4B74A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
total genus 208
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b74A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b74A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b74A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b74A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b74A03
4G5QA 4RD3A 4H1UA 4D80A 3EAJA 3GCHC 3GFPA 4XFQA 3REFA 2ZU1A 1O5AB 4NYIQ 3PV5A 1GL0E 3EA5A 1S85A 2J38A 5HXFA 1AVGH 1LTOA 5LH8A 5LD2B 1NT1A 3ZZBA 1P62B 3KKNA 2A7CA 1JNYA 5BN4A 2BTCE 3AF0A 4O2LA 4ITRC 5H68A 2XITA 2OBMA 4M1MA 1F2TA 4FMBB 5JSZB 1L4DA 4X6PA 5HPYB 2B0FA 2GF9A 2QP4A 1Q20A 3VFEA 4FWTA 2QM8A 4QHSA 3U8RH 2Q9AA 1KLIH 1FV9A 1EZSC 4LZ4B 2IWRA 3M1IA 3K9HA 1E4YA 4AK9A 5F98A 3F3YA 5FI1B 3KQDA 2WSSD 4NCIA 2ZRKA 1SB1H 2XYAA 4A4DA 4LYJA 3NPSA 3AASA 2ZM5A 3DKPA 4DDUA 4RD2A 3ZZUA 4OK5A 1AZZA 1JEDA 3CF6R 4GFDA 1YZTA 3NWJA 4JSYA 2A5IA 2Z94A 4WOPA 3V9PA 3FGNA 4P4UA 1GL1A 2WJGA 1GJCB 2QYIA 4G5SA 2GAAA 2QTVB 4POAA 4KELA 5HKKA 1AUTC 1GBMA 2WKQA 4Z1MD 4V0OA 2AK3A 1D5CA 2ZTYA 4M2LA 2VU8E 1DAMA 5CDFA 1NIPA 1GJ6A 4OHZA 2Z3CA 1ZC4A 1ABJH 3SJIA 2BBTA 1TMKA 1R5OA 1GJ9B 3I4LA 4XWOA 4LBZA 1CGJE 4KTCA 1J99A 1II0A 1NMXA 1GI1A 3HR7A 1ZNYA 1HJ8A 5JCPA 1INCA 2GEDA 3ATKA 2VB0A 1M34E 3H1TA 5EP3A 4TWYA 2IYQA 1VKJA 1IJFA 4KLNA 4E05H 5KSYA 4INLA 3SOSA 4DB4A 3ODDA 2WMNB 5JEEA 3SYNA 3EC1A 3JZMA 2BBOA 1P9UA 4UEHH 2DWQA 4LV5B 1ZM7A 4HDOB 2CF9H 2X1VA 3RS2A 1COWD 4JBYA 5B2ZA 4IEEA 4EFMA 1KK0A 4WJG2 4TMZA 1ZUHA 2AD5A 2QROA 1E79A 2JDID 1NG1A 3QKSA 4H42U 4W5WA 3KJHA 3BB4A 3TUZC 4DIHH 2PKAB 1W49A 2A1DB 1HJ9A 4Y0ZE 1P61B 1QIXB 2R6GA 1OSSA 1AVXA 1M7HA 1Z7KA 4BTUB 1QHNA 2AGEX 2OXRA 1VCIA 3RS0A 1P9RA 1IXZA 2CF8H 2J0UB 3DL0A 1UM8A 1UADA 5EW2H 1XD8A 1SXJE 1O38A 3G5UA 3RRMA 1G8FA 3KXIA 1MO3A 3GCHB 1E32A 3MD0A 3ENSB 4KU4A 1G37A 1E2EA 3VPKA 1Q3HA 3ZVMA 1XX9A 1JQLB 1XJQA 1WOFA 2GKSA 4A5TS 4Q7KA 3LY5A 3R7WB 3DVLA 4ZHAA 4JLKA 1UKZA 1GJ7B 3BTWE 4V0NA 1PQ5A 2A5KA 1Z2AA 2QTHA 1S1MA 1R4AA 1VJ9U 1QQUA 1RGQA 3SU0A 2WPIS 2XB2A 1V2JT 1Y3WA 3TR0A 1Q2WA 2GV6A 2GK6A 1XCGB 1EFCA 1TUEA 4JMYA 1W12U 3OU0A 3E16B 4RFVA 3QKTA 1P2KA 5LGOA 3GOVB 4GI7A 2HWLB 3RXEA 1IOZA 2GJ8A 1GDQA 2R3UA 3TAHA 3ZZ9A 2CVFA 3OSYA 4Q7MB 2ZTXA 2JLYA 1E9CA 1GBAA 1H8HD 5AR1A 9LPRA 2SGEE 4NA8A 1E2DA 2PLFA 3A89A 4AWXA 1C2DA 1CQQA 3JVUA 1QDEA 5AJXA 5KDDA 1E94E 3C1KA 1DVRA 3DHKH 2CXXA 1UPTA 4PC6A 1W44A 1P2VA 4AKIA 1C5TA 1L8QA 4PQYA 2WKPA 2VRWA 2BM2A 3SUGA 4OI1A 5FI0B 1HAOH 1SHKA 5FUYA 3FANA 2JLQA 4DGJA 1FQKA 2GWHA 1XPRA 3QXHA 3N2IA 1IAQA 1X3SA 1A0JA 3PUXA 1QHSA 3H2YA 4LJ7A 1FY5A 3GLHA 3T1TA 1DELA 2LKCA 1M2OB 3ZD7A 3AH8A 4ABDA 4ZIRB 1VYUA 3EA7A 1KIGH 4NTZA 3UPUA 4NIWA 2QBYB 2WWFA 3KQBA 3RXAA 4CREA 3EAQA 4D7GA 3CM0A 4MDSA 1SKQA 3NEYA 2Y5HA 3LH5A 1FY8E 4Q66C 3DOEA 1MKWH 1U99A 1OFUX 5FOUA 1GI3A 1BYIA 2A2ZA 3QTOH 1JPJA 2PLRA 1ANKA 1VITH 1PV4A 4F49A 1R6BX 3B2EA 1QHIA 4FIDA 4XOJA 2OCAA 2O8LA 4ZKRU 1VCQA 1A4RA 2Z9IA 5H4IB 3F9EA 3K8YA 2ZYUX 5DIFA 2FSIA 3TJUA 4LJ4A 2BLQA 3DT0H 1TNKA 2A2QH 3SHFA 1Q1EA 5FPKA 1NLZA 1GVKB 1NL3A 2ZVPX 2V3OH 3PQCA 2UUFB 1O36A 1MD8A 1FUJA 3SJBA 1KY2A 4X1RU 1F5KU 3TIFA 2F9VA 3QBVA 1YZLA 1ZPZA 1KSJA 4M8NE 4BANB 1MH0A 4KO8A 1QJ6B 2IYUA 3UNSA 2VIOA 1NRQH 5P21A 5B57C 1OLOA 2A45B 1J90A 1N0WA 3KL4A 3V3MA 3FYHA 1QB6A 2QPTA 3NDBB 2X19A 2F9BH 4D76A 1GKUB 1ANBA 2WJJA 4ZUHA 3RXJA 3C15C 1YR8A 3PEWA 1GBIA 1QHYA 1E98A 4A7IB 4DC9A 4Q9LA 3L2OB 1UVUH 4KTSA 1YR6A 4B71A 3KDSE 3RU4E 1N5KA 5LB2A 3UWOA 1LPZB 3ND8A 2Z3EA 4IOMA 3SNCA 5ESTE 4UDWH 5E95A 3ADKA 2RGDA 1GWAA 5CHAC 3K9NA 4YT7H 3EE0B 5GDSH 3D8BA 5JHGB 2GVZC 1ZIPA 3KQKA 1EPTC 2N1BA 4NZLA 2CCKA 3QTVH 3QKRA 6CHAC 3NC0C 2DR3A 4TTPA 5FBQB 2C4FH 2BVRH 5GJWC 1JXPA 2ZI4A 1RFLA 3E0PB 1AE8H 1P60A 1XEWX 1D3DB 3QF4A 4YMSA 4M53A 2O8CA 1P9WA 3K53A 2QRNA 4RSPA 2GJAA 5DNYB 5LD2C 1N5IA 1ZC3A 3AK5A 3OFND 2FPMA 2ZU0C 4ZI2A 3UWJH 1V2VT 1YKSA 2DUCA 4R98A 2ZI7A 5L3SA 2F9OA 2FX3A 2OBNA 4ISIH 4UNQA 3NXSA 1NKSA 1XNJA 1ZRKA 3P17H 3TK6A 4Q9IA 2GETA 4JK5A 1H8HA 2GRJA 3PENA 1P3CA 4OQXA 4BAOB 3W5IA 2G77B 3VKGA 3MNCA 1Z63A 3Q5EA 4JIMA 3LJJA 1RIWC 4LI0A 1HJAB 3AV0B 2ANMH 3S7HB 1C2IA 1E1RD 2BY5X 3CX7A 3PLKA 1AWHB 1S96A 1OP0A 1Q1QA 1L4YA 4UXIA 4QGAA 4K69A 3TH4H 2CJIA 1NFWA 4OJKA 3SU8A 2ZR7A 1Z3IX 4TN1A 2O8BA 4ZIRA 1OXVA 1FX0B 4HI0E 3FZZA 1E0FD 1C2MA 3EA9A 1N8OB 3M5OA 5EUMA 2NIPA 3B85A 3AP2A 2J9NA 1TA6A 1S6FA 3RXTA 4IW3B 2Q3HA 3PVSA 3BTKE 1RTKA 1E6CA 4J2YB 1R8QA 1V2OT 2KWIA 1BTHH 2ANWA 1Z6YA 1E36B 2KBEA 3ZZ8A 1SMFE 4IOJA 1XTKA 1UAAA 1GL7A 5HCNA 3RS5A 1RS0A 4PSVA 4AORA 4CGZA 1EUFA 2ZDLA 1YQTA 1ZJDA 2OFOA 5AK0A 1FPCH 4LV8B 3K0SA 3GP8A 4KHZA 5EP4A 4KXFB 4IN1A 1SLVB 2AL7A 3FP6E 2JLRA 4QBIA 1OYWA 5JBAS 4R2IA 2UUJB 4QM7A 2ANBA 2ZHEH 4LHYA 4DW2U 1QR3E 1O3HA 3UMRA 4P4SA 1D3TB 2H1LA 5JJKA 2J95A 4TLAA 3U3JA 4I99A 3G0HA 3LW8A 2FGKA 2C5LA 3LGVA 2AGGX 2H17A 1QURH 1BTZA 1YPJH 1T3HA 4B48A 4DIEA 4LYAA 4TL8A 4W7SA 3W6PA 4IMZA 1KI1A 2SNVA 3SJOA 3KNXA 3R0FA 3V4RA 3ZVEA 1P5ZB 4IFBA 2ZUBA 3P8OA 2D74A 1KTTB 4PSAA 1PPGE 3H86A 4OI0A 3CNOA 2FOHA 4US2R 