AB 1AY6H 2ZVQX 3T5DA 1A4WH 5FAHA 1T31A 1ZVQA 1TMBH 1IY1A 1N2CE 2RGXA 3UMFA 1XUFA 1ZSKA 4MLFB 3VR2A 3RXHA 1N6NA 3AB3A 4Z8XA 2BBOA 3AVVA 3ZH9B 2FFHA 1DSTA 5J47A 5IK2A 4Q7JB 3LOXA 5FI0B 4BFZA 4XBCA 2ZGBH 4XDEA 1ZPZA 3I1FA 2Z9GA 2ZDVH 5JBAS 2C98A 2Q9BA 2AGGX 1W36B 4DB2A 4LJ4A 5SZIA 4OL0A 4JKYA 2RGNC 2ODWA 2D7DA 5KNCA 2VLIA 2SGAA 4WVFA 1GBKA 2ATVA 4B33A 2ZRCA 2VIWA 5DN6A 2GZ9A 2I3BA 1E2DA 2OC0A 3PEVA 3IEUA 2BDHA 1VCIA 4Q7XA 3KZ1E 4DSNA 2EWVA 3TK5A 3PMBB 3GEIA 1G37A 3SDZA 3K9LA 1CU1A 3GLFB 1X8LA 1FP7A 5EUMA 4PC3A 2WPLS 121PA 1RS0A 2O9QA 4NKRA 4LJYA 4PO8A 1K5DA 1BTXA 1QFKH 1GBBA 4DCUA 4XWAA 1GBEA 2I6QA 4MNXA 1U98A 1KLJH 2GKVE 1NJGA 4LHYA 4HLUA 5FUYA 1O2KA 2BQ7B 3I3SR 4E05H 3BS4A 3TIFA 3L33A 1EZSC 8LPRA 2B5TB 4C0LA 5DGXA 4M1MA 2BDTA 2ZRIA 1B0EA 3URCA 1P2UA 1RGQA 1E2QA 3QTVH 2J46A 3PXGA 5C4GB 2VHQA 1ZHRA 2TIOA 1J8AA 4WMEA 5FR1A 3SU0A 3D31A 1Y5BT 1XXDA 5TDHA 3UATA 4RCZA 4LBVA 4OQXA 4JCNA 1GP2A 1SQTA 4I8HA 1KXBA 2FDAA 3ZZ3A 4UONA 4JLDA 1DAEA 1D9ZA 3B6EA 3VB4A 1COWD 2EI7A 1OKXA 1P2OA 3TSWA 1F2UB 1G64A 4N0DA 3UWKA 2ULLA 3GP8A 1GRRA 5L2YH 1O5CB 4ZPXA 2ZAOA 2O8BA 4I8JA 2J38A 4CZ2A 4MNVA 3GLGA 1Q3TA 2Z3CA 1AJEA 5FOTA 3MWYW 4Q1FA 3F9GA 1OXVA 1RPZA 2CVHA 2WWXA 4ARZA 1YCPH 1VG8A 1UHBA 3L82B 4B76A 3PLBA 3EC1A 1JQJC 3UTUH 1R5BA 4X1SU 4XWKA 4MQBA 1SVLA 2FJUA 2RDLA 1G7TA 1T4UH 3GCTG 4WIAA 2OT3B 1FQKA 3EZ6A 1W47A 2NO1A 2ZIQH 1FQJA 3MOCA 2ODEA 2ZCHP 3AW0A 3P95A 1MKYA 1YR7A 5G3YA 4PC2A 1W49A 2QP9X 4MKGA 4KP0A 5FL7D 1VJ9U 5B2ZA 2BVSH 4FMDF 4MGKR 3VX3A 1I2DA 1GHAG 4NIYA 1GI1A 2OQUA 2RCNA 4JKIA 1SKYE 3GCHB 1H9IE 5A8YA 2FEQH 5AJVB 1O2LA 2PJZA 3SN6A 1IN8A 1P3JA 4DLTA 2A5AA 5AJWA 2CF9H 2FM2A 4WWYA 4R2HA 3VFDA 4QHYA 3MD0A 4HB3A 4CT4B 4UXIA 2H18A 1A82A 3W90A 1E1QD 1GAJA 1TU4A 4ILEA 2F3CE 2D1JA 1P61B 1ZRKA 4IVQA 1SLVB 2GCHG 3BE4A 3NEJA 3P8OA 1Y3WA 2VB0A 3U3OA 4KTSA 1VKJA 2PMDA 3KKNA 4GCHG 5C1YA 4AB8A 1HFDA 4LXBH 5EE0A 1O34A 2GMTC 3Q3XA 4W5WA 1UVOA 1OXUA 2ZU0C 1SXJE 3T12A 1P02A 5L6NH 5EW1H 4MYTA 3QVUA 1BMFA 3KHVA 1D5CA 4PSKA 4QFMA 1ZSJA 1QL9A 4M1TA 2OCVB 6ESTA 5EW2H 2ZHFH 3EE0B 1JB1A 2GV7A 4EJSB 2XC5A 2F83A 1YYY1 2BDAA 2QA5A 4AYXA 2CHGA 1NSTA 4GNKA 2ZVPX 1EQ9A 2DBYA 1UTJA 1RJXB 3GLHB 4U01A 2GXAA 4WXVA 5H8WA 1P5ZB 4RZ2A 4O3UA 2ZPQA 2JJ1D 4R2IA 1QG2A 1YZQA 1VHLA 1QG4A 2O8TA 3TUIC 3ZZ0A 1DM4B 3A58B 3A8TA 2HNTC 4XIGS 4LY6A 2F1HA 4WBSA 4RD0A 1BBRE 5HKKA 2QYIA 3ZIAA 3FMFA 1KI3A 4XBBA 2BLOA 1US8A 3AVWA 4R7ZA 1XUGA 4B6FA 5E0JA 1ZIOA 2BDCA 5F8XA 1E0FD 1AQYA 4PANA 2Z4RA 1QHNA 4AD8A 4V0OA 2FYQA 4H1VA 1GJDB 1FNMA 2B21A 4URUR 2P93A 5JECA 4RN6A 1Z29A 1NN5A 5CYOA 1AN1E 4AFUA 3ZZ4A 1V2NT 1GDDA 4O2LA 4Z6AH 4EPYA 5LPEA 1FIWA 2IS6A 3RXLA 