4B74A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
645
structure length
645
Chain Sequence
b'GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
molecule tags Hydrolase
source organism Hepatitis c virus (isolate bk)
publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function
pubmed doi rcsb
total genus 208
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b74A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b74A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b74A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b74A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b74A03
3C5CA 2J0QA 1XWIA 1NKSA 1O5DH 5TDHA 2OSBA 4LJAA 4IDNA 3W34A 4B6EA 4B76A 3M7QA 2FH5B 1SLUB 4H42U 3A84A 2WWYA 1Z6EA 4XVQA 1KLTA 3E8LA 1S2MA 4CR5A 5DP4A 3LX8A 1EFRD 1MKYA 4TTRA 1M34E 2J0SA 4O2RA 2ODNA 2EC9H 4NIYA 1D9ZA 1XFAA 2OLGA 2O52A 1FN6A 4Q7JB 2FPZA 2GZ7A 1VIYA 2HPPH 3AEZA 1CS4C 2UUKB 5ESBA 5G3YA 1SL3A 2FFAA 4POAA 1O3OA 3LO5A 1KXBA 3T12A 5IRCD 1TF2A 1Q44A 1IHTH 2LCFA 2FYRA 1C1WH 2D26C 1SHKA 2OLKA 1V2OT 2ZITA 4MRRA 3OX7U 2BVSH 2AGGX 2QGNA 1SG8B 1KI2A 4OHVA 1O5FH 1Q3XA 1D8TA 2PFEA 3N2IA 3RXKA 1NLZA 4C7OB 4LV6A 1WBGB 1L4UA 3K0AA 3E16B 4A8JB 4B32A 2H5CA 5JWOA 3K2UA 3K6ZA 4A8JC 1FMJA 3OIWA 3OIYA 3CS7A 5J4YA 3P4YA 1LHCH 2GVZC 1MTUA 4M1OA 3GLIA 4QJ3A 1RE0A 4LJ8A 2RA3A 3U8OH 2EFEB 1MKXK 4D6PA 4RZ3A 3ZYDA 3M5OA 4PAOA 2G4TA 2FP7B 3BEIB 4HSEA 2XX3A 3AF0A 3KIDU 1KY3A 2VIVA 1IQKA 1W4AA 3NZIA 2VIPA 5FOWA 3PLKA 3I92A 3RDZA 1R0XA 2FTLE 1T9HA 1SGDE 1OH8A 2GCHF 3X1XA 5ANRB 5GVRA 1QBNA 4PC6A 2C90B 3DKPA 4X8VH 2ZPTX 4XWAA 3BTGE 3ZZDA 1DS6A 4Q4HB 1Y59T 4Y10E 1RD3B 5H70A 1Z28A 4LGMA 1MBMA 1PLLA 4ISOA 3E1SA 5E2OA 3ATIA 1RW4A 1PLJA 1MH1A 3T1VA 5BYJA 1GWAA 2HF8A 4B2LA 4IOMA 1VYVA 4WW0A 2CCJA 5E3HA 1WUNH 1MU8B 1ZPBA 3FP6E 4E06H 1N0VC 2QM8A 2JLWA 1SHZA 4KBFA 1G8GA 3HK3B 1NT1A 3TK6A 1YF4A 4YXWA 1CT0E 1FQJA 3GJ6A 5E7IA 1EKBB 4JMPA 1QHHB 3CF6R 1C1SA 1JR6A 1Z0AA 5A09A 2B6HA 1PPFE 1TPOA 1MBQA 5FBVB 1G5PA 2J41A 4Q02A 3PUZA 3MLEA 1WB9A 4WY3A 2GZ9A 2MSCB 1GBFA 2CL7X 1G9IE 1TNGA 2CL0X 3TPIZ 4IN2A 4D4JA 2IHBA 5DHFA 3QWCH 1ZSLA 1O33A 4AKEA 1EAWA 1KDTA 2O8CB 2ANYA 1KSNA 4NU0A 2QSZA 1ZC4A 3QX5H 1T3HA 4D80A 1UKYA 5JZVA 2PHBA 1XUGA 1KZ7B 4FCTA 4Y71A 3KFXA 1YE8A 1D3TB 4TYWA 3PB1E 1TUIA 3CENA 1J16A 3CPEA 1E2JA 4QT8C 1BTXA 1O0DH 5FTKA 4BASA 4US2R 2ZUBA 1IQEA 3BTHE 4NFFA 1T0JB 1QB9A 1QQ4A 2QPAA 3EG5A 4B35A 2V1XA 3ZVMA 2J38A 1XUHA 4ABDA 1XXHE 3BG4C 1E36B 1BRAA 2DHRA 4CRWB 2XITA 3GFPA 3WP1B 6GCHF 2WSSA 2R6AA 2GNOA 4X1NU 721PA 1GDDA 4X2YA 1OSNA 1HAZB 4DCDA 3SOSA 2EFDB 5LH8A 2X2EA 2C03A 3VFEA 3FMFA 3BERA 4TY6A 2IYSA 4F4JA 2ZAOA 3QE0A 2CL6X 5LGOA 1F6BA 5SZKB 1PUJA 2VIIA 2VP2A 1C5MD 2IYUA 4S2EA 3RS4A 2BZ6H 4NKRA 3U3JA 4A6XA 2L0XA 1T5LA 2P5SA 3LDAA 1LNZA 1SR5C 3SOPA 2I4IA 4LHZA 3DM5A 2PUXB 2BDYA 4C0KA 2EVWX 2ZU1A 2HYDA 4PSKA 4CR9A 4Q1DA 3GYLB 2ZFSA 1O5CB 2STAE 3BOSA 1O2NA 4C0JA 1VCNA 2X19A 3BTEE 2Q6TA 1LHFH 1GNRA 2A4OA 2J87A 3VX3A 4AKIA 4JJKA 1UKZA 1J15A 3AKYA 1XM1A 3VXEH 3MHWU 1EP5A 1TUEA 5FI1B 1A1VA 4I31A 3W8NA 2OILA 3BD9A 4HFPB 3K1JA 3GJXC 4Y76A 1BB0B 1TADA 4YDSA 1NRPH 3ZQJA 4BRUA 2CJWA 4TLAA 2ANWA 2FFBA 3QVVA 3HU2A 1ZM7A 2GDDA 1C5OH 5EXMA 5LBIA 4LYFA 2BMEA 2Z94A 2SNVA 4YOJA 5C3NA 4UJ5A 1FPCH 3U69H 1Z0KA 1C1MA 5DI3A 2FZZA 3OAAA 5EE1A 1WMSA 3UOUA 1FIWA 1GHYH 3RMOH 1ZMJA 3BTFE 2NQ2C 1S3GA 2IXEA 3AQ4A 1ZRHA 2GZAA 2JJ1A 4WH8A 1P60A 1SLVB 2A7QA 2PT5A 3SNEA 1UVUH 2R62A 4HLCA 2ZFFH 4KYIB 1UBGA 4AFZA 4GVUA 4G5OA 4KCGA 4INHA 1R0ZA 1CRPA 2H18A 1JAHA 4AG2A 2XYAA 1XEWX 2X8AA 4L9SA 5JBQA 3RWOA 1ZPZA 2H17A 5TCAA 1C2DA 1AUTC 2QF0A 1RFLA 1N6OA 1NFYA 3U1JB 3SORA 3PR1A 2W5EA 3Q5DA 5CITA 1D3PB 1N3BA 2BJWA 2DPXA 1C4OA 4JL6A 4MKHA 2HYIC 3QSYA 2QP4A 1AIPA 2FEMA 3TRFA 5DGXA 1RIWB 4Q03A 4Q1AA 4U2WA 2QGRA 3IITA 2HCJB 3GCHB 3FKSA 4RSGA 2BC9A 2EQBA 1SFQB 4DDUA 3QQ5A 3U7HB 1KMHB 4ON9A 4CYMA 1F92A 1VECA 5SGAE 1X1RA 2A4GA 4LHXA 2FU5C 5EXLA 3LY5A 4RFSB 3QPUA 3K09A 1ELDE 4XTCS 4NH0A 1CJKC 4KFSA 1KI6B 4P32A 1GG6B 1GRNA 2BMFA 1V2PT 4TMZA 1W4BA 3KJEA 5AUPB 1SKYB 2KAIB 1UBEA 4Q4AB 2TGTA 2R3UA 4ISLA 1AMHA 1IQHA 3T5GA 1XTSA 1GI1A 2ONJA 2Q6DA 2PEYA 2V3OH 3QK1A 2FNAA 3FFGA 5A4JA 1DM4B 1KSFX 1XNJA 1FXYA 1DSTA 4HGCA 2WKRA 2NMVA 2GF0A 1ZHRA 3MH5A 1GBCA 4ABGA 4HAUA 5E2PA 3CRQA 5EE3A 3GCNA 1UEJA 1COWA 1SVWA 1E0JA 4EPXA 4DLUA 1S0QA 4TT3A 1O2RA 5H1YA 1X1SA 5A0AE 3KXIA 4BAMB 3UNSA 2ZCHP 3B1YA 5KSPA 2P8OB 1YPEH 1CJMA 3Q8XB 2WYJA 2IYVA 5IDVA 1S6HA 8GCHG 3LX5A 3IO5A 1ZRBA 1YLDA 2Z4RA 2XBYA 5DK1A 4N0DA 5HM9A 3BRWD 3GJ3A 4AYWA 3OHMA 1O2VA 3NXPA 1VGCB 4KP0A 3ZGXA 1V2KT 1D6JA 4XOIA 1GI2A 1OJLA 4BFZA 3PEYA 1QHXA 4YT7H 1TEVA 4WMDA 4IFBA 2VINA 1P73A 1CGHA 1O3GA 4CH2B 5F8XA 3OEHD 4Y0AA 2JJ2D 1Q1BA 3PUYA 4K46A 4B2BA 4BNRA 1PJPA 3PTBA 5HMAA 4KYUA 1P9WA 1UADA 1A5HA 4FXGH 2UZ3A 1JI0A 1WE2A 3GD7A 3MO6A 1DAFA 1Q3TA 4X1QU 4D9QA 5BXQC 2B9LA 3SQXA 3HPTB 2NG1A 3TQFA 1ZYOA 1ZNZA 2VH6A 3L2OB 4B47A 4PZLA 3CWQA 4PAMA 3ZVNA 2ULLA 5JHHB 2WJHA 3A85A 4JVLA 2ZHEH 1YZGA 4RJLA 1TBRH 1V2ST 5DO4H 4I8HA 1EFHA 3OFNA 3JZ1B 1FL9A 1A0JA 3WMFA 4QGAA 3L0OA 3LNCA 