1O3YA 2HUPA 3QO6A 1Y5UT 4ON9A 2A7HA 2P8OC 1QHHB 4XBBA 2V1UA 2GCTB 1E3MA 5A0BA 2FOAA 3P27A 3UY9A 2OESA 4U5XA 2QT0A 3FMOB 4DT1B 5K8UA 3UXMA 1MO5A 4TY6A 2MSEB 1U2RA 4D82A 1ZBDA 1AE5A 1ZP6A 3D49H 4JVNA 1ZTKA 5KSZA 1ETRH 1V2RT 3NXPA 2QSZA 4QGGA 1HDTH 3CZQA 2R3YA 5J4VA 4B73A 2E1RA 1UK4A 3VR1A 3OIWA 3Q00A 4Q9KA 1ZD8A 4B2IA 4IRUB 2XNIA 4UONA 3SQWA 5EPNA 3QUSA 2BIFA 4FMCF 2WSSA 1ZTLA 1T5LA 5HCIA 3GMTA 3U8OH 1SGPE 1DT2A 5TJXA 1IN5A 2RGEA 4BFTA 3LAWA 3WHLA 1XTIA 3QKSB 1RVDA 2HEIA 1NVVQ 2A5DA 4M9SA 1AFQC 3VU9B 4WWYA 2G0TA 1E38B 2QXIA 3NKVA 2HALA 1NMZA 4GDFA 2QY0B 5FOWA 2P67A 1E2MA 2C03A 4GP6A 2ZKSA 3TVTA 2J0SA 3K09A 1YPMH 2YC4C 2DCUA 1BMMH 1ZSJA 5IYTA 4YMVA 2I1QA 2VTKA 1ZSKA 3VXEH 2FMXA 1E2HA 2BZAA 5AHGH 2BDYA 2XWAA 5DLQC 4B2BA 4RKFA 5DP4A 2JETB 1SQAA 3RS3A 4XTCS 4G5OA 3GCGA 5C67A 4MPWA 1ARCA 2XXAB 4IDHA 2O8MA 1OFIA 3Q72A 2TRMA 3GLIB 2ZQ1A 1DARA 4URXR 4MUAA 3OHMA 1RJ9B 4LZZA 3GLGB 421PA 3RMMH 1OHHD 1PUIA 3SV2H 1C1TA 1J8MF 3LO5A 4IOKA 1AS2A 2FM2A 1O2VA 1B0EA 2JKHA 3NZIA 4KFRA 4QM6A 4YMTA 5DN6D 4TMKA 1LHGH 1W3CA 4LPKA 6ESTA 3FKSD 4JZKA 5C1UA 4GSOA 4IC5A 1MAXA 4I1OA 1FL9A 1Z0FA 4DSTA 5EXTA 2X77A 2JGNA 2JLUA 4MG3A 4MPVA 2AEIH 2CE7A 4Z51A 5JLJA 1UTOA 3BFXA 4XSGA 3I8SA 1OWEA 2ZEBA 2VP4A 1ZTJA 3ZZDA 3GLHE 3VR4A 1D9XA 5EXNA 1ARBA 2J7PA 3OEED 1D2EA 2R62A 1MCVA 4X2WA 4BFZA 3ZYCA 4MRPA 3GDVA 4LX0A 3NUMA 3KB2A 2REBA 5FBEA 1QJ7B 5T6FA 4NP6A 1UF9A 2C8VA 2ZDMA 3QVUA 4HUTA 1T8LA 1ELTA 3KHVA 3RWOA 1O5GH 2BC9A 1BZXE 2YC2C 3AVUA 4NSVA 2FOGA 2OAQ1 3BK7A 5E3HA 5L30H 3DM9B 4ESHA 3THWB 2QGRA 4X1SU 1FMLA 1N6XA 1R0YA 5E2PA 2GCNA 2B9LA 1C1NA 4WAUA 1MD7A 5C5NA 1LPGB 2QPAA 5B58C 2ZRAA 2QP3A 5A09A 1JR6A 2CE2X 1O3JA 3QGNB 3LDAA 2ILNA 3TBKA 3CENA 4IVRA 3T1OA 4RSGA 1W14U 1A61H 4OHXA 4Y0VA 1WQVH 4OM9A 5HM9A 3FMFA 1EPTA 1LHCH 5J4YA 4D4MA 1W4RA 1N0UA 3LXRA 1J8AA 1U6QA 1LVMA 2BOHB 3WMFA 1NO9H 4BTTB 2HYDA 1OV4A 1KI2A 4BZXA 3CRMA 3JZAA 3K70D 1BBRE 3DMDA 3N5CA 3AVWA 1P04A 4BPBA 4GRAA 4F93B 2VLIA 1X8JA 5A8ZA 1THRH 1XPOA 1JAHA 3SQEE 4DCNA 2NPFA 1CT4E 1TPOA 4MRRA 1LVOA 4CW7A 5F2EA 4ABHA 2HJGA 2KI5A 4NIYA 5G40A 4I31A 1ESMA 3A7TA 2PJZA 1A5TA 4KI0A 1XTJA 1N1LA 2C3SA 2W3KA 4Q4HA 2QUZA 2GMTC 4CDGA 2QF3A 1O2TA 3RXIA 3LVRE 4BZQA 2DB3A 2ZP0H 3ZLJA 1BQYA 1S5SA 3VQTA 4NBSA 1Z1JA 2YKGA 1EASA 2ODEA 4G0NA 2IHYA 5HZKA 4LOAA 1T6NA 3PM3A 2W6JD 2BQWB 1U0HC 3U3MA 1N6OA 1U8ZA 2B5TB 1HV8A 4TL7A 3VTKA 4A9AA 4G3XA 4KTUA 2ZE7A 4IKEA 3RXHA 2IJD1 1G6HA 1GP2A 3SU3A 3B8HA 4R7ZA 1QRZA 3TSOA 4E06H 3C16C 5HMAA 5HYOA 4GZLA 5F6MA 2DE8A 4CRFA 3FKQA 5CM9C 1KMHB 2BEKA 2DWOA 3GLFB 1O2LA 1R8SA 2J87A 3BTME 1NRNH 4M1TA 4Q19A 2O8TA 5CE1A 3ASZA 1F2UB 2Z4RA 1TABE 1DEKA 3BEUA 1SPJA 1M6NA 3EPLA 4JLBA 3QIAA 1E0KA 2CCJA 1O2WA 3LPRA 3UR9A 1KDTA 5FBVB 3UNQA 2GDJA 2RCEA 5B64A 2HXSA 4JSTA 4LGMA 3SZNA 1UTJA 3PIRA 2EA3A 4EFNA 4FU8A 4HEJA 1XXFA 4QGFA 5G3YA 4DZZA 1TRYA 1JIRA 4LHWA 4JVMA 2DPXA 4RD4A 5C1YA 2YWFA 1RC8A 3NBFA 2QE7A 2C98A 4WBSA 1MUEB 1SGDE 3UIEA 4LK2A 4YLUA 4JJKA 4HB4A 3UWKA 4Q7LA 1TNJA 221PA 2ZJ2A 3VGCB 1EFRD 4TYDA 1MTNC 1P12E 1YR9A 3HJNA 1AN1E 3A8BA 2FX4A 3PO1C 2R65A 3AF2A 2WWWA 3IITA 3A88A 1C1OA 1DWBH 2JJ1D 2V1XA 5FBWB 2D3WA 3TE6A 4QGHA 1EK0A 4CF7A 5ETXA 1XEFA 2J0QA 3T29A 2OLKA 4BLPA 2ZFTA 4BLRA 5EXMA 2BDGA 4DG4A 1SLUB 2WV4A 5EUQB 2GXQA 2ZJ5A 4QNMA 1KXDA 3ADCA 4RKJB 2O9QA 1K21H 2GKVE 1YE8A 1DXWA 2B21A 5FTJA 1WCV1 3NHAA 7GCHG 1RYHA 1G5TA 2Z9LA 3HYTA 1Y3UA 1W0JA 2IYSA 4C7OA 2VP6A 1JIMA 2NU3E 2ZRBA 1O2HA 1RRGA 3RXFA 4JS0A 3ZZ0A 2BB4A 1ELBA 2IJOB 1VMAA 3A36A 5DP8A 3PEUA 3K1JA 2F3TA 2JJ2D 4UJ3A 4A0HA 2AN9A 2RGNA 3MFYA 4GCHG 3S9CA 4PFSA 1NG9A 3EPKA 2PHBA 5J4SA 1JMOH 1GRNA 3L82B 5GXPA 3BS4A 4P0TA 4BXWA 1QFKH 3KZ1E 1P57B 1C5SA 2ZG0H 3I29A 2ZYTX 5JRZA 4CH2B 3M5NA 1GI9B 3TK5A 1JWTA 3KJIA 1H1BA 4CHAB 3ZVAA 4FINA 3MMPA 4THNH 1GHAG 1O2IA 4AYXA 3ZZ6A 2HRVA 2UWPA 1IJEA 3ZIAA 1OF1A 4NIXA 3K2UA 2QBYA 3B9PA 3TNTA 1KO7A 3PTNA 3KUDA 2HLDA 1BMAA 2CN0H 2ANYA 1HURA 3IPXA 3MH6A 2OINA 4NDZA 2FZLA 3DUXH 3WYFA 3BTTE 2ALPA 4XOIA 1R2QA 1O3GA 2G4TA 4CRAA 5EQRA 4FMDF 4CR9A 4M1KA 1KO1A 4QRHA 1F7ZA 2ZU6A 5JDUB 3X1XA 2YVUA 3D23A 1KI7A 2J7KA 3U2QA 3IO5A 3PEVA 2QAGA 4WF8A 2WINI 1K28D 3KQLA 5DI3A 1O3NA 3PV0A 3GY4A 4MNYA 1EZXC 1I4LD 1V5WA 5JBTA 3WBKA 1Q12A 1C1UH 3U5ZB 1C5PA 1QJ1B 3B82A 1TL7C 1WU1A 3U6KA 4PC7A 1FN8A 4HZIA 3RXKA 4FUGA 2YNAA 2VSXA 1V2TT 1UVSH 4TYQA 1BMFD 1E1QD 2K1QA 3Q85A 3RWMB 4K5ZA 1J15A 1TU4A 1WE2A 5A8YA 4Q2KA 1IM2A 4IEIA 1U0LA 3FFBA 4B3CA 3WP0A 1Z06A 1ZJKA 1VJAU 4QT8C 1ZUIA 4PROA 4IXNA 3CS0A 1NM6A 2VGCB 1TNIA 3M61U 1DAGA 4Q9HA 3KQNA 2JA1A 1EFHA 2QQ0A 2F9NA 2CVHA 4YC7A 1TPPA 4GOXA 3UQOA 1W7XH 3SHCH 3GDSA 3W6NA 3VB7A 2IS4A 2J34A 1GJ8B 3QEOA 3VB5A 4XSHA 5EPYA 4I7YH 3IKJA 3PEYA 5EXPA 1QG2A 2N42A 2WJIA 2ZE5A 2R6CA 2OILA 3E5HA 1F5LA 4KAXA 2GNOA 2H2ZA 5IF9A 2FZZA 2QAAA 3A58B 1FI8A 1RIFA 1AGRA 2BEJA 2BLWA 5DHFA 1CBWC 1P09A 2ZU2A 2AKAB 1MABB 1OOKB 3BSQA 3LOXA 2OBLA 1GJAB 5A8XA 1XMIA 3KQUA 4EPWA 1QL7A 4YOIA 4LHZA 4X6NA 3AEZA 4KJZA 2PEZA 2G1JA 1DS2E 1FY3A 4OS6A 4RKOB 2AFIE 3T12A 1OPXA 4OS2A 4PX9A 1ABIH 2ZCKP 2Y81A 3K0CC 