4B75A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 208
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b75A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b75A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b75A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b75A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b75A03
1MH1A 4VGCB 2FIRH 2AFHE 1BBRE 2R3UA 3F8TA 3ZJYA 4AYVB 2WWWA 3HKJB 3GJXC 3UWJH 4DLZA 3VR1A 1KK0A 2YC2C 4DXAA 2IEYA 4QGGA 2WPHS 2GXSA 1LO6A 1T8NA 1SLXB 1IN5A 4ZCMA 4ERNA 1RIFA 3CPEA 2OLJA 4DW2U 2IS1A 4Q1DA 1FL9A 2Z0MA 3VNVA 1RJ9A 3N2EA 1GJ7B 5JWHA 1RXPA 4ABBA 1OP2A 3RC6A 2QQ0A 4AN7A 4OS5A 4LBWA 2P5TB 1J15A 3CRVA 1FPHH 1Q21A 1QJ1B 3THWB 1VYTA 1G21E 5AFYH 2QAAA 3LVQE 5GCHF 3MRSA 1CS4C 5B6LA 2QP3A 1TQ4A 3B1VA 1OFHA 3VFDA 3K9LA 4JK6A 1DOAA 3E5HA 1KXDA 3AF3A 1ZNXA 3TH2H 4AX9H 2KB0A 1EQ9A 3KQDA 4PAMA 2YWFA 2HF8A 1UTJA 4RCYA 2GF0A 1UEJA 1HPGA 1BBRK 3PTBA 1ELAA 3X1WA 2C95A 2A7HA 1TX4B 3PR1A 1QB1A 1U0JA 2JLXA 1CRQA 4JKIA 5SZJA 2A3RA 2QMUA 1GCTC 4A5TS 2UZIR 3OSYA 5JBQA 5EXXA 1O2NA 1HY3A 1JR3A 5HZKA 5FOTA 3RXDA 2WPIS 1BTXA 5BN3A 3GISB 3RS4A 2H18A 3LW7A 3WBKA 3WY8A 4JYUH 2O9QA 1QURH 4M9QA 3B13B 4ZDKA 2BOVA 1VG9B 4M1WA 3I78A 5ESTE 5FPSA 1KSNA 2WIAA 1HYLA 1QHSA 1BMNH 4WOPA 2W00A 1KSJA 3THXA 2AN9A 3VB4A 3K9GA 3RANA 3RXUA 1XPRA 2D4HA 121PA 1UHBB 1AKEA 1ZU4A 3U8OH 3D3QA 1MD7A 2FTLE 4JZFH 2J41A 5FR1A 1VGCC 1HJAB 2O5VA 1UTMA 1NSFA 2IYRA 1E9SA 2XB4A 2CL6X 4H9GA 1RRFA 3EZFA 3MO9A 1L4UA 2GRJA 1L0ZA 5DYGA 3I73A 3U3MA 2GK6A 4NONA 2BY8X 4IC5A 5EQRA 2BLWA 2B7DH 4X8SH 5DP8A 1TRMA 4JJKA 4M53A 1VPLA 1Q1EA 1EZXC 1L4ZA 4FUCA 4C4PA 2WJYA 1KSGA 4PPGA 4FVDA 1NO9H 4EAQA 4NA9H 2QQEA 3EPKA 3H86A 4TQAA 2OE2A 4A8JC 4A2WA 1RIWB 2DWOA 3AF1A 4POAA 4HB2A 2G3YA 1TFXA 1G3MA 5TDHA 1NRQH 5SZIA 1QHHB 1GP2A 4D0NA 3L8YA 5G3YA 4PPFA 4CIDA 1P2MA 3MU5A 3NXPA 1TX8A 2E1RA 2NO6A 