4L5BA 3PMAB 2WAYA 2Z3EA 3ZVEA 3GFOA 4IC6A 8LPRA 1ZM4A 4Q9JA 1O3KA 1DWBH 1C1OA 2I3BA 4TMVA 1NTPA 1KDQB 2ERXA 3M4YA 6Q21A 5JPMH 1NVUQ 3UQOA 2QQEA 1Z07A 3SU4A 3DT0H 2J4IA 4JLMA 1KI7A 4AI6A 1T4GA 4H1VA 1V2RT 4Q4HA 4MYCA 1GRQA 1GG2A 4D4MA 1C5NH 2DFTA 5TXGA 1U0HC 1EOJA 1GBDA 1FLEE 5FCKA 3BBPA 5JS7A 2QMHA 2ZRMA 3TJOA 3AV0B 4D26A 3MO9A 2ZSBA 1G2MA 4IXMA 4RCZA 5FBRB 4QGFA 4XBBA 4IEIA 1KTVA 1UHBB 3QXJA 5BW8A 4M9ZA 4Q5IA 1M2OB 2J9NA 2IF0A 3EIQA 4DY7B 2AN9A 3URCA 3P27A 3M7UA 1EP6A 4FD2A 5IHPA 1Y5UT 3SE0A 3CO5A 2J5XA 1BBRE 1O2TA 1GP2A 3TSZA 2BMJA 3P17H 1VJAU 1KYNA 3BH0A 1THRH 4KAXA 1F3OA 4EJSB 4JYCA 1NRRH 4PQYA 1F5KU 2DE9A 2FV8A 3TLOA 1QHGA 1D4PB 3TK1A 1K2I1 4ILEA 3TK9A 1YR7A 1ZM9A 2MMCA 3Q7PA 5J4QA 3LU9B 1JIRA 2QSYA 4ABIA 3GY4A 3N2EA 5L3SB 5ABWA 1DAEA 3HR8A 1OIXA 4IDQA 4LJ6A 5D3MB 1C9KA 1O2KA 4TL8A 2B7DH 2ZI3A 4AKHA 3FVQA 4ZO4A 1PYTC 1DAGA 3K0CC 1XPOA 4RD6A 4HI3A 5HCIA 2OCVB 1UF9A 4JLOA 3DHWC 3IGFA 3KEEA 2NZ8A 5CK4A 3MTYA 4DSNA 1O3PB 2AGEX 1JQJC 4GLYA 2FX6A 4C9BA 1GI8B 2QMUA 4JLBA 5EXXA 1YCPM 2WWHA 1ZUIA 2DCUA 2WJJA 1Y3AA 4Q18A 4FUGA 1E1QA 1GKIA 2ZHQH 3R9IA 3A7YA 1TX8A 1AQYA 1PQ5A 1R0YA 4WXIA 6GCHG 3RDPA 3VU9B 4LZ4B 1I2MA 3MU5A 5JYIA 2SGPE 5L2YH 4ZMAH 1KI3A 3C4JA 2GZDA 2FPKA 1D5CA 3A80A 2REBA 2BD7A 3MH6A 2G9NA 2VJ1A 4EJSC 1GCTB 2C95A 3FP7E 2W7UA 4PC1A 3W94A 2DFNA 3F9EA 1H9HE 2UUJB 3PLBA 4KFTA 1C2GA 5EP3A 3A87A 4YDHB 5K7RA 1VR1H 2VP5A 3ODDA 4M1KA 1CP2A 4P31A 3ADCA 3DOFA 3SNDA 2EEKA 3UG6A 5FUXA 3SU0A 2ZC9H 5C2ZA 2ZJOA 2BDIA 1P75A 3LW8A 1LFDB 1KTSB 2JLQA 2A7HA 1II9A 4JVSB 2CV3A 2J0UA 1XXDA 1O2YA 4AOQA 4YQFA 2FSHA 2FSFA 1XPUA 4P4SA 2ZYVX 4UKDA 2A5YB 3O8CA 1ZBDA 4UEHH 4DT1A 1Y3WA 1N0UA 4BFYA 2H16A 3B8JA 3NKKA 3RS0A 4DHEA 1CBWB 2XOKD 1DAKA 1Q20A 4HDCA 2J9RA 5TB5A 1GI4A 4YOIA 4IN1A 2N46A 4AIIA 1A4WH 3Q85A 1QVRA 1NVXQ 2W3IA 1PPGE 4QL3A 3KJGA 1V2NT 1YLCA 2ZE8A 1SKYE 2YOFA 3LVRE 2ODBA 2A31A 2C8XB 3KQCA 2AGIX 1LF5A 5L30H 4NYJQ 1JEEA 1EFRA 2VRWA 2AR7A 5JS8A 1BYIA 2GAAA 3V9PA 1D2MA 2WUBA 1AS0A 3LH1A 4DBLC 4NCJA 1YVDA 1DBSA 4AK9A 1IQMA 4K1EA 4WBSA 4G3XA 3ZVBA 5JRJA 2O8FA 5FXLA 4VGCB 1LVYA 1F7ZA 4FUFA 4ZKOU 2ALVA 4X6MA 1S8FA 2F3RA 3PV5A 3BG4B 5LPFA 4AD8A 1N8OC 4A6PA 3OTPA 1BDAA 4XSKU 1AKEA 1P9SA 3EQ0H 1X8JA 2CDNA 1UM8A 4NHOA 3Q3KA 3W3AA 2VWMA 3AF2A 1IQNA 1HRTH 1OLOA 2O8UA 1R6BX 3FHOA 4CEHB 3B9FH 4BFUA 2ODEA 2FZLA 4HLUA 4OGXA 3U60B 2ASUB 3GEIA 2XXLA 2FWWA 2Z9GA 2TIOA 4IVQA 2R44A 1HA3A 3GY7A 4Q7LA 3BE4A 1K5DA 1K1MA 3RNLA 5FUVA 1KO5A 4EPVA 1P2VA 1LTQA 5DO9A 3QOFA 3QBTA 4IVPA 1XZQA 2QN5T 1FV9A 1AUJA 2BM2A 1RIFA 1OHHA 1ZOMA 4E05H 4MPWA 4OK3A 1QQUA 3BJIC 1HURA 2ZE5A 4XIGS 2ZR9A 3UXMA 1MOZA 2FFQA 3NEJA 3AVXA 3E0PB 3W3ZB 5JFGA 2Z7FE 4RKJB 4NP6A 1BMFA 1GBMA 5GPIB 4MPXA 4KLZA 3U44B 2C8YB 4OI0A 3VU9A 1UVSH 2ZR7A 1ZJKA 3L82B 3WMGA 2BMGB 2FO9A 3KKOA 1CE5A 2IS2A 5DSZA 1DWCH 2P65A 4Z8XA 4JLJA 3A8BA 4GHTA 1A82A 5HYOA 1XTRA 1Y3YA 2BCGY 5BN4A 4B3FX 3H5CB 3LONA 3ZZCA 4OHYA 1O2XA 1O87A 3QF4A 4TWYA 1X8LA 2PTNA 1TGTA 1CJTC 1G6HA 2YWEA 1Y3XA 1KIMA 3LH5A 5AUNB 4A2QA 1A5GH 4WVPE 1A1RA 1KK1A 3A83A 1E2QA 2QPTA 2YINC 1QBOA 3RSOA 1R8SA 2REOA 2ZRNA 4MA4A 4YXWD 4KTSA 2EA3A 2ZTZA 1XTKA 1AK2A 4NZYA 3RS7A 3LJJA 1Q12A 2ZIQH 4G5GA 1O3FA 2ZECA 4HEJA 2F4LA 3H0KA 1TYNA 1SGFA 3W6NA 1RRCA 4Q7YA 3RXPA 1AFQC 3FKQA 1GMCF 5FL7D 1CLUA 2PH1A 1MKWH 2NTYC 1HJ8A 2OXCA 3SU3A 1XMIA 3MWJA 4QHSA 1Q31A 2A5KA 1UTJA 4GMXA 3PITA 1FONA 1VG1A 2Y80A 1ZCAA 2CHAC 4AY2A 1XMSA 4HAZA 1HAHH 3GCHC 4U30A 2QAGB 3DO6A 4Z6AH 4WVFA 1MO4A 2GESA 3SU1A 3T61A 4MDSA 3QXSA 1DY9A 3WY8A 1QCPA 3E2IA 2WWIA 3T27A 2MSEB 3CX8A 2FGKA 3EA0A 5KPDA 4BTUB 1QVAA 1RZ3A 2J92A 1ELOA 1P2JA 3IIMA 3U44A 3THOA 2EYUA 4LOAA 4PPGA 1XTIA 4FWIB 3F0TA 2JGNA 4TYNA 4NYIR 2HJGA 3HK6B 4GZLA 4XWKA 2ZREA 1DPFA 3KL6A 1G8FA 3TBKA 3TVDA 5EXNA 1N5KA 2ZJYA 4BTTB 3B1XA 3SS8A 1ESBA 2BDGA 3T35A 1C1YA 2ZI2H 4JKYA 3C27B 1JIMA 2H57A 1NY6A 3LQQA 2F43A 4D25A 3UTUH 2JLVA 2STBE 1J7KA 4BOHA 1TU4A 1Z8IB 5HCNA 4C0LA 3Q5EA 4AYYB 4KODA 1D9XA 2W6JD 3U2QA 2NU0E 3S7KB 4A36A 3LAWA 3DZ8A 4MG3A 4WOPA 4CHAC 5DG6A 3EWSA 1GBKA 3IPYA 3IWMA 3LJOA 1UTNA 1E9CA 1DOAA 2GMTB 5EE5B 2QM7A 3QO6A 1SVIA 1KXAA 3PMBB 2QROA 1E0SA 4F4OC 3PQCA 4JT4A 3CNOA 4TL9A 1DVRA 2C99A 1N6RA 4O0MA 1QB6A 2O8DB 2HNTC 1W0YH 1CR2A 2IYLD 2ZS9A 3RC5A 4ISHH 2EYQA 1JWTA 3OU0A 4MRNA 4LYJA 1F2TA 3U7FB 3AVYA 2W0MA 4EPYA 2MMGA 1HAYB 3AUXA 1OV4A 1U0JA 3EPJA 2ODWA 3MWLA 4MRVA 2HT6A 4QJ4A 4Y6DA 3BORA 4DCUA 4V03A 5H4IB 1DUEA 1UK2A 4Z54A 5JLJA 2C9YA 2NU3E 3W95A 1HDTH 1YC0A 1RGQA 1US8B 3A7XA 4DEXA 2LWIA 4M9FA 4KFRA 1O3BA 4XWOA 1S83A 4TQAA 5TMPA 2FZ4A 4I7YH 3RMNH 4AG6A 2ZDNA 1NL3A 1VYUA 1H9IE 1LVMA 3HPRA 4MRPA 2B21A 2UWPA 1Z7KA 1KNQA 4TT3D 2IS4A 4Q1FA 4A1TA 1NESE 5SZHB 4OM9A 3MNSA 4UNRA 2C8VA 1FIZA 1AIXH 4DSTA 4GOKA 1G3MA 4NPHA 3PCRB 1TALA 2BMDA 2A32A 3W90A 2BVNA 5SZIA 2GCTB 3DOEA 1XUKA 2ZJ8A 1ID5H 2P3FH 5GCHF 3CB4A 1E2DA 2GEVA 1OS8A 4QXAA 2IEYA 4LUCA 2WV4A 4QM6A 2WIBA 3PEUA 3MU1A 1PQ8A 4N3NA 3U6BA 4BLRA 4ACBA 3QKSB 1O5BB 5JB8S 2EFGA 4JT2A 2YKGA 3SHAH 5K8IA 1SB1H 4YMVA 1TPZA 4GP6A 5JEEA 4RZUA 4U5XA 4X0WU 2A1DB 4P33A 3LFUA 3NCLA 1GSIA 1GMDG 1D3QB 