4B75A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
total genus 208
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b75A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b75A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b75A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b75A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b75A03
5IYTA 1U9IA 5EW2H 1E38B 4FUJA 2XZLA 1TABE 3GJ6A 1GG6C 1YPKH 3KZ1E 3FMIA 4HB2A 1QHHB 4AK9A 1S85A 3V13A 2YKGA 1A82A 3MH6A 3JZMA 2XGJA 4CH8B 1OYWA 1G4AE 1D3TB 3VGCC 1AGRA 1TGCA 6GCHG 1V6DA 4JK6A 1ZINA 3A8TA 2SHKA 221PA 3DOEA 3PUXA 2BV3A 1O3EA 3Q76A 3IBYA 4KHZA 2JATA 3PWCA 4AG6A 5CHAC 3P26A 1XXFA 3TPIZ 1OKKD 3RXTA 1ZNWA 1O2WA 1N6IA 2HDNB 1TRNA 1RVDA 3K0FB 3VX4A 1KO8A 3U3RA 2ZYVX 1ESBA 3RVBA 4BLSA 5KSOA 1S6FA 2V3CC 1GI7B 5H70A 4FUHA 3TR0A 2C90B 1NVVR 2BM1A 3KN2A 3LC3A 2QXHA 2XXAB 2PX0A 2ZPTX 7KMEH 1Z8RA 3MO6A 1NI3A 1NN6A 1G3BA 1XM1A 2Q6DA 2ZPSA 5HCNA 3THYB 2YWFA 1HXEH 4PQFA 2IYWA 3AVYA 5FH9A 2J9NA 5A0BA 1ZAKA 1TA2A 5DP3A 4BFVA 1P72A 1NT1A 4B75A 4CF7A 1EAUA 4ZHLU 4MGKR 1II8A 1YRBA 1Z5ZA 3S9BA 1SG8B 3A85A 3QKSA 5FOWA 4P33A 3THYA 4KP0A 3RRYA 5HMAA 1C2EA 4LV8B 5HTKA 4HLUC 4URUR 3AKDA 1FAXA 3MJRA 1FJSA 1SGCA 3PO1B 3F6UH 1G7RA 1G1MA 1NRRH 4ZHAA 4QKQA 2SGFE 5LPFA 1AVGH 4EDHA 3W94A 6ESTA 1O36A 4ZCIA 3R20A 4Z8XA 4RKJB 3BORA 3EW9A 2ZROA 4EPVA 1O2IA 3QBTA 4B3DA 3KKOA 4Q7KA 1XXHB 4AKHA 2Z83A 2GA8A 4U30A 1IBRA 1CJTC 1WU1A 1ONBA 2FESH 1R0WA 1Z0JA 4X8TH 1J8MF 3L0IB 2ZR0A 2QORA 1S9HA 1D2EA 3CR7A 5EPYA 1T4VH 4BXSA 2QPTA 3A8AA 2AKYA 3E0NB 3C14C 2HLCA 4BTUB 4Q1FA 2H6MA 2F9MA 1AIPA 1KMQA 3HYTA 3T1QA 2XOKD 3QDZB 4JLPA 2ZI4A 1HAOH 4Y0AA 1ZM3A 1JR3D 6Q21A 2GF9A 1V2RT 1MOZA 3OAAD 1G37A 3FHOA 3EE0B 2FZZA 1UK3A 2A5KA 4VGCB 2W6ID 2CGAA 4Y0VA 2OK5A 1M8PA 1NSFA 4M21A 5C20A 4OGYA 4M1KA 1N25A 1B0EA 1JPNA 1YM0A 1BJUA 4CEIB 2JASA 3K9GA 2XC0A 821PA 3GLHE 4PSVA 1OHHA 1OSNA 3A89A 3SFZA 1QY6A 3GJ3A 1E36B 1YP9A 2ZIQH 1GHXH 1T31A 2PKSC 3NTUA 3SR0A 3I92A 2P8OC 1C5UA 1EP5A 1SVLA 3GCHC 1OIXA 1G20E 3UOUA 2WOOA 5FUVA 1BKDR 1AFEH 3D23A 1F7ZA 1O3KA 3RXLA 2W3IA 1GI8B 2ECKA 3IIJA 3SU6A 3LBIA 3M37A 5FPKA 2ZTZA 3IDQA 2NPFA 4CEIA 1RJXB 3FFBA 1YJ5A 1MABA 4M9FA 3MU5A 3UG7A 5JRZA 1ZUHA 2J7PA 4UFEH 2YWGA 1ZCAA 2XZOA 1PPGE 1CRQA 4TSFD 8GCHF 1YU9A 3RMNH 4DURA 2F9VA 1Z2CA 3HPTB 1L2EA 1O5CB 1XJCA 1E2KA 3AASA 2PGQB 2ZS8A 2PZEA 1FP7A 1SVWA 4LOYH 1N5LA 2IYQA 1E2GA 1JRSA 1K1LA 3TH4H 1BMMH 1QTFA 1RD3B 1BBRE 1P10A 3WXMA 3ND9A 1RRFA 2NO0A 3AVVA 1X7AC 1BRUP 3TJUA 4LJ6A 3P8GA 2OCPA 3QXHA 5EQQA 3GEHA 4HUTA 2ZRPA 1ZMNA 2G00A 4M9SA 4O97A 1HUQA 4IGDA 4D4JA 4JLAA 2XJ9A 2ZUDA 4FI3C 2Y5FA 2VWLA 1LVMA 3BFVA 4HAZA 1E9DA 3QIAA 1FY5A 2GDEH 1ZHPA 3IGFA 1NFYA 1H9HE 4TZ6A 1FDPA 1DG1G 2D8WA 1TQ7B 1G32B 1NKSA 4E03A 3W90A 3NWJA 1FMGA 1ELAA 2F9NA 1A1RA 2BCGY 2FI3E 5JBTA 4Z51A 3HWSA 3MH5A 3MFYA 3MWJA 1RRKA 4NIYA 2HCJB 2DE9A 1DSUA 1E0SA 2RGBA 4OQLA 3AH8A 5CB6A 2CJWB 3DZ8A 3AF3A 5FOXA 4FVDA 4E09A 2GT8A 1QQUA 5EG4A 1LW7A 3B5JA 2UKDA 2C9CA 3MU8A 2WHXA 1VCNA 4LOAA 2BBWA 5FXLA 1HAHH 3PEYA 2BBSA 2G81E 2WIAA 1HB0B 3NXPA 4JSYA 1MAXA 1NFXA 1TQ0B 4ARZA 3GJ8A 2F43A 2VP0A 1F2UA 2G5VA 1GVKB 1N0WA 4Q48A 2ZC9H 2GTBA 4HAXA 7GCHF 5B2ZA 3GCTF 2AGGX 1P2SA 2PUQH 1KI7A 4IHQA 1W2KH 2G0TA 2D7DA 1F92A 3SYNA 5FOTA 2GMTB 5EXMA 3WHLA 3R9WA 1A61H 1WMSA 2FX3A 4DDWA 3L6PA 4JYCA 5F03A 2X77A 1EUFA 2QMHA 1ZR0A 2IJD1 1COWA 4RKEA 2XRCA 4WMFA 2GKVE 4CR5A 1O3CA 4MNYA 2O8DB 2J46A 1W48A 3PFIA 5F9HA 4Q80A 1NRSH 3U61B 3N70A 3SNEA 3EYDA 4DIHH 4TTPA 1EFRD 2ZDLA 2PLRA 3BD9A 1CJVC 3KFXA 3T25A 5JMTA 5GCHF 1GBHA 5KOYA 4Q9HA 2IS6A 5EQSA 4WJG2 3M4YA 4NSVA 2ODEA 1LPZB 4Y7BA 3VFEA 2CJWA 2WJGA 4JVSB 3OAAA 3QY0A 2A4QA 4X8LA 3DM9B 2ZFSA 1S0UA 2BOHB 1NRJB 1A0JA 3P17H 8OHMA 1KLIH 2UUFB 5CMXH 2CHAB 2ZG0H 5L3SB 1P02A 1ZPCA 1ODFA 2EFGA 1LVGA 1OH6A 5FFMA 3VB7A 1XMNB 1MTUA 1DLKB 4YOJA 1UCYK 5TVKA 1XX6A 5EZ6B 1ANCA 4US2R 2JCSA 1C1QA 3MFJA 1SHKA 4CYMA 3IBGA 3SI3H 3LO5A 2QAAA 4EAQA 1ZRBA 3LW8A 4XTCS 1DE7H 2AWNA 3FP7E 1OFTA 1EOLA 2BDIA 1O5EH 4EPWA 4K60A 3W34A 4JYVH 2ZP0H 1KHTA 1RTLA 1XUJA 4ESHA 5EE1A 4R9UC 1ZMXA 3Q3XA 2NO9A 5FUXA 4HUQA 2BY9X 2FOBA 1XUFA 3LQRA 2IF2A 1A5GH 1ANDA 4W5JA 3C1KA 3ZZUA 1YCPM 2QV1A 4Q18A 3RYTC 1P3EA 2HNTC 2QA5A 4DB2A 3P8NA 3LA6A 3ADBA 1OP0A 3REFA 2H16A 2Y8EA 4R8TB 2BBOA 2VRWA 5GDSH 4IVPA 4LHVA 4TLEA 3GY6A 4HFPB 3QJYA 1IXZA 2WWWA 2ZSAA 4X1SU 3GYMA 3LGYA 1GI0A 1BRCE 2PFEA 4TTQA 1QF9A 1G5PA 4QOSA 2GJKA 3STIA 1U0HC 3VHLB 4K81B 1BJVA 1AFQC 1F0RA 3A1SA 1O2QA 2JA1A 1QHNA 5BYKA 1Z63A 4OQXA 4D2IA 2ZVPX 5EGMA 3MH7A 4FINA 3KQLA 3ZGXA 2A5YB 5KU1A 1EXFA 2SGQE 2YOLA 5JECA 4BFUA 2J34A 3SN6A 1R10A 3RUOA 4RZUA 1F2UB 4NMMA 4EQ6B 4AOQA 1NLYA 4AKIA 2GZAA 1UKEA 3KDSE 8GCHG 2DE8A 3TIUA 1ANKA 4UJ5A 3GJXC 2Y80A 4E7RG 4DVGA 3KQHA 1VCPA 2F4LA 3PO1C 3ATWA 1O2RA 3K09A 1W0ZU 2W26A 2BD9A 2XWBI 2PMKA 3Q7QA 4YTAA 3FP6E 1VYTA 4TWWA 4LJAA 1KYNA 1Z6TA 4TZ0A 5E95A 3KL6A 4Y71A 2EVWX 3GCGA 1PYTC 2TIOA 4B2CA 5FHTA 5DIFA 2PTCE 1QHXA 3ATIA 1Z6EA 3DPUA 3SS8A 1DFPA 1VITG 1QL9A 3A82A 1V2NT 2IXEA 1HLTH 2ZHWH 4EKDA 2V6IA 