4B74A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
total genus 208
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b74A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b74A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b74A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b74A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b74A03
4PC7A 1BS1A 1O5CB 1G17A 1BMMH 5CLQA 1CU1A 2PZFA 4A7IB 2VP9A 3NDPA 1T8UA 4POAA 4DLRA 4IMZA 4KFSA 3A7TA 3HKJB 3KHVA 1OH8A 2L0XA 1DS6A 4YT7H 4QBFA 2C8YB 1W13U 1B0FA 4GP6A 4QOSA 2O8WA 2BBTA 2E87A 1Z6YA 3PFIA 5C67A 4Q7KA 3I78A 3NKKA 1KTSB 2P59A 2AH4X 4HUQB 1LVGA 3SHAH 3BB1A 3GYLB 2FFHA 1Q31A 1LVBA 2ANBA 5E4FA 5C1BA 1FX0A 2JLRA 2A4GA 4LYJA 1FXYA 5BN3A 2ODWA 3RC5A 3QGJA 3T28A 1Y3AA 6LPRA 3E2IA 2LWIA 5CHAB 1TQ4A 1W0JA 1JNYA 2ZSDA 4LBWA 2D74A 2BC9A 1E9EA 3GCHB 1HURA 3GLHE 3AF1A 3ZZ9A 3SQXA 1P9RA 4OHYA 2J0UA 3MWLA 5D3MB 4UXIA 3R20A 3UOUA 3K1JA 4O2RA 2Q6GA 2G81E 5EOKA 3FKSA 3IITA 1V2MT 1V2PT 3KGPA 1ONBA 1M8PA 5K8TA 3QTVH 1FY3A 4URWR 2C78A 2AEIH 1LNZA 5DHAA 3PJRA 3OTJE 2BCJQ 3F0TA 1A0HB 2DHRA 2OEPA 3W90A 4KTCA 1ZP6A 2IEZA 2EFGA 4H42U 4DVAU 4V0OA 1KI1A 1HV8A 4PAOA 3HWSA 1CTQA 3TW4A 1S6FA 1U98A 5EUMA 1KOFA 1TF7A 1XCGB 3VR5A 1B5GH 1ZM9A 2WM9B 4M2LA 4AURA 2ZQ2A 2RG3A 2F3RA 2F9LA 1F5RA 4ZKOU 2BTCE 1JJVA 3E1XB 3AKDA 1QHRB 5JJLA 5IRCD 1KYIA 2FWWA 2FOFA 5HZKA 2JDIA 4BNRA 2ZS8A 4WZ6A 2BLVA 2CHVA 3HU2A 2G52A 2P8OC 1WE2A 3D6TB 3RS7A 2V55B 3RSOA 1W49A 4MRVA 1KAGA 1XNJA 2FZ4A 2CHAB 3SUDA 1U2RA 2W6IA 3H09A 2HPPH 1O2LA 4OQNA 3RU4E 3W6PA 3AF2A 1IQIA 1G3QA 1RW4A 3BTQE 4PANA 1S9DA 1HPGA 3AVXA 2H8KA 1Z29A 3CF2A 2W2TA 2RGXA 2ZUBA 1OLOA 2IXFA 5EW2H 4HLQB 2D4HA 2PJRA 2J34A 3KQHA 1DAHA 3QBTA 4B35A 1UBCA 1THRH 2AX4A 2GCNA 2W7SA 1Z6AA 1F60A 1NFWA 1KTVA 1P9UA 2XSZD 2ZHQH 3U8OH 4LJ8A 4JSYA 1NLFA 2OE2A 1S1MA 1R0XA 1G7SA 2AN9A 3L8YA 2IYUA 3P8OA 3TSOA 1DLKB 4OHWA 4Q4JA 3GD7A 1TBRH 3N7OA 3S0NA 2XNDD 2QAGB 1RRCA 1VIAA 5TV2A 4ITRC 2A4OA 1V2NT 4CR9A 1ACBE 3EYDA 1OJLA 3P32A 1ZMNA 5FPTA 3PV2A 5JSZB 4IOKA 3SQHE 1U9IC 4FW9A 2VVCA 1GVNB 3OHMA 5H4IB 2BDHA 3JZAA 4EPYA 1HDTH 2GILA 2ODPA 2JLQA 5F9FA 4Q00A 1NU7B 4M1OA 3F9GA 4C0QC 3RLYH 4A8JC 3PMHB 5DK1A 5A0FA 3SQWA 3U7EB 4RD3A 2XXAB 1O2HA 1C5PA 1G36A 3KZ1E 1IQJA 1GHYH 1GM5A 2ZJZA 4Q4JB 1QQUA 1ETRH 1EWRA 2GDJA 4LBVA 4PAQA 2BOVA 1YRAA 4A92A 5JI3E 3FE2A 2VTKA 1HY3A 2GJAA 1BTUA 5K8UA 2BLWA 1NRJB 4RFSA 3LDXH 3VKGA 1E6CA 3SJZA 4B48A 2FOCA 1TGTA 1VCMA 2SGFE 3UMFA 1TL7C 3M4YA 1U94A 4R9UC 3EPHA 1DVAH 5EZ6B 2Y5GA 4O3TA 3NTUA 3NK8A 5GIBA 5EP3A 3C7KA 4AKEA 3E6PH 3K6ZA 1I2DA 1C4U2 1VYVA 2B5TB 3WHLA 5G3YA 2Y5FA 2A9KA 4DLVA 1E36B 3RRMA 3WYAA 2SGAA 2FEQH 1Z2CA 4DC9A 1W4RA 3IBGA 1XFAA 3T12A 3D31A 1MQ6A 2QI9C 2W5EA 2EFEB 1O31A 4A82A 5EPNA 3AM1A 4JZDH 5E2PA 1FOEB 2I3BA 1OWIA 2FOHA 2K1QA 1UJ1A 4LHYA 1RTKA 3BS4A 3U61B 2G0TA 3RSLA 4FMDF 1RTLA 1PLKA 3OE7A 4HI0E 2FFAA 1ZRKA 1GG6C 3ZV9A 2FDCA 3ZZDA 2OP9A 4FIDA 4NWKA 2QL6A 2ZRPA 3EDXB 3RXDA 1G8FA 2ZJ2A 3KUCA 1S82A 2Q6DA 4ARZB 3MU5A 2QTHA 2QXIA 4ZIRA 1C1NA 4D2IA 3QKUA 2VP5A 1JECA 5B64A 1GILA 2IUSA 5KYKA 2QM7A 4OI2A 2UVQA 1KDOA 1C2HA 2CLCX 2GXUA 2R9PA 1HYQA 3A8AA 1UF9A 1YP9A 3IHLA 1IHUA 2VA8A 3ZZTA 1TNDA 4MNYA 1G8GA 4M21A 5KNDA 1R7RA 3RXPA 2V54A 5C1UA 1GI3A 4M9ZA 1XCPA 3A89A 1F7ZA 4MYTA 4BOHA 3CX7A 4B34A 1R0YA 1F0RA 1BTWA 1XWIA 2OO7A 5IHPA 1A5TA 2DCUA 3LFUA 2ZSEA 5JJKA 3MNXA 1AMHA 4AGJA 3MWYW 1GIAA 3SZNA 3QXJA 4TT3D 3OIYA 1FPCH 4OQLA 1S96A 4G3XA 3WBJA 3NIBA 3VR2A 3TUJC 4N0DA 2P3SA 2WPDD 3AEZA 1D3TB 3FHOA 4ABYA 1GUAA 5DI9A 3RNLA 4ESHA 5EE3A 1UTKA 5L3SA 1GJ8B 1VG8A 2PGBB 5JYIA 3RS4A 1ELAA 3UMRA 1A0LA 2B0FA 2TGDA 2ZGCA 4AB9A 2VNTA 2HGTH 4JLKA 2PUXB 1OXSC 1IAUA 1TTTA 6GCHG 4HDOB 1PVOA 3E3TA 3ICEA 2FPZA 3SV2H 1BUIA 1LFDB 1EZSC 5CMXH 2WJGA 4OM9A 1LMWB 4INKA 1EXMA 4LV5B 4EPVA 3ASZA 2EI7A 2PV9B 1SVWA 2D62A 5J5CA 2C9YA 1ZSKA 1O2NA 1NY5A 3PUXA 4MG3A 5CIWA 3W5IA 1L4YA 3L2OB 4IN1A 1EAWA 1YZLA 2R2AA 1DAGA 4Q4LA 1UK3A 3FP7E 2JH0D 2HF8A 1AE8H 4A2WA 1E38B 1XUHA 4Y7AA 3UWIA 1TOMH 3GY2A 3TNSA 1CEEA 3NBZC 2NU0E 2PSXA 2YHSA 3BH7A 4KFRA 4QM7A 3A81A 5JI2E 4X8UH 1GZSA 2BM2A 3GLIE 3V9PA 4O3MA 4HI3A 4R98A 1YC0A 3GMTA 1THSH 1PPEE 4TL8A 5FCKA 3LY5A 3BD9A 3SBKA 1R2QA 3SJCA 3B1ZA 2HXSA 3AF3A 1F5NA 4XE4A 1N3BA 2F55A 1SQ5A 1UBGA 1O2ZA 3I72A 1HA3A 2ORWA 5G41A 5JCZA 3A8CA 4Q48A 1GJ6A 2G88A 3PVSA 2WYJA 3B8HA 3UOPA 2HJGA 1C2MA 3FP6E 2IUTA 4WOPA 2DUCA 2A5FA 3BFKA 1ZINA 4A6PA 1YQTA 1JEEA 1DLEA 3X1DA 2O9QA 5JSZA 2FS9A 2HV8A 2NO7A 4Y8ZA 1QDEA 4JZ1A 1TX4B 2SGDE 4I33A 1O3GA 1ZGVA 3TRFA 3DD2H 4OYHA 3KNXA 3WHKA 3VB5A 2WWWA 4ZCMA 4XD7A 2D26C 3BSQA 1S83A 3UMSA 3BB4A 3GFOA 4PO1A 1GGDB 2XCNA 1F3OA 2JH5D 4PTLA 3U3JA 3PMBB 2AK2A 5H70A 1N0UA 1GNPA 3VKHA 2QAAA 1MO3A 4BPBA 1DAIA 1MKYA 3TH4H 4PPGA 4P4SA 4DLUA 4HZIA 4HZHA 2F9MA 3Q3XA 5CLLA 5LGOA 1YZUA 4HATA 4CEIA 3VR4A 2C4FH 5HCNA 2B92A 3U3OA 2GBLC 3EGKH 2ZFFH 3DDCA 3GCTG 5H8WA 4Y6DA 1PYTD 2H7VA 3O8DA 1C9PA 1R4AA 4I4LA 1ZVQA 2GV6A 2XOKD 4AG5A 1TADA 3RWOA 3U4QB 4KFUA 1W0KD 4B1TA 1Y3YA 1NI3A 4GMXA 1F6BA 1ZJ6A 3NEJA 1O5GH 2J0UB 4XSKU 