2YV5A 2VLIA 4CF7A 4ZPXA 5AJZA 2C93B 1VZQH 2C2HA 5HPYB 1AZSC 1E9FA 2QXHA 1SLXB 4YC7A 1NZQH 3MMPA 2J0VA 3NTUA 4R98A 2Z9LA 5CM9C 3BEUA 2HV8A 4EFNA 3JVVA 2I1QA 3AKEA 1IAUA 3ZQ6A 1P9NA 3P95A 1ZLRA 1QZXA 3NVAA 3TW4A 2FSGA 1CT4E 1TOCB 2ZZUH 4HDQB 1TA6A 1YPMH 4DURA 1ETTH 2G88A 1EATA 1YZNA 5E95A 4CW7A 3RLFA 1N2CE 1FN8A 2BBSA 3LGUA 2PX0A 1HUQA 1HH4A 1HAIH 3RM0H 1KOFA 2AKYA 2GV6A 3EAQA 1KJYA 3WY9A 1V2TT 4FUBA 5LD2B 1N8OB 3I5XA 4TYYA 4Q47A 2HOBA 3DFJA 5CIWA 1V5WA 1T0HB 5B58C 4JZKA 3ZZ0A 1UTMA 1C5WB 2OO7A 3RABA 3KQHA 1Q0UA 1S85A 5KTYA 5J4VA 4HLUC 1E94E 1FPMA 1IY1A 4LC1A 2CVHA 3SUEA 1FTSA 1YQTA 1XD2B 1MRSA 5FBWB 4LHWA 2C98A 2XW9A 4GOJA 3D49H 4JLNA 4MGYR 2WJIA 4K69A 1X8KA 3L0IB 3FP8E 2OE2A 3DUXH 2H5EA 5TJXA 1GHVH 2BEKA 4BUJA 2MSDB 2AXNA 1HTWA 1R5OA 3RXLA 1B0FA 2ZF0H 1UDWA 5C4MA 1NRNH 2P67A 2BM1A 4YT6H 2ZI5A 3VR4A 3F6UH 4ABAA 1HE1C 3FANA 1NU9A 3T5FH 1AKSA 1LVOA 5EPNA 3N7OA 1M7BA 2GAOA 4DKXA 1MQ5A 2P93A 1P01A 2B0FA 3OYPA 1ZRKA 1AGPA 1KDOA 4WF8A 1SKQA 1N6KA 4B71A 3RS5A 2ZU5A 1D6RA 1E9BA 3FHCB 2V7QA 3SJCA 3ZZTA 2WIAA 3BIUH 5JBTA 3VR5A 1LMWB 1BA8B 2THFB 2SGQE 4C0QC 3NDPA 1LPZB 3MJRA 4OI2A 3RXFA 3EPHA 4JYBA 2ERYA 4MITA 1RFNA 3M5LA 2YOLA 1AU8A 3I1FA 1S3SA 1F0UA 1ELEE 2ZJ5A 1VHLA 2ZI6A 1BTZA 3MMGA 3BWDD 1XMJA 3V12A 1BHXB 4TSFD 1T8NA 3ZVRA 1DG3A 5B64A 1GHAG 4C3ZA 1FX0A 1P9UA 2NU1E 4Q7ZA 4WAUA 5FR2A 1MKWK 5FTMA 4CBNA 4EFLA 4YESB 1NY5A 2G77B 3D8BA 4ABHA 3TIFA 2KBFA 1P3EA 1H8DH 2O9QA 1C2EA 3B7GA 3GDSA 1II8B 4FINA 3RHFA 4BE7B 3URDA 3BH7A 1THSH 4NYMR 3F9HA 1AN1E 2W26A 1EX6A 2H5DA 4JZIA 4AZ2B 2GT8A 1YR6A 4BXSA 5KPJA 2G5NA 1MTWA 1J8AA 2SHKA 3O8BA 3LWNA 4I81A 1ZAKA 4CH8B 4Y8ZA 1TX6A 1L2TA 5CLQA 5GADl 2R6GA 2QC2A 2PZFA 1UTLM 5DYGA 2H1LA 3MU0A 1KSHA 1EX3A 1MTNC 2FOMB 4R2HA 4C30A 5JI3E 1BRBE 1RJXB 4ZIRB 2PGQB 4OJQA 1S5SA 1ELTA 2GXUA 2K1QA 2G8TA 1MO5A 4E7RG 1CTQA 1OH7A 4GSOA 4PC2A 3UWJH 2HNTF 4HUTA 3WNCA 4ZDIA 2IN2A 1ZNXA 1ZTJA 5FTLA 2JLUA 1W4CA 3VR6A 1C5RA 2HRVA 1T4UH 4IW4E 2CHGA 3G82C 2EFCB 2C8ZB 4LYAA 2JJ8A 2VEDA 1TE0A 1E9AA 4FUJA 5EQQA 5F2EA 5J4SA 3FGNA 4NMMA 1UK3A 4LK2A 1OXSC 5BQ5A 4UNQA 5F8ZA 3MOCA 1TAWA 4M0LA 2XTZA 3CPJB 1GDQA 4ARZA 1T8UA 4AFSA 1ZUNB 2QIQA 3KTAA 4OS6A 3RXHA 1K1JA 1J9CH 1GZSA 2J59A 3Q72A 1WBDA 4Q21A 3R3GB 2BY9X 2D06A 2WJGA 1V3XA 4BLOA 1HPGA 3EA5A 3HPQA 4ZKNU 3IDQA 4CEJB 1II8A 1B5GH 4ZCMA 1C2KA 3VGCB 1ELVA 1IXZA 3S7HB 1GL1A 2E1RA 3CX6A 3U4QB 3VR2A 4XBDA 3SU6A 3DVLA 3OE7D 5FUWA 3QPWA 4K2YA 4V0KA 3KKQA 4KVAA 3OE7A 4GI7A 2WWXA 4MQBA 2J1LA 2PKSB 3L3TA 4L8GA 1FFHA 3A37A 4Y7AA 1C4U2 2ZI7A 2GXAA 2CXVA 2EI6A 1IN8A 1NRQH 1O2LA 1G291 4KKDA 3TVJB 4MH0R 2Z5FA 1AY6H 3ODFA 5AFYH 4F91B 2ZAMA 1ZTLA 4O03A 3RXVA 1OYWA 3V13A 4F92B 5KNCA 5C1BA 1D2NA 4LJ5A 3U5ZB 3AVUA 2AH4X 3D7MA 5DP7A 5C1YA 2XBVA 2ZJAA 3LGWA 3RVBA 1T91A 1E9EA 4B48A 5T6FA 2PGBB 1I4TD 5D3QA 2AX4A 1DANH 3K0SA 4DC9A 2WSSD 3K65B 2PBRA 4THNH 2XTNA 1S84A 3T2NA 1NY22 3FMPB 1NVWQ 1AM4D 2C5LA 1AQUA 4G5RA 1MUEB 5EP2A 5A0CA 3A8TA 1MQ6A 1EASA 4PR0A 1FI8A 1Z6XA 1GI5A 1NBMD 3M36A 5KSOA 2ANKH 3RRMA 2XSZA 3PTNA 5TV2A 1GL9B 1QHHA 1YP9A 4W5HA 3LBNA 2XSZD 5KSZA 2OV2A 2ODPA 5FR1A 2J7PD 4TYQA 5AF9H 4WMEA 4I1UA 4IC5A 4DUGD 1CKEA 1EZSC 1JR3A 2V1UA 4JBWA 4TTPA 3SUFA 5HM2A 2RGDA 1ZD1A 3ECCA 3UKDA 4JLPA 1THPB 1DPOA 2OHFA 4TPYA 4ABEA 3A1UA 1H1BA 3D6TB 1P2QA 4GT1A 2IXFA 1C2MA 1UHBA 1AE5A 3QF4B 3AW0A 4TYDA 1M7HA 1ZIPA 2OFWA 3VXFH 1GOTA 5HGGA 3I29A 4NZLA 1SVPA 3NBXX 1N6HA 2D4HA 1XCPA 3EDXB 3GLFB 1G36A 1S1MA 1W13U 3IIKA 2KWIA 2DR3A 1ESMA 4MKIA 1WF3A 4URZR 1WCZA 3E0NB 4RI0A 3AK5A 2OT3B 3MNXA 1GNQA 4Q4JA 3U8RH 1JBKA 1V2UT 4MUBA 3BGWA 1GJ8B 3ICQB 1VCOA 3K70D 2J45A 3CRMA 1ZSJA 1EUFA 4D4LA 1KYIA 3KUDA 2VIOA 2XJ4A 4YMWA 4HZUB 1XXHA 2VSXA 4LJ7A 3MU4A 2WVJA 4NE2A 4VGCC 2QN6A 1DAHA 3ESTA 1SXJD 2AMPA 3B9PA 4U01A 1ONBA 3AGPA 1ELBA 3EZ9A 1L4ZA 1GTVA 1EAXA 2DFKB 4ZCLA 2GWHA 1F2UA 2WWWA 2SGAA 1YU9A 1VPLA 5K8TA 3AP1A 2C9OA 1NFXA 3RYTC 4TZ6A 4A7IB 2VP0A 1PJRA 5F9FA 2BQWB 3MCAA 5GXPA 5T1VA 5HR5A 2R9VA 1XF9A 1CEEA 1CQQA 5FOTA 2VF7A 2V9PA 1EFUA 3DL0A 3ICEA 2R0LA 1E79A 2VHQA 1LQEA 1K5GA 1Q3HA 1CF4A 3BN9A 3RXSA 3RXRA 1Z6JH 4OK5A 3GY5A 2WTUA 2F83A 2OC8A 2AIQA 621PA 3RXIA 3BTWE 4X6OA 2HPQH 1HT2E 1HNEE 5GCHG 3NDBB 4KELA 4OQLA 4OJKA 3K8YA 5JDUB 3V0XA 2W2TA 4EPRA 1BMFD 3MRSA 4ZKEA 5EW1H 2ZFPH 1FNMA 1S0UA 1LV7A 2QV1A 3SJAA 1GHBG 5C5NA 1VJ9U 1YPKH 2Q9BA 4YM9A 2NO6A 3BC1A 3G01A 2ZI4A 2G0NA 5KDOA 3KJHA 4OS5A 3FFAA 2AKAB 4WWYA 2QI9C 3BV9B 1FNNA 4CRDA 1ZMNA 2UVQA 4AURA 4Q4LA 4D0LB 3N5CA 4R2IA 1A0HB 2IYQA 1YZTA 1HXEH 1KLJH 2RAPA 2YVUA 1GNPA 5HE9A 3KZ1E 4QBHA 4KHZA 2ZTSA 3SZNA 4IRUB 2JJ1D 3TE6A 2FMJA 1TRNA 5GDSH 2QAGC 5JEDA 4JSYA 1BTYA 2XEXA 1P12E 4CEHA 2O0JA 2AIPA 4I8GA 3PV2A 1YZUA 3SNHA 1C2FA 3ADBA 4JVNA 3NC0C 3TITA 1AGJA 3THYA 1SVLA 2FPLA 2P5TB 1KKLA 2QEQA 4LV8B 2WMOB 4OI4A 1ZVQA 3UMRA 3MI4A 3RXAA 1CU1A 4AYXA 5KU1A 5EU8A 2J7KA 5B30A 2Z43A 2ZJBA 2IK8A 1U8ZA 1CULC 4DIEA 2F1JA 1UPTA 2GZ8A 2QE7A 3SGAE 5AHGH 2WICA 2BCJQ 2FE4A 4BFSA 2PL3A 2O0KA 2Q3FA 4G5SA 2VHUA 2AXPA 3KQKA 1GI6A 2ANBA 3LPRA 1RYHA 1KIGH 1OF1A 2O0HA 2YNBA 1U99A 1DWEH 2F9NA 1W4RA 2P0EA 1E99A 1TGNA 4NDZA 