4B75A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
total genus 208
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b75A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b75A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b75A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b75A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b75A03
3EG5A 2NZ8A 2AGEX 4XFQA 2JATA 1MRNA 3TK6A 2RH5A 2A5JA 3A36A 4V02A 1JJVA 1NNEA 2QYIA 5JB9S 1SPJA 1DUEA 1AD8H 4IVQA 5KSYA 5HTKA 4AURA 1FIWA 3AH8A 4CZ2A 5EE1A 5GJ4B 1FOEB 1ZM4A 3GLHE 2ZHDA 1ARCA 1I4LD 1SGPE 4TLEA 1TU4A 1NRPH 5EPYA 4B2BA 4S35A 2QXGA 1EP6A 3PG5A 3VMFA 1SLXB 3K09C 2QL6A 2A5IA 4UXJA 2WWGA 2ZS8A 3IITA 3M6AA 4TTPA 1BMMH 4Z51A 4EFMA 4E03A 4MUAA 1E9AA 2ZPQA 1P5ZB 4XVRA 1VPLA 2VO1A 1Z8FA 1BOQA 1S2MA 5BXQC 2R2MB 2VP2A 1KSGA 1XCPA 2CF9H 2V3CC 2UWLA 1M8PA 2GV7A 2ZFTA 1DARA 2XZOA 1FFHA 2EFGA 4CRDA 4RD4A 2QP3A 5AFYH 1GMHG 3TUIC 3M3SA 1DUAA 1GHVH 3LC3A 2Q9BA 1QJ7B 4U32A 4FWTA 1Z6TA 2V0BA 3SOSA 2RDLA 6GCHG 2H57A 2ZEBA 4IMZA 1O2HA 1TNIA 3TLXA 3B1WA 1OXTA 2PR3A 1GI3A 4LJ9A 1JRTA 1PJRA 1TF2A 4JLBA 5LPRA 3EPKA 2W0SA 1C5UA 5FH9A 3OIYA 1OKKA 4KP0A 1IAUA 5A2MH 1C1SA 1PZNA 3RHFA 3S7KB 1L8QA 5TJXA 5B6OA 1D3DB 3R3GB 4UEHH 1NIJA 1EFCA 3U7EB 3BC1A 3HU1A 1RJXB 4MTBA 2SGAA 3LGIA 4QRHA 4DG4A 1WOFA 1YF4A 3SI3H 1YPLH 1MRSA 3CP7A 2BD2A 1MKXK 2BD9A 2ERXA 2C9CA 1CR0A 4G0NA 4L9SA 1G3RA 3OFND 2WV4A 5J4YA 1A2CH 4HLUC 2KI5A 4DSTA 4MYHA 1XU4A 4PPGA 1J17T 4IC5A 1M7HA 3MU0A 2BJWA 2O8EA 3MU4A 1SXJA 1MQ5A 4ZAEA 3T5GA 3TW4A 4TYYA 4JVSB 4JLPA 4RZXA 2A0QB 3ADBA 2VP5A 3BFVA 2O8UA 1NY5A 3KQHA 2PEZA 1GBMA 3QXJA 1PPCE 3ENSB 2WUCA 1O3OA 4ABJA 2W2XA 3EA8A 1GOTA 1A0HB 2OXSA 2XC5A 3KTAA 2FOEA 2BD5A 2MMGA 2X2FA 1G36A 3ZZ8A 4AFQA 1Q1BA 1Q57A 3NEYA 1PYTD 1O2ZA 3K2UA 1O36A 4X8TH 3U5ZB 2QCYA 4TMVA 3KQDA 1C5YB 3ICEA 2KBFA 2FNAA 4ZHAA 1WUNH 1ACBE 1XXHA 4LYFA 3RABA 1GG2A 3P92A 5FOSA 1N6IA 1UHBB 4HB4A 1YJ5A 3MWYW 2BDHA 1KNXA 2AK2A 1C1YA 1O5FH 2XNDD 5HCIA 1AZZA 4M2LA 2EQBA 5DHAA 4GHTA 2ZC9H 2GJSA 1Q44A 2XXLA 4MGKR 2J0SA 2FX3A 4F38A 4GOJA 1K28D 1PJPA 1J90A 1MBMA 2BQWB 5F3WB 4BAMB 4ESTE 3CH4B 4UNSA 2J4IA 1O2WA 1W0KA 2SHKA 2WSSD 3SE0A 4OJQA 3I72A 2OBQA 4YMVA 2A5AA 4KFTA 3BRWD 3TH2H 4TT3D 4BFWA 1G32B 2GESA 4G5QA 1EP5A 1CT4E 2BMGB 5AJYA 3GDUA 1XTJA 3HYRA 1DSUA 1S84A 1D9IA 1AHTH 1EPTC 5FBLB 2ECKA 1FUJA 5DYIA 4PSAA 2ZFSA 2HJVA 2J46A 2ZCKP 3Q3KA 4YMTA 2YV5A 3C14C 4MRSA 2HXSA 2VEDA 3BTFE 2BQ6B 5KSOA 4FCWA 3GCOA 4MNYA 2PTCE 1BDAA 1P05A 2OHFA 4Q7ZA 2J59A 1DWDH 1E2FA 4O3TA 2C4FH 5T1VA 4FXGH 3EWSA 2D2FA 3LXRA 1B23P 3B1VA 3GICB 2MSCB 3QG1A 1O0DH 4DSUA 5FHTA 3WHLA 1AI8H 1FPCH 4KSBA 4PAMA 4B3CA 2ONJA 1ZHMA 3ASYA 4I31A 4PC1A 4BZXA 3DVLA 4F92B 1KOFA 4RD6A 2PZEA 3O8RA 1XVOA 1NFWA 2FTLE 3U44A 5CM9C 5B58C 5FI1B 1WQVH 1MAYA 1CA8B 1ANEA 2RGXA 2ZTYA 1MZAA 1FY1A 3IWMA 3KIDU 1CGJE 1ZRKA 3AM1A 3B9PA 2ZREA 1RTKA 5KOYA 1ZOMA 4Y0YE 2G5NA 4A5TS 1P61B 1ETRH 1Y5UT 3WRXC 4KFSA 4DOQA 3BSQA 3SORA 5DP3A 4DT1A 3W95A 2B21A 4NBSA 2OEPA 4IMQA 5JWHA 5TY0A 4A9AA 5FAHA 2GX4A 4UNQA 1MD8A 4Q1CA 3RXCA 3UK6A 1D4PB 1LHCH 3Q72A 2A4OA 2ZSEA 4LJAA 1MKWK 1NRJB 1NC6A 4BE7B 2AKAB 4JMPA 2A78A 1YPMH 4NIWA 1J2JA 3R9IA 4LV8B 3VB7A 5JZVA 2G5VA 3SGAE 3UG7A 4ZMAH 1JAIA 3A86A 4BLQA 4HAUA 1ODFA 2HALA 3ZIAD 2ANBA 2V3OH 4QBHA 4BRWA 1AZ8A 3RLWH 3UOPA 4PSKA 2Q6GA 1HE8B 3PCRB 1OXXK 1YPHC 3SZNA 4JZKA 2BDCA 3JZ1B 2CK3D 1SZPA 3X1ZA 7ESTE 1EFUA 3TR5A 2AIQA 2XC4A 2WOJA 1C9PA 4A0GA 3K0FA 3DDCA 1XD2B 3GLHB 4US2R 1GRRA 1C4OA 4NONA 1DG3A 4BANB 5AR1A 1MU6B 3GYMA 1RPZA 5EGMA 5EE9A 1IN4A 2H5DA 2GZDA 3VB3A 2ZANA 4POAA 1HJ8A 1ZUIA 1O3MA 3ATIA 4R9UC 1P9RA 2YINC 1G30B 3PUYA 4D81A 3QPVA 3C5CA 1F3OA 1P03A 2QN5T 2ZRFA 4AFSA 3SJKA 5L6NH 5GJCA 4MPVA 1VCMA 2JDIA 2QV1A 2CMKA 4ZKDA 2ZO3H 3UNRA 4RY2A 3TK1A 5CIWA 1KXCA 3LRPA 2XXAA 4BASA 3LV8A 4X2YA 2A2ZA 5IHPA 2PLRA 1ID5H 1JEDA 4LCBA 8GCHF 2BDYA 1O2RA 1F48A 3KQNA 2WPMS 3GISB 5L2YH 5AF9H 1J7KA 2CCJA 3THXA 1TE0A 3RRYA 2QM8A 3LXXA 2WSMA 4XOJA 1ESNA 2Y5GA 4B76A 1EGAA 1Z0AA 1P3CA 3FHOA 4OQXA 4EIWA 1TWXB 1J8MF 3HK3B 5E8EH 1HQYE 5C1UA 4HUQB 2HLDD 5DNYB 4EJSB 2R6AA 1A3BH 1GPZA 4Q9HA 2XXAB 4MKHA 3QGNB 2OAQ1 2QM7A 1KI6B 3GFTA 3T12A 2OT3B 1OYYA 5J40A 3RWMB 3M35A 2FE4A 2YNMA 1P2KA 4HAXA 2PKSC 1RIWC 3WP0A 5FL7D 1VYUA 4ZV4A 2NTYC 4IEEA 4ZXYH 2VHUA 1G6HA 1BRAA 5B2ZA 3BGWA 4DLWA 2FO9A 3RM0H 1GMDG 1AKEA 4KXFB 3WP1B 3PLBA 3U3KA 5L2ZH 1G3DA 2IYVA 4NL4H 4QBIA 1UJ2A 4JT2A 1TQ4A 2A7CA 3PMJA 2R2WU 3K53A 1SGTA 4NCNA 4UONA 4CBNA 4XTCS 3MI4A 1A5HA 1TPZA 4X8MA 2VHTA 2B7BA 2X8AA 1ELEE 4C0HA 3TAUA 4X8HA 1INCA 1LVBA 3OEHA 1OWKA 1JWTA 1VG0B 1RD3B 4K1SA 1ZIOA 3BB3A 4C0AC 3ESTA 2XGJA 4RD1A 2XB4A 2F1JA 1UM8A 3SQWA 1O2GH 1W0JD 5DGJA 2ODEA 2ZRAA 3WRYC 5J5CA 3GEEA 1E69A 2J7KA 2ZF0H 1NJFA 4OI1A 5FBQB 4F91B 1DBSA 1O2LA 1PLKA 2JJ2D 2QQEA 1Z0FA 4O03A 3UTUH 3A1WA 1GHBG 1UBCA 1BKDR 4K3JA 3PUVA 1XXDA 4TYPA 1TABE 5DP5A 1S6HA 3SU3A 1XMNB 2FOFA 2ZTXA 1GHYH 1QF9A 3CB4A 3EZ9A 3GY7A 5IK2A 2GXQA 4ZUHA 3A87A 1WMSA 4OBEA 3FMPB 2GCTB 5E3HA 3DEFA 1C4Y2 4LHVA 1V5WA 1ELTA 1SQTA 3MD0A 3IILA 2P3SA 