3BFXA 2QF3A 4BLRA 2WPKS 2IN2A 2FH5B 2NMVA 3SOSA 2JGNA 2CVFA 4L9SA 2FF7A 3QLPH 2FXRA 3ZVCA 3A37A 3GJ3A 2FOLA 5KHOC 1ZM3A 2VIWA 3MFJA 2FI3E 1U8YA 2QP3A 2VHJA 2C3SA 2F1RA 4HDCA 4I1SA 3ZZBA 3M37A 4BLQA 4KELA 2G6BA 1LHDH 4A1TA 2OC7A 5TCAA 3SHFA 1E9DA 1DT2A 3ETLA 5J4LA 2GMTC 1O0DH 2ZQ1A 1W0KA 4ZKNU 4KJZA 1C5LH 1C5NH 5K0HA 4HZUB 4LJ4A 4CGZA 4W5HA 1ZMJA 3WP0A 2BDGA 5BRRE 5I46H 2EFDB 4DCDA 3KFVA 1FUJA 1CT4E 1GMCF 3M7QA 5GJBA 2ZDMA 2ZECA 4GNKA 2PKSB 1U99A 2VLIA 5GVRA 1ZSJA 1VDZA 4S35A 5H1YA 5L2ZH 1R5OA 1SVMA 3CPHA 3S1AB 5KNBA 1W4CA 2J9RA 4GPTA 1Y5UT 2OBQA 3P17H 1KAOA 3L82B 2B21A 4TL7A 2GXAA 2PSYA 4GOXA 2NU2E 2NZ8A 2P94A 3BB3A 3NH6A 1HAHH 4B44A 2ZYUX 4C3ZA 2ZI9A 1RRKA 2R3YA 1P06A 3LBNA 3DO6A 2EI6A 1T8NA 1OIVA 3K0FB 3SUEA 3KQDA 1J14A 4A15A 2QTVB 5FBRB 2YC2C 2SNVA 1AS3A 1QJ7B 1KXDA 3D3QA 5C5NA 4GL2A 1L1NA 5L6NH 1GNQA 2FJUA 2OC8A 1KTTB 1NIPA 5KSZA 3QZQA 2H9TH 1Z63A 1X7AC 1E1QD 2C03A 3FHTA 1VG0B 3NEYA 3ITIA 1P2UA 3O8BA 4TN1A 1DG1G 5A0BA 1V2OT 3VXEH 3U7HB 2BOHB 2IJOB 1X8JA 1H8IH 3LXXA 2ZETA 1ESTA 1AGPA 2DFTA 7GCHF 3I8XA 3LGIA 4MVNA 3SHWA 4TQUS 5L3RA 1P9WA 1YCPK 2Z3EA 1C2JA 3LH1A 2GEUA 1QVAA 2GMTB 4BFSA 4EJSA 4S2EA 4MNWA 3ATLA 1WTGH 5JBAS 5ANRB 3KQKA 2XNSA 3REFA 1P9NA 4I8KA 1JAIA 1ESBA 1TA2A 1CSOE 4GI7A 1G41A 1KK0A 3TJNA 3WMFA 2WWIA 1SG8B 1ZTKA 5BW8A 3PQCA 3DA9B 3W34A 1PQ7A 4CR5A 3QKSB 3MWKA 2J1LA 2RGEA 1GJAB 2HF9A 2VHCA 3PEWA 4MRPA 5AJYA 4RSPA 3TW8B 4IKEA 3SI4H 2OXRA 5HE9A 4EIWA 4JYVH 4ZROA 1WUNH 3SYJA 5EW1H 4EFNA 1ZBDA 1VYTA 4V03A 3SC3A 4A36A 1SGRE 1FL9A 1G9XA 2O5VA 1IN6A 1PPHE 3BIUH 5EU8A 2BV3A 4ZDKA 1M6NA 2PUQH 1DWBH 7ESTE 1GBBA 3TJVA 1E1QA 1W48A 4C7OA 3TLOA 2XBYA 2W2VA 2H92A 3ZZ3A 1U8ZA 4BTUB 4CVNA 4KU4A 4NCJA 3AUYA 3QUMP 4CIDA 1ZU5A 2DE9A 3RC8A 4MPVA 1CJKC 4TYNA 5G53C 2KE5A 3EIHA 2HLDA 2ZDAH 1H8DH 4JLMA 2ZFSA 3QKSA 4X0WU 3NPSA 2ZIQH 4UFFH 2GEVA 3UG7A 3K70D 2BIFA 5KUTA 1AB9C 4YESB 4F92B 3B6EA 4KSCA 2O8EB 1ABJH 1QR3E 4NCYA 2O8UA 1U6QA 3KIDU 3KTAA 1JOUB 4ISIH 1PJPA 4A5TS 2O8MA 2BZ6H 1DOJA 1SGPE 2GVDC 5KNCA 1YHNA 1EFRD 1DUEA 2BXUH 5CB6A 3GP8A 4TY7A 4BAOB 4MRNA 2PMDA 1RD3B 1NN3A 2VHTA 1BZXE 1DEKA 1N6KA 4M1YA 2QT1A 4FMCF 3OAAA 2WJIA 1F2TB 1IQPA 1K2I1 4G5QA 3RMOH 1ZUHA 2C04A 2EYQA 4Q9IA 4PPNA 3GEEA 3L3TA 2QSZA 2ZRHA 4PSKA 5HR5A 1V2ST 1XEWX 4DUGA 2B7CA 2ZUDA 5DP6A 3T5DA 3IIMA 3SQEE 3LU9B 5L3QA 1NS3A 1YZNA 1G19A 5LB4A 2JLVA 3R3GB 4I81A 1E79A 4BECA 4RD1A 1ELTA 2ZYTX 5CHAC 4KTUA 4M22A 2ZC9H 3EWSA 2XB4A 4BE7B 1AGJA 3C41J 4M9SA 1W2HA 2SGPE 1PUIA 4C30A 3RXBA 2ODNA 2JJ1A 1NBMA 1II8A 1XVOA 3TQCA 2AD5A 2ZSBA 3K9NA 2IXGA 4B2CA 2JIZD 2OCPA 2Q3MA 3TH3H 1Q21A 4PPFA 1Y3XA 2R9VA 2BHGA 1FP7A 4KBFA 4DCUA 3HU3A 1GCTC 2BY9X 2QV1A 3THXA 3SNAA 1O3KA 1II0A 3CKLA 3ZZ5A 3BTWE 1F0UA 3ESTA 3GLFB 4FCVA 2VP0A 3ZYCA 4DWJA 4AFUA 3IIJA 1LY1A 4CRGA 2XC0A 3WNCA 5FTLA 1TQ0B 4AKHA 1C1UH 1EZUC 4MDSA 2V7QD 3VR3A 2J59A 4U5XA 2P5TB 3VKWA 1WF3A 1HBTH 5H68A 2BX4A 4O2LA 5FOTA 1IXZA 2BD8A 1RJ9B 2CL0X 3MH6A 1Z7KA 4D4JA 2WKQA 3RWMB 1LV7A 4E7NA 1ZZZA 3TMKA 3KL4A 5EE9A 2DWOA 1XZPA 2VHUA 2ZRFA 2QBYA 5LPNA 6CHAC 2DB3A 1GI4A 5AUNB 2W7UA 2F9OA 4UFDH 1G6HA 2QXHA 1ZC4A 3BG8A 4OS2A 1P2VA 2ZRDA 4I1VA 1OB5A 4MQAA 4DEXA 1BMNH 3ZJYA 2ZFRH 1JBUH 3H2YA 3DOFA 3IBYA 2FOAA 3JZ1B 4IDHA 4MYHA 4ZI3A 3P8GA 4IW3B 4N3NA 4KKDA 1CBWC 3SJ8A 4AWXA 3VU9A 4JJZA 1MKXK 1S85A 1SC8U 2W6ID 3CWZA 1Z6GA 4JK5A 1GSIA 1IY0A 3QKTA 5EE1A 3DOEA 3M6AA 1XXHB 2RCEA 1AKSB 2ZDVH 1BDAA 3BE4A 2OK5A 4AKGA 4CH2B 3GLHB 1INCA 1GBLA 1UEJA 5FL3A 1P3EA 2W0MA 3TVDA 1XEXB 4R71A 2GVFA 2AKAB 3VX3A 3OFND 1O3LA 1CA0C 3Q3YA 4GSOA 4A0GA 2ODYB 1G8HA 4NHOA 4XWAA 3MH7A 1COWD 1GCTB 4O03A 1GWNA 4TMVA 2O0KA 2NU4E 2QGZA 1D6RA 2GD4B 3MJRA 3E0PB 1GHZA 1WSSH 1E34B 3EWAA 3BWDD 2STBE 1C2FA 1O2WA 1O5BB 2GCPA 2IYXA 1KLTA 4A2PA 3PLPA 1JMOH 4MPWA 5CK4A 1OWDA 4WW0A 1QL9A 4MGKR 1GBEA 3PLBA 1W47A 1C5MD 1YPGH 3A4LA 3PWBA 4Y0ZE 2ZQ5A 3ZQ6A 2JJ1D 5B57C 1KI2A 3DKPA 3U69H 1A7SA 3SJBA 2FU5C 4DDTA 1NFUA 2ZU4A 1O2YA 3C5CA 2QRZA 3FGNA 4EAQA 4NYJQ 2QT0A 3G01A 6CHAB 1E1RD 2XGJA 1XUFA 3WP1B 2XXLA 5FPSA 1F2SE 1AIPA 2R6FA 4GRAA 1O3BA 1UVOA 5IT5A 4M1TA 1G7RA 4CRDA 3Q3JB 5AF9H 2O8BA 1CS4C 2BVXH 2NU3E 4JZFH 4LZZA 1UTJA 1UK4A 2B7DH 1PFXC 3LPRA 4D76A 4IFBA 3P8NA 2DE8A 1MQ5A 1E2NA 2XBVA 2FEOA 1MBQA 4Y0VA 1GJCB 3BORA 1IQGA 4EUNA 4HAXA 3U1IB 1FMGA 3T5GA 4VGCC 2D1JA 3RC4A 2C8VA 1SHHB 1WMSA 2OBLA 1C5YB 4MGIR 4X2VA 3KN2A 3EIEA 1BRBE 5FBIA 4GLYA 3I5XA 2GT7A 3MD0A 4JZKA 4JLOA 2HT1A 5DP9A 3T27A 5FTMA 1CF4A 1C1VH 1GBMA 1NVVR 1TE0A 2OUAA 4K1EA 2QU8A 1YPJH 1GG6B 1T32A 3IHWA 4NZLA 1CJVC 3HYTA 2Z94A 2P2LA 4DB2A 3TAHA 1DAKA 3TNFA 1WQ1R 4QGHA 1NU9A 4FUHA 3W5JA 2MSCB 5EPYA 3KQCA 3QY0A 1IQHA 2HLDD 1SLWB 3SHCH 3IQWA 2GZAA 3THOA 3D49H 3PM3A 3EARA 4LV8B 5AUOB 1ZMXA 1XRJA 2W58A 3QI2A 3DEFA 3NBFA 2CCJA 5JWOA 2QN6A 4U01A 2ZRAA 2GWHA 5HXFA 2Z6BD 5FPKA 5FR2A 1W12U 2XZLA 3BC1A 4Q7JB 1Z0KA 1SI5H 1HUQA 2QY0B 1FAXA 1K28D 2C77A 1OKKD 1MTWA 3I77A 1H4WA 2KI5A 3A58B 2WPDA 1LHGH 2IT1A 5FX6A 3EIQA 4KLZA 4GOJA 2O0HA 4P0TA 3URDA 3WRYC 3LX5A 4PZZA 3UIRA 3B60A 2IS1A 4AY2A 4WH6A 1NJFA 2Z4RA 2ZVQX 3EA5A 