2QPAA 1HUTH 1MO4A 1P73A 1ELBA 2JAQA 1CVWH 4ZKRU 3IHWA 1IN7A 2ZO3H 3CZPA 1HYQA 4X1NU 2UZIR 1IQEA 5E0JA 1E79A 3NCLA 4EJSB 2NWNA 3THOA 1Y3WA 4QGAA 4BNRA 4DBLC 4URVR 1S83A 3EZ7A 4A36A 2UWPA 1E2PA 2YHSA 1MUEB 3EC2A 3LW7A 1NVXQ 4P4TA 2I6SA 3GCNA 1TRYA 2ZGHA 3GCTG 1KXDA 2A2QH 1ELDE 3IWMA 4ZUHA 1E9AA 3ADDA 1O2GH 1E2FA 1PJPA 2EI8A 1KI9A 1W7AA 2JLVA 4R0IA 4NP6A 1LVOA 2ZU6A 2DBYA 3KKMA 1ESAA 4K1SA 4MNVA 1C2KA 2GCPA 5JJKA 1G8PA 1JBKA 1W4AA 2HF9A 2IBMA 2ZR9A 1NLFA 4KITB 2YC4C 3AVZA 2R0KA 2HF8A 2CV3A 3I62A 1UEJA 1EXMA 5A0AE 2ZRFA 1F2TB 1AZZA 4NWLA 3L8ZA 3AAVA 2C03A 3MHWU 1E9EA 4ZIRB 2FS9A 1HAGE 1MV5A 2GJSA 1JXOA 3ZD7A 3T1VA 1CXZA 1AN0A 4TTRA 4BLPA 5A0CA 4BRWA 2FLBH 1W4CA 4CR9A 2JDIA 3SYLA 1YPEH 1VJ9U 3IPYA 2J95A 3RXQA 3OE7D 1N6XA 3QG5A 3QKUA 3AVQA 4GLYA 6GCHF 2G4TA 4A9AA 5FBLB 2BJWA 4OHYA 1PPCE 1AY6H 2BX4A 2RGXA 2QY9A 5GJBA 4I8JA 4KGAA 1C5YB 1GCDA 1L0ZA 3L0SA 4GCHF 1BO6A 4QRHA 4LSGA 1OJLA 5TMPA 3UR9A 3MGCA 5DP4A 1GJDB 4MA4A 3RXOA 2IYRA 2GETA 2LPRA 4NCYA 1BUIA 1NS3A 2FSIA 1GJAB 2ERYA 2F3CE 3CRVA 2QE7A 1J8AA 2P5SA 2GJAA 5DKMA 4KV9A 5CIWA 2FPKA 1SGWA 3MH4A 2BBTA 1P01A 3RXVA 4LC0A 2OBOA 1AQUA 1P61B 3RU4T 1O2YA 1U81A 2P3FH 4KJZA 5AFZH 2F7SA 1O39A 1QHYA 121PA 2FOAA 3LAWA 2Q21A 1AGJA 4IXNA 4ACAA 3TVTA 4YMSA 4NDZA 4FIDA 1E96A 1EFRA 1F2SE 2JLUA 2E9SA 4DKXA 1G17A 2AFQB 2VSOA 1GKUB 2R2AA 5A2MH 4R7ZA 1P09A 3F9HA 5SZJA 2XBWA 4URZR 1CR4A 5EXSA 2BEJA 3A8CA 5EXTA 1IQNA 1DOJA 3M7UA 1AQ7A 1P8VC 3ZV9A 4X0WU 1BRBE 4RCZA 5KPJA 4JL6A 3S1AB 1G19A 4B47A 2ZXUA 3VAAA 1E1QD 1RS0A 3SQEE 1P6XA 1TNIA 1II8B 4MDFA 2QBYB 2GMTC 1RE0A 1EOJA 1P12E 3RANA 3ND8A 4NCHA 3OIWA 1Q22A 2DYKA 4M4SA 4P3YA 4YDHB 2Z6VA 5G53C 4TYPA 1P7CA 2KBFA 2WV9A 2JIZD 1G16A 2ZSDA 4PPFA 4RSPA 2FOCA 3CPJB 2WMNB 3LGUA 2CNWD 1EPTB 2B5TB 1K28D 4Y10E 4GFDA 4LZZA 1Q1EA 2ZJZA 3NIBA 4ON9A 4GOKA 1HT1E 4AYYB 2GCNA 3VB3A 1SI5H 2PZGA 5EXPA 4NGAH 3BEUA 2XEXA 2J59A 2BHGA 1A5IA 5EPNA 4BTIB 1TEVA 5AJZA 4UDWH 1OWIA 4RSGA 1PLJA 4M9ZA 2BWJA 1FNNA 2DWOA 2A7QA 3HP1A 1TWXB 1ABIH 3AP3A 1BTWA 4OHXA 2G83A 3EDXB 4DSOA 1T0JB 1GTVA 3LVRE 1UVOA 1Y63A 4B44A 2EW1A 4DOQA 3V12A 4RY2A 1GGDB 5ELXA 3GLIB 4QJ3A 3BTQE 4NZLA 3TSZA 1UHBA 3AB3A 5CK4A 3W8NA 4JBYA 4RD1A 4XBDA 2P16A 4PHHA 1G9XA 1Z8GA 1SPJA 2GKSA 1WCZA 1XVOA 4BFZA 1ANBA 1LPKB 3WBKA 2J87A 2CDNA 2WBLC 2VP9A 4NTZA 4E7NA 4CHAC 3BG8A 3PM3A 1ZSKA 1IN4A 2AHOA 2ERXA 3IKJA 4TQAA 4Q9JA 1AB9B 4XSKU 4JKIA 1ZGIA 4N1AA 1UJ2A 2G77B 4E5UA 4PO1A 1GJCB 2FTMA 3EIHA 8LPRA 2ZZUH 2FEQH 3P92A 3GLGE 3UNQA 1K9OE 2BX3A 3LXXA 2O8FA 1DWBH 2H5EA 2D7CA 1KTVA 1SLVB 4NL4H 1IQKA 5KYKA 2JEOA 3MNBA 1VG8A 2YV5A 5IHPA 3GLGA 5K8UA 4PHFA 2VNTA 4RFSB 4TLDA 1AZTA 4DDUA 3AF4A 4WXPA 4D76A 1NU9A 4LYAA 4WBSA 2OEPA 1AGPA 3TW4A 4PQRA 3GJ0A 1DWDH 2L0XA 3KFVA 1U9IC 2GZ7A 1T0HB 4IS5A 3SHAH 1MMJN 5JJLA 2GF0A 3RC5A 2BY8X 3E8LA 1QA0A 1FNMA 2VIQA 2Z9JA 3W95A 1U0JA 2ZRAA 3MAAC 5P21A 1KSGA 1O2SA 3TBKA 4S2EA 4D81A 2ESTE 4GRAA 3TAHA 3TE6A 4IVRA 2A78A 1Z0DA 1N5JA 1V5WA 1GG6B 2QGRA 4GUXA 4KVGA 1IN6A 1I4DD 1P2QA 2B7BA 2OZEA 2Q6FA 5CDFE 1O87A 2JJ8A 3THWA 2P59A 4BEJA 1P2TA 1SHZA 2FSGA 3BG4C 1HCGA 1H8IH 1C2IA 2PCLA 1GBJA 3SJKA 1XEXA 4PHTA 4JSTA 4KFRA 5A8YA 4HDCA 2Z6BD 1HQYE 1OFHA 5PTPA 2KI5A 3EA5A 4H42U 1XCMA 4M8NE 1ZTKA 1RTFB 4Y7AA 2AXNA 1NESE 1NN0A 1E35B 3TU7H 3DEFA 1HAVB 3NPSA 1KI3A 3BB1A 4ABHA 5HR5A 1M7HA 3LKWA 2VP4A 3ZS9A 1GJ5H 1DOAA 5AJVB 4G3XA 1KAGA 5FL7A 5L3RA 3LJJA 3SJCA 1SVMA 3KB2A 2FPZA 3S9AA 4NCKA 5H8WA 4PC3A 1NBME 4X8HA 1C2GA 3SU3A 2BMDA 4URWR 4O2RA 2VEDA 1OXUA 3K9XB 4IEIA 1EX7A 1KO5A 2FM2A 3B1WA 3ZLJA 1BYUA 2Q9AA 4FD2A 5AUPB 4OM9A 1DAFA 3MMPA 1KY3A 5CDFA 3WMEA 1C9KA 2LKDA 1DARA 1Y3YA 4K5ZA 1V2KT 4LPSA 5EP1A 1OXVA 2VIIA 1H8HA 4B3GA 4ABFA 1QHRB 2ZRNA 4R2IA 2O9QA 4F4CA 1DXPA 4A6XA 2YZ2A 1QGFA 3ZZ6A 1II9A 5A8XA 1CULC 4OS4A 1N6LA 1SVKA 3FE2A 1VITF 5HM9A 1YBWA 4Q01A 4U32A 4PQYA 3VR1A 3MO3A 4EFLA 2ZDNA 4FMCB 3QBVA 3IIMA 4Q7LA 4WF8A 1THRH 2O0JA 3OEEA 4RKFA 3SZEA 1E0JA 2GD4B 2W2TA 1O2VA 3WYAA 1XU4A 3K9NA 1PFXC 3QKSB 1TYNA 1YPHC 4PTLA 4PZYA 3QSYA 3MTYA 1H9IE 1P2IA 1EFHA 4XWAA 1GVLA 3T1OA 3UMSA 1KIGH 2QQ0A 1IN5A 3CNOA 1UADA 1GJ4H 3QPWA 4Q1EA 3SJAA 1X8KA 1HAZB 5UKDA 1QBVH 2THFB 1GGDC 1C1PA 3BJIC 1LVBA 2D4HA 2D06A 1I4LD 4CBOA 2VHCA 1R5NA 4GCHG 2KAIB 3ZZDA 1TL7C 2DY1A 3PUVA 4XVQA 4BRUA 1E2IA 3QG1A 4TT3D 4KTSA 2P3TB 4X2XA 5A5GA 1XUGA 1B0UA 2WJIA 1XD8A 1TPPA 4V0LA 2J5XA 3SNBA 2G1KA 4BAHB 3THWB 1L1NA 3PMHB 2AGIX 1DS2E 4B33A 3BTGE 2EWWA 1OIVA 1GL7A 1Y59T 1OYYA 2VHUA 5CK5A 2KSQA 3U44B 1BTUA 3RXBA 1LKAA 1GCTB 3BTKE 1NVVQ 4A8JB 3NVAA 1F0UA 1YLDA 2P6NA 1QBNA 1SVPA 1AZSC 3CPEA 2ZE6A 1P3JA 2EFDB 3DOFA 3VR3A 2IS1A 3B6EA 1C5SA 2JH6D 4UNSA 2H8KA 2ODWA 2PT7A 1QURH 3K65B 2CLDX 1Z47A 2D2FA 1E79D 4TN1A 1RRCA 4AN7A 1U99A 2YOGA 2RCNA 1QCPA 1N2CE 4GOXA 2CL7X 1S4QA 1DO2A 1O34A 5DNYB 3UG6A 4UNRA 4AB9A 1KDRA 2UUJB 2F9PA 3RSOA 2KAIA 5J4VA 2ZHDA 2ZRKA 4B3BA 1FP6A 3LY5A 3TJVA 1OH7A 1TGNA 2V0BA 2IYVA 3RXCA 1KI6B 2UWOA 1OH5A 4A1XA 1NRPH 1SQAA 1C1VH 1AS0A 3OU0A 3MUFA 1QZXA 1A3BH 1TTTA 3LLMA 3QXSA 2STBE 3GP8A 2GK7A 1CP2A 4BANB 2WSMA 2ZDKA 1G8HA 