1IQMA 1PQAA 2QN6A 3MU4A 4L9WA 3PCRB 1KI4A 1OB5A 1GHBF 2J0VA 2VNTA 3SJKA 1KKMA 1SVOA 2H5DA 1N6LA 1FZQA 4NGAH 2MSDB 4ISLA 2ZU3A 2OC0A 1RXPA 1S82A 1XMVA 3S1AB 1MZDA 1T9HA 3A7WA 3DKVA 1S0UA 3PV4A 4OHVA 2BY8X 1P2SA 1V2UT 4M1YA 1AWFH 2BM1A 3CB4A 3QF4B 5BXQC 1II8A 1AM4D 3MU8A 4HLDA 4ZKEA 3WYAA 4WH6A 1FLEE 3RXVA 3I73A 2GV7A 4UFEH 3QKRB 3EZ9A 1GKYA 1DDJA 4HAYA 5JECA 2P6UA 3SBKA 3FTQA 3R9IA 3SFZA 2P6RA 1FQ3A 3FHOA 4GNKA 1P06A 1BRAA 5IK2A 1SXJC 2QNRA 1CSOE 6GCHG 1O2YA 1LO6A 3KKMA 3CO5A 2PSYA 1S9DA 3SYKA 3T62A 3V12A 4II7A 1XUIA 1L0ZA 2Q6FA 5B6OA 1CRQA 4BE7B 4X2YA 1HXEH 4TMVA 1HAIH 1AKYA 3VEQB 4ZKOU 1BTXA 1OFTA 4LV6A 1OYTH 4CEJA 2AIPA 1GOTA 1EAXA 3EZ7A 1M8PA 1CBUA 4CVNA 3SJCA 4DKXA 2FFQA 2QENA 4HB2A 2IOTA 3F0TA 3BH7A 2JLSA 1KTSB 3RXPA 1JPNA 1CO7E 5L3QA 2IA5A 2QXHA 3F1SB 3OTJE 5KDOA 1S2MA 3R8CA 2WUCA 4ILEA 4EPXA 4NPHA 3K65B 2J4IA 1X86B 1Y5BT 1GNRA 3Q3YA 8ESTE 1IQPA 2OFXA 4I8HA 2HNTE 1E2IA 1GI6A 3R8FA 1GCTB 3KTAB 1RRCA 4LUCA 2CJWB 5GADl 3U1IB 3JZ1B 1K5DA 2P16A 3SR0A 2FOLA 2QA5A 5EE1A 5IDVA 4PHFA 1TADA 2HJVA 1LHFH 3RXDA 4AOQA 3OEHA 4TYWA 4YESB 1SI5H 1NLYA 3A1TA 1P2IA 5SGAE 1NU9A 3TGKE 4XE4A 4X6OA 1BRCE 2GZHA 5HKKD 2OP9A 1WBDA 4Y76A 1C1PA 2A4QA 4MRNA 1GPZA 3J81k 1FXYA 2FJUA 4GMDA 1HE1C 1OIVA 4QKQA 121PA 2W5EA 2IK8A 5FHTA 2A3RA 1P01A 2G5NA 1CULC 2ZRFA 3Q3KA 3LQQA 1L1JA 2JH6D 1AA9A 1LF0A 1K5GA 3GQBA 3MJHA 2F83A 3DPUA 4WMEA 1TQ0B 1YGCH 2ZIAA 2XJ9A 1ANEA 1GWNA 1DOJA 8GCHF 3GEEA 3RANA 5JEDA 4DB2A 1OE0A 3ZV8A 3CX6A 1IY1A 5J47A 1ACBE 2V6IA 1ZR0A 1XZQA 3CF0A 3IIJA 2ZRNA 4J0QA 5E7MA 4DBLC 1XEXA 2W00A 4QHTA 1IONA 2PL3A 1DY9A 3GFTA 4B6FA 3BTGE 3SV9A 3BAFA 1SKYE 2BXTH 2RGBA 1OXGA 4FMDB 3A7VA 3RMLH 1LPKB 3A87A 5KNBA 2F3CE 1E2FA 1OB2A 1FP6A 4WW0A 1OXTA 5B30A 2XC5A 2HCJB 4UKDA 1YVDA 1A2KC 1BOQA 2ZTSA 2FP7B 2DHRA 3TNSA 3EWAA 3K0FB 3SI7A 3LRPA 1AGPA 4N0DA 1NN6A 1DM4B 3PWBA 4RN6A 2WPLS 4FUHA 1N0VC 4ZKDA 1TWXB 4HTCH 3ZJYA 2ZSDA 4WXVA 3AKEA 2IYLD 2ZWLH 4M9ZA 1OWKA 1Z8IB 3A6PC 3NKKA 3E90B 5M04A 3A1UA 1SGTA 5C3NA 4EJSB 3W34A 1ELDE 4NKRA 1WQ1R 5JWOA 2CCGA 1CBWB 1C1VH 1GCDA 4GLYA 1ZU4A 3BFKA 4AURA 1Z8JB 4B1TA 3S7KB 3M35A 4D0NA 1ZW6A 4FMCB 4KBGA 1C1WH 3RC8A 1AMHA 2WPKS 2OE2A 721PA 1DITH 3TPIZ 2ZAMA 3AW0A 4UXJA 2G81E 3U8TH 3UATA 1LS1A 1DVAH 3TIUA 2BV3A 2AKYA 1MOZA 2O8DA 3KQHA 4OS4A 4M9XA 2ZPSA 1FJSA 3VAAA 5DP7A 5G41A 1IQIA 5EQSA 3OTPA 3QE0A 2GD4B 2ZANA 1QGFA 3TU7H 2HLDD 1UK3A 3E91A 1BMLA 1EX7A 2WV5A 2R2MB 2UWLA 4GPTA 4CRCA 4L8GA 4JLJA 3LQRA 3V7TA 2XSZA 3ZYDA 3X1YA 4EPYA 4TLDA 4JT2A 3KKOA 2RA3A 1KSGA 2ZI3A 4E5UA 1KJWA 4NZQA 2N46A 1IXRC 5SZHB 4P33A 1HGTH 4P32A 1E35B 4XVQA 4TMTA 1G9XA 1VCWA 4M22A 3EG5A 4FWIB 3LT3A 1LKBA 2YNMA 4HYYA 2YHSA 4UD9H 2IF2A 4C2TA 2NU0E 1G3EA 3SJAA 4N3NA 1G8PA 3PTBA 4WMFA 3BIVH 4HB3A 2OQUA 5F8XA 2ZU5A 5G4BA 1EAWA 3KB1A 5H70A 1XPUA 4JCNA 1GI2A 3EIEA 3UMSA 2IXGA 5L6NH 2W58A 2ZHQH 2VQSA 4FUBA 3BFVA 1GI8B 4INKA 3NCLA 1YRBA 2B7BA 5K8LA 1DUAA 1KI9A 2IYWA 3B6EA 1TEVA 2Z0MA 4JZIA 1Q21A 3SBEA 3MTYA 3RXBA 2Y7XA 2FE4A 3KF2A 2HXYA 4B2CA 5FR1A 2ESTE 1F5NA 1B7XB 4JLPA 4ZDKA 4WXRA 4BRUA 1BTUA 1RJXB 2BD8A 3KUCA 4MGZR 2C9OA 1ZINA 3BTQE 2D06A 1PPZA 2CMKA 2D62A 3AUXA 5FBRB 1CHGA 4ARZB 1GG6B 1PPFE 5KUTA 4TYYA 2FESH 4NYIR 4MUBA 2WIBA 2VP0A 1F3OA 1T3LA 5AUNB 2BKEA 1Q44A 3H09A 3LX8A 1CT0E 3WNDA 3EGKH 1MMJN 2V3CC 3ZGXA 2IYZA 3RXMA 1DBSA 2YWHA 2CHAB 1I4TD 5F03A 2WOOA 2BOKA 2IYYA 2LNCA 2BBWA 2NO6A 3DEFA 4BLQA 3RM0H 2YZ2A 3MYWA 5SZKB 1LHEH 2BVXH 3QG5A 3EWSA 2QI9C 2ZI2H 4DSOA 5JCZA 2YNBA 1NRRH 2HT1A 4YDSA 3C4JA 1OW3B 1ZJ6A 1HFDA 5TMPA 3RXRA 1EATA 3TUIC 3VKWA 1CGHA 3AM1A 3VR6A 1IBRA 2Y6TA 3OZXA 1AQ7A 2QPOA 4PHTA 1TF5A 2BD9A 3STJA 4GHTA 2C9CA 5DI9A 2J5XA 4MYHA 2QN5T 2ZFFH 4A36A 4A6LA 4MLFB 1TU3A 3PO1B 1UKVY 3CWQA 4DJTA 2CHQA 4Q5IA 1UCYE 1TGBA 1W10U 5E0JA 2ZJYA 4Q1CA 4TLCA 1G5PA 2OG2A 4JZFH 3NBYC 4WY3A 1E9SA 3ZZ7A 5A0FA 2H16A 1GVZA 4TLBA 1KZGB 4I1VA 3VX3A 1Z0KA 5PTPA 1T4UH 3W95A 1O3BA 1SQOA 1K1PA 1QQ4A 1GILA 3FVQA 2P5TB 4CIDA 2VHCA 2DFKB 1O2ZA 1JR3D 2W0SA 4D9RA 1GJDB 1C4Y2 1DSUA 1LHDH 2IUSA 5FH9A 2HT6A 2XBYA 1M74A 4OK3A 1E1RA 2WVJA 3GJ0A 4GVUA 4RD0A 3QEJA 1UFQA 1E0SA 4Q4JA 1IQJA 4IDOA 1JB1A 4MKHA 1GHBG 4B44A 4CEIB 4LBYA 2HF8A 3GCNA 4HATA 3FZDA 3ZVRA 2XSZD 1O3EA 1YPLH 1ZD1A 3HYRA 2LPRA 1O3DA 4RZ2A 1IOEA 1E79D 2Z9GA 3A84A 7ESTE 4LC0A 1SLXB 4URZR 1AJEA 3T26A 4HGCA 1Y3AA 1KK2A 5CM8B 2CNWA 1XX6A 1F2SE 2XBWA 4B2AA 4NL4H 2FDCA 1V2KT 3SBDA 1XEWY 2PCJA 3E8LA 1EP5A 2YWGA 3ZQ6A 2UZIR 1I2DA 2QA9E 1XD2B 1TGSZ 2PKSB 2ZSBA 2JATA 2P3SA 4LJ9A 1ODFA 3PB1E 3B7GA 4NYMQ 3BJIC 3UUZA 3I92A 4LBWA 4M7GA 1VECA 2IS1A 3ATLA 4PZZA 1Q57A 3MNSA 1CR1A 1MQ6A 3M7QA 4Q03A 3HATH 2IX3A 2GILA 2WKRA 1GKIA 1E96A 5LB4A 1SR5C 3IPYA 5TXGA 1SZPA 2OD3B 4YT6H 2CGAA 4ABEA 4AKGA 2BD2A 2FOEA 3PFIA 2O8CB 3NBZC 4G5GA 1MTNB 3THWA 3W8NA 4JZDH 4ACBA 2ZGXH 5AUQA 3X1DA 1RKBA 2VWLA 1EESA 2JLWA 1C2EA 4QBFA 1NLFA 1KXCA 1SGFA 4YMUA 1GAJA 4OBEA 1Z47A 2BJVA 1UBFA 1V2ST 1FAXA 2Q1JA 2BMEA 1O2JA 2GJSA 2FV8A 1VYVA 3VNVA 1ZLRA 1K1IA 3HK6B 2WWGA 5AFYH 2PW8H 2H9HA 2ODWA 4ISNA 4JYUH 1R0ZA 1IQLA 1BS1A 5GJVC 3CR7A 1XDBA 1GDDA 