2WM9B 1JECA 1G8FA 3QGJA 3RU4E 3FFBA 1AA9A 2AD5A 1EB1H 1P3EA 2WWFA 4B71A 2ZU5A 1XF9A 4P3YA 5CK5A 3L0PA 2O5VA 1KMQA 2CE7A 3CM0A 4PAOA 2H2ZA 5FUYA 2IXGA 1ZGIA 1KKLA 1O3DA 2SFAA 2EFEB 1O2YA 2W6ID 2YKGA 4QC2A 4WA7A 2OAP1 3NXPA 1Z28A 4QHSA 2Z5FA 3SU6A 2FDCA 3CPHA 5BPEA 3RDPA 3DOFA 4LBVA 4U2WA 2HUPA 1DVRA 2ZUDA 3L0SA 1HAIH 2FI5E 3B8HA 5KU1A 4XD7A 2Z9JA 1RRGA 4V0MA 1P2OA 4M9FA 1KK1A 5E0HA 5EXNA 3QG5A 2VP9A 3MH6A 4MVNA 3NC0C 2TGAA 2ZS9A 1XUHA 1DEKA 3GJ8A 3IO5A 2GZ8A 4MDFA 4E7RG 3K9NA 4YM9A 1I2MA 3VTKA 4DCSA 3LD9A 4EPYA 5FI0B 1S1CA 1F7ZA 2VGCB 3D7MA 2R3YA 2A45B 2QRNA 1FV9A 1G7CA 1XXHB 2VP4A 1FMJA 3KB2A 4CHAC 5G41A 1CR2A 4JKIA 3QUMP 2P0EA 2ZZUH 4KYUA 4Y79A 4BUJA 2F9MA 1O3KA 2Y7XA 2R9VA 4GVUA 4C2UA 3UNSA 4A82A 2FSIA 2C03A 3SU0A 5J4HA 1D2MA 4BAHB 5A0FA 2ZDMA 2A2XH 2AN9A 1E9SA 4PHHA 4LBYA 4D4MA 3SJBA 1KK3A 4H1UA 1NJGA 4AG6A 4L8GA 6CHAC 1OFTA 2PV9B 3TW8B 3U3OA 1YKSA 2WYJA 4RD3A 2C93B 1AB9B 2PJRA 1Q21A 3UWKA 3TJZA 4UQOA 3BIFA 2ZRLA 2IEZA 2WSSA 3T61A 3RMMH 1G5TA 1T8NA 2ZRBA 4OQNA 3WNCA 3HWSA 1MV5A 4DLSA 1SLVB 4Q9KA 3Q7QA 3ZS8A 4B73A 5EQTA 3AP2A 2W26A 3LGUA 4LUCA 2H8KA 3A88A 4GCHF 4YXWA 4UNNA 2P5TB 1OKKD 1AKSA 4XVUA 2BC9A 2G88A 1QIXB 2O8CA 2VHCA 2WINI 1U90A 3AW0A 2XTTB 4NFFA 1NRQH 2BY7X 4GFDA 3VR2A 3MH5A 2FLBH 4ISOA 4MA4A 2KAIB 1JI0A 2WPKS 2G0TA 6CHAB 1K2I1 3O8DA 4URYR 2JLVA 3B82A 1CE5A 3V4FA 3HU3A 1TEVA 1K6MA 4UJ3A 3C4JA 1FI8A 2QSZA 2XTMA 1V2VT 5BN4A 4DJZB 3WHKA 2ZDNA 3KDSE 3VU9B 1FN6A 4JLVA 4AZ2B 2F6RA 1HIAA 3RC4A 3HKJB 3VFEA 1P09A 3BTQE 1N6OA 1GILA 3SFVA 2ESTE 2REBA 2PMDA 3TJUA 4NYIQ 2ZR0A 2PKSB 2KBEA 2Z6VA 5HXFA 1T3LA 1G6OA 2VSFA 1ZU5A 4LBZA 1TNDA 1C2HA 2AWNA 4X6NA 4Y6DA 4BFZA 1ZD1A 4ZROA 3K9XB 3VKHA 2G1JA 2Y82A 4AB8A 3D6TB 5J4LA 4QXAA 1CJTC 5JJLA 1NS3A 3ZVDA 1EZUC 3LGTA 1XB2A 1IXRC 2OCBA 4JMYA 1FY3A 2A2QH 1TALA 1S82A 4WAUA 4GSOA 2IYUA 2NMVA 1LV7A 4HZHA 4HDQB 4IJMA 4I1SA 5DG6A 3EA7A 1ZP6A 3U1JB 4N3NA 2IYRA 1GJ9B 3EPHA 3CF6R 1XTQA 3GLFE 3OAAD 4Y71A 1TMTH 3AVUA 1KJYA 4WZAE 4R2IA 4GZLA 2QA9E 5D3MA 2ZRHA 1VGCB 3E1XB 3GJ5A 1LMWB 1C1UH 4GOKA 1MO4A 4ZKEA 3ZYCA 2FA9A 3D3QA 1NU7B 2P3TB 3M3VA 5AHGH 1GL7A 1GZSA 2BXTH 4DZZA 1E35B 2V7QA 1C5RA 5FR1A 3KJEA 4FU9A 2A5FA 4QGHA 3UANA 1MKWH 2AERH 2GJAA 3H2YA 3LT3A 3GLIB 1IOZA 3A4LA 1C2GA 5FOTA 1V6DA 3M4YA 3M7QA 2HV8A 1DS6A 1N5JA 4FI3C 2I6SA 3IQXA 4FW9A 1ZMNA 2C5LA 4I1VA 5LPFA 1P4SA 3K9GA 1ZIPA 1JR3A 1EPTA 4I8LA 4OS4A 4RJLA 3SHWA 1J70A 1BRCE 4PROA 3P8NA 3QJYA 2ZI6A 4JLOA 3S0NA 4EDHA 5BN5A 1T32A 4EPRA 1JAHA 4KLNA 1CHOG 1WCV1 1U81A 2V4ZA 421PA 1LTQA 2YYZA 1TNJA 5GPIB 1AO5A 2IW3A 3IBYA 1E2IA 5K0HA 2QP4A 4PC2A 2H16A 1GBEA 3LPRA 1RS0A 2D4HA 1CLUA 4EUNA 3MU5A 2IYXA 2FS8A 1KY2A 3GEHA 1O35A 2YHSA 1GG6B 2OILA 2IEYA 3BXZA 1DAEA 5P21A 2V8OA 1K1PA 3GY5A 4J2YB 3RANA 4M7GA 1O31A 3HGNA 3SHCH 2QPOA 4A92A 2ZIQH 8GCHG 1W2HA 5GNDA 3EXAA 1DLKB 4A6LA 3H1TA 3LVRE 1W13U 2NGRA 3WYAA 4X1NU 1Z08A 4OHZA 2PL3A 4ZCIA 4A6XA 4X8UH 4OKSA 1DITH 2Q9CA 5AWFC 2IC5A 2Z3EA 3AV0B 4DY7B 2AWOA 1Z63A 3MO9A 1RRFA 3KKNA 3EA0A 4PSVA 5IF9A 5FPSA 5DGXA 3MCAA 1CTQA 4ZCMA 3IHLA 4WY3A 1XWIA 4LOAA 1G7TA 1IHUA 1XMSA 5C1XA 2OLGA 4LJ5A 5IDVA 3PUXA 1Z1JA 2ZRDA 4FUBA 3GFOA 4HI3A 4N1AA 4DVGA 3P70B 4DKXA 1S1MA 1G37A 3WMFA 1AGJA 4X1RU 1NU9A 4FMBB 5BQ5A 3LX8A 1FONA 1S81A 1JBUH 7GCHF 2GJKA 3QVUA 3RXRA 5I25A 4M9ZA 1EFRD 1J14A 1YPEH 4YLUA 3QF4A 1WBBA 1PPBH 1AVXA 1W1WA 1F0UA 4NYJQ 3QENA 1HAXB 4H9GA 1FUKA 2BDAA 3RUOA 4DJTA 4PHGA 2C95A 4BLSA 3VXFH 3EQ0H 1P2SA 3I4LA 4JJKA 1KHTA 1WRBA 4OHYA 4FMCF 1ZM7A 3FE2A 1ELDE 1VITG 2AHOA 4WOPA 4GRAA 4KU4A 2Z7FE 3GLGA 2HCJB 1C4U2 1XJQA 1M7GA 4IKEA 1DXWA 5DKMA 1U8AA 2D2DA 1NLFA 5AUQA 3SV6A 3ZZ6A 4GLYA 2GA8A 1GMCF 1R0XA 4HYYA 4TYWA 2R65A 1E2MA 4BGDA 1JQJC 2CXVA 1QDEA 3L43A 2FMXA 2O8MA 4JVMA 1PUIA 1F92A 2FPLA 3U44B 3D62A 3IUYA 5AUNB 3QKUA 1GWNA 2JETB 2GCPA 2D7DA 3UQVA 4AWXA 5JS7A 2FTMA 3LKWA 5DN6A 1OWIA 2IYSA 2YWHA 2ORIA 4XVQA 1FNIA 1C5QA 1Z6YA 1XTRA 3STJA 3K8YA 2GZ7A 5C1YA 2F9LA 1AE8H 3T27A 2XWBI 3RXBA 4OS6A 4O3UA 3BFXA 3TUZC 4KSCA 4B35A 2EW1A 4DUGA 1TONA 1F2UB 2RCNA 3EC2A 3L33A 3GYLB 5BYKA 3IHWA 4TZ0A 4IDQA 1FTNA 2CLSA 3ND9A 2CXXA 4HAZA 2EI7A 1Z22A 2ZHFH 3LW8A 4YMSA 3KXKA 2RA3A 1QBOA 1CJVC 3LBHA 1SXJC 4C3ZA 4TSFA 2G83A 4JBWA 1M34E 4KODA 1XCGB 3CO5A 2JETC 1R10A 4S2EA 1TGSZ 5F8XA 3KTAB 4A1VA 1ZHPA 1H8HA 5C1BA 1M1YE 1N6XA 2BD4A 2H5EA 3LAWA 2HVXA 5L3SA 2WKRA 1JALA 3I3SR 4P4TA 4A2WA 3AKEA 3PJRA 1O3AA 4XSGA 3QE0A 4Q4HA 1RRCA 2FZ4A 2QROA 3U98H 2QG6A 4X6PA 1GKUB 3K0SA 3RYTC 2GHIA 2GVFA 5AJWA 4BFTA 4PC7A 1A2KC 4Q1BA 5CK4A 1VGCC 1O5EH 4ASUD 1QHNA 1G3IA 5FPYA 4CEHA 1O2SA 4LK4A 1GI6A 1O2JA 3TIUA 3QLPH 1YR6A 1CJUC 2GRJA 4R0IA 4YOIA 1T5LA 1FJSA 2RGEA 3AUYA 3EZ2A 4HLDA 1K1NA 1M9UA 1RTLA 4YQFA 1NY6A 4D2IA 1ZGVA 3NBFA 2CHQA 1TQ7B 5FR2A 4JLKA 2JDID 2FODA 2ASEA 1DSTA 1MBQA 3W8RA 5C4GB 1THSH 1VR1H 3M0EA 5BRRE 1CBWB 2HPQH 3E16B 2GCHF 1ELFA 2FU5C 4GP6A 3ITIA 4PXAA 1MTSA 1FY5A 2OLKA 3CW2A 5CB8A 3U3MA 4THNH 3T25A 2WJGA 1OWJA 1KMHA 3QY0A 4BXWA 3IPXA 2FOHA 1C2JA 3OESA 4QG7A 4EFNA 2V3HH 3L82B 1LQDB 2FMJA 1BTWA 5EUQB 2BKUA 4WXIA 2HF9A 2JJ1A 