2WPKS 3HKIB 5JS8A 2AL7A 3P4XA 1W14U 1HURA 2VP2A 4TL6A 2WPHS 1W0JD 1C2JA 5F98A 3UY9A 4ABDA 2F1RA 3D31A 3OEED 4NYIQ 1TX7A 1ARCA 5GCHG 4X8SH 1TGSZ 4PZLA 3KEEA 4BAKB 2BVRH 2Z4RA 4DLTA 3ELAH 1G30B 2V35A 1QQ4A 4X1RU 5FCKA 2YC2C 4ZHMU 4ASHA 4LI0A 1MCVA 1O5DH 4C4PA 2GXSA 1XTKA 1BCUH 1IHSH 1VITH 5DLQC 3SZNA 2VSXA 5F2EA 1P2MA 4B1TA 1C5NH 5FBWB 2XTTB 2Z9IA 2CCJA 1ELFA 3CNLA 3K70B 3IUYA 4KLZA 1K21H 2ANWA 1OXXK 3QX5H 1WTGH 4G01B 4HATA 4D7GA 4YLUA 1X8JA 1YZNA 3AP2A 2IWHA 3EPJA 3PV4A 3SU5A 3OHMA 2GWHA 2D2DA 1KOFA 3L2OB 4B76A 1S5SA 3DHKH 2I3BA 1KI6A 3CM0A 4ZKOU 3HKJB 3QF4A 2RGDA 5HE9A 1VG1A 2IXFA 1TONA 4JL8A 3QI2A 3HR8A 2J38A 3PTBA 2QAGB 3CONA 1HGTH 1BMNH 2A4OA 2Z3EA 3B8JA 2CE7A 3BIUH 1J99A 4HSEA 4KBGA 4JZFH 2P93A 3T28A 4L5BA 3TH5A 4MG3A 1TUIA 5K8IA 1O5FH 1A2KC 3ZVAA 2BMFA 4AORA 4YT7H 4N0EA 5LH8A 4Y8ZA 2NU3E 1M7BA 3LGWA 1Y5UT 1TAWA 5CYPA 2SGAA 1DDJA 5H1YA 1RPZA 2QRNA 4D82A 3SUEA 4NE2A 4NA8A 2FE4A 4V03A 1BHXF 2ZFFH 2K1QA 4LK2A 1BITA 1GHBG 2XSZA 5AUOB 1UVUH 4C7OA 3TNFA 1W44A 4Y8XA 2GZ9A 3ECCA 2ZUBA 1VECA 3ITIA 5C5OA 4K8OA 2O8MA 2EYQA 4LJ4A 5M04A 1XXHA 3RMMH 4WXIA 2HJVA 3VU9B 4GNKA 1PUJA 4B3FX 4FUEA 3SBDA 4Z6AH 3O8DA 1H9LB 1BOFA 4MGIR 2BXUH 4C3ZA 5SZHB 2VPPA 3ZZ4A 3WP0A 1SKQA 3KQCA 4QFMA 2XCFA 4JVNA 2Q6GA 1NZQH 4MYUA 4Q7XA 2EA3A 3BIFA 3KTAA 4XTRA 3PLKA 2O8TA 3T1TA 3AVWA 2P67A 3MYWA 3CIOA 4XE4A 2BTCE 3WRXC 2O8EA 1NBMD 3CX6A 4A4DA 1KLTA 1OB2A 1D9ZA 4QNRA 4OBEA 1HXFH 4MITA 1GI1A 1RJ9B 4VGCC 4E06H 4TY7A 1O5AB 2Z0MA 5FI1B 1XUIA 1HAVA 1OF1A 4LV6A 1XD2A 1ZCBA 1FZQA 1TALA 3NBXX 1OWJA 4B6EA 3LXRA 5DJ7A 4W5WA 4NWKA 1SVSA 4N3NA 3BS4A 1XEWX 2A5DA 1G3CA 2GCOB 4QM7A 1W8BH 5TXGA 1T4UH 3T5DA 1Q12A 3MO9A 2GBLC 2VJ1A 3UWKA 1IJEA 1D4PB 2WYGA 3EA9A 3TVJB 1VHLA 1XBTA 1YPLH 1GHAF 1INCA 1U94A 2VIPA 1K1JA 2Z94A 1O3PB 2TMKA 1Q2WA 3D8BA 4JJKA 2ZSEA 1S3GA 4ISIH 1G8GA 3B85A 1NTPA 2V54A 3HU2A 2FWWA 1SXJD 2ZI9A 2JETB 4BLTA 5IDKA 5JI2E 3QEOA 4UFGH 1WOFA 1ELCA 5CITA 5ETXA 2XNSA 4JZIA 2QT1A 1AWHB 2PBRA 4K46A 1CGHA 2B7CA 2BDHA 4YLQH 3DVLA 1RYFA 3KUDA 3CO5A 2VQSA 5BQ5A 1ABJH 4Y76A 4HAYA 1EFCA 2FGJA 2JDID 4AG2A 2WJYA 2ZWLH 4OKSA 1TPOA 3H4MA 1KLJH 1PQAA 2C95A 2WJJA 3ADKA 1DPFA 3CP7A 3EIEA 3GCOA 3DDCA 2IS4A 2J41A 1AQYA 2RGAA 3A7XA 2A45B 2WWGA 3CW2A 3GYLB 3VKHA 4GSYA 3GPLA 1O38A 2JLWA 4DG4A 3WNDA 2BD5A 1AI8H 2C93B 3AAUA 3UTUH 3MWLA 2CE2X 4O9VA 2ZFRH 3FZDA 1V2LT 1VKJA 4DVAU 1KXFA 4U2WA 3MWYW 4A8JC 1EQ9A 1O5GH 2GDDA 1OE0A 2D26C 1VYUA 2XCNA 3VX3A 3A87A 4X6MA 1MKYA 2V4ZA 2C8YB 1HFDA 1GMHG 1Z0IA 2W7UA 3QGJA 3Q5EA 4BLQA 4WAUA 1WQ1R 3OEHA 2R6AA 1SGYE 5EP2A 1FUUA 1UO6A 4D25A 3Q72A 3KQBA 4B32A 1N0VC 8ESTE 2OILA 4TL9A 2AWOA 3KTAB 2BY6X 4G5RA 1B7XB 2B7DH 5JJIA 3ZIAD 2A5FA 2CMKA 3BTWE 5LPEA 3T26A 3O8RA 2ZIAA 4K2YA 1OOKB 4P4SA 1DE0A 3K0EA 1BYIA 2ZAOA 3RWOA 4LBWA 2QP9X 1O2PA 1Z7KA 1HAYB 2FSHA 3F9EA 3MCAA 2FG5A 1Y3AA 1OXGA 5C2ZA 3ZYCA 2PSXA 2ZHFH 4KYUA 1OYQA 5DN6D 3JZ2B 2QI9C 1WE2A 1X1RA 1LF0A 4MRVA 3EZ9A 3U5ZB 4BWYA 1KJWA 3LX5A 3TGKE 1CR0A 1OWEA 3QVVA 3AVPA 2EFCB 5C4MA 1EZSC 4NYMQ 2YWHA 4NYJR 5DSZA 1N6HA 1HIAA 4FUBA 1CA0C 2DFTA 4V0ME 3FMOB 4DIEA 2AMDA 3RXEA 1MCTA 3U69H 2AGEX 4S35A 2IYUA 4M1OA 1SULA 3OSYA 3KQUA 1ZZZA 4DJTA 3M35A 4FU8A 4ZAEA 1EESA 2PT5A 1YZQA 5JBQA 1CA8B 3AUYA 3MNCA 3GJ7A 4KFUA 5JWRA 4HLQB 1O32A 1M9UA 1YPMH 2I1VB 1IHUA 4L15A 2ZSBA 4OS5A 3WRYC 4TYNA 4Q1BA 5JWHA 2HVXA 3A80A 2KB0A 2CK3A 4Z1MA 1ZMLA 1F2TA 3T34A 2IX3A 4PC6A 4TMVA 4DDTA 4IN2A 4I33A 4P4SB 1T8TA 5JLJA 1DADA 1N6PA 1U8ZA 4IFEA 4AZ2B 4HDOB 2A4GA 4YT6H 1NM6A 4THNH 3PJRA 5DHAA 5DG6A 1JRTA 4JVMA 4C0JA 4ABAA 2OC7A 4X6PA 4RJLA 3LONA 4XWOA 1A0LA 2G8TA 1E2LA 5CM9C 3QENA 1Z08A 3SV2H 1QHGA 5HCIA 1W11U 2X2EA 5JBBS 2YNAA 4JBXA 4NHOA 4X1PU 4LX0A 2FI5E 4PZZA 3IPXA 4JKYA 3RU4E 2ZQ5A 3K2UA 1O3FA 2IYYA 2ZGBH 2ZRDA 3I4LA 1N1LA 2ZI6A 5C18A 4GHQA 3RDPA 4UXHA 2OUAA 1SGIB 2GESA 1YRAA 4CEHB 1KO4A 4RD6A 2VIDA 4BOHA 3OTJE 2I4IA 1FIWA 3A7YA 4B2BA 3U7GA 1E1QA 1QNJA 2J7PD 4DUGD 3RSLA 5HXFA 4XD7A 2FFQA 2W2VA 3PMBB 1FW6A 1EG7A 4B74A 1IQMA 4BAOB 2J0QA 4DLRA 3A36A 3LGTA 1QVAA 4X8UH 1GBTA 4GT1A 4US1R 2X19A 3QXJA 1AZ8A 2QF3A 4LC1A 1O3MA 3LU9B 1KJZA 2Z9GA 1VTKA 4O3UA 3SE0A 1FFHA 1P3CA 2YOFA 3BOSA 1XEWY 1L8QA 4D4LA 5CJ2A 1KSJA 5TJXA 5BPEA 3TR5A 3Q3KA 1R8SA 1QG2A 1CRPA 2WOJA 2QTHA 5AR1A 2XYAA 2GJ9A 1L4ZA 1MKWK 5J4HA 3AF0A 4EPXA 2A5JA 3GFTA 4YMTA 1D6JA 3N5CA 3BEIB 4AFUA 1SQOA 4DLXA 3IITA 2BDAA 5CLLA 1KXCA 1AA9A 4MYHA 4IW3B 1Z6XA 3R3GB 1OFUX 1T8LA 3A1TA 1TE0A 2QNRA 2WMOB 4UEHH 2ZFQH 1AB9C 2ANCA 4RD0A 3BBPA 5B6OA 2CL0X 1NJGA 2WKPA 2WVJA 1K1MA 3CRW1 3ZS8A 2C4FH 1M74A 2GAAA 1C5QA 3W6PA 2V8OA 1KK0A 2BZAA 1PPFE 1P03A 2BKUA 3CF0A 1GI5A 1TRMA 3DFLA 5CB8A 1LO6A 2IEYA 1CJMA 3RS5A 1G3IA 2R2MB 2XXLA 2RG3A 4GI7A 4Q4HB 3SYJA 4Y79A 2F9OA 4UD9H 2CEAA 1TPZA 2GV7A 1TF2A 5BXQC 1Q1QA 3M5LA 1UM8A 4ZI2A 1PUIA 2ZANA 3FAOA 4BZPA 5EOKA 1UTLM 5EUQB 1YQTA 2O8LA 4ZDJA 3PQCA 3BSQA 1GI9B 1SL3A 2FA9A 4P4UA 3TSWA 5CIQA 3QKRA 3T12A 1EX3A 2OFXA 2XZPA 1GBAA 4MPUA 1XD9A 3K70D 1XKAC 2HUPA 1F0SA 1XD2B 2TPIZ 4E07A 4TY6A 5EXLA 1RYHA 2CXXA 3MNSA 4CRGA 1N0UA 5EE3A 1XZQA 3TVDA 1T7CA 