4JL5A 3H84A 1HEIA 3ZZ5A 1O2QA 3K0CA 3QGJA 1NZQH 2SHKA 5F8TA 2V0BA 1HCGA 3LKWA 4BFXA 2Y80A 1KJZA 4HAXA 2C8XB 1E9AA 1W36C 2BVSH 4DDTA 2XX3A 4EUNA 3RXOA 2GT8A 2P8OB 4XIGS 3I5YA 1O3OA 1LFDB 2VWNA 3ZZAA 5AUOB 4C30A 1MRSA 3OF5A 1C9TA 2GAOA 2VH5R 1DXPA 5EE0A 1JJVA 4AG2A 5E7IA 1K8RA 2PT5A 2RCNA 1YBWA 1U81A 1R7RA 1XD9A 3TH5A 3QBTA 4JLAA 1WQSA 1CR2A 1FMJA 2ZSEA 4BOHA 2C9YA 3VHLB 4IFEA 2QMUA 2EFDB 5CYOA 4ZPXA 2XTTB 2V7QA 3K70C 4NFFA 2ZGJA 2HGTH 4JJZA 2RGGA 4B43A 2BD7A 4E7RG 1N8OC 4LRWA 4IS5A 1O3MA 2ZGHA 5EQQA 3U44A 2FPZA 1SXJA 4MTBA 1O3PB 2RGXA 4F38A 1D4PB 5GNDA 4BLTA 2ZU4A 1N6RA 1SLWB 3EIQA 5D3MB 1QL8A 3CH5A 3IO3A 4X8TH 4A1VA 3BTEE 3C41J 5FTKA 4AYTA 4BLSA 2UWOA 2A4GA 1P2TA 1IQEA 3CPHA 4N0EA 1W4BA 1JXOA 3W3ZB 3RXSA 1NRSH 1CS4C 2A78A 1ZHRA 4E22A 2EI6A 1E9DA 1HPGA 1DUEA 3QUMP 1SQ5A 2GCPA 5CIQA 2NQ2C 2XXLA 2OLGA 5EP2A 3Q77A 1PPBH 5A0CA 2F6RA 3M3VA 4HI3A 3KTAA 2SGAA 4YXWD 4EPTA 2ZRPA 3QPUA 2H5EA 4NE2A 5IT5A 3SNBA 4EJSA 1HYQA 2REOA 1ETSH 1OXXK 1K6MA 1ZM3A 3T1QA 2GXAA 2XWBI 3CRW1 1MKWK 1FPMA 5L3QB 4Q1BA 2Q0HA 4AFQA 3U61B 3MU0A 3WY9A 2OZEA 1T91A 1GVNB 2IXFA 1PZNA 2WPDA 2Z6BD 3VR3A 1AD8H 4MPXA 3QENA 1NI3A 1DG1G 2FPLA 2NU1E 5KYKA 1ZNWA 2C78A 4K1SA 3DFJA 3A81A 1NN3A 1T8MA 5HZHA 4I81A 3CPEA 2W26A 3CPJB 2O0KA 4X8UH 2WJYA 2H18A 2IEYA 1GG6C 3T1VA 4JYCA 4NSYA 1S1CA 2AR7A 1FUKA 2FO9A 1G3RA 1Q1BA 1ANCA 2WIAA 3TGIE 2O0JA 3BC1A 3EXAA 2ZQ2A 1GL9B 4K81B 1G17A 1ZUNB 1Z29A 1O34A 1R0XA 2DBYA 1IHSH 1XCPA 2O8FB 1KI8A 5I46H 5DI3B 4JVLA 2V3HH 1G5RA 1H9IE 2XOKA 3VMFA 2ZGBH 1NTPA 4C0BA 5TDHA 5JI3E 1GG2A 3M7TA 3Q7PA 5G3ZA 4AKHA 4JBWA 2B8WA 2J0UA 1JECA 1DX5M 2GCOA 1VG0B 1O0DH 3IGFA 2J59A 4WVPE 4JYTA 1OT3A 2A4OA 1SGYE 4MRVA 3GEHA 4M4SA 1VIYA 2SNWA 2EYQA 1GM5A 2Z7FE 1P6XA 4Q4AB 2HPPH 1QBNA 2CMYA 1C5LH 4NWKA 2BWJA 1CGIE 4DLSA 4TMXA 1ZM4A 3K70B 4LJ6A 2MMGA 2F4LA 5JBQA 2QXJA 1ELOA 2OEPA 1Q3TA 2QZ4A 2ZJZA 3GY8A 4KFUA 2OT3B 2FTLE 3TLXA 2REXB 2GCOB 2VJ1A 2H1UA 2RAPA 1FIZA 4ABJA 2EQBA 4FXPA 2STBE 4LPSA 1BHXF 3SV6A 1GJ5H 1F48A 4IGDA 3SU6A 3U7FB 3P6ZB 1YZQA 2O8FA 4AG1A 2G88A 4MVNA 1ZM9A 4DSNA 3ADBA 3PMHB 1MKYA 1ESAA 4FUCA 4X1NU 1VDZA 4MKGA 4DHEA 1NNEA 2JLVA 1JI0A 4MH0R 2D2FA 2ATXA 2X2FA 4L5BA 3CW2A 2JIZA 1Z6TA 2G00A 4X1QU 2BD5A 3CRQA 2QU8A 1F6BA 1QHXA 4Q01A 2WJVA 2FXRA 1X1RA 4M9QA 4HUQA 3A82A 2PUXB 1DOAA 3W94A 4EQ6B 3RDZA 4BZPA 3B1XA 3NEJA 3UREA 1LNZA 4URUR 2QE7D 3U98H 3T61A 2EFEB 2FGJA 4LZ1H 2SGQE 3X1ZA 1HIAB 2C99A 2D8WA 1WSSH 3LDXH 1MO4A 1TOCB 3B60A 3PV2A 3AUYA 1L2EA 1E37B 3T2NA 2KBFA 4IVPA 3L0SA 4KV9A 1BA8B 3I1FA 2H92A 2P3UB 1F92A 5JWRA 2VO1A 3WP1B 2AXPA 3KQEA 3I32A 3VR2A 3TK9A 1AY6H 1LQDB 2HPQH 2A7QA 5CLLA 1T4GA 4LJ5A 1E0AA 2Q6TA 4GPGA 4HLCA 4JL6A 4P3YA 3AVVA 5L2YH 1UKYA 4R0IA 2L0XA 4ABAA 5KTYA 5JBBS 1AI8H 1IHUA 1Z8FA 3VNUA 2AWNA 5DP3A 3UKDA 1E99A 1IY0A 1L1GA 5FL7A 1PQ8A 2R44A 3JZ2B 3P32A 4B3FX 2A4RA 5EXSA 3GISB 4I8LA 1GI5A 1KHTA 4DLUA 2UKDA 3OIYA 1TGNA 1G2LA 2OBQA 2CHGA 1EFUA 2WPDD 3LVQE 4INHA 4LHVA 1D8TA 4EQ6A 4JMPA 2F91A 1O5CB 1PFXC 1Z8GA 2W3IA 4Y0AA 1AO5A 2ODNA 3UPEA 1VCNA 5FBIA 1W7AA 3HR8A 1NY6A 1UVPA 4C0QC 2STAE 2ZECA 2JLXA 3AVYA 4GUXA 2IHBA 1DFPA 1RIWB 3BBPA 1BDAA 1TOMH 5GPIB 4EPVA 2D7DA 3SHWA 3S1AA 2ZI9A 1AKSB 2FLBH 3DO6A 4B47A 3OX7U 4DLRA 2VF8A 3ETLA 4D0GA 3QDZB 4PHHA 1YPEH 4V03A 3NH9A 3QXJA 2ZPTX 3OY5U 4Q18A 1Y63A 1BT7A 4A8JA 3ZVFA 2OQ5A 4UFGH 1VCOA 2Z5FA 2RDLA 2R9PA 3OESA 4ERNA 1Z0DA 1HY3A 1JR3A 4X8OA 1ZRBA 1OH8A 3ZDQA 1SOTA 1P75A 4RD6A 1CT2E 3V4FA 4DIIH 2HVXA 3MWYW 2FA9A 1KDQA 5J5CA 2KJQA 1JALA 4WH8A 4KCGA 3GY2A 2WV9A 2KAIB 1XBTA 4PXAA 2ZJAA 2HCBA 1BMNH 1AFEH 4UE7H 1DE0A 3SZEA 4OS1A 3TGJE 3I62A 1TB6H 1O2XA 5A2MH 2P2LA 3I72A 3I61A 1O5BB 1GMCG 4PPQA 3BTDE 1PUJA 3ZVGA 5DN6A 3QKUA 2OM2A 4Q80A 2FOBA 5JPMH 2WWYA 1TX4B 2FX6A 1SHHB 4Y7BA 2HNTF 4BAKB 4KYIB 3PUWA 1GL6A 3CF2A 3AVTA 2CL0X 1UJ1A 1VCMA 3TQFA 1ZGIA 2VEDA 4D0LB 2JEOA 2P59A 1XVOA 1T3SA 2JJ8A 2IPHA 2QMHA 3P92A 3KFXA 1TNGA 4BEJA 1SVKA 1Z22A 1HXFH 4MNXA 4CT4B 1FAKH 1O33A 1U94A 2PCLA 2R6DA 3GJ8A 3P8GA 4C4PA 2BMJA 3DZDA 1X6VA 3FVFB 2BQ7B 1HAZB 3A4LA 4KYUA 1CTQA 5CK5A 3O8BA 3UIRA 3QNUA 4Z8YA 2DE9A 2NGRA 2GXSA 1TPAE 1A1VA 4BAMB 2IT1A 3AF3A 1O2RA 5DHAA 3KL6A 1MT0A 1HT2E 4QXAA 1XVMA 1LVGA 1OKXA 2F9PA 3A7XA 1C5VA 5I25A 4UFFH 2AMDA 1C4U2 1GBBA 4U00A 2ZEJA 2IC5A 4Y8XA 3W3AA 3A1SA 4NYMR 2ZA5A 1TAGA 4BAHB 1ZD9A 4I8JA 1A2CH 5IHPA 4A2PA 1OWDA 8LPRA 3EARA 2ZRIA 2UVQA 1JQJC 5DYIA 1SFQB 1XUFA 2BY9X 1HB0B 3N70A 2AERH 4H4FA 1CE5A 1II8B 3TVJB 3L8ZA 3H4MA 4X8SH 4MPUA 1XTRA 4QJ3A 1KMHA 3U7GA 4WMDA 1D6WA 1TNHA 3BXZA 1FW6A 2ANCA 2YOFA 3SU1A 1BJUA 4DSUA 3N2EA 2AWOA 3IG6B 1P2NA 4PAOA 1ZHMA 2GDDA 5KOYA 5FTNA 1YZKA 2LCFA 1KXEA 4MITA 4AY2A 1C5MD 3BOSA 4CBOA 3UNRA 3HGPA 2JDIA 1TQ6A 1XFAA 3RS4A 3U7HB 3LGYA 1KY9A 2QG6A 4BFUA 4V0KA 3F9FA 4W5HA 1XZPA 1ZCAA 2F7SA 3OIUA 4ZDJA 1H65A 2DFTA 2I1VB 1P3JA 3OE7A 4PR0A 2ZFRH 4JBXA 1O5EH 3AP3A 2ZS9A 1PLKA 3SNAA 3RU4D 1UTQA 1HAGE 2FN4A 2CBZA 2NMVA 2B8OH 4Q9JA 3ONWA 2BM0A 2BDHA 2J46A 3HP1A 2PKSC 1Z08A 3TJNA 2XNSA 1O2NA 4ZROA 3HPRA 4ZHMU 2OCVB 2AMQA 2RGNC 3M6AA 5FTLA 1FUUA 2XEXA 3THYA 