1ZMJA 4E5UA 4HLUA 1DPOA 1GI8B 4NA7A 1AWFH 3FAOA 2VP0A 3FOZA 4JYVH 4WVPE 2I1QA 1U0HC 4DEXA 1A5GH 2HYDA 1XJCA 4Q18A 5GXPA 2BEJA 2W5EA 5AFZH 1VG9B 2NIPA 2TPIZ 2GD4B 4DDVA 1UTJA 1NN3A 6ESTA 4EFLA 1R0YA 2ZI9A 1C2KA 4XWKA 1O2VA 5LGOA 1SKYB 4DBLC 1KI8A 2ZSFA 1VTKA 2JEOA 1RIFA 1SHZA 3LGWA 1GBKA 4Y10E 4JLDA 1CP2A 5FX6A 1CJKC 3W94A 5F6MA 1HAZB 3UR6A 1DAKA 1BRUP 5GJWC 4D9QA 4YLQH 1O3BA 3SUGA 3SU1A 2O0JA 4OI2A 4BTTB 1UTLM 5PTPA 1UKYA 2TGTA 4BRUA 2IXFA 4QM7A 3BTME 4X2WA 1F5KU 1C1PA 1R5OA 3W9YA 5EZ5A 1QA0A 1E2JA 1D6WA 2WOOA 3M7UA 1OXSC 5LH8A 2HCBA 2JLWA 4QHTA 2ZE5A 4B3DA 2WIAA 3I8SA 5HM2A 2J92A 1ZM2A 3WYGA 2XJ9A 1OT3A 1KO8A 2DYKA 2G3YA 3BS4A 4NCIA 3LJJA 2EA3A 1YC0A 2XEXA 5C46F 1BBRH 3WY9A 3GY3A 1A7SA 4M1OA 5DLQC 1HXFH 2BZ6H 2IHYA 1A0LA 3TSOA 3RXTA 1QVRA 2HRVA 2BD7A 1FY8E 2TBSA 1W4AA 2ZRIA 1K9OE 2F9PA 5FPKA 4FN5A 3KUCA 2PT7A 4G5GA 1KSHA 2GZHA 1LPGB 1GJCB 5CYOA 3PTBA 1V2OT 1F2SE 2G77B 5HKKD 3FP8E 2BOHB 4JL5A 2IYZA 1TTTA 1NT1A 5FBRB 4DSNA 3T5FH 2CGAA 1H9LB 1EJAA 2FZLA 3FFGA 2G9NA 2I6QA 3RU4D 3VR5A 3SBEA 3LDXH 3THOA 1QRZA 5TDHA 4FMDB 2IT1A 4DLUA 5FCKA 1BITA 5EUMA 1HJ9A 5T6GA 1VYTA 3I5XA 4JVNA 1E2EA 1ZLRA 5DP6A 4WMEA 1ESTA 2G6BA 2ZPRA 1E9DA 3ADDA 2IHBA 1GTVA 1V2TT 2BVRH 2D2EA 4KVAA 3SNCA 1EX3A 3A8CA 2F3RA 3PM3A 3QBVA 7LPRA 4INKA 1ZSLA 2VF7A 4KBFA 1Z6AA 1Q22A 1E9RA 4JT4A 4ZKSU 2QQ0A 1IQHA 3UNQA 4BLTA 2A5DA 1ELVA 2ZSDA 1CT0E 2H9EH 2QRZA 1Z6XA 4WXVA 1QNJA 1Y3WA 3SNAA 1X8JA 1EX7A 2GF9A 3PITA 3I1FA 4HZUB 1YR8A 1GBLA 2JH6D 3KKOA 1DO0A 2EYQA 2BYAX 3EZ7A 1G19A 3TLOA 1RIWB 1NVVQ 2OBNA 2ZHWH 1MQ6A 1HH4A 3MJRA 3Q3YA 2HXYA 3QK1A 3KHVA 4NDZA 3E6PH 4MPWA 3IIKA 3EE0B 4LZ1H 4ZDKA 2JLRA 2B6HA 1Z2CA 2A7JA 3ZS9A 4ABEA 3G82C 1SGFA 3RXVA 3W6PA 2OFXA 4YDSA 1XUJA 2TMKA 1RKBA 2QGRA 4HAVA 2WWIA 4IDHA 1QL8A 4Q7JB 3A8TA 2VYFA 4IOKA 1Z0JA 4URVR 2NOAA 1Q3HA 5FOWA 3BG4B 3AVOA 3K0AA 1X8KA 1NL3A 1K5GA 4KHZA 2RGAA 2BIFA 1VCOA 3EA5A 4NU0A 1AIPA 3W3ZB 2ZR9A 2BOVA 2WJJA 4IC6A 3RRNA 1XCMA 3MWJA 4Q21A 3QVVA 3QUSA 4Q7LA 1J9CH 1Y63A 4JZIA 4FUEA 5GVSA 1AWHB 3CR7A 1GVZA 2WYGA 4BNRA 3PV0A 2A5YB 1GI9B 1Z7KA 2SGFE 5E7JA 1MT0A 5AUOB 3PEWA 4OM9A 2F9BH 1G64A 2WPJS 2BTCE 4X8SH 2AIPA 1Q3TA 2VB0A 3N2IA 4D26A 4AC9A 2C9YA 2HT1A 2IL1A 1QL9A 1K22H 2YNBA 2OV2A 1W46A 2R6GA 4UJ5A 1KDPA 3BEUA 3SJAA 1YVDA 4WBSA 5D3QA 1E2QA 3RMOH 2E87A 4BZQA 1P01A 4MRVA 1EPTB 2O9QA 4B1TA 1H65A 1GJBB 5FL7A 1CSOE 3HP1A 4AYYB 1FL9A 1SGDE 4ABAA 1E9FA 4RZ2A 1RW4A 2FF7A 5K8LA 4BPBA 1N5IA 3N5CA 5JCZA 4DUGD 2ZKSA 1T3SA 3AAVA 3LC5A 3KF2A 1TPAE 1QB9A 4WXRA 3NWUA 3DFJA 3SC3A 1FQKA 5CJPA 4WW0A 2FOAA 4Y0VA 4B32A 1N6NA 2QORA 2ZRGA 1D2EA 2JLQA 4EJSA 3PENA 3SYLA 1AQUA 1UVTH 2ZVPX 5DSZA 1UBFA 2ZSAA 5AJXA 3X1XA 1E2KA 4MH0R 1BMFD 3KQCA 3QO6A 5TXGA 4G3XA 4BFUA 1OPHB 4NMMA 2ANWA 1XD9A 3F68H 1LW7A 1F5NA 1IM2A 3URCA 3PEYA 1YR7A 3ICQB 5DP8A 1JQLB 4D7FA 3FTQA 3QXHA 2BM0A 4LK2A 4BECA 2F3TA 1E36B 2WJIA 3TK5A 3R9XA 1ANDA 1GI1A 2GK6A 4GNKA 2ZDAH 2GZ9A 3GJXC 2G4UA 4FUHA 2ZDLA 4LV6A 4ON9A 1D6RA 2V9PA 2BB4A 3C16C 2ZAOA 5DO9A 4LSGA 3MRSA 3MUFA 3KXIA 4LRWA 1NLZA 1NROH 4V03A 4TMKA 4IRUB 1VHTA 2IWRA 2H6MA 4O2RA 3P17H 1LDTT 3SUDA 1OWEA 3FKSA 2LKCA 4RKFA 1YGCH 3U69H 1QHIA 4M1KA 3LBIA 4AK9A 1HY3A 4OGYA 3Q9LA 1C1MA 2PLFA 3DKPA 3RXUA 1KIGH 3KGPA 4TY7A 3SGQE 4XTRA 1BTXA 3UWJH 1KO7A 2O8LA 1AMHA 1GGDC 1IQGA 3VGCB 4R2HA 1W36D 4WXPA 2ANCA 3GMTA 4TWWA 3L0IB 2DFLA 5EXTA 1U9IC 2VIVA 1XEXB 1Q2WA 1YPKH 5TCCA 3T26A 1K1OA 1YQTA 4JSYA 2C8WB 1E98A 2PX3A 1G4AE 4ASUA 5DISB 1MTNB 2KAIA 3PUWA 2UUKB 3SYJA 4QL3A 2IJOB 1PLLA 1E37B 1BQYA 1J8AA 1NVVR 4C0QC 3K6YA 1N6HA 2FI3E 4I99A 4YLGA 3THYB 1N5KA 3K70C 2GAAA 1BOFA 1GJ7B 2ODPA 1C4V2 4AORA 2NU3E 3DT0H 4WMFA 1RC8A 4DHEA 3A85A 3ASZA 4GL2A 3AVZA 3LU9B 4QGFA 3UMRA 3F3YA 3VR1A 2QXIA 4B6EA 2OCYC 4PTLA 1GI0A 4QM6A 1D9XA 4KFRA 3CS0A 3B1XA 1OP0A 1L4ZA 1KI2A 3B7GA 1YHNA 2GEUA 3W34A 3C15C 3ND8A 3OEED 2AFIE 4OHVA 3U7FB 1N25A 1WA5A 3UIRA 4TY6A 3KCGH 1SGNE 1SULA 3BH0A 4C9BA 4DGJA 5JFGA 1Z06A 5DJ7A 1DT2A 1SGQE 1S96A 1TF5A 3RP2A 2A7QA 1F5LA 5SZJA 2G52A 3NWJA 3RWOA 1CRQA 5ETXA 2BOKA 3ZV9A 3BV9B 1H8EA 4NKRA 3A83A 2HOBA 1OYTH 4WH6A 4G5RA 5CITA 1RYFA 5G3ZA 4ZKNU 1AN1E 1HNEE 1OXUA 1NSFA 1UVOA 1CHOF 2K5UA 2Z6BD 5DK1A 3P8GA 1PPHE 3UIEA 2FPKA 3K6ZA 2ODBA 2XZPA 3DD2H 1SHHB 4QNMA 3SU2A 1NN1A 4NE2A 3MSXA 2OINA 4P33A 5UKDA 3AB3A 2F9OA 4OI0A 1L1GA 2Q0HA 3A4MA 2LCFA 2BM2A 4MPXA 4JZFH 3MFJA 1C5SA 4I32A 5L3SB 2V1XA 1NMYA 1OF1A 1II9A 3KB1A 4RKOB 3DHWC 3DA9B 1EK0A 3QF4B 3H84A 2ZGCA 1O5DH 4GZMA 4MDEA 2JH5D 4K2YA 4BFYA 1JR3D 5HE9A 1WF3A 4YO9A 1TPSA 3N70A 1XX6A 5G40A 1M74A 3TSZA 5JI3E 5SZIA 2J3EA 5JMTA 5EE3A 2OC8A 1HEIA 1RVDA 1SQAA 2FOGA 3HKIB 3ATWA 5E0GA 4U00A 1T4GA 1XMVA 5HM9A 2BBWA 4RFVA 5T6FA 4URUR 4DSOA 1G41A 3BB1A 2J7PD 1QG4A 2VGCC 2XBYA 3H7OA 1G8HA 3BIVH 4KGAA 1EJNA 1C2LA 4PQRA 1C1TA 1V2UT 3UR9A 4BFVA 2J0QA 3BH7A 1DE7H 2FYQA 4UFEH 2EWVA 3SR0A 4RCZA 2PX0A 1GJ8B 1IQFA 1HTWA 5KDDA 1N6RA 3OTPA 5E4FA 3RS3A 1EWQA 2LNCA 3ZV8A 4RSPA 3ATLA 2B8WA 1RRPA 4HDCA 1NKSA 1P9NA 3VXEH 1XZPA 1DWBH 1MZDA 1XEFA 3BIUH 4BXSA 4JLJA 4JYCA 4M1TA 3KQBA 1QZXA 5HCNA 4CYMA 