4KODA 1UEJA 1ELTA 4WMFA 4TMVA 4M0LA 3BF6H 3FPAA 2GZAA 4MGZR 2BDYA 4IRUB 1IQFA 4O0MA 3U3MA 2ZYUX 1NO9H 1GHBG 1LW7A 1UHBB 2ZI6A 4YOGA 1Z63A 1GI2A 1FJSA 2P65A 3OIYA 3AVUA 3AVZA 2FOCA 4KCGA 4A8JC 4P32A 5K8UA 1AUTC 3FE2A 3PV5A 2F3TA 3QI2A 1O33A 2ZDNA 3ETLA 3W5JA 3BTEE 1OKKA 4RCYA 4UD9H 1OFTA 5BQ5A 2ZANA 2Q1JA 2OFWA 5L3RA 1BTUA 1DXPA 1ZHPA 1AS2A 2WSMA 4IDPA 4Q7ZA 5FTJA 1Z0JA 3KQDA 2ALVA 2QV1A 1SPJA 1LPKB 3DM5A 4GOXA 4D9QA 1KI6B 3W94A 2FGJA 5KSOA 1MU8B 1UK2A 1ZMNA 1C1OA 3T2NA 3AM1A 1CXZA 4LRWA 1HXFH 4DCSA 4XE4A 1TA6A 4Z54A 2ZHQH 1GVKB 4WJG2 1HAOH 4LHVA 2C03A 4EJSA 4DSUA 4Z0KA 1NLFA 2F1JA 4DLVA 3LX8A 2IYZA 1FTNA 5JJIA 1IQPA 2DE8A 3P20A 4QHTA 1ZPBA 1N5LA 1CRQA 3GJ3A 4YXWD 4UDWH 3U7HB 1HEIA 2QPOA 3LD9A 2JJ1A 1BTZA 1MCVA 3NXPA 2ZRKA 3RWOA 4Z1MD 5B6LA 4JLMA 1WTHD 3A7XA 1GJ9B 3RMLH 4MPVA 3IG6B 5KDLA 1EZQA 1AB9C 5EQTA 2IS4A 2ZG0H 5L2ZH 3EYDA 2PMKA 1PPEE 3AF1A 2A2QH 2OEPA 1ESNA 4QT8C 2Z7FE 1VG9B 3SUEA 3NK8A 5FI1B 1F0TA 2B8TA 4AYWA 3UANA 2PKSC 1WRBA 3IDQA 1EK0A 2VYFA 1SGWA 3VGCB 5DP9A 5TCAA 3A88A 3LA6A 1C1WH 2FSIA 1BIFA 3GFPA 2FOHA 2X2FA 5JEEA 1R6BX 3DDCA 1CS4C 2C5LA 2ZRBA 2OXSA 3KJEA 1TE0A 2RH5A 4JS0A 4CHAB 4P4SA 1QBNA 1VIYA 4ZHAA 2ZGJA 1S84A 1HTWA 2R2MB 5B57C 4XH9B 2KJQA 2N1BA 1E34B 5GNDA 3EPJA 4MITA 1P2NA 2SNWA 1YZTA 1GL6A 3EASA 4ZO4A 4ZXXH 3P4XA 1GBHA 2HLCA 1M1YE 3ND9A 3ZGXA 3EZFA 3CZQA 2FEMA 1LMWB 2FLRH 5FPTA 1OXGA 4XSKU 3JZ1B 2E1RA 3LNCA 5JHGB 1ZTJA 4W7SA 2G8TA 1QQ4A 1ABIH 4OQNA 2QSZA 1G9XA 4TN1A 3E70C 1TEXA 1Z6TA 4PHHA 4A2WA 1F5RA 4LYAA 4TYDA 1XJQA 3E90B 1P2IA 5LB4A 1G36A 3TNFA 3QF4B 4G5GA 3RXUA 4KFTA 3HPRA 2XYAA 1R4AA 1U2RA 3I8XA 1II0A 2AXPA 1W12U 3KXIA 4U32A 4FMCF 4AB9A 2V0BA 3BFKA 5FFMA 5FPKA 5FX6A 4KFUA 2H5EA 4RZXA 1AI8H 3KFVA 2C77A 3ZV9A 4OI4A 2AEIH 2H57A 4PO9A 3QBTA 2G4UA 2XOKD 1NIJA 4N1AA 5EP3A 3JZ2B 4Q4HB 4HB2A 2FI4E 1ZC3A 3UWOA 1XUIA 3E8LA 3GJ5A 4V0KA 2ANCA 3WNCA 2FESH 5HXFA 1O2TA 5BN5A 4QHSA 1XMJA 4R98A 1OYWA 4QBFA 3NC0C 3M5MA 3L3TA 4FWTA 1W8BH 1Q12A 1YE8A 1FTSA 3UPUA 3M1IA 1FIZA 3OIUA 1VITF 4NBSA 1GJCB 5HM2A 3AGQA 1LF5A 2XXLA 3M0EA 5AJXA 4HTCH 5FUXA 2ODBA 3KIDU 1MQ6A 3A8BA 4Z1MA 2IF0A 2PV9B 1UMAH 3K0EA 5ESBA 4US1R 2P59A 1ZNZA 4OJKA 2P94A 4S35A 3UY9A 1D9IA 1GI4A 3RXOA 2Q6FA 5L3QA 1HUTH 5KNBA 2FOEA 1XPRA 5T6DA 1W5TA 1MQ5A 1WBBA 1ONBA 3A82A 3SV8A 5F98A 1P4SA 1W36D 4ZKRU 2GP9B 4NSYA 3L0OA 3RABA 1PFXC 1E94E 2OBMA 2CXVA 3F5FA 1Z0KA 3PO1B 2IJD1 1C9TA 4FCTA 5FPYA 1XFAA 1OP0A 1PYTD 3ZS8A 2ZRNA 1OS8A 1OXSC 4HAXA 1YZNA 4HAWA 3GY3A 4TYYA 2PJRA 1MD8A 5FTKA 4FUBA 2Z9KA 4AYYB 2QA9E 2A4QA 1UM8A 4S2EA 1UVSH 3ZZ5A 3KQCA 3T5GA 1HAPH 3SHCH 4LV5B 5CJ2A 1VCQA 1JPNA 1O2NA 2GT8A 3ZZ6A 1LTOA 3RRYA 1MV5A 5JRJA 