2RGEA 1NLZA 1EWRA 2ZPQA 2ZA5A 4IEEA 2OE2A 2AYWA 1E2JA 3HJNA 4NYMR 4DXAA 3K53A 1VGCB 4X8OA 5IRCD 3VU9A 3U9AH 3QKRB 3RS4A 3X1DA 1QBKC 1C1OA 3M6AA 1GMCG 3S1AA 4Y0ZE 2BDBA 3CENA 1SOZA 3KIDU 2OSBA 3LIWA 5KUTA 2VWMA 5FTKA 2PR3A 3G01A 4QHTA 1WBBA 4GHTA 2BMEA 4A1TA 4CRDA 4P31A 3BTHE 1RZ3A 1ZP6A 2JLXA 7GCHG 3C5HA 1TBZH 1M34E 3VR6A 2A32A 2MSEB 1WTHD 4RN6A 1NVWQ 5LD2C 3GISB 4A1FA 1QRAA 4H6SB 1OYTH 1HH4A 1C5TA 3TJNA 2ZI7A 1R7RA 4LJ9A 2V3HH 3UMFA 3CB4A 3O8CA 2FU5C 4IKEA 3FMPB 3QGNB 1WUNH 3KCGH 3PTNA 3SNDA 1JQLB 2ZE7A 1GJ9B 4FU9A 2ZPRA 3Q8XB 3K70C 1KSHA 1MH1A 3RXMA 1J9CH 3ZYDA 2ZRCA 4DSNA 1HNEE 3NG1A 4KI0A 2XC4A 1H65A 2G88A 4YONB 2PTNA 1PQ7A 5DI3A 1O3LA 1BS1A 4H1VA 2EEKA 4I8GA 3E3TA 2J2UA 4UFDH 1SQTA 3NUMA 3UR6A 2QMOA 3QQ5A 2C8VA 3RM2H 3DHWC 4IDNA 4BZQA 4DB4A 2IA5A 4XD7D 4GZLA 1UFQA 1SGFA 5EUMA 1D3PB 5JB8S 3BFXA 5FL7D 1NROH 1G8YA 1DM4B 5HKKD 2HLDA 4XVRA 5GVSA 2D2EA 3A8DA 2OLJA 1GHYH 1EJAA 4MRRA 3DM5A 3QF4B 4OI1A 4YM9A 4IW4E 4A82A 1XTSA 2SGPE 5JBCS 3F0TA 3NDBB 4AD8A 4B3XA 4B6FA 1UBGA 3SGAE 3UREA 1XTRA 2ALPA 4M22A 4BASA 2Q1JA 5T6DA 5L3QA 1LF5A 5J4KA 3AGPA 3LLUA 5GIBA 2ODBA 2VLIA 1ETTH 2A1DB 1P2VA 3PV0A 1SHYA 3N2IA 3UPEA 3ZVBA 4YMUA 1O2JA 4H6TA 2C04A 1E94E 1SZPA 1CF4A 1V2PT 5C46F 1WYKA 1DAEA 1SC8U 1TUEA 1PQ5A 4B35A 3RLYH 3E1XB 1P9WA 2V1UA 2XB2A 2BLOA 4AIIA 2ATVA 4Z54A 1Z8JB 2B6HA 1ZM9A 3B2EA 1IOEA 3U8RH 2RB4A 1GUAA 2BHRA 2JH0D 3MRSA 2WPLS 5FOVA 1GMHF 1C1RA 1ZYUA 1TLDA 3EA7A 4LHWA 2WZQA 1E99A 1PZNA 4NYJQ 4V0KA 1GHBF 1EJNA 3E0PB 4O25A 5ANRB 1KDOA 3S0NA 1GM5A 4B3CA 2NU4E 4IDPA 2PJZA 3NH6A 4Q47A 4QHYA 2V9PA 1GI6A 1P06A 2GJ8A 2Q3FA 1SLWB 3CH5A 1DITH 1G3MA 1HY3A 1AD8H 1JWTA 1DTSA 2QYIA 1S81A 2PKAB 2G6BA 5KTYA 1KO1A 1EFUA 1N3BA 1C2MA 3R7WA 4DJZB 5EE5B 1AE5A 4M1WA 3C7KA 1UMAH 4PPQA 1A4WH 9LPRA 3JVVA 4JMPA 1C2FA 3TW8B 1E37B 3H2YA 4C2TA 4ISLA 2OC1A 5GXPA 2AN9A 5GJVC 2DFKB 2HOBA 3AK5A 4TMKA 1ETUA 3GFOA 1MRSA 3A1UA 4D9RA 5DN6A 5KNDA 1DPOA 4A6LA 4II7A 1GDDA 3TUJC 2CVHA 4C2UA 1ZC3A 2ZU2A 1JI0A 2HALA 3RXSA 1ZRHA 2KE5A 1BRAA 2DWPA 2O0KA 3QF7A 5BW8A 1OPHB 1QR3E 4TPIZ 1Z6YA 2ZYTX 4D4KA 1VYVA 3ZZ3A 4DT7B 2XBXA 3EGKH 1HYLA 3I3SR 4PAQA 3RS2A 1OHHD 5AVDA 2ZTSA 1H8ED 2FS8A 2QAGC 1C5WB 3GLHA 1JJ7A 4TLBA 1AU8A 2DFLA 5J4LA 3NZIA 3KGPA 5I46H 1MKXK 1KDTA 5GJ4B 4Q19A 3Q5DA 1LV7A 3OE7A 2W6IA 3DUXH 1ZSLA 2LKCA 1W13U 5FUYA 2VTKA 4URXR 2H5CA 2V6NA 4LPKA 4R71A 3FVFB 4LZ4B 4XSGA 1O37A 1C1NA 3F68H 2FDCA 1HE8B 4JLKA 1FN6A 3W9YA 1JEEA 1ETRH 1C4U2 2ZGJA 3RXHA 1FMLA 1OP8A 4UQOA 4B48A 4WZAE 1ZHRA 4GP7A 5L30H 5JDUB 2FJUA 3UKDA 3CX8A 4W9MC 4SGAE 1BH2A 3MNXA 3IG6B 4MNWA 2P2LA 2ASEA 4WIAA 3VQTA 5FCRA 3E91A 4LV5B 2VB0A 3G0HA 3SV9A 4M7GA 4JYUH 1OIWA 1A2CH 1H8EA 5JCPA 5EODA 4MLFB 4MGYR 1E6CA 4AYTA 2JJ2D 1FPMA 1UTJA 5H68A 1WAYB 5EE0A 3WY9A 1L1JA 1WP9A 1UKVY 1GDNA 2FOFA 5IT5A 3RABA 3SO3A 3HATH 3GY2A 5D3QA 3TITA 1IQLA 1NG1A 4ILEA 4QC2A 1NG9A 4ZDWA 3VXFH 2Q3HA 1GI3A 4OI2A 3QTOH 5EP3A 4DCUA 4V02A 2JLYA 1NY6A 3U6KA 2BY5X 2ZKSA 3R7WB 2ZJOA 1ZTLA 2BM0A 3H84A 1G5RA 3QOFA 3EWAA 4C30A 2CHQA 2WSSA 4FWIB 1NKTA 1L4UA 3C41J 4YLGA 2EI6A 1EZUC 2VH0A 1ESMA 3PLBA 2G0NA 3RRZA 4OK3A 3AVTA 2QCYA 1GILA 4A15A 2VH6A 1GL6A 1BTPA 1MU8B 1QJ7B 2NG1A 1XWIA 1YPHE 4TQUS 2DHRA 4JYBA 3S7HB 3T2NA 521PA 1AKSA 3R0FA 3N7OA 2XXAA 1KK1A 2NO7A 3A1WA 2F1JA 3SV8A 3P6ZB 3NEYA 5ABWA 1TFXA 3F8TA 3V00A 1YKTA 4WH6A 2CCGA 1PPHE 3RXUA 2YNBA 1U2RA 1HDTH 4URYR 2NO6A 2GZ8A 5LDDC 5L3VA 4D26A 3ASYA 5E2PA 3TGPA 3I77A 4D0LB 5DP9A 4M9QA 2ZECA 3ATLA 2WKQA 4DSUA 5LD2B 1OWDA 5G3YA 4I1VA 3P8FA 2FIRH 3SUDA 4JZ1A 2K5UA 4PR0A 1CQQA 4D9QA 3U3JA 2AMPA 6CHAB 2ZI5A 1FAKH 1MBQA 3UIEA 4KELA 4HI0E 2GXAA 1Z06A 3QVUA 2ZU3A 4BFWA 3ONWA 1KSFX 2PH1A 3CZQA 1E1RD 2DPXA 2IT1A 3CS0A 3NKKA 2GCTC 4UJ3A 3TAUA 3BTTE 4Q03A 4ZKDA 5TDHA 2R3UA 2RGCA 4M1MA 2PZFA 2GP9B 5AJWA 2PHBA 4C0AC 3AM1A 3NWUA 4FUGA 1HE1C 1O3YA 2CF9H 4I4LA 1JXMA 2B8WA 4KFTA 3SNAA 4KBFA 2SFAA 5DK1A 3LT3A 4LBYA 1Z0FA 1J90A 2A31A 1NP6A 3EAQA 3QXXA 1XB2A 3X1XA 3ZVMA 3U7FB 4JJZA 5GPIB 3LPRA 4LXBH 4I8LA 2OBNA 1SGQE 4LYFA 2A7JA 2ZRJA 4B2PA 1PJRA 3SC3A 1G3RA 2VVVA 1ZD9A 2ZNKH 4QJ4A 1WRBA 2YOHA 1OW3B 1UAAA 2TRMA 4KTCA 4YO9A 1R5OA 5FUWA 2N46A 4BEBA 2VSFA 2GCTB 3HGNA 2VL7A 3ZIAA 4MTBA 2VIOA 1EFTA 1X86B 4QBGB 5DISB 2NMVA 4ZCMA 1VR1H 3DMDA 5EW1H 5L2YH 3RXRA 1Z29A 1CU1A 4MKIA 2IXGA 5TCCA 1F5KU 1XNJA 4YMVA 2GV6A 2FOMB 3SGQE 3D3QA 3BFKA 1MBMA 1R5BA 3CS7A 4Q00A 4RFVA 1TMUH 2FGKA 1J7KA 2OCVB 2OAP1 1R0XA 2FZ4A 1BHXB 1CLUA 3IIKA 2FX4A 1RFLA 4QGGA 3D62A 2MSDB 1KK2A 4MPXA 4QHSA 4AYXA 4D8NA 5KDOA 1JQJC 2FDAA 1F3OA 1X8LA 1ZSJA 1IXRC 4PANA 1OKKA 4UE7H 4P0TA 3KQNA 1GKYA 5FTNA 5FPSA 4HB0A 2A5AA 3DD2H 1JMOH 4KSCA 4TYQA 1AUJA 2Z43A 3BE4A 3EQ0H 1VDZA 5B30A 2Y7XA 1KI4A 2B8TA 1ZD8A 3LH5A 1L4DA 2ODYB 2NGRA 3VFDA 4A1VA 2DR3A 1IY1A 3BTEE 1XMVA 1J15A 2XTNA 1NFWA 1W7GH 4DWJA 3UNSA 1FQKA 2VF7A 4OS6A 2Z3DA 2RH5A 2PLXA 1A2BA 2FPMA 1KTSB 3AF2A 1LHCH 3ASZA 5DE3A 1LMWB 2I1QA 2WWFA 4RD2A 3VR4A 2J0VA 1EWQA 2G52A 1CT0E 2ZVQX 3PB1E 1XTJA 3C5CA 4DCNA 3AW0A 3TLOA 5G3ZA 4FUDA 4RZ3A 1TX4B 4Q21A 4XFQA 2JJ2A 3SJZA 5C67A 1SLXB 1N8OB 