4B74A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
645
structure length
645
Chain Sequence
b'GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 208
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b74A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b74A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b74A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b74A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b74A03
3VGCB 1QA0A 4TQAA 4ZV4A 1O33A 2BXTH 3TKLA 2FMJA 1LCYA 1T4VH 5T6GA 5EE5B 2C8WB 5GJCA 3SUEA 2QMOA 2X1VA 2GWHA 4X2VA 4Q7JB 2ZYWX 3KQCA 5JWOA 1SZPA 2QM8A 2F9PA 2WKRA 1GI1A 4BAOB 2IWRA 1YPJH 2W00A 4M4SA 4BZPA 3ZH9B 2O8FB 1G3IA 3GJ4A 3EZ7A 4NPHA 2IX3A 4JLOA 3QENA 2LNCA 4NU0A 3WMEA 4ASHA 3U7HB 1BDAA 2IOTA 4I8HA 2Q3HA 4FCTA 4DRZA 1M9UA 1TX4B 3SI4H 1Q57A 2GDJA 1QHSA 4NCNA 4AKGA 5FBIA 1IN8A 1Z6YA 3BG4B 4JMPA 4ZH8A 1Y63A 1X8KA 4BEJA 3T1TA 2A32A 3AW0A 3CM0A 3ZS9A 5GCHF 1FY5A 2NPIA 2XYAA 3IO5A 3TLOA 2O9QA 1M74A 5BN5A 4UFEH 3PCRB 2ORVA 2IYXA 2A30A 5JEEA 5FBQB 1K6MA 3DM9B 1M7GA 1BRBE 3WY8A 3BH6A 1C1VH 1A1VA 4OKSA 2Z9IA 4OJQA 1O2SA 2B8WA 1ELOA 4PO8A 3SORA 2P2LA 1BIFA 1UBGA 4QBGB 2A0QB 4D4MA 4YOIA 1LW7A 2P5TB 5DP7A 2JJ2D 3ZVNA 2YC2C 2ZYUX 4I7YH 4D9RA 2GK6A 4RZXA 1MRSA 4DKXA 1C5QA 4HUTA 1C1YA 1E1QA 1FP7A 1TQ2A 5CB6A 3U8OH 1V2JT 4E22A 4Q9IA 3GLIB 3SU1A 4XBDA 3BC1A 2VQSA 5FUYA 4JJKA 1F5LA 2ZS9A 1SGQE 2QE7D 4ACBA 4LDJA 1KO1A 4NIXA 1D3PB 2FLBH 1H8ED 3ZVLA 1N6OA 4M1MA 4P33A 2WAXA 1VG8A 3KN2A 2A7HA 3AW1A 4IRUB 5BN4A 2H2ZA 2R6CA 2HT6A 1XXHE 3EZ2A 5GADl 2ODBA 1DELA 3L3TA 2H5DA 4ABFA 1ELCA 1GI8B 1W5SA 1IY1A 1FAXA 2VWNA 1KI3A 1XFAA 2A4RA 1UPTA 3R0FA 2D62A 1WBGB 1DO0A 2QP9X 3WYFA 1FUJA 2UUJB 1FUKA 2O8CB 4RSGA 1Z0FA 4FVDA 3D3QA 1YR7A 3VB7A 2OQ5A 2ZJYA 3PLKA 4GSOA 3SU8A 3HYTA 1O5CB 2ODYB 2ALPA 2VHUA 1PYTC 4M1YA 1GI0A 1E79A 3VR1A 3Q9LA 3HPRA 2ZDMA 4ISLA 3KL4A 4NDZA 5BWMA 5BPEA 3L0SA 2AR7A 4PSAA 4OS4A 2BHGA 1M6NA 2ZHQH 5EG4A 2VP0A 2PSYA 1FTNA 3MRSA 2O8FA 2FTLE 3GLIE 2HEIA 1AM4D 3ZDQA 3G0HA 3F9FA 3DA9B 4CBNA 3WBKA 1Z8FA 5LDDC 3IG6B 3THYB 1CE5A 1S1MA 2Y5GA 1YZTA 1HURA 2DBYA 3SE0A 3VKGA 1XX6A 1DWBH 4Q01A 3FFAA 1P11E 1CHGA 1DY9A 3FTQA 2VIOA 2Q0HA 1NU7B 3BIVH 4NCIA 1P2VA 4UD9H 1XMVA 1XXHA 1GNQA 3BEUA 3BORA 2HYIC 2QT1A 3BN9A 3NEYA 2OBQA 3U3KA 5CITA 1O2IA 1TGBA 3KFVA 1O3FA 5TXGA 1Z28A 4E06H 4Q1FA 3K0FA 4Q9JA 1KZ7B 3M37A 3VXEH 2ANKH 5EGMA 5EPYA 4M1TA 2VP6A 1C2FA 5EQRA 1AKYA 1XM1A 3AH8A 3ZQJA 3E70C 4QBFA 1GCDA 1R0YA 1D9ZA 3SJAA 4UNRA 1US8B 4LBZA 2WWXA 1FN8A 5KNBA 4ISOA 4ZUHA 2R6GA 4OS1A 4LCBA 2HUPA 4BFXA 4JZFH 1LV7A 4G1UC 1NJFA 3GLIA 2BEKA 5LD2C 3C4JA 4CR5A 1T3HA 4X0WU 1P60A 4XVRA 1EZSC 1EATA 4ZKRU 1O3LA 1BQYA 1II9A 5FOWA 4D4LA 3A1VA 2GVFA 4BQSA 4A0HA 1JR3E 4NSVA 3VB4A 1G5PA 3K1JA 4IEEA 1O5GH 4DSTA 1N6KA 1GMCG 4IBLH 1E0SA 1SOZA 4QRHA 3CF2A 3FDIA 1ZSJA 1Y3UA 3CPHA 3QQ5A 4P3YA 2C9CA 1UKVY 2Z9KA 5L30H 1JEDA 1N2CE 1DLKB 1CJUC 1SGFG 3LD9A 4AG1A 4ZI3A 1LO6A 1O2PA 3W34A 1ZNYA 2CK3D 2UZIR 3NBFA 4D82A 3RLYH 3SGBE 4AZ2B 1M2OB 1KZGB 1EUFA 4DUGD 2RGBA 1UCYH 3M36A 5G53C 3LRPA 5FAHA 5GXPA 3SJOA 4DLVA 3NC0C 1A5HA 521PA 3T1VA 2OILA 2WTUA 2XNSA 3EAJA 1KSFX 3RXGA 1IQNA 2ERYA 1XUGA 3PEVA 5FPTA 3PXGA 4AB8A 4WMFA 3W8RA 1T0JB 3UIRA 1XEFA 1SC8U 3SV8A 2FOBA 4MRPA 3M6AA 3DVLA 4ABGA 1P9WA 3GLHB 2V55B 2WWWA 4DJZB 1J14A 2Z0MA 1VZQH 3U8RH 2P6NA 4MRSA 4WVFA 3SYKA 1TX7A 1N6XA 5J4VA 1GJ5H 3TJUA 1JR3A 2KBFA 1FONA 4FUJA 1NN1A 1GFIA 2G1KA 3GJ3A 2GEUA 1G3BA 2D74A 2OTVA 2PKSB 2R8RA 3RXOA 3ZVCA 1ZCBA 3CWQA 1T7CA 3M5OA 4NIVA 3V12A 3QF4B 3BG8A 2ZEBA 1GZSA 1N5LA 4GCHF 5JBTA 3DOFA 2A5JA 1KOFA 3LT3A 2FS9A 4DSUA 1ANEA 4M2LA 4IOLA 3NXPA 1ID5H 1KSNA 2GV7A 4HZIA 1G3QA 1X8JA 2W26A 3TBKA 2QU8A 3NEJA 5FBWB 2ZHEH 4ZXXH 1LQEA 1VCPA 2G0NA 2J46A 2YWHA 2BJVA 3SHCH 5AJZA 3K9XB 2AD1A 5DP9A 4EQ6B 3H7TA 5JBAS 4PHGA 1V2PT 3HGNA 4ESTE 3W9YA 4EUNA 4PR0A 1H8EA 1YVDA 1E9DA 3GLHE 3KKOA 1EAIA 1XCPA 3C1KA 2ZTYA 3M4YA 4LOYH 3GCHC 2C03A 2NO1A 4QL3A 1EPTA 1BUIA 1T4UH 3LAWA 3A36A 5GJ4B 4FCWA 1D9IA 421PA 2HALA 3GDUA 1OWEA 2C4FH 3K2UA 1XD8A 3A83A 3TGKE 2ZRCA 4KITB 1G7TA 3M5NA 4ZPXA 2IUSA 1K1MA 3EGKH 2D06A 2BBWA 1ZM2A 4A8JB 2I3BA 3K0AB 1QJ6B 1XMJA 4KI0A 4KHZA 4WXVA 5CK4A 1ESBA 1VCOA 4ABJA 1C2HA 3VX3A 4YOJA 3CRW1 2ZRBA 3RWMB 1Z7KA 4A5TS 1KSJA 4A1TA 4Q4JB 4JBYA 3ZIAD 2FU5C 2P67A 2WWFA 4A0FA 2WJGA 2GZHA 1WA5A 3EZ6A 2GDEH 1P8VC 2VYFA 2FG5A 3ECCA 1WCZA 2CJWB 4QJ4A 3S9CA 2PX0A 3LPRA 2BMFA 1CEEA 3AGQA 1CA0C 2YVUA 2ZRNA 3BAFA 3ZVGA 1RS0A 3THXA 4BFZA 4WZAE 3S9AA 4AG5A 1L0ZA 1P2TA 3MUFA 3UUZA 1SHHB 1II8B 4XOJA 1UDXA 4L8GA 1YZLA 4U2WA 2FESH 3IIKA 3Q72A 4RCYA 3HU3A 1VITG 4JJZA 3KEEA 3VQTA 2C96A 3FMIA 3GLHA 3SJIA 1FV9A 4TL7A 1XPRA 3KKQA 2GT8A 3I8SA 5M04A 3QJYA 1KSHA 2BDHA 5JSZA 4K1TA 1JR6A 4HB2A 1F48A 2ZAOA 4O3MA 5GWZA 1H4WA 2TGAA 2P3FH 2EFGA 4JLDA 4LJ9A 1G7RA 4OQNA 3SJBA 2WPIS 2DPXA 1W48A 3QF4A 2AH4X 4X6PA 3GY3A 3FVQA 5KSZA 1CT4E 2ZGHA 4WBSA 2ZRHA 1E2JA 4LJ6A 1S81A 1Z8GA 2B8TA 5TY0A 1NP6A 2WSSD 1NPMA 1XNJA 3NBZC 1E4VA 5EQQA 1YM0A 3PENA 2ZU3A 3ZVMA 1XMNB 5H68A 1FZQA 4DSOA 3RC6A 1GI7B 2ZETA 1XUJA 2AKAB 