4B2LA 4LV8B 2Z9GA 3PTNA 1O3MA 2R9PA 3TBKA 3HU2A 1I4DD 5A0AE 1C5ZB 2KAIB 1F0TA 1FNNA 1IBRA 5A09A 5T3HA 4UDWH 3ADCA 2FLRH 3D49H 3B8HA 2F1RA 4WZ6A 5LDDC 8GCHF 1S6HA 3QPVA 5L2YH 1QRXA 2WPLS 1TA6A 2Z9LA 2CE7A 4D26A 3RXCA 1THRH 3SUGA 4PO9A 3D31A 3M5LA 3RC3A 4PROA 2WMNB 1F5KU 1LPKB 2GJAA 1LVOA 1KZ7B 1J70A 4JVMA 2J2UA 4BLOA 1MU6B 2Z94A 1HAVB 4PC7A 2XSZA 2EYUA 3TSZA 3QKRB 4PQYA 1EB2A 2QZ4A 1C4Y2 1IQEA 4OL0A 2F9BH 2ECKA 4X1QU 3DEFA 4KFTA 2P16A 1KLTA 3AP1A 3RRYA 1QA7A 4M9ZA 2QUZA 4EQ6B 2CK3D 1GMHF 4U7DA 1QTFA 3NHAA 4IW3B 2VF7A 3RM2H 2Z9KA 4I81A 1ZSLA 2H16A 1YRBA 1VJAU 1O3HA 3AVYA 721PA 1ZHPA 3IITA 1J2JA 1YPMH 4NCJA 5IK2D 3LU9B 2R0KA 1Z8GA 3SJ8A 3NBXX 2Q0HA 3LX5A 1INCA 1FN8A 1O5GH 3QXJA 2D1JA 5SGAE 3CNLA 4Q18A 2WKQA 4A1XA 2M5TA 1RE0A 4DIIH 3W6OA 1G36A 1V2WT 4TLDA 3NH6A 2NU4E 1OJLA 3W95A 3UANA 1SGQE 2W26A 1P2QA 3D6TB 2GCHG 1GBHA 3FZZA 3A58B 4YMVA 1IQHA 3HK6B 4JL8A 1VITH 1ETUA 2GEVA 3ZZ9A 3A88A 4UE7H 2FJUA 2SFAA 2YJTD 3L2OB 5H1YA 2FU5C 2B9LA 2H5DA 3BH0A 2EEKA 2UUFB 3JZ1B 4BFTA 5L3SB 4YMUA 1LTOA 4TWZA 2DY1A 1IN7A 1NPMA 1RRCA 2IF2A 1C2GA 1SLVB 4UFGH 4URUR 4I4LA 2IS6A 3I4LA 4BRUA 4LJ9A 2VVVA 1UO6A 2GCNA 3A1UA 1GJ6A 1SVOA 5GJCA 3TR5A 2ORVA 1ONBA 3UMSA 3HU3A 3AASA 3E1SA 3AKYA 3BFVA 1EUFA 5EQTA 3A81A 1C5LH 3BEIB 1SFQB 2L0XA 2AERH 1XEWY 2VIDA 1E1RA 4DVAU 4M8NE 2CLDX 3I62A 4HDQB 4URZR 5LD2C 1OLOA 1AVXA 1L1JA 2JJ8A 4NH0A 1S3GA 2FH5B 2P8OB 3PEYA 2R62A 2QN6A 1EAUA 1E99A 2XWBI 1KJYA 2DR3A 1JEEA 1LKAA 3WNDA 4IDNA 2FEOA 2A2XH 5IK2A 1SGIB 3X1XA 4XVRA 4L5BA 1WA5A 3MHWU 4RKOB 9ESTA 1US8B 2JCSA 4URVR 1TNHA 2V3CC 1OSSA 2IS2A 4BLSA 3ODDA 3SV7A 4AG2A 3TKLA 2WSSD 1UCYH 1SVKA 4JT2A 1LHEH 1HAZB 5FBIA 4MYTA 1LQDB 1P01A 3U3JA 4R98A 1FFHA 3FMFA 2ZQ2A 1FY5A 1GJBB 1M9UA 4JMYA 1U0HC 2OBLA 1TF2A 1FDPA 5GCHG 2GXQA 2AD5A 1SC8U 3PV0A 4PAQA 4CEHA 1ESNA 3T5GA 2D06A 3K9NA 2ZI7A 1RJ9B 1ELDE 4JL6A 1TPPA 4DT7B 1P0SH 