1XXDA 2V7QA 1XCPA 1HAIH 3THXB 2CN0H 4OQMA 3F9FA 3BRWD 1IAUA 5CM8B 2HXYA 4KO8A 2GRJA 2OINA 1VCOA 3U7HB 1RIWC 1E0KA 2Q9CA 4K69A 1K5GA 4PFSA 2BOVA 1QRWA 1TQ6A 5KSYA 4JVLA 2VA8A 1FX0B 3SU2A 2ALVA 1FN8A 2FOEA 2W0SA 1ZVQA 1LNZA 2ZHEH 3A4NA 1A0HB 1SMFE 1E9BA 2P6RA 1AE8H 2IYXA 2ZUCA 3BTME 4HLDA 4IC6A 4JL5A 1S82A 4LRWA 4FCTA 3A1VA 1TMKA 1GWNA 3H0KA 1GBCA 3MI4A 5DHFA 3GD7A 3ENSB 4QGFA 2BD8A 5JI3E 1AHTH 1ELTA 3R8FA 5DP5A 2V6JA 1NMXA 2Q9BA 2C5LA 4NKRA 4OJKA 5E8EH 1YCPH 3GY3A 4RI0A 1W0KA 1E0AA 3H7TA 1T6NA 5JBAS 3X1YA 1AJEA 4DEYA 1UBFA 2QT0A 3IEVA 1GITA 3LV8A 4DT1B 1D6WA 1AKEA 5FTMA 5LPNA 3GY4A 5LPRA 1KNQA 1P62B 2LWIA 1G6HA 4GZMA 3TKLA 3GOVB 1RFNA 5J5CA 2Y5HA 1K1NA 2RGNA 1V2QT 5HGGA 4K1EA 4HI3A 2RCEA 3GFPA 2YINC 4EJSA 2ANBA 2N42A 3P4YA 2BQ6B 3KKNA 2A9KA 2R9VA 5JHGB 1GNQA 1W7XH 3W5JA 3HYRA 1UCYE 2DB3A 2OLKA 4ERNA 1P9UA 4TWYA 2G55A 5CHAB 2A7CA 1C1TA 1TPAE 3PG5A 4JZDH 3K0CC 3I78A 3RDZA 4PC1A 4QBFA 3GLGB 1W36D 1E69A 1Q1BA 4L8GA 1EP6A 5G40A 1C2DA 1E3MA 2ZHQH 4FUFA 2QE7D 5EXNA 5KO2A 5JSZA 2AD1A 3SDZA 2ODPA 1OB5A 4ISNA 5DI3B 1FQJA 1KGDA 1YGCH 2ZCHP 2OESA 3GMTA 1G2LA 5F6MA 5SZKB 3T27A 2NU1E 2QTFA 2VHJA 3SU0A 3ADCA 1DAMA 1GL0E 3CRRA 2F9BH 2IUTA 4DCVA 1E0FD 4X8VH 2P3SA 1G3EA 1NPMA 2WPIS 4DIDA 3F9GA 4QJ5A 1LVYA 1Q44A 1Z8FA 1BDAA 4ABBA 4MQAA 1R8QA 3GY7A 2AIQA 3BEFB 3RXKA 4US0R 4JZEH 2P65A 3LDXH 3LNCA 3W3AA 3X2SA 4HDQB 1CGIE 3IO3A 5FL3A 2X1VA 2NU0E 1S9DA 2AFHE 2HT1A 2FOGA 3PMAB 1KIMA 4JCNA 3NHAA 2J94A 2QEQA 3GJ4A 4PC7A 2OFOA 2A4RA 4J2YB 1KNXA 4PSKA 2JJ1D 3NBYC 4OHVA 5FX5A 1TGBA 1S3SA 4Z1MD 2IS2A 2KJQA 2O8EB 1WF3A 3K0AB 4CBNA 4MYTA 4OYHA 2ORIA 3CF6R 5D3MA 2ZJ5A 1ID5H 1DBSA 1KI8A 1B23P 4RKOB 4AX9H 4ESVA 5FBQB 5LBIA 5F9FA 4O0MA 2ZI3A 5L8VA 2WPDD 1JIMA 2VWNA 1FTNA 2ZTXA 1GRQA 3UQVA 2XJ4A 2QIQA 3L8YA 3WMGA 4W7SA 3ZVCA 3LGIA 3GLFB 3ETLA 1ZW6A 3M7TA 3LX8A 3S7KB 1J2JA 3Q3JB 1AMHA 3V0XA 1OXSC 1RXPA 3EZFA 1Q57A 2H7VA 4PPGA 4NA7A 3OIUA 4YZUA 3AF1A 1TQDA 3SBKA 2GZDA 4NCIA 1C2HA 1CHOF 3GY8A 3VB4A 4AY2A 3OX7U 1SXJE 2YVUA 4WOPA 4XH9B 2F1HA 4CT5A 1US8A 6CHAC 3C16C 1BTYA 4TL7A 4G5QA 3TQFA 1W47A 1VHTA 4IFBA 1T3HA 3SUFA 3BWDD 3QTVH 2R6GA 3D7MA 1KI1A 2ZRLA 1II0A 4UNNA 3A7VA 4DLWA 1NN5A 1ZMJA 4X2VA 1NL3A 1EPTC 1IQHA 1GP2A 3FKSA 1N6NA 1GBEA 5AHGH 1YHNA 1SFIA 4BQSA 3B78A 4Q5IA 1GVNB 3U3MA 1IQIA 3F3YA 5DGJA 2FX6A 1GL9B 2NO1A 3W3ZB 3DKPA 2KBEA 4MNXA 2GHIA 2PW8H 5SGAE 3QN7A 3P8OA 5DH9A 2R0LA 1UKZA 1SGPE 5FOSA 1ZD1A 2F9LA 2AS9A 3HPQA 4Q02A 5FOUA 1DEKA 1WXQA 4BAQB 3B13B 3NDPA 3H1TA 1UBCA 1UTNA 3DT0H 1SGEE 1GKIA 1QRZA 3NHBA 1BIFA 1FNIA 1XRJA 1A1VA 2OD3B 3GDUA 4FU7A 4UONA 2LNCA 3UNRA 1JAIA 1G7TA 1PPEE 4LHXA 4SGBE 4EPTA 2WIBA 2QQEA 1PYTD 3O8BA 2GX4A 1AK2A 1E2DA 2FOHA 2GCHF 4LWZA 2BD4A 2IYSA 4F49A 4PC2A 1DVRA 3J81k 1ZPBA 1RKBA 4NA9H 1CJUC 2AKAB 1VCQA 1G64A 3CRQA 3EASA 1OP2A 2B92A 5DYGA 1P2KA 5FR2A 3B60A 3TK9A 1RTKA 3QZQA 5K8TA 4ZDKA 1N6YA 2BYAX 3L0OA 4OGXA 1DUEA 3EA8A 3NEJA 1NMZA 4DDVA 4ABIA 2X2FA 4AKGA 1CA0B 3OY6U 1WQVH 1K8RA 2TGPZ 1M7GA 1QVRA 1Z1IA 1P60A 2ZF0H 3RXDA 3KB1A 4A0GA 4AFZA 1GNPA 1BIOA 3TGJE 4Y8YA 2OG2A 4OHWA 1KY2A 1THPB 3HGPA 1NY22 4IMQA 1DWCH 1JB1A 3AKCA 1HRTH 2OCBA 1LB1B 2XC5A 2NTYC 2WUCA 1O3IA 4M53A 2C9YA 1Y8TA 1GI4A 1D3QB 1L2TA 1ZM4A 1DY8A 5DP8A 4JLOA 3T62A 2VIVA 3UWIA 1PLLA 5F3WB 3P95A 1DSTA 4FMBB 2QUZA 4IN1A 5TV2A 1Z0AA 1E2NA 2MMCA 4X2WA 1QDEA 2YYZA 2VGCB 1S96A 2ASUB 4KTUA 2AMQA 2RMKA 3AKEA 1QJ1B 3CPHA 1H8DH 1ZOMA 1FX0A 3K0AA 5AUQA 1SKYE 2WWYA 4MRSA 3OY5U 4M1SA 2AK2A 1EAXA 5EE9A 1HPGA 2GCHG 3EIQA 4G0NA 3V7TA 3DKVA 3FOZA 1XEXB 2QMEA 2Y81A 1S1CA 1YLCA 4OK5A 3RS7A 2FFAA 2WAXA 2TGDA 5AFYH 1W36B 2XWAA 1LPGB 4GOJA 3TIFA 2R6FA 1BMFA 3CUEF 4TMTA 4AG5A 4NG9H 1ZC4A 2BQ7B 2FH5B 3SV6A 1FXYA 1G9IE 5JPMH 2J92A 1NRQH 1D9IA 1Y5AT 5J40A 1MO3A 1JR3E 4FCWA 3U6BA 4JZKA 2F3RA 3CF2A 3MU0A 2J9RA 1T91A 4WY3A 5GADl 1ZJKA 1ZBDA 1MTVA 1P04A 3AVOA 5JCZA 3KKPA 4AB8A 3VR5A 3FVQA 2VP5A 1YE8A 4X2YA 4DLYA 2MSCB 2ANMH 1IXSB 2BD2A 1Z6GA 2F55A 1GDQA 2FFHA 1YVDA 1U0LA 4Q9IA 4MVNA 5KDLA 1WSSH 4IBLH 1CHGA 1GOTA 4BLRA 4D0NA 3E1SA 3ZD6A 4MDSA 4K8BA 1GAJA 1F60A 2AEIH 1O35A 1EZXC 2KWIA 2JIZA 3ICQB 3ATMA 4QG7A 1LS1A 4POAA 1WB9A 4GVUA 3U4QB 1Z22A 4AGKA 1EAWA 1AO5A 3ZH9B 1UTKA 1FY8E 4IRUB 1XJQA 2Y82A 4CRCA 3FB4A 2HLDD 5IK2A 1IONA 3KQEA 1ZNYA 4PROA 1KKMA 5KPDA 4NSYA 2XAUA 4GBMA 2P6UA 3OFNA 4MUAA 2R9PA 4BGDA 2V7QD 5JS7A 3LRPA 3TNSA 3CKLA 2ZGCA 4Z0KA 3D65E 2XX3A 4Q1DA 1CEEA 2AIPA 3SZRA 2ZAMA 4TMZA 1O3BA 5DP6A 2ZTYA 3SEAA 2CCKA 2VHQA 4GMDA 5EZ5A 1HV8A 2IK8A 2FZLA 4EFNA 4NCNA 3PXGA 5JYIA 1U8YA 2XBVA 3X1WA 4E22A 5GNDA 4ZI3A 1LY1A 1VIYA 2F1IA 2OC8A 5TCAA 1GNRA 5HZKA 1VG9B 1C5MD 1MTNC 5EU8A 3ZZ9A 2E1RA 4IDHA 1TQ2A 1PQ8A 3MJHA 3RU4D 5JB9S 1XFAA 3WYGA 1T5LA 3ZZAA 2H17A 3GLFA 4PO9A 3L0PA 1HQCA 4TSFA 3GQBA 1ARBA 1XPUA 3KJHA 2XTMA 3M36A 4KAXA 1C4OA 1T8UA 1HJ9A 3ZQJA 3ZZ0A 2J7KA 1HAXB 1CGJE 1KSNA 2V1XA 1G4UR 2ZJ8A 4XWKA 4DCDA 4WXVA 3CH4B 4ABGA 1NBMA 1Y5BT 2Z5FA 1RRGA 4JK5A 4DGJA 2A5IA 1W49A 4KVAA 1CTQA 1FUJA 3T5FH 1FLEE 1UTOA 5TB5A 3ESTA 1J8YF 2IYZA 2QG6A 1QHSA 1HAPH 2O8FB 1NC6A 1T3SA 1KK3A 4L4UA 5KNBA 