1DFPA 4YONB 4E7RG 3FMPB 3ZYEA 1SBWA 1T31A 3SJKA 2ZSFA 3QPUA 3ZZ0A 1XD8A 2NZJA 1J8AA 4GVUA 1BITA 4D6PA 3K0EA 2FGKA 1AN0A 4HEJA 4KP0A 3GOVB 5C3NA 2FM2A 4RJLA 2QQEA 3ODFA 1G3RA 1GOTA 2OSBA 1TQ2A 4Z1MD 2V0BA 3N2EA 1QB6A 1TNHA 1G4AE 1RGQA 4MKFA 2X1VA 4MKHA 4PPQA 1JR3E 2P95A 2GXSA 2QA9E 3HATH 2ZRBA 2GRJA 2UWLA 1ZUIA 2C9CA 3LA6A 4PSAA 2UWOA 1VMAA 4QBIA 1Z28A 2O8LA 2ASUB 1X3SA 1N0WA 1P2NA 2F9NA 4OJKA 1W4AA 2EYUA 1JWTA 1MTVA 5B6LA 1GGDC 2ORIA 2H9HA 4ZCLA 4JLNA 5GWZA 3REGA 2FX3A 2CMYA 4INHA 1C1OA 1YU9A 5AJWA 1TQ6A 3TJUA 4UNPA 4F7WA 2J38A 4OK5A 5DLQC 3T1QA 3PROA 3VU9B 1JEDA 1QRZA 1VCPA 3BTME 1MD8A 2A4QA 2I4IA 1MABA 5DIFA 1MCVA 3S1AA 1TEVA 2FTLE 3EC2A 1XEXA 4E03A 3TK6A 2YWHA 3V00A 4K1TA 2HEIA 3KKQA 1E0SA 2CNWD 3I29A 1O3OA 2J46A 4B3BA 1GCDA 4C0HA 2GDDA 4JSTA 4ZHLU 1XD2B 2NPIA 3MU1A 1CP2A 2V3OH 4R0IA 3G0HA 2VHQA 1NO9H 1T3HA 3NC1C 3BTFE 1HV7A 1SKYE 3EPLA 2ZJOA 2IJD1 1G64A 1ANEA 2QAGC 5JBCS 5GVSA 1HAGE 4F91B 1GJ9B 4Q4HB 1AVWA 1DAFA 4OQXA 4TMKA 3RDPA 4PHTA 2A2QH 4NFEA 1PQ8A 1IJFA 4ERNA 4BRUA 1QVRA 4YLQH 2GCOA 1KJZA 1IN5A 1OXGA 3RXFA 2BOKA 1CJUC 4B2BA 3ZQJA 1FZQA 5GJWC 1VCNA 3GICB 4JMPA 1YZKA 4Y10E 3FMFA 3U6BA 2UKDA 4AFSA 4PZLA 4TLEA 4QNMA 1QURH 3LH3A 2BJWA 4JYCA 1L4ZA 2PKAA 1Q22A 4ZO4A 3CB4A 4Z1MA 4IOLA 3BJIC 4Q01A 4KI0A 4NYMQ 4Q4HA 1IJEA 3A8BA 1E2LA 5F8ZA 1P11E 2FESH 4WZBE 5EXTA 2IW3A 5GJCA 2BY5X 2FE4A 4MYCA 3LNCA 4TLAA 2X8AA 4FWIB 2M5TA 3SDZA 2NIPA 3BOSA 2YZ2A 1MZDA 4BLSA 3ZV8A 2EC9H 3SI7A 1KY9A 3CO5A 2ZA5A 2AFQB 1QG4A 3S9CA 3QNUA 2PX3A 4HLDA 4NYIQ 1SGDE 3QO6A 3CM0A 5DI3A 3GY6A 1O2VA 3MJHA 4HAZA 3VR1A 2FS8A 2P6NA 2FDAA 3VMFA 1UKZA 1G3EA 1AWHB 4E06H 2VH0A 1Q1QA 4DCNA 4U30A 1KK3A 3OAAD 4Y76A 1HXEH 1KO7A 1UAAA 4ZV4A 3K0CA 2AD1A 2WKPA 3UNSA 1KXCA 1B23P 1PLLA 4AG6A 4GMDA 1SB1H 1N8OC 2EA3A 4O97A 1G30B 1EUFA 2R0KA 1NC6A 1ANKA 2FG5A 5SZIA 1NG9A 1QHHB 4RKFA 3LC5A 1IAQA 5JBTA 1XD9A 1E0JA 4EPWA 3NKVA 1GBFA 2AGGX 4II7A 1G3BA 3QDZB 2F7SA 1SHYA 1JALA 2FODA 4AN7A 1XM1A 2GZHA 2ODBA 4ISNA 2G51A 5UKDA 1UTPA 4ZHMU 4A8JA 3LO5A 3CS0A 1XTSA 3FKQA 1F2TA 1LW7A 2W6JA 4LOAA 4KVGA 4DB4A 2ALPA 1H9LB 1UFQA 4ACAA 1EFTA 3T62A 1QJ6B 1G5RA 3MHWU 4RD0A 1GJ5H 1SVPA 5L3QB 3SU1A 3X1ZA 4NKRA 3AKEA 1EG7A 4NIWA 1OPXA 8GCHF 2H16A 2REXB 4NU0A 3SU4A 4KCGA 3JVUA 1ESAA 4WH8A 1TU4A 4NYIR 3SGQE 2ZI4A 3AUXA 3B1WA 3NCLA 2NGRA 1T7CA 3RXOA 2EFHB 4B47A 1FLEE 1P01A 1C5OH 1HRTH 2ZM5A 4KLNA 4LC1A 3U3RA 2GDEH 4AIIA 3QKRB 2OZEA 2ESTE 4Z51A 1GMHF 4F38A 4K46A 8LPRA 1GRRA 2W6JD 1SGYE 5A2MH 1PPZA 2V6NA 2ZGXH 1HGTH 2ZEBA 1E1RA 3THXB 4JLDA 5JBQA 4PQYA 1PV4A 3AP3A 1CR0A 5HPYB 2P93A 4JT4A 4FU7A 2GTBA 1TPZA 1Z47A 1O3NA 3QXXA 2ZUCA 2KAIA 4V0NA 1GVKB 4EPTA 4DSOA 3C15C 3SJIA 4D9QA 3TKLA 3UWOA 4PC3A 3A1TA 3A7VA 3QN7A 4TMXA 2VWMA 1KSNA 2Y6TA 1UCYE 3AVQA 4HAUA 3CENA 2FN4A 4AFZA 1E35B 3SFVA 1H8ED 3H7TA 2AKYA 2YKGA 1NKTA 5EQRA 521PA 3VB6A 5C2JB 1AVXA 1IQLA 1US8A 3U9AH 4DEYA 1FMJA 3SNHA 3AVOA 1R8QA 1WYKA 1M34E 4Q1BA 1MTNC 4LHXA 1V2UT 4CZ2A 1DITH 2LPRA 2VSXA 4BLPA 1E98A 4DBLC 2YWFA 4NONA 4PSVA 3BH6A 2ILNA 1WBBA 2ZHDA 2ATVA 1M74A 1YF4A 221PA 4I32A 2PMKA 5CJPA 1CT0E 1RXPA 3P95A 2GKVE 3IPXA 4ZXXH 3SUFA 4ZMAH 2WWYA 4OS5A 3MH5A 3P4YA 1SXJA 2GETA 1TGNA 4NH0A 1VITF 1T3LA 4LV6A 1C5ZB 4LBYA 2UZIR 2WPMS 1O5AB 4L15A 1Q3HA 1Q57A 1LPGB 4CRWB 3E16B 4CT4B 2A5AA 3L0IB 1R0WA 3NBYC 3TLXA 3K9LA 1Z8FA 2Q9BA 1KXBA 4LCBA 2ZR7A 1PPGE 4UQOA 3PLKA 3M0EA 5LBIA 2Y7XA 1KO8A 1MR3F 2V1XA 1O33A 3VPKA 1AD8H 1XTQA 1HJAB 1N6OA 3DHWC 4Y8XA 2GAAA 3B7GA 3A4NA 3K0CC 4X8SH 4C2TA 1VPLA 2ZKSA 2CF9H 3U7FB 3V4FA 1KK2A 4DY7B 1OHHD 2PZGA 3NWJA 3NVAA 2YNMA 2AL7A 4XTCS 2QMOA 3BG4C 2IOTA 1DSUA 4LJ9A 4ISLA 3AQ4A 1IM2A 4L9WA 4PHGA 1EJMA 1K6MA 5A8XA 8GCHG 1TPAE 5FHTA 1Z2AA 3RABA 3KEEA 2VIIA 2YOFA 1N25A 4JBYA 3SV9A 3RRNA 3SYKA 5T6GA 3ATKA 1YZTA 1Y63A 5F2EA 1ZCBA 1MU8B 4FI3C 3KTAB 3AH8A 3K2UA 2ZRGA 2R3UA 2HCBA 4HLCA 1VGCB 4NCNA 1HE8B 4ABAA 3FWYA 4QFMA 1XX9A 2A7CA 1XUJA 2BMDA 2FOGA 5TB5A 3P92A 2JASA 5AFZH 1CVWH 1WA5A 4TQ9A 3QJYA 3SJ9A 1LVMA 2YNBA 1TX8A 1OYYA 3MTYA 4TZ6A 2CL6X 4JYUH 2REBA 4PX9A 3V4RA 1NN6A 4XWOA 1TA6A 3TR5A 3U3KA 1FNIA 2XOKA 2JEOA 4TY6A 3MNCA 3SZEA 1OH5A 5SZHB 1TGCA 5IK2A 1O3CA 1QGFA 2EWVA 3KB2A 3UG6A 1XXDA 2YINC 3ZS8A 4BFTA 1ZNZA 3BV9B 3RXKA 1AUJA 5DP8A 3A82A 1RVDA 1D6JA 5BYKA 1JR6A 1YGCH 1ELDE 1E79D 2FSIA 1RRGA 2N1BA 2GBLA 2CCGA 2PJZA 2FWRA 1XJ0A 4DT1A 2WIAA 3CNLA 1EAXA 2QE7D 4IVRA 1NESE 2QGNA 2GAOA 5JFGA 4L4UA 4QGGA 2F1IA 2V1UA 2AGIX 4Q7MB 1TNIA 3V12A 1QHXA 2XTNA 4TPIZ 1TF5A 1ORFA 3B9FH 2BBWA 3AW0A 3NH9A 2QZ4A 1VCOA 1VCWA 2WAYA 3H0KA 3FZDA 1S1CA 4LJ7A 3R7WA 5PTPA 2GCHF 2V35A 4NZQA 1DSTA 1GDQA 5JEDA 1O2JA 1WDTA 1Q3TA 2FYRA 1FTSA 5J47A 2JDID 3GQBA 1Z0AA 4ZKDA 4DLYA 2XAUA 1ARCA 2QIQA 3FDIA 3MFYA 3KX2A 2VBCA 2VF7A 1HH4A 4ASHA 2ZHWH 4US0R 5HM9A 4IDNA 2V6JA 1U0LA 2QA5A 3JZ2B 3UWKA 1U81A 1TBZH 3ZVFA 2XW9A 4QNRA 3ZDQA 1EESA 1BOFA 1C5QA 1S3SA 3HJNA 1JIRA 4G5OA 1ZYUA 2F3CE 2WSMA 1IN4A 1GI2A 1O2QA 3P8FA 1SGIB 1E2HA 2QTFA 1KO4A 4UNQA 1EFRA 3IQXA 4XSHA 1SOTA 2FZZA 2WZQA 1GITA 3RS0A 1UTNA 4QHTA 1K21H 4HLUA 1Z1JA 2ZI6A 2JETB 5FI0B 1FZZA 4A9AA 