1SVMA 2GKSA 2CK3D 2VIDA 2P6RA 3RXVA 1G4UR 1YKSA 1THSH 2XB4A 3L43A 2YC4C 1CJUC 2ZS9A 8OHMA 4PC1A 4FD2A 3W6OA 4CHAC 5FPSA 2G3YA 1C5XB 1AIPA 3L6PA 2UVQA 1O2WA 2PFEA 3F8TA 3I78A 4TL7A 3FP7E 1N6HA 1KMQA 2EYQA 1RTFB 3RC8A 1G7CA 1QZXA 2ZXUA 3PEUA 1BMAA 1OIVA 4KVGA 1NN0A 1P04A 4US2R 1V2LT 2SFAA 2D06A 3H1TA 1TQDA 2O0JA 1B23P 1W0KD 1P73A 2ZI9A 4UXJA 1W4AA 2ZITA 2AL7A 4Q7MB 3GLIE 3OTJE 1TQ7B 1KYNA 3MNCA 1GHXH 3AEZA 3VXEH 3CNNA 4HAYA 1U99A 2OFXA 1G3RA 3W34A 4LI0A 1ESAA 4E7RG 1XNJA 3K09C 4FUDA 4JZKA 4XSHA 2C9OA 1XTJA 1F2TB 4Q48A 4TTRA 5C1UA 1GITA 2DFNA 2IYXA 4C0HA 1JECA 1VCNA 2LWIA 3JZAA 1US8B 1N1LA 3EDXB 2W0MA 1DAGA 3PLPA 2EI8A 1RRKA 4GFDA 1VR1H 4PQRA 1C1MA 2BTCE 3WNDA 1JJVA 4C2TA 4DLXA 4FW9A 1TGBA 2ZO3H 4K46A 3HKIB 3A7VA 4PX9A 3OTPA 2IS1A 2F6RA 5FHTA 3TGPA 1HAVB 2JLVA 3QXSA 1HAIH 2B92A 4RZUA 2FDCA 4Z51A 3AKYA 4BLSA 1KDTA 1HDTH 2QG6A 3Q76A 3RS2A 3GLFE 1OWJA 2BY9X 1OH7A 2ZRAA 4O2RA 4DRZA 1KXFA 5CYPA 2KB0A 2F7SA 2HVXA 1GTVA 5IDVA 1O2JA 3FGNA 2REBA 2H9HA 2ASUB 4KELA 2QAAA 3H0KA 1JR6A 2VVUA 3AVXA 1KY2A 2BOKA 1YZUA 4IN2A 2Q3FA 1GG6B 5JDUB 3BAFA 2UWPA 1W4CA 1J8MF 1H4WA 3ZZUA 3PMHB 1KK2A 4Q1BA 3PVSA 3W95A 4D25A 1JOUB 2FGKA 2ZSDA 2F9MA 2P3TB 1N8OC 4AKGA 4UQOA 1U0HC 3LXRA 2QQEA 3OYPA 1KI1A 1ZUHA 4RFVA 3C8UA 3FYHA 5GVSA 4TYPA 1DFPA 1J7KA 5AJYA 4JLVA 2QPAA 2EEKA 3IO5A 1KY3A 1QBKC 1TPPA 2H8KA 2A2ZA 2XB2A 1SB1H 3HK3B 3BG4B 1V2UT 1QA0A 5C3NA 4DEXA 1LKBA 1H8EA 1GMCF 4FXGH 1S83A 2YZ2A 2F3RA 1E0KA 1JI0A 3KB1A 2J4IA 3R9XA 4GSYA 1YPHC 2WWWA 4FMBB 1IHUA 2UUJB 2WJHA 4P4TA 1EJNA 2HGTH 3SV9A 1TF7A 2NMVA 1HQCA 2CJWA 1GHYH 1KDOA 3SEAA 4MPUA 1DARA 4YOIA 1LVYA 1Q1BA 2OBLA 2GZ8A 4TLBA 1TLDA 2OE2A 2OC8A 3SU1A 1VIAA 3RXKA 3BTHE 1TIOA 4LV6A 1WQ1R 2Y81A 1UAAA 1MTSA 1X8KA 1KMHA 2WOJA 2D26C 5DYGA 4KFSA 1MKXH 5FOSA 3AUXA 1E96A 2PSYA 4UFDH 3TJOA 2IX3A 2CGAA 1TMKA 2QP4A 1F5LA 2ZJOA 4WY3A 1OYYA 2R3YA 5J4KA 2CHAC 2HYDA 1S85A 1F2SE 3QKSB 1X6VA 5JYIA 2HLDD 1JEEA 2IXEA 5AUNB 2GWHA 1KI8A 2CEAA 2FFAA 1TNLA 1C9PA 2Q9CA 1LHDH 2ZJYA 2B7BA 4WH8A 1L1NA 1E2EA 1GBLA 4I1VA 3QZRA 1P11E 5F8ZA 1HYQA 4B47A 4R9UC 1U0JA 2F9OA 1V2RT 1EPTB 2V3OH 1DS6A 4Q9HA 1HCGA 4IOJA 4RKFA 5JRZA 3RU4T 1N5KA 2W58A 2ZJ2A 3EAQA 8ESTE 2PEYA 4IS5A 3QO6A 2DUCA 1SKQA 3AVQA 1G17A 4TQAA 1SGIB 1CSOE 2CMYA 1XXHB 4BAOB 3RXSA 1P8VC 3GCOA 5J4VA 4QGGA 4DLRA 2A7JA 5EU8A 1AGJA 1C4Y2 1LQDB 5A0AE 1UBCA 3GLFA 3H2YA 5JFGA 3CF0A 4MKIA 4PHFA 2WAXA 1W4BA 3KTAA 1PYTC 1O2OA 4HB0A 2O52A 2X8AA 1DTSA 2QMHA 4TT3D 1HJ9A 3Q8XB 5IF9A 1GWNA 3M7QA 4Y8XA 2FODA 5A2MH 4LJ8A 4HFPB 3X1WA 1VJAU 4MRPA 3SBEA 2BBWA 4HZUB 3EA7A 1NPMA 3VR1A 4Q21A 2ZU1A 2HXSA 2F55A 1W48A 2QEQA 4AFZA 1OFHA 5K8TA 3ZVLA 4PPFA 5KUTA 1BT7A 