2W6JA 1FTSA 1P2UA 4C0HA 5C1XA 1BTYA 4O3MA 2VVUA 4FU7A 3BTFE 5CJPA 1SULA 3MOCA 1Y3VA 1IXSB 4OHWA 1W5SA 4IC6A 4AX9H 4BQSA 3NC1C 1SQTA 2CV3A 4Q02A 2FI3E 4HLUC 1RE0A 1OYQA 4S35A 3ZS9A 1GRQA 1H8ED 3NBXX 2KE5A 4NCHA 1YPKH 4I8KA 4QC2A 1KYIA 5DKMA 3N7OA 4PPNA 3NIBA 1PJRA 1GNQA 5DP6A 4C0SA 3K9LA 1PQ7A 3D31A 2ULLA 4CRGA 3LGIA 5JFGA 4TT3A 2P3FH 7GCHF 3D65E 2EW1A 1IHTH 4R9UC 2D26C 5KSPA 3FB4A 4JK6A 1TE0A 3GFOA 3ODFA 5HM2A 2ZRMA 3ICQB 2SGFE 2FFHA 2FOCA 3A86A 1M1YE 4TL6A 3RU4T 1PPEE 5UKDA 3W8RA 1BRBE 1C2JA 1A2BA 1FMGA 3LH1A 3CH4B 4CH8B 3AGPA 3UG6A 1W36B 2PGQB 2FS9A 3CNLA 2BYAX 3GCTG 4Q4LA 4U2WA 1HLTH 3RSOA 3CLVA 1S0QA 1EWRA 2K5UA 3PUVA 1X7AC 4NA7A 3SJ8A 6LPRA 1QTFA 2BX3A 1M7GA 1C5YB 2GBLC 4P4SB 1W0JD 4GSYA 3QF7A 4K46A 1D3PB 5BQ5A 1NVWQ 1EX3A 2Q3MA 4RD1A 4Y79A 1QBVH 1SVLA 3AGQA 1KO4A 4JKYA 2XW9A 5AJWA 3VR5A 4NCJA 3R3GB 4FVBA 5KDLA 1QHRB 3SDZA 3RXQA 2OBOA 2O8EA 3MI4A 3S0NA 1FOEB 2BLOA 1B5GH 2DYKA 4TYNA 4HAZA 3VB3A 1BBRH 4LBVA 3Q3XA 2ZO3H 1NKTA 1O3AA 3Q9LA 1BUIA 5EXXA 1YF4A 4PO1A 1THPB 3MH4A 4BTIB 1BIFA 3RRYA 1TX8A 4NG9H 5EJEA 1UMAH 1T8OA 2BJWA 4JT4A 5FOTA 4ZMAH 4XD7D 3S69A 3K09C 4H6SB 3ZVNA 3MSXA 3GLGE 2KAIA 3BG8A 2J94A 4TPIZ 1KDQB 1R5BA 5FX5A 1H9HE 2ASEA 4B35A 3PWCA 1MBQA 2OTVA 4RCZA 1A0HB 3QZQA 5L2ZH 1QG4A 1B0UA 2PX3A 4ZXYH 1GMDF 4FUEA 5DPAA 2HF9A 1YLDA 2THFB 4Z54A 5J40A 2Y5GA 2R6FA 1SGIB 4WZ6A 5SZJA 3BD9A 1ZRHA 4K1EA 1XMNB 4A8JB 3P8NA 1OH6A 4OQFA 2BCJQ 3CKLA 2DWPA 3MUFA 1KMQA 1ZMNA 1OPHB 1GJBB 3HPTB 3ATWA 4TWWA 4BEBA 3MNBA 1OP8A 2SFAA 4F4CA 4L15A 1A5HA 3DD2H 1MAYA 1DAKA 2ZCHP 5GWZA 2OXCA 3ADDA 4URVR 2RA0A 3SNHA 1W4AA 1KNXA 5IDKA 1R0WA 3HGNA 4YO9A 1H8DH 1ESNA 3EZ6A 2ONKA 3PYHA 1VG8A 1NPMA 1F5RA 2PMDA 4I1SA 2B7CA 3HWSA 4KFSA 521PA 4AKEA 3FE2A 3NHBA 1D2NA 8GCHG 1R10A 3SNEA 1XXHA 5HTKA 4BWYA 2FFBA 2CDNA 3P20A 1HV7A 4ZO4A 5TVKA 4PAQA 4TWZA 2G52A 3AAVA 3T28A 5A4JA 1YZUA 4HFPB 3H0KA 1ZVQA 2YYZA 1ZMXA 2NG1A 3WMEA 2LWIA 2PZFA 2QP9X 2BX4A 3GY3A 3I77A 1DO0A 1O5FH 3C14C 4JZEH 3WRYC 4CT5A 1J17T 2TGAA 2QAGC 1C1YA 1HQYE 1H4WA 4A15A 2P6NA 2H6MA 2WYGA 2BD3A 2O5VA 1V3XA 5FFMA 2ZR9A 4OQNA 4ZHLU 1II9A 3RRNA 3D3QA 1AUJA 2ZRDA 3OFNA 4ASUA 3THOA 4NH0A 1WV7H 5JB9S 4CEJB 2WUBA 2PZEA 2FEQH 3T15A 1P9SA 3GLGA 1RJ9A 1G291 1N2CE 3BIUH 1IQFA 4ZI3A 1UK2A 1FFHA 2XGJA 1WF3A 4TQUS 4CEIA 4ASHA 3AF1A 4M0LA 3AVQA 4B32A 3U1JB 4Z1MA 1KO8A 1G3MA 2H5CA 2R9VA 4FVDA 4P31A 1XU4A 1O30A 1K1JA 3RC4A 3L0IB 1ZAKA 2R6AA 2VVVA 2VYFA 3EQ0H 3U3OA 5BN3A 1UTPA 2MSCB 1QVAA 1HRTH 1C1RA 3TJOA 1CXZA 4KGAA 1DE7H 2XBVA 4MDFA 2V35A 2X2EA 2GF0A 4PQFA 5CMXH 3RMNH 3C5HA 1W1WA 1BO6A 4D4JA 2BKUA 1YPHC 2D2DA 1O31A 1QY6A 4LOYH 3QWCH 1KAGA 3O8CA 1XWIA 1OYYA 3M36A 2EEKA 5E8EH 1SHZA 3IHWA 1GBTA 3RDPA 3NTUA 2AFHE 2FDAA 4PC2A 1E69A 1YU9A 3W6OA 3GLHB 5C5OA 3IEUA 1KLJH 2ONJA 3G82C 4MGIR 1P73A 1XUKA 1C2KA 3QY0A 2GA8A 1HE8B 5FPYA 5TCCA 1G8HA 3E2IA 1G20E 2GBLA 4DCTA 1DPFA 2R2WU 2WPJS 2F9LA 1ESBA 2NZJA 1ZOMA 4N1AA 1HBTH 2RHDA 4AI6A 2J1LA 1AQYA 3UQVA 2IN2A 1E34B 1CHOF 4ACAA 4ZXXH 1G41A 2QT1A 1N5JA 2BBSA 3VX4A 5CDFE 4UNSA 1TBQH 5AWFC 4AN7A 3H5CB 1NRJB 3M0EA 2Y8EA 1U8AA 3A7YA 1CJTC 4IVQA 4KODA 3U60B 1L7VC 1XXDA 2G6BA 3SQXA 2PR3A 2OUAA 3MO6A 4F4JA 3AF4A 4MQAA 2MMCA 2XZOA 3PMAB 4BFYA 4XTRA 1MH1A 1KYNA 1NN0A 3O8RA 1GBLA 1G1MA 3BH0A 2JH0D 3AP1A 2GHIA 4LC1A 3RS7A 2BHGA 3AQ4A 4PSKA 1HAXB 4A0GA 2PLXA 1DAIA 1OIWA 4KBFA 4Q1DA 5BRRE 1PLLA 4X8VH 2QMEA 1FP7A 1GHXH 1XMSA 3L8YA 2W0MA 2RGAA 3LLUA 4C2UA 1V2PT 2FSGA 1HJAC 2WMOB 5HE8A 1TF2A 1TQ4A 1EOJA 1TFXA 4RJLA 3MRSA 3M3SA 1GSIA 5DG6A 1S3SA 1EWQA 1TYNA 2H57A 4XDEA 1C1SA 3ZS8A 3UR6A 3GJ4A 3DHWC 4X8MA 5JBCS 1JBUH 1U8YA 5LPNA 4JKIA 5KSOA 1BRUP 1G4UR 3U3RA 2EVWX 2NO1A 3KXLA 3GDUA 1AHTH 2QL6A 3BN9A 3O8DA 1O2MA 2HDNB 1A7SA 5ESBA 1KNQA 1XJCA 3RRZA 4CR5A 1W7GH 5JWHA 2IL1A 4DLTA 2NZ8A 5LPEA 1TRNA 2Z3DA 1NROH 5C20A 1VPLA 1P03A 4LJYA 2ODYB 2ZJ8A 1VYTA 4DEXA 3MCAA 4TYPA 1UEIA 3F6UH 3ZZCA 2F3RA 1RTFB 4I4LA 2YV5A 2QSYA 1N6PA 3NK8A 1J14A 2G3YA 1EJMA 4ZCIA 2OC1A 3IHLA 1KDPA 3VB4A 1SXJB 5EE9A 2FYRA 3U44B 1MTSA 4NCNA 4DCUA 1ELGA 2ZJOA 1KK1A 4ABBA 1GJ4H 2QAGB 2B92A 4BFVA 1XJ0A 2WPMS 4YLQH 5AJZA 1VIAA 2BQ6B 1W11U 2FTMA 2OCBA 4Y0YE 2ECKA 2JJ2A 3EZFA 4ESVA 1KXAA 1NU7B 3PLPA 3GJ6A 2GZ8A 4LDJA 621PA 6CHAB 4V0ME 1SL3A 3L6PA 2VPPA 4D81A 1C2GA 1ELFA 5T1VA 2QGNA 3P4YA 1MO6A 1VG9B 5EQTA 4OI2A 1HAYB 1ID5H 3THXA 4CYMA 3SYJA 5DGXA 1BBRK 4UXHA 4JZ1A 2A2XH 5JS7A 4MYTA 1W2HA 2A5GA 3EZ2A 3ZVCA 1Z83A 1IN8A 2OO7A 4H9GA 3U4QA 2A9KA 2G55A 4KP0A 2FH5B 3ATMA 2VP5A 4Q47A 4EJSC 3UOPA 1KDOA 1OWHA 1FY4A 2A5AA 3LONA 5ABWA 3A1WA 1TALA 5ELXA 1WRBA 5DO4H 4BUJA 4A1FA 3BGWA 1OWJA 1DPOA 2WZQA 1T5IA 4BECA 3ZH9B 4DURA 4KSCA 4DRZA 5E0GA 1L2TA 1ELEE 1O37A 4LK4A 1D9ZA 1SHYA 1PPCE 1Z8RA 1XKBC 1LVYA 3L43A 2ZETA 4SGBE 4DLZA 4KSBA 5KPDA 2F1RA 1KAOA 3A7ZA 1G3QA 4PO9A 4ESTE 2O8UA 5DP5A 1CJMA 3P95A 2KSQA 1S0RA 2P3TB 4KVGA 3KCGH 1L1NA 1GMHG 3C5CA 3RXGA 1EZUC 3SQHE 4GMXA 5TV2A 1J16A 2ZHDA 4K8YA 1VZQH 2WOJA 1FNNA 4FD2A 3I78A 1RYFA 2QRZA 4I1UA 3I5XA 1YPHE 1OXUA 3L3TA 4MRSA 5L8VA 3ELAH 2GDEH 821PA 1DADA 1RD3B 4LYFA 1SVMA 1W0KA 3I3SR 