4IMQA 1IN5A 2J0UB 1OIWA 1R0WA 3PJRA 2DE8A 2OBNA 1OP2A 3SZEA 3TU7H 4TN1A 3GDVA 2KJQA 4ESVA 4PPFA 1SXJE 5EG4A 2H8KA 2F1RA 2CJIA 1Q57A 2GK6A 1QF9A 2OAQ1 1RRPA 4URWR 1XMNB 1JAIA 4Z1MD 3GCTF 5L3VA 4YTAA 3ELAH 2OCAA 2RDLA 3ZH9B 2ZS8A 1GBEA 2AK2A 2HNTE 4BAKB 2IBMA 121PA 2P59A 3JZ2B 1ZIOA 3RC6A 1P9RA 1UO6A 2VO1A 1A2CH 1IQIA 4PANA 1G3DA 2IWHA 4HLQB 3VQTA 4E7NA 4YLGA 1G5RA 3GJ5A 4D76A 4W9MC 3ZJYA 5FUYA 2D2DA 2R65A 1TAGA 2HWLB 3EZ7A 1KMHA 3QKRA 3B82A 2XNDD 1KXFA 5FX6A 2VL7A 2EI7A 2PLXA 1GCDA 2XNDA 3QG5A 3UATA 4OHWA 2F3CE 5DPAA 3U9AH 1O3LA 4W5JA 1BRCE 3A8DA 3HYTA 1UCYE 2ZPQA 3BIFA 4LCBA 1Z3IX 5L2ZH 3GJ4A 3M3SA 4S35A 4GRAA 2OC7A 3THXB 4PFSA 2X77A 1FDPA 3MFJA 4Q00A 2BDBA 1GFIA 2BIFA 1SVOA 4CVNA 3Q77A 2QG6A 1EPTB 4PO8A 3WRXC 1GVNB 1NRSH 2IYTA 4AORA 1WQVH 4Q19A 2OQ5A 4MRSA 1W46A 1LPGB 1ZTKA 1SXJB 3UNRA 1Z6TA 2ECKA 1VCIA 1GGDB 1C1TA 1LCYA 2I6QA 4TL7A 1OW3B 1E9DA 3D31A 5L3SA 3MWYW 4X2VA 1VGCC 2ZRJA 3ZD6A 6CHAC 3M37A 2BVRH 3S0NA 1NC6A 2V8OA 2WV9A 3JVUA 3MSXA 1YZKA 3AAUA 3EA9A 4X8LA 1HAPH 3KB1A 4C0HA 2QAAA 1GBHA 2V35A 4I1VA 1SGYE 3ZD7A 3IIJA 3PUWA 1EJMA 5A8ZA 1XUIA 3K70B 4HB4A 2J46A 3EXAA 2F1IA 3C8UA 1NI3A 1CHOG 3ZYCA 3IUYA 1QURH 2NO7A 2M5TA 1O36A 1E2NA 1XBTA 1XJQA 1OE0A 4LJ9A 3VPKA 2BDTA 4KITB 4CT4B 3PEVA 2RGGA 2V4ZA 2N42A 1XKAC 4M53A 1OH6A 2RGCA 2CHAB 1PYTD 1C5PA 3TSOA 2C78A 7GCHG 3ZVGA 1NIJA 1E0AA 2GVFA 3F8TA 3S9CA 2D74A 5E8EH 2D2EA 3F1SB 4R8TB 3W9YA 2OAP1 1VG8A 2CLCX 1MKXH 2ZHFH 5JWHA 1LQDB 1FTNA 1NN0A 2SFAA 1R4AA 4TLCA 1O30A 1JPJA 1NN6A 2CNWD 1U98A 1ZYUA 1L4DA 2V6IA 2F9PA 3AASA 5HKKD 1SQAA 3HU1A 1OP0A 1O39A 4GAWA 1DADA 4QNMA 3RXOA 2FS8A 4TQUS 2D7DA 4LV5B 3H4MA 3RXJA 2ZSEA 4EPTA 4TZ0A 1UFQA 4M21A 1NKTA 3NWJA 1C1UH 3C41J 3FVFB 3VR3A 5CHAC 1SOZA 1ZGIA 3RXUA 1W11U 2C8WB 5F8TA 3QGNB 1S9HA 1YZQA 5AK0A 3CF0A 3UPEA 4FVBA 3ZIAA 2ONKA 4PAQA 4RZXA 4Q9HA 4RFVA 3OZXA 1NG9A 3GQBA 4JZEH 3SJKA 3S9AA 2OFXA 4UXHA 5LB4A 5FOSA 4DVAU 3OESA 4GCHF 1O35A 3TAUA 1ZM3A 3R7WB 5JBBS 4AGKA 1Y3VA 1KI8A 5T6DA 4NL4H 2XWAA 1ZD9A 1TA2A 5EXSA 2A30A 2IT1A 2WJVA 4E07A 5ELXA 5CB8A 5F9HA 2TGDA 2OD3B 1ZM2A 3U3RA 2IW3A 2DWPA 2PJZA 3TJUA 4BZPA 4U32A 2WKPA 3RP2A 5CHAB 2R6DA 1O3AA 4NIWA 2H9EH 2ZRKA 1LY1A 3GLHA 4ZHLU 4ZI2A 4PHGA 1XCMA 4K1TA 3DHKH 1GVLA 1XPRA 1AZ8A 5KNBA 3MAAC 6CHAB 4NG9H 1ESTA 3IQXA 2EW1A 2H9TH 2O8EA 4OKSA 4KFUA 4QC2A 5IK2D 2R2MB 2WHXA 2CLDX 3UG7A 2VTKA 1T32A 3P26A 1O3CA 1NPMA 4Z0KA 1UVOA 3T28A 2F9LA 4PQRA 2GF9A 1IN6A 1ZGVA 2BVXH 4JMYA 4SGAE 1OXUA 2B5TB 3GEEA 3E3TA 4AG5A 3A58B 3QEOA 3GLFE 4PZZA 1MCTA 1OHHD 3EYDA 5B57C 5FL7A 3BG8A 1L8QA 4OL0A 3K9GA 3KQNA 1MZDA 2ZE7A 3HYRA 3ZV9A 1Z83A 2RGEA 1P10A 1Z63A 1TNJA 1SOTA 4MVNA 2G81E 4GMDA 2PTCE 2VGCB 3IEVA 2RCEA 1TRYA 1TU3A 3VKGA 3MWIU 2ZXUA 1Z29A 3W5JA 5B2ZA 1OX1A 1QDEA 1NN5A 2JH6D 3RMLH 5BYKA 3K70C 1DWDH 3S69A 3A4NA 2CF9H 3VNVA 4MNVA 3KUCA 2ZGCA 3OEEA 3ZLJA 1P2MA 2V3CC 4DLWA 2ZETA 3GY3A 2QP9X 3IBGA 1C5ZB 2OZEA 2HUPA 3A8CA 2IPHA 3EA7A 4ZCIA 4LXBH 3TNTA 3WHLA 2W2VA 1GL0E 1TPAE 3GCOA 1C2LA 1H4WA 2BBOA 3PMHB 3SNBA 2WPLS 2CHVA 3W6OA 4MGIR 1NSTA 2C04A 3Q9LA 4I4LA 2QORA 2DYKA 3EC1A 2OXSA 3NHAA 1OYQA 4TLBA 4TTQA 2WUCA 1BZXE 1BIOA 5B6LA 2GK7A 3RRZA 1J99A 5EGMA 3M7TA 1SULA 3LLMA 1KK3A 4G1UC 1UCYK 4URXR 3QF7A 4K81B 1WSSH 1VG0B 3V4RA 5IF9A 2ZEJA 4B1TA 2CEAA 1W14U 1MMJN 5EP1A 3S9BA 1QG2A 1O32A 1IN7A 3RWMB 2A9KA 1CO7E 1I4LD 5C4GB 3CPHA 2QP3A 3IKJA 3LV8A 1HJAC 5FX5A 4NA9H 4QHTA 2ZRFA 5JBCS 2XC0A 1R7RA 2DFLA 3NG1A 3PLPA 1HT1E 1BOQA 4TWZA 4B2IA 2RG3A 4NA7A 1HQCA 2CN0H 4GL2A 3H86A 4DT7B 2JA1A 1O5GH 2AFHE 2K5UA 3VFDA 3TSWA 1GBLA 4P4TA 2J95A 3RXTA 3ADDA 5EOKA 1DO0A 5TARA 1GJDB 1YGCH 2FWRA 4WMFA 3I32A 2IYYA 3M5NA 4NYIQ 3AVTA 3TNSA 3IBYA 2NWNA 1QY6A 2ZS7A 1NO9H 2ZQ2A 1RTLA 4GCHG 3WHKA 2O8CA 5G4BA 4IBLH 1BTWA 3CKLA 4I8LA 4K8BA 4FMDB 1QIXB 4MDFA 4CRFA 4Q9IA 1Z1JA 3GY2A 2GCTC 2Y5HA 3LDXH 3SEAA 1TLDA 3AW1A 1V2WT 5FTNA 1IQFA 2HEIA 4US1R 2FSIA 1EZQA 1LHGH 4MNXA 1BQYA 2ZSFA 1GJ6A 1Y8TA 1YPGH 4NIXA 2H92A 4ZV4A 1GJ5H 2GKSA 4PQFA 1FZZA 1A7SA 2CLSA 3KTAB 5IDKA 3IO3A 4X8HA 2A7CA 5J4LA 2BDCA 1JR3D 4F38A 3T06B 1U8YA 2ZSAA 2FX3A 1UTOA 2SGFE 3QLPH 2PUQH 2W58A 4CHAB 1DXWA 2Y5GA 1BKDR 4NYMQ 1HLTH 1SGFG 4DCNA 1A0LA 4D81A 1SGRE 1KDPA 1O2UA 3Q76A 4A1FA 3THYB 4Q1EA 1JECA 1YCPH 1XEWY 1KI9A 1PLKA 1M1YE 3B5JA 4INKA 1W12U 2DWOA 1ELAA 4EUNA 2ZYWX 3TJZA 2VSFA 1GJBB 1O2JA 5JCPA 3W5IA 1DLKB 4B3DA 3AF4A 5KYKA 1UTPA 3K6YA 2ZRIA 3UREA 2IOTA 3O8DA 2GMTC 1GJ4H 2HT1A 1ZHPA 3NUMA 821PA 1RPZA 4DDVA 1XEXB 2B92A 1LF0A 2GJKA 1F60A 3L6PA 1P57B 1VMAA 3ZDQA 2JLYA 1GRRA 5ESTE 3CNLA 1F2SE 1E38B 4A1XA 4L15A 1WV7H 4DDWA 4F93B 3VHLB 3MH4A 1W0KA 2G4UA 1CHGA 1M6NA 4DB2A 1WAYB 2GXSA 2JH5D 2NU4E 1IQGA 1OXXK 1GWNA 2CK3D 3REGA 1IBRA 1J14A 4H6TA 4Q4JB 5JSZB 2W6JA 1NU7B 4M9XA 4X8TH 1SSXA 2PR3A 1N0WA 2OBOA 3AVQA 4A82A 3ZYEA 4MGZR 1SI5H 1EJAA 2A5FA 1QRXA 4C4PA 3J81k 3QENA 2NU2E 2Z9KA 4TYPA 1S1CA 1XXHB 5GWZA 3Q7QA 3V4FA 3V00A 3B78A 2Z3DA 4TY7A 3UQVA 1SHYA 1S4QA 3ZZ8A 4D0GA 2E9SA 3F3YA 3KQLA 1HCGA 3B8HA 4A0HA 1TMUH 3WYFA 4U00A 1KXEA 3A7WA 1NJFA 3CLVA 1FQ3A 4B3XA 1L1JA 1VITF 4CZ2A 2XB2A 5H68A 3VMFA 2ZU6A 1XVMA 