2XBWA 1IAUA 2VWLA 3MWKA 2IYVA 3RRNA 2BD9A 1SXJC 1J99A 4KTUA 5DPAA 1P09A 1G3UA 3SYNA 1A2BA 4RSGA 1TBQH 3K0SA 1C5NH 1II8B 1NLYA 3SHWA 4CREA 2OCYC 4CEJA 5KPDA 2OBOA 1L1GA 1OWIA 2OBNA 4BAHB 3NBXX 2H9EH 3SYLA 1LV7A 1EUFA 3MU5A 2UKDA 4XTCS 2PUQH 1QJ6B 1NIPA 3NDPA 2BQ6B 3B60A 2EVWX 1Z0AA 2FZ4A 1BHXB 4AG5A 5EXLA 4NSVA 1FN8A 2J95A 2JETC 3SQWA 4CRBA 3QJYA 2ZU4A 5FCRA 1P03A 4KO8A 1CBWB 1D4PB 2ZDKA 1F0RA 4CR5A 4NA8A 1G3CA 1EG7A 4EFMA 1D6RA 1R8SA 3LKWA 2BY5X 2J9RA 3KEEA 3X2SA 3ADDA 4DJZB 1JXOA 1V3XA 4B43A 2FH5B 1GBJA 1OIWA 2J0UB 3WMGA 5LDDC 4DLWA 2AWOA 2ZYVX 1AE5A 1QHHA 1IJEA 1XCGB 1C4U2 3A81A 4AOQA 2ZCKP 2AMPA 2WV9A 1FP6A 1IQKA 2OV2A 5L3QB 3N5CA 4JT4A 1MZDA 2GJSA 2XBXA 4CEHB 1OE0A 3OESA 1KXCA 3M5LA 4H6SB 1CR1A 2OBQA 1QL7A 2BKEA 4ZV4A 1EFTA 2WAYA 3RC5A 1E0SA 1TMUH 2FPKA 3DKPA 1R0WA 1C4V2 2OZEA 1PQ8A 5JZVA 3RM2H 1GNRA 3PIRA 1TU3A 2BYAX 3QF4A 1MO6A 2H1LA 3V9PA 2FPMA 3GLHE 3K65B 1T0HB 1KKLA 5AFYH 2EFEB 3NVAA 4IDOA 3SUFA 2WMOB 1LPGB 2PLRA 3SO3A 4R71A 3LGTA 1JR3E 3TVJB 4FWIB 4DWJA 2SGEE 2NG1A 1A2CH 3OSYA 3MJRA 3ZVDA 3OEHD 4DOQA 5DHFA 1B0FA 4ISNA 1HAZB 2QXGA 1ANCA 3ADCA 1WU1A 2BVNA 1HV8A 1BTPA 4KBFA 3SU5A 3T1TA 1ELOA 3GQBA 4B35A 1ZUNB 4O3TA 4D4LA 3LH3A 3KB2A 3DM9B 5GJWC 1AKSA 2D4HA 4W5HA 3ZQJA 3M3VA 1Y3YA 2BY8X 3QGNB 3N2IA 1XPUA 3WNBA 1SULA 2ZGHA 5L3VA 1W7XH 2YNBA 2GDEH 1C5LH 3AVYA 2QMEA 5J4LA 1FZQA 3VB7A 1IXSB 2THFB 3T35A 5T1VA 1KSJA 4MDEA 3RLYH 1X7AC 5A0CA 1E3MA 8KME2 4ZKOU 2WV5A 2AXNA 4AFQA 2ERXA 3BIFA 1HBTH 2Q21A 1QNJA 4D4KA 1FMJA 1QDEA 3W5IA 4HAUA 3LC3A 1CP2A 1RRCA 1UKVY 4X6OA 5HZHA 1Y3UA 2Z6VA 1E9EA 4ESVA 4YMSA 1J14A 2ZROA 1PQAA 4B44A 4A7IB 1WE2A 1YPGH 4A6XA 4XWOA 4U02A 1BTHH 5FBWB 4K81B 1AM4D 4G5SA 1E2GA 2EU8A 3LLUA 3SJ8A 2G9NA 1WOFA 4Y71A 1WQSA 1TALA 2IXGA 5H70A 4LYFA 1C5MD 1YJ5A 4B1TA 3BEFB 4E03A 4DGJA 1DWEH 2VP0A 4K60A 4RKOB 1CR2A 3SJZA 4M1KA 5J4SA 1DAIA 1L1JA 1AS0A 1WF3A 2GJ9A 4NTZA 1IQIA 2TPIZ 1DAHA 1L4UA 2RGBA 4TQ9A 2OFOA 1P7CA 3K9NA 2DFKB 2BZAA 1VDZA 2RKOA 2SHKA 1KXEA 1CE5A 3U4QB 4I33A 5CITA 4ABHA 4ACAA 2G52A 3KKPA 2B8OH 2I1VB 1II8A 1FQ3A 4BFUA 1SGQE 1DWBH 1PPBH 3K6YA 1N5IA 1GHZA 3QQ5A 4A4DA 2PKSB 1EOLA 2W0SA 1TF2A 3H09A 4BLRA 3LBHA 1XKBC 1HIAB 2AKAB 1GBFA 1UBGA 1BITA 1MZAA 1NRJB 5A0FA 4UFEH 2HUPA 1E1RD 1OWHA 5GPIB 2IJOB 3BD9A 4LYHA 3MO6A 4Q1EA 2BXTH 2O8DA 3WBKA 2DWPA 3SBKA 1E6CA 1CA0C 1EB1H 3ZD6A 1TAGA 1F2TA 1XMSA 1O30A 1XB2A 2CLCX 1A3EH 3KL4A 1RJ9A 4NYIQ 2WTUA 3IHWA 3R9IA 4YM9A 5IT5A 3KQLA 1FUJA 1KTTB 3RVBA 2XNDD 1F0UA 3Q3JB 1G291 1PZNA 3PTNA 4HATA 1UCYH 2JJ2D 3VB6A 1QHHB 1GCTC 4Y11E 2ZF0H 4L16A 1WP9A 5TARA 4DZZA 1NZQH 3BTWE 2PHBA 1ZIPA 1C2FA 1M7BA 4F4IA 7GCHG 2FPZA 5KNDA 5EXTA 4FUGA 3KXKA 