1SULA 1JR3A 2QG6A 4W5JA 4GZLA 1NL3A 5DP4A 3TK9A 2OXSA 3D7MA 2ZJAA 4RCZA 4P33A 1GBDA 1VHTA 2BVRH 4TQAA 5L3SB 1L4DA 4TWYA 2BVNA 2TPIZ 1E2JA 4MUBA 4LK2A 3RLFA 1XKAC 1YR9A 2BDYA 2ZEJA 4IXNA 1GMDF 1A0JA 3CR7A 3NZIA 4Q1AA 3NXSA 1GG2A 4B76A 1KDTA 2P6RA 4O0MA 1GHAF 2RGGA 5JECA 3SU5A 1AQ7A 4IBLH 4O3UA 4MKIA 2A1DB 1TBQH 2GCOB 1KGDA 5DP5A 1AN1E 3LOXA 5DG6A 3ONWA 1OP0A 2ZU3A 2ZTSA 2AR7A 1YR8A 3GEIA 3UR9A 1DVRA 4GPGA 2HYDA 1WAYB 4R7ZA 4B43A 1U0JA 4KHZA 3GDVA 2ZE5A 1N0VC 4XJXA 4DLWA 2ZRLA 1JR3D 3U44A 1F48A 1W46A 2BD4A 1DY9A 3CONA 1KO5A 4BAQB 4QJ3A 4X6PA 3M7UA 1M7BA 2PKAB 1V2JT 3KQUA 4IMQA 4UONA 1Z06A 1SVKA 5IYTA 1E2IA 1PQAA 3QF7A 5G4BA 5L8VA 5LPEA 4IEIA 4I31A 3KQNA 2ZHFH 1NN0A 1XMNB 1ZHRA 4O25A 1K1PA 1JIMA 4BUJA 2FLBH 2IEYA 5E2OA 4G5GA 1SGNE 3LQRA 1XVMA 4GDFA 4XBDA 5EE5B 3TVJB 3T15A 3A8DA 2N42A 5DGJA 1KSGA 1Q1EA 4CRAA 1H8HD 2ZJ8A 4BZPA 1AZ8A 2ZU0C 1DPFA 4LK4A 5DI3B 1XUKA 1YPHC 5DN6D 4XTRA 3PMAB 4THNH 4C9BA 4DDVA 4WY3A 2CVHA 2A2ZA 3QK1A 2JLWA 2SGQE 1XMSA 1XMVA 1EFHA 3C5HA 4HSEA 3GCTF 2ZPRA 3W6NA 2WPHS 1G2MA 5AUPB 1ZC3A 2O0JA 3BTKE 2WYGA 2Z6VA 2AHOA 4ILEA 4D4LA 2OCYC 1IN8A 2BQ6B 4BZXA 2IS6A 2HXYA 1FW6A 4K5ZA 2F9BH 1D8TA 1CO7E 3QXCA 4W7SA 2IS2A 1PUJA 3W6OA 1KYNA 2YYZA 3GISB 5LD2B 2EVWX 1OWJA 3B85A 5KDDA 3VNVA 1O3JA 1I4DD 4IVPA 2Z9GA 1UVPA 2BEJA 1E9SA 3KCGH 5KU1A 2ZDKA 2QY9A 2ANKH 3P4XA 3MU0A 2O8FB 4AFQA 2C90B 1XPRA 2GT8A 4ABIA 2ZS9A 2FO9A 4GUXA 3KKPA 2QN5T 2OTVA 4UD9H 2GK7A 4IDQA 1FY4A 4H6SB 1U9IA 4JK6A 3TBKA 3ZVAA 5I25A 1P62B 3ICQB 2CJWA 1W0YH 4DCVA 5AWFC 5FH9A 2ZCLP 2ZREA 2ZU5A 1L2EA 3O8CA 5EXNA 1J15A 4J2YB 1CHOF 2G55A 2BZAA 2OINA 1P02A 4US1R 3QVUA 4PC2A 1G3DA 1VJ9U 4NDZA 3QWCH 2MMGA 3AVTA 4NL4H 1NZQH 3ZVMA 1BCUH 4MRRA 1G3MA 1U8AA 3BTTE 1YR7A 3AVWA 4P31A 5JB9S 2F43A 3L0PA 1RJ9A 2A5DA 4TWWA 4YOIA 2ZRMA 3DM5A 2N46A 3AKCA 4KFTA 121PA 3ADKA 1J7KA 1BTHH 1WCZA 3VGCB 2PTCE 1A46H 5JPMH 1RYFA 1JRTA 1V5WA 1SQOA 1VJAU 1LVOA 3PIRA 5JS7A 1TRYA 4HZUA 1OHHA 4O9VA 1UDWA 1TNGA 5FTNA 1CLUA 3GFPA 4QM6A 3FZZA 1HLTH 2OXCA 3TQFA 4WXPA 5EQQA 1SFQB 2H57A 1IQMA 2RB4A 1TIOA 3LDAA 2RGNA 1GP2A 1Y3WA 3K6YA 3C8UA 2JJ8A 1W36B 2D2FA 1N2CE 3BTEE 1C1MA 2HLCA 2IA5A 1YPHE 2EI8A 3GJ0A 4R8TB 2GESA 5TCCA 4DT7B 1P4SA 3S7KB 2ZS7A 1OF1A 4KITB 3KDSE 3VB3A 3LJJA 3K70C 4QC2A 4PZYA 1QB1A 3ZZ4A 1L8QA 4IFEA 5FCRA 5A8YA 1Z0IA 4N0EA 1GDUA 3ZZCA 2RCNA 4FMCB 4XH9B 3AGQA 1IY1A 3QVVA 1K9OE 5DISB 1O2OA 1FIWA 4H6TA 4AG1A 1OH7A 1K1IA 1GJ4H 2ZP0H 1SXJB 1KKLA 2P5SA 4F4OC 4RZ3A 4X6MA 3P1JA 1H8HA 3NXPA 4F93B 4XWKA 2HOBA 1YPEH 3X1XA 3RXLA 1O2TA 1CXZA 2BD7A 3A88A 4TTQA 1GI8B 3ADDA 2AYWA 1GKUB 5AUQA 3SJAA 3ASYA 5J4VA 1V2VT 2A5YB 3SNCA 3GY4A 1ZHPA 3U98H 5IF9A 4M7GA 5A0AE 4FUEA 3CF0A 2VJ1A 3F68H 5C4MA 1ELOA 3W9YA 3TGJE 4AKIA 1XP8A 1AKEA 3LVRE 4URUR 3LC3A 2AERH 5C18A 1Z6EA 1GHBG 1C9TA 3VXFH 1D2EA 1OSNA 2HNTE 2P3FH 4NSVA 1BYIA 2BYAX 2HALA 1N6NA 1NPMA 2BMFA 4HYYA 2WHXA 4QRHA 2BM0A 1JBKA 2RKOA 1IY2A 1Z6TA 3ZVBA 2CJIA 2AXNA 3A6PC 1H9IE 1VCQA 5LD2C 2QP4A 1W2KH 1QZXA 3BIVH 5KPJA 3LWNA 4PFSA 1G3IA 2YWGA 2IWRA 2GP9B 4U7DA 2BD9A 4LI0A 2AGEX 5LPFA 4Q19A 3VB4A 3WBKA 4PHFA 3NHAA 1EP6A 4Y11E 2JLXA 1DTSA 1KI8A 3A1WA 9LPRA 1HAVA 4ZI2A 3SU3A 4TL6A 1Q0UA 2J0SA 2BQ7B 3K70B 1X8LA 1Y5BT 6GCHF 1A4RA 1T4GA 2BQWB 1NSFA 1GMDG 2BM1A 1TAWA 1R6BX 2SHKA 4LPKA 5IDKA 4BRWA 2TRMA 4LYHA 2PX0A 1P2QA 2BJVA 3A1UA 1C2IA 3ND8A 4OKSA 4C7OB 1RE0A 3RRZA 1A2CH 2ZZUH 1C5SA 4DZZA 5JDUB 4UEHH 4VGCB 3I3SR 2GZ9A 1YPLH 2IYYA 2QSYA 3ADBA 2ZPSA 2OHFA 3VGCC 2GZ7A 3OIVA 4AYYB 1NROH 4TLCA 2FIRH 2PCLA 1MTSA 1GBJA 2Z7FE 3U3MA 2B6HA 1WBGB 3I73A 1O2RA 1VITG 5JHHB 4B3DA 3E0NB 1MBMA 3BEIB 5FBVB 2ZDLA 1DX5M 4Q18A 2G4TA 1Q3XA 4D25A 2IXEA 1GVLA 2NQ2C 1FX0B 4W9MC 4X8LA 1P09A 3AK5A 1HJ8A 1XKBC 3A4MA 2HNTF 1V2RT 2OT3B 4IC5A 1GHWH 2ZFTA 4BAMB 3SO3A 1UKVY 3C14C 2O8FA 1FFHA 3QEJA 1NLYA 3VNUA 1BRUP 3MH4A 2VP6A 1R8SA 4ISHH 4YZUA 5A0CA 3PR1A 2DFLA 2VRWA 2AWOA 1WXQA 4OHVA 4OJQA 1R0ZA 3TNTA 2BDTA 3X1WA 2PKSC 2ZGJA 3B5JA 1SVOA 5GPIB 1TLDA 3EASA 4IGDA 4TYYA 2NG1A 1A82A 4JBWA 4DIIH 2ZE7A 2VO1A 2EW1A 2BY6X 2XZPA 2IYZA 1TALA 2YJTD 3DFLA 5DO4H 1E2MA 1GBHA 4URVR 1OYTH 1YKSA 3QTOH 4ZIRB 2FEMA 5G40A 1IBRA 3E8LA 1SGCA 1T8TA 1L1JA 1BO6A 4MNXA 3PUYA 2H5CA 1Z8RA 3PO1B 5A4JA 1ZM2A 4NA8A 1OWEA 1V43A 2VWOA 2OBNA 1NMZA 5F03A 2ANWA 4NZYA 2FSFA 4BTIB 1NRQH 4JS0A 3GLFA 1HIAB 2WOOA 5C20A 3T06B 5M04A 4JLJA 1ZU4A 1N6PA 5GJVC 3CS7A 1VZQH 4F4JA 4DSUA 1YPMH 4IXMA 1K1JA 2EWWA 1A5IA 1HE1C 1C4Y2 2AMQA 5GCHF 3EE0B 5DH9A 1L0ZA 3V3MA 3FFBA 4YT6H 4RVCA 1D3DB 3SEAA 4PO8A 4W5WA 1Z08A 4FCWA 2OQUA 2V3HH 4B2PA 2GV7A 2QBYB 1TQ7B 4WMFA 2WUBA 3B1YA 4XD7D 1UTLM 2VIOA 3GLIA 1G18A 1I2MA 1O3HA 4XIGS 2R6AA 1LCYA 4LHVA 1Z6JH 2BDIA 1AB9B 3C4JA 3SNEA 3MGCA 3DVLA 2WWXA 3IUYA 3R7WB 2GX4A 5HKKD 4OL0A 5KTYA 2CCKA 5EXSA 1UEIA 4E05H 2C99A 2XNDA 1GI5A 1SMFE 1ODFA 2BKEA 1ID5H 3K9HA 4NFFA 1CE5A 1HUTH 1MTNB 1E37B 4DKXA 1WP9A 1NG1A 4YXWA 3B82A 4X8HA 2F1JA 4Y79A 4LX0A 4LPSA 1I4TD 1AM4D 3IEVA 3M7TA 2VWLA 3GLGA 1XX6A 1YCPM 4AYXA 3V0XA 4K3JA 2WMOB 5BN4A 2F1HA 3EW9A 3TH5A 1LKAA 2WPJS 2IBMA 1O5DH 4NE2A 4YMSA 3I1FA 