4R8TB 1EXMA 2ASUB 1X6VA 3KEEA 4KTUA 1HGTH 2UZIR 1ANBA 4FUCA 3WBKA 2QY0B 4PANA 1JR6A 1NVWQ 4XOIA 3TMKA 5HE8A 3P95A 1JBKA 2ODNA 4LJ6A 3T5DA 1YZLA 1D3QB 1OWDA 3SV9A 2OD3B 1GJDB 4IN1A 1H4WA 5CM8B 4B34A 1G8PA 2VIOA 3VNVA 1TUEA 1MABA 1XMJA 4TTQA 1XPUA 3A1VA 4M1SA 1Z2AA 1UCYK 5FXLA 1GHZA 1GJ5H 2ZI2H 4OL0A 4RZUA 4BWYA 1HRTH 5AUPB 3JVUA 1AS3A 2FM2A 4CRBA 1KI6A 4PFSA 1AKYA 4IVRA 1GL0E 2X1VA 1Z0KA 2IYWA 1JXMA 3AF4A 1JPJA 3ZGXA 3RM2H 3VX3A 3C5HA 3U6BA 4B6FA 3TNFA 4GPTA 2ZDVH 3S7HB 4OGXA 4XBBA 2DWPA 4X1PU 3I61A 4A0HA 1AM4D 3MNSA 1R0WA 1LY1A 3SQHE 2FWRA 2ZI3A 1OFUX 3ZZ7A 3A7TA 2D26C 3AW1A 1US8B 1T0JB 5K8UA 2VINA 2REOA 5H68A 2F1HA 1UK4A 1UF9A 2GCOB 1GVNB 2C8VA 3MH7A 3RXSA 3ZZ4A 4Q19A 2VH5R 2QMOA 4DLTA 3GLFB 5GIBA 1ETTH 3CPJB 2QI9C 2XCFA 2BMJA 2ZGJA 5A8ZA 2F9VA 2PHBA 2AMPA 4MLFB 2GMTC 2BKEA 3W5IA 5JBTA 4LJ4A 1KYNA 4H1VA 1Z8GA 1OYWA 3ZVNA 3ZYEA 1XPRA 2G4TA 3RSOA 3IEUA 2PT5A 4TL6A 3LH1A 3OSYA 5GWZA 2PTNA 4DB2A 2RAPA 2BY9X 2P5SA 1KTSB 5DI3B 5F8TA 4MRPA 4C2TA 3UOUA 4WWYA 1P73A 2GXSA 2C8XB 1VHLA 2DB3A 2Z3DA 1G9XA 4GMDA 1CULC 1O5AB 3SYKA 1MH0A 2JIZA 3H0KA 4NZLA 1EAWA 3B9FH 1P2MA 3QBTA 4ZDWA 4Z54A 1GVLA 3QWCH 4D4JA 5FCRA 3K0FB 3QI2A 3GQBA 1QGFA 3RXOA 3F9FA 4JL8A 2ZHQH 2JJ1D 3RMLH 3HR7A 2Q6TA 4XD7D 3BERA 5FTJA 3WNDA 3BFKA 5KDLA 1T91A 5C5NA 4A0RA 2XTZA 1XVMA 4PQYA 4MGZR 2HLCA 4F7WA 1TQ0B 3TVDA 2PKAB 3SUFA 3KX2A 1OLOA 2HWLB 1K21H 1DTSA 1W4BA 4KBGA 1HAYB 4XSHA 4MNVA 4LHXA 2A30A 4ZHLU 3F5FA 3EARA 3KQEA 3V0XA 4E05H 2CCGA 3B23B 1IJEA 1ESBA 2GVZC 1HFDA 2VLIA 3JVVA 5EOKA 3NHAA 1P2UA 2AFHE 5IDKA 1Q1QA 4DT1B 5EE0A 4Q9LA 1C2EA 1CRPA 2ZRCA 1UTNA 1V2PT 2F83A 4YESB 1QG2A 1ZNWA 1M6NA 2IJD1 2JJ2A 4F93B 4EPXA 2Y6TA 4Q7YA 1O3HA 1VIYA 1YPJH 2R62A 3PMBB 1IY2A 1QL7A 3SNEA 1A82A 2DFTA 3H09A 2GCOA 3GP8A 2UZ3A 2AGGX 3GEIA 2PGBB 1KO5A 3LJOA 3LLMA 1PFXC 1OX1A 1NM6A 1YZNA 1P2JA 1E9BA 2OCPA 2WJHA 1N5LA 1KXEA 1NMXA 2VTKA 2GBLC 2BDBA 2J5XA 1W10U 1SVWA 3E1SA 3CZQA 1VITF 4XSKU 5LB2A 3UREA 5JHGB 1GBFA 4DVAU 3A7ZA 1BA8B 5AK0A 2ZYUX 3I78A 3LH3A 3T1OA 2PW8H 3C41J 2C90B 4C0SA 2XAUA 1FAXA 2G81E 4I7YH 3RXLA 3RXQA 4Q4JB 4JCNA 3PEUA 5DN6D 4EPVA 2LWIA 5M04A 5FOUA 1YZKA 1T9HA 3NZIA 5BN3A 1P72A 2THFB 3V4RA 1TMKA 3C1KA 3A1UA 1EAIA 4QOSA 1NLYA 2W00A 1LVOA 3K9HA 4KKDA 1DXPA 5EODA 2NPIA 3PV2A 2CLCX 2EYUA 3VKGA 4AG5A 2NU4E 1H8HD 4J0QA 4TL8A 3LH5A 3N2EA 4P4UA 1G8GA 4FCVA 5JHHB 1F2UA 4PPFA 2Z4SA 1E96A 1U99A 2H9HA 1U8ZA 1UKZA 5B64A 1AVWA 1Z1IA 1NN5A 3PLKA 1UK2A 4BFSA 2GV6A 3VPKA 2VL7A 2W0MA 1E34B 1W12U 2P3UB 3RRZA 1LS6A 5CDFA 3TVTA 3B9QA 1UJ1A 4K8YA 2A32A 3UUZA 4OQLA 1L1NA 3CX7A 3H5CB 1QTFA 1U2RA 2IA5A 1O3IA 3A89A 3CNNA 1ZBDA 3NBXX 3CX8A 2FSHA 4ACAA 1EESA 1RE0A 5K8IA 3ADCA 2JLXA 2HLDA 1II0A 2QY9A 4TL9A 2OM2A 4Z8XA 1W7AA 4D80A 4URWR 5IRCD 3P4YA 4AY2A 1LVMA 1Y3VA 2EC9H 4JK5A 3KL6A 5G3YA 1HPGA 5JDUB 2GBLA 1Z8JB 2BMEA 5BYJA 3TQCA 5ABWA 5B6LA 3E91A 2BVSH 4ERNA 4L16A 3K0AB 2WJVA 2BMDA 2IS2A 1GKYA 5JBQA 1S3GA 1UBGA 5DPAA 4Q1EA 4GAWA 1C5ZB 4QBGB 2C3SA 1SXJE 1FDPA 3TNTA 2J7PA 2QAGA 2NG1A 2J2UA 2QF0A 5HMAA 4A1XA 2BLOA 4UXIA 4UDWH 4AIIA 2RHMA 3V9PA 3I5YA 2UVQA 2VP6A 3MTYA 3AVWA 3IPYA 3CS7A 2QT0A 2G51A 3ONWA 3RLFA 1QHHA 3F0TA 5CLQA 4CGZA 3RXJA 1O2UA 3LGVA 3NCLA 3A8DA 1SVMA 4B2CA 3LA6A 2GXUA 4A4DA 3LBNA 1UCYH 3EGKH 1P6XA 3PIRA 4UXHA 2XITA 1VJAU 1KI3A 1AQ7A 721PA 1Z0DA 3WNBA 5LB4A 3TKLA 5FX5A 1HAPH 4B3XA 2EFCB 3RXFA 3SI7A 2VU8E 3GCTF 3A1TA 3MO3A 4UKDA 2WWYA 1PUJA 3ZZUA 2F7SA 1C2IA 2N46A 1OS8A 4NA9H 1GMHF 1O38A 2VQSA 4N0DA 1L4DA 1AVGH 3G5UA 2C9OA 3O8CA 3OX7U 4D7GA 2ZEJA 2FOCA 3QN7A 4FUGA 3WMGA 1O3PB 5B57C 2WPHS 1E0SA 1ZNZA 1P7CA 2W83A 4DIDA 2EI8A 2DUCA 4RSGA 2UWOA 5LD2B 1JJ7A 2VIWA 2DPXA 1YRAA 2EVWX 2ZWLH 2O8FB 1II8A 1E99A 1LCYA 5DP9A 4DCDA 4MITA 1KAGA 2IOTA 4IFBA 2FEQH 1NFYA 1D3PB 3X1YA 4JYBA 2JLSA 1WQ1R 1QRXA 3DHKH 3RMNH 1SG8B 1DAGA 4TL7A 1Y3XA 2WPIS 4Z0KA 3GLIE 2GDDA 3KJGA 1MUEB 4INLA 4M8NE 4I1UA 4AGJA 1MMJN 4FVDA 1KLJH 2AMDA 1A4WH 1CBWC 3OEEA 1G3MA 2ZJ8A 3ZVEA 2ZJAA 3EZFA 3UMFA 1Y8TA 2FIRH 2RGNA 4ARZB 4NCKA 3FVFB 5C18A 2WBLC 1IN7A 4Z6AH 1GBBA 3U7HB 4BTUB 2RCEA 4JZDH 4AOQA 1EASA 1TRMA 3UKDA 2NU0E 3CONA 3CX6A 4Q7MB 3SNDA 2ZPTX 2BY5X 5CE1A 4NYMQ 1L1JA 1HA3A 2J0UA 5L8VA 2W2VA 2QBYB 3S1AB 3TNSA 4Q2KA 1E2GA 1T4VH 2V7QD 1G3BA 2P67A 2PBRA 2O8WA 1GBCA 1PPFE 3AP3A 4OJKA 1O2PA 3RRMA 4F4OC 2WWWA 1SMFE 1O2IA 1YCPH 2UUYA 4UFGH 2BBOA 4LJ8A 3ZVMA 3ZZBA 2DWQA 2G1KA 3TU7H 1ZPBA 5JBBS 3ZVCA 3E0NB 2P8OB 3IEVA 2JLUA 1C5PA 5FPTA 1N6YA 1F6BA 1ZC3A 1LQEA 3BTWE 1SBWA 2ZJZA 4B3BA 3OIUA 2R0LA 1IQPA 3OF5A 2Z9IA 1KSNA 3ZVLA 1WCZA 1TAWA 8LPRA 3Q3XA 4CEJB 1QA7A 3RXAA 4HUQA 3SHFA 2ZA5A 2XX3A 5JEEA 3RNLA 1V43A 4JKYA 1TADA 1XXHE 1W49A 3SJZA 1W2GA 1DM4B 1IQJA 1EXFA 2OBLA 5T6DA 4RFSB 1AS0A 3R9WA 3P1JA 3RVBA 3RS4A 3TGPA 4L5BA 3FP7E 2NO1A 2RKOA 4TQAA 4HZIA 3ZVBA 4ISHH 3RXEA 3FKQA 4ABFA 2JIZD 1YRBA 1FPHH 3HDTA 5EP3A 1CA0B 4A8JA 2VRWA 3CRRA 4INHA 1NI3A 1HV8A 1E38B 5F9HA 1NPMA 4IOLA 2OSBA 2FS9A 1LKBA 3BAFA 4K60A 1SLUB 1GSIA 7GCHG 3MMPA 1GBIA 1KMHB 1G9IE 1QQ4A 4CRAA 2V6IA 1W0ZU 4PPQA 4MKGA 2D1JA 3O47A 2ZCHP 1KI4A 3CRVA 1LPKB 