2ZI4A 1NKSA 1P3CA 5EE1A 4CEIB 1OH8A 2FTLE 2C9YA 5BPEA 1LHGH 3QK1A 1M2OB 1YU9A 5CE1A 1P10A 4BLOA 4B3XA 5EPNA 3EIEA 4B2CA 3U3JA 1M9UA 5E7JA 1WQVH 2IWHA 1BB0B 3KUDA 4OHYA 3UWJH 1P9UA 3MU1A 1SSXA 3PUYA 5D3MB 1CIPA 1OPXA 3EARA 3LH1A 3MTYA 1R0YA 2R6CA 1SVKA 3DEFA 1R10A 4OS4A 2ZR0A 1KLIH 3ZZ9A 3A36A 5KSPA 2ZFTA 4PTLA 3RC6A 3T25A 2VIIA 1KDRA 5G40A 3KFXA 1K21H 4DT1A 2XC4A 4OS6A 3W6NA 2C3SA 2JETB 2CE2X 2VINA 1UTNA 2FI3E 3L0SA 2VWMA 3Q72A 4IFBA 4QM6A 4HAZA 3TJVA 4O9VA 3HU1A 1E79D 3Q3YA 1LVBA 4MGYR 2W5EA 3KDSE 2GJAA 2QCYA 2ANYA 1GL7A 4BFTA 4TMWA 1SVPA 1R0XA 4JLNA 1QVRA 3QEJA 4LJ7A 3HYTA 3ZZBA 4GPTA 3ITIA 3FZZA 1XMVA 3VB5A 1QCPA 4FINA 1NN1A 1HXEH 3SFZA 3PCRB 4OK3A 1MT0A 2GA8A 1R7RA 4IOKA 3RDZA 4L15A 2YVUA 4JL5A 8GCHG 4X8OA 1W2KH 4OGYA 3CX7A 5AUOB 2GTPA 4PZLA 2ZPTX 4TMKA 1A1RA 3BTME 1OXXK 1O39A 5JLJA 2X77A 4A36A 4A2PA 3SU2A 4BFWA 5JBTA 1FNIA 4QNMA 4EKDA 1CKEA 1XTRA 4FMCB 1ZUIA 1HAXB 3U2QA 3RXIA 2J5XA 2W2XA 4PC7A 1FMGA 1QRZA 4A0FA 4A1XA 4JK5A 3A7YA 3QKRB 3VGCC 2AGIX 2HEIA 1AGRA 4OHVA 2GEUA 3ATWA 2ZM5A 2G1KA 2P67A 2ATXA 3MNXA 1ZU5A 4Q1AA 3SYKA 1J70A 1ZMLA 1H8DH 4X2WA 4TMZA 1PUIA 3MMGA 2KBFA 2QF0A 4UEHH 1E99A 2O8WA 3QXHA 5T6GA 2AIQA 3JVUA 3LVRE 3U9AH 3QG5A 4Y76A 1BMFD 1WXRA 4U5XA 3QE0A 4M9XA 4CRAA 3M36A 1MKWH 3SNEA 3U60B 1YR8A 3BRWD 5EJEA 4FUEA 5CLLA 1SLXB 2BJVA 2BD4A 3QX5H 2HALA 1WYKA 4H42U 3EIHA 1DEKA 4X0WU 2TBSA 3DZDA 5JB9S 1ORFA 1TONA 3THOA 3CS7A 2QE7A 4X1RU 5P21A 1Z8IB 3AF2A 4IJMA 2AKYA 3FDIA 1KTVA 2ZDLA 4E09A 3U6BA 2IYTA 1KTSB 2RGNA 4X6PA 4DVGA 3ADBA 4WW0A 1INCA 2IXFA 2XBVA 1RE0A 3GJ0A 4OQLA 3V0XA 1Q20A 1ZGIA 3CB4A 2PX3A 1Z0IA 1FAKH 2WJYA 2FPLA 4AK9A 4ABGA 2BJWA 1YZGA 5LB2A 2YYZA 3A37A 2NGRA 3PYHA 3A7ZA 2AN9A 2QBYB 4JSYA 3ZVBA 3T61A 4A15A 3Q5EA 1XTKA 2GHIA 2WWGA 4NCHA 3F9EA 2ZFRH 4EIWA 1N3BA 2G77B 1K1PA 1T91A 3PQCA 3IBGA 1Z8FA 2C96A 1XMIA 2QP3A 2PZFA 5C67A 4E06H 4B2AA 2G88A 4BZQA 2R0LA 2EFGA 3PEWA 3T1QA 2E9SA 3RXTA 1ZU4A 3A4NA 4TZ6A 1DPOA 3FMIA 2SGPE 5A5GA 3RLWH 2OSBA 1P62B 1PPGE 2YHSA 3MH7A 3R7WA 3RC3A 3QUSA 4FUJA 2QAGC 4NZQA 3NXSA 3C5HA 2QXIA 1RTLA 1QHYA 3NC1C 3QWCH 4Q4JB 4JYUH 2BOVA 3GJ7A 2W26A 3P70B 3P27A 1E9CA 1IOZA 2W83A 4MPWA 5BN4A 4JYTA 4ZHLU 4C0QC 1DY8A 3VMFA 1RZ3A 1NTPA 1FMLA 1HJAC 2O8CB 2V54A 4YQFA 3NIBA 1KOFA 1TB6H 1SFQB 5FX5A 4JLOA 2R2AA 3V12A 4IMZA 4OHXA 3OAAD 4IHQA 1IM2A 3KKQA 1E69A 5FTMA 1T3HA 3SJBA 3CM0A 4I81A 3FKQA 5D3MA 4QBGB 2VVCA 1YRAA 4D8NA 1QBOA 1E79A 3FFGA 2V4ZA 1ZTKA 1H8IH 2C78A 1UPTA 1E4VA 4GZMA 1GGDC 1TNKA 2WWFA 1AB9B 1QHRB 4PFSA 2FLBH 2PWXA 2WPHS 2TGTA 1AZSC 2EC9H 5A0BA 1I4DD 4XOJA 1A7SA 4M1YA 2BBTA 1UVUH 2RHMA 5JJLA 1UTQA 1OF1A 1QB1A 3BV9B 1OFUX 3LU9B 4RI0A 2JJ2A 4G5OA 