9ESTA 1TF7A 3MD0A 4B43A 4Q7ZA 1FY4A 1DAGA 2B9LA 1T9HA 2WV5A 3SHCH 5IDVA 4AC9A 4Q4JA 1CBWB 3FWYA 3K8YA 1HJ8A 3GEIA 4UNPA 5E7IA 3M0EA 2XB4A 5B6LA 3SJOA 1P11E 3V9PA 4TYDA 2ZJBA 1G18A 2IJOB 3GDVA 3IQWA 2VU8E 2G51A 3U2QA 1K1OA 2VWOA 1GBIA 1TOMH 2Q0HA 3B9FH 2XOKA 2R62A 4KFSA 1MAYA 1CR1A 1TMBH 3UK6A 3SNCA 1IOZA 2QU8A 4OI0A 5C1UA 1OXTA 1W3CA 1G6OA 1UVPA 1VZQH 1M1YE 1SR5C 2XITA 1V2MT 2WAYA 3QNUA 2ZDAH 2OM2A 2BEKA 3EAJA 1FUKA 2OBLA 4H1UA 2PLFA 3P70B 4MKHA 2QA9E 4AKEA 4QBHA 2ZITA 4I31A 4MRPA 1ZTJA 3RRNA 4LBVA 5GVRA 1JPJA 4ZDIA 1KMHA 3AP1A 3VMFA 4TQ9A 4HZIA 4CRWB 2OQUA 3OYPA 1BMLA 4LBZA 4RD4A 4WXRA 3S69A 4H9GA 4IOLA 1V3XA 4F38A 1EGAA 3H7OA 5T6FA 1THSH 4FCVA 4HYYA 2VF8A 5FBEA 1D9XA 4PAMA 3AV0B 4BLOA 2ZCKP 2BLQA 2O8WA 1E4VA 1FI8A 1FL9A 3ZZ5A 2IF0A 3T29A 2GT7A 2ZM5A 1E9CA 1E32A 3UQOA 3RS0A 3SU4A 2BMGB 5HZHA 2P8OB 1HA3A 2TGTA 1NSTA 3U4QA 2TBSA 5KNCA 3NK8A 2Y7ZA 4ASUA 3CNNA 1DUAA 1UCYH 3W8RA 5A09A 1KAOA 2GAOA 3QPVA 5ESBA 4PSAA 2ZE8A 4DSTA 3RWMB 5FX6A 2FTLE 3URDA 4EPYA 1U8AA 2QN5T 3BIVH 4Q7MB 4OL0A 4C9BA 2O5VA 2FI4E 1XPOA 4AG1A 1BA8B 1TOCB 2V3OH 2N1BA 3B9PA 1HTWA 2A5GA 3A6PC 4NFEA 4V0MA 1EX6A 3B8HA 4QXAA 5L3QB 2H92A 4KKDA 2W83A 3KJEA 3WBJA 2D1JA 3EC1A 1IHTH 2ZJ2A 4C0BA 1RIWB 1C4V2 1N5IA 4BXWA 2GDJA 2QL6A 5BN3A 1V2TT 1TEXA 1IJFA 1ZYOA 1KMHB 3EPLA 3A58B 2NU2E 1ZPZA 4CRFA 4PPNA 1TB6H 2BKEA 1XVMA 2WSSD 3ATKA 2GTPA 3M7QA 2AX4A 3AUXA 3BXZA 4IDQA 4HLUA 5AF9H 4ZMAH 1FZZA 2FMXA 3TSOA 1T4GA 4C0QC 4AWXA 3SQHE 2BM2A 4CDGA 2NOAA 4JMYA 1VMAA 4XBCA 1TBQH 1RW4A 1JNYA 4I99A 2OCYC 4NYIR 3R8CA 1EATA 2BZ6H 3LC5A 3ZZBA 4Z8YA 1A5TA 3VB5A 1VCMA 4CREA 1DX5M 5F8XA 1G36A 4ZPXA 2HV8A 5E2OA 3FFAA 4OS1A 4CEHA 4ZROA 2PGBB 4HAUA 3OEHD 3RLWH 4I7YH 1XJ0A 1QG4A 3VNUA 4G1UC 2ZSFA 3FANA 5BN4A 3RLFA 3T15A 5A0FA 3PUYA 2EWVA 4MGZR 4UXIA 4GL2A 4XOIA 1YZKA 1XMSA 1C2LA 1QFKH 1DWEH 4XDEA 4TMXA 4MUBA 1GJ7B 1O33A 2UZ3A 3E16B 5JRJA 1GCTC 5JEEA 3FMFA 2BDTA 1AKYA 1SKYB 7ESTE 2AK3A 2BIFA 3U44A 2WPDA 3URCA 1E2MA 2I6QA 3GLFE 5J4SA 2PMDA 2Z9KA 4EPRA 4YDSA 1UF9A 1A7SA 3BF6H 1V2VT 5GWZA 2P94A 4A92A 3A86A 4TMWA 4KXFB 1O2OA 1ZU4A 1KTTB 1VPLA 4HZHA 4TT3A 1MO6A 2A3RA 2C78A 3FGNA 2HJGA 3ZV8A 1FPCH 3RXFA 4CIDA 2ZRBA 4I1SA 1SGNE 3NC1C 5FAHA 3QUMP 4I1OA 1P57B 4ZXXH 3V4FA 1UBEA 2ULLA 4JLBA 4DW2U 3HK3B 2GILA 2RHMA 2VVCA 3CLVA 1BTZA 1OS8A 1LHFH 2IN2A 2GXQA 5L2ZH 4I8KA 2EFHB 4HTCH 1PLKA 4U00A 1SGDE 4FUIA 3MU4A 1SXJB 2QP4A 4INHA 2J0UA 4IOMA 4Y11E 2LCFA 3SQXA 4DLZA 2REXB 1V2UT 1BBRK 1V2WT 2J3EA 3VNVA 4YOIA 2ORVA 1AS2A 2VH5R 3TH3H 5E3HA 3RNLA 1XXHE 1KXBA 1H4WA 1Y3VA 3LFUA 2OLGA 3C8UA 1E2HA 3UUZA 3O47A 4DZZA 3A81A 3EZ2A 3PYHA 5A8ZA 3Q7PA 4UKDA 3U8TH 2FEOA 3HR7A 4Q7YA 1JECA 1Z3IX 2IC5A 2BB4A 2ZE5A 2W0MA 4WH8A 2JKHA 5C5NA 5TY0A 2HT6A 3GDSA 5HPYB 3SOSA 3SI4H 1Q31A 2BXTH 1MKWH 2STAE 5JHHB 2ODQA 2NQ2C 3RC8A 4OJQA 1UDXA 1TQ4A 2CLCX 2FXRA 4V0NA 3QO6A 5FTLA 1GBFA 1CHOG 3SJBA 4B2AA 1TNKA 1UK2A 1C5XB 2B0FA 3CR8A 3RXIA 5CJPA 2H57A 1C5ZB 2R44A 2ZCLP 2ZDMA 2SNWA 4CEJA 1TX8A 1NO9H 1E9RA 4M2LA 1SXJA 4A0HA 4DHEA 2RGNC 2IHYA 2OXRA 3LVQE 3U1IB 3SJ9A 2PCJA 5E4FA 3ZVLA 2NPIA 4WZBE 1QRXA 3H86A 1EAIA 3SBEA 1XPRA 2SNVA 2GGVB 2B21A 4BFTA 2OP9A 3BH7A 3M5MA 2BY7X 1S0QA 2O8CA 5HE8A 4K1TA 4X1QU 5HM2A 1LHEH 5B58C 1G7CA 3KQKA 2FWRA 1V2OT 1IAQA 1YPJH 3DO6A 3SHFA 4ABEA 2HYIC 3PENA 1O3OA 2F43B 4BUJA 5E0HA 4XIGS 1AKSB 1YZGA 2PSYA 1CO7E 3K0SA 4ABJA 2ZYWX 621PA 1QIXB 2A2XH 3WMFA 1ZJDA 3WY8A 4NBSA 4L9SA 5KDDA 3EXAA 2BC9A 1NJFA 1FQ3A 1GHVH 3BGWA 1MQ6A 2ORWA 4YMWA 1YZUA 1DAIA 1XZPA 1O3DA 1G41A 3UXMA 4DLVA 3I5XA 1NU7B 1TX6A 2ZETA 3EWSA 6LPRA 3FKSD 1QA7A 4LJ8A 1FMJA 2H9HA 2ILNA 2QGNA 1P75A 4UNQA 1C9PA 3VKWA 4ZKEA 3CRMA 3PLPA 2EQBA 1B5GH 2JLRA 2CJIA 2D74A 3P32A 2ZRHA 4PO8A 4LGMA 1ZU5A 1D2NA 1CS4C 3SU1A 2UUKB 4TLCA 4A0FA 2H2ZA 2WICA 4O3TA 2BCJQ 1MU6B 1I4TD 5KHOC 1Z6JH 4CHAB 4X8MA 3A8BA 3E6PH 3KL4A 3H09A 3W6OA 2HEIA 1Q21A 3T5GA 1TNJA 2H18A 3QPUA 3MOCA 3D49H 4Q4LA 1BBRH 2ODNA 1S6HA 2UWLA 1C9TA 3SYKA 1O3NA 4DIIH 2JLZA 1SGRE 2C3SA 4CRAA 2QROA 2CHVA 3SJ8A 3I1FA 1FTSA 1L7VC 1W1WA 3L33A 4ESTE 2NIPA 4EIWA 2GEVA 3C15C 1KZGB 2W58A 4CZ2A 1X1SA 4D0GA 2FMJA 2GNOA 3LDAA 4AYVB 3KQDA 3B1XA 3GEEA 3VB6A 2WTUA 1DY9A 4OS2A 1C5OH 1LDTT 1O5BB 3OIVA 4I8HA 3P27A 2PL3A 3THXA 4LK4A 1K6MA 1RIFA 2W00A 4GAWA 2JJ1A 1G21E 4WMDA 3Q85A 2QBYA 4U5XA 2ZFTA 2C77A 1WBGB 4AFSA 3VTKA 3SQWA 3X1ZA 3MWIU 3PMJA 3PEUA 1UTMA 1PVOA 2GVZC 3RP2A 2RAPA 1O2ZA 5T3HA 1KYIA 2IYTA 1CJKC 3M1IA 3I72A 2WPJS 1BTHH 4RD3A 1P5ZB 3RS3A 4ISOA 2ZS9A 5JFGA 1EPTA 1P2UA 2RA3A 1O2KA 1WQSA 3C4JA 4A8JA 4CVNA 2HWLB 3PIRA 4HLCA 5T6GA 2HRVA 2CNWA 3SV7A 2VGCC 4NZYA 1X3SA 4J1YA 1R2QA 2BMJA 2ZRIA 4Q66C 3P20A 1RRPA 1G8FA 1NF3A 4Y0YE 2P0EA 1E1RA 2PEZA 2A2ZA 2MMGA 1GHAG 2FODA 4PAOA 2UUYA 3B9QA 1QL7A 2WM9B 2IWRA 2FOLA 4E05H 1G3UA 2ZU5A 3UMRA 1SBWA 3QWCH 3VXEH 2WJVA 1JR6A 1D2MA 2XNDD 1N6RA 2PKSB 2M5TA 1W5SA 2QRZA 4KCGA 4N0DA 1ACBE 1YR6A 1XTIA 2AXPA 2WJHA 4B2LA 1F6BA 2ZGXH 3LWNA 1C5RA 1DANH 3BH6A 4YXWA 1GBKA 3U7EB 8KME2 1T8NA 2XNIA 2YJTD 4OI4A 2BLVA 1COWD 2ZQ1A 4KLNA 1ZM7A 1BMFD 1C5LH 1UPTA 2CHGA 2CMYA 2Z3CA 