3MNCA 3HR7A 1OB5A 1Z1JA 3BAFA 1SKQA 3O8RA 1R5OA 6CHAB 4RFSA 3U3RA 1DADA 5EZ5A 3MWLA 1BYIA 1VTKA 1X1SA 5ELXA 2I6SA 3KQBA 4XBDA 4B3CA 2N1BA 3WY9A 2F7SA 4MYUA 3ETLA 5LPNA 3NEYA 2B8TA 2HDNB 1IAQA 3RYTC 3RLWH 2H8KA 3VR4A 2FFAA 2ZUCA 1TF5A 2SGPE 3E2IA 2IXGA 1ORFA 4QBIA 3Q3YA 1KK3A 3NUMA 2SNVA 1NY5A 2A32A 4AK9A 3UMRA 2XC4A 3B6EA 2P94A 2HNTC 2QGNA 2KBEA 1C1YA 3BB3A 521PA 1E32A 1AZZA 4O25A 1PPCE 3U61B 5FBQB 1T6NA 3EXAA 2HPQH 4KBGA 1LY1A 3D62A 1F3OA 2OBNA 4YOGA 3TJVA 1E1QD 4FUEA 4NGAH 4RZXA 4EPVA 4KSBA 3UIEA 1ETSH 4FXPA 3SU5A 4OI0A 3TMKA 4G5SA 1P60A 2VBCA 4ZI2A 2ZDLA 3THXB 1UVSH 2OBQA 1MCTA 4ZV4A 3A6PC 1PJPA 1NMZA 1TEVA 5C1YA 4MNVA 2HT6A 2A9KA 4ABGA 1JMOH 4R7ZA 2ZI2H 2UKDA 4GFDA 1HIAB 3SFZA 4X2YA 3W3ZB 4BFSA 4Q80A 4A0GA 4YXWD 2P5SA 4ISLA 4DRZA 2QT0A 3GY3A 1VIAA 5E0HA 2JH6D 1C5MD 3A82A 1DAGA 2GZHA 2Z3EA 3SZRA 1SVMA 2WUCA 3SJOA 1TE0A 2A7CA 1BO6A 5JEEA 3VHLB 3QKUA 3AKEA 3IHLA 4CF7A 3A8BA 1M34E 2GXAA 2GCPA 5FAHA 1QVAA 4X1RU 3MSXA 5EXMA 2R9VA 6ESTA 2P95A 2J4IA 1WRBA 2YNBA 2QAGA 3T15A 2MSCB 4JLKA 2GETA 3EC2A 1E0JA 1C4U2 2RGXA 4IC6A 1TU3A 3LONA 4B3XA 4DDVA 3GLFE 1JAHA 1FTSA 1QQ4A 2OUKA 4YONB 2ZIQH 3SQEE 2FLBH 4JVSB 1E4YA 1N6RA 1KI3A 3BB4A 2J87A 3VX4A 4ZHLU 1GILA 1U8ZA 4TYNA 4PC3A 1TPOA 1OKXA 2PT7A 1O2KA 2OBMA 1NRPH 4JKYA 3PG5A 2AMDA 4K3JA 1MTNC 2ZO3H 1TUIA 5DI3A 5E7MA 1FJSA 2Y8EA 3U4QB 8GCHG 2XEXA 1BMLA 1Z8RA 2ZCLP 5EE9A 1KNXA 3RXVA 3WNCA 4RJLA 1KY2A 2GX4A 2PSXA 1W4CA 4KGAA 1Z6XA 5EPYA 4D9RA 5DHAA 2QENA 1YLDA 4ZDWA 4QHTA 1A7JA 2WM9B 4A0HA 2Y81A 3WP0A 1A2CH 3EC1A 3VHXA 1A61H 2Y7ZA 1DFPA 4UNQA 4IMZA 4LSGA 2QSYA 5J40A 3SZEA 1KO4A 2ZC9H 1HJAC 4XJXA 1NVUQ 1UTNA 1NP6A 3Q85A 3LJJA 1KXEA 1CF4A 2QM8A 1GGDB 1VCMA 2ATXA 2CN0H 1OFUX 1XD2B 2BBTA 5KNDA 5JJLA 1SQAA 1QBVH 3EQ0H 1GMHG 1P62B 1P12E 1YZNA 2C03A 3R7WA 1F48A 1K9OE 2XAUA 3OE7A 4SGBE 4HTCH 3SYJA 1EJNA 3EPHA 3KQEA 2OC8A 5CYPA 1ZPCA 1J9CH 