2UUJB 2ZSBA 4U02A 5DP4A 3MNXA 1C1VH 2ZECA 1S0UA 1A3EH 4JLMA 2ZDKA 1DE0A 3S1AA 4IDNA 3D23A 4ESHA 1ZYUA 2ZI7A 3M5NA 4TMXA 3LVQE 3A81A 3SN6A 3UMSA 2ZU1A 3ZD7A 3JZMA 1W11U 2EFHB 4DLXA 3KL4A 2ZE6A 4V0LA 2R6CA 5CJ2A 3VHXA 5A8YA 3ODDA 1Y5AT 1AGPA 2B0FA 4YDHB 4NCHA 4AX9H 3VEQB 1O34A 3Q77A 4I8JA 2VWNA 1AE5A 3ZZ5A 3VR3A 1SR5C 2H92A 4DDWA 2H5CA 2IN2A 1O39A 1E0JA 1HYQA 1Z83A 4UD9H 3RS5A 2UUFB 4P31A 1ETSH 3IGFA 4AKHA 4QBFA 2FX6A 5C67A 1DANH 4GUXA 4IGDA 1BTHH 3ZZTA 2FGJA 3WXMA 3TJOA 3T1VA 1C5LH 3BEIB 2L0XA 4Q03A 2QAGB 1RXPA 1RZ3A 1T8UA 4X2VA 4U7DA 4A15A 1AJEA 1QB6A 2VH0A 2EFDB 3SHAH 5JJIA 1DAMA 2X77A 3A6PC 3STIA 2FJUA 1COWA 3MWIU 2BCJQ 4IHQA 3QDZB 3VB6A 1PVOA 4Y8ZA 3RC3A 1C5XB 2I4IA 3A7VA 1BMFA 1TU3A 1N8OC 3DMDA 1CS4C 2J9NA 1UTKA 3KN2A 5LD2C 3U7GA 2IYTA 4GBMA 1YM0A 4QFMA 4E7NA 1DOAA 2NWNA 4CREA 3DM5A 1NRNH 4NCYA 2IF2A 1TQ2A 1H8ED 3SO3A 5EXXA 1HAHH 3SJOA 3NG1A 1BJVA 1XDBA 2GP9B 2BQ7B 3SS8A 4HGCA 4YMUA 3E8LA 3OZXA 1IQNA 3U8OH 3CR8A 4LDJA 1XUFA 4DDUA 2IS4A 4QNRA 5JWOA 2W7UA 3OE7D 2PSXA 2MMCA 5FOVA 4FUIA 1WE2A 4MKIA 1YPHE 3I29A 3T15A 4BAKB 4AD8A 1N6LA 4DLYA 3K0EA 4DCUA 2Q1JA 4Q5IA 1GDUA 3IIJA 1XTKA 3NDPA 2DFNA 1V2NT 2H9TH 2ALVA 3LQRA 4O9VA 1C5OH 5GVRA 1TX4B 1Z6GA 4JZEH 2H18A 5L3VA 3O8BA 1EKBB 1FP6A 4CDGA 3GJ3A 4YT6H 3G0HA 1E1RA 2VHQA 1DFPA 2ZGHA 1DWEH 4MYUA 5CYPA 1TQDA 2A31A 4OQFA 3AQ4A 3SOPA 1X1RA 1QFKH 1FUUA 1C5WB 1GHAF 1UO6A 1LHDH 1R6BX 1SKQA 1ZSJA 4HB0A 3ODFA 2QMEA 4Z1MD 2AEIH 2OK5A 1TOMH 2XTNA 1SFIA 4AYVB 4RKEA 4K1EA 2ZI5A 2Z9GA 4AN7A 2XNIA 3F6UH 2XRCA 2FN4A 2FV8A 3PTNA 1G2MA 1JIMA 4WMDA 5F03A 3EPJA 3M5MA 3QKSA 4DCTA 1O30A 1UTPA 4M9SA 4QGAA 1SGYE 1E9EA 4NYIR 4BEBA 1I4TD 2Q9AA 2PJZA 4TSFD 1DAFA 3KJIA 1O2KA 2D8WA 4HTCH 3A7YA 1DPFA 4XWOA 1XUGA 1UKEA 3BEFB 1O5GH 1TQ6A 1KTTB 2VWLA 3UPEA 1W47A 1Z3IX 5EXSA 2XZLA 3DZDA 3GLHA 2O8CB 3AP1A 1FIZA 1N6PA 4ABBA 3EPLA 5DH9A 3SUEA 2FG5A 1JB1A 1RFLA 1BS1A 1GDQA 2W2TA 2PGQB 1RFNA 1YCPK 4KLZA 5J4SA 5DI9A 1P2IA 1G21E 3S69A 4ISNA 2M5TA 4IFEA 3U1IB 7KMEH 4EQ6B 3GLFA 2BDIA 4PHFA 2PZFA 1O2QA 1SXJD 3JZAA 1GCTC 2R6FA 3CUEF 4RN6A 5FUVA 2VF8A 3MWLA 2BEKA 4OQMA 4X1SU 3IO3A 3J81k 1KI9A 1WXQA 1LS1A 5AJZA 2HF8A 1KI7A 4K5ZA 2CBZA 1AFQB 1FW6A 4UNPA 4Q4HB 4TT3A 3IIMA 4OK6A 1E2LA 3R7WB 1Q12A 4IN2A 3WYFA 5H70A 1QBVH 1E1QD 4M21A 4Q47A 2HPPH 1GVKB 1I4DD 1CBUA 1J99A 3I92A 2JH0D 1BUIA 1YYY1 3CPEA 5FOXA 1OP2A 4K46A 1G5RA 4F4CA 2J0UB 4LI0A 4II7A 2VJ1A 3U6KA 1SGWA 1BHXB 1Q31A 3AKCA 3NUMA 4JLNA 2X2EA 1CIPA 1CF4A 5EP1A 2F4LA 3K09A 1GCTB 2XYAA 3QKRA 1NY22 4RI0A 3GPLA 1AZTA 2ZU0C 1B0FA 2R0KA 3WY8A 1D6JA 1C1WH 1KDQB 1J8YF 2OCAA 4GT1A 3U8TH 1SFQB 2ZFFH 1T31A 3FPAA 4HB3A 3Q85A 3VR4A 3SJ8A 1JXOA 4ZXXH 4QT8C 4Y7BA 5K7RA 1LVYA 1TNHA 2SNVA 4XBDA 1KDOA 3SDZA 1IQKA 1KXFA 2JLZA 2WPLS 1Z71A 4M22A 1AN0A 2C96A 1AU8A 5JS8A 1AB9C 2J94A 3B2EA 4FXPA 1GBJA 1THRH 3CRW1 4D4KA 4CF7A 4B48A 3QEOA 1S6FA 4LC1A 2QIQA 2H7VA 4NA8A 4JVLA 3PYHA 5GADl 1EFRA 1UFQA 2XBVA 2ZRPA 1SVPA 4OK5A 1N3BA 5FL3A 5E2OA 1P8VC 1LB1B 2HDNB 4FINA 1DX5M 2B92A 3HGPA 1X8LA 2CK3A 3BK7A 2EWWA 4Y7AA 2E1RA 4CEIA 2NO6A 5KUTA 2XSZD 1OWHA 2ALPA 4X0WU 4DXAA 1PPZA 4HLCA 2ZFRH 2AFQB 2QN6A 4URXR 4K81B 1W36C 4FVBA 4FIDA 5JCPA 2ZU2A 1HAVB 4CRCA 1B0UA 4TLBA 3ZDQA 1VITH 3ZVAA 1CGIE 1T8TA 4F49A 2GGVB 3GD7A 1ANKA 3PEVA 2KWIA 4ZHMU 1P75A 2CNWD 1TLDA 4JYTA 2BBTA 2WVJA 2XJ4A 4CH8B 3I77A 1GI7B 1F2TB 2ORVA 3QTOH 1L4UA 3B60A 1MTNC 1HDTH 4Y8XA 5JWRA 2ZCLP 121PA 1G3QA 2XCNA 2ERYA 2VSXA 3A84A 2D74A 4GI7A 1MKYA 1KDTA 1FQ3A 1ZHRA 3ZVRA 1GG6C 2BLWA 3URDA 2OZEA 4D6PA 1KK2A 1SHYA 5FBIA 3DZ8A 1TNGA 3LOXA 2NQ2C 1TRYA 1HQCA 2CHGA 1BO6A 1VCNA 3A4NA 4V0KA 2WWHA 2FGKA 4ZIRB 1TEXA 2K1QA 2VWOA 2ULLA 2FLRH 1GNPA 1R5BA 1KLTA 4LPKA 4I33A 2ZJ2A 3Q76A 4YZUA 1JXPA 1G17A 3M1IA 4MNXA 1HUQA 3LW7A 2NU2E 1TYNA 1P62B 3CWQA 2ZNKH 3M61U 1XD8A 3ZLJA 2IBMA 3R0FA 1SVSA 3EYDA 4E09A 1SXJB 4D76A 2Q6FA 4XE4A 3QZQA 3NH9A 1GHAG 1KSFX 1GKIA 4Q1DA 1GJ6A 1P9UA 4GPGA 4US1R 1WU1A 5DE3A 1KZ7B 1IY1A 821PA 1HYLA 4CEHB 2QT1A 1U98A 3TRFA 5KSPA 1S8FA 1BCUH 1G7SA 1YCPM 5JB8S 1FY4A 1H9HE 1OB2A 4BFXA 5HGGA 1GRNA 1ZMLA 1ZCAA 4GSYA 3EAQA 4K8OA 1W4CA 5FTNA 3B78A 1QB1A 2ZQ2A 1E1QA 5L3QB 2ZRJA 3RXMA 4NYMR 1QHXA 2P94A 4NZYA 3UWOA 1GITA 2FOLA 1K1LA 5GCHF 2ZIAA 4ISLA 1DOJA 1X7AC 1LVGA 4C7OA 3AVVA 5JECA 1C1OA 4QJ4A 2XBXA 2FI4E 1UVSH 1HT2E 4RD2A 1CEEA 1R8QA 4BLRA 2PMKA 1S4QA 2AD1A 3K0CC 3AKDA 4TLDA 1NBMD 4KI0A 2CVFA 3KJHA 4DLZA 2J87A 2IWHA 4MYCA 2RGGA 2ZETA 2J9RA 1Z8IB 4CEJA 1VECA 4BAQB 4KFUA 3KZ1E 1Y3AA 2ZUCA 2WPDD 2PLXA 3EASA 4X2XA 5A5GA 3SV7A 4PX9A 1P9WA 2A4RA 1AFQC 2XWAA 4B2IA 4C7OB 2IK8A 1TIOA 4AKGA 2V6JA 1G291 4B2PA 1IBRA 3TVJB 1PV4A 2RMKA 4YONB 5JRJA 1NG9A 2ZYWX 3TAHA 1V2QT 2F3CE 4XIGS 1A61H 5C4MA 4PQFA 3UFAA 1JMOH 4NPHA 3ZD6A 3A80A 1ZD8A 5B30A 3SZRA 3OFNA 3AAUA 1FP7A 5IK2D 3MNCA 1IY0A 2YOGA 1L0ZA 2PZGA 3TPIZ 2IX3A 1O2MA 1BH2A 2IUSA 4YC7A 2H17A 4MQBA 1BMAA 1P11E 3TJNA 4M1YA 1SB1H 3FP6E 4XWAA 1SL3A 1ZJ6A 2JAQA 2CL7X 2WV9A 4P0TA 4TWZA 4LJYA 5CMXH 3KKQA 1E9CA 3RXDA 2C8YB 2BDTA 2I3BA 5KNDA 2G8TA 2V35A 1SOTA 1LHEH 4FMDF 3Q5DA 1HLTH 1UTQA 4AKEA 3SU5A 