5JS7A 2QF3A 2XEXA 5T6FA 4QM7A 3TQFA 4BOHA 4U7DA 3THYB 3LT3A 3PFIA 1SQOA 1C9KA 4Q02A 1CT2E 1P2SA 1DG3A 5FXLA 4TT3A 3ICEA 3QUMP 1O31A 5EXNA 1ANKA 2AFQB 3SE0A 5PTPA 2BCGY 1FI8A 2YV5A 2G81E 2AFIE 3S9CA 1OPHB 4Q5IA 3ZVAA 1P60A 2QGZA 1EATA 1ELEE 1RYHA 1ZM2A 5FOUA 4Y0ZE 4JZEH 5FBIA 1G3DA 2FOAA 4WH6A 1DO2A 3MI4A 1DWCH 4WXRA 2P8OB 1NFUA 1L4ZA 4LHXA 3GYMA 4OM9A 3Q00A 1A5GH 1O2YA 1TQ2A 1T8NA 2Q9AA 3F9FA 4DC9A 3QPWA 4EDHA 4CYMA 1UK3A 3UQOA 1CULC 1TMTH 1Z6AA 1BBRK 4H6TA 3TJUA 4QOSA 4DUGA 1DUEA 9LPRA 2XBYA 4O3MA 3TW8B 3E91A 2O8CA 1XVMA 3BG8A 2A78A 3VU9B 1BUIA 2Z0MA 4E5UA 4I8LA 2ZQ1A 1G3QA 2ZRPA 1XTQA 3LDXH 1OW3B 1SC8U 2HNTE 5C18A 1FY3A 4M9SA 3W9YA 4HYYA 4ISHH 3B23B 2FP7B 2NTYC 1JAIA 3QG1A 3T62A 3KF2A 1TQ6A 1CQQA 1IXRC 5E2OA 3UR9A 3U69H 1TNJA 3STIA 3QY0A 3KQHA 4GP6A 2QY0B 4D9RA 2WIBA 3FHTA 4Y7BA 3LGIA 3EW9A 1NFYA 3A6PC 2WV4A 4ZXYH 4FXPA 4MDFA 2GAAA 3UK6A 1NROH 4AGKA 2F4LA 1KI9A 2IEZA 1MRNA 5JI2E 3GEEA 1ESBA 5KSYA 1IHTH 2XTZA 4OS5A 4NP6A 3KJHA 3L8YA 4D82A 2WWHA 5JCZA 1FN6A 1DSUA 1BOQA 2SGFE 1DAFA 1VYVA 1KI2A 4AIIA 4A82A 4GPGA 1O87A 1N6KA 1Y59T 1SGNE 1F7ZA 4A0HA 2CCJA 2YWFA 2OCBA 1P6XA 2CL0X 1D3QB 4TYQA 2WMNB 3GJ4A 2ZR7A 4ABYA 3H5CB 3SJOA 3S7KB 1UVPA 4MRSA 1D2NA 3H84A 1ETTH 1TA2A 4JBYA 2CL6X 1N0VC 2ODQA 1AGPA 3IO3A 2ZHEH 1O2VA 2VL7A 2V6IA 5KSZA 5ETXA 3GYLB 1T8MA 221PA 1XF9A 3CR7A 3HU2A 2WUCA 1R5OA 5HM9A 5EUQB 2JLWA 4X6NA 1AMHA 4MYCA 1W7GH 2ZDMA 2JH6D 4JZDH 3ZLJA 2GBLA 1RRFA 4LUCA 2YINC 4KSCA 2I1QA 2E87A 1Z3IX 3CUEF 4RD3A 3ZVGA 1DY9A 1QHXA 2PT7A 2R6GA 1KI7A 4OI1A 2AERH 4OS1A 3E6PH 2ZREA 1A5HA 1HUQA 5IRCD 1M74A 4QJ5A 3OEED 4LK4A 1GZSA 4OI0A 1UKYA 1MCTA 2ZTZA 1T4GA 3LQQA 1JPJA 1YC0A 3ICQB 5SZHB 1GDQA 1JR3D 1GBDA 2RCEA 3OEEA 1ZJKA 3IILA 1EFHA 4IEIA 4BWYA 1QURH 2FX3A 4BLQA 2TGDA 2A31A 2JAQA 2W2TA 3LY5A 4G5QA 4QBHA 3GDUA 4X8MA 4LHZA 2FI5E 4NG9H 5TV2A 1BH2A 2QU8A 2IOTA 3NWUA 3F68H 4WA7A 4AKEA 1UTKA 4ON9A 1IQHA 3X1XA 1Y3VA 4UNQA 4IEEA 2GCOB 5JHHB 5HE8A 4DVAU 2GX4A 4DHEA 1V2MT 4JMPA 2FN4A 1A5IA 4IC6A 1F48A 3WBJA 1ZC4A 4JMYA 5HR5A 4PHTA 5GJCA 3MSXA 3RS3A 1GVZA 4UNRA 5J5CA 4JZ1A 1OXTA 4UE7H 3SNDA 1SGFG 1EESA 4N3NA 1ARCA 1GI9B 3TK6A 4ZKEA 1M6NA 4GMXA 4MH0R 1UTMA 4IN1A 4BTIB 1Q3HA 1U94A 2PTCE 3RXEA 2Y5HA 3M37A 1DAMA 4LGMA 1BO6A 3OE7A 1O3LA 3LH5A 3BTFE 4Q9IA 1YCPM 2GTBA 2BMEA 1G7SA 1CBUA 3TR5A 3UQVA 2V35A 1HT1E 2HF9A 4BLPA 1GBIA 2N42A 1GBCA 2FA9A 1SKYB 5E0GA 2ILNA 1NBMA 4CH8B 1NC6A 1GI6A 3QPUA 4D7GA 1DS2E 3TVTA 4F49A 1U90A 1RW4A 2OCPA 3K9XB 2BKUA 4QXAA 2UUYA 2R65A 1KIGH 5E8EH 1O3DA 2XTTB 1E0AA 3GCTF 4A1VA 1RD3B 3GISB 4NYIR 4B3CA 2ZYWX 4I8KA 2J1LA 2Y82A 1Q3XA 3P92A 4HZHA 4NFFA 2DHRA 3BBPA 4KBGA 3A1VA 3BXZA 1S3SA 3B2EA 