1D2MA 4B74A 1CT2E 2N42A 5I46H 1DO0A 5FX6A 4LYJA 3DOFA 1KDOA 4M0LA 4TPIZ 2YWGA 3F9FA 3AUXA 5J4QA 4FMBB 3PITA 4DCDA 1PPHE 1OT3A 1N6KA 3V00A 1RIWC 1TEXA 4OHZA 3AAUA 3Q3KA 4W5HA 2CDNA 1LMWB 2A5AA 2QCYA 3GLGE 1RFLA 1C1PA 2Z6BD 4B6FA 4WZAE 3MGCA 3UKDA 2BD3A 4PHGA 3AW1A 5JB9S 2WOOA 4R71A 3UIRA 2CVHA 5JBCS 4M7GA 2ZYWX 1GNPA 3EGKH 5F9HA 1N25A 4TMZA 2RB4A 3GJ3A 3DL0A 2I6QA 3U44B 2PL3A 1F2UB 1E3MA 2J7PA 1NN6A 3QQ5A 1V2JT 2PUXB 4IFBA 1EX3A 5F8TA 2VQSA 5JRZA 4F7WA 4YOIA 5JBBS 1M2OB 2CMKA 2A4QA 1YJ5A 1QZXA 2VL7A 2ANKH 1ZMNA 3P32A 4P31A 2EVWX 4O9VA 3ZIAD 2FEQH 3QZQA 3UOPA 3B9FH 3RXTA 4KAXA 3MMPA 3WRYC 2FA9A 3LDAA 2YOFA 4FCTA 1Y8TA 2QE7D 1ETRH 2G9NA 2EYQA 2O0JA 3H0KA 3M3SA 2F3CE 3RXAA 3EE0B 4ABIA 4EIWA 2NOAA 1XF9A 2GNOA 2R6CA 3CO5A 3B85A 1W36C 3B9PA 4KFRA 3THOA 3CR7A 3FMPB 3EIEA 2LKCA 4HDCA 2WVJA 2WYGA 4ZXYH 3EAJA 2RKOA 1SGWA 1N5IA 3T5FH 2GWHA 2J45A 1S0RA 2W6JD 4ZI3A 4YT7H 5JDUB 1AS2A 1PFXC 1XTQA 3DKVA 1RTFB 1ELFA 1IY2A 2HXYA 4O0MA 4NPHA 4MRPA 3W8RA 2ZU0C 3ZZBA 3W94A 1ELOA 4PC1A 2FPKA 3FOZA 2QROA 1YPHC 3TUIC 3MNXA 1QG4A 2CV3A 2PCLA 5LBIA 3T1VA 2F6RA 3UNRA 3C5CA 1TBZH 3I32A 1AO5A 2FG5A 3ZZ4A 1P2SA 2BVNA 6GCHF 1TGTA 3U7HB 2VRWA 4G5OA 1EWRA 1TB6H 2D7DA 4YMSA 2WZQA 2B8OH 3QUMP 1ZBDA 3E0NB 4DCVA 3RMOH 4YZUA 2JJ2D 2OXSA 1O3CA 4OK6A 1OPXA 4HLQB 1IQGA 1HT1E 3I1FA 1PJRA 1VCQA 2ZJBA 1R0YA 2WWIA 4L16A 3K0CC 3FAOA 3PVSA 3MU0A 1W7XH 1BYUA 4AURA 2OILA 4RZ3A 2A5JA 3R0FA 1EFTA 1KO7A 1HUQA 3PMBB 3T28A 3BG4C 3STIA 3A1SA 1TUEA 4NCYA 1KTSB 3LQRA 5P21A 2XRCA 2BJVA 2BM2A 2OAP1 1KNQA 1YHNA 4NFEA 4IN1A 2BOKA 1R5NA 1LHCH 4JSTA 4HLUC 2A7JA 3WYAA 1LKBA 2IK8A 3GPLA 2LNCA 2BD7A 3GLIA 2W6ID 2ZI6A 2FO9A 1S1MA 2ZDKA 3BXZA 1N6YA 1MQ5A 2F83A 5EE0A 3EYDA 3CENA 4CEHB 3ZIAA 3P26A 3NWUA 2QPTA 1PLKA 1A3BH 1I2DA 1S2MA 4HLDA 2OD3B 3LDXH 1TMTH 2HJVA 1Q3HA 5GXPA 2PZEA 1E2DA 1GJ9B 1N5LA 1E98A 2N46A 4LJ5A 5FR2A 3DHKH 3VKWA 