2FFBA 1VG1A 3BTEE 1KK0A 1LTOA 2W6JA 1OXGA 4HAYA 1X1SA 1UDWA 3KKMA 4PZLA 4M53A 3BH6A 3L8YA 1DELA 4FMCB 4QJ5A 4CRWB 2OC7A 3P4XA 1HIAB 3RS7A 3D49H 5KHOC 4GDFA 4TMTA 4TPIZ 2WAYA 1L7VC 1FMGA 1P57B 4AB9A 4BLPA 1UCYE 2ZJOA 3FMFA 3B8JA 2NU1E 3DMNA 4GMXA 4UE7H 1YR9A 4C0JA 2FPZA 1IN5A 5H4IB 4QHYA 4C0BA 1W5TA 4PO8A 2V55B 4Y76A 4BZPA 4LYJA 1GNQA 4URZR 1KJZA 1PPGE 2W3IA 4RKJB 3F9EA 3MOCA 4AYXA 3A1SA 4IVPA 1UEIA 5GCHG 1Z0IA 4DDTA 4D82A 3OU0A 1ZC4A 3E90B 4H6SB 5JBCS 4Q66C 1Z6EA 1YP9A 1A5IA 1XP8A 3K9LA 3BF6H 3VNUA 1TBQH 1UHBA 5SGAE 3TK9A 2FP7B 5CDFE 6Q21A 2MSEB 3BTTE 2UKDA 1V2LT 1O3NA 4DIEA 1COWD 2ZU4A 5EXMA 4TQ9A 1H8DH 3F9HA 2Y5HA 3GCGA 1T3HA 3ZVGA 2WTUA 4H4FA 2OO7A 1ELCA 3W8NA 1ZRHA 1QHSA 1XTIA 5TARA 1GCDA 2VWMA 5TCAA 4A1FA 5L30H 4HAWA 4B3GA 4GP7A 3KNXA 1Q20A 5KYKA 2DR3A 1P0SH 2BM1A 2O0KA 1QHHB 2AMQA 4A8JB 1QY6A 1A1VA 2GCNA 2RGBA 2Y7ZA 2P3FH 2QAAA 2DE8A 1UKVY 3PROA 1GBHA 3H86A 1PLJA 3DUXH 2BVNA 2RGNC 3P8FA 1TA6A 4ISIH 4MRRA 2ZYVX 4LHZA 2R8RA 3P6ZB 2B8TA 1LF5A 1SQ5A 4B2AA 1EZSC 1EQ9A 1DWCH 1IONA 2KB0A 1JRSA 3QNUA 4C4PA 4OS5A 3A58B 4M1MA 1CGHA 4LXBH 1GHXH 3T35A 4M9XA 4AYTA 1U0JA 3WBJA 3KUDA 2CE2X 2OUKA 4Q80A 1GMCG 4X8LA 3T1TA 1K1MA 3GCTG 1ZZZA 1PQ8A 1ZTKA 4NG9H 1OSNA 2O0HA 5F9FA 2P93A 3L3TA 4Q48A 3MG9A 1BMNH 3NHBA 4AI6A 1AUTC 4CR5A 1K1IA 1C5NH 1XXFA 1ABIH 3K1JA 3W90A 3BBPA 2ZHEH 2GCTC 1UAAA 4ARZA 2ZRMA 2TIOA 1A1RA 3TGJE 4FUJA 3ECCA 4IOJA 2OXCA 1L2TA 3BJIC 1WDTA 4GCHG 3RC6A 3NIBA 2AKYA 1TBRH 5CHAB 1DG1G 4A6PA 1XX9A 1XEXA 3REGA 1HBTH 1OE0A 2AL7A 4IS5A 1P2VA 3SI4H 1C1NA 1NRRH 1KZGB 1ZU4A 1CR4A 4JLAA 3AK5A 3TH5A 1ZUHA 3D8BA 2WPDA 3CF0A 3U4QA 4WH8A 1NIPA 2Y5FA 1T4UH 3Q7PA 5FBVB 4CH2B 1PPEE 3ADKA 3K65B 3L2OB 3U61B 2Z0MA 1MD7A 1G3EA 3ZZDA 3EW9A 2ANKH 1EOLA 2Z43A 2HT6A 1XTSA 2QPAA 1C9KA 3NK8A 2O8FA 1EJMA 2QZ4A 3T1QA 1FX0B 1YLDA 2VIIA 1P9SA 4FWIB 2CN0H 5C2ZA 4B47A 1MO5A 4GOXA 1AFEH 3AF3A 5KSZA 4I8HA 3BB4A 5JSZB 2W6JD 1P02A 1E32A 3T62A 4MNWA 2GK7A 1ESAA 3AGPA 1GL6A 1ZUNB 3NKKA 2GKVE 1DAIA 2QTVB 1HE1C 2FH5B 1O3LA 2OUAA 4P32A 5HPYB 4D9RA 1JPNA 3BORA 2PUXB 1OH5A 2J1LA 3VFDA 1XUKA 1HUTH 1P3JA 1GAJA 4D0NA 1NBME 1E2HA 1O3GA 2ODQA 1F0RA 1D3TB 3GY6A 1ELBA 1BTUA 2N42A 5HKKA 3EIEA 3RLYH 4K69A 2JA1A 1SC8U 1BT7A 1GJAB 5LPNA 1KKMA 2GEVA 2ZR7A 2PEYA 2O52A 1EAXA 4ZPXA 1K1JA 1Z8RA 2IF0A 1NKTA 2J0VA 3I62A 4BTIB 2JASA 4HFPB 5KNBA 1TGCA 2KJQA 3OY5U 3QSYA 1QHGA 1F0TA 1E2DA 1OH7A 3QPUA 3LGYA 4YOGA 2C99A 5DO4H 2FOBA 3A37A 4DB4A 4NWLA 4CEIB 2C8ZB 1XPOA 4YOJA 1T6NA 3SZEA 4MKFA 1WV7H 1QHRB 4O97A 5GJVC 3MH4A 2NZJA 1BIOA 3GLGE 5FUXA 4CHAB 5AJVB 5DHFA 1O2TA 4A2QA 3MNBA 1XMIA 2JKHA 1G3UA 3F9GA 4DW2U 2QEQA 4LPSA 4LC0A 5L3RA 1GHBF 2OXRA 4Z8YA 2BY6X 4CVNA 1V2MT 3EIQA 2YOFA 2WUBA 2F55A 1NVUQ 5KNCA 3QXCA 2V1UA 4ASHA 1HJAB 4M4SA 3LY5A 3FMOB 4MPUA 1TPOA 3B6EA 4B43A 1GI4A 4KVGA 1WAYB 4MGIR 2WJYA 3KQUA 1NG1A 1C1QA 1HAGE 3PLPA 5TV2A 2GT7A 3MWKA 2FDAA 3VB5A 3THWA 1HURA 2DCUA 3PV4A 1EATA 2WZQA 3X1DA 4TYQA 2PUQH 3EA9A 1TX8A 1KO1A 5A0BA 1AS2A 3W5JA 4LV5B 5E2PA 1FZZA 2F91A 2ZRKA 1XZQA 4YTAA 5ELXA 1IJFA 4Y8YA 1TX6A 4O0MA 3AVQA 1W3CA 2DFKB 4J1YA 1ZTJA 3A8BA 4ZCLA 3PB1E 2OQUA 4Y0ZE 4Q4JA 2JCSA 4GHQA 3AASA 3BG4C 3GLGB 5GJBA 4KV9A 2FZZA 5ANRB 2FSFA 1TMUH 2CJWA 5EQRA 2WHXA 2Z9KA 3R8CA 5JBAS 4TQUS 4Q4AA 3LDAA 5EXPA 3FGNA 3VU9A 3PWCA 2SGPE 4IXMA 1KDQA 1P12E 4JIMA 3U2QA 1C9TA 8OHMA 1LHFH 1TX7A 4L4UA 4I1OA 1Y5BT 1F60A 3DM9B 5F2EA 1P06A 2RB4A 2BBSA 5L3QA 4NGAH 1UDXA 4OHWA 2OFOA 2VIQA 3I8XA 3GDSA 4OYHA 3V12A 1EZQA 3PO1B 1OXVA 2BMFA 5E7IA 3U3RA 2QE7D 4YT7H 1R7RA 2CLDX 3V00A 1S85A 1PYTC 4JYUH 2PSYA 3VQTA 1E4YA 1AGRA 3T28A 3SU4A 2WV5A 2QXHA 2BLQA 2GDEH 2HYIC 4UNRA 1J16A 5EQQA 3AF0A 2GT8A 6GCHF 1TGNA 1BTPA 4HUTA 1GUAA 2YOHA 1ANCA 2IS6A 3ZH9B 1UTOA 5KDOA 1FQJA 4ZO4A 2CHAC 4NIXA 3BWDD 1UMAH 3P8OA 5K8TA 5C5OA 3PQCA 2J45A 3GJ4A 2BDGA 3V7TA 4DWJA 3CH5A 5BW8A 2ZPSA 4B74A 1PQ5A 2XB2A 5F8ZA 3NKVA 3LX5A 1C5MD 1P2QA 3FFAA 3SQEE 2OLJA 4WIAA 5C3NA 1ZNXA 4EKDA 3RXPA 4RCYA 4IW3B 1EFTA 1RRKA 4LBWA 2Q3MA 4FU7A 2YVUA 1TMBH 2W7SA 3TQFA 1THPB 1G7RA 1P04A 2P16A 2ATVA 3NVAA 3KFXA 3MLEA 3KXLA 2A1DB 3TR0A 2XNSA 1HAVA 1CO7E 1EX6A 1WQSA 1OJLA 3GLIA 2QAGC 3MU8A 1P60A 2A9KA 1DY8A 4XJXA 2XOKA 4DT7B 1S9DA 3I32A 1K8RA 1ELOA 1RJ9B 2YZ2A 1KNQA 3THXB 2VA8A 1ABJH 2ZYTX 3OTJE 1OYQA 4A1TA 1GI5A 1T8MA 2OESA 4TN1A 4I8KA 1WXRA 3E0PB 2RGDA 1NP6A 1XFAA 1Z47A 5H1YA 1MU8B 3FANA 2AR7A 1KY3A 4ABDA 3QPWA 4FD2A 1NN6A 1YKTA 5ESBA 1GP2A 2PWXA 2F43A 2R44A 4AG1A 2ATXA 3VB4A 1WB9A 2ZROA 1DO2A 1GHWH 3QKRB 1N0VC 1BBRE 3Q5EA 5FUWA 1AY6H 1D9ZA 2FSGA 1W4RA 1SQOA 5GDSH 3TJVA 2YJTD 1KJWA 3GJ6A 1QHYA 2VHJA 2RGCA 3VKWA 1O3YA 1YZTA 1VMAA 4FUDA 2R9PA 2BXUH 3NPSA 3S9CA 1LF0A 3KQKA 3U8RH 3AVTA 2B7CA 2Q3HA 1YZUA 3EIHA 1IN6A 1SVLA 1DVAH 2HNTE 4Q1AA 2D62A 1TNLA 2F9UA 5EP4A 3NDBB 1GWAA 1NO9H 1QR3E 1KIMA 1W5SA 4MG3A 1GL1A 2ILNA 1J15A 1IQEA 1RTFB 1O3JA 1HT1E 2GCHG 1AQYA 4RZ3A 3SFZA 3EC1A 5H8WA 1N6KA 3NBYC 1UPTA 1IHSH 1X3SA 3U60B 2EEKA 3EWAA 5HZKA 2GAOA 3SNHA 4LHWA 3TH3H 4YXWD 2G0NA 2DWOA 3G01A 3U3JA 2QXJA 4NYJR 1O2OA 5TMPA 2C98A 4LX0A 3S9BA 1DADA 1QBNA 