2JH5D 4KO8A 1GHXH 3A88A 4FW9A 4BFUA 1LTQA 2ZHFH 2DHRA 5EXPA 1RRGA 4NCYA 1CBUA 3C7KA 2SGDE 1BMFD 3W6NA 3T35A 3PIRA 1XXDA 1ZW6A 2WMOB 1E3MA 3GCNA 2V3CC 4CZ2A 3ITIA 3T5GA 1GI9B 5SZJA 1RPZA 4MTBA 1GL0E 4FUCA 1M34E 5BQ5A 4TMVA 1QL8A 4GMDA 4TTQA 1NFYA 2XJ9A 3PUXA 2QRNA 3TSZA 1HCGA 4B73A 4F4OC 3D31A 3F9EA 5HCNA 1ZHRA 1SFIA 5SZHB 1KDPA 4MITA 3KUCA 4DXAA 2IF2A 2OQUA 3TUJC 4A1VA 7KMEH 3U44B 1G7CA 3AVTA 2BOHB 2YOGA 4RVCA 1OS8A 1E1RA 4Q4JA 1MU6B 3P95A 3CWZA 4QGGA 2QMEA 3BFVA 1HAGE 1CO7E 1JQJC 1EAXA 1V6DA 2BMEA 2CJWA 1YC0A 3LC3A 1FQ3A 2J0SA 1W36B 1W8BH 1MTWA 3O8DA 1AO5A 3AUYA 1CJTC 3BTGE 5BXQC 1GSIA 2R3UA 2RDLA 2Y82A 4YC7A 5JRJA 4MDSA 1ZLRA 1ANCA 1C1UH 1SKQA 2QT0A 4P4SB 1II8A 2Q6TA 5JBBS 1GBIA 4ZMAH 4BXWA 3P17H 5ABWA 3ZVRA 4AG6A 1VIAA 1BMNH 4RKOB 2OCVB 4YMTA 1CR0A 1HV8A 2WAYA 3P4YA 1O2XA 3UFAA 4O9VA 2J38A 2QAGC 1ZHPA 1SULA 1WE2A 5HXFA 5DJ7A 2BX3A 3U3OA 3FB4A 4XBBA 2ODPA 3OTPA 4LJ5A 1NRPH 2VF8A 1HE1C 2EYUA 1Q0UA 4EAQA 6CHAB 2UWPA 3RS3A 2WBLC 3D49H 4GBMA 2ZRKA 1R0WA 3QUMP 3QE0A 1NF3A 4HTCH 2VTKA 1Z2AA 1N5IA 1HAPH 1JWTA 1UVOA 3FVFB 2WINI 4M1KA 1NVWQ 1E6CA 2GHIA 2HF8A 4IDNA 1E2NA 3THOA 5T3HA 3C5HA 1TNHA 1CHOG 4DZZA 3ICQB 1NBMD 4J0QA 2H18A 5HR5A 1LFDB 5L3RA 5FBLB 1ZOMA 5HPYB 2F3CE 3GJ5A 3OFND 3VR3A 5C2JB 2WUBA 5DE3A 1XP8A 2W0SA 4JZKA 1QG2A 1RKBA 4Z1MD 4TLBA 4TTRA 3K9GA 1HE8B 3VKWA 4RY2A 2FPLA 1ZD8A 3UOPA 4W5HA 1SQOA 4TYDA 4SGAE 3VU9B 4X2XA 1QBNA 2R6AA 2DUCA 1GJ8B 1VCNA 3PUYA 2XZOA 1ANDA 1A2BA 2P3SA 2GJ9A 1MAXA 1R5OA 1N6IA 3BH0A 5DKMA 2QC2A 4FU9A 1KJYA 5JJLA 3PEUA 1E94E 1V2MT 1RRKA 1NU9A 3G82C 1G36A 1P2JA 5BRRE 2WIAA 2BB4A 5B30A 5C5OA 2ZRLA 1RRPA 1NL3A 2ZI9A 3RXAA 3TNSA 3U44A 4URUR 2WVJA 1DM4B 4Z54A 2IXEA 1RC8A 1N0WA 3FP8E 3IPYA 4M21A 1AKSA 1F2UB 4V0KA 1INCA 4GLYA 3KJHA 4CHAB 4AWXA 4K81B 4PC7A 1J16A 4A82A 5JI3E 4URZR 2OBOA 3JVUA 4MQBA 5FTJA 4FUIA 2ILNA 1XBTA 4LK2A 3CRRA 4M1SA 2VVCA 1AN1E 1FPHH 2JKHA 1P62B 2R3YA 1BCUH 2KWIA 3GDSA 4H9GA 2HDNB 4F93B 2GTPA 4P4SA 3JZ1B 3PJRA 1AIPA 3KZ1E 2HPPH 2YOLA 4YDHB 4TYNA 1NZQH 3CP7A 1Y59T 3M61U 2IYYA 2P5SA 5FR2A 5KDDA 5AFZH 1RIWB 3OIWA 1BITA 1NN0A 3L43A 1KXAA 3OEHA 1QHGA 4TYWA 2BOVA 3T1QA 4X1SU 2J95A 1IONA 4RFSA 4TY6A 1KTVA 3KFXA 1BHXB 2BD2A 4PQFA 4BFTA 1O3YA 4MUAA 5KO2A 1KK2A 2BIFA 2IXGA 1EB1H 4TMTA 1YBWA 121PA 4AN7A 4BEBA 3NBXX 1VYVA 3QPVA 5F03A 2Q1JA 3QTOH 4R71A 4EPWA 2J0QA 4U32A 1SGEE 1YP9A 4XTRA 1GHZA 2PJRA 2ZGCA 1SGDE 1G3RA 2NTYC 2CNWA 2CGAA 1XTIA 2HF9A 2UWLA 1GWNA 2YOHA 2PKAB 4PO9A 3W5IA 1E9SA 1Z3IX 1TFXA 3NVAA 4Q7XA 5L3QA 3QZRA 4CRWB 3LQQA 2IL1A 1HAOH 4ABBA 3A86A 1TEVA 3IWMA 3VU9A 1CJMA 4FMBB 3T27A 1H9LB 4LC1A 5DP8A 2GP9B 3WBJA 1ELEE 4X2YA 3RLFA 3P70B 3BTDE 3CX8A 1KYIA 3TAUA 1VITF 4L4UA 4GNKA 3RS2A 4F92B 1G41A 5DI3A 2IN2A 2GCNA 1G8FA 4MGIR 1C5YB 5E0HA 3SO3A 3PV5A 4DCVA 3F3YA 4S2EA 2CMYA 3L33A 1BTXA 1KKLA 2AHOA 2GXAA 4LHZA 3GP8A 4Y8ZA 2YKGA 3THWB 2FIRH 1KMQA 5H70A 1UFQA 1F2UA 3AEZA 2ZU6A 1KIMA 3CW2A 2MSDB 1U90A 1PV4A 4AOQA 2BY5X 5EJEA 1C5UA 2BD8A 3H2YA 1X8LA 2J94A 2UKDA 3SNCA 2C8YB 2JA1A 5FPKA 1HDTH 3NH9A 2RGEA 3TH3H 8GCHF 4CRGA 2JASA 1J8MF 4MRRA 4Z8XA 4W5WA 4FINA 1MBMA 1NSFA 3LU9B 4RZUA 3ZJYA 4NSYA 5SZKB 1OLOA 1XUIA 4LPKA 5LPNA 4X8MA 2A7JA 2G88A 3GISB 2WPLS 1SB1H 2W7SA 2G77B 2FZ4A 1YRBA 1HYQA 1K5DA 2AKYA 3W95A 1J2JA 1QNJA 3MO3A 4YMUA 2XTTB 2WIBA 1UJ1A 1I2MA 3DO6A 3A81A 3VFDA 2Z6VA 1W1WA 2FX6A 4YLUA 1NI3A 1JOUB 1TIOA 1W4RA 4IDPA 3UQVA 3DHKH 1P05A 3OEED 5EODA 3EG5A 4YT6H 3SGAE 5DP5A 3UREA 5D3QA 3OF5A 1RZ3A 2D1JA 1OYYA 2RGDA 1E4YA 3GJ7A 3RU4E 3K0EA 5H4IB 3GFPA 1HJAB 5I46H 2CLDX 2ONKA 2VA8A 2CVFA 2GMTB 4US0R 3RDZA 3SZNA 1F2TA 3SBKA 1T8LA 5EE1A 2NO9A 2D2DA 1TPOA 2BKEA 4X1PU 2FWRA 3EASA 1L1NA 1PPCE 3LA6A 2JLVA 1JXPA 3TR0A 4H42U 1OYQA 1BJVA 1GI3A 5E4FA 2GESA 2PKAA 3GY2A 3CH4B 3A7VA 1PPHE 7GCHG 1GDQA 1GBDA 4KKDA 1E2DA 4DIDA 4QFMA 2Q9BA 2NZ8A 4CRAA 1AB9C 5FI1B 1X7AC 2H9TH 4M1OA 3TGPA 4MVNA 3B5JA 2FYQA 2ZRJA 4C0LA 5J5CA 1ESNA 1IM2A 3AUXA 2OCPA 3VB3A 3M7UA 3U98H 4VGCC 3SNEA 2IUTA 4PC6A 1PJPA 2F3RA 8KME2 1T8OA 1CKEA 1RD3B 4BFYA 2BVXH 3IBGA 1W4CA 1S3GA 4LGMA 1GITA 2BCGY 4CREA 2BD5A 2VVUA 3EA9A 2EFEB 3PB1E 4RD1A 4X8HA 3THWA 3M3VA 3RXQA 3KB2A 1UKZA 3SZRA 4IS5A 5KTYA 3R9WA 3TIFA 4HFPB 2XC0A 3H0KA 1G4UR 4NZQA 2JETC 4UFFH 1JJ7A 4G5RA 4NYIR 3LNCA 4PHFA 4PSVA 1E2PA 4Y8XA 4D0GA 1GG6B 2E1RA 5AUNB 4X8UH 1U98A 1DVAH 1G6OA 4RZ2A 2NZJA 1QHYA 1OB2A 1YGCH 1OWDA 4F91B 5DPAA 1FY1A 4Q4AB 2J0VA 2CXVA 4JKIA 1GL9B 1GWAA 1ZUNB 1NRRH 3R8FA 1SKYE 3EC2A 1DARA 5FOVA 4C0BA 3I1FA 4C30A 4D0NA 1MH1A 1GJDB 1OH5A 2BD7A 1ZBDA 1WTHD 1CULC 1CRQA 2XITA 2W2XA 1GJ6A 3ENSB 2A2QH 1P72A 2Y5FA 2AFQB 3SNDA 3ZZ0A 4M1WA 1XZQA 2Z3EA 4Y8YA 2A5FA 1XD2B 3MNSA 3IKJA 4ZKOU 3WYGA 3WMFA 1UF9A 2K1QA 2FDCA 1CP2A 3P8GA 2YYZA 4YQFA 1VHTA 5AVDA 1TBZH 4PAQA 4C0JA 2OFXA 2WJYA 2ZITA 1SVWA 1E2KA 1F60A 1QHHA 2EWVA 5L2YH 1G291 4BAHB 2CHQA 2BVNA 2LKCA 2WJJA 4GOKA 2JATA 1QJ7B 4ZKEA 1X6VA 2JLZA 4AC9A 4E05H 4K1SA 3V0XA 4B3XA 2O8EA 3FFGA 4LV6A 3BXZA 2QP3A 4ZDKA 1JI0A 3FFBA 3A7ZA 4Y76A 1ZP6A 1V2RT 3KF2A 2ANWA 1Z0DA 1KI9A 1GPZA 3SYJA 3CR7A 2OC0A 5JBQA 1YYY1 4BECA 1V2KT 