3P8GA 1MTVA 2ANBA 4TPYA 4MDEA 1H8DH 3P70B 3SC3A 2V9PA 2ZFTA 4U01A 5F03A 3GD7A 2P8OC 2UUKB 2CHVA 4Y0ZE 3SU6A 5CK5A 1DSUA 4L4UA 3AF0A 1W2KH 4K1TA 5KSPA 1JAIA 4QFMA 3AKCA 1N8OB 1YBWA 2ZJ5A 4Q4JA 3I8SA 1BMMH 1TONA 1HT2E 1QDEA 3E91A 1X6VA 5KU1A 1HJ8A 4BUJA 1NRNH 2ERYA 1GI1A 3PUZA 5DGJA 2QT1A 3UFAA 4LYAA 2D2EA 5LPFA 1UKEA 3MJRA 5F6MA 2ZAMA 2FYRA 4RSPA 1B7XB 4C0BA 3E90B 5G40A 2R0LA 2VWNA 3V13A 1T0JB 2GDJA 1W0ZU 3ZGXA 1O2JA 4ASUD 2VSFA 5AUOB 1IXSB 3RXQA 2NO0A 1O3YA 4K8BA 1V2UT 3A8CA 1S6FA 1WSSH 5FUYA 3W34A 1MTSA 1OP0A 5GPIB 5EP3A 5JJKA 3A7VA 2OCBA 1GKIA 2PR3A 3SHWA 2Q6DA 1CP2A 4H1UA 2VHQA 4K2YA 1ANEA 3ATLA 4FMCB 1KI7A 1C2MA 1EFUA 3BB1A 1JR6A 2IYUA 3SN8A 1ABIH 2AX4A 1MO5A 1G3UA 1XZQA 4JLBA 4FU9A 1S0QA 1KKLA 1XTSA 1GJ8B 2A4GA 3L43A 1LW7A 2W6IA 5DO9A 4D4KA 3K1JA 4PPQA 1DWBH 1NESE 8LPRA 1I2MA 2CEAA 2KI5A 1S83A 1G8HA 1HV7A 1NRRH 2IT1A 2LKDA 1O3BA 4PO8A 2QAGB 3KB2A 2NTYC 4AGJA 4F4JA 4Q7KA 3V4FA 1JJVA 2OCPA 3CONA 4AGKA 4R9UC 2WJHA 5A0CA 3RP2A 2VNTA 3QXSA 2FSHA 1L7VC 1ELVA 4LJ4A 5J4SA 2LPRA 1O2ZA 1SL3A 3A1WA 2BM0A 2FOBA 1QB6A 3P17H 1XX6A 4WVPE 4FWIB 4D80A 3DA9B 2JJ1D 3QF4A 1VG1A 2HALA 1HA3A 1V5WA 5A0FA 3RXOA 3HR8A 1CE5A 2WHXA 1EP6A 3EW9A 4PSVA 3ZZUA 4Q5IA 1EX7A 2VHCA 2ZRBA 1NROH 1UKVY 3U1JB 4JYCA 4Q9LA 1SQTA 3TH5A 4Q1FA 1Z8IB 1GJ4H 3NXSA 4Q4LA 1UBGA 3QX5H 2ZHWH 3A36A 2Y7XA 4RD3A 3OU0A 1NKTA 1KI6B 2GZ9A 1D2NA 2ZECA 1K5DA 4DSOA 4IW4E 4C2UA 3CS7A 4LGMA 1ARBA 4NZQA 2ZI9A 2HXSA 3R7WB 4OM9A 1G5RA 2ZRFA 3A84A 3GJ4A 1NG1A 1A5GH 1OIWA 1G7CA 3M37A 2W2VA 1KSFX 4JVNA 3NH9A 1IAUA 1KDRA 4NWLA 3RS5A 2FOHA 3QN7A 2NG1A 4B32A 1V2NT 2WJVA 1U81A 1D5CA 3FPAA 3RXSA 1NSTA 1GI0A 2PLXA 3L0SA 3SW2B 4HSEA 2GGVB 1N6OA 1CBUA 2B0FA 2TGDA 5DN6A 4RD6A 3A8AA 4QGFA 4LOYH 1FTNA 2CHGA 3QE0A 4YMTA 1O2WA 2P65A 4S2EA 5GJBA 1BTHH 2HOBA 3SV6A 1RJXB 2ZQ1A 4ZDIA 2R6AA 3RNLA 3MH7A 5DE3A 5CLQA 2OSBA 3I77A 1AVGH 2P2LA 1FZQA 