5EZ5A 4QJ5A 4OQFA 1XZQA 4US2R 5GCHG 4A1FA 1ELGA 3SNDA 4URXR 2OCBA 2VQSA 1O2KA 4IJMA 1KI9A 4A0RA 2X77A 5FFMA 3AASA 3QG5A 4DDWA 1N5IA 3AAVA 2OFXA 2UUKB 4C0LA 3PV4A 1GL6A 4OHXA 3AVZA 3SBEA 4ABEA 5L2YH 2TIOA 1LQEA 4JVLA 4Z6AH 3RXVA 3NG1A 4MNVA 1OXXK 1TQDA 4XOIA 2R8RA 1MH1A 1SR5C 4QXAA 2ZVPX 3TH2H 1C2GA 4OS4A 5BYJA 4B32A 4JCNA 3HK6B 1UTMA 3GLGB 1MD7A 2IHBA 1XCMA 3RM2H 1H65A 4KGAA 2R62A 3SU8A 2XRCA 2ZE8A 3DUXH 1LDTT 6Q21A 1UVTH 1HFDA 4NIYA 1EKBB 5BPEA 3UK6A 3VR6A 1P2IA 2SGEE 3EZ9A 1W3CA 3RVBA 4K2YA 2GCTC 4K1SA 4OK6A 1XD2A 2P3TB 4HLUC 3S7HB 4URYR 2RMKA 1C1TA 5HCIA 1FONA 1K1NA 2WJJA 3PTNA 1SKYB 2O8BB 1KO1A 4WAUA 2R6CA 4Y8YA 1M7HA 2YOHA 3ZGXA 4PC6A 2QM8A 3QIAA 3RXTA 1OKKA 3SI3H 4F4CA 3EQ0H 4KVAA 1FJSA 3K09A 5KDOA 1LS1A 2GJ8A 4FUBA 1FMLA 2P67A 2BD2A 3RS5A 4OS6A 1MOZA 1UTOA 4YTAA 1OW3B 2WJHA 2QP9X 3ATWA 1JQJC 2JA1A 2KJQA 4AX9H 4GCHG 2IYLD 2IYQA 1G2LA 5J4HA 2A31A 4MA4A 2ERXA 3VAAA 3I62A 2QUZA 4TSFA 3RXRA 1SGTA 1EFCA 1II8B 3MMGA 3BGWA 1LTQA 1TMKA 2XB2A 3FMOB 1XDBA 3FVQA 1T3SA 1KDPA 4V02A 4BXWA 3CP7A 2F3TA 3ZIAA 1ZNXA 1SPJA 1G5TA 4XSGA 1G20E 5DO9A 3PXGA 3M3SA 3KJEA 1H9HE 4NP6A 1C9KA 4A1XA 4Y0AA 3RXMA 3RXCA 3TGIE 1BYUA 1T8MA 3BTDE 1N5KA 5AVDA 2GCHG 1W4BA 3RUOA 3GY3A 2IK8A 1HCGA 1NIJA 2WPIS 1KIGH 3P6ZB 3KQEA 3OF5A 1GL0E 1DO2A 2PBRA 1M7GA 1W11U 4X1PU 1EX6A 3VHLB 5DKMA 4B3CA 2GJSA 4HDQB 2FPKA 4HFPB 3RDZA 4DT1B 2VL7A 4TMZA 5LDDC 3TSWA 5J4YA 3P70B 1SFIA 3OX7U 3CH5A 2R6DA 2JKHA 2FA9A 2PTNA 2D06A 2Q9AA 4Q1EA 1BT7A 1E4VA 2UZ3A 4FINA 4CRCA 1K1LA 1MV5A 1QA0A 1O87A 4EFLA 3Q3KA 2JH6D 1TB6H 5C46F 1S0RA 4EPRA 2KAIB 4DOQA 1SL3A 1SVIA 4UJ3A 2OC0A 4AK9A 4AYTA 1DG3A 2X2FA 2Z9IA 1Z3IX 3KJIA 5JHGB 1DM4B 4XDEA 2ZYVX 2ZTZA 1ZSLA 1AHTH 3SV8A 3VHXA 3DMNA 4D8NA 5CDFE 2FYQA 4DSNA 3B8JA 4OS1A 1ZD9A 4DLTA 1V2QT 3ZLJA 3R8CA 2XX3A 2BCGY 1FQJA 1RIWB 2WVJA 1BQYA 1ESNA 5HYOA 2RGAA 1BBRK 1C5RA 1DELA 4LRWA 1ANCA 1AZTA 3AV0B 2FSHA 3FANA 3FVFB 1CA0B 1OFUX 4IRUB 4B2LA 3GLIB 1YPKH 1NRSH 3T61A 4Y71A 1BMFD 5FR1A 4TTRA 4KO8A 2IS4A 1DE7H 1A3EH 1C2EA 4V0KA 4TPYA 2ONJA 4HAWA 2O8CA 2YOLA 4BFWA 4QG7A 2WV5A 3Q77A 4X1SU 4IC6A 3U60B 8OHMA 2GHIA 4ISOA 3ZZ8A 4PQRA 2A3RA 1K5GA 2XBXA 3I5YA 4YOJA 2OLGA 2QROA 3URCA 4Q1CA 4BAKB 5E0GA 1O5EH 2PZEA 3R8FA 2G5VA 1UTQA 3B13B 5EP1A 4IEEA 1IOEA 1KXEA 4XVRA 1UBEA 1G1MA 4JJKA 2A78A 1LS6A 4BEJA 4R2IA 1GHBF 3TK5A 2ZPQA 1QHSA 2BDBA 2RDLA 2QMEA 2CN0H 1THPB 2H5DA 2FV8A 3KJGA 2YC4C 1BTPA 4WXVA 4Y0YE 3SOPA 4ZDIA 1AY6H 1P60A 2GXQA 5AFYH 3SV7A 3E70C 1GJ7B 1P73A 1OOKB 1MT0A 1TUEA 5F9HA 2BHRA 2FMJA 1G7CA 1W7GH 1EWQA 2Q3HA 3M5OA 3B1XA 2EU8A 2F91A 1UCYK 3GCNA 2XWAA 3AKYA 1AFQB 2ZRNA 1FY5A 4CBNA 4AC9A 1E2DA 3L43A 2KSQA 2AK3A 1OV4A 1TNKA 3THWB 1ANDA 1HQCA 3IPYA 1AFEH 4K69A 4OI4A 4ZDWA 1V2LT 1DOAA 1HT2E 1ZAKA 1Q12A 5CK5A 1Z22A 5HZHA 4OGXA 5C1XA 3TR0A 2ZIAA 2P65A 3SFZA 2C98A 2HUPA 1SGEE 3UR6A 3UATA 1P2KA 4FCTA 4HB3A 3RM0H 1Y8TA 3SJOA 4H1VA 3WXMA 3SE0A 1WXRA 4NG9H 2WICA 1O39A 1Y3UA 2IF2A 1AZSC 3IO3A 1GWAA 4NYMR 3T35A 4AZ2B 4OI0A 3K09C 1P57B 2GK6A 2UUJB 3BAFA 3HKIB 2V8OA 2FPLA 1MRSA 1YKTA 1IQKA 1LB1B 4U00A 1J16A 4OBEA 3BIFA 1T5IA 1MRNA 2WWHA 3D8BA 1C1SA 1SVSA 2GVZC 2A2XH 2J7PA 1D5CA 2A5IA 1SQAA 2ZR9A 4LC0A 5EP2A 1IHTH 1PPBH 1GI0A 4PC1A 3RU4T 2C5LA 1UHBA 2FOMB 4RD4A 1GL7A 1LQDB 1O3IA 1G8YA 4ABJA 3M35A 3ZIAD 3KKMA 1G37A 2W00A 1OS8A 1HAIH 1QIXB 1HAVB 3LW7A 2HCJB 4KTSA 2ZRIA 4JMYA 5EE0A 1VGCC 4TYDA 1TGBA 2O8DB 2IC5A 3IDQA 2QXJA 2XJ9A 2BY7X 1SLVB 4CEJB 2CXXA 4DIDA 2F9UA 3W8NA 1XJQA 3STJA 4V0LA 3T29A 7GCHG 3ZZ6A 1T0HB 5DP7A 4DIEA 2B8OH 1TMBH 3N70A 2JLZA 1ZLRA 1E0AA 3F5FA 1W0JD 1YR6A 5DE3A 1OP8A 2I1QA 1W44A 2V9PA 2ECKA 4M1MA 3LGYA 5KDLA 2A7QA 1P03A 5CM9C 1BMAA 1T8LA 2H18A 3FAOA 1TRNA 4DLXA 1VG9B 3CBQA 2JATA 5TY0A 1JRSA 2R2WU 3ECCA 1KJYA 4LJ6A 4Q7XA 4TWZA 1YVDA 1BBRE 4BFXA 2C95A 3EXAA 5J4SA 4GHQA 1WBDA 5JRJA 1XTKA 4DURA 3NUMA 1BRCE 2VU8E 5ELXA 4KYIB 3MMPA 2W3KA 3SW2B 4WVFA 3K8YA 4QGAA 3EZ6A 2CMKA 3EA0A 4I7YH 1TU3A 2FX6A 1WCV1 2CE2X 2IPHA 2AIQA 1E9CA 1KDQB 4A8JB 3ZVNA 3ADCA 1OE0A 621PA 1U90A 3DMDA 1XU4A 1Y59T 1SHZA 2NU1E 8ESTE 2Z9LA 1UPTA 1A2BA 3LVQE 2XWBI 1YRBA 4HTCH 3FYHA 1CULC 2GZDA 3RS3A 5T6FA 2R44A 1XPUA 1BMLA 3TGKE 3MUFA 3CF6R 2PLFA 1C1QA 1WU1A 4Q1FA 3HGPA 1WQVH 2RGNC 2AFHE 1BBRH 3QXSA 1FQ3A 4IHQA 1EAIA 4D7FA 1N6HA 2C8WB 4BAHB 4Y7BA 2P6UA 1MMJN 3BF6H 4EQ6B 5EODA 1FPMA 1ZGIA 1G291 4ZXYH 3TIFA 1N6LA 4E07A 2Z43A 1X6VA 1RIWC 1RRPA 4YDSA 4BFYA 3PEVA 3ZVGA 1C2KA 3QSYA 5DJ7A 2BMJA 5IK2D 2QMHA 1Z07A 1S2MA 1NLZA 1D9ZA 2CK3A 4DDUA 4E5UA 5F8XA 1I4LD 1TX6A 3BRWD 1FP6A 4JL8A 2ZU2A 1BTXA 4X2XA 1YZGA 2R65A 5CIQA 2RHDA 4Z0KA 2G77B 4TTPA 5FPYA 3ENSB 3RYTC 2F4LA 3THYA 1DADA 2IF0A 5EP4A 4EKDA 2W26A 1G9IE 1D9XA 4WXRA 3CH4B 2ODQA 3OTPA 4TMWA 3M36A 1GMCG 2E1RA 1K22H 4X1RU 3FTQA 2CL7X 1US8B 3TPIZ 1ZIOA 4RKOB 3FHCB 1N5LA 1OT3A 2K5UA 4CEHA 4U02A 2QAJA 4QKQA 2IHYA 1AWFH 1F0TA 1O38A 1COWA 1GI7B 2IYWA 4KYUA 4ACBA 1TAGA 1B0EA 4LYAA 2FFQA 5FL7A 1X1SA 3CZPA 1C5XB 3M3VA 4Q2KA 3CRQA 3AP1A 1LO6A 5SZJA 3IO5A 2JIZA 3B23B 2OLJA 1S3GA 4HB4A 2BD3A 3PEUA 2Q6TA 2RH5A 5A8ZA 3K0AA 2BD5A 1P04A 1E9AA 