5CE1A 4I8LA 1FI8A 3LO5A 4O25A 2H17A 2E9SA 2IYZA 4A6LA 1XTRA 2NO6A 1X1SA 5F2EA 3EIHA 2NGRA 3KQLA 4US2R 1GBMA 3H84A 1TB6H 1A4WH 1N8OC 2P6RA 1G20E 1P2QA 2JJ1A 4ASUD 3K09A 2W6ID 3U1JB 2X19A 1ABJH 3KB1A 1H8HA 4AKEA 1BS1A 3QVVA 1CRPA 1R4AA 1EK0A 1TQ6A 4YLGA 1CS4C 1SI5H 4DLUA 2ZEJA 1UKEA 3CLVA 2GZ7A 4ISIH 3I3SR 5FPHA 3MU0A 4Q4AA 5HCIA 3A1SA 4GUXA 1GCTC 3X1ZA 3RXLA 1U8ZA 2A78A 1J8AA 3OEEA 4I81A 2H57A 4H1VA 1PLKA 1CBWB 2ZGJA 3RXRA 4KFUA 3ZVAA 1EX3A 2G1JA 1FJSA 1KNXA 3K6ZA 3X1DA 6LPRA 1KI4A 1T0HB 3FYHA 3Q7QA 2GEVA 1QRAA 1IOEA 2AXNA 2NU0E 3L82B 4LZZA 2SNWA 3SJCA 1E9FA 4CT4B 2FTMA 2XXAA 3SV2H 1EX6A 3BB3A 4EJSC 2CF8H 2A2ZA 3DDCA 1XD2A 5F8ZA 1KAGA 2BMJA 5J4HA 3LV8A 1UK4A 1L8QA 1C2DA 3LIWA 1W0ZU 5KNDA 2OBLA 4GMXA 2FF7A 2PTCE 2NPFA 1ZMNA 1XKAC 3WMGA 3OAAD 4DW2U 2FOLA 3BJIC 1AKEA 3WP0A 1VJ9U 3B23B 2PZEA 3HU1A 1E2HA 1ZUIA 1MKXK 1AY6H 1CF4A 2A5YB 1G8GA 4IDHA 1LVYA 2ZJ5A 1AFQC 3SQWA 2WOOA 1O3NA 3SN8A 5GIBA 2HPQH 2ZDVH 2SGQE 2AGIX 2J9NA 1VMAA 1O3DA 2WM9B 1SL3A 2GJKA 2YJTD 1IN6A 3GLFB 2STAE 1TX6A 3KGPA 4OYHA 2WJVA 1VG1A 4C4PA 4ARZB 1F7ZA 3RRYA 1XEXB 1GJAB 1DAGA 3SQXA 2WPKS 3HK6B 3N2EA 1FAKH 4V02A 1CIPA 2VINA 4PX9A 4AX9H 1PZNA 1ZTKA 2FPZA 1H65A 2VP2A 2HNTC 3VAAA 1DT2A 3QXHA 1O3OA 3LX5A 1MUEB 4B3DA 2OCBA 5FBVB 4ZIRB 5T1VA 1ZC3A 1L2TA 5FBRB 2Z9JA 3LXXA 4PANA 7GCHF 2ANCA 3QG1A 2ODNA 1TQ4A 3B1YA 3IPXA 1Z8RA 3WHLA 6Q21A 5H8WA 3K9LA 2ZE8A 5BN3A 3ZZCA 2VP9A 1C5VA 4MG3A 1WMSA 5JRZA 1G6HA 4JVLA 1THPB 2RGAA 3KKMA 2ZDLA 3KQNA 1DAMA 1GVZA 4BAQB 2BQ6B 1M8PA 1AWFH 4CRBA 4B32A 1DUAA 4GHTA 3GLFE 4KYIB 2R6FA 4EFLA 2YNBA 3QKSB 4JK6A 1IN7A 1UO6A 2XSZD 1OHHD 3E5HA 1QURH 5LPEA 4B1TA 2FH5B 3ATIA 4QNMA 1B5GH 2WYJA 2VL7A 5JLJA 5E0GA 1TA6A 2XC4A 1CQQA 3WRXC 3UR9A 1GBAA 3FPAA 2MSEB 4Q4HB 2BDYA 4PHTA 3FKQA 1TPSA 3CS0A 5HKKD 2FOAA 2OT3B 5A4JA 3JZ2B 2G8TA 1BMMH 3TJNA 2VH6A 3A1WA 4AIIA 3I77A 3RANA 5EPNA 2HOBA 4DEXA 4TMXA 1O2NA 5F9FA 3GCHB 2UVQA 1EWQA 2EWWA 1N5JA 3QLPH 1DAIA 1ZSKA 2J34A 4H6SB 1A82A 1O2KA 3BEIB 1G3EA 2CBZA 1S5SA 3A8BA 1OXUA 2CLCX 5DO9A 4NIYA 3T28A 4OQFA 4ZKSU 3P6ZB 5IF9A 1GI5A 2O0JA 4XWKA 3RC4A 1JPJA 4V0ME 3ADCA 2CCKA 4QT8C 3QDZB 2ZFTA 5HE8A 3MTYA 1ZINA 1SSXA 2H6MA 1OE0A 4TL8A 2CJIA 3UQOA 1TRMA 3BTWE 4HLCA 3QPUA 4FUEA 2C93B 3VB5A 3CONA 4UXJA 1IJEA 4Q7KA 1AQYA 2JDIA 1P9RA 4A15A 5EE3A 1NC6A 4B34A 1FXYA 1HUTH 1HAIH 2RA0A 2Q6GA 4AFQA 2QYIA 2W3IA 3NTUA 4Q1AA 2L0XA 4DHEA 3GLFA 1R5BA 4JS0A 1A3EH 2V54A 1J90A 2OFWA 2JJ8A 2O8UA 4DLZA 2BD4A 3T34A 3BEFB 3S1AA 3SU5A 2QXIA 3UWOA 3CX6A 1GL1A 3PV2A 1MT0A 1E32A 4NZYA 1ZNZA 5KU1A 2AN9A 4FUGA 2GEDA 4OGYA 5EQSA 4ZIRA 1OX1A 1TYNA 1O39A 1EZXC 1PQ7A 3SNHA 1Q44A 1T31A 4DT1B 2CHAC 2ZJ8A 2QXHA 5B58C 3HYRA 1KO7A 5J4SA 1QHNA 3BTKE 1MQ6A 1W44A 4V0MA 1ZTJA 5JMTA 1MR3F 2FX3A 1T6NA 3X2SA 3FGNA 1C5LH 1TBQH 9LPRA 3LLMA 2ZIQH 5EXSA 3QPWA 4KSBA 4G3XA 2ZTXA 2VGCC 4TTPA 2MMGA 2C9YA 3RMOH 2WSMA 1YPKH 3RNLA 3SJZA 2FI5E 1IQMA 1W11U 2BJWA 5AUOB 1S8FA 2V8OA 1JAHA 1Z0JA 4M0LA 1C2IA 5IK2D 1KMHA 4KYUA 4LHYA 2AEIH 2RAPA 1BA8B 2KAIB 4Q4HA 4JYBA 1ZC4A 1IHSH 5TV2A 1G16A 4QHSA 4QBIA 1XMIA 3B9PA 1Z5ZA 3P32A 3BERA 3ZYDA 1C2JA 3MH6A 2PSXA 3BFXA 2FZLA 1HXFH 1TL7C 3EYDA 4DLRA 1X3SA 3SOPA 1II0A 4OQLA 1O3HA 1F0TA 2FI3E 3K0SA 2H5EA 2DWPA 4YM9A 4O03A 3TUZC 3PMHB 4HSEA 4DCNA 1JRSA 3SV7A 4XIGS 4DGJA 5T6DA 3VHLB 4HYYA 2OCYC 1A7JA 3WP1B 4NYMQ 1O5EH 1SXJD 2KB0A 2C9OA 2QZ4A 3SU2A 1OFUX 5FX6A 3U3JA 3GY7A 4OHZA 1ELBA 2QGNA 2OESA 2GZDA 2ZZUH 2ZYTX 1MAYA 1O31A 1CJKC 3KTAB 3H5CB 3TVJB 2IYRA 3GJXC 3OZXA 4WH6A 1TF7A 1S0QA 3AKCA 2V6JA 1RYHA 4BFSA 1PLLA 4R7ZA 4GAWA 1GBCA 4Q18A 3A8AA 3A8DA 4D81A 4HLUA 1GDNA 1A0LA 1DE7H 1J7KA 3EWAA 2ZQ2A 4QM6A 2A5AA 3B85A 1ZCAA 3D7MA 5JB8S 4K60A 2GETA 1Z6JH 2R9VA 2BWJA 1ARBA 1QRXA 1CLUA 1UEIA 4YONB 1O2MA 1TLDA 2JLYA 2VBCA 5HGGA 2FO9A 2QAGB 3QG5A 1O2HA 4ABYA 1EJAA 2XX3A 4G5SA 3LQRA 1GM5A 1NT1A 5ELXA 4WW0A 4OHXA 4ITRC 1NRSH 3TUIC 3NK8A 1HBTH 4BLQA 1OP2A 1DITH 4HDOB 2AFHE 1HIAA 2F83A 3QKRB 1YKSA 3H7OA 2GGVB 2PW8H 1VG0B 4H6TA 2A4OA 4OHYA 1QG4A 4NHOA 1V3XA 3QIAA 4LRWA 2ZI5A 2XSZA 2NWNA 4MYUA 4NE2A 1ELDE 2W6JD 1HUQA 4QNRA 3A7WA 2ZS8A 4ZO4A 4IOMA 2PWXA 4U01A 5C3NA 2ZUBA 1GRNA 5A8ZA 2WWGA 3PEWA 1S85A 1MO3A 4JVMA 4DDWA 3TGIE 2QQEA 2KAIA 1W5TA 3L8YA 1C1SA 4JYVH 1YZNA 2FFHA 4QGAA 3MNCA 2YOFA 1LVMA 1SGPE 1NY22 2HYDA 2PBRA 3RXJA 4TT3A 1Z47A 1ZRKA 3U5ZB 3Q5DA 2QORA 2VB0A 1EP5A 4NA7A 5GJBA 4PPQA 1IXZA 1D6JA 2XOKD 2ZREA 4X6MA 4Q03A 1XTQA 3GQBA 2OZEA 5B6LA 3UNQA 1QCPA 1HYLA 4Q80A 3BF6H 1THRH 1GBLA 1CU1A 1RVDA 4OS7A 1XDBA 1DO2A 2GCOA 3U1IB 3KDSE 1E1QD 4JLVA 2VIDA 1U2RA 4V0LA 3R9IA 5DGJA 5HZHA 1TADA 3U3RA 1UBFA 3HATH 2OBMA 1QDEA 2PR3A 3FMOB 3MOCA 3QGJA 1AN0A 1SR5C 5HTKA 2DFNA 2OUAA 3HK3B 3TE6A 4IOKA 1KKMA 1P3CA 2G9NA 3EX7C 1ZM9A 1MTUA 1TAWA 1V2ST 2CL0X 1FOEB 2PLRA 1O5DH 2GAAA 4NTZA 4Y11E 1QA7A 2ZYVX 4TL6A 1E99A 1AZSC 3TK1A 2O0HA 1T5LA 4ZHLU 4LJ8A 3AVYA 1O3CA 3FP7E 3P92A 4V03A 4A36A 1Z0KA 1ZMLA 3IHLA 4PTLA 5GJVC 4I1VA 2ZTZA 1E79D 4BZQA 5FOSA 2IF0A 4QC2A 1E69A 2W5EA 2IT1A 1OSNA 4Q1EA 3RXMA 4ZDIA 3CUEF 3ZV8A 4QM7A 2PTNA 1E9RA 4C0KA 3AVVA 2A4GA 5EZ5A 1DPFA 3B60A 