4NWLA 3BFKA 4NZQA 1OFHA 1CJUC 2GCHG 3RLYH 4IMZA 1IONA 3SNAA 3A7VA 1P2TA 1K22H 2XNSA 1WTHD 4C0AC 1T8MA 1BS1A 4LC0A 3SJ9A 3A36A 1AN0A 2P95A 1NMYA 2PV9B 2ATXA 3X1YA 1P72A 1S81A 3PM3A 2H7VA 3U3KA 3SHWA 1Z47A 8ESTE 2XC5A 1HAOH 1ABJH 2BOVA 4FVDA 2ZROA 2ZPSA 4ISIH 4NYJR 5EW2H 3SYJA 4EKDA 2A3RA 1KXCA 1UKEA 3VKWA 3A81A 4BZQA 4II7A 4ACAA 1UBFA 4LYHA 5EXPA 1EAUA 1QHYA 1SLWB 4H1UA 2Y7XA 2NO9A 1GDUA 2WSMA 1AZZA 2A4QA 1HIAB 3LW7A 4YZUA 3KQUA 4B75A 3QKSA 1ZD8A 2A5GA 3QUMP 4CRAA 4I32A 2O8TA 3EAJA 2FPMA 2Z3CA 3QI2A 2RB4A 2VH5R 3T1TA 3ZZ5A 5G40A 3HDTA 2V55B 2ZJ2A 3OIUA 4YMTA 3L0PA 1MTSA 5DISB 3T29A 3QDZB 2QXGA 1ODFA 1BMLA 1OWHA 4F7WA 2Z9JA 5L3RA 2B7CA 1Z8GA 4WJG2 4W7SA 3E90B 1SFIA 4OHXA 5FHTA 5FFMA 3SZRA 3CR8A 4C2UA 1W49A 3MD0A 1P2OA 2VP9A 1BMNH 4AX9H 2I1VB 2RGNC 1XD2A 5EZ5A 3A89A 2UUYA 3PO1B 1P2UA 4ITRC 1L4YA 3ZZ9A 4UFDH 4IEEA 5E7JA 1W2KH 1HGTH 1X86B 4DIHH 4O2LA 3LRPA 1E98A 4R7ZA 2Y81A 4M8NE 5J47A 3B9QA 1EWQA 5EODA 2ZRDA 1JMOH 4MUAA 1DVAH 4TMKA 3SFZA 2YNMA 1P3CA 1WU1A 1JPNA 4TQ9A 1G7SA 4DB4A 1DITH 1CIPA 1LVGA 1IQPA 5FOVA 1D3DB 3BXZA 2FI4E 3F5FA 5HZKA 3PVSA 4PPQA 2BLOA 3ZIAD 2GCOA 1K6MA 3A4MA 4RSPA 4RN6A 1G9XA 3NBFA 3PENA 2VP4A 1NNEA 3M1IA 4ZHAA 5FAHA 2XXAB 2O8EB 1P09A 2A5JA 2ZGHA 3GICB 2B8WA 5DI9A 3TUZC 4O97A 4EAQA 5EE0A 1PPZA 2QE7D 3KKMA 1KJWA 3O8RA 2CJWB 1QHRB 1WQSA 4WH6A 4Q1BA 1QG4A 3CP7A 4B2CA 2YC2C 2HVXA 3GPLA 4V0LA 5DYIA 4MPUA 1HIAA 2QENA 3B6EA 2ZRPA 1TGBA 4A5TS 1K28D 1R2QA 1GKYA 1Q21A 3I8XA 4JLVA 2FX4A 3GCGA 1ORFA 3OY6U 1F5NA 1QJ7B 4O3UA 1YRAA 2LKCA 5KSYA 5GIBA 2JDID 5FPSA 2AWNA 2GETA 2CVFA 2D7CA 1DS2E 2FOHA 5JECA 2XBXA 2BY6X 5HKKA 5G41A 1FPHH 1J2JA 3DKVA 4BLSA 4GHQA 4D9RA 3I78A 3GY8A 1IHSH 2YWGA 1N6PA 1V2LT 1OWJA 1SVMA 1GM5A 1GHAF 1N5IA 4B74A 2F43B 3HR7A 3RRNA 3ZVDA 3ZS8A 2KBEA 1C2HA 1DFPA 3B13B 3UR6A 1KHTA 1ZINA 2XOKA 4DCVA 1D6WA 3ZZ7A 1GHXH 3QTVH 1NIPA 3FAOA 1XP8A 2F1HA 1YRBA 5L3QB 1C5YB 3OF5A 2ZHWH 3T5DA 1WA5A 4LZZA 4EQ6B 1FY8E 2OBLA 2G51A 3SU8A 3SU2A 4X8OA 1K1OA 5CJPA 2FS9A 3SI7A 3SJ8A 5AR1A 4JKIA 5E0HA 4H6SB 1E2KA 1O2PA 3X2SA 2WV5A 3LLUA 7GCHF 3SV6A 4X8MA 1IOZA 2BLWA 4IVRA 4Q7KA 1DTSA 3QJYA 4QBIA 3M3VA 4B44A 1O5AB 4JLKA 3OEED 1QA0A 4XVUA 1G4UR 3SYLA 3ASZA 2WPDD 1O3YA 2ZU4A 5JCZA 4QNRA 1CSOE 1UMAH 1ESNA 2CXXA 2X2FA 2GTPA 4LRWA 1DICA 2JAQA 1NJGA 1G3CA 2BOKA 4XVRA 2ZI9A 3HU3A 4Q80A 1T3SA 1EB2A 1QHNA 3RS3A 3U6KA 4FW9A 4QKQA 3UIRA 1B0EA 1C2JA 1P06A 1BHXF 1SBWA 1TPSA 2C9CA 5JWRA 1O34A 1GI9B 1C5LH 3M6AA 5A5GA 2OK5A 2ZGBH 1GJ7B 2ODYB 4N1AA 1AWFH 4TMTA 2FI3E 3SO3A 4DLZA 3P8GA 1H9LB 4Q7XA 1GBJA 3BB3A 221PA 1QBKC 3PFIA 4Q2KA 1FY3A 1TNDA 2QA5A 4BLTA 2FEOA 1Z5ZA 2CBZA 2AD5A 2AYWA 4UONA 4D7GA 4LPSA 3QKRB 2YC4C 4BAQB 1G37A 4JZFH 1XD8A 5BN3A 3H2YA 1C1PA 4UDWH 3NXSA 3C16C 1DELA 3VB6A 1Z8FA 1J8MF 1BUIA 2BY5X 3TMKA 1K21H 1P2IA 2FLRH 4E09A 1VG9B 2EFHB 1YHNA 3T1OA 1MO6A 3KKNA 2DWQA 1KSJA 2R3YA 1ZNYA 1AHTH 3B60A 4HB2A 3AF3A 3TH2H 1OWKA 2FA9A 4IDOA 1PV4A 2ALPA 5F98A 2Q3HA 1PPBH 1QL7A 3SJBA 5C1UA 4O3MA 2WZQA 3X1WA 1TQ2A 2OESA 3FOZA 2V6NA 5JMTA 1SXJC 1UCYH 4HZUA 5DP9A 3L43A 3AVVA 2W3KA 3RXEA 1QTFA 4BAHB 4PXAA 3SHFA 3QVUA 4RVCA 4PHFA 1OKKA 1KZGB 3PG5A 1E4VA 4FMDF 4C7OA 4DGJA 1OKKD 1WXRA 3L8YA 2ILNA 4Q66C 2P6UA 2OFOA 1G3RA 2PT7A 3CRW1 2GTBA 2FFHA 4UXIA 1HAVA 3SU5A 1MTNB 3F9GA 2F9MA 1PFXC 1UJ1A 2VWLA 3NHBA 2BWJA 1GIAA 1U94A 1GL6A 3QEJA 1HEIA 1N1LA 2C77A 4MYTA 4JL5A 4AB9A 4HB3A 3EZ6A 2P2LA 5CB6A 3A8AA 5K8UA 2EU8A 1P2SA 2ZANA 1C5UA 2FDAA 3CM0A 3LC3A 4FI3C 4QOSA 3RUOA 2AK3A 3WNBA 1DAMA 3P6ZB 3B1WA 2ODQA 5M04A 5JBAS 3VEQB 3FZZA 3SGQE 5A0FA 4GP7A 3CRVA 2Q21A 3A4LA 4SGBE 3PV4A 1EAIA 4XE4A 3SN6A 3ZVFA 3P70B 2YYZA 3WXMA 3NWUA 1SZPA 1Z71A 4F4CA 3RM2H 1JXMA 2GZHA 1TMBH 2XXAA 3D65E 4JJZA 5EJEA 4DOQA 1P61B 2GJAA 1XKBC 2G83A 2Y8EA 4P4SB 4UQOA 1Q1ZA 4XDEA 1ZHMA 3RC3A 521PA 4DCSA 2HCBA 2PEZA 3LD9A 4EDHA 5T6GA 4TMWA 4RKFA 1QRAA 4V0ME 2J7PA 2LNCA 2GXQA 4DUGA 3PIRA 1VITH 2HJVA 2FGJA 2ZWLH 1Z6GA 3TGKE 4IXNA 2PZGA 1B23P 4MGKR 3HATH 2Q9CA 5JRZA 5GJBA 4B6FA 3ATMA 1A2BA 2R6FA 1W7AA 1HV8A 2OCYC 1QJ6B 3DMDA 3H7TA 3MNBA 3FDIA 1T3LA 2ZRHA 4DLSA 2HGTH 4J2YB 1QRZA 4NCIA 1ELGA 4BXWA 1U0LA 4C2TA 2GCOB 3PROA 4ESTE 3RC4A 1HAVB 1A5TA 1WQ1R 3RU4E 5FPKA 1IQLA 2YWHA 1A46H 3TJVA 1VITG 3SFVA 2G5VA 1IXSB 1LO6A 3UMFA 3T62A 1ZCBA 4QG7A 2ZQ1A 2VWNA 1D2EA 5DHAA 1KTTB 1YCPK 5F6MA 1BT7A 1GBTA 1LDTT 5DN6D 1E2GA 3RRYA 3TH4H 3GLHE 3H09A 4NSVA 4HYYA 1OH5A 1I4DD 4LPKA 5E0GA 1P3JA 1H8EA 2XB4A 3M5MA 4X6NA 1X7AC 4MYUA 3T15A 2BJVA 1KDQA 6ESTA 1CGIE 2D62A 1TX7A 1HAXB 4TL6A 3SJIA 1E79D 3CWZA 3HKIB 1OFUX 1EPTC 2GP9B 2BHGA 5AJXA 1LS1A 4YMSA 4JK5A 2OUKA 1E9SA 2QGZA 1A2KC 3I73A 5CM8B 4JIMA 1YPJH 2O8BB 3QY0A 5EUQB 5CE1A 1VCWA 3JZMA 1N25A 1TONA 3R7WA 2P6RA 1KKMA 2XJ9A 3LA6A 2ZFTA 1UBCA 3A6PC 4M22A 1QB1A 4LI0A 2FN4A 3LGIA 2IL1A 4INLA 1C1QA 4ZXYH 4DLVA 1O2WA 3TGIE 2GD4B 1ZMLA 1BMMH 2ZNKH 4AYVB 1DXPA 2PJRA 5AFZH 5A0BA 1N6XA 2F55A 2QCYA 3ND9A 4EQ6A 5EPYA 2AFQB 1KK0A 1PZNA 2AFIE 4RZ2A 2G1KA 3E5HA 1QJ1B 3SNCA 2XGJA 4A92A 1XZPA 2CE7A 2ZEBA 4LHYA 3SBDA 2P8OC 4JYVH 2OBQA 4CRCA 3GLHB 1VCPA 3NBYC 5FI0B 2R2WU 3F68H 2PMDA 2CK3A 2QF3A 4P0TA 