2ZROA 5BN5A 3ZZ7A 2J9NA 2CHQA 4YLGA 1JAHA 1GBKA 3MAAC 3H84A 1OXVA 1C4OA 3CR8A 4BQSA 1WB9A 3FPAA 1LKBA 2G9NA 4NIVA 3LIWA 2WBLC 3A1SA 1QHGA 3JVVA 2ZAMA 1AQYA 3RXAA 4WJG2 1W8BH 3QENA 5DYGA 1VG1A 4BFVA 3QUSA 1BJVA 1GHAG 2RA0A 1E94E 4YMVA 1ZCAA 2PGQB 3DT0H 1ZRBA 1O3FA 3T26A 4TYWA 2ZNKH 5CJ2A 3CPEA 4UNNA 2PEYA 3MI4A 5CM8B 4JZEH 1SLXB 1CJMA 3LGTA 1O32A 5ETXA 3KFXA 3IGFA 1O35A 4D0NA 3NC0C 2Z9JA 2HT6A 3CRMA 3VFEA 1AE5A 2MMCA 2ZI2H 5T3HA 3UANA 5FXLA 1S84A 1ETTH 1TNJA 4DG4A 3L33A 4MTBA 1PPFE 3RXHA 2ZU1A 1E69A 2DBYA 4LJYA 3WNDA 1G7TA 3PUWA 4IN2A 2ZWLH 4B3FX 2CXVA 1KXAA 2ZXUA 2KBFA 2W83A 4U2WA 5EXMA 2XSZA 2WJYA 4GBMA 4KODA 2V7QA 3HDTA 4WMEA 3SR0A 1L1GA 2QMUA 4AG2A 1QG2A 4CEIB 4M4SA 5EJEA 2W2XA 3UKDA 3F9EA 5GDSH 3Q5EA 1O2MA 3RC3A 3PUZA 1XPOA 3CZQA 4OQMA 1J2JA 4MGYR 4CT5A 4ZPXA 2I6SA 3AF0A 2OAP1 5BWMA 1P75A 1G3UA 3M61U 2H9EH 1AFQC 5EQTA 2WV4A 2I6QA 1ELCA 1HYLA 1P2JA 3U4QA 1P2SA 1ZJDA 4EPXA 2UUYA 2ZPTX 1O34A 4D0LB 5FOXA 3WRXC 3TE6A 2ZTXA 4X1NU 1KMHB 2G1JA 3SYLA 2J92A 2WAXA 1DPOA 4XOJA 1O2UA 3MU4A 1DWEH 5TXGA 2WTUA 2Z9KA 2QXGA 1G4UR 2PCJA 2ZRKA 2ZRJA 3HP1A 3AP2A 1S6HA 3S9BA 2Y80A 2IYTA 1NRNH 3W3AA 4NYJR 1T6NA 1OYQA 4Q9KA 1N6XA 1S5SA 1KMQA 3UQVA 1GDDA 4JLBA 4FUIA 1SXJE 4YQFA 2TGPZ 4INLA 1LHFH 3DL0A 3X2SA 2DYKA 1L4UA 1ELVA 2YOGA 2J87A 3MNBA 3HPQA 3F8TA 2ALVA 4DRZA 4HAVA 1QBNA 4M0LA 4B6FA 1Q20A 1O36A 1K1MA 1A4WH 4ZKSU 1CJTC 3PYHA 2ZITA 2TGTA 1MO5A 1S9HA 4LZ4B 1NT1A 2IYSA 5JBBS 4GCHF 4HB2A 1RTFB 4CH8B 3ZD6A 2ZR0A 3A80A 4X1QU 1SKQA 4D9RA 2QEQA 3EG5A 1K8RA 4DLZA 4CRFA 1EPTC 1W7XH 2J0QA 4RZ2A 4AB8A 3A7YA 3KKNA 4JKIA 1SSXA 2VIVA 1X1RA 3FB4A 1UVSH 4FXGH 1ZUNB 1SVLA 1O3MA 3LBHA 5EXXA 1CBUA 5SGAE 1C1YA 4RFVA 3M5NA 4WWYA 1T9HA 5FPHA 3H5CB 1CHGA 3SBDA 3TIUA 3OEHA 1N5JA 3B78A 1D2MA 1E32A 2OILA 4AYVB 3SZRA 4FWTA 1F92A 2JETC 4B3XA 1P10A 3BBPA 4GP7A 1QL7A 4ABHA 2Z3CA 1YYY1 3NWUA 1AKYA 4FU8A 3ATMA 3E91A 3ZZUA 1P5ZB 2MSEB 4DJTA 2BVSH 1EASA 1T5LA 1GPZA 1KNXA 1O3DA 3T5FH 5JRZA 3T1OA 3PG5A 3R9IA 2WOJA 1CGJE 3PEYA 1MO6A 3MRSA 3BG4B 1W7AA 1TPPA 2ZCHP 4JBXA 1QA7A 2TBSA 1M1YE 3OE7D 4CF7A 1BHXF 3I8SA 3G82C 4C0SA 1BIOA 3TITA 1CGHA 3GY7A 1O5FH 3FOZA 1EGAA 1MAYA 1AI8H 5JMTA 4SGBE 4X8OA 2RHMA 3DPUA 4NSYA 5EQSA 2DR3A 4TYPA 2A32A 3OZXA 1M9UA 1B7XB 1XXHA 1NFXA 3CUEF 3AF4A 3Q7QA 1A2KC 1FV9A 5GJ4B 1T8OA 1BA8B 4ZUHA 4BTTB 1F2UA 4HAYA 1Z8IB 1OWKA 1UJ2A 2VYFA 4KV9A 5FBQB 3RU4D 2REOA 2VIDA 3DM9B 1P72A 3KF2A 3MO3A 3EA9A 2QPTA 1OB2A 2BX3A 2H6MA 2QE7A 1G5PA 1DO0A 3UUZA 2QC2A 2JJ2D 2J7PD 3RHFA 2RGCA 4UKDA 5CITA 1O3YA 4M1SA 3GJXC 2FOEA 1P05A 4Q4AA 2EEKA 1XMIA 1SGFG 3LGUA 3EZ2A 2Q0HA 3IKJA 1ABIH 3PTBA 4IDPA 3TK1A 3IG6B 1O2XA 1XJCA 1E2PA 1ZIPA 4AORA 5CYOA 4D7GA 1NRRH 3A8TA 3OFNA 2FSGA 5AJXA 4ASUA 4CYMA 1AO5A 5BXQC 4HB0A 2J3EA 4JLVA 1LPZB 3LBIA 1N1LA 1SQTA 2LKDA 4BEBA 3FMIA 4UE7H 1UMAH 1EPTA 4K8BA 4Q9HA 1NN5A 1V2KT 1KHTA 3H7OA 2O8EA 2AWNA 1A5HA 2ORVA 5DYIA 3CRRA 3HK3B 3W95A 3Q5DA 4OK3A 1J8MF 4Z54A 3OEED 2VP4A 4JLPA 4DGJA 4M8NE 2ATXA 3WMEA 5EXPA 4F49A 2QQ0A 2NO0A 2ZAOA 1B0UA 1HB0B 1DANH 1S0UA 3CRVA 4LSGA 1DARA 1MUEB 2UUFB 1FTNA 4JKYA 3UREA 2A4RA 1BIFA 1EJAA 6ESTA 1TGSZ 5FOVA 3PCRB 2GGVB 2CJWB 4Q7LA 1VKJA 1XTRA 1SLUB 1O3AA 1UKYA 2CGAA 5GXPA 2V4ZA 4NCHA 1G32B 4FUDA 2VIQA 3HYRA 1QQ4A 4WIAA 1MTUA 4RD6A 1XUGA 1J17T 1HQYE 1XBTA 1EQ9A 1IOZA 2C96A 4G5RA 3LH5A 4YC7A 1MO4A 1A1VA 1Q2WA 1GI6A 3PO1C 1EPTB 5E0HA 2PEZA 2F6RA 1LPKB 3LX8A 1FAKH 3A86A 1EP5A 1L2TA 4X6OA 1W10U 4QT8C 2TGAA 1G3CA 2B9LA 1E99A 2YNAA 2OQ5A 1MH0A 2BBSA 2CNWA 1YCPH 1Z0DA 4MDEA 9ESTA 3KKOA 3BTHE 4EQ6A 1JXPA 5F98A 4G5SA 1ZM7A 4JVSB 4WA7A 1GFIA 4TZ0A 2A30A 1GNRA 1F5KU 2JLUA 1L7VC 2PLRA 3GPLA 4D26A 1HAZB 1HEIA 3U5ZB 1N6RA 1TYNA 5FTKA 2R0LA 4DIHH 721PA 4N1AA 3GCOA 1P0SH 4CBOA 1NF3A 1ZNYA 2FOBA 2J2UA 2A5GA 3A7XA 3B2EA 2IWHA 5A5GA 3I32A 3MWJA 4PQFA 5AJVB 4C0BA 3W94A 1XF9A 1UVUH 5AK0A 1NY6A 1SXJD 3BK7A 1XMJA 4B33A 1CKEA 2Z5FA 2Z0MA 5TMPA 2RGDA 1KI4A 1LVYA 1H1BA 4PO9A 1GBCA 4ZKRU 1A3BH 1MZAA 3L6PA 2QENA 3VX4A 3SU2A 1TUIA 4KXFB 1E3MA 3Q00A 1SGWA 4GFDA 1ZRHA 2VH5R 2NOAA 3A7ZA 3CX8A 3QBVA 5JZVA 1XTJA 4A1VA 2ZI5A 1ZW6A 4CEHB 1OXTA 2O8CB 5LPRA 3TJOA 3ND9A 3QQ5A 2SFAA 4RY2A 1HAPH 3QOFA 4UNRA 5B30A 4M1WA 4LHZA 1F5LA 5G3ZA 3OIWA 2DFNA 3K9GA 3WYFA 2OV2A 4DCTA 3RXSA 5FUXA 1JB1A 4JYTA 4X8MA 2IUUA 2P0EA 2Q1JA 2Q3FA 2PT5A 3H86A 1CGIE 2ZHEH 2J5XA 2W0SA 3QEOA 5B2ZA 4B75A 2IYVA 1NVVQ 1NKSA 2D3WA 3OYPA 1KI3A 1FY1A 4NGAH 2P8OB 3B9PA 3EAJA 3SGBE 1VYUA 4RN6A 1O37A 3LGWA 4K8YA 2F9VA 1W1WA 2VVVA 1NVXQ 3D62A 4YMTA 1KJWA 2RA3A 3SV6A 4TT3A 4KBGA 1OYWA 2Y8EA 4YMUA 3EC1A 4X8TH 4X2WA 1OKXA 3V7TA 2OBMA 1NP6A 1HJ9A 4MRSA 3SU0A 2PR3A 2BLOA 4Q7YA 1EK0A 1DE0A 1NTPA 2G1KA 4UNSA 2J45A 1J70A 1WQSA 1FNNA 2OFWA 5ESBA 2FLRH 3ZD7A 1BTYA 2CE7A 1OFIA 1RFNA 2PT7A 1NY22 4M9FA 4OGYA 4I1UA 4TYQA 1PPCE 5KPDA 1ELFA 1N8OB 1MKWH 1OXUA 3QGNB 1Q44A 2ZI7A 3Q7PA 5EG4A 3A85A 2BY8X 4UXJA 1A61H 2XC4A 4B73A 4URZR 4M9XA 3LXRA 1NSTA 1ZM4A 1VECA 5FBLB 5FBEA 2XEXA 4IW4E 1FY8E 1TPOA 2GKSA 3TGPA 1AQUA 1MABB 3V13A 2YV5A 2I1VB 4CHAC 3C27B 4AGKA 2IX3A 2PHBA 4QGFA 2GCTB 2D8WA 3MNSA 