3M5NA 3V3MA 4ZIRA 1YR9A 3SJIA 1W0KD 1Y3UA 3CX7A 1MT0A 2FFBA 3KXKA 1B0FA 1S2MA 1W36C 3RXGA 3A4MA 4Q4AB 1IM2A 4KODA 2RGGA 1AN1E 2Y5GA 1O31A 2GXUA 4ZKNU 3BAFA 1DVAH 1BZXE 4X6OA 2G5NA 3NH9A 3FTQA 4RCYA 2HCBA 1A4RA 3GLIA 3IHLA 2XSZD 3SHWA 1GMCF 4NFFA 4JLNA 4IOKA 1TPSA 3W5IA 3DFJA 2QN6A 2D3WA 2ZU4A 1C1WH 2ZDVH 2EI7A 3EPKA 3VPKA 1NN1A 4JLDA 4Q9LA 3ODDA 3SI7A 4QT8C 4Q4HA 3TK5A 5SZIA 4YESB 1NFUA 2ZJAA 1BB0B 2IUUA 1LQEA 2WPMS 2AR7A 2BD7A 5FPTA 2RKOA 1Z0KA 1ZRKA 1AM4D 2HPPH 1US8B 1P4SA 2O8BA 1Z28A 2GCOA 5J4YA 1GBBA 3KF2A 1GVZA 4IDOA 3A37A 5FBVB 5C2JB 3GLIE 3FHCB 3AGQA 3I29A 4UFFH 3A7TA 4WVPE 1O0DH 2WWHA 1HJAC 1FOEB 4NPHA 3I8XA 2XTZA 5LB2A 1Z1JA 1Z07A 1GG2A 1BMAA 1CT2E 4IVQA 1QHIA 4I32A 4Q7JB 2CHAC 1E2QA 1GFIA 4I1UA 1JBUH 2ZYUX 1EASA 1AVWA 5IF9A 2Z7FE 3EA0A 5EXXA 4BTTB 1G2MA 4IJMA 4IXMA 2J1LA 2FYQA 1O2NA 2PUXB 1E4YA 3ZVGA 3EPHA 2AH4X 5AUNB 1FIZA 1TBRH 2BQWB 1MABB 3AW1A 5EQTA 2QGZA 1OKXA 5A4JA 3GY5A 1RGQA 1UEIA 1GZSA 2IEZA 1ZM2A 2BJVA 1IQPA 5JSZB 4NONA 1W12U 1A3EH 5HKKA 5F8TA 4I81A 1KDQA 4Q9KA 2CLSA 2QC2A 3PEWA 2A30A 3CWQA 4K8YA 4MYCA 3EARA 2BDGA 2JGNA 1UVSH 3WYFA 3P1JA 2O0HA 1VCWA 1G7SA 1EB1H 3A7WA 1OT3A 5B57C 4WW0A 4GP6A 3JVUA 1HEIA 2VP6A 2F91A 3HU3A 4M1TA 4K3JA 1GBMA 3ZZTA 3FDIA 5TARA 1DO0A 1YCPK 2GEDA 5EP4A 4FWTA 3E5HA 3KX2A 3LGVA 1K2I1 5C1YA 4HAVA 3GLHB 4HUQB 5AJXA 2H5DA 2XBYA 4ZCLA 1SB1H 1TNHA 1V43A 2W7SA 1O2UA 2RHDA 1WCV1 1TA6A 1JOUB 4LZ1H 1YR7A 2WYJA 4FUCA 2W2XA 2OV2A 1IY0A 3B23B 1K5DA 7LPRA 3U1JB 1YR8A 4ZXYH 1WXRA 1Q3HA 4FW9A 3QZRA 2FN4A 1TAGA 5GJCA 2C8ZB 2WV4A 2QENA 3L43A 3B7GA 2C96A 5C1BA 5FPYA 1DXWA 1GI2A 1GIAA 3LBHA 3VHXA 2OXCA 3PROA 4DC9A 1CBWC 2HNTE 1YPGH 1OH8A 1EB2A 3ZZCA 3SUGA 4INLA 5K7RA 1ZUIA 1TADA 3DZDA 5H4IB 3STJA 1O30A 4OQNA 4CT4B 3RAPR 2YWEA 2XNDA 2QXJA 3H5CB 2HXSA 4C0HA 4TYYA 4YQFA 4L9WA 4DCSA 3M3VA 3U60B 1CBUA 3EX7C 5DPAA 1YKSA 4H4FA 4R2HA 3PUZA 4NU0A 1XF9A 2GEUA 3IO5A 3TJOA 2OCAA 2G9NA 2E87A 2O8BB 4NCJA 1TNDA 3Q9LA 4EUNA 4F4OC 1ZIPA 3KXIA 4YOGA 4D80A 3FZZA 3NKVA 2F83A 1NVUQ 5K8LA 4D4MA 3I5YA 1P9NA 2ZREA 1G3QA 1WDTA 3UIRA 4CEJB 3U3KA 1HT2E 4CW7A 1E9FA 3OIYA 1ANEA 4EFMA 2GBLA 2XW9A 3QKTA 2A7HA 4EJSC 2EU8A 4JLMA 5FTJA 3T35A 2QY0B 2REBA 1S8FA 1NY5A 4TL8A 4HZUB 2WWXA 4LYJA 4MRNA 1GBLA 2GK6A 4M9XA 2CK3D 1ELGA 3NXSA 5AWFC 5BYJA 3ZZ8A 2IW3A 5BWMA 1NIJA 2C98A 3GJ5A 4D6PA 3OFND 4WVFA 1O3HA 2NZJA 4XJXA 1S84A 1IQFA 2VVUA 3KHVA 5G41A 3UFAA 1GHZA 4IMZA 4LDJA 3VEQB 2REOA 1S1MA 1XMJA 4HB3A 1XMIA 2QSYA 1PV4A 3OF5A 1EJMA 1QHHA 2FYRA 1ZGVA 3I73A 1YC0A 2QM8A 2O52A 3FFGA 4RZ2A 2VYFA 1VGCC 1VJAU 1DS6A 1BT7A 1LHGH 5JWOA 1T8OA 1FONA 1UTPA 3BN9A 4O03A 3NBZC 1KJYA 4Q1CA 4U01A 3R9IA 1F5RA 2OBQA 4DLSA 1R0YA 1SQ5A 1SLUB 1H1BA 4OHZA 3TK6A 2BVSH 3A7ZA 2W5EA 2VBCA 3LH1A 4QL3A 1XUKA 1LHDH 1W0YH 1TIOA 3UOPA 2HYDA 1NNEA 1TU4A 2AD5A 1OLOA 5DI9A 3MU1A 4V0OA 3U8OH 3BERA 2VIWA 5CE1A 3TJZA 1T3LA 4LYHA 4FXPA 1KZ7B 4EQ6A 1AVXA 4AGJA 1G291 2H1LA 1O3JA 1VIAA 3QE0A 3RXJA 3UPUA 3BTFE 4NH0A 3BG4B 2C8XB 2ANYA 2V55B 1ELOA 3M3TA 1WA5A 3QK1A 1KO7A 4B2IA 4QNMA 1DAHA 1MTSA 1ESNA 1TMTH 2AFIE 2WWIA 2FF7A 1F48A 3PUWA 4DEXA 2BVXH 4C0KA 2R3YA 3PV5A 3IQXA 2AERH 2Y6TA 2EC9H 1LFDB 1N6OA 1XUHA 3TNTA 3G5UA 2X8AA 4FVBA 2O8UA 4TPYA 1JAHA 4Q4AA 3SW2B 1XCGB 4HAWA 2P95A 1DT2A 3HU1A 1PPBH 3U3OA 1L1GA 2FSFA 3K6ZA 1GMDF 4JBWA 4BFSA 1R0ZA 3RC3A 1GRNA 2QF0A 4JT4A 1GWAA 1AIXH 2B8OH 3W6NA 2O8DA 3LJOA 3EG5A 3SN8A 2BOKA 1XP8A 2NZ8A 3QXCA 3TRFA 4R98A 2J45A 2Z4SA 4A7IB 2CXVA 4IC5A 2DCUA 4B73A 1UK4A 4BZXA 1LQDB 1L4YA 2WINI 1LCYA 2EYUA 4KYIB 3FYHA 3VGCB 2R6CA 4MKFA 1CIPA 4HZUA 4DY7B 2QXIA 1GPZA 4TYWA 4O2LA 5FR1A 2ZRMA 1R4AA 4ITRC 4LJ5A 1Q0UA 1QBOA 3IEUA 1MR3F 5L3SA 3SNHA 1CKEA 1KY9A 1SFQB 3TH2H 1MRNA 1PPZA 2A0QB 3ZVEA 4MPWA 3A84A 4AYWA 2W3KA 5E7JA 4F92B 2ATXA 2W6JD 3PV2A 2FPLA 4G5OA 1MQ5A 4ZH8A 1AFQB 3EZ6A 4MDEA 5K0HA 5B64A 2H9TH 4IOJA 2PJRA 1Q3TA 2ZU1A 2CVFA 3FPAA 3RC4A 5FI0B 2CBZA 2QPOA 1TGTA 2OTVA 5T1VA 3UANA 1ZNXA 4LHZA 1T5IA 1W2GA 1MZAA 4LY6A 4FN5A 4RFSA 1CR2A 2TGAA 3M5OA 2Q6TA 4XOJA 1GMDG 1EKBB 4TLAA 2FV8A 1QB6A 2C9OA 3ZVRA 5ESTE 2QTVB 2ZU0C 2PKAA 1MTWA 1P2OA 421PA 4OQFA 1C1UH 1NRNH 1D5CA 1GJBB 5L6NH 1N5KA 1O3GA 2P5TB 1IQGA 3C27B 3MLEA 4JS0A 4A5TS 2OAQ1 4ZV4A 5DGXA 2PV9B 2RDLA 2C2HA 1LKBA 1ZLRA 4JLVA 1Z2AA 3D6TB 1JEDA 3OESA 3MMGA 1UKYA 4C7OB 3JZAA 1UJ1A 5G4BA 2Q3MA 5DYIA 1DG3A 5LGOA 1P2NA 3R9XA 1MD8A 1SGTA 4J0QA 1BOQA 3BB4A 1JXPA 4BE7B 1DAKA 1LTOA 1K1PA 1J17T 3DA9B 1H8HD 4A0RA 4AFQA 5FPHA 3FHTA 1U6QA 2R65A 2P3UB 4A2WA 1I2MA 1XTQA 4RZXA 1P9SA 3IILA 4AI6A 2PEYA 4DT1A 3K9LA 3OTPA 5CYOA 1O2XA 4LJYA 1UDWA 1T32A 4FMDF 3RXPA 1Z83A 1UHBB 2FNAA 3ZQ6A 4GSOA 2ZQ2A 1ZUNB 3NC0C 1HBTH 4ABYA 5C3NA 1M6NA 4Q1AA 3PWBA 5DO9A 1DLEA 3HPRA 3ZVNA 4B34A 2PX3A 2BDYA 1Q20A 4D7FA 2OO7A 1W4RA 5FBIA 1OV4A 2ZR7A 4NIWA 4DCTA 3Q77A 3K1JA 4P32A 4C0LA 2G1JA 5J47A 3TQCA 1MO5A 5LB4A 1JJVA 1KKLA 2G3YA 3RMOH 3I32A 3PITA 3WHKA 4W5HA 2QMUA 5JZVA 1JALA 1OWKA 1D8TA 3ZZ7A 1SOTA 4QM6A 3GICB 4CH2B 5D3MB 4QGHA 1OPXA 1X6VA 1QL8A 4KSBA 1ESTA 1O2MA 4BFYA 3FKQA 4U02A 1P9RA 4OS7A 1TU3A 3AQ4A 1OSSA 3RHFA 3GCHB 2J4IA 