2W7UA 1YE8A 3IILA 2EFGA 1GHYH 2BY5X 4MKIA 1PPZA 1JIMA 5KYKA 2FPMA 1SGFA 1LS1A 2F3RA 1O33A 1H8HA 2FZZA 3GMTA 1KK2A 3NDBB 2CBZA 3THYA 4M4SA 1G6OA 4MITA 3RXPA 1YCPH 1G291 2VIVA 5CHAB 4LPKA 1WB9A 2ANYA 4E05H 2JJ1A 2BHGA 3IQXA 3LXRA 3GCGA 1UTLM 3LQQA 3FVFB 2IYVA 1KYNA 1OIVA 1OE0A 5EXSA 1ZM7A 4Q21A 4QL3A 2ONKA 1OYTH 5L3VA 4Q01A 1L1NA 1G3BA 4XIGS 5FL7D 3TSOA 4KBFA 1FAXA 2YHSA 4GHQA 3AVOA 3D7MA 5E4FA 4CW7A 1SHYA 5J4HA 1VMAA 5EQQA 4J0QA 3LIWA 3M3VA 2BD8A 2A5IA 4PX9A 2ZETA 2AWOA 1QHIA 3SUDA 4QG7A 4UJ3A 5DISB 2J3EA 1GI6A 3L3TA 2AHOA 4HATA 1Y3AA 4XD7A 1YPJH 1R10A 1L8QA 1GDQA 4X6PA 1H8IH 4OJKA 3BS4A 3IBGA 2FDCA 1W10U 6GCHG 1YYY1 1UKYA 1DTSA 1R2QA 2NZ8A 4EPWA 5D3MA 3IPXA 3T25A 1C5WB 2FS8A 3QXXA 1V3XA 1PQAA 1C5VA 1Q31A 4MPUA 2J38A 2PKAA 1P2JA 2IXFA 2QIQA 1BA8B 3A80A 3GJ7A 4V0OA 1NFYA 2X2FA 2NU2E 1MO3A 2H9HA 4HAUA 1F0RA 3M5OA 1U94A 3PEUA 1FAKH 1AM4D 1DOJA 4A4DA 5FTLA 1AS0A 1BRAA 1XD9A 1GI4A 1QB9A 1A1VA 3K0EA 1DS6A 4CH2B 1TOMH 3C41J 3U9AH 1K21H 4NSVA 4PFSA 3ZYCA 3M4YA 4FMDF 1KKMA 2VB0A 1Y59T 2ODYB 1QJ7B 3K70B 2D2DA 1FQKA 2AIQA 5KSYA 1TX6A 2ONJA 4PC2A 2VF8A 1UJ1A 3M36A 1SSXA 4WIAA 3TK6A 3FWYA 4YDHB 1PPBH 2ZFSA 1Q1BA 2FMXA 3CX7A 3QNUA 2J95A 3S1AA 4A6PA 2PBRA 5TMPA 1HXEH 4X8LA 3T34A 4WH6A 5FBRB 4AYTA 4C2TA 1GL0E 1V43A 4HI3A 3KXIA 3NC1C 1IY1A 1AHTH 5EODA 1L2EA 3LY5A 4XWAA 3HYRA 2ZQ5A 3FYHA 1K1MA 4O97A 4G5QA 3B2EA 2B21A 1E38B 4X2WA 1TF7A 2QL6A 5K8IA 1H8ED 3SU4A 3FP6E 2QTFA 2BYAX 3L0OA 2XBXA 4KI0A 4Q03A 5FHTA 5A8XA 1XUHA 4P4UA 3TAUA 4IJMA 3BFXA 2B7BA 1Z2AA 2A31A 1XUKA 1TQDA 4BAMB 2GJ9A 4AG5A 4X6OA 2BX3A 4C0JA 4Y76A 1V2RT 4FUGA 1GJDB 1W2HA 3GY8A 5F8XA 3K0FB 1ZW6A 2J94A 3UPUA 4FVBA 4II7A 3KXKA 1ZNZA 4ZIRA 4B2CA 4IEEA 3NZIA 2ZDMA 1E35B 1XJQA 1T8UA 5G41A 1P73A 4EPXA 3NCLA 2GXUA 4IDQA 1BS1A 1AUTC 1TL7C 2HUPA 4NKRA 1P9RA 5CB8A 3KKPA 3OF5A 3TPIZ 2ANWA 1G18A 3MH6A 1GUAA 1YZLA 3T12A 4D82A 1BQYA 