1Z8JB 2A45B 3RS2A 4IS5A 4YO9A 1BHXB 3IILA 2J7KA 4I8GA 2LKCA 4JT2A 1E4YA 4WVPE 3R9WA 1T4VH 1P7CA 3QPVA 2NO1A 3CNNA 1ZHMA 5TJXA 3F3YA 2AMDA 2C93B 1CRPA 3PB1E 1D2NA 3UWJH 5JWRA 1G6OA 1S8FA 3A1VA 4C0JA 1JXOA 3EA7A 5FBWB 4ON9A 2WWGA 2CV3A 5K8LA 2Y81A 1GKIA 5FUWA 1TF2A 5JLJA 3Q8XB 4JZIA 2ZCKP 5K8IA 1C2LA 4FMBB 5K7RA 2THFB 4D82A 1HT1E 1E0FD 1DDJA 5E7JA 1QBKC 1Q1ZA 3W8RA 5JJIA 1F0SA 4J1YA 2ZO3H 1NFYA 3EPKA 1UHBB 1RYHA 2AMPA 2B7BA 1QY6A 3MU8A 1QBVH 2O8DA 1BOQA 1FN8A 1ELEE 1ESMA 4ZKEA 1OX1A 1MAXA 4XVUA 3D23A 1SZPA 5DHFA 4LHWA 1EJNA 3SGAE 5E95A 1R5BA 1ELBA 1M2OB 2FX4A 4C0KA 1CRQA 2DFKB 2HJVA 3KQBA 4UDWH 4G01B 4QHYA 5HMAA 1ZD8A 5C5OA 2J41A 1GI1A 5GNDA 2ZFPH 1A7JA 2OM2A 4D4MA 1V3XA 2BXTH 3S69A 1DWCH 1GDNA 5KO2A 1FUUA 1D9IA 2XZOA 1XB2A 4GOKA 4NBSA 2J94A 3ZH9B 1PJRA 3TAUA 1FIZA 2HPQH 2JAQA 4MDFA 4PROA 3F6UH 1EX3A 3BH0A 4LY6A 2FI5E 1G21E 2OCAA 1P12E 1J8YF 4RFSB 3GY8A 2OD3B 2H2ZA 4RI0A 4TMTA 1GBAA 1P8VC 3CWQA 4FUFA 1O30A 2PH1A 4BXSA 3M3TA 2H17A 2H5EA 2STAE 1YJ5A 4ZCIA 3LW8A 2B8WA 4Q47A 2H1LA 3NDBB 2VB0A 3SS8A 1EATA 5DSZA 1AGRA 4BWYA 3E90B 2QYIA 4J0QA 4RKEA 1KY3A 3MCAA 2ZGBH 1AK2A 3HU1A 1S4QA 3VTKA 3T34A 2VGCC 3TU7H 2D7CA 4ASUD 1BH2A 1QNJA 2Q6FA 2F9PA 5L30H 3GJ5A 4AI6A 5CE1A 1KLIH 1HXFH 3R0FA 3M1IA 1RKBA 4OI1A 3RMLH 4LDJA 3Q9LA 1C1RA 1VITH 1XXHE 1TRMA 4NWLA 1KI6A 5HKKA 3J81k 5D3MA 3B1VA 3OY5U 2F83A 1II9A 1GRQA 1ETSH 1A5GH 2YWEA 4C2UA 5F6MA 2Q9CA 2G3YA 2VH6A 1H8EA 2BLQA 4IOJA 5HTKA 4D81A 2D2EA 7LPRA 3K9XB 5SZKB 1KI7A 5FUYA 1XTIA 3B9QA 1SGFA 2ZJBA 4A6XA 2EFCB 2ANMH 1GI9B 2ZG0H 4XBBA 3AGPA 3AW1A 4DSTA 4I8JA 1OIWA 1G8PA 3JZMA 3TSZA 3EZ7A 1E2KA 2BMEA 1WOFA 1KSFX 4Q9LA 2NO9A 4DUGD 2VSFA 4UXHA 4JL5A 4CHAB 1YLCA 3C16C 3H4MA 3L8ZA 3THYB 3THWA 4LJAA 5T1VA 1W5SA 2XTZA 4I8LA 5J4QA 2AFIE 4LWZA 3M5LA 1NMYA 4MYUA 3HPRA 1FI8A 4DW2U 2ZJYA 4SGAE 1UBFA 3L0OA 2J4IA 1WTHD 1GTVA 4RSGA 4Z8XA 1CHOG 4ESTE 1AA9A 2W3IA 1KZ7B 2ZGHA 3OESA 1Z5ZA 2G4UA 4IVQA 3P26A 2BDCA 1FNMA 3F9FA 1NBME 3QKRA 1IQFA 2WINI 4C4PA 1E0KA 5J40A 2OAQ1 4X2YA 1O3EA 4UJ5A 1P2TA 3QX5H 2C8XB 5KOYA 4KSBA 1VCIA 1E2FA 2GF0A 4Q9JA 5JS8A 2HYIC 4GZMA 4U32A 5FOUA 1BKDR 2KB0A 3ATIA 3MWIU 4EJSB 4NMMA 4TL9A 1NBMD 4UFGH 3FP8E 2AIPA 1ZJKA 2A7HA 4NCKA 2ZJ5A 1XEFA 1KSHA 3VB7A 4A2QA 3GJ7A 4CREA 3Q85A 4LBZA 1JPNA 3PUVA 2ZSAA 5ESTE 3RLWH 1V6DA 1IN7A 3UPEA 1UADA 2D2DA 3EA8A 4YLUA 3CRW1 3LLUA 3MOCA 1EXFA 3LQQA 4WF8A 5TVKA 2FP7B 3GDUA 4P4SB 4LOYH 1AS2A 3MYWA 1TEXA 1CA8B 4RZXA 1AVGH 1CT2E 1E2GA 2QAGA 1Y5AT 1ZNWA 1Z83A 3E5HA 2OCVB 1X8KA 3N5CA 4M9QA 1MKXH 1D3PB 4K8OA 1EZXC 4I1OA 4FVBA 3PWCA 2RGBA 2BEKA 1TFXA 4CDGA 1KKMA 2QCYA 3T1TA 3WY8A 2ZI3A 1QF9A 3Q72A 4DXAA 4NIXA 3QXHA 3T25A 3ZVDA 1KNQA 2A7JA 1CR2A 2VVUA 1UO6A 1R5NA 1YZQA 3CIOA 2WPLS 4A0FA 3EPJA 3UFAA 1ZPZA 4TSFD 4MITA 2Y5HA 4FUGA 1BJUA 1P2OA 3RXUA 2R2MB 5CDFA 4P4TA 3A87A 1AUTC 1YLDA 1AIXH 1LHCH 1ZOMA 1EFUA 1FDPA 1TWXB 5DNYB 3KQLA 7KMEH 3RXGA 5HGGA 2WWFA 4G1UC 4FN5A 3GLFE 1XUIA 1QRXA 1O2GH 4NCIA 1OPHB 3BXZA 1RS0A 2WJVA 2P16A 4Q1DA 3DFJA 2ZTYA 3LJOA 2GA8A 2A5KA 2CEAA 2WSSD 2FNAA 3LD9A 4CRBA 3LRPA 5AJZA 1RRFA 3LAWA 3SN8A 4YM9A 4IOMA 1C5WB 1C4V2 4GSYA 1SXJC 1Z6XA 1DAEA 2ANYA 2G5NA 1P3JA 4TLDA 1KMHA 1FQKA 1ARBA 4EJSC 1JQLB 4QJ4A 1QHHA 1QFKH 2F43B 5TARA 2GEDA 3QPWA 2C2HA 5FAHA 3K0SA 8KME2 5AHGH 3L0SA 1JPJA 2Z83A 2XTMA 1OFTA 4ABFA 3ELAH 3AVPA 1E2QA 5B6OA 3U1JB 2HRVA 2UWPA 1C5VA 4NA9H 3MG9A 4DHEA 3VFDA 1AS0A 3UPUA 3WMGA 4GAWA 1MKWK 2BMGB 3SN6A 1C5TA 1C1WH 3U7GA 1HJAC 4ARZA 2GF9A 4WBSA 1IQEA 4YDHB 1Y3VA 1GMHG 2VPPA 4IDOA 3AVUA 4Q02A 1N6YA 1DXPA 1UK2A 2Q21A 4K81B 4PHHA 1ZPBA 5J4KA 1OSSA 4FXPA 1TOCB 3RMNH 4AOQA 2QGRA 3SORA 3U2QA 4WMDA 1DXWA 1E9FA 4LJ5A 3NBXX 4Q66C 2ZDNA 1HAXB 4WXIA 4I99A 1YE8A 4MPUA 1TMUH 1QL8A 4F4IA 3DZDA 2EQBA 3RXIA 5C4GB 4CW7A 2X2EA 5DP3A 1DBSA 1O2PA 1CBWB 5D3QA 1TNLA 1IXRC 1QRAA 1Z1IA 1PQ5A 3OU0A 4B74A 2BWJA 1EAUA 1EX7A 4JL6A 3OIUA 5E7IA 3CNOA 3AVVA 3LGVA 1HAYB 3E1SA 4PAMA 1PYTC 3GJ6A 3VQTA 3W3ZB 2CK3D 5LH8A 1C2DA 3WYGA 3BEFB 1KZGB 4JVMA 1JXMA 3PITA 1VTKA 5EUQB 4FMDB 1T4UH 5JWHA 2DPXA 2Z3DA 3QF4A 3MO6A 2VINA 3HR8A 1J99A 1NJGA 1V2WT 2BB4A 4Q7ZA 1LTOA 1E9RA 1IXSB 5FL7D 4PXAA 2HNTC 3K65B 2OLKA 1NVWQ 3KXLA 2G8TA 3BN9A 3GLHA 3S9AA 1CR4A 1IHSH 4WZAE 1BTZA 3SNBA 1RFLA 2QF0A 5L3VA 1P6XA 1AZZA 2WKRA 2VF8A 2A5JA 4JYBA 3TVTA 5FTJA 4I8HA 2VEDA 5IDVA 4LUCA 4EDHA 1ZR0A 5A09A 3KXIA 1X86B 4BGDA 2GJKA 1Z0FA 1WRBA 3ZVRA 1VR1H 3N2IA 4A6LA 1O2IA 2PFEA 1GKYA 4GT1A 4D0GA 4X8VH 2HWLB 3SUGA 2ULLA 4TLBA 3GYMA 2E9SA 3DZ8A 2PW8H 4EFMA 1FN6A 4QL3A 2PWXA 3P20A 5TDHA 1T0JB 1GAJA 3MO9A 1GHVH 3T1VA 2PLXA 3KUDA 1F2UB 2OC1A 2TMKA 4L8GA 5KSOA 3WNBA 1SHKA 4ZHAA 4P32A 3D65E 2BBOA 1E2EA 3O8RA 1RPZA 2ZRCA 5E8EH 5BQ5A 4E22A 4LYFA 2J0VA 3UXMA 1QJ1B 3AB3A 3TUIC 3GY5A 3ZZAA 4QBHA 821PA 1JI0A 1AU8A 2ANCA 2ZE6A 1TPSA 3FKSD 2Y82A 3X1YA 3KXKA 3RRYA 3PV0A 3OEHD 3U44B 4P3YA 5FOWA 4Q4AB 5GADl 1S0QA 1Z8GA 4DCSA 1IONA 4MH0R 3TJZA 1ZYOA 4FD2A 2ASEA 5KSYA 2LNCA 2IL1A 2DWPA 1N6IA 1QHNA 4H1UA 1RIFA 3FFAA 3C1KA 5C2ZA 1P2MA 2OUKA 3CW2A 1OWHA 4DLSA 3CLVA 3HGNA 2IYRA 2YVUA 5F3WB 5DN6A 3T2NA 2QRNA 