4JZIA 4PHHA 2Q6FA 1EFTA 1IHUA 3B8JA 2VIPA 3IDQA 5TCCA 1JQLB 3DUXH 4WVPE 3CR8A 2XB2A 2ZCKP 1VGCB 4AKHA 2UUKB 1XF9A 2VHJA 1KO4A 3MD0A 4UDWH 4FMCB 2EI7A 2J1LA 1TONA 1G2MA 4LJ4A 2VWOA 2BV3A 4PSKA 3K6YA 1GKIA 2GRJA 2BMGB 2JH0D 2Y7ZA 1KLTA 4OHWA 2A5KA 1MABB 1FN6A 2ANBA 4IGDA 2LWIA 4HB3A 2FOFA 1QHXA 2JH6D 1EGAA 4B71A 1G2LA 3B78A 4QOSA 1PPBH 5BYJA 4RZ3A 5IT5A 1HY3A 5DHFA 4DCUA 3I4LA 4UNQA 1EQ9A 2FOEA 5G3YA 2CXXA 1SLVB 5C2ZA 5DG6A 2ZC9H 3ZZ3A 5CYOA 1BKDR 6GCHF 2JAQA 1FMGA 2AS9A 1D6RA 3QX5H 1QBKC 4KELA 4QXAA 3AF1A 1KI6B 4THNH 4BFWA 1BOQA 1XUFA 4XVQA 2X8AA 5AJYA 2QF0A 3TRFA 1UCYE 1NKTA 3QXCA 1UTOA 4ISNA 2CMKA 1G8YA 2FZZA 4IDQA 1IOZA 3CBQA 1FP6A 4C0SA 4X8OA 1JIMA 5FX5A 1K8RA 3TU7H 1C2EA 3UWJH 1HTWA 1OIWA 1KLJH 3F8TA 2ZSBA 1XVMA 3KQBA 3NKVA 4BAMB 3A4LA 2FJUA 1IY2A 2HWLB 3ZZAA 4JVNA 1GMHF 1L1JA 4C9BA 1Z6AA 4Q7LA 3SNAA 3PR1A 2F9VA 2VNTA 1Q3HA 4YO9A 3ZZ4A 2IYSA 2H16A 3CF0A 3OY5U 4KU4A 4JL5A 1ZRBA 1OPHB 1GBKA 2CL6X 3QKTA 3LW7A 2GZ8A 2OO7A 5UKDA 1P2OA 3NH6A 4ERNA 1EPTC 1R10A 3O8RA 3PITA 1N3BA 1UJ2A 4C0AC 1KYNA 1JXMA 4WXRA 2IEZA 2FWWA 1MD8A 2O8TA 3MWJA 5KSOA 3NPSA 2QM7A 1VG9B 3AGPA 2Z4RA 3MO9A 4V0NA 4Q21A 1YPHE 3RRNA 4BTTB 4IOJA 2HLCA 2XNDA 1KDTA 8OHMA 1Z07A 1G8HA 3CIOA 4MKHA 4JL6A 4UFDH 2AWOA 4IVQA 2ZSFA 2W6JA 3DMDA 1C9KA 3A37A 3DPUA 4FI3C 2IUUA 2EFHB 3V3MA 1G19A 1UTQA 1BTWA 3U7FB 4JYUH 2Y8EA 1OW3B 1EWRA 4N1AA 1F3OA 1XMSA 1AE5A 2HXSA 3TQCA 3HGPA 3WYAA 3URCA 2GVZC 2DYKA 1UCYK 1JR3D 2R0KA 2ZI4A 2RGNA 2M5TA 2CCJA 2EQBA 2PT5A 3RWOA 3MAAC 5L6NH 4JBXA 1PPFE 2UUFB 4ZCMA 4XE4A 2F1RA 2I1QA 3AAUA 1AS0A 2CF9H 4IN1A 3PROA 2XOKA 2AWNA 5JWHA 3DT0H 4LV5B 4FMCF 2DE9A 4C2UA 3RS7A 5G3ZA 2R9PA 3PTBA 3UKDA 1P10A 3SI3H 2ZPSA 3V7TA 5JHGB 1KI6A 4VGCB 2WV9A 1Z6GA 1Z08A 5CB8A 3MGCA 4JMYA 4KVGA 1L2EA 4M22A 1DOJA 2JLUA 4BLSA 5JHHB 2GCTB 3VPKA 1FW6A 4DB4A 1ELAA 5CYPA 4LOAA 1R0XA 1V2NT 4NFEA 1TMKA 5E3HA 3AKEA 4U02A 2YNAA 1YCPK 3SYNA 721PA 3GY5A 4HZHA 2C90B 4B6FA 4L9WA 4HB4A 3S69A 2ZR0A 4TMZA 5AJVB 3V9PA 2V3OH 2JETB 3PMJA 1Z06A 4HEJA 1WB9A 4WA7A 3S0NA 4I8GA 1UDWA 5IDKA 4GL2A 1DAEA 2BEJA 3IHWA 5LH8A 4PZYA 2GJSA 3U7EB 5ESBA 1LF0A 4I31A 8ESTE 4CRCA 1Z6XA 1ZHMA 4EPYA 3ODFA 1P2KA 3REFA 4PAMA 3ONWA 4TWZA 1BRUP 2QL6A 5FHTA 2C98A 4HGCA 3LH3A 3BD9A 2FA9A 1Z22A 4RI0A 1A7SA 5ETXA 4XWAA 1XZPA 4R2HA 3STJA 1BH2A 3IUYA 1W0KA 3TJOA 3CX7A 4FCVA 1LY1A 3D62A 2FE4A 2Z94A 5KNCA 1J99A 2BM1A 3DZ8A 1J8YF 1C5SA 4INKA 2XCNA 2ULLA 3K8YA 1O2YA 1NY5A 1ZM7A 2BY6X 3P27A 5KHOC 2J7PA 5FBEA 4RKJB 1IJFA 2VH5R 3U4QB 1LKBA 3NKKA 3AASA 3QBVA 2BVRH 1C2GA 4OQMA 1O2RA 1NG1A 3LH5A 1OP0A 1A1RA 1O2TA 2GBLC 2J5XA 3K9HA 1WF3A 5AK0A 3GLGB 2IS6A 4UFGH 4DOQA 3FKSA 2QEQA 1O34A 3UTUH 1UK2A 5B57C 1OSSA 4PPFA 1HAXB 4CYMA 1P2NA 3OHMA 1RRCA 2WPMS 5TARA 1EFRA 3SOSA 4ZKDA 5HMAA 2HJGA 4I8KA 3Q3YA 2CHVA 3NZIA 1HB0B 4Y10E 5AF9H 2RA3A 2VHQA 4HAZA 3PO1C 1AZZA 1QRZA 5FOUA 2PLXA 1SVPA 3F9GA 1ZM4A 3NC1C 2BBSA 2GZAA 2TGPZ 2NU2E 1CGHA 3W94A 2Z5FA 2ZE7A 2J0UB 3UG7A 1N25A 4HUQB 1KXFA 1VTKA 3GFOA 1DAHA 2PV9B 2QA9E 2VIWA 1FIWA 4NGAH 2J59A 3P26A 4GFDA 3ZYEA 2ZG0H 2ZPTX 1BBRH 3ATWA 5EXMA 1TMUH 4MDFA 2O8MA 2ZFFH 2DWQA 4MYTA 4W7SA 2XZPA 3JVVA 4ZDJA 5FH9A 5EE0A 3R9XA 1Z1IA 2G5NA 2QI9C 1L4ZA 1R2QA 1SHKA 2XWBI 4X2WA 5J4YA 3GYLB 1IQEA 1NVXQ 4NONA 2BDAA 1JMOH 3SNBA 4TLDA 4KP0A 1J17T 4WWYA 3RM0H 1BMLA 1GI2A 4Z51A 2O8CA 1P9NA 2VU8E 2ZPRA 1VKJA 2E87A 2YZ2A 1ANBA 1E1RD 3IEUA 1GP2A 1U9IA 1K1IA 2BMDA 1UADA 4L9SA 5T6FA 2OAP1 4Y71A 4K8OA 1GCTB 2BY7X 1P3JA 1ELFA 3RLWH 2SGFE 5GDSH 2ZKSA 4AORA 3E90B 3AKYA 2F9MA 1N6NA 3AKDA 3GEHA 3ZZ6A 4UONA 4FN5A 4RFVA 5TVKA 4MKFA 2BM2A 3Q3XA 1WQVH 2ZP0H 1NVUQ 4XBCA 5D3MB 2WMNB 3THYA 3NDPA 3FHCB 4I1OA 1KTTB 3K9NA 5TJXA 4YMSA 1O37A 7LPRA 1EXFA 5JEDA 4R2IA 5CM9C 3U4QA 1Q22A 1UBCA 3VNVA 1AQ7A 3OESA 4G01B 1C1QA 1C2LA 2LPRA 2JIZA 4LJAA 2IA5A 3CRQA 4PPNA 3U61B 1AHTH 1N5KA 5AFYH 1KHTA 2FXRA 1OP8A 5EXTA 1YR6A 1V2OT 2ZJZA 3RMLH 1NVVR 1D2NA 5JBCS 1Q21A 1P02A 4P32A 4DBLC 1EX7A 2N1BA 1OT3A 4XD7A 1DG1G 2D7CA 1FL9A 5C1YA 4LHVA 1KGDA 3SBDA 1GTVA 1C1RA 3TQFA 5EP4A 2J92A 1YCPH 4F7WA 1C1OA 3V4RA 2PZFA 2BLOA 4X1NU 2GCHG 1OXXK 1YLDA 3ZLJA 2QN5T 3K0CC 1K1LA 1GVNB 3I5YA 1O2WA 1C5RA 4AYYB 2PLFA 2EI8A 2OK5A 2QUZA 1SLWB 1AFQB 1US8A 2OSBA 4XSKU 6CHAC 3PUZA 2BVSH 1E9BA 2ZRDA 3ZZ7A 1W2HA 2F7SA 3BIFA 1NIPA 3A1TA 3BBPA 4HUQA 3BRWD 4IC5A 1ZNXA 3PM3A 3V00A 1MKYA 4W9MC 1F92A 1XUKA 5CLLA 4NFFA 2WKPA 3ATMA 4GOXA 2TGDA 1DXPA 3CB4A 1V2WT 2C2HA 2XW9A 1T8TA 1LHCH 3E1SA 1KJZA 1GHVH 4U5XA 2ZRAA 4B6EA 2JCSA 4PROA 4JLBA 4I4LA 4A2PA 4ZI2A 2REOA 5GVRA 1PPZA 2GF9A 1NIJA 3E8LA 4TQ9A 1SQTA 2WWYA 1ZVQA 1GBBA 2QG6A 1OKKA 3NWJA 3REGA 4NCJA 1KK0A 4JLJA 1C5ZB 2QA5A 2IXFA 1DANH 4Q1DA 1Z0AA 1Z6EA 2TGTA 4ABDA 3TJVA 3MU4A 2QIQA 1JNYA 2ZRIA 1XTJA 5DISB 1EOJA 3D23A 3LGYA 2ZM5A 2BDCA 1OB5A 3ZZUA 2PMKA 4DEYA 4M9QA 1THSH 1EXMA 3FHTA 5FFMA 4O2RA 2TRMA 4M9ZA 1GRQA 4X1QU 1W36D 3UPEA 1XCMA 5P21A 1WDTA 1U94A 3SW2B 4LZ1H 4QHTA 4KAXA 2B8OH 1T3LA 4JSYA 4MKIA 2GX4A 3KUDA 1TMTH 2PCJA 1ARCA 3RS4A 2DR3A 5HE9A 2ERXA 4CHAC 2ZE5A 3S9BA 2VP4A 4LYJA 2LKDA 1QQUA 3TJZA 1UTPA 3AK5A 3NHBA 1TOCB 