3MU1A 1HJAC 3PMHB 1WYKA 5HZHA 2ZE7A 2Q3FA 4AG2A 3DKVA 2W58A 2WIBA 4PPNA 1V2JT 5G4BA 2H1UA 2GEDA 2P2LA 1KI1A 3OHMA 1YLCA 3AEZA 1BYUA 1MOZA 2Z94A 1CU1A 1ZPZA 1EZXC 3HATH 1BMLA 2STBE 2ZS7A 1N8OB 4IDPA 2H1LA 5D3MB 2GILA 3M37A 4LZ4B 4KO8A 1OP8A 1EFHA 2CVHA 3M5OA 3TIFA 2J95A 3T2NA 3QF7A 3CRQA 2O8EB 1DAHA 3L6PA 1V2RT 5KTYA 1RJ9A 3RC5A 2AXPA 4C0LA 5JPMH 4RD0A 3SW2B 4PC6A 4Q9JA 4ZKOU 2P6NA 1D8TA 1G18A 3Q00A 1TL7C 1W7GH 2WAXA 4WZBE 4PR0A 1DDJA 3ZQ6A 2GETA 1WBGB 3ETLA 3C7KA 1DY9A 1EAUA 2CCKA 4LHYA 4ZDIA 3SJIA 3DL0A 1ETUA 3ZZ0A 2QE7A 1YPGH 4W7SA 1TBZH 3B85A 1BIFA 2C04A 3SV8A 2ZUBA 3CNOA 2QU8A 1E0KA 3M7TA 1SI5H 3QEJA 4MGYR 4MQAA 1OH6A 3WMEA 1SVIA 5A09A 4AGKA 2XSZA 3ATKA 4D0LB 4CRGA 4ZH8A 8ESTE 1O2XA 4M9QA 1A7JA 4SGBE 3PMAB 3K0CA 3CNLA 2QBYA 2VVVA 3SNBA 3M36A 4G5SA 4HEJA 4XH9B 3IDQA 4Q9IA 2ZFPH 3LLUA 2FX4A 1W36B 3RXHA 4E06H 3EZ6A 4Q00A 1OH8A 3U9AH 1C1RA 2STAE 2ZVQX 2FFQA 2JLYA 1A46H 3RS2A 4X6OA 3ZZAA 3W3AA 3DOEA 2FESH 4U30A 4U01A 4X8OA 1ZM3A 4Y0AA 1W0YH 3CIOA 2Y81A 3HR8A 3F8TA 3T06B 4R7ZA 1OV4A 1QQUA 1GM5A 4AYWA 1GBTA 5EZ6B 2OCVB 5J4QA 2F43B 5DP7A 1WBDA 4PO9A 1O3EA 2Z9LA 1VCQA 1UVUH 1MTUA 4LYHA 3MJHA 2DBYA 1XUIA 1AK2A 2RG3A 1H9IE 3QZRA 1XRJA 4FUFA 3UY9A 1T8LA 1ELGA 3GOVB 2W3KA 2HJGA 1LO6A 3X2SA 1AUJA 221PA 5E0JA 3BTDE 3GCHB 3A7WA 4XDEA 4PZYA 4RFSA 1TGBA 2FXRA 1XNJA 1FNNA 2BCGY 5EP2A 1LKAA 2CL0X 3TGKE 3LO5A 5EXLA 5A0AE 4B2LA 1E2NA 2XNDA 4KAXA 2AXNA 2ZQ5A 2FFHA 4V0ME 4ILEA 4Q02A 4Q4AB 4TMZA 1R5NA 3RDZA 1ZSKA 4CT4B 5J47A 1TFXA 3HPRA 1KLIH 1IQIA 2GTBA 2OTVA 4IBLH 2PH1A 2YWEA 3FB4A 1NN0A 2D06A 4E07A 3NXSA 3PR1A 2G00A 4JZ1A 2I1VB 4L9WA 1N0WA 3IQWA 1AKSB 1A0JA 5LDDC 4X6MA 2IYQA 4HI0E 4X8VH 4QKQA 2FEMA 3VX4A 1GBAA 2GJ9A 1H8IH 2W6IA 1B0EA 3V3MA 1YU9A 4DIHH 3UATA 1U94A 2IUUA 2QMUA 1RYHA 2P6UA 1MTVA 4A0FA 1W2KH 2O8DB 5IYTA 3ELAH 1AIXH 1TAGA 1ZJDA 4O3MA 4ABGA 1KSJA 1IQLA 4UFDH 5EW1H 4NP6A 2O8BA 3IBGA 3LNCA 5ESTE 5SZKB 2YWFA 4IDOA 1YBWA 2FPMA 4BEJA 2GWHA 2VIPA 2QPTA 1S83A 3PWBA 3SBKA 1O5CB 4I4LA 1GDDA 3FMIA 2BJVA 5C2JB 4JK6A 3JZ2B 1CXZA 1G2LA 1TPPA 1XM1A 4LYAA 2YOLA 1IN8A 2NO9A 4A36A 1AZSC 4ZI2A 4N0EA 3IG6B 1WSSH 4TPYA 2IYLD 1KY9A 1S0RA 8KME2 4ZDJA 4NHOA 1CA0C 2P59A 1M2OB 1VCPA 3QXXA 2Y80A 4NCJA 5J4VA 3LFUA 2IUTA 1MKXH 4DRZA 3BOSA 2HNTF 3S9AA 4IW4E 2ZAMA 1QRAA 3RXIA 4UFFH 1SOZA 1IXZA 1ZVQA 3OEHD 3CBQA 3BG8A 4JL6A 3HPTB 1ZR0A 1S0QA 3BTKE 1O37A 2RHDA 3E70C 2CL6X 3X1WA 4OHXA 1C2MA 1KXDA 2GTPA 1VYVA 2X19A 4NFEA 1C2FA 1B5GH 1GI2A 2ZTSA 2FEOA 1QRWA 3U4QB 3SN8A 1KAOA 1GNRA 1ZTLA 1E4VA 3MMGA 3AVXA 4EAQA 1E3MA 3T34A 4Q7XA 4V0NA 3K70D 2BV3A 3THWB 2XBWA 3RAPR 3OE7A 4TTRA 2R2AA 2TGPZ 4PZZA 2D7CA 2R6DA 3UG6A 3CRMA 5FTKA 3ZZCA 2BHGA 2F1RA 4H6TA 4KTSA 1W14U 2SGQE 1E1RD 4CR9A 3LQQA 2AGIX 4XBCA 3LIWA 4W9MC 1D5CA 4F4JA 2CF8H 1OIWA 1JNYA 2WMOB 2QSYA 1JOUB 1LHGH 3I73A 4PHTA 4AKIA 2QF3A 2ONKA 4B3FX 2RA0A 4LZZA 2SGDE 5CB6A 1Y3YA 2QTHA 3FKSD 3OIWA 3ZQJA 1OFIA 2QGNA 1FTSA 4CBOA 1FX0A 4OK3A 3GY4A 2BZAA 1ESMA 2Z3CA 2ODWA 1XKAC 1QVAA 3FYHA 1ZW6A 2IYYA 3UPUA 3ZZ3A 1UEJA 5FBEA 2AH4X 4AFUA 1O33A 2ANMH 4US0R 3FWYA 1F5RA 3Q3JB 5TB5A 4LOYH 2ZE8A 3QXSA 1CT2E 5JYIA 4KYIB 1VCWA 3AF1A 1XEWY 3NC1C 2WWXA 5HR5A 4HATA 4NWKA 1ELAA 4CIDA 1QJ1B 5F98A 3OYPA 2OBMA 2JJ8A 2CJIA 4K1TA 1G3CA 2JGNA 2ZXUA 2BHRA 4KITB 1E94E 3L8ZA 3OY6U 1Q3XA 5J4KA 3T29A 1LNZA 2CHVA 2QNRA 3TSWA 1GL9B 3MGCA 4ITRC 1O87A 1O2NA 2EU8A 6LPRA 3AKYA 2DHRA 2J38A 2B9LA 2J41A 4Q1FA 3IKJA 1CR1A 5DIFA 2WKQA 3GCHC 2BY8X 1ZYOA 1NF3A 4QGGA 2AS9A 4K8BA 3QTVH 1GRQA 3A8AA 4HSEA 2ZITA 3AUXA 2R3UA 1EUFA 4P4SB 2P8OC 1MO6A 1GBDA 1F2TA 621PA 4LGMA 3H7TA 1O3CA 4KELA 5FPHA 1TUIA 2YC4C 2OE2A 1G1MA 1NFXA 1N1LA 4DC9A 2BD3A 2ZGBH 2REXB 4OI4A 4PC3A 1MO3A 4Q7KA 1SGCA 1ZINA 4EPWA 2OP9A 4U5XA 2ZP0H 3SU8A 2IXEA 1II8B 2TRMA 1U8YA 4CT5A 4WVFA 3UXMA 3ZZ9A 1U9IA 4D25A 3LWNA 2E9SA 2G55A 5T3HA 4W5WA 1HXEH 1T0HB 1SSXA 2Q21A 2GKSA 5JI2E 2VBCA 2A4GA 1UK3A 1E6CA 1QJ6B 4VGCC 2GNOA 3PXGA 1E0AA 5DI3A 1BYIA 3FHTA 3KKPA 2BD8A 4ABHA 1O5BB 3REFA 4C0KA 1Y59T 3CF2A 2C78A 4NIVA 4Y11E 4DEYA 1M7BA 4LY6A 4V0OA 2ZFQH 1HAOH 1VZQH 9LPRA 5I46H 1YZGA 4BLOA 2CHAB 5EW2H 1SHKA 2GZAA 1XEWX 2YWGA 2PFEA 1HB0B 5CHAC 1OHHD 2LPRA 1VDZA 2NPFA 1TA2A 4DLRA 4SGAE 1UVPA 3P20A 1O32A 1DLEA 4M1WA 2YNAA 5EE5B 5C20A 2N1BA 1YZQA 2D3WA 2IS1A 1BB0B 5BWMA 1OW3B 3C27B 3P26A 4JBYA 5AVDA 2A3RA 1GGDB 3VGCC 5E95A 1BBRK 4FCTA 3B1YA 4R98A 3VR6A 1O3FA 1UTMA 3ZIAA 2VPPA 4TWYA 3V13A 3HPQA 1BJUA 2VNTA 3B13B 4ABIA 2A5KA 3SEAA 3PO1C 4TYNA 1VG8A 5FTMA 1BRBE 4R71A 521PA 1A5TA 1T8OA 3RS0A 2PKAA 1WTGH 3SV2H 2UWPA 1L4YA 4I81A 4KCGA 1V2KT 2SNWA 2AYWA 2F1IA 3R7WA 4P4SA 2ZG0H 5LPEA 5FFMA 1NRSH 1FN8A 1NSTA 1QCPA 3RU4T 3SGBE 2AK3A 4CW7A 1ZAKA 1Z07A 2CNWA 2ORWA 2ANYA 5FTLA 2ZRNA 5FBWB 3QIAA 1T7CA 3TUJC 1TB6H 2Z4RA 2ZJ5A 4JS0A 3CZPA 4BAOB 1IQMA 1VJ9U 1NTPA 5LBIA 2QAJA 1GMDF 2P65A 5SZHB 1LPZB 1K5DA 2GF0A 3BE4A 4NZQA 1S3SA 3MFYA 1R8SA 3TGIE 1OIXA 2OBOA 3QQ5A 3BTHE 2CEAA 1JEEA 3NBZC 1XD2A 3A82A 1ZPCA 3SJ9A 3GY8A 3FDIA 4KJZA 3GFPA 1SGEE 4M0LA 4LWZA 1R2QA 4I8GA 3UWIA 2F9NA 3L0OA 1W44A 3E2IA 2FOMB 2V54A 3R20A 1XBTA 