2NU0E 1FY5A 4I1OA 3ODFA 1BRCE 3C15C 5FBRB 3DUXH 3O8BA 1S6FA 3STJA 3H7TA 4M4SA 2R3UA 1DAKA 4ZDJA 4NGAH 3TK9A 5DI3B 3B1WA 2QAJA 3PMJA 5LPFA 3PENA 2JKHA 2H2ZA 4PAQA 2EYUA 2IN2A 1LDTT 2ZS8A 3PV4A 1XEXA 1ANBA 5F03A 2ZGXH 3SI7A 3Q7QA 3LGYA 4ESHA 1S1MA 1IQMA 4XJXA 1P12E 1XBTA 1SZPA 5CDFE 1SGCA 4D76A 1AZ8A 3G5UA 4YONB 3T28A 2NO0A 3AGPA 3V3MA 3W8RA 2VBCA 1S5SA 1Z83A 3O47A 3IKJA 2A5YB 4KSBA 1N6IA 5DH9A 4B3FX 1QRWA 1AE8H 4PC6A 2CJIA 4JZIA 3LFUA 4F91B 4TQUS 3B85A 2VHJA 3TH3H 3MRSA 1UVTH 3PB1E 4M1WA 1SHHB 4DW2U 4GRAA 3URDA 2FS9A 3EZ7A 1H9LB 4JZFH 1NNEA 3BB4A 3U98H 4LZZA 2AMQA 4FCVA 4GLYA 1Z08A 1J8YF 5B58C 4OBEA 1OH6A 3X1ZA 3SJ9A 2OLKA 2GJKA 2A30A 1TGSZ 1IAQA 1O2PA 4WMDA 5CHAC 5EZ5A 4A9AA 1ZCBA 4Q19A 1SQAA 1UK4A 2GEDA 1SGYE 2OAQ1 4ZH8A 3SNAA 1OJLA 3B9PA 4DCDA 2C8VA 2B0FA 1ELFA 1KSFX 2VF8A 2CLSA 4NYJR 4KAXA 1UKEA 3Q9LA 4Q1DA 1BTYA 1GDUA 1IN7A 4EPWA 3K9GA 1E1RA 3DKVA 3L8ZA 1UDWA 2J7KA 4X8HA 1DICA 3CRRA 1NM6A 2CHVA 5CIWA 1Z6JH 1E2PA 2BQWB 3QSYA 2HXYA 3B1XA 1BQYA 4CBNA 2KAIB 2IW3A 1EWRA 3HWSA 4NCYA 2VPPA 5DP3A 3I8SA 1KSGA 2CHQA 4UFGH 4ACBA 1ZMXA 1IQEA 1O2UA 4XD7A 1NRSH 2D2FA 5I25A 4QL3A 4XTRA 3SNCA 4DCNA 2N46A 4BAMB 5DI3A 1ZRBA 2QL6A 1ESMA 2NO7A 2ZE7A 3QXXA 5AHGH 3LW7A 1VTKA 1KZGB 1V2TT 4K1EA 2ZSAA 3P26A 4Q47A 2QXJA 3U6KA 2GVDC 2QN6A 3CH5A 3V4FA 1C1RA 4OHWA 3V13A 1Y3AA 4URXR 4GMDA 1W13U 2ZFQH 4AN7A 3NWJA 2DPXA 3O8CA 2QAGA 1P2KA 1X1SA 4WVPE 3SU6A 3WXMA 4IW4E 3S9AA 3CX6A 1SFIA 3PM3A 1GHWH 2JH5D 1NRNH 2IHBA 4TMXA 5EQRA 2J94A 2A0QB 3X1DA 1XUJA 3EG5A 2ZI2H 2OD3B 2QIQA 3S69A 2V3CC 3W3AA 5FL3A 1VITG 3OEHA 2ZEBA 2RGGA 3OHMA 3TGKE 3CLVA 1PJRA 1O5EH 1DADA 4LPSA 1JIRA 2UWLA 2ZWLH 1LHFH 3GFOA 4NMMA 4DDVA 4D6PA 1O2XA 3VR3A 4II7A 2VWOA 3ZZ8A 2ANMH 3SI4H 5LGOA 4ZDWA 3BK7A 1KNXA 2Q6DA 3OIWA 3GDVA 1Y8TA 5DP7A 3EPHA 3RXJA 5EP1A 3GLHA 4QKQA 1P9NA 2WWYA 5DP5A 4I1UA 4YXWA 3CF2A 3RXGA 2VA8A 5FUVA 3CP7A 2IL1A 521PA 2VVVA 5AVDA 4YMWA 1E2HA 1AU8A 4JLPA 1S9DA 1O37A 3GEHA 1C2JA 4I99A 3Q3KA 4CRGA 3E0NB 4H4FA 1S0UA 4HDCA 3VAAA 1TFXA 4X8LA 3SV7A 1F5NA 1ZP6A 3A7TA 2NO6A 3RWMB 4MKHA 4NA7A 2CNWA 4MRVA 2CCKA 2SGQE 3R8CA 1XM1A 1YVDA 4M22A 1ZTLA 4Y0VA 1P57B 4BANB 2D7CA 2CBZA 2YWEA 2Y8EA 2XXAB 5DN6D 5FR2A 3A85A 2VSXA 3EA9A 4IXMA 2I6SA 5EP4A 4EPRA 1M7GA 2QC2A 1LF0A 3MAAC 2BM0A 4BUJA 3UG7A 2TGPZ 3SJIA 1OOKB 2OESA 3LQRA 4IBLH 3P4YA 2ORVA 3EPKA 2ZZUH 3ZVFA 1HT2E 1WA5A 4OK6A 1N5JA 2V7QA 2VJ1A 3OU0A 2HT6A 2MSCB 4IVRA 2ZUBA 4IC5A 3LC5A 4E7NA 2HOBA 4CEHA 2YNMA 4O03A 1NVVR 1XP8A 2NOAA 1GMHF 3ZYEA 1HB0B 3MU8A 5E4FA 5AFZH 1JRTA 1U0LA 2W00A 4BAQB 1TUEA 2A4OA 4GHTA 5DNYB 2BC9A 3IUYA 2YOFA 4LC1A 4QGAA 4F4CA 2A5GA 3GLIB 2ZECA 4BQSA 1E38B 1EZUC 2XWAA 1NY5A 4F4OC 2ZUCA 3VU9A 1OT3A 4CDGA 4XVUA 1FLEE 3TJNA 1IONA 1U81A 3PV2A 1X3SA 1ZZZA 1G8FA 1HJ8A 1T8LA 3F9HA 5T3HA 4THNH 3U44B 4L8GA 3SHAH 4YMVA 1OYTH 4RY2A 2G00A 2D74A 3G01A 3UKDA 1MRSA 4ZI2A 4LK2A 2GCOA 1C1SA 1U9IA 3BN9A 1V2QT 1MABB 1P2MA 1P2JA 5HTKA 2ZJAA 4X8SH 2VIOA 5UKDA 1O2HA 3T5FH 4X8UH 3NKVA 4URWR 1Z1JA 5D3QA 5CB8A 2V6NA 1XZPA 5KOYA 1EFUA 1SQ5A