1AS3A 5FUXA 4I32A 2AMPA 3VB6A 2BC9A 3OIVA 4ZHAA 1JBUH 3E2IA 3OE7A 1SLXB 3MH5A 5LGOA 2DFTA 2P0EA 2GAOA 4CIDA 2WHXA 2BKUA 3SEAA 1OV4A 3OEHD 3QEJA 3SHFA 4HAYA 3UR6A 1BO6A 1G37A 1JEEA 1GL7A 1O2GH 5FPSA 1VYTA 3LGTA 4LPSA 5DK1A 1P04A 4JIMA 1GHAF 1SBWA 8GCHG 3UWKA 4URYR 4MH0R 2FOCA 2V3HH 4OJKA 3SFVA 1RIWC 3MMPA 3LVQE 1GGDB 4UJ5A 3UIEA 2ANYA 2FFQA 4LK4A 1RTFB 1W49A 3LC5A 5F8XA 1LS6A 1WCV1 3D8BA 4IVRA 2CNWD 2XTMA 4EQ6A 1JJVA 1XU4A 2ASEA 2P16A 3PUVA 3QEOA 2BCJQ 2P3UB 4DVAU 2ZI6A 1A5TA 4KTCA 4Q1CA 3ZD6A 1D9XA 1P73A 4S35A 5CMXH 3QO6A 1BMAA 1AMHA 4B2BA 3SJ8A 4GVUA 2WPDA 2WPHS 3M7QA 1OWHA 1G3CA 3EPJA 1Z8IB 4A8JA 2HXYA 3K0AA 2ZFPH 1P4SA 2I6SA 4MYHA 4A6PA 4TWWA 1Z83A 1GI6A 3UATA 1ETTH 4CF7A 1SPJA 3CPJB 1Z0IA 4E03A 3QUSA 1FNMA 1OFIA 5A0FA 2NQ2C 2PMDA 2RGGA 4CRFA 1F0UA 3QTVH 4OHVA 5J4LA 2GILA 1S1CA 1ELVA 2F9BH 5EP1A 1LS1A 3Q8XB 1TGCA 3HKJB 2HV8A 2CHAB 3IEVA 2G6BA 2VF7A 4E7NA 1ELTA 2WWIA 3ZVBA 3K65B 1TF5A 2BXUH 4ABAA 4KLNA 3OSYA 2UUYA 3GICB 3PVSA 1F5NA 4LXBH 2RCNA 4P4TA 3PUWA 5FTLA 2Z9GA 3OY6U 3PV4A 2FX4A 1VCWA 1ZR0A 3F1SB 2VGCB 3MCAA 4ESHA 1N6LA 2D2EA 4OQXA 1KO8A 1OXVA 1MRNA 1QHIA 2GA8A 2A45B 3C41J 2H9HA 3TVTA 3U2QA 1ZZZA 3P1JA 3ZQ6A 1KXEA 1TOMH 3IIMA 3I72A 3I62A 2VIIA 1C4V2 1ZMXA 5A09A 5JS8A 4K3JA 5FXLA 2IEYA 1MBQA 1UTNA 3GJ6A 2ZDAH 1U6QA 2BDTA 2ZUCA 2OG2A 5FL3A 4LYHA 4HAWA 4A7IB 3L0OA 2V4ZA 1TNKA 3AF2A 2NU3E 3RXSA 4UXIA 4G0NA 2Z43A 4E07A 5EOKA 2QSYA 5C1UA 2VWMA 4NA9H 4GSYA 1CR1A 2VO1A 2IJD1 1ZPCA 4M53A 4JVSB 3M3SA 3F9HA 4NYJR 1TUEA 2BOKA 2IJOB 4ZKNU 4KCGA 1CGIE 2W2VA 4AYXA 1LHFH 2QCYA 4YXWA 1LPZB 4GP6A 1ESAA 3EE0B 1L4UA 1AUTC 2BYAX 1F0SA 3TNFA 3EA0A 2HT1A 2A4QA 3SQHE 1ZU4A 2YWFA 1LMWB 4MPWA 3RUOA 1XD9A 3TW4A 3D65E 4O0MA 3RMMH 5KPDA 4POAA 1HJAC 4FU7A 1YQTA 2EU8A 1F6BA 5TB5A 1NS3A 4AB9A 4Y6DA 3KQKA 4FMDB 4UEHH 1S96A 1TRYA 5TMPA 3GCOA 2PEYA 5C1BA 1YHNA 3G5UA 3KQEA 1HV7A 3QOFA 3TR5A 1O3IA 1E2MA 2AERH 3FP6E 4UQOA 2FPKA 4MRNA 4FXGH 1RJ9B 4GPGA 3I73A 3Q76A 4D4KA 4MRVA 4PO1A 5BYKA 2QN6A 5FR1A 3GFTA 3LGUA 1FIZA 3ASYA 1L4DA 1COWA 1YR8A 4JLKA 4CBOA 1AGPA 2TPIZ 3RU4D 3UG6A 4LZ4B 4B3GA 1OWIA 2XBWA 3T12A 2EC9H 1WQSA 2P8OC 2G83A 2GCHF 1CXZA 1C5TA 4D6PA 3X1YA 3DKVA 3ZZBA 2HCBA 4GZMA 3UMRA 1PUIA 1NN5A 2V7QA 2BY9X 1DG3A 4W5JA 3EIEA 4DIIH 1MZDA 2IC5A 2V9PA 2OXRA 1TQ0B 3QXXA 2X77A 4B2PA 4GI7A 3RXHA 5EQTA 2G52A 2VJ1A 4EFMA 1MZAA 4JYTA 5DN6A 1IQPA 3AVZA 1ESMA 1UBEA 4J2YB 1T91A 2F1HA 2XC5A 4FWIB 3K09C 3QWCH 1J15A 1YLCA 1NNEA 1R0ZA 1EZQA 1GG6C 2XXLA 4IKEA 1P09A 4LY6A 4CH2B 1S0UA 1T3SA 2IYWA 4DSNA 4QG7A 4XVUA 4OM9A 4TSFA 2J7KA 2ZU5A 2AIPA 1MH0A 2VVVA 1YZKA 4I8JA 1I4DD 4DVGA 1FQJA 4B33A 4C0HA 2FSFA 2PH1A 1XEWX 2Q6DA 1SGYE 4WIAA 1XXHB 2F9NA 2VSOA 1A4RA 2O8WA 3UPUA 5CK5A 4TPIZ 1DICA 4TYYA 2XCFA 1HLTH 1OPXA 3LONA 3L0PA 4TLAA 1LNZA 3M3TA 3GCTF 4LBYA 3E16B 4BTUB 3K0FB 4AFZA 2DCUA 3SN6A 1VECA 3RSOA 1KY2A 2ZU0C 1P06A 4IMQA 4IW4E 2R6DA 4OK5A 1AWHB 1P2UA 5K8UA 2A3RA 3TW8B 1RRFA 1AQUA 3C27B 3AM1A 1GJCB 2QSZA 3Q7PA 1BTHH 2ZSEA 3GD7A 5C5NA 1ZM3A 3ZVDA 4B74A 3BWDD 2ZHDA 3ZGXA 1SVOA 1QQ4A 5CIWA 2GJAA 1NMXA 5ANRB 5FUWA 1S6HA 4IHQA 1WUNH 4JZEH 1RJ9A 1KNQA 1G5TA 4NYIQ 1HEIA 3F68H 1DFPA 4D7GA 2Q9CA 5F98A 2W2TA 1H8DH 2J45A 1W0JA 2WV4A 1BIOA 4WJG2 4FMDF 1TTTA 3ETLA 4F49A 5LBIA 1C5PA 4AD8A 4US1R 3WNBA 4NIWA 3R8CA 4B76A 2ZRGA 1W0YH 2CN0H 5AHGH 4TWYA 5EW1H 3KJIA 2PZGA 1T8MA 1R7RA 1B23P 1NSTA 1A2CH 4UKDA 1W7AA 1O5AB 3CRVA 2JJ1D 4TYQA 1C5XB 4GHQA 2AD5A 2X2FA 4NWLA 2ODQA 2Q3MA 3VNUA 2RCEA 4M9FA 3NG1A 1H8HD 2GXSA 3X1XA 2SFAA 2ZGBH 1D2EA 2QXJA 1TNLA 1U99A 5DI9A 1P9SA 1FY8E 2JLWA 5E8EH 5ESTE 5SZIA 3PTNA 3RXKA 2QGZA 1P9UA 3B1XA 1BYIA 4HI0E 3RRMA 4B75A 1VR1H 1OXTA 4HB0A 1FZZA 2FEMA 9ESTA 4LYAA 1SG8B 4XDEA 2AGEX 2G3YA 4BZXA 1C5WB 1PPGE 4RD2A 3F6UH 1SGIB 2Q9AA 4XWOA 3OYPA 3A58B 1JIRA 2ZWLH 2PFEA 1ZGVA 2QTHA 1TU3A 3RXFA 1A3BH 3MO6A 3VMFA 2KJQA 2V0BA 1Q1QA 4BPBA 1MCVA 1RXPA 5FTKA 2IYLD 1JAIA 2AFIE 5GJWC 1AIXH 4J1YA 2QPAA 4Y0AA 4JCNA 4ZROA 4BTIB 4Q5IA 1S2MA 4X8TH 1O0DH 3EWSA 4YMVA 3QXSA 1A5GH 4JT4A 3VXFH 4I33A 1UAAA 1BTUA 1CBWC 3EW9A 1W47A 1OWJA 4ABEA 4DY7B 3MWIU 1BHXF 3MYWA 2RG3A 3Q3KA 3PLPA 4A6XA 3SUDA 4IEIA 3SUGA 1K22H 4KJZA 3U6BA 1G9IE 3E0PB 1DPOA 3EA8A 3GPLA 2ZQ1A 1UVTH 2AMDA 1GHYH 1TABE 5A0CA 1WBBA 2AK3A 1KDRA 4DLXA 4BNRA 3DMNA 1V2UT 1WYKA 3B1VA 1GNPA 2CCGA 3W6OA 4K1EA 2MMCA 2J4IA 3IGFA 1QFKH 3DOEA 1O30A 1NLYA 1D3QB 1GDDA 2ZHWH 4K5ZA 5EP3A 3TIUA 4C0QC 2YWGA 4HDCA 2R44A 3U60B 1ANKA 3AB3A 3E3TA 2A5IA 5IRCD 1EPTB 2Z4SA 3M1IA 2HRVA 1DUEA 2FMXA 1C2MA 1HJ9A 1I2DA 1S3SA 3BFKA 1Q20A 3EZFA 1B7XB 1ZPZA 2YNMA 2R62A 3M5LA 4GP7A 1TF2A 1P2IA 1Q12A 2NO7A 2NU1E 4B47A 3ZZ8A 4Q7MB 2JLRA 1PYTD 1FQKA 1A5IA 3DHWC 1FPCH 5IDVA 1SVIA 2IK8A 2ZSDA 1ETUA 2TMKA 1PPEE 3W3ZB 2WOJA 1O2UA 3A7YA 5JDUB 4LV8B 4CW7A 4FUHA 2BLQA 1K28D 2UZ3A 4X6NA 1KI2A 1GMDG 1G18A 1KLIH 5CDFE 1O35A 1DAFA 3DD2H 4DLWA 1MO6A 2C3SA 4R0IA 2ZRMA 3RABA 3B2EA 4Q19A 1L1GA 1OF1A 3EA7A 1C5OH 3THXB 1Q3TA 2D7DA 1DTSA 2Z3CA 1VCIA 4NBSA 1XJQA 2PL3A 1XJ0A 2QY9A 1EOLA 4YESB 4IJMA 1PLJA 2BZAA 1EZUC 4X8SH 4B2AA 2OBNA 2GK7A 4HAUA 3NCLA 1YR9A 3VR5A 4JL8A 