2LKDA 2A7HA 2ZJYA 3VAAA 1RGQA 1U6QA 2CV3A 2OC1A 2WMNB 1OIVA 5JSZA 2O8DA 1I2DA 4KTCA 3EDXB 5EU8A 1NVXQ 2XW9A 2QA5A 1BTZA 2GVDC 4NTZA 3TBKA 1HV7A 5JEDA 3GJ7A 2QUZA 4HZUA 1OOKB 3W6OA 3ZVFA 2EI6A 1CHGA 4D4LA 3NTUA 1TRNA 2DE9A 3MAAC 2WICA 1W0JA 4F4IA 4H42U 1Q1EA 1WP9A 4VGCB 1SGIB 1SLWB 1E79D 1A2BA 1B7XB 4C30A 2NO7A 4A8JC 1G8YA 1ORFA 4O2LA 1QURH 4G5OA 1L2EA 1MCTA 3B5JA 4A2PA 5KPJA 2ZU3A 3HJNA 1NMZA 2ODYB 4RVCA 3HK6B 3KFVA 4IOMA 4EJSC 3R8FA 2QTFA 1Z29A 1OKXA 1FPMA 2BX4A 2VSOA 3QKTA 1P10A 3OIVA 1SGFG 4DCNA 2CDNA 2NO0A 5KPDA 4TMWA 1G20E 3ZYDA 3GJ0A 3M3TA 3H4MA 1G16A 1MAXA 4PO1A 5JLJA 4HDOB 1FZQA 3HU2A 1CQQA 4OS7A 1R0ZA 1T5IA 1IAQA 1VCIA 2FFAA 3EX7C 2VVUA 3DPUA 4JJZA 2GJ8A 3VHLB 5A0CA 4OS1A 1ZNYA 3M5LA 1W0KD 4AFZA 4OS2A 1LFDB 1NZQH 1PQAA 3RXGA 2O8BB 9ESTA 4G1UC 3CLVA 3B1ZA 2ZU6A 1CVWH 2O8TA 2HEIA 1ZCBA 1OB5A 3P27A 5G53C 1US8A 4G01B 3FZDA 2AX4A 4DURA 5A4JA 2B7DH 4B44A 3AVPA 1BTYA 1BHXF 1DS2E 1DICA 1KTVA 1OHHA 1A4RA 3W6NA 5TVKA 3CENA 3AVYA 1KGDA 1TOCB 3CKLA 1GDNA 1NFUA 2SGEE 1C2DA 1EWRA 1Q0UA 4MUBA 2DY1A 3D65E 2XOKD 3MYWA 2WKPA 2OFWA 3RSLA 1FAKH 3RXKA 1FLEE 5EG4A 1SKYE 1IXSB 4TZ6A 1MCVA 3QX5H 3NEJA 1E2PA 4MDSA 4ABYA 1ZM9A 2J34A 3E3TA 1MH1A 3D31A 2HGTH 2A5GA 4JSTA 1P2TA 2ZJBA 3BN9A 3PV5A 3K70B 2ZTZA 4ACBA 1UADA 3SJCA 2QENA 4IEIA 1BZXE 4EPTA 4D0GA 1Z5ZA 4TYDA 3HYTA 2GXAA 1WTHD 3GCNA 3RC8A 2Y8EA 3NH6A 1QBKC 1EB2A 4ZI3A 5EJEA 1TNKA 1ARBA 1ZD9A 1P2NA 1KXAA 4Q01A 1E0FD 4YMWA 2P95A 2PCJA 1V2ST 5DYGA 1C5TA 1YE8A 4B33A 1UBEA 1KYIA 4WJG2 1ZRBA 1W8BH 2GDJA 4BQSA 2VIDA 3MHWU 4NSVA 1Y3UA 1ZJKA 4HLQB 4O25A 3N7OA 1KDRA 1XKBC 4E22A 1ZMXA 1W48A 2V6NA 4L15A 3AF2A 3AGQA 1KO4A 2B5TB 2OC0A 3E5HA 1U0LA 1X86B 2IPHA 3PUZA 1IOEA 4CRFA 4PAQA 5E7MA 1VIAA 3Q8XB 4TLAA 1OFHA 1W7XH 1TGTA 1FNMA 2C77A 2FYRA 3FVQA 4NSYA 3CWZA 2CMYA 3KQLA 1TF7A 2GMTB 1N0UA 5IT5A 1JR3E 3QKSB 1D2NA 1VKJA 3EAJA 4MYTA 1GJ4H 2KSQA 4QJ3A 1HCGA 1FMLA 1Z6JH 3BTGE 3SBDA 4NIYA 1FXYA 5KO2A 3GY2A 3TH4H 4WF8A 2BLVA 1MTWA 2PCLA 1N2CE 4WZ6A 1XJ0A 1Q1ZA 1S5SA 1E79A 5EPNA 4NH0A 2QMHA 2BX3A 3GDVA 2YC2C 2CJWB 4BOHA 3FHCB 3PFIA 2B8OH 1MABB 3BD9A 4IXNA 1OSSA 1GIAA 2OG2A 2HNTC 5EQSA 4X1QU 1R4AA 4D8NA 3A7XA 2KE5A 2XC0A 4DCVA 3F1SB 1S9HA 2ZI4A 5CLLA 3ATMA 4DIIH 3OAAA 2QGZA 5JRZA 2ZGXH 1OPXA 1G4UR 2QP9X 2BVXH 1F0SA 5CIQA 1SVKA 1JIRA 4W5HA 4DLVA 4W5JA 1ONBA 3LONA 4Q4LA 3SYNA 4FU8A 4EQ6A 1KXBA 3TE6A 4ZIRA 3P32A 3SQXA 2C2HA 2Q6DA 1G5PA 4A7IB 3THYA 2VVCA 1H1BA 1MR3F 3UQOA 1SVOA 2OQ5A 1PQ7A 2Z83A 1GFIA 2VH6A 2P6RA 2FWWA 2ZM5A 3DO6A 4LJ7A 4ESVA 1NESE 4MRNA 3TITA 3QOFA 4TLCA 4B75A 1EG7A 1CKEA 1EOJA 3C8UA 1V2WT 1IHTH 5HYOA 5JJKA 1V3XA 2ZQ1A 4HB2A 3ZJYA 4JBXA 1NBMA 1CJMA 3PVSA 1SGRE 2TGDA 3MO6A 2MSDB 3DFLA 2A4QA 2BWJA 4ZKRU 3FZZA 4Z1MA 2QC2A 5A8XA 1C5VA
chains in the Genus database with same CATH superfamily
3EG5A 5H16A 1HF3A 3Q3VA 2P5YA 2NZ8A 2AGEX 4D74A 4XQ9A 1YDEA 2WU0A 4XFQA 5JO0A 2JATA 1K6IA 1MRNA 3UB4A 3QWIA 3TK6A 5KU7A 1V6SA 1YOBA 1U2EA 2RH5A 4X1KB 1VLQA 4QFBA 2A5JA 3IJRA 5EA2A 3EZLA 3NGLA 4ZHSA 3I2JA 2OGUA 4PIPA 2ZQYA 3VR2D 3A36A 4UQLA 4V02A 1JJVA 1TQ8A 4C2AA 3D4BA 1NNEA 2QYIA 5JB9S 1SPJA 2R86A 3CLUD 5GGYA 3RFFA 5BQFA 1N2GA 1DUEA 1AD8H 1YWGO 4NFSA 5T7BA 2W8ZA 3N87A 3DZIA 1GFSA 5D2CA 2W4MA 3RTDA 4QQ8A 1N2JA 1XMQB 3E9MA 3JPWA 4ZI7F 4IVQA 3UV7A 1G42A 2I6UA 3LA8A 5KSYA 1H2YA 3L40A 5HTKA 4AURA 4PZAA 2Y1OA 1QPZA 1FIWA 1X70A 3WDMA 4GE3A 1NLUA 2H4HA 3AH8A 4CKYA 1UEXC 1E9VA 4CZ2A 5EE1A 5FI5A 2C5GA 5GJ4B 1FOEB 1ZM4A 4ZOLA 3ZJ4A 2ZWMA 3GLHE 4RACA 2GASA 2PV0A 2ZHDA 1ARCA 5A3VA 3VYRB 1NHWA 2VTBA 4ZVLA 1Q16A 1GSAA 3EK2A 1MAUA 1I4LD 3L8FA 1R4ZA 2X8LA 4RY8A 4X44A 3T9DA 1THMA 1SGPE 1A97A 4TLEA 1TU4A 2QZPA 2C9ZA 1NRPH 5EPYA 4B2BA 2BHLA 2F64A 4AP6A 3K2QA 2VT2A 4FOUC 4S35A 2QXGA 5AKJA 3BL5A 1QG0A 2QRKA 1EP6A 3ETGA 3PG5A 2IOFK 5F4BA 3G85A 1NQVA 2G40A 2HFKA 3E35A 4C04A 3VMFA 5MN6A 1SLXB 1HSZA 3K09C 1JIXA 4HDSA 2QL6A 5D00A 2A5IA 5I5GA 3VSDA 3W2HA 1UC4B 2I9KA 2FW6A 2B61A 4UXJA 3KD2A 2WWGA 3WKBA 3J81A 1ORWA 4Z9YA 2VDRB 2ZS8A 4RZQA 3IITA 3M6AA 3DO5A 4TTPA 3HN6A 1BMMH 2G71A 3C39A 2G25A 3HCRA 5CTAA 3RU2A 3PGJA 1PDVA 2BHTA 4DFDA 4FX2A 4MUAA 5DBEX 3I9FA 1E9AA 2ZPQA 1P5ZB 3JVIA 1XC7A 1VPLA 1YFKA 1CCWA 2VO1A 4PFJA 4XVRA 5IVIA 1Z8FA 1BOQA 1FW8A 1S2MA 1D2HA 2Q4RA 2CXQA 3NBQA 3QX9A 1U0SY 2AFRA 3CEHA 5BXQC 1FE8A 2J3HA 5DNUA 4QFDA 3T7JA 1M75A 5HQJA 4CT0A 3WK7A 5L4NA 4WZZA 2QD1A 4DA8A 1V4BA 2QD3A 5ARDA 1J39A 1WF6A 4WNCA 3FWNA 2O5RA 4EEZA 3GROA 4GLBA 3CKMA 1L7PA 5BUSA 2R2MB 2VP2A 5G0TA 4DWWA 4BLWA 4MV4A 1KSGA 5ADVA 3ICPA 4I8XA 1CT9A 1XCPA 1LVHA 2UZ1A 4J91A 2VJKA 3NAQA 2B6NA 4RK7A 3VOSA 4BNGA 2CF9H 1PWEA 2UWLA 3G6WA 2V3CC 3COJA 1I13A 2H9AA 1I0ZA 4RELA 3I9LA 4YV2A 1MFPA 1M8PA 3KYCB 2AOUA 2GV7A 2ZFTA 3IEXA 2Y1XA 1DARA 2XZOA 2RG7A 2VDJA 3A0RB 1ULSA 2ZFUA 2H08A 2FW7A 1Z12A 3D3JA 1FFHA 2EFGA 1K4MA 4L0DA 2WIJA 1H85A 4CRDA 1Z4IA 4XIJA 4MI3A 1F4LA 1LFAA 2Z9DA 1XZFA 2QP3A 3AOEA 5AFYH 1GMHG 2RI1A 1MGPA 1XALA 4RD4A 3TUIC 2OORC 3ZY4A 1CPYA 4CMHA 2AG6A 4KE8A 3M3SA 1MLDA 1DUAA 1GHVH 2PJDA 3Q98A 3LC3A 1Q0TA 1UPUA 2Q9BA 2FEAA 5LNK6 2D59A 1QJ7B