2ZUDA 1GVKB 2FF7A 2IC5A 2Z6VA 2FG5A 1O3NA 2BKEA 5DP8A 2WMNB 4EJSA 1Y5BT 3P8FA 5J4KA 3AH8A 4TPIZ 1G30B 1XUJA 2WWFA 1QR3E 1RS0A 2GKVE 4M2LA 1JOUB 1SGWA 2OC0A 2JLZA 2R2AA 2VYFA 4ZUHA 5DH9A 1W8BH 4M9QA 1Z8RA 1Z0DA 3STJA 2QY9A 3X1ZA 1XD9A 5BRRE 5LB2A 3TGPA 4HI0E 1VHTA 4JL8A 1ARBA 3SW2B 2ZSDA 4BPBA 2P3TB 8OHMA 2JJ2A 1DEKA 2ZCKP 5GJCA 4X1RU 3MJHA 2CF8H 2OG2A 4A1VA 3THWB 1FAKH 1U9IA 4QFMA 5C46F 1G8HA 2BD2A 3RC8A 2BEJA 2XTMA 4AWXA 1HQYE 1EG7A 2OXRA 3UANA 2GCNA 4BZXA 4DLTA 2BKUA 2FDCA 1NMXA 1YYY1 1RRKA 2H9HA 3CBQA 1C5SA 1HXFH 1MD7A 1X6VA 4MKFA 2GGVB 1H8HA 3P32A 1VKJA 1Z2AA 3EWAA 2KI5A 4ZDWA 3W6PA 1AD8H 1NP6A 4N0EA 4KI0A 2JEOA 1G7TA 4Y0VA 5EZ6B 1AKSB 1CRQA 1VYTA 2HF9A 3UIEA 2GBLC 4PHTA 1BYUA 2G52A 3SJOA 3C1KA 1E35B 2RGBA 4MNYA 4XJXA 1JNYA 2TGAA 4FMBB 4RCYA 3LBIA 2VH0A 2J34A 1H8ED 1ZU5A 3GJ8A 3IG6B 5CK5A 3W8RA 2JH0D 2AWOA 3CH5A 1O2MA 3EZ2A 5ETXA 1QGFA 1AKYA 2IA5A 1BOFA 2VA8A 5DKMA 4OQMA 1GI7B 3CR7A 4RFSA 1BITA 1RVDA 3ATLA 3V3MA 2BY7X 3DA9B 3DEFA 4OS4A 3QXXA 3RXQA 1HY3A 5TY0A 3BTTE 2ZIAA 3A86A 4MDEA 3D62A 2B8TA 4HUQA 3Q3JB 4A0RA 4HZIA 2ORIA 2W0SA 1IY2A 4X8UH 1IY0A 5LDDC 1DT2A 4BFXA 3OEHA 2FOGA 4ABJA 2AMDA 1P2NA 1AVGH 4ZHMU 1XVOA 7LPRA 3B1VA 1GL7A 3IILA 2VGCC 5LPEA 3VB7A 2YJTD 1KI1A 2NIPA 1Z06A 5DP6A 2ZM5A 1CA0B 2IEZA 1IOEA 5EE9A 1P4SA 2YOHA 1SGCA 4K5ZA 1JRTA 2ORVA 3TH5A 4LBYA 2HXSA 1S0RA 3BIVH 4DG4A 1E6CA 3FMOB 1IN4A 4DJZB 1QBVH 1OFTA 1TQ7B 1IXRC 1OP8A 4YO9A 4JVMA 2WPDA 1E1RA 1BO6A 1XJ0A 2CNWA 3WYGA 1SC8U 1IAQA 5KDDA 3OFND 3PWCA 3CF2A 4K3JA 3AP2A 3GEHA 4GBMA 3FB4A 3L0SA 2A2XH 3UY9A 3FE2A 2O8FB 4P4UA 4D8NA 3NC1C 3UOPA 3KQDA 4ZKDA 2BQ7B 4PC3A 3TH3H 4MQAA 1MAYA 2BV3A 3PV0A 2TRMA 1WYKA 3NH6A 4WXRA 5BN5A 2IYRA 2RHDA 6LPRA 3KN2A 1QNJA 2JATA 4HAVA 4R71A 2ASEA 3TJNA 1CR4A 3WBJA 4JZDH 5J4HA 4RKOB 4A9AA 1G32B 2RA0A 3BSQA 1G5TA 2ZPRA 3EE0B 2WKQA 1W1WA 1C5QA 5CJ2A 1HYQA 2R8RA 1DARA 4BECA 2BLQA 1V2JT 3NKVA 4AFQA 5I25A 1ARCA 4FCVA 4RD3A 3SUGA 5JI2E 3QN7A 1DX5M 2XCNA 4XTRA 3BTME 4PPNA 3I4LA 3REFA 4E03A 2F7SA 1GMDF 2ZE6A 1LHEH 2PSXA 4XBCA 2VHCA 3AB3A 1W36C 1II0A 2CHQA 1FAXA 1V6DA 4Q9LA 4WXPA 3PMJA 4DZZA 4BAOB 1G19A 1A3BH 4JK6A 4BFTA 1MO3A 1ANEA 1BBRK 3P92A 1HAGE 2ZU3A 1RYFA 3FYHA 2ZJZA 1O3IA 4D0NA 1XRJA 5HTKA 4DRZA 1W36B 1WCV1 5C5OA 2VSOA 2C3SA 2PX3A 1YPLH 2IUSA 2AHOA 1FY4A 3MNCA 1N6IA 4DXAA 4UFGH 3KB2A 4OQNA 2WOOA 3TR5A 2IYXA 3WNDA 2IWRA 2FOLA 1BJUA 1AA9A 5SZJA 5CDFE 5FCRA 1GUAA 1W0JD 4Q7MB 4JBXA 3VHXA 2XZOA 5E4FA 2Y5FA 2RCNA 3AF1A 1W44A 3WP0A 3RLWH 4IDHA 4GPTA 1TNKA 1G17A 4D82A 1W2HA 1FP6A 1KO4A 4NSYA 5A8XA 2O5VA 1CR0A 1GITA 3NBZC 2V0BA 3A1TA 3CUEF 2TPIZ 2ZTXA 1EESA 1TF7A 3RANA 1OKXA 5K0HA 1YM0A 4UNNA 4O9VA 1E1QD 2GHIA 1AQ7A 3SBEA 2ZQ5A 5EQRA 4AKGA 4FUHA 4B43A 1ZC3A 3C15C 1DG1G 4OS7A 3C7KA 2IS1A 3U98H 4K1SA 2Y82A 1NLYA 5I46H 5JJLA 2NO0A 3BB1A 2H2ZA 4LZ1H 3DPUA 1LHDH 3CNNA 2EWVA 1UKVY 4UXJA 2FOAA 1NN1A 1TEXA 4A8JA 1FZQA 1XUFA 3ZVLA 3K0FA 3LQRA 4ZROA 4GZMA 1QL8A 3K53A 2GILA 3PYHA 2F9UA 2QXIA 5GJWC 1TQDA 1CJVC 5IK2A 2TBSA 1FUKA 1G3UA 1XTJA 3UWIA 4F4IA 4ISNA 2BXTH 2IUUA 1UVTH 3LKWA 2ZU2A 1SGQE 1O37A 1CXZA 1NFUA 2I6SA 2V7QD 4DSOA 3P8NA 4OHZA 1ANBA 2Y7ZA 1R10A 4OI1A 2W6IA 1FQKA 4B73A 1OYTH 1R8QA 5JJKA 1E32A 1XJCA 1A3EH 3UK6A 5KHOC 2IJOB 2ZA5A 4A6LA 2GX4A 1EFTA 1O2QA 1T5IA 1CVWH 1DSUA 1MABB 1RRFA 4GFDA 4US0R 1BMAA 5FBIA 4H4FA 1EZXC 3BTDE 2FODA 1JEDA 1KY2A 5IYTA 1VCQA 2ANCA 1GBIA 4MYHA 1EQ9A 4URVR 3TNFA 4LBWA 2ZFQH 2JETB 3LIWA 3SYNA 2OM2A 4ABYA 2ZGXH 4I33A 1TX4B 3E1XB 5FPHA 3R8CA 3MFYA 1GHZA 1JJ7A 4Q01A 4ZAEA 4DLYA 2ZUCA 2XRCA 3SI4H 1G3BA 2PZEA 2BX3A 2GJ8A 4HTCH 1G3IA 2VU8E 2P6NA 4OYHA 1ELFA 1FY5A 2WWGA 4WZAE 3WRYC 2GJSA 1SPJA 3BS4A 2N1BA 1F0TA 3GMTA 2GDJA 4D7FA 4Q48A 2IJD1 3R0FA 3UMSA 1ANDA 2EI8A 4BWYA 3M61U 2XC4A 1GJ9B 4GNKA 1UTKA 2ZDKA 3GDUA 1UJ2A 1GAJA 3MUFA 2WBLC 1GG6C 1GDNA 2FOFA 3QBVA 4JLDA 1FUJA 3ZVCA 2QMOA 2BBWA 1O2OA 4WZBE 2NPIA 3OIVA 4NWKA 1GCTC 3BB4A 4HAWA 2P94A 2GVDC 4RD2A 3RXCA 1Q2WA 2IS6A 4NCHA 2BYAX 1SGEE 3B1ZA 1XXFA 3SUDA 4IFEA 4F49A 4DEYA 1BTHH 3SDZA 3KDSE 3E6PH 3UUZA 3ZZ4A 4Y11E 1XMVA 3N70A 1T31A 3PEWA 4DIDA 1ZJ6A 1O2IA 1OWEA 3ATWA 4P3YA 4ASUA 5CMXH 3JZAA 2HLCA 2BTCE 3AVPA 2GBLA 2QXJA 1BTUA 3GYMA 1M7GA 4ZKRU 1H65A 1JRSA 1AVWA 3MU8A 1PVOA 4KXFB 1W47A 2RGXA 2FOBA 4CEJA 4LJ4A 1YKSA 3BEFB 4ZXXH 1C1NA 1TNIA 4CEIB 2CE2X 5JB9S 2XWBI 2YZ2A 3I61A 1XCGB 1G6OA 1NBMA 4FU9A 4QJ5A 1KGDA 2ZRGA 1GBAA 1MH0A 2HLDA 1ZUHA 3NH9A 1RC8A 3G0HA 2KSQA 1E3MA 4LK4A 2XZLA 1U6QA 2JETC 3TK5A 4QGHA 1YR8A 2QAJA 3I5YA 1YPHC 3QGJA 2ZU0C 1PQAA 1RJ9B 2UWOA 1SVSA 2IYZA 5KO2A 3GCTG 4YLQH 3GLGA 3MO3A 3UWKA 1KLIH 1NMZA 1N5LA 2QT1A 4H9GA 3ITIA 2B8OH 2VIWA 3SGBE 4BQSA 3FPAA 3GLGE 2FJUA 1NM6A 3H7OA 3TUIC 1J70A 3AUYA 1JXPA 4Z51A 5DNYB 3BK7A 2JLSA 4FU8A 2EWWA 1N6LA 4CDGA 3GP8A 2BY8X 3E70C 1OIVA 2C4FH 4RD4A 5AUQA 3D3QA 1Z8JB 2G0TA 4LOYH 1OB2A 2CGAA 3TUJC 4R9UC 2F9OA 3VB5A 2OTVA 2QTFA 1FMLA 3A1WA 4BLQA 5D3MA 2QAGA 1AI8H 4KLNA 2X1VA 4Z8YA 1DLEA 1WTGH 1FW6A 4LX0A 1CHOF 2UUFB 1K1IA 3A1VA 2PWXA 1AO5A 2A5AA 4DT1B 1K1NA 2BOHB 1W10U 5AJWA 2CMYA 2W7SA 1Z1IA 4IOKA 3RSLA 4PSAA 4IGDA 4B3BA 4R0IA 2GT7A 4JBYA 