3M35A 1ZYOA 1HPGA 4Y7BA 4WXIA 4IFEA 3W3AA 5C18A 3SFZA 1HAZB 2REBA 4BLOA 5JSZB 1P12E 5DH9A 2ORIA 5A5GA 2Q3FA 1W2GA 2WJIA 3E91A 2C8XB 5L2ZH 4UNNA 1K1PA 1DWDH 3VR4A 1O3PB 1C9PA 4EPTA 3BB4A 2VLIA 4BGDA 1XEWY 2Y5HA 2JLSA 3W6PA 1DDJA 2W83A 1Z6TA 1G7SA 2ZJAA 3NDBB 1UTLM 2XBVA 1XTKA 1QB9A 2H9EH 1WP9A 4X8VH 4FWTA 3BE4A 1V2LT 4KFSA 2JJ2A 3RP2A 5CDFA 1GAJA 2RHMA 3AV0B 2FN4A 2FPMA 3EA5A 1MO4A 1V2QT 3DFLA 1SGTA 2QMHA 3BTEE 1IQFA 5EZ6B 1SHYA 2F1IA 7ESTE 5FOXA 2ZVQX 4BXSA 2QE7A 2G0TA 4DDTA 2R2MB 5LB4A 4CEHB 1C9TA 4M7GA 1GBTA 1Q31A 2QAAA 4CR9A 1QF9A 2BM0A 5FTMA 1K21H 1AVGH 2F9LA 4FVBA 2GZ9A 4WXPA 1GL6A 2JDID 2OC1A 1OFTA 1XB2A 1LKAA 1E0FD 3TAHA 4TPYA 4IDOA 4AGKA 1HQYE 5HM2A 4NA8A 4FIDA 3TVDA 3PWCA 4PC2A 4WAUA 2W58A 4AYTA 1S9HA 1K5GA 3RM2H 5K7RA 1E9AA 5HM9A 2BBOA 3EDXB 2C8VA 4OI1A 3A8TA 2GCPA 3V13A 1BTYA 4ABHA 5JJKA 1DADA 5A8YA 2ZRPA 3P8NA 1O3KA 1G32B 4O3UA 1YE8A 2WJHA 4F4JA 2OUKA 3L0IB 2IHBA 1MTNC 1UTKA 3S7HB 5E95A 1VYUA 1XPUA 1V43A 3DZDA 1ZIOA 3TSWA 2C5LA 2P95A 3FAOA 2DY1A 1UMAH 4QKQA 4IXNA 1O5BB 4CEJB 4FUFA 1Y3AA 4HLUC 2Y80A 1D3TB 4L16A 2FFAA 1CT0E 4CRDA 1XX9A 3K70C 1AA9A 5L8VA 4MUBA 1LVBA 5DYGA 3U7GA 4D25A 4RD6A 2HVXA 3HP1A 1P57B 1O3JA 1G5RA 1HFDA 4UE7H 1V2VT 4LI0A 3ELAH 3MFYA 1DWEH 1NY6A 2K5UA 4CEIB 3MSXA 2R65A 1GHWH 1F0RA 1OYTH 1TE0A 1P0SH 3HU2A 3UMFA 4INHA 2REXB 4RKFA 3CF6R 1ZJ6A 3PO1B 1XVOA 1P6XA 1NROH 4O97A 2F9UA 3FANA 1LDTT 5DP4A 2VPPA 4U00A 3RXUA 3OIUA 1FFHA 3KKPA 3BIUH 4B3FX 5DO4H 5LD2B 1A0HB 1TX8A 5G40A 1M1YE 2C8ZB 4KTUA 1ZYUA 2J9RA 1NJGA 2QF3A 4L5BA 3ICEA 4NMMA 1YZUA 2FV8A 2QPTA 3GDVA 3FMFA 2ORWA 4UXHA 3N5CA 4YOGA 3SJKA 3A80A 1Y3XA 2YWEA 3DFJA 4MNYA 4AYVB 3L6PA 3TK6A 5C20A 1A46H 3AVUA 4LHWA 1AUJA 4R8TB 4CEHA 2HCJB 2H92A 3SU0A 2YHSA 4I1SA 1YPMH 1P2SA 2NU4E 2IBMA 5J47A 1CT2E 3R20A 1U0LA 2IPHA 1RW4A 1DXWA 2OLJA 5F6MA 1KDOA 2RB4A 4EKDA 1KI1A 2O52A 3QBTA 2SGAA 1GKUB 1SVMA 3L2OB 4AGJA 3VEQB 4Q7YA 5JB9S 2P93A 3RXIA 1YPEH 3B7GA 4BWYA 3LFUA 1XKBC 1AVWA 3SHWA 2CK3A 4QJ5A 4KBGA 1O36A 2CEAA 3HKIB 1AKSB 3K70D 4DUGA 4I1UA 2FEQH 3TPIZ 2FOGA 4JZ1A 4CGZA 1MQ5A 1SOTA 1O3MA 1O2LA 4C2TA 3AQ4A 4NH0A 2GKVE 5KUTA 4KXFB 3BGWA 4CEJA 4B3CA 1R8SA 4ZAEA 3SJ9A 3BTME 2GBLA 5DSZA 1TBRH 2P65A 4XH9B 1TNDA 2BD9A 4DG4A 4F4IA 2FSGA 1KDQB 4EPRA 2OCAA 4ON9A 1Z2CA 2PUXB 2SHKA 4PPGA 1O38A 5EU8A 5KDLA 3GEIA 4CT5A 2HGTH 2B6HA 1O2QA 1TNJA 2D26C 2B92A 1VHLA 4CEIA 3ADBA 2BBTA 4TMWA 1B0UA 1SGFA 2OC7A 4JLAA 3QVUA 3P8FA 3BB1A 1XCGB 3ZVEA 5A0AE 2NOAA 4RFSB 1H1BA 4K2YA 2VH0A 2Z83A 4TZ0A 3QK1A 1GMCF 3SDZA 2P6UA 3KXKA 2QGRA 1QL7A 1SVKA 2G4TA 1BOFA 2Q21A 4OS5A 2WICA 1KJWA 4KVAA 2GV6A 4NG9H 2XEXA 1SGRE 2PEZA 3ZZ9A 2PGQB 1C1PA 1XXFA 1HXEH 1RIFA 4TT3D 2I6QA 3Q5EA 1O3GA 3LBNA 4HAXA 1W7GH 1SLUB 1ETSH 3I92A 1GMDF 1UTMA 5JI2E 5F9HA 3D6TB 3H4MA 2O8BB 3JZMA 1O2VA 1JALA 4KBFA 3IO3A 1PFXC 4BLPA 2G00A 3LLUA 3PFIA 1N0UA 2GVDC 1E0JA 2ZS7A 1C1WH 1ZRHA 4Y0ZE 5J4KA 5L3QB 4PC3A 3U69H 3B82A 1DY8A 2GNOA 1R6BX 1D6WA 1GUAA 1IXRC 1RFLA 1O3BA 4IVPA 3PYHA 4QGFA 2B9LA 1CR4A 1ZMJA 3SU6A 3T5FH 3UWIA 1CA0B 1EAUA 3PWBA 1GNRA 2HJVA 3AP3A 4ARZA 5DI3B 2GTBA 3SS8A 1JXOA 1SXJC 1XEXA 4KFRA 2DB3A 3T1OA 3RXTA 1D3DB 1EG7A 3ZIAA 6GCHG 2IWHA 2OLKA 4DC9A 1MV5A 3BTFE 1L4YA 1U8YA 3FWYA 3KXIA 3RMNH 2VRWA 4LX0A 1B0EA 1RE0A 4OK3A 1F5KU 1P75A 4RD0A 4DT7B 3DL0A 1SGWA 1Q2WA 1T9HA 4LUCA 1UEJA 4FUBA 4A9AA 1IQIA 4NZLA 3BH7A 3OX7U 1EAWA 4LBWA 4LJYA 4B2LA 2B0FA 4V0OA 4OS6A 2EFDB 1G30B 1OYWA 5JCZA 4M9SA 4E5UA 4ZDWA 2FNAA 3SGQE 1ZJKA 5IYTA 1TWXB 4YTAA 2QMUA 2Y7XA 5KYKA 5CHAC 1W46A 2Z3DA 1HAHH 1KDQA 1ONBA 3PMBB 4HZUB 5E2PA 3P4XA 1V2TT 4ESVA 1MMJN 2B7CA 1EFHA 1GMHG 1JPNA 3CNOA 1GBFA 1CVWH 4U30A 4GOJA 5C46F 1TEXA 4WMDA 2GXUA 3QZQA 3QKSA 5K8LA 2ZXUA 1UHBB 3MJHA 3K0CA 3U6KA 2RHDA 4BRWA 3S7KB 2N46A 1MCTA 2FYRA 3NUMA 1OWKA 5L3VA 4MLFB 5JZVA 4Q1BA 4JZDH 4FUDA 4JYCA 2Z7FE 1O87A 1N0VC 3UY9A 1TGNA 1VGCC 3TGJE 2ATVA 2WSSA 4ZCIA 2H8KA 3DM5A 2B21A 1UTJA 4AG2A 1CA8B 1AJEA 1F2TB 3RYTC 1WV7H 5G41A 3B8HA 2F4LA 3GY8A 4AKIA 2ASUB 4NCHA 1NN6A 3LBHA 2O8BA 4EFNA 1LPGB 3GOVB 4GDFA 2RGNC 2ZVPX 2GDDA 1BMFA 4KODA 1ETRH 3I32A 3A7XA 1AZTA 1GVLA 3TMKA 3ZVFA 2WZQA 2J3EA 1DEKA 3N7OA 3NWUA 2ODWA 4MYCA 1G64A 4RD3A 1T8UA 1GJ9B 3IIJA 1K9OE 2P59A 5EP2A 4MA4A 4OI4A 2BY8X 1FPMA 3RHFA 4DCDA 3EC1A 3T5DA 2RMKA 3NHAA 3MU8A 3CRMA 3H1TA 3MHWU 5CJPA 1YJ5A 3EAQA 4BANB 2ZFQH 3EIQA 1Z8JB 3TH4H 1YPHC 3SV9A 221PA 1NBME 1HA3A 3RXBA 1QGFA 2P3TB 1YZQA 4NCKA 2X2EA 1MO5A 1UK3A 1G4AE 2OEPA 1H8IH 1N6YA 3MWLA 1Y3WA 3ATKA 1BT7A 2AGGX 3AVQA 2OXSA 1IY0A 3T25A 2QENA 1W14U 1P61B 3KCGH 1LVOA 3I8XA 4INLA 4Q47A 3LGWA 4AYWA 1ACBE 1BB0B 2H5CA 4DT1A 3EPKA 1UVSH 3LDXH 3MNXA 3KL6A 4A4DA 1HAYB 3T15A 3B9QA 2ZIAA 3W90A 3VFEA 1BTZA 3A85A 2ESTE 3VGCC 3T61A 1NFXA 3LGIA 4HZUA 3LY5A 2XNDD 2ZR7A 3LJOA 1WU1A 1FX0B 4OGXA 5FOTA 3LJJA 5JYIA 1HAVB 2QAJA 4Q9LA 5EUMA 4XJXA 1KXBA 1NESE 1E0AA 1Y8TA 1UHBA 1Q3XA 3GCGA 2ZJOA 3BS4A 3I61A 1FTSA 2P94A 1YKTA 2RGXA 3A4MA 2A7QA 3AVWA 3MWYW 1TQDA 2FOHA 1OXGA 4QHYA 1UVUH 3TH2H 3QSYA 5HYOA 1MTVA 1TPZA 1TMBH 3BOSA 2EVWX 3NIBA 4OBEA 5CIQA 5A0BA 1NN3A 3HWSA 4YZUA 1NBMA 3HJNA 4EPVA 