5HMAA 1J14A 3LRPA 3X1ZA 3ZYEA 1OWIA 4URYR 1DE7H 5JJIA 1IHTH 4Q7XA 5JECA 4L9WA 2AWNA 4NIYA 1MRNA 4M2LA 3VGCB 1S5SA 1O5AB 1TQ7B 5L8VA 2Z9JA 1C4OA 4D7GA 4Y6DA 1U9IA 4K60A 2O8FA 2CJWA 3KL6A 2O8WA 1NMXA 3K0SA 1NBME 2C9OA 1NT1A 1VHTA 1ZHRA 3JVUA 3TRFA 2OINA 2FV8A 4MNWA 3K53A 5FOSA 3B23B 3KQNA 2QP4A 2RCNA 2WBLC 4Y0VA 3HPRA 2P3UB 3KQUA 1EX6A 1DICA 1OWJA 1HXFH 1EXFA 5CIWA 2NU3E 1GBFA 3FB4A 4CGZA 4ZHAA 2QI9C 2HCJB 5AUQA 3ZVLA 4B3DA 1XMJA 1VCIA 1CR4A 1R0XA 4PZLA 2PMKA 1C2HA 2ZU3A 3SBKA 4KYUA 3TK1A 3SBEA 4P4SA 4BFYA 1HEIA 3SJIA 4B73A 2WWHA 4AWXA 4ITRC 1H8EA 3OFND 4A6LA 1E0AA 3S69A 4I8GA 1NZQH 1D9XA 1SKYE 4GHTA 3KTAA 1XCPA 3VKGA 4URWR 3KUDA 1ZM3A 5EJEA 2XX3A 3DZDA 1IJFA 3CNOA 1HDTH 2ANMH 3UXMA 5IT5A 2ZDNA 3P4YA 1O2UA 2FFHA 1Z3IX 1U8AA 4LYHA 5HGGA 3P27A 2CHAB 3MWIU 2P6RA 1J17T 4B2IA 1YZUA 1N6XA 2IUTA 2HV8A 1PZNA 2XJ4A 1MCVA 1W1WA 3BTEE 2EFHB 4ZMAH 1A0LA 3PLPA 3PO1C 2UWOA 4V0NA 1GJAB 2ZXUA 2IWHA 1YPHE 4XWKA 3QF4B 1IQIA 5FXLA 2GD4B 1G3QA 1P7CA 4AIIA 2IS4A 2ZTYA 5DNYB 2FESH 2BQ7B 1P9WA 3ZVNA 2DE8A 1II0A 1E9AA 3PMJA 3LGUA 4IXNA 2ZAOA 1QRAA 1F5NA 1N6HA 1D6RA 5DLQC 2ZF0H 2VH0A 3ZVRA 3S7KB 2GTBA 1QQUA 1SXJB 2PKSB 2QAJA 4BLRA 2P3FH 3EA9A 4GPTA 1TX7A 1BTPA 2QP9X 3MWYW 1A82A 5LGOA 4I1UA 3MH4A 3TH4H 1OXVA 3K8YA 2HYDA 2JH0D 1KAOA 3NBYC 3OESA 2IJOB 2WPKS 1LTQA 3PXGA 3DHWC 1ESBA 1H65A 4LY6A 3QGJA 4ZUHA 2A2ZA 1UADA 3GCNA 1XVOA 4LV6A 4FUDA 4CRWB 4C0KA 3CZQA 1MKWH 1HV8A 4TLCA 5FX5A 2ALPA 4R2HA 1AN1E 2QAGC 2OEPA 1F5LA 2RDLA 2PJRA 4BTTB 3BTFE 5TB5A 5G53C 4YMWA 3CBQA 1RC8A 1P11E 1NRSH 3QLPH 2VWOA 4GPGA 3SE0A 1K1NA 1KI1A 4BRWA 4V0ME 2NIPA 3PUWA 2JEOA 5EW2H 4HAWA 4DZZA 2IYQA 4JIMA 2IN2A 4HAVA 4UNSA 1XXHE 4M9FA 5KOYA 1KSHA 2ZEBA 1TNGA 3H84A 2AGEX 4BEJA 1VG0B 3C1KA 3GY7A 1GNQA 4X8HA 4MDFA 1Q44A 4FMDB 2EFEB 4LBZA 1NIPA 1X8KA 1HTWA 2GVZC 2FE4A 5GVRA 1DEKA 2IYZA 4ZXXH 1YPGH 3C27B 2GVFA 1BH2A 1GNRA 2F9VA 