2C8ZB 1EAUA 2FYQA 5TCAA 1BHXB 3DA9B 4TY7A 2ZGCA 5FOVA 1C4V2 2PT7A 2VSOA 1U90A 2GZAA 1LB1B 1MV5A 1LF5A 2BMGB 2WTUA 1C1QA 1BIOA 4DCSA 4HDQB 5SZIA 3BB1A 4K60A 3IDQA 2A32A 1M9UA 1VGCB 3AB3A 3KN2A 1GUAA 7LPRA 1GITA 3TVDA 3BRWD 2NTYC 1DANH 1MR3F 4A6PA 5F8ZA 1TNDA 1SVWA 1K22H 4TZ0A 3SGBE 2VHTA 3PG5A 3QPWA 2TPIZ 1OWIA 1XTQA 5D3QA 2ERXA 2ZS7A 4FXGH 5F3WB 3FHTA 1MKXH 1XM1A 1UTLM 3QX5H 1AB9C 3U9AH 4IOLA 4PO8A 1GBCA 4RCYA 1FX0A 1SSXA 3BE4A 2O8BB 4ZCLA 4EIWA 1TIOA 3T5FH 2JCSA 2HYIC 1UTMA 4SGAE 5JYIA 2ANKH 4AZ2B 3GY7A 1NIJA 5ANRB 1D2MA 4XH9B 1KSFX 4GP7A 2BDTA 2OCPA 3Q5DA 2VHQA 4KFTA 3LBIA 2EFGA 1VTKA 1I2MA 2A5YB 4C9BA 2VIQA 2J3EA 2V7QD 3M3TA 2VF7A 1TA2A 4O2RA 4KLZA 2W7SA 4QBHA 5FX6A 3B23B 4ZDWA 1HUQA 2BD4A 2F43A 1V6DA 3SI4H 3VB6A 4NYJR 1UBCA 1G7SA 4Y8ZA 4DCDA 3WMGA 3LXXA 2CJWA 6GCHF 1E2NA 1NP6A 2IF0A 4Q7ZA 4ABYA 1C5OH 3P8FA 1CJKC 1AZTA 1ETUA 4RKEA 2ORVA 2F9MA 1U9IA 5AFZH 2Z6VA 3LC5A 4LJAA 3TMKA 1YLCA 1GMHF 2D7CA 5EP1A 3SI3H 4B3GA 2C90B 4YOGA 1E0JA 2ZE8A 3MH5A 3P70B 1SC8U 4X2XA 2G4UA 3LGWA 1KKLA 1S6HA 1ANDA 1GHVH 1UEJA 5BPEA 1DAFA 4RVCA 1JRSA 3UMFA 1ZCBA 2GVFA 1B23P 2PZGA 4URWR 1WUNH 1X8KA 1MABA 2CXVA 3A8AA 2VHJA 2ZRGA 4X6MA 2BVNA 3URCA 3M5MA 4FW9A 2QGZA 3AKCA 5DH9A 1E2JA 3UANA 3M7UA 4TMWA 4DVAU 2ZPQA 2GX4A 2R2AA 1GHAF 3ZV9A 2QM7A 3AKYA 1B0FA 2PTNA 2EC9H 2ZUCA 5KNDA 3PJRA 1V2QT 4Q7JB 3F8TA 1RTLA 2IYTA 5DYGA 2G0NA 1O3LA 4BNRA 1O2GH 2FLRH 4B3BA 2ZNKH 4PTLA 1F0TA 4I33A 4AC9A 1CJUC 3RLYH 1Z6AA 1ZPBA 1E2PA 5CJ2A 5FAHA 2ZDAH 3RYTC 3ZQJA 4R2HA 2IEZA 4DDWA 2PGBB 1F0RA 1N6YA 1NJGA 3SFVA 3GY5A 1UHBA 3PLBA 2A5FA 1A46H 1S81A 1FIWA 1IY2A 1NSFA 5DJ7A 4UNNA 1O3IA 3IIKA 1QL9A 1G16A 1NSTA 3RC5A 1G18A 4YXWA 5C1BA 1C4OA 8KME2 3PMBB 3E6PH 4AD8A 2EYUA 2PH1A 4U02A 4Z0KA 4F92B 1ZGVA 2FPKA 3RHFA 3E1SA 4HAVA 4JYVH 1SGFG 2YINC 2GZ7A 2WICA 1P11E 5FR2A 4BGDA 2AX4A 2GESA 3HKIB 2VWOA 1K1LA 2FOMB 1VCPA 2VGCC 2XNDA 5D3MA 3NVAA 1T7CA 2WAYA 4B34A 3WHKA 1YR7A 2ZDKA 2OK5A 4AG6A 1EP6A 3QSYA 1A5GH 1ESTA 2RH5A 1G4AE 1XD2A 1JRTA 4YDHB 1W0KD 4BXSA 1CLUA 1VG1A 3P4XA 2GZ9A 4RZ3A 4WIAA 1TPSA 2QY9A 2XOKD 4HZHA 2ZYWX 3TAUA 2ZE6A 1NN1A 1WBGB 1J8YF 2RB4A 1ZU5A 2IUTA 1UKEA 4MYUA 1T8UA 1CKEA 1P2JA 1O2SA 1XMJA 2GZDA 1IQGA 4B76A 5L3VA 3ASYA 4Q4AA 2JAQA 4E7NA 2Q9BA 3A1VA 1SGRE 3SE0A 2QXGA 3WYGA 1LW7A 1Z5ZA 1FPHH 1MTWA 4MYCA 2C96A 1GGDC 2CHVA 1ZIOA 1Q0UA 3ITIA 5AJVB 3ZIAD 3VGCC 3L0PA 5HGGA 4X0WU 1W0ZU 1OIXA 3JVVA 4GZMA 4EDHA 1O5DH 1A3BH 4A6XA 2AIQA 2XZPA 1QB9A 4AYYB 3CIOA 4TSFD 2IS6A 2ZR0A 1NY22 1QBOA 2AD1A 2QTFA 1GI0A 1TGTA 4DY7B 2A0QB 3FP7E 1KI6B 5K8IA 3LH3A 4I32A 4E03A 2BY7X 3TNFA 1OHHA 2RGCA 2F1HA 4RI0A 5KU1A 3EIHA 1G9IE 1TF7A 2GJKA 2VIIA 2QIQA 1KOFA 1G32B 1UVTH 1S9HA 3QN7A 4TZ6A 4M1SA 1VHTA 2FNAA 3ESTA 2ODQA 3RP2A 2VIDA 2ORIA 1ELVA 2HLCA 4MKIA 2IUUA 3GEIA 3R9WA 5J4QA 3MGCA 4JLOA 1ZYOA 2IWHA 1UVOA 1S3GA 1PLJA 3R20A 1O2UA 2D4HA 3F9HA 3LWNA 5AF9H 3MFJA 2YJTD 1ELAA 1GRRA 4A2WA 1DAEA 4VGCB 4A82A 3R7WA 1NBME 2O0HA 5FCRA 4QJ4A 1C5ZB 4E09A 2XJ4A 2AYWA 1JJ7A 4OS7A 4YZUA 1KXBA 1IQKA 2ZDVH 1YCPK 1G30B 1CEEA 1HAHH 2TMKA 1UCYH 1KJYA 2YOHA 3RXLA 3LGTA 1TBRH 3KFVA 2JASA 1HA3A 4ISOA 4O3UA 1ZMLA 1NMYA 2I6QA 3CP7A 1QHHA 2WWIA 3EA0A 2ZFQH 1PYTD 1JAIA 4UNPA 5EG4A 2H9TH 1E9BA 1SVIA 4WXIA 3T5GA 3MAAC 4IJMA 2C8WB 5FUVA 4KITB 4ARZA 3K0EA 2PSXA 3VHXA 4YQFA 3RUOA 5A0AE 3GLIE 2XBXA 1Y59T 1TX7A 1TMTH 3Q8XB 2F1IA 3ICEA 2Z83A 1XUGA 1IAUA 4MA4A 1OKKA 1G2MA 1W47A 4FCVA 4A92A 4LWZA 1WCZA 5C18A 3KEEA 3QXCA 2AS9A 3TK1A 3B1VA 2R0KA 1P3EA 3WXMA 4XD7A 3ECCA 1UCYK 5FOXA 1Z6XA 1T32A 1XF9A 1F0SA 3RSLA 1AIPA 5GVRA 4JL8A 1YZNA 4NHOA 5GIBA 3SZRA 2NO7A 4OYHA 1XCMA 4C7OB 2WBLC 1BB0B 2VVCA 1DWEH 1GBFA 5GJBA 4CBNA 2QMOA 4MNWA 5FUXA 2C77A 3CRRA 1TAWA 1D9IA 4Q1AA 3PMJA 2J92A 1DTSA 3A83A 1E2KA 4PC1A 1CU1A 1G6OA 3OAAA 4PZYA 1KI3A 4PPFA 1S8FA 4I8GA 1BITA 2AMPA 5LPFA 4CRBA 5BN5A 3T34A 1WMSA 1K9OE 4PC3A 1HAVB 2NU2E 3TH2H 3ZYEA 1Y3XA 1G3UA 1YCPM 4TQ9A 3WNBA 3D7MA 1KGDA 1T0JB 2GJ9A 3B78A 1CVWH 3TRFA 3HK3B 4TL9A 1Z6EA 1C5XB 3AKDA 1IN6A 1W0YH 1GBEA 1XXHE 1TX6A 3T35A 3PUYA 4W5JA 1C5QA 3BEFB 1EGAA 1TMBH 4UQOA 3D62A 5AUPB 4MGKR 5EZ6B 5H8WA 4D8NA 2UZ3A 1K1MA 2PV9B 2ZRHA 2ZITA 5F9HA 4X8HA 3TQCA 4BLOA 2C95A 1SG8B 3SN8A 5FTMA 3Q76A 4B74A 4B3DA 1SVPA 2QV1A 1YHNA 2NPIA 4B33A 3EASA 3URDA 5K7RA 1LQEA 1P9NA 5C4MA 1XXHB 2P94A 1GI7B 1HUTH 3LBNA 3F5FA 8OHMA 4UNRA 2FU5C 2FF7A 4AIIA 4AYVB 5JB8S 2G8TA 3MH7A 3P1JA 4P4TA 3CONA 2NOAA 2FFAA 4EFLA 3LC3A 3VFDA 2XAUA 4D2IA 2E9SA 1CJVC 1OJLA 1Z28A 1O2PA 3MMGA 1WP9A 2WJHA 2GTBA 1N25A 1Z6JH 2VL7A 1P05A 1RFNA 3TSZA 4PZLA 4D7FA 5LDDC 4ZDIA 4FUIA 1UBEA 3WBJA 3MU1A 1O35A 4B2LA 4GBMA 2JLZA 3B1WA 3SU4A 3MNXA 3RAPR 2XZLA 2W2XA 1L4ZA 5CITA 1IN4A 4XSKU 4ZKSU 3WY8A 3HDTA 1VR1H 1Z0AA 1ZHPA 3KXKA 4Q4HB 2PJRA 4O3TA 4G01B 1NBMD 5J4HA 2ZAOA 2PTCE 1PVOA 1GBJA 4Y71A 1T0HB 1VGCC 2ZVQX 1XEXB 3M37A 1UTNA 1UDXA 2PMKA 4ZKNU 5FPSA 1GDNA 1PJPA 4Q48A 1NN5A 2BDBA 3SUEA 5E0HA 1LVBA 1DO2A 4BFWA 1CRPA 4DJZB 3GLIA 3GYMA 3OEHD 1MRNA 3R9XA 1UDWA 2B6HA 1EFTA 4F4OC 3RABA 1MQ5A 1C9PA 1YYY1 2H9EH 1NRPH 1RRFA 6Q21A 3T5DA 1Q31A 4YLGA 