2NG1A 3BG4C 3URDA 4TMKA 1CR2A 5EE9A 5FPYA 3DEFA 2ZU1A 3OFNA 2PHBA 4Z1MA 4MDEA 5KOYA 2F3TA 2H1UA 3TITA 2G5VA 1J9CH 3GYMA 5AJWA 1C1NA 1GJ4H 2F1JA 3CENA 2BLVA 1LHDH 1TNIA 1P01A 3M5MA 2GKSA 4MPUA 1QHHB 3AVPA 4URXR 1GDUA 2XZLA 1Q1EA 4Y0VA 1ZTLA 3M7TA 3AVXA 4P0TA 4KTSA 1C4U2 3KTAA 3BTHE 3T2NA 1FUUA 4F4CA 2O8EB 1C4OA 2CLSA 2A5DA 4EPXA 1S82A 3PMAB 4H1UA 3MMGA 1NM6A 1MOZA 4PQYA 4OS2A 2KE5A 3A87A 1AGRA 2IHYA 1A61H 1OKXA 3FZZA 4K69A 2UWOA 1NRQH 1E2QA 1SKYB 1KO5A 2PGBB 2P8OB 1KI8A 1M7HA 3HPQA 1YU9A 2VWLA 4ZCLA 1Y5AT 3BTQE 2XJ4A 2GCTC 5DGXA 2OP9A 1O2OA 1VCQA 3KNXA 1TQ7B 3VHXA 5H1YA 4Z6AH 3UK6A 1DLEA 4FU8A 3AP2A 1KSGA 4NKRA 4AURA 3GY4A 2XAUA 1LF5A 3SUFA 4KLZA 1G3MA 3RS5A 4PC1A 4Q9HA 1SGNE 2VIQA 2QAGA 3ND9A 1FLEE 4TY7A 4D80A 2R0LA 1NO9H 2FP7B 1Z63A 1ZNWA 3M0EA 2QTVB 1CHOF 3WNCA 2SNVA 3A6PC 2QNRA 1W0KD 1AGJA 3QKRA 4Y7AA 3B1WA 1QB6A 1U9IC 3TSOA 2DFKB 2IYUA 4MNWA 1FX0A 1DSUA 1HAVA 4WZ6A 1TPAE 2OFOA 2O5VA 2THFB 1RYFA 3KQHA 4WOPA 3R3GB 3VX4A 2AK2A 4OK6A 2WV5A 5K8TA 3IQXA 2J7PD 1ESTA 5JWRA 1HNEE 3LKWA 1BBRE 1FY3A 3UOUA 4EIWA 5FCRA 4FXPA 3CKLA 3F0TA 1MKWK 1GVKB 3QNUA 3VR2A 3PQCA 2ZE6A 1NLZA 1SHZA 2VSXA 2DWOA 3Q85A 3FKSD 1Y3VA 1VCMA 2VHTA 1E35B 1VITH 3A84A 4Q4LA 4D0LB 2XXAB 4GRAA 2ZTSA 3FZDA 1YF4A 3SQEE 1EFRD 4K8BA 3I78A 3V4FA 4Q48A 2ZROA 2G81E 3GJ8A 1YZGA 2STBE 4UNPA 2DFLA 4II7A 1QHRB 1GJBB 1EP6A 2CE2X 4AK9A 1EFCA 4DB2A 1U8AA 2I4IA 3SHAH 2ZAMA 2YC4C 1LHEH 4AFSA 4OI2A 3MH4A 3TLXA 4TZ6A 4N3NA 3RC5A 3RAPR 2GT7A 3CZPA 4DLSA 1EJMA 1FDPA 3FMPB 4UJ3A 6ESTA 5DLQC 3IILA 2XBXA 2CHGA 3HR8A 5LPRA 1MU8B 3TK9A 5B64A 1FY4A 3DKPA 3N70A 1QIXB 3SR0A 3VTKA 4D2IA 2DE8A 4WMEA 5E0JA 2IYTA 1N6HA 3A4NA 3SBEA 1E37B 3G01A 1D2MA 4YDSA 4R9UC 1CTQA 1O3EA 2FGKA 4DJTA 4DCSA 5PTPA 5F3WB 1SFQB 4KFTA 4PQRA 3ZZTA 1NRNH 4GT1A 1FNIA 3QY0A 1VIYA 1BBRK 1S0RA 1Z71A 3CO5A 3KX2A 1ZIPA 3A8CA 1RTLA 3B9FH 1PQAA 1OIVA 3EPLA 5B6OA 2FODA 2EFCB 5DHAA 2HLDD 5LPFA 4A2QA 2ZU2A 3RS0A 4ISHH 3Q77A 5JS7A 1G8PA 1MTSA 2C99A 1S6FA 2B7DH 4MGZR 5FL7D 1A0JA 1CSOE 1UVPA 2QV1A 1DE0A 3KKNA 3LDAA 3GEEA 1BRAA 3A7TA 2H1LA 3TH5A 1EB2A 3UANA 2NIPA 1AI8H 1DS6A 1CGJE 1I4LD 1S9DA 4F38A 2C77A 4BLRA 3BSQA 2ZECA 3ATLA 2AIQA 4Q9KA 3MG9A 2VHCA 4Y79A 2W7UA 4Z8YA 1NMYA 1OH8A 5J4QA 3EZ9A 4N0DA 2Y6TA 3LH1A 3J81k 4A2WA 1Y3YA 1L7VC 1MABA 1ELGA 1VPLA 4BAKB 2F9OA 2WUCA 5JJIA 3HPTB 4PZLA 1E9CA 3KQDA 2QRZA 3ZZ5A 2JIZD 1GHBG 3SC3A 2BD3A 3U3MA 4DLYA 1IQJA 1OFHA 1TA2A 3RVBA 4I99A 4URVR 1AB9B 2JLQA 4XD7D 4BUJA 1C5MD 1Y5UT 3P20A 2WPJS 3O8CA 2ZFSA 4D76A 3WY9A 1Q1BA 1OXSC 4B43A 1E2IA 1DX5M 4A92A 4ACAA 2FM2A 2G55A 2QBYB 1N6RA 4DDUA 2NMVA 1QB1A 1HH4A 2PKSC 2QROA 3KJEA 1ZPBA 1NRJB 3LX8A 2J41A 2QP4A 2OD3B 3WNDA 1SMFE 4XSHA 3LXRA 1C4Y2 1EJNA 2ZDNA 1EKBB 3QGNB 3KXLA 3E0NB 1HT2E 5E2OA 4E7RG 1R5NA 4YLQH 1KK1A 1M7BA 3UXMA 5C67A 4E09A 1GHAG 4PFSA 1P7CA 5C4GB 3C5CA 4B48A 5BW8A 3C14C 4QBHA 2ONJA 2OHFA 1GJ7B 1OKKD 4A0RA 1KI7A 1W12U 4CH8B 3I5XA 1YPGH 1KY3A 1E2FA 2O0KA 4TN1A 1HT1E 3RXVA 2XTZA 3T26A 3IITA 3QF7A 4HATA 3O8BA 2KI5A 3OIYA 5JCPA 1E34B 3ASZA 4K8YA 2TIOA 2D4HA 1JBKA 4A8JC 1TUIA 4DDVA 1MKWH 3OTJE 1GILA 3SU3A 5FCKA 1N1LA 5GVSA 5AUPB 1NFWA 1OIXA 1NTPA 2NO0A 2G4UA 3S1AB 5DYIA 2ODEA 1I4TD 2IS1A 1YCPM 1NLFA 4CDGA 1KIGH 4HI3A 3SZEA 1XWIA 3ZD7A 4DURA 1NVVQ 4D4JA 2Z9LA 1WQ1R 5K0HA 2PCLA 1GG2A 3H86A 2BHRA 1JECA 1ZD1A 4B3BA 1X1RA 1DBSA 4BASA 2WYGA 5KSYA 2V35A 3U8TH 3UNRA 1T5IA 3OE7D 5AR1A 1G3DA 3IQWA 1KTSB 4PZZA 1P03A 4DIHH 4JKYA 2ZPQA 4XFQA 3NXSA 2BX4A 4IC6A 4MNVA 4L15A 1PJRA 4MQAA 1U81A 4OI0A 1ZGIA 2B7BA 2ZI7A 3T62A 2BDBA 3AP1A 3FOZA 2RKOA 4K46A 4OL0A 1KMHB 2QY0B 3MFJA 1T4GA 2IS4A 1DSTA 5CM8B 2QBYA 4Z0KA 4A1XA 2D8WA 3RXCA 5AWFC 1NMZA 4ZXYH 2AX4A 3RXPA 4TL9A 4Q02A 8LPRA 4MPVA 3BK7A 2ZCLP 1OOKB 4G5QA 3CNLA 1IQHA 1S83A 3BTTE 2EEKA 1WSSH 5SGAE 2H7VA 5HZKA 1G21E 3AF4A 4TQUS 4O2LA 4GZLA 1Q1ZA 1ZUHA 3E1XB 3SYLA 3SI7A 3C16C 2IYVA 4HDQB 1G3UA 5TDHA 3WHKA 1O2ZA 3RC8A 1NFUA 1GGDC 2XWAA 1W10U 4JLPA 2A1DB 2CVHA 2WPDD 4NL4H 1S84A 2W3KA 1N8OB 2XGJA 4XSGA 2D3WA 2GXQA 3GLGE 4IW3B 5K8IA 4WY3A 1QVRA 1ABIH 1V5WA 1QBVH 3MJRA 2VSFA 1SQAA 1TAGA 2O8LA 1F2SE 5F8TA 1P5ZB 1MTNB 4B2CA 1HJ8A 4NP6A 1BJUA 2TBSA 3IBYA 5G4BA 1G9XA 5A8XA 3WXMA 2IYQA 1NKSA 4URWR 4LYFA 1RFNA 1HGTH 1QY6A 4HLDA 2XRCA 2HLDA 3A1UA 3EXAA 4ASUA 1LTOA 4M9XA 1HQCA 2W6IA 3X1WA 2JGNA 1GIAA 1WXRA 1WTGH 5LB2A 2VP5A 2BLWA 3B1ZA 3K70B 2A2XH 3PG5A 5FL7A 3GJ0A 5JFGA 1E9EA 2W0MA 2ZGXH 2WWHA 1AS2A 4PXAA 3RC3A 1E2EA 1Z29A 3B6EA 3A82A 4C7OB 2A31A 1ZJDA 2AYWA 2V1UA 2BZ6H 3VKHA 4LBVA 2XB4A 1GI4A 2FLRH 1QBOA 4RD4A 1QRWA 4TLCA 2OM2A 1BTPA 1S4QA 3CZQA 1O3AA 1TNGA 1W36C 1GBHA 4N0EA 4RJLA 4RCZA 1C5NH 1AD8H 3F5FA 3Q3JB 5AUQA 4EJSB 5L3SB 4DIEA 1N6PA 4BRUA 2BQWB 2FGJA 5J40A 5DIFA 1HIAB 5CJ2A 4KSCA 2IW3A 4UNSA 3GLGA 2O8DB 4JLNA 2AL7A 5DNYB 4LSGA 1LB1B 3MWKA 1LPKB 2Z6BD 3BV9B 1O32A 1K1JA 5DP6A 2OV2A 1IXSB 2VIVA 1KY9A 4PAOA 1MKXH 1PQ8A 1Z1JA 4C3ZA 3RU4T 2ZRFA 4A1FA 5B2ZA 3RSLA 5C4MA 5KPJA 4D9QA 3LWNA 1BYUA 5DP3A 5C1XA 1B0FA 2ZA5A 3MU1A 2MSCB 3C8UA 3OAAA 5JECA 5GNDA 2J0UA 3LOXA 3TNTA 4YXWD 5E7MA 1FNNA 1OJLA 3KQUA 2QXGA 1MD7A 