chains in the Genus database with same CATH superfamily
4KNWA 2Z6BD 2ATCA 2NVBA 1ND6A 1SZDA 4EY5A 1EGVB 3L8DA 3D3QA 3FFTA 3WGYA 3WLTA 3UFAA 5HMAA 2BM9A 3DEHA 3ESXA 3FZNA 3IAFA 1J97A 4IMPA 4MYSA 1ZBDA 4WNAA 1U2ZA 4LXIA 5IZCA 1NVVQ 3U44B 3O1JC 2AHRA 3H5TA 1DLKB 3LY8A 3QXGA 2IPHA 2ZTMA 1H4TA 3BRSA 4NI5A 2GCPA 1XYVA 1LJLA 4EJMA 3DPIA 4ZAGA 2PRJA 3FWNA 3HJCA 4LYJA 5JISA 1XKAC 1HG1A 1UZUA 4RK6A 5KJFA 1QH1B 3TLKA 3VR5A 2Z9LA 2DBZA 5TSDA 1SQSA 2VPTA 4DR1B 4WOPA 3QPDA 1RKQA 2IOHA 4F48B 1JV2B 3EXHC 1DOJA 3HCDA 5JPIA 1BD3A 3AK5A 1NR1A 2Z30A 4QUHA 2Q1WA 3LO5A 3VHRA 4AJKA 3NH9A 1P8JA 1U0FA 2VJPA 4FYMA 1QB9A 1BROA 2HV8A 1T9GS 5CVTA 3GRKA 2GK6A 4QXMA 5HKAA 4HDKB 1SKAA 1ZHMA 1VQ1A 2J45A 1TZKA 4QQ8A 3ZBPA 3DF9A 4AXBA 2RG1A 5KVAA 3PD1A 4ZT3A 2GDDA 1FSPA 1BS9A 1NM5A 1SK8A 1WMAA 3WYGA 1XJ5A 4B6GA 4FYPA 3AFOA 3TUJC 1FUEA 1PFQA 3DMRA 3SC6A 4Q82A 3SQEE 2MSLA 2R6DA 4EITA 2GM4A 2PG3A 1P2FA 3WB1A 1E2IA 4BJ1A 3IH5A 3D3EA 1EFRA 1UBJS 3ATKA 3FCEA 3R3XA 5LXTB 2GZHA 1AN0A 3GZ4A 1Y5RA 4F5ZA 3EEOA 4TL9A 1RE1A 3KAJA 4YUYA 4PG5A 3TNJA 1LVMA 5I7EA 2BSAA 1USKA 2HKIA 2BZ0A 2Q4RA 1JKFA 4WOCA 2IS2A 1J06A 2YWGA 4OUDB 5LP6F 1VM6A 3CEMA 3NM4A 4JIMA 1CO7E 2X8BA 2VQSA 3GPCA 4C6TA 1CA0B 3U3RA 1QNLA 2GT7A 1MIOA 4F91B 1XALA 3OTGA 4P02A 4BL5A 2XLBA 4KQIA 1ESZA 3D6UA 2BD8A 1A9RA 2HLDA 1O2GH 2Y1LA 4OVKA 5KNBD 3LY9A 3G6WA 1A3BH 2ZTYA 3M34A 1C2GA 4M0FA 3U7EB 4BO1A 3ZV4A 4MYHA 1Z8GA 1PFYA 1NVMB 2BTQB 3CN9A 4OHPA 1HI9A 3UAGA 4EVSA 2J9FB 1T5HX 1C2HA 3LCRA 4LBWA 5CLFA 3PTZA 4MSUA 2VH5R 1WF6A 1I5OA 2AQ8A 3CMCO 3EQ6A 5D01A 5EWJB 1C5KA 3R0FA 4CMGA 1D2HA 3HU5A 2R6AA 4ZT5A 1UTPA 4IMRA 3CG0A 3Q85A 4F9TA 1HAGE 3WTBA 4IIJB 4KN9S 1Q6YA 1J1UA 3NM5A 3ROEA 1N0WA 3WRYC 1TEHA 3ITDA 4GMFA 2O3SA 4C06A 1V1RB 3HEAA 2JGDA 4RKJB 1P75A 1PNVA 2ZWOA 1QYCA 3LIIA 4HYQA 3TYXA 2ZEJA 2FV8A 1MTUA 2W6JA 4V39A 3K9BA 3FRHA 4Y6DA 3T52A 5K2MA 3ZWCA 2OHFA 4YJDA 4DG5A 1GNQA 5ELXA 4XEHA 4CUJA 4AC9A 4OJYA 4G5FA 4YLGA 5DM1A 3K6SA 4BO2A 2PD3A 1PFVA 3O74A 2ZKIA 5A0TA 1N2HA 3A28A 3IBYA 1MTNC 5CDFA 2M6LA 1HDOA 2OM2A 3HN2A 1PFGA 3GB9A 2EZTA 1A0LA 1EVQA 1OZFA 4JJEA 5GVRA 3UFXB 3T26A 1Z47A 2VEDA 4K9SA 1DLIA 4U6NA 1TKAA 3CNQS 3L7OA 1E4YA 1QGFA 3EWSA 2DBRA 3Q2IA 5L7YA 3TS1A 3X1KA 4RIGA 2YWXA 4PCAA 1MO5A 2O1XA 1TPZA 5C20A 3D43A 1DC8A 2WICA 5FBQB 4AZ0B