1MCTA 3CX8A 3GYLB 2I6SA 2CL7X 1J7KA 1H9LB 3U69H 4BASA 7KMEH 4IN2A 2ZJBA 1XRJA 4V0MA 1E2QA 1FY1A 1AS3A 4JLDA 3SU2A 4L4UA 3T27A 4R8TB 5FOSA 3A37A 5KHOC 1W4CA 1RRKA 4B6EA 1N6KA 4QOSA 2ZF0H 3L33A 3RXCA 2SGDE 5DSZA 1LCYA 4D26A 4S2EA 1EJNA 3BERA 4HSEA 3CZPA 3A8CA 2Z9KA 4HAWA 2ZSFA 2AXNA 3BWDD 4IDQA 2O8DB 1A0LA 1FTNA 3OEEA 1OXSC 2FIRH 1NESE 1SGEE 4OQLA 3BG4B 4FCTA 3HKJB 1N3BA 4K8OA 2BDCA 3CNNA 1GTVA 3OAAD 3LU9B 4US1R 5EXLA 1CA8B 5FXLA 1TQ2A 2P5SA 1BMFA 1E1QA 1DAHA 2F55A 2WM9B 1O2KA 2JIZD 4TT3D 5CYPA 4K2YA 2B7DH 4OS5A 5K0HA 3KKPA 1YJ5A 1K1NA 3QVVA 2BMDA 3RLFA 5FUWA 3CWZA 4O97A 2OAP1 4QBGB 4XJXA 1KXFA 5AVDA 4US0R 3K0FA 4Q1EA 3DMNA 3GJ5A 1HIAA 5CB8A 5EZ5A 2GGVB 2ZTZA 4D6PA 4V0LA 2BDIA 1XTSA 4LJ8A 1AGJA 5A5GA 1VITG 3LBHA 2B8TA 3THYB 1YKTA 3E1XB 2VH0A 4D25A 2D2EA 1CIPA 5E4FA 3OYPA 1EB1H 2XCNA 4HUQB 2XXAA 2NO0A 1ZM2A 2FEMA 5CK4A 5T3HA 4AFSA 4PHGA 2XTNA 2PWXA 2F1JA 2KB0A 2WYJA 1NVVR 4AB8A 3CS7A 3EC2A 5DGJA 4AFZA 2C04A 2ZRJA 1P2QA 3U6BA 1O87A 3QZRA 2OV2A 4CRWB 5BW8A 2DY1A 4J1YA 1XB2A 2OUKA 1G21E 4AYWA 2BHRA 4Z6AH 2ZXUA 2FZ4A 4DLXA 3QJYA 2NU4E 3LD9A 2VSFA 3GCTF 5T6GA 1G64A 5C2ZA 5KNCA 3EYDA 1W8BH 1O3KA 3SGQE 1SGQE 2XTMA 1N5LA 1EJAA 1C2FA 1N6IA 3U4QB 3MWJA 3TLOA 3HPQA 4GHQA 3EX7C 1D6RA 2XNDD 3DDCA 3CUEF 1BKDR 3AVPA 4ISHH 3NH6A 5EOKA 4D4LA 1V2MT 2VP9A 3K0AB 2P0EA 4YONB 3QI2A 3QXSA 5FPTA 1NS3A 3TGPA 1CP2A 4U30A 1CF4A 1O39A 5GCHG 1SFIA 3MWLA 1QA7A 1GMDG 3QG1A 2QAJA 1Z6GA 1COWA 5EE5B 2ZREA 1GI4A 3EPJA 2VIPA 1OFHA 1GNPA 2VIWA 4LXBH 3AVXA 4NCKA 2A31A 2OHFA 2QORA 1CA0B 2FI4E 2C93B 2AGIX 1ZNXA 1PYTC 2ZROA 2P65A 1GGDB 2H7VA 1FN6A 1Z71A 4TPYA 3LW7A 2C2HA 4OJQA 1S4QA 2XB4A 2ZSAA 1ETTH 1O2OA 3A4MA 4URYR 4OQMA 1DICA 5GJ4B 5IRCD 1L4UA 4JVSB 3V00A 3SN6A 2V4ZA 1AS0A 2ZI5A 3REGA 1AZSC 3SUFA 1G7CA 2FEOA 1VITF 1EFRA 2ZZUH 3PROA 1C5RA 1S83A 2E87A 2NWNA 1W2KH 1KIMA 4D9QA 2CEAA 3AVOA 1CR4A 1IQHA 3B9QA 4Q1FA 2RHMA 2HNTC 2GK7A 1CR0A 4BFSA 3ZVDA 1K2I1 2XC0A 1ZMJA 1EAIA 4HAUA 1C2LA 1P10A 2VWMA 2ZPRA 4QJ5A 1XUJA 1W36D 1K1OA 1UHBB 1E2LA 3BH6A 3ND9A 1JXMA 4IDPA 3ATIA 2YOGA 5JMTA 5CB6A 1GBDA 5JRJA 4JYBA 1MU6B 1G36A 2M5TA 2HV8A 1MTVA 3MWIU 3SU5A 1FDPA 2RKOA 2IBMA 3HU2A 2V6JA 1EOLA 1YCPH 4XBCA 3QLPH 1QA0A 3V0XA 1YRAA 1YPGH 1E2GA 4U32A 3GCOA 1SKYB 2G5VA 3AVZA 1VHLA 1AZ8A 2EI7A 2VA8A 5C2JB 4QFMA 3KQCA 3CRVA 1GBKA 3TSWA 4B75A 4U01A 1C9KA 4G5RA 3T25A 2GT7A 1V2NT 2A5JA 4ABIA 4O03A 2VBCA 1RW4A 3MLEA 5L3RA 3RMOH 5TY0A 5BWMA 5E7JA 1TLDA 2FI5E 1G3CA 4Q21A 4EAQA 2PKAA 1E4VA 3A8TA 1HNEE 4GOJA 4DVGA 2WWXA 1T4VH 2J9RA 1F60A 4DT7B 1DSTA 4X8LA 1P2MA 4RY2A 1Q3XA 4UJ5A 2I3BA 1F0UA 3HU3A 4DLWA 2JETC 4IBLH 2PFEA 2XCFA 3FDIA 1QBKC 3A4NA 2GEUA 3TW4A 1GIAA 1G8GA 3GICB 2J45A 2IS2A 4MNVA 1P72A 1MTUA 4R71A 1KY3A 2R8RA 1WYKA 3KJEA 3W90A 1XKAC 2NO9A 1OKKD 1V2LT 5FPHA 5BYJA 5L3SB 4A1TA 1P8VC 3FFAA 2WHXA 1D6JA 1EB2A 3FKSA 3TITA 3MWKA 2ZHWH 5CLQA 4FCWA 1ORFA 3FWYA 4HZUA 2A7JA 4K3JA 1X8LA 2AHOA 3W5JA 2QCYA 1GCTC 4ABGA 2Y82A 2W6ID 4XWKA 1MU8B 4D4KA 3UOUA 3FPAA 3K0AA 3W9YA 4NU0A 1H8IH 1W5TA 1AQUA 3T06B 5DK1A 5GVSA 5EODA 4GL2A 5JJIA 2BOVA 2EI8A 2C8YB 3Q7QA 3NWUA 3E0NB 3DM5A 4Y11E 4LCBA 4M1OA 5G53C 2OSBA 3ZD6A 1KTVA 1FNIA 3GD7A 4DLYA 2VH6A 2CLSA 2ASUB 4FU9A 1GHZA 3OE7D 4W9MC 4DUGD 3FFGA 2EFCB 4F4IA 4YM9A 2GCHG 4EKDA 1EZQA 3TR5A 2DFLA 3UFAA 1BTPA 3EPHA 1IQNA 4A0RA 4FUJA 2CNWD 3V13A 3DZ8A 1T31A 2FSFA 1O3FA 2TGPZ 4Y10E 1JOUB 2Z4SA 4NONA 5H1YA 2GTPA 2AH4X 2PX0A 3GJXC 4C0LA 3RLWH 2IXEA 3MG9A 1AVWA 2QF0A 3PUZA 1HAPH 2OXSA 4Y8YA 4C0JA 2J7PD 1QRAA 1C5UA 3LV8A 1GHYH 1HYLA 1KLTA 1LDTT 3S9BA 1P4SA 4PQRA 4TLEA 3GLFE 4MDEA 3PITA 2ODPA 3GY6A 3GPLA 3G01A 3FP8E 3H7OA 3HU1A 3KKQA 1HH4A 3A8DA 1GHWH 1BOFA 3ZVLA 1V2WT 3A80A 1CA0C 3MO3A 4MKFA 3B5JA 2UUKB 5TB5A 4XVUA 4WZBE 1NBMA 2Q3FA 4PANA 4LSGA 1G3DA 3STIA 1TMUH 3U3KA 4OL0A 3S9AA 5E2OA 4JLMA 1QB1A 2VHUA 1UO6A 1G3BA 1E9EA 1SGCA 1ZYUA 4WZAE 4AGJA 4OHYA 1G7TA 4AGKA 3B8JA 3SNDA 5LPRA 4BRWA 4X2VA 1W46A 1THSH 3ZZ3A 3SUDA 3SC3A 3SOPA 3Q3JB 3IEVA 3KJGA 2Q6DA 4YTAA 4WVFA 3WNCA 3B1ZA 2GCTC 3IBGA 4ZV4A 1KK3A 2WPHS 3OIVA 2FS8A 1A5IA 1U0JA 2ALVA 1ELCA 3K6ZA 5BYKA 1F2UA 5AJYA 3GJ3A 5TARA 2X8AA 3SEAA 3THXB 3UWIA 4A2QA 2BDAA 1G19A 1KZ7B 5EU8A 1FNMA 2ZUDA 2ZCLP 3BEIB 4HLQB 4HZUB 2PUQH 2ERYA 4O9VA 4WXPA 4AB9A 3CBQA 1C5NH 1LMWB 4CEHB 1C2HA 1J2JA 1P02A 2ZFPH 3X1WA 4Z8XA 2H8KA 5F9FA 5CIWA 2BCGY 4M21A 1NFUA 1I4DD 2P93A 1GZSA 2V6NA 3QK1A 2EFHB 3ZZTA 4FN5A 4B2PA 1Y3YA 2WAXA 4IHQA 1LS6A 4QL3A 4NIVA 2OCYC 4KKDA 4TTQA 1IN7A 1TTTA 1EX6A 3FAOA 1SOZA 2GEVA 2ORWA 1J70A 1QRXA 1TGCA 1O32A 1P7CA 1QHGA 1G8YA 1A4WH 4RFSA 5FL3A 2Q21A 3U7EB 1QVRA 3GJ7A 1M7BA 2I4IA 3IIMA 4ZH8A 4OI4A 4OGXA 4Y6DA 1EXFA 1YP9A 4A8JC 1R5NA 1S84A 2QQEA 1MKXK 3IQWA 2CHAC 4OK6A 4NYJQ 2R0LA 2A30A 1LY1A 3ZVBA 4FI3C 3E70C 2Q6GA 2O8WA 4VGCC 4O0MA 1KDRA 4DLVA 1UTKA 5EW1H 3SW2B 3UK6A 3PR1A 1J9CH 2CLDX 5HR5A 5KPJA 2FWWA 1ZSLA 2O8EB 1Z2CA 3EA8A 1ZNZA 1EPTB 3BTHE 2ZC9H 1KO5A 2RG3A 3SGAE 4GAWA 1DLEA 3SHAH 4IXMA 4CZ2A 3UTUH 3QOFA 3SJ9A 1GBHA 1XP8A 4Q00A 5IK2D 1V43A 2OLJA 3EDXB 3SYLA 4L16A 3SV7A 1Z07A 4B3XA 1BYUA 1US8B 1OS8A 3SO3A 