5BWMA 8GCHF 1GHWH 4XD7A 3VKHA 4TMXA 1WXQA 5F3WB 2ZDAH 4J1YA 2PLRA 5J5CA 3EASA 3PO1C 3VR1A 4Y7BA 2BD4A 3SQEE 4K8YA 2BD9A 3CZPA 3MWKA 4A0GA 3PWBA 4NIVA 3BFVA 2WJYA 2W00A 3GLFA 2ZVPX 3FKSD 1MT0A 3T26A 4W5WA 4DCTA 4OS1A 4X1PU 4I1SA 5C1XA 5DE3A 1L7VC 1P02A 2WAXA 2FI5E 2VIDA 2LPRA 2NGRA 3KNXA 1BIFA 5FBLB 1NROH 3ZZAA 4YLUA 5C20A 2DUCA 2GV7A 5LPNA 4HB0A 4HATA 3SV9A 1HBTH 1YBWA 3HGNA 1ZPCA 4XFQA 1SXJA 1F0SA 1GJAB 8KME2 1P62B 3TKLA 4L9WA 5UKDA 3RXBA 4PTLA 4RKEA 1P6XA 1KAOA 2FESH 3QG1A 1O2SA 1WRBA 4TLDA 2D8WA 2V3HH 3EW9A 3KXLA 4FMCF 5G53C 3TAHA 4QBGB 2Q6GA 3K0AB 3QIAA 4JYUH 3SR0A 1ETRH 1GMHF 1FMGA 1BJVA 2YNAA 1XU4A 1NS3A 1AB9B 5FL3A 3SI3H 1ZSKA 1BH2A 1ACBE 3A82A 2XCFA 1LS6A 4NCNA 1EPTA 1VCMA 1Y3UA 4FXPA 5GNDA 1Z0FA 1EXMA 3A7ZA 2OCPA 3TR0A 2F9BH 1B7XB 421PA 1HJ9A 4IJMA 3LGTA 3THXA 4QHYA 3FZDA 2ZP0H 2A45B 4NBSA 1E2LA 2ZVQX 4HDOB 3K9LA 2IYWA 3P4XA 5TVKA 3GLGB 1YKTA 3VNUA 4DLXA 3Q00A 2RGNA 1S96A 2VWOA 1O5EH 1G7CA 3QNUA 1AGRA 2BDHA 2TMKA 2SGDE 1UAAA 1XB2A 5CYPA 3KCGH 1BTPA 1OXVA 2OLJA 4GSYA 2YOGA 4UJ3A 1YZLA 2AMQA 1C9PA 3SYKA 2QRNA 2RHMA 4PROA 1H8HD 3BTQE 4A2PA 3VB3A 2AS9A 1E1RD 1SMFE 2DBYA 1KO8A 2PKSC 1JB1A 1CBWC 1E2PA 4M1SA 4MTBA 4PX9A 2QU8A 4OK6A 4UE7H 4LSGA 1GGDC 1OT3A 4IKEA 1SGTA 1JQLB 4X2XA 1TNLA 5A8YA 4YOGA 1G1MA 1P0SH 4EFMA 3SV2H 5B6OA 1K9OE 1P8VC 4UNPA 1W3CA 4NCYA 2J3EA 2BLVA 4D2IA 4OQFA 3V7TA 7ESTE 1NN3A 3SBKA 4XD7D 2IUTA 1Q1EA 4U02A 1XEXA 3I77A 4BEJA 2UZIR 1EWRA 1TL7C 4E22A 3LH3A 2GCPA 1P03A 1J17T 3QPVA 2WINI 3IHLA 3FWYA 1AVXA 3GJ0A 1C9TA 2PCLA 1GILA 1Z0IA 1DE7H 4MLFB 3X1DA 1C1VH 1WBBA 1G41A 4O3TA 4CIDA 1F0RA 1ZNWA 1TQ6A 4Y0ZE 3AGQA 2R6CA 3AKCA 4KBGA 3RXMA 2PKAB 3RU4T 1MU6B 1UDXA 3BTKE 1Z22A 3CRRA 4WA7A 2JDIA 2Z0MA 1ZU4A 1U90A 1GHBF 3UNQA 2NO1A 4G0NA 1YPHE 4RY2A 1A4RA 2A2QH 2B7BA 3O47A 2OQUA 4JS0A 1KI4A 1AS2A 2V6JA 4Q1CA 3K9HA 3IPXA 2Z83A 4Z1MA 2IHYA 1U8AA 1A5IA 1OFIA 3FHTA 5TCCA 1W36D 2VPPA 4ZI3A 3K0CA 2O8WA 3DMNA 1JR3E 2OEPA 1RKBA 1JXOA 1Z6AA 1TGCA 1GMCG 3T25A 4Q4AA 4J0QA 3I72A 5DP3A 3DFLA 4E5UA 3LOXA 3SQHE 3M35A 3L8ZA 1FY1A 2VVVA 2QT0A 3SV8A 4CEIA 1EOLA 1E9RA 3KF2A 2SNWA 5CIQA 2R0KA 1ZJDA 2G1JA 4DDTA 5FOUA 1UEIA 1F2TB 3NEYA 1QRWA 1TOMH 2ZFRH 3EA8A 1F48A 3I62A 1KJZA 3STIA 3VAAA 4JSTA 1GJCB 4BRWA 4KVGA 2WYGA 1C5TA 3AVOA 3BFXA 5E0JA 2REXB 1Q22A 3EPKA 5HZHA 1Z08A 2JCSA 5EUMA 2Z4SA 1Z2CA 5HE8A 1V2QT 1HJAB 1EK0A 4BEBA 2VQSA 3ZZ6A 1KSGA 3K9NA 1ZP6A 2BZAA 3UFAA 1PPEE 1SHHB 4AFUA 2A4RA 4OBEA 4ZDKA 5FTJA 3I8SA 2ZDLA 1NSFA 2JIZD 3U4QA 3KL4A 2XTTB 4FIDA 1TRMA 1Z6YA 2BD3A 3GFTA 4A15A 1L0ZA 2H1UA 3ND8A 4KTUA 1H8IH 1OXGA 1TBZH 1NF3A 4ERNA 3M3TA 4NA8A 4QM7A 2NZJA 5AJVB 2Q0HA 5CDFA 3GLIE 4CGZA 5FBQB 2CCKA 1OYYA 1NLFA 1KO7A 1JJVA 4DVGA 3KFVA 2WPIS 4FUIA 2ATVA 1RTFB 4C0BA 1ABIH 4KO8A 3MH7A 1F2UB 4FUDA 2OINA 2DB3A 3GY6A 4D4KA 3FMIA 4FUCA 2QL6A 1XEFA 2O8MA 4TLEA 4V0NA 1ETSH 1T7CA 3THWA 3E91A 2P16A 2ZRLA 1CA0C 3FFBA 1TGSZ 4FU7A 2ZYTX 3TGJE 1IQJA 2JLRA 1P04A 2QA9E 4URYR 4XSHA 1SQTA 1PPCE 1OWIA 1TPPA 2BXUH 4TSFA 4DW2U 2ZYUX 1TMTH 1P05A 1U2RA 1G8YA 5DIFA 1LW7A 3RAPR 1V2VT 4K8OA 4EPWA 5DLQC 4B2AA 3EGKH 2FEQH 3R20A 1QA7A 2H6MA 1IJEA 1P7CA 2ZCLP 4M9SA 2KE5A 2BB4A 1O2ZA 1C1RA 3C5HA 3LXXA 1CBUA 4KJZA 1AWHB 2RH5A 4CRBA 5E7MA 2HDNB 2W83A 4BANB 2XNIA 2AL7A 3GJ7A 3WMEA 2NPFA 2A78A 1KXDA 3CW2A 4OGYA 1CT2E 4OS2A 2BD8A 1GKUB 4PC7A 4YONB 1OXTA 2G3YA 3A7TA 5T3HA 2VBCA 2QQ0A 1FUUA 2ZDVH 4CRGA 5P21A 5FPYA 1TTTA 5AVDA 5C2JB 2RGAA 3ZVAA 3H84A 4FCWA 1C5XB 4M1YA 1R5BA 1O2GH 4BFWA 5DJ7A 4JZ1A 4NCKA 3R9WA 5KDLA 1AFQB 4BFVA 1OSSA 4NONA 4PHHA 5G3ZA 1O3MA 3DD2H 3K0EA 1M74A 2C96A 1Y63A 1BBRH 4I8JA 3P20A 3HP1A 4GDFA 5IT5A 5KOYA 2SGEE 4URUR 4Y8XA 2PSYA 4Y8YA 1E2MA 2QZ4A 1G18A 3CONA 1VTKA 4X1SU 3C14C 1MD8A 4PO1A 3AAVA 1FJSA 4WXVA 5A2MH 4Y79A 5H8WA 4JLAA 1G8PA 1LTOA 4OQXA 2RKOA 1XX6A 2ZKSA 3QXHA 1DAIA 2KAIA 1K1PA 3OSYA 5F03A 3LXRA 1V43A 4UFFH 3CX7A 1IJFA 5GVSA 2V54A 2OUAA 3DZDA 2Q9AA 2ZRAA 4GOXA 1S82A 4JCNA 4PO9A 2R9PA 4A4DA 2XZPA 2XBWA 1JBUH 2FMXA 3ZZUA 2O8LA 1U9IC 3U3MA 4KV9A 4KSBA 3U7EB 1OPXA 1W0KD 3P8OA 2PMKA 4G5QA 3MYWA 2ZDMA 1N6NA 1GI0A 1TWXB 3ETLA 4EIWA 4ARZB 4ABBA 2BX4A 2VHTA 3U7GA 1HUTH 1M9UA 3CZQA 1RRGA 4B33A 1HYLA 3TVTA 2FOCA 1N6YA 1E0FD 3KQBA 3HKJB 2Z9IA 5DI3B 2LKDA 1RXPA 3SN8A 4AGJA 4QBFA 1NFWA 2UKDA 4I8KA 2RMKA 3RMMH 3ATKA 4V0MA 1F5RA 1W0ZU 1XX9A 1C4Y2 1TF5A 1KI6A 2QBYA 2KB0A 4DJTA 1SGNE 1SGIB 4KSCA 5LPRA 4FN5A 4X8SH 2VF8A 2J2UA 5AUOB 2IX3A 2D2FA 4PZYA 3B85A 2WPHS 2HALA 3U8TH 1SQ5A 1W5SA 1E37B 1CGJE 5KNDA 1E2IA 3CIOA 1DE0A 2O8DA 1L1GA 2AEIH 1EXFA 1LB1B 3ENSB 5GJ4B 3KHVA 3NK8A 1A7JA 1T8TA 5J40A 3SJZA 2QBYB 1S9DA 4GPGA 3EPLA 1RIWC 1O38A 2FXRA 2Z6BD 3AM1A 4ASUD 3RU4D 3IEUA 4RD0A 1E0KA 1MAXA 3IHWA 1R5NA 2QTVB 1DOJA 4AYTA 3OAAD 4QGGA 2GDEH 3LT3A 2Q6FA 2QY0B 1UVPA 3PUXA 2CCGA 3LBHA 3QTOH 1UK4A 3A88A 4GUXA 2PCJA 1GBBA 1ESAA 2Y6TA 4ESHA 1QFKH 2ZGJA 5DN6A 3ZZ3A 1E4YA 2XAUA 4CT5A 1V2MT 1P2KA 1TFXA 2GRJA 1AE8H 4FUEA 5EQSA 3TLXA 1D9IA 3UPUA 4C0SA 1E2FA 4M1MA 3ONWA 1O3EA 1LKBA 3LGYA 4ZKSU 3LC5A 2VIQA 1X3SA 1KO1A 4BLPA 2P3SA 4V02A 5BPEA 3UWOA 1S6FA 1ZZZA 1MCVA 5DP5A 1OPHB 1E96A 4L4UA 