2GZ8A 4QHSA 3O47A 4BZQA 1E9BA 3BERA 4B71A 3A36A 2G00A 4B6EA 2HDNB 5T6DA 3RP2A 2XC5A 5CB8A 1EB2A 3AAUA 3ZYDA 2QPOA 5ABWA 2JLYA 3RXJA 3P27A 1VIYA 3MLEA 1OIXA 3IIKA 4PR0A 3LKWA 3I61A 5CYPA 1PLJA 3BFVA 1ZTJA 3GFTA 3QE0A 2V6IA 4A4DA 2C8ZB 4H9GA 4ZDJA 2QORA 1KIMA 3UY9A 2WSSA 2XJ4A 4RZUA 1BRAA 3KJHA 2ODEA 3ZS9A 3OSYA 3GLGE 4XVQA 1J90A 4RKJB 1UCYH 2NO6A 2ONKA 3EX7C 1FPHH 5JB8S 1PZNA 4G0NA 3WY9A 2VP2A 4DJZB 2GJ9A 1D4PB 3F9HA 2ZU6A 3DKVA 3BEUA 4XFQA 1V2TT 1EZQA 2KBEA 1OP2A 2DY1A 1KI6B 1KXFA 2OBOA 2RAPA 3U8RH 2P3UB 4L5BA 1DWDH 1HTWA 2QNRA 4M1KA 4MLFB 1LF5A 3TUZC 4KAXA 3LONA 2FMXA 1YM0A 2CLSA 3G5UA 1SGQE 4LZ1H 5FI1B 2KWIA 1J9CH 2BKUA 1W36D 2V3CC 4MKGA 2FFBA 5P21A 1NNEA 1HIAA 1CIPA 1NRPH 1R10A 1OH6A 1JJ7A 3ODDA 4RD2A 3F1SB 1TMTH 1P3CA 3HPTB 421PA 1GBIA 4XBCA 4YMWA 3I92A 1NVUQ 1Z0JA 4FVDA 4QBGB 3GJ4A 3FFGA 2VIPA 4JLAA 1GHXH 2CLDX 1W14U 1O3PB 3KB1A 2JLSA 2WIBA 3EZFA 4NA7A 2B8TA 1MU6B 4ZAEA 3DHKH 1D6WA 1XEWY 1KDQA 3QG1A 4V0MA 1TONA 4JVNA 1NMXA 4P4UA 3GEHA 4R2HA 1UKEA 1UM8A 4X6NA 4AYWA 1P9SA 3U8TH 4BFZA 1W2GA 1ZPCA 5AR1A 2AS9A 2XNIA 1RC8A 4Q21A 1Z71A 3CX6A 1AKSA 3CPJB 3QZRA 2XCFA 1ZTLA 4Q03A 4DVGA 1FUKA 4Q80A 3UIEA 3I4LA 1GVZA 1ZMLA 2NPFA 3SU6A 1QRWA 2WUCA 5DGXA 4A0HA 3HR7A 4B3GA 3NHBA 1K1OA 4YOGA 1EB1H 3QF4B 1W5TA 4HUTA 3GJ8A 3K0FA 2VGCB 4OHZA 2R6GA 1ANBA 2AXPA 2Y7ZA 4NPHA 5LB2A 4L16A 1WV7H 5FOSA 1T91A 1GRNA 2X19A 1GL9B 1HNEE 4C0AC 1E96A 2XBWA 2XYAA 1G16A 3LT3A 2LCFA 4FUJA 1QBOA 4RCYA 1C1PA 2NTYC 1XXFA 1KSJA 2XITA 3R9XA 5E7MA 3Q76A 1CQQA 1GJBB 5JEEA 4YXWD 2QPAA 2FGJA 1RZ3A 4MPXA 5E0JA 2Z4SA 4MQBA 4K60A 2BDAA 2G0NA 4HGCA 1LF0A 3AVYA 1IQNA 4Q5IA 1TX7A 1DAMA 3GCGA 3A7WA 2HVXA 4ABDA 1HAOH 1A1RA 2JCSA 4BASA 1U0HC 3PENA 3RMMH 5FUVA 4AD8A 4D80A 1QTFA 1KK1A 2NWNA 3UNQA 3IWMA 1C5UA 1KLJH 2DWQA 5C1YA 4MGZR 2XTTB 3M5MA 5JCPA 2JJ2A 5KSPA 4V0ME 2G83A 4E09A 4B2AA 3K53A 1BB0B 4FUCA 3UTUH 1KY2A 3ZVLA 3LLMA 3IEUA 2OG2A 2FI4E 5B58C 3H1TA 1TABE 4M53A 4BLTA 3PMJA 3K0AB 4LXBH 1W36C 1GL1A 1QB9A 2GTPA 4Z8YA 2GNOA 2ZANA 4BFUA 2FZLA 4OS7A 3GDSA 2ZFQH 1GBTA 2FTMA 4GHTA 4BANB 5DPAA 1YBWA 2C9OA 2CHAC 4ABGA 1P61B 4NTZA 1D3QB 3OY6U 3RXQA 2VSOA 2CHGA 1ZD1A 1MCTA 4CEJA 3EAQA 1OFHA 3OEEA 4LGMA 4MUAA 3A84A 1DICA 1DUAA 4UFEH 3GCHC 1AJEA 4ESVA 4JIMA 4D4KA 1W0ZU 1RJXB 2XXAA 5EGMA 1QHYA 2O52A 3ZVEA 2ZF0H 3MSXA 1SOZA 2ZYWX 1O2SA 3A83A 2CBZA 3PV5A 2ERYA 2A0QB 3STIA 2D7DA 3BTGE 2PL3A 1GJDB 3SYNA 2O8TA 5E3HA 1DS2E 4H4FA 1KDRA 4B2IA 2MSDB 3VEQB 1EOJA 1LHEH 1DY8A 1QCPA 2OFOA 3KL6A 1BMFA 1EOLA 2VWNA 3LV8A 2CDNA 4FU9A 4ZH8A 1VHLA 1CR1A 2OESA 1NM6A 4HUQA 5HE8A 3RAPR 5FX5A 4ABBA 1S81A 1Q1BA 2CF8H 5HM2A 1ETUA 3UQOA 4BLOA 3RXEA 5F8TA 5EXLA 3RC6A 1UDXA 2SNWA 2WV9A 3RANA 1K5DA 1NN1A 2FPMA 3UNRA 2H1UA 1QHIA 2WMNB 3U6KA 2J95A
chains in the Genus database with same CATH superfamily
1M2OA 4O2BB 2DULA 3MERA 3ER8A 4DA4A 1N2IA 4WASA 3ABZA 4PC7A 1BS1A 1O5CB 4BKRA 1RAAA 3LUAA 1C2YA 3DE6X 1G17A 4ZU3A 1BMMH 5CLQA 1CU1A 3GT3A 3DMRA 2PZFA 4PG6A 4ZVRA 4A7IB 2IHUA 2VP9A 3NDPA 5JZBA 3TCXB 2CB0A 1L7BA 1VBNA 5KI6A 2P9JA 4TWJA 2PX6A 4J03A 2PA3A 4ZGBA 5CT4A 5G4KB 1T8UA 2DQYA 4B6JA 1Q6ZA 1WUJS 4POAA 4DLRA 4IMZA 4KFSA 3A7TA 3HKJB 2HLHA 3ANTA 3M5DA 3KHVA 2J98B 3IUEA 3K5PA 6YASA 1OH8A 3W5DA 5M29A 2L0XA 2RGRA 2Q5FA 1T8YA 3ZC3A 4B46A 1DS6A 4YT7H 2ZKLA 2AZMA 2D1FA 1EHIA 1N3YA 2ZJ4A 3NM6B 5JMOA 5HRCA 1U1CA 2Q07A 4KJXA 4R1TA 4QBFA 2C8YB 2OYSA 4WZAA 1W13U 2NZ2A 4TTIA 4MHOA 1EVQA 1B0FA 2C4WA 3G89A 4GP6A 4QOSA 5E9WA 3M6IA 4TVBA 2O8WA 3U31A 3CZCA 1H1LB 4EEXA 3FBGA 2BBTA 2E87A 3J80A 1IB6A 1Z6YA 3DE0X 4CKBA 1J1UA 2GM5A 3PFIA 5C67A 2X86A 4P8RA 4Q7KA 4TV8B 3I78A 3NKKA 4D57A 4F5EA 4BTEA 4G0QA 4MI6A 5BVGB 4X7PA 2H5LA 4UDNA 2FQYA 1KTSB 1YCGA 1SFRA 2P59A 3BXOA 3HGQA 3LRTA 2DX7A 2AH4X 2O05A 4HUQB 1LVGA 2PKXA 3DDSA 1M0EA 1T3TA 1Q0QA 4OG2A 3C3WA 2IEBA 5KTRA 3SHAH 3BB1A 4O4IA 3GYLB 2FFHA 4FT2A 3C5VA 4P5PA 3PYMA 4XPIA 1J8DA 1Q31A 3B48A 1LVBA 4R54A 2IYFA 4QDKA 3HWX1 2ANBA 5E4FA 3L7YA 5F73A 4B6GA 5FULA 3ZEAA 5EL0A 5C1BA 1FX0A 1ZMOA 3R74A 2JLRA 4FNMA 3MLBA 3W4JA 2A4GA 2BMAA 1PT7A 1FXYA 2QD2A 2RHLA 3ORQA 3PJFA 4LYJA 1QKJA 3E8XA 4X6XA 3LU1A 3RBAA 5BN3A 5BXYA 2ODWA 3RC5A 4KE6A 3ZZ1A 1RQXA 2WJ6A 3QGJA 4NEQA 2I6FA 1T5DX 3FSEA 3T28A 2ZCVA 3A05A 3IT2A 4DW8A 5HUQA 2ZUEA 1Y3AA 3DKKA 6LPRA 1A4UA 1P2FA 3E2IA 3V42A 2O2JA 4F5YA 2ZJFA 2LWIA 1KVUA 3D2BA 4PX2A 5CHAB 3OT1A 5B1HA 1DQRA 2ZWIA 4D45A 2BF7A 5AVYA 2BR4A 1D8AA 2FEWB 5LZ7A 7GPBA 1EDZA 1TQ4A 1RQ7A 1UPAA 4OLHA 4QDOA 1KFJB 4KL8S 1R1DA 2HIMA 3F3MA 3IUBA 1W0JA 1JNYA 2ZSDA 4LBWA 3ZWQA 2D74A 2BC9A 3IEXA 2YN2A 1E9EA 1Z13A 3GCHB 1JJAA 3CZRA 1HURA 3GLHE 2JBHA 2LTAA 3AF1A 3KSRA 4C29A 3ZZ9A 1YQEA 5EIYA 2P6PA 2YWDA 1XVVA 1P9RA 3DF9A 4P82A 4F6CA 4ZYXA 4OHYA 2J0UA 1THTA 1PUXA 2VAWA 3MWLA 2C9ZA 5D3MB 4UXIA 1VQ1A 4X7BA 3R20A 1T9KA 2EX0A 5G0VA 3UOUA 3K1JA 4G1CA 4O2RA 2PIDA 6GPBA 2Q6GA 1Y1LA 1PQYA 2CDRA 2G81E 5EOKA 3E3AA 3FKSA 1XNHA 3IITA 4D96A 1V2MT 1V2PT 3KGPA 3GVXA 4G1VA 4HWOA 4R84A 1U8CB 1ONBA 1D1QA 3GRPA 5K0LA 3HXTA 2YL2A 4QAJA 5DJ5A 1M8PA 2FW8A 3TNLA 3WGYA 2PE5A 1Z4PX 3IV9A 4ALLA 2AA3A