1GVLA 4DT1A 4HB0A 4ASUD 2FODA 1HTWA 2VINA 3QPVA 4M9FA 2Y5FA 3DFLA 3RC3A 4M1WA 3DOFA 2OFWA 5DISB 2QC2A 4K8BA 1P2OA 1NF3A 1Q22A 3OY6U 2JJ1A 1MBMA 4DIDA 5JSZA 4GCHF 3C7KA 1AN0A 3B9FH 3FOZA 2ZI6A 4CRDA 4C3ZA 2G51A 4NWLA 1RZ3A 1QRWA 1BTWA 2PBRA 3TKLA 3ZZ4A 5GJCA 4ABFA 3NG1A 2SGPE 3RM2H 3MJRA 4DCVA 4F7WA 4UFDH 3VXFH 1SGWA 2FWRA 4TTRA 2CK3A 3WRXC 4NZYA 2HOBA 1DY8A 1SGNE 4QHYA 1SBWA 1FONA 2BLVA 1G3IA 2YOLA 1W48A 4LY6A 1P0SH 1WBBA 3F68H 4Q7YA 3GLFA 3QXXA 1OP2A 5JS8A 2AFQB 5C46F 1TQDA 1W2GA 4NFEA 4OKSA 3P26A 2WSMA 2DFNA 2LKDA 3H7TA 1LTQA 4HDCA 4X1PU 3L0OA 1WXRA 2P95A 4Y7AA 4ZCMA 3LFUA 1JEEA 1DG3A 1HAVA 4XWAA 2G1KA 2IYVA 2FSHA 3NDPA 2W83A 1BJVA 3LIWA 1U9IC 1JBKA 1A1RA 5JZVA 4E07A 4TQAA 4AG5A 2GP9B 1QF9A 1T8NA 1X1SA 1XUHA 1HT1E 1QCPA 3FHCB 3RXUA 4AFUA 1DWCH 2XTZA 1DS6A 1Z0IA 1CHOG 3SV8A 4C0AC 1Z0JA 5FBLB 1WTHD 1G7RA 3LX5A 4XVRA 1TPZA 1PPHE 1UJ2A 1AFQB 9ESTA 5DE3A 1AKEA 3C8UA 4YMWA 2FMJA 2PEYA 3TW8B 3IQXA 2IYRA 4PPGA 1BCUH 2EWVA 2BMFA 2ZRCA 2TIOA 2BY6X 1A3EH 5HE9A 3TH3H 3SORA 4BAQB 3O47A 3LA6A 1WB9A 3IILA 2BZ6H 1KSNA 2GMTB 1KSHA 4C0KA 3MO9A 1JR3E 2G83A 5CHAB 3VU9A 4CHAC 3AAUA 4Q7XA 4L9SA 2QEQA 2JH5D 4CEHA 4FUDA 1TNLA 3BORA 4FUFA 1E9FA 5FCKA 1ZZZA 2FG5A 1H8EA 4IDNA 4O25A 3M5LA 3KIDU 3TJZA 1D3QB 1F2TB 2J2UA 1C5WB 1OH7A 5EE3A 4GOKA 4QNRA 4NMMA 1EG7A 3TUJC 4NCYA 3BB3A 4NA9H 1Q1ZA 5J4LA 1WAYB 4XBDA 4QG7A 5EGMA 1US8A 2Z9JA 3QQ5A 3VKHA 2EU8A 5KO2A 1RPZA 2GXUA 3A85A 1Y8TA 3BV9B 1ZPCA 1N6NA 5GCHF 3SJZA 3E3TA 5B6LA 2Y7ZA 4LHXA 2BXUH 1NVUQ 1AIXH 1YZGA 3AW1A 5JJLA 3RNLA 3UG7A 1LKAA 1OSNA 2Q9CA 1Z1IA 2TBSA 2D1JA 1NFYA 2F9UA 2ATVA 2FOFA 1YC0A 4JLNA 3LNCA 4IW4E 1NC6A 4A1XA 2V55B 3M4YA 1WXQA 2VP2A 2ZYVX 1NFXA 4IMQA 4H6TA 1AK2A 1QNJA 2OC8A 1NJFA 3IUYA 1GMCF 1SVSA 3IBYA 1OX1A 4JLVA 3K9GA 1GDUA 2XRCA 2GVDC 3K9XB 3LJOA 4ZAEA 1NY5A 4RFSB 4RZUA 1EQ9A 1NVXQ 3I8XA 4F91B 1T8TA 3B13B 3MU5A 3X2SA 1GFIA 2TGTA 1TRMA 4V02A 1TUIA 4HLUA 3BF6H 2CL6X 5FL7D 1WTGH 2W6IA 1KI6A 1SXJD 2J41A 5K8TA 2ZQ5A 2CLCX 4OGYA 4LYHA 5JHHB 4Q4JB 3SS8A 4PAMA 2ZS8A 3FMIA 1WA5A 3F9GA 2ODBA 2CK3D 1DWDH 1LV7A 3EW9A 3RC6A 1AB9B 4MQBA 2V54A 1O3CA 2YWEA 2TGDA 1TONA 3K6YA 1OH5A 2XC4A 2AK2A 3CR8A 4G1UC 1WDTA 2F43B 1TQ7B 4H1VA 1EXMA 2O52A 1HQCA 5T6DA 2G9NA 5DP9A 4RZXA 5JI2E 3KGPA 2Z43A 4DEYA 3C27B 1A82A 4DUGA 1C1MA 3LGUA 1BH2A 1FZZA 2W2VA 3FMPB 1ONBA 3BIFA 1A7JA 4A0FA 3PXGA 1QZXA 1TBZH 1EKBB 1FQJA 4WA7A 1U98A 4EPRA 3TJVA 2ZFSA 2EWWA 2OC7A 2W7UA 3IWMA 2V9PA 2IW3A 1RRPA 3RVBA 2UUYA 1UBGA 1AU8A 4DWJA 4GT1A 2RMKA 5LBIA 4KVAA 2ZHFH 5C4GB 4DDVA 4K1TA 3LLMA 4DXAA 4U7DA 1DLKB 5J4KA 4YOJA 1E9RA 2ZDNA 1YM0A 2WWHA 1Y5AT 2W2TA 2IYXA 1MZAA 3KX2A 3BG4C 4MGYR 2ZRLA 4TSFA 4DOQA 5DO9A 3D6TB 1AKSA 3MHWU 1N6HA 3B1YA 2GCHF 1TEXA 1W13U 2VIVA 2V8OA 2ZIQH
chains in the Genus database with same CATH superfamily
3R5XA 5DNWA 2BM8A 4L4RA 1NBOA 3UMBA 4G5QA 4RD3A 3AF6A 2FN3A 4H1UA 3VPDA 5K2OA 1RQ2A 2H7YA 3B8EA 1FE8A 1JXAA 4D80A 2G5CA 3EAJA 3GCHC 2C9DA 1H1TA 3H7AA 3GFPA 4XFQA 3E23A 3KS9A 3REFA 2ZU1A 3OJFA 4EM6A 4REQB 1O5AB 2JGAA 2NO5A 4NYIQ 4UBIA 1FA9A 3PV5A 1GL0E 3EA5A 3WLMA 4CMHA 2O2IA 1S85A 3EXHA 3PPXA 2J38A 3DPSA 1Y1SA 1MW9X 1XQ6A 4M87A 5HXFA 1Z0ZA 1AVGH 1LTOA 5LH8A 3HCPA 1CNEA 3ZCSA 5LD2B 2J4DA 4L50A 4LVNA 4BVKA 5HM6A 4OHCA 4DLBA 3KOZA 4YAGA 1NT1A 3ZZBA 3OQHA 1P62B 1Q95A 4GS5A 3KKNA 4QDJA 3BE8A 2A7CA 1WQ3A 5ALSA 1JNYA 5BN4A 1JEOA 2BTCE 3AF0A 1RI5A 3I2HA 2AZXA 1PSZA 4O2LA 2PKRA 3WIBA 4ITRC 1OWOA 5H68A 4DKJA 3MCVA 1JHQA 1QIHA 2OBMA 2XITA 1WZCA 2JZOA 1NX6A 3LC1O 4IQGA 1F2TA 4FMBB 2CD9A 4KDCA 3UGQA 4F46A 5JSZB 1KAQA 1L4DA 1T9CA 4LDRA 4TWJA 5CH3A 4X6PA 5H5JA 1QH1B 2NT3A 3C1AA 4AF6A 4AX4A 1ICEA 4MUMA 1FFWA 1Y7IA 4L22A 1GCUA 4MIEA 2A7XA 3OQNA 4ZCRA 2AEJA 2Y1OA 1NJ6A 2AEFA 4UCWA 5HPYB 3OCCA 2B0FA 2GF9A 2QP4A 3VNBA 3UAXA 3WIDA 4HFJA 1Q20A 3VFEA 1DIHA 5LUAA 4FWTA 3UUEA 2QM8A 4LXQA 4QHSA 2VQFB 2JHPA 4Y18A 2OYRA 3PGVA 3U8RH 3MXTA 2Q9AA 2WABA 1KLIH 2HH9A 4AP5A 4F21A 4INZA 1FV9A 3ZWVA 4C06A 3QLEA 4ALLA 1R16A 1EZSC 5REQA 1JTEA 3FDZA 4YCSA 5DGDA 4KHPB 4NCAA 4LZ4B 1FK8A 2IWRA 3WC4A 4ETMA 3M1IA 3T7EA 4KTVE 3K9HA 1E4YA 1EHCA 4KMMA 3DVQX 4R2MA 1MFZA 5JTUA 2FZ5A 2AFHA 3TFOA 3OZDA 4RVNA 5CT9A 4AK9A 2XOEA 3DCNA 2PIAA 3CE9A 2WFMA 1EVLA 3KLBA 3GW8A 3DFIA 1TM1E 5F5NA 5JO9A 3ZVKA 3OWOA 5HFAA 2YS7A 3D4OA 3ESRA 2I34A 2PUTA 3F3YA 3KQDA 1IUKA 2FAXA 3QE3A 4UQPA 3MYYA 5FI1B 3H9CA 1G0NA 3PNYA 5C0OE 3V8BA 1UKCA 3LQYA 4NOMA 2WSSD 3R0ZA 4NHEA 5KYNA 3PS9A 4J9VA 4NCIA 3TOCA 1V5IA 2FK8A 3A4IA 2ZRKA 1SB1H 2XYAA 1PFQA 4LYJA 4OBBA 2HIAA 4A4DA 4Z4EA 3NPSA 4LZNA 2MYPA 4OAOA 1WDIA 3BMOB 1J1UA 4IMPA 3AASA 2ZM5A 1L5NA 4FMPA 1JLKA 3ITKA 1T2CA 2IHJA 1OLUB 1P0PA 2BELA 2JNWA 1SVUA 3DOOA 3TLBA 3DKPA 4JBLA 1YA8A 4WZZA 5E8JA 4DDUA 3UEOA 5I7WA 4EITA 5ER9A 2XDQA 2WF5A 1JXQA 1H6CA 1K66A 4MAMA 4RD2A 3ZZUA 2IEAA 4OK5A 3IJ5A 2FWMX 1QFJA 1KJ8A 5A7FA 1AZZA 1JEDA 1Y42X 2O2YA 3CF6R 1YZTA 1K5PA 3BHNA 3NWJA 3OZEA 1C1HA 4JSYA 3VSAA 1QG6A 3CU5A 2A5IA 1EA7A 2GFQA 2XQIA 4B8YA 1OTHA 2ZTUA 4WKCA 3BN3A 3QFRA 1K75A 2Z94A 3LHIA 2V7XA 4WOPA 3V9PA 1U6IA 1N2XA 3FGNA 4HRXA 4P4UA