2JASA 3SV7A 4O25A 2PW8H 3QZQA 3ZZBA 4LBVA 3QKUA 2ZO3H 4LWZA 1O3DA 3U1IB 5EP4A 2A7JA 1G64A 2ORWA 3A1SA 9LPRA 5JHGB 2GA8A 1BCUH 3KQEA 1PQ7A 1MR3F 4DWJA 3ADKA 4UFEH 3BF6H 4A0FA 1EX7A 5KUTA 5AWFC 4LDJA 3U3OA 4LHVA 3MG9A 4HLDA 3ZV8A 1L1NA 3KXKA 3TIUA 3EIHA 3NPSA 4DLRA 3QXCA 2AERH 3B23B 1JALA 1MV5A 2AD1A 1P5ZB 2Q3MA 2BHRA 1F5LA 2QNRA 1XTQA 1P11E 4MPVA 4Q9KA 1RJ9A 1VIAA 4BTIB 4B2PA 3KKPA 4B34A 2QYIA 3HWSA 4K60A 4IHQA 1L2EA 4ZH8A 1TQ4A 1G2LA 2OP9A 3OTJE 4B3CA 1YJ5A 4ZIRA 3T1QA 3P1JA 1O31A 3H1TA 3K09C 5FPTA 2ZTYA 4HAXA 1MRNA 4M1TA 2QUZA 4AG1A 1IM2A 3AP3A 2VP6A 1QHIA 3IQWA 2IF2A 3LVQE 1G4AE 4LBZA 1SQOA 1ZMXA 4NFEA 4LY6A 3RXDA 1COWD 1VDZA 1C4V2 1GPZA 2HLDD 1TBQH 4X6PA 1KAGA 1SVKA 2W2XA 4U7DA 1G7RA 1OOKB 1E69A 4M4SA 2VB0A 2CMKA 2F6RA 5PTPA 1G20E 2D1JA 1TIOA 1G3QA 1AFEH 1K1LA 4TWWA 4B3GA 3ASYA 1FX0B 3B2EA 3UR9A 4FWTA 1ELCA 1CA8B 1DUAA 1MABA 3FTQA 2A5DA 2QPOA 4HUQB 2ESTE 2VNTA 2HXYA 4L16A 2WOJA 3SHCH 2QRZA 4I1OA 1NVVQ 1WP9A 1DDJA 4UD9H 1NG1A 1MZAA 2ZG0H 4FMCB 3CH4B 1M8PA 4IS5A 2QMEA 4CBOA 4KU4A 1U81A 3WYAA 4M7GA 1W5TA 3Q3YA 1OB5A 1TQ0B 1KDRA 1PUIA 1W48A 4X2WA 1E34B 4QRHA 5EXTA 1AZTA 1TB6H 3PXGA 1HV7A 3EARA 1E2EA 2IXGA 5JSZA 4KTCA 4BGDA 4IW3B 1EGAA 1EZUC 2ZHDA 2D3WA 2PLFA 1G16A 4MKGA 1O2HA 3GOVB 3TW8B 3LGVA 4Y0YE 1INCA 2G00A 3DDCA 5FBEA 4WIAA 2FOEA 4MNWA 1MTVA 5C67A 1PPHE 3KJIA 3AKDA 1T8LA 1T8OA 1LVBA 2F91A 3G5UA 2BD5A 1BRUP 1YR9A 3KX2A 1TNHA 5CLLA 1ANCA 4AN7A 1NBME 1W7XH 4NGAH 4UNSA 2BQ6B 1NVVR 1O3JA 2WPMS 2G6BA 2ANMH 1ANKA 2JKHA 4ZDJA 4AC9A 1EFCA 2OBMA 2GEDA 2VVUA 1RTKA 1K8RA 2A2ZA 3R8FA 3EX7C 3D23A 3ZS9A 1UTQA 2BBTA 1LPKB 2GEUA 1IHUA 2ZR0A 1E2HA 4XH9B 4NTZA 4ABFA 2Q1JA 2UWLA 2BM0A 1GMHG 3K9XB 3I3SR 3DM9B 3HGPA 2O8BA 4XSGA 3OY5U 1ETUA 2FTMA 1QL9A 3QUSA 4V0OA 4KGAA 1Z0JA 1C5VA 2P3UB 4IDPA 3RXGA 5L3QA 1FOEB 4A2WA 2NOAA 1C2IA 5FOXA 2WPJS 3QKTA 5DGJA 3U61B 2QTHA 5HXFA 4RD1A 1KY9A 1ZW6A 3VGCC 5L8VA 2JIZA 9ESTA 2YHSA 2VVCA 1W2GA 3AVZA 1HFDA 1SGPE 1GVZA 3KGPA 1Q1QA 4DIIH 3EC2A 3EIEA 1W0JA 5CYOA 1G21E 3TQCA 2FM2A 4YMUA 5LD2C 1WOFA 4HZHA 3K0FB 2F3TA 5EQTA 3T34A 1T4VH 5K8LA 1AS3A 1KK2A 2WM9B 2JLXA 2FLBH 2VHJA 1NRJB 2FYQA 3GISB 2W6ID 1AB9C 4IOJA 4IOLA 2PKAA 3VX4A 4WZ6A 3Q3XA 2OCBA 5JJIA 3VTKA 1I2DA 1N5JA 3SQWA 3QZRA 3NIBA 1EB1H 3EZFA 1AJEA 2GJ9A 1OWDA 2E87A 5FH9A 1EJNA 4AB8A 2TGPZ 1O3HA 1DY8A 4HAYA 1XDBA 3F9FA 2F9VA 5AJYA 1Y5AT 4PSVA 1FP7A 3SC3A 1A61H 4JYTA 4I99A 1J90A 1W7GH 1HB0B 4M1WA 5C18A 3MGCA 4G01B 1KMQA 3PUVA 1LKAA 3AVWA 2A0QB 2OC1A 1DO2A 1TMKA 1TABE 2G55A 4DSUA 3BH6A 3S1AB 4CREA 1B0UA 3R9XA 1GI3A 1QHSA 1ZR0A 2FIRH 4XOJA 3CS0A 2WPKS 3M0EA 1HE8B 3L33A 2DY1A 1WDTA 3VB4A 3GLIB 3BAFA 2YWFA 1CR1A 1KNXA 1FNIA 5GJVC 4LJYA 2BDAA 4ASHA 1G3EA 1US8A 3S1AA 1J8YF 5L6NH 2ZRBA 2J94A 3RS2A 3HJNA 3WBKA 1T6NA 7KMEH 2A5IA 2ZRCA
chains in the Genus database with same CATH superfamily
3C5CA 5A9TA 2HSEA 2HNKA 1NUPA 1W85A 3M49A 1IG0A 4I6EA 1NLMA 4EHBA 5K3FA 4Y2UA 2J0QA 3NGLA 1M1NA 3M3DA 3UXEA 1XWIA 1NKSA 3RBVA 3RVJA 4CUJA 1O5DH 3WL3A 4L27A 5TDHA 2OSBA 5E1BA 4KQFA 3TCNA 5LBIA 1UMDB 1UPUA 4LJAA 1GPBA 3MCUA 1DBRA 4IDNA 3BTOA 4ZANA 1U65A 4NS1A 3W34A 4B6EA 1F2VA 1G5QA 4EG1A 1J4AA 3TLYA 1ZN7A 1TW3A 4B6JA 4D9MA 4B76A 3M7QA 1N9KA 2FH5B 3EFEA 4D3YA 1P45A 4X24A 2ET6A 4JP5A 4ZK2A 1XYGA 3QV1A 1YE3A 1F8UA 2OG1A 1SLUB 4H42U 3A84A 2G4CA 4ZRMA 2G08A 3T5AA 3WGNA 4D9HA 2WWYA 1N8TA 1Z6EA 4XVQA 5ALSA 3DVAA 3LGXA 3O2SB 5JOQA 2ETXA 1KLTA 3E8LA 1S2MA 4CR5A 3O84A 4C3OB 3VJKA 3QYFA 2XGOA 5KYXB 4PNEA 5DP4A 4POOA 2PX2A 1E2BA 3LX8A 1ZK2A 1EFRD 5JARA 2Z9DA 2Z2JA 5AHXA 2EY4C 1QQ5A 5HF9A 3WFZA 1MKYA 2IY7A 1EGMB 1M34E 2VK2A 4KXXA 4TTRA 4A2CA 4Q3OA 2J0SA 3E7DA 3ICOA 4H59A 5LZ7A 1L5SA 4B5LA 5CT9A 1CFZA 5I7FA 4O2RA 4LOKA 4WOKA 4D8VA 3WLQA 2ODNA 3PL5A 2EC9H 3BD6A 2G72A 3SF8B 3S0JA 4NIYA 1D9ZA 1XFAA 1ZX1A 3HVUA 2OLGA 2O52A 2Q3EA 3RKUA 1FN6A 5FAKA 3LMKA 4RCVA 3LX4A 3GJRA 4Q7JB 2SNIE 2XEDA 2FPZA 2GZ7A 5EP4A 4O8ZA 5EWMB 4LY0A 3KTOA 3BZBA 4U0KA 1VIYA 2HPPH 3RUAA 4MPJA 3LECA 2B36A 3AEZA 5BWOA 1CS4C 5ALGA 2UUKB 3DFUA 3O83A 5FJIA 5ESBA 5G3YA 4BPRA 1SL3A 3WAGA 2LGJA 1Y37A 1QQTA 3UJHA 4B7UA 2FFAA 4POAA 4IQFA 1O3OA 1JDJA 3LO5A 4DR7B 1NV9A 1KXBA 4FBLA 3T12A 5IRCD 1TF2A 1Q44A 1IHTH 2LCFA 3NHRA 3QX8A 3DV0B 2HSWA 2FYRA 2H9YA 3OT4A 4LXTA 4AJOA 2BEVB 1ISSA 2EARA 3VPBA 1C1WH 1ABEA 4LNUA 2D26C 4EH1A 1OLUA 1U3TA 2GNPA 1SHKA 1EJ2A 5CM2Z 2OLKA 4HDAA 1V2OT 1HL7A 2FG7C 4IIFA 2ZITA 4MRRA 3T3EA 4L02A 4RJKA 1VSUA 2HPZA 2W6QA 3OX7U 3K92A 4MUGA 4DE5A 2BVSH 5F64A 5BVHB 2Q1YA 5ALPA 3T1TA 1GL3A 2AGGX 1R4MA 2CV0A 2QGNA 3UNXA 1SG8B 1W6RA 4DA8A 3PYLA 1ODSA 3HCAA 2AOUA 5EAIA 4BDTA 4I5FA 4NESA 3TTWA 1KI2A 4OHVA 1O5FH 4WOJA 3K1AA 1YQXA 5I3ZA 1Q3XA 2FG6C 3IE1A 2ZIEA 4BVBA 1D8TA 4J0KA 2PFEA 2PH3A 3UB4A 5ED4A 3N2IA 4S04A 4TKZA 4CKYA 3RXKA 5JBNA 1BFKA 1NLZA 2DH5A 4PZAA 2OFFA 4TT8A 3KV1A 4BCDA 4C7OB 4LV6A 4EO7A 1WBGB 1YF3A 2NXEA 1L4UA 2ATIA 2ZZMA 3PX3A 3WB1A 1EX9A 1YNSA 1G66A 2HIAA 3F8WA 1V8DA 3GB9A 3HJHA 3K0AA 4TYMA 1KH3A 3UQZA 3E16B 4A8JB 4E2WA 3M6MD 3T5MA 2JLBA 1P19A 2AQ8A 1I5RA 4B32A 1YJAA 4FT2A 4AT1A 1Y0BA 2H5CA 3EEYA 3D5TA 5A7GA 4D1YA 5JWOA 2QD1