3CWZA 1Q1ZA 2JLSA 1CSOE 2DFNA 1GDUA 2OBMA 4ACBA 1N6KA 1NN3A 4LCBA 1TNGA 3SOPA 4JIMA 3BC1A 2ONJA 3LH3A 4Y6DA 4YC7A 3RRMA 3ZYEA 4Q4JB 4XVUA 2JLQA 2FP7B 3QUSA 3RXAA 1W10U 4WMEA 1A7JA 2BVNA 3SFVA 4ZKSU 1XX9A 1WBDA 1OWHA 5EQRA 2GZHA 3WP1B 1FY1A 4U7DA 2CL6X 3T06B 3V4RA 3LOXA 1C1YA 2G4UA 3RC6A 1GJ6A 4Q2KA 1KXAA 1YYY1 5E0GA 1E9SA 2ZFPH 1Q3XA 4ISHH 4PXAA 1I2DA 4MPVA 3TUIC 3HK6B 3MG9A 4C0SA 1TF5A 1J14A 5DO4H 3BH0A 1C1MA 3SORA 5GJWC 3BK7A 3OZXA 4OK6A 2QAJA 4F91B 1SXJC 1W0JA 4JYTA 1GBDA 1P05A 1FPHH 2QM7A 3PR1A 1GJ8B 3N2EA 4AURA 1UVTH 4MQBA 3A4LA 4BECA 3DL0A 3UWJH 1IN8A 4WWYA 2UVQA 4F7WA 1RJ9A 2ZRGA 3ZJYA 4JLJA 4MKGA 4QBIA 4HGCA 3ZVFA 5F8ZA 2VHTA 1LTQA 4LUCA 1SVOA 5I25A 3DMNA 4M1YA 1Z8IB 1DICA 1GL1A 3BB3A 4INKA 1KI2A 2VINA 2IHBA 1UTQA 5FBRB 2BLWA 1OFIA 1TNLA 2HNTF 2R6DA 3TGIE 3HDTA 2IYLD 1O2LA 1HV7A 4YXWD 2C99A 2ZEBA 3F1SB 4PHGA 2IUSA 1S0RA 1HIAB 5KSPA 4A2PA 4ASUD 2O8CB 2PWXA 2DWQA 3BV9B 3SU8A 1HJAB 4GPGA 3SGBE 721PA 4BPBA 5EJEA 1JIRA 2GVFA 3KXLA 3LBNA 1EZQA 1JR3A 2R8RA 1O2HA 5JEDA 4M0LA 3LD9A 1V2ST 4DUGA 2BDCA 1IQJA 3B82A 3L3TA 4KU4A 2OUKA 1E34B 1Y3XA 1CE5A 3ZDQA 1MKXH 2J0UB 1SSXA 1NIPA 2F3TA 4MH0R 1AWFH 1R6BX 3ZVDA 3TUZC 3A83A 2BD3A 1AUTC 3B1ZA 1J70A 2Z9LA 1G5TA 3VKGA 1YZLA 1RC8A 3K0CA 1Z6AA 3KJGA 1K1IA 4A2QA 4XBBA 1GHWH 2OHFA 1MZDA 3ICEA 3ODFA 1SGFG 2SGEE 3F5FA 4HEJA 2OC0A 3RM0H 3NBFA 4PX9A 4NIVA 4NZQA 3KJIA 3Q00A 1ORFA 2WKRA 4O3MA 1A5HA 3U98H 1C1SA 1U90A 5E7MA 3AVXA 3M3SA 3I61A 4F4IA 1KDQB 3TLXA 2FLRH 1D6RA 3KKQA 2IOTA 2ZS7A 3K6YA 3LQQA 4B71A 3PCRB 4FMCF 1BQYA 1SHHB 1LS6A 1BTXA 3PVSA 1SVIA 3MSXA 2YNMA 2C8WB 3B1YA 1V2JT 1KDPA 1P2JA 3S9CA 3KUCA 5J4QA 1U98A 1ZJ6A 1T8MA 1ELEE 2ZEJA 3PEVA 3BTDE 3UWOA 1W2HA 4HB4A 5DP7A 3CBQA 2DUCA 5AK0A 3AEZA 2QSZA 4FMDB 2JETC 2QZ4A 1P0SH 1GRRA 2ONKA 3QLPH 2OXSA 4GPTA 4TWZA 1F5NA 1KXEA 3WNCA 4FXGH 4BAMB 3I8SA 1AS3A 2R2WU 3E90B 1W5TA 1D3DB 2OFWA 1QJ6B 1ZIOA 2QP3A 4XSHA 1ETSH 2GVDC 3MWKA 4JT2A 2J0SA 1XEFA 3K0FA 1O2TA 2CF8H 5KSZA 1ZHMA 3K9HA 1C5VA 1CT4E 1C4Y2 3G82C 4LJ7A 3KNXA 4G5GA 2SGDE 1QB1A 3TMKA 1N8OC 1GSIA 2ZJYA 4CGZA 4CRBA 2ZI2H 4F4JA 4BFXA 1FV9A 1J16A 1K22H 1A46H 3VR2A 1OX1A 2IPHA 3QEJA 3TK1A 3T61A 4DRZA 1VCIA 3M61U 1XDBA 1MH0A 2H1UA 1MTNB 3AVUA 4DLUA 2HGTH 1VG0B 3FP8E 2ANKH 4ARZB 1W4BA 2W6JA 1MD7A 4UXJA 1E98A 4G5SA 1YF4A 2IL1A 5BN5A 5C1XA 5BRRE 1YZTA 2F9UA 3E2IA 1G3DA 3A88A 4L16A 3WNBA 3L82B 4RVCA 3JZ1B 1C5PA 3Q3YA 1EK0A 3RMLH 2RA0A 1FY3A 2D62A 1Z71A 3B1VA 4F93B 3REGA 2OQ5A 2EFEB 2WUBA 2QAGA 1QB9A 5IK2D 4ZO4A 1E2EA 4WA7A 4LHYA 2OT3B 1F5LA 1NMYA 4NIXA 1ELVA 3K09C 2H9EH 1ZNZA 2F6RA 3AKYA 5AJYA 2FO9A 1DELA 3UATA 5HYOA 1WV7H 4X6NA 1W46A 2VO1A 1IY2A 2JH5D 3E70C 4GDFA 2QXGA 5C4GB 1O3AA 1F0TA 4WZ6A 4GMXA 1M2OB 1XKBC 2FEMA 5CLQA 4A6PA 2HPQH
chains in the Genus database with same CATH superfamily
2JFQA 5IYTA 1E1MA 1U9IA 3CWCA 3IQFA 4F7DA 2MR5A 1RLJA 5EW2H 1E38B 5IJ9A 3W5AA 4FUJA 4HH0A 3TI9A 1SCQA 3ZNOA 1NX9A 4N5NA 4RQBA 1Z2NX 1HF3A 4TLLB 2XZLA 1DOZA 1TABE 2OZVA 5L6MB 3GJ6A 5ALXA 3KTFA 1GG6C 1YPKH 4R1QA 3KZ1E 1G2QA 2ZBRA 3FMIA 2OKCA 1JKMA 4HB2A 4FFPA 4BMSA 4QXPA 5LNK1 2QV7A 2WFLB 2ZDHA 3F6RA 1JKFA 3RU3A 3TZBA 4J4BA 4BLOA 5IZ4A 1HX7A 2XOXA 1QHHB 1XQ6A 3L77A 4JASB 4YONB 1WETA 1SXIA 5ETJA 5KAPA 1P1IA 4AK9A 1L7OA 1GQRA 5FWXA 1VL6A 4Q3KA 5F2OA 5CFMA 1J22A 5AW4A 1MIOA 4F2PA 5IT9A 2HJWA 3H4TA 3TIIA 1S85A 1VM6A 1LDEA 4DA4A 1IEQA 1UM9A 3V13A 4BU0A 4EM6A 2VJAA 1EVJA 1N1GA 2FOIA 5BWLA 4FDLA 2YKGA 1H6BA 1A82A 3AUKA 2GFQA 1P2DA 3MH6A 2O1SA 3C1OA 2EL9A 2FZ5A 3JZMA 1MV8A 3RSFA 2B4AA 1Z0SA 2J3HA 5ILGA 2O2EA 2XGJA 3BWCA 2C8KA 4AT1A 2NXJA 5CHYA 5CFRA 4CH8B 1OYWA 2P9QA 1FDSA 1G4AE 3D7KA 1L4KA 4RHYA 5GM2A 5EJEA 1D3TB 1ZUNA 3G5AA 4W1QA 3TTVA 3SSAA 3VGCC 2QTCA 1AGRA 1TGCA 1NLUA 2AI3A 2HHCA 3FSEA 4RNDB 4YJ2B 4D0RA 4YHHB 2W42A 6GCHG 3FIUA 1V6DA 2R8OA 1Z17A 2QVXX 2VCYA 3OLYA 4CR8A 4JK6A 3DFZA 1ZINA 3A8TA 4FQ8A 3RS9A 5EJ9A 2SHKA 1U2DA 221PA 3DOEA 2A57A 3VKFA 2HRRA 1F1JA 4L5AA 1WZ2A 1PJSA 3QWAA 1MQ8B 3PUXA 3SHTA 3MT7A 4Q12A 4YAEA 5AK6A 1MG0A 4YRAA 1BVHA 3CLTD 1GUZA 3WQRA 2BV3A 1BQ4A 1X92A 4G84A 5A1TA 1O3EA 4WERA 3Q76A 5IF3A 3IBYA 4DNFA 3HKEB 2FRVA 4KHZA 2JATA 3RYFB 2MCFA 1GGVA 3KAPA 1MAAA 2OGUA 3CEHA 1CY4A 3G8DA 3ZVKA 3PWCA 1MIOB 3K4PA 2P7IA 3A27A 4AG6A 2FETA 4YXFA 5CHAC 2H59A 5AW9A 1GG8A 3E9EA 3TAXA 3P26A 2R79A 5DW3A 2SKEA 4YWHA 4BBPA 3SBXA 5BSWA 1XXFA 5IXJA 1F12A 1RE1A 2EZUA 5CVUA 5JASA 3TPIZ 5BSTA 1X8XA 1HDEA 3RJ9A 1EVYA 4RY9A 1FMTA 1ODTC 2ADMA 1OKKD 1YVEI 4GM1A 4C21A 3OCUA 1SQSA 4AJHA 3RXTA 1ZNWA 4PX2A 1RAGA 1O2WA 1N6IA 2HDNB 2Q99A 1MA0A 4QPDA 1TRNA 5IYZF 4X66B 1RVDA 3VPHA 2NYUA 1JR2A 1BZYA 3K0FB 4CF4A 5DP2A 4CKWA 1I1OA 3VX4A 1NSYA 4PW0A 1CV2A 1KO8A 4NFSA 5J5AA 3U3RA 3ZHZA 2ZYVX 3LQKA 1ESBA 2VQDA 3RVBA 1E89A 4HDKB 4ALMA 1W59A 1S6FA 1H5NA 2C84A 4BLSA 4JP8A 5KSOA 3HK2A 3QYPA 5H02A 5JDCA 1QBGA 2C2YA 2NTEA 2VDLB 1GI7B 1NP3A 5H70A 2PJUA 4FUHA 4WLVA 3RFVA 4EENA 3ERCA 3TR0A 2C90B 3JASB 1FBTA 1NVVR 1UJCA 3KN2A 2BM1A 3LC3A 4MTCA 2WE7A 5IEBA 1IL0A 3HVHA 2HMSA 4B82A 4TS4A 5A4MS 1L9KA 2FMFA 1NXTA 3TE7A 2QXHA 4ZQGA 2CHEA