2B5TB 2R2AA 1D4PB 1C1TA 2BDGA 1OH6A 1Y5BT 3B13B 5I25A 1AVXA 1GRRA 2EYQA 2ZI2H 2XBYA 2FSIA 3CNNA 1QVAA 1XRJA 3H09A 3L8ZA 4QGHA 3K53A 1KXCA 2BTCE 4KGAA 2GCOB 3ZS8A 2VEDA 2ZUDA 2WKQA 5GCHG 2XNIA 1TU4A 2FFBA 1IN4A 3PEYA 3R7WB 2F55A 4D8NA 2D2FA 3ZV9A 3AF3A 4HLQB 4TYPA 4B44A 5IHPA 2A7CA 1QR3E 4AFUA 1GHBF 2V1XA 1XUHA 2BDIA 3GCTG 3FHOA 3UMSA 2BQ7B 1COWD 2ZR9A 3T29A 4D26A 1IN5A 1WAYB 4MNXA 1D5CA 1XTSA 621PA 1XPOA 3NBYC 1E36B 1W7XH 4LHXA 3C15C 2YV5A 3OU0A 2ZFRH 3FE2A 2ANMH 1U0JA 2J2UA 4C7OA 4R98A 2PUQH 4MPXA 1TPPA 5D3MA 4ABIA 1NG9A 4U7DA 4NWKA 3KIDU 2ZJBA 3W8NA 4DLTA 4H4FA 3LBIA 3N2IA 2V7QD 5CLQA 2OXCA 2KBEA 2A5GA 2ALVA 5FI0B 1WOFA 1UKYA 4RSPA 5L3SA 4EJSA 1BRCE 1T32A 1RJXB 5DN6D 1EASA 2HNTE 4BLTA 1H9HE 2R2WU 4IFBA 2ZANA 2A9KA 821PA 1IAUA 1O2JA 4NYJQ 1W3CA 3LW8A 1QTFA 2O8DA 1JB1A 1SVSA 4BFVA 1LHGH 1OHHA 3PLBA 1BZXE 4FD2A 5EUQB 2FI4E 2ZI3A 4B2IA 1W2KH 4MGYR 5KSPA 3RXEA 4MKGA 4TSFD 4WH8A 1ZU5A 2J87A 4IMZA 3ESTA 4QJ3A 1G1MA 3AVOA 5HKKA 3VR6A 4B35A 3RXDA 4JLMA 4BOHA 1PUJA 3ZZDA 4JSTA 1DWCH 2ATXA 3MU5A 1LVGA 4WF8A 4HAVA 2EW1A 1E2LA 2FOMB 3W5JA 1T8NA 5TCAA 2FSHA 3MNBA 1GKYA 4GPTA 5KDOA 1LQDB 4JBWA 1E0KA 1KAOA 2C04A 1AK2A 1AE8H 2ZCHP 3UNSA 2ZO3H 1IAQA 1QL9A 2ZQ5A 4BE7B 1SXJB 2F91A 3QI2A 2GF0A 2CV3A 2F43B 2N42A 3GMTA 5E7IA 3HR7A 3Q00A 1E38B 3AAVA 2KSQA 3QN7A 1W4AA 4ZHMU 4D7FA 3U9AH 3JZAA 5AJXA 3ND8A 2ZNKH 2OAQ1 2V6NA 4LJ7A 1IQLA 2PT7A 4JT2A 4P31A 3R7WA 5E7JA 4Q66C 1AZ8A 1SGCA 4XOIA 2EI6A 1PVOA 2ZJ2A 2ECKA 2PX3A 3CS7A 4NYMR 2CL7X 2YINC 1QJ1B 2OE2A 3O47A 1W0JD 1KXDA 2GD4B 5JPMH 5EXLA 2ZU4A 4KV9A 1TGSZ 3SU4A 4Y0YE 4M8NE 2JEOA 1EFUA 1F5RA 5CHAB 3ZYCA 4XTCS 2HNTF 3E6PH 1AU8A 1P3EA 2OLGA 2F6RA 3QXJA 1DAKA 1C2KA 1TGTA 4X1RU 2CE7A 1IHTH 1EESA 1TRNA 2PJZA 2Y81A 1TALA 1CJVC 4G5OA 1DVRA 4LWZA 1WRBA 3STIA 4IXMA 1O5FH 2JLXA 2OINA 4O3TA 1SXJE 5EXNA 1ORFA 1SVLA 1HRTH 1SQ5A 4YT7H 1W4BA 1PQ5A 2FS8A 4SGBE 1WBDA 2G51A 2RGCA 3WRYC 5GPIB 4CVNA 1E98A 3RRZA 3EQ0H 1J70A 4WZBE 2V6IA 1GBEA 1RGQA 5EW2H 4AY2A 4AI6A 1K1OA 2XTNA 1R8QA 4A0GA 2CDNA 5FTNA 1GBJA 4YMWA 1DS2E 3T06B 3ADKA 1ODFA 3ODDA 1IBRA 1VJAU 3KJGA 1ZAKA 3EARA 4RKEA 1K2I1 5IK2A 4Q2KA 2QPOA 2QTFA 1DOAA 3RDPA 1RTKA 1G17A 1E2GA 3CH5A 1W13U 4X8LA 1A2KC 1ZSLA 1VDZA 1AFEH 3QKUA 1H9IE 3TK5A 3HDTA 5FUVA 1IQKA 1ZD9A 5EXXA 4EDHA 2OC8A 3MI4A 4LC0A 1U0HC 3LGVA 4TLEA 4RN6A 1KK3A 1E96A 5A2MH 2AXPA 4ILEA 1WXQA 1XJCA 1IQGA 2GJ8A 1JRTA 2GMTC 3A89A 1SXJA 3LVRE 4Q7ZA 2ZF0H 2I1VB 2C95A 4IN2A 2LCFA 4JK5A 2SGEE 3EPHA 3KHVA 3GY6A 4G5GA 4P4UA 2AMQA 1QZXA 2F43A 2QQ0A 3ADDA 3CPEA 2IS2A 3I29A 2FDAA 3MH7A 1GOTA 4Q00A 1P2MA 4MGKR 1FMJA 2EA3A 2RH5A 1OH7A 1D8TA 2ZSAA 1FMLA 2ZDKA 1K1NA 4X6OA 4DCTA 1C1MA 1YPLH 4GCHG 3AF0A 3MLEA 2C78A 1UM8A 1YRAA 3P8OA 3PV0A 2SGPE 1X86B 3SV6A 4DWJA 2FEOA
chains in the Genus database with same CATH superfamily
4F11A 4RTPA 1QA0A 4TQAA 4ZV4A 1O33A 1ZIDA 2A67A 4O4JF 1MQ9A 5EE5B 2C8WB 5GJCA 2QMOA 2X1VA 2JK1A 1KARA 1W52X 3L4BA 4Y2QA 3KQCA 1SZPA 1ODIA 2VJNA 5GV8A 1VRWA 4BJ5A 1IEVA 1FNSA 2X8LA 4ZVOA 4BZPA 3ZH9B 1JDSA 2Q5EA 2O8FB 3GJ4A 3KZCA 3QENA 3WMEA 1S89A 2NU6A 1X1AA 5B1EA 2WHPA 2Q3HA 4DRZA 1M9UA 1Q57A 2Q5LA 4NCNA 2O6LA 4GM1A 1MOQA 1I5RA 4CG2A 2QAIA 3BG4B 4BLVA 1Y33E 4DQKA 1X8KA 3D7KA 2P78A 3T1TA 1YJXA 4JHLA 3AW0A 3W3AD 1EK6A 1FY5A 3D7LA 4G37A 2NPIA 3ETCA 5LQJA 5CBPB 3C3PA 3H5TA 2Y92A 2ZBQA 1M74A 1WCYA 4UTPA 1VHQA 3KAQA 5DHSA 5BPHA 4GM4A 2ORVA 5JEEA 2PX5A 2C2GA 1LVUA 5BXYA 5HF5A 1C1VH 1K08A 2CLKB 2Z9IA 4OJQA 2I66A 3LL7A 3DTYA 3GOQA 3PYMA 4LNUA 1F1JA 2P2LA 4OFBA 1BIFA 1X87A 3U0VA 3RODA 4YOIA 5MF6A 2P5TB 4OQPA 5DP7A 3ZVNA 2YC2C 3HN7A 3M82A 5HJ5A 4I7YH 1PZFA 2HB6A 1XQVA 1MRSA 4NI5A 2I4LA 4HUTA 2O07A 1Y1SA 2D1RA 3VU0A 4E30A 3LSTA 2GI4A 3TLAA 2F59A 1TT5A 4JJKA 2JZOA 2WTMA 5TQ0B 2GAJA 3DVQX 4JEHA 4NIXA 2AE1A 1H8ED 2FLBH 3S2YA 3ZVLA 1JVBA 3H2ZA 1D09A 2A7HA 3I30X 4R1PA 2QV7A 1SAYA 1XXHE 5GADl 1AKQA 1SXQA 2ODBA 3QJGA 1DELA 4XWGA 3T7EA 3N7EA 4ABFA 3BWEA 1ELCA 1GI8B 1DSSG 2CEKA 1UPTA 1YDMA 3FPBA 3LIPA 1DO0A 4G5HA 2QP9X 1JR4A 2DBQA 2DFPA 1PGQA 4RSGA 3DOHA 5C7IO 1Z0FA 4FVDA 3GN1A 4YASA 3IVGA 2O1XA 1YR7A 1TCUA 3PLKA 2ALPA 2L42A 3HXOA 3DV9A 4G0XA 2P3QA 4ISLA 3KL4A 1HM5A 4HAIA 4PSAA 2BHGA 3AM4A 1JG7A 1DCTA 5CH8A 1M6NA 4ZQFA 2ZHQH 1QVWA 5EG4A 2VP0A 2B82A 4HSGA 3G0HA 5A4IS 3EB9A 2EG9A 2O2SA 5HEKA 3DA9B 3TRDA 3HBMA 1Z8FA 3K9WA 5LDDC 5AHOA 5KQPA 2Y5GA 3NDIA 1HURA 2DBYA 3SE0A 4QATA 1DWBH 4Q01A 4XUEA 3FFAA 3KNZA 1P11E 1AT1A 3A1EA 5KB3A 1CHGA 1DY9A 3GF4A 3EGWA 1FY2A 2VIOA 5MFZA 4QUAA 2Z4TA 4LEIA 1ZXXA 1VE5A 3BIVH 1XJWA 1P2VA 1HORA 1T0PA 2QR5A 3DE0X 2OHXA 1VHDA 1JHMA 3BEUA 1B0ZA 4OV6B 2H9YA 1ECLA 3CCFA 3U3KA 2MCFA 3NOQA 1AN9A 1TGBA 2PD3A 3KFVA 1O3FA 4W8OA 5TXGA 4Q1FA 2SCUB 3N6XA 4RL6A 1F12A 4IIEA 3VXEH 5EGMA 2EKZA 1YZVA 3DUFA 5EQRA 3ZQJA 3DBHB 2ZTHA 2WWXA 1E20A 4UFPA 5KNBA 3ICCA 3BK2A 2AN3A 1Z4LA 5KEIA 2R6GA 1AO3A 1P29A 2HUPA 5KOHB 4BFXA 4JZFH 4WUTA 5EINA 1NJFA 3GLIA 2GS9A 5LD2C 1UANA 3O8QA 4X0WU 1P60A 4F3NA 4HUJA 1XHLA 3M33A 4XVRA 1EZSC 4ZKRU 1BQYA 4G24A 2O8NA 4IFTA 1HMPA 3LFTA 1G5PA 1N5DA 2VHZA 2B1JA 1GMCG 5J63A 5GTDA 3CF2