1CHOF 1GBMA 3EZ9A 4CT5A 2ORIA 2NPFA 1GRQA 3C16C 3BTDE 2ZREA 1OH8A 4FIDA 4Y71A 2GZ7A 1X3SA 5EXLA 1OWHA 1ZJDA 1GMCF 3BK7A 1TA2A 1OOKB 4CDGA 3F9EA 3WMGA 4A92A 2EFCB 2C3SA 1HE8B 2FOFA 4GAWA 2OFWA 2F9UA 1IJEA 1F2SE 3SOSA 3THWA 3BSQA 1PYTC 3F1SB 1OWEA 1CGIE 3ZZCA 3LNCA 4XVQA 3U8RH 1BDAA 4Y11E 2RCEA 2XXAA 1BB0B 3QGNB 4JZKA 4AB8A 4G01B 1RGQA 4C7OB 4TTPA 3W5JA 4M9XA 1G30B 3UNSA 4F93B 2QF0A 5DSZA 3KNXA 1KI4A 4LHYA 3LXXA 3MU1A 3ECCA 4LJ8A 2VH5R 3FKQA 3UG7A 5D3MB 4MUBA 4KXFB 2AGGX 3TNTA 1FXYA 2R2MB 4JBXA 2ZUBA 1TMUH 3AVQA 4B2AA 1RRGA 1F0UA 2ZJ2A 2O8CA 3AW0A 3A8TA 1ZM4A 3M1IA 1RVDA 4CEIB 4TLEA 2WSMA 4US2R 4NZLA 1G8YA 4YLGA 1SGFG 1SULA 3TNFA 5C46F 2QORA 3KKQA 1T4VH 1CULC 1O32A 3FKSD 5IRCD 2J0VA 1UHBA 5JCZA 1E9FA 1GHAF 1MR3F 3AQ4A 4O2LA 5CM9C 1C2FA 4NYMR 2AL7A 3R3GB 1Q1ZA 3QY0A 3CX6A 2ZFPH 4ZDJA 4UNNA 1V2KT 1MABB 3S1AB 1G2LA 3SYNA 2JETC 3TVJB 4DEYA 2BKEA 2YOLA 1XUFA 3W5IA 3SNEA 3A8DA 4JT4A 4DKXA 4BFWA 2AR7A 3BH7A 4F4CA 4ESVA 1ZPZA 3GY4A 2H1UA 3WYFA 3LGIA 5FPYA 2PW8H 4BLPA 5CJPA 4CEJA 1GZSA 4K1EA 1MQ6A 5PTPA 3AVTA 4JYBA 4WZBE 2C90B 1MKXH 3EWAA 4INKA 2ZJZA 2ULLA 2XTNA 1P72A 2V6JA 2V55B 1WTHD 2WAYA 3B7GA 5EOKA 3N70A 1O2YA 3GEIA 1ZC4A 3GLFA 4ISOA 2ZR9A 1O2TA 2PTCE 3SYLA 3MAAC 3TJNA 1IHSH 3AF4A 2C8YB 1WYKA 2VIQA 3QPWA 1QHNA 2AD1A 1E2GA 3QO6A 3F9GA 4DURA 3IEVA 1FW6A 4O3TA 3T2NA 4ZIRB 4DSUA 3LW8A 4DJZB 1G19A 3T26A 1BTYA 4I7YH 3A83A 1Q3TA 1FUJA 4LXBH 1FUUA 1DAKA 3V9PA 2KAIA 1UDWA 3VNUA 5H68A 1NFWA 3MO3A 1TIOA 4OHWA 3LVRE 1GAJA 1Z6JH 1XMNB 2LCFA 1GBLA 1P2IA 2ZFRH 5F8ZA 3VR5A 3VXFH 2YYZA 3NTUA 4QOSA 2ZANA 2G81E 4NFFA 3MNSA 3MCAA 2ZS9A 4MGYR 4DDTA 2EW1A 1P02A 4E06H 1Z2CA 2YINC 1E96A 1KDTA 4BECA 2ZJYA 1YLCA 3VR3A 2IUSA 5ETXA 5DHFA 2BVSH 1II9A 4QBFA 2EFDB 1AA9A 3LGYA 1HAVA 1JNYA 4F4IA 1T8OA 3QKRA 2O8FB 2CJWB 1Z28A 2JLUA 3FHCB 3ND8A 1P8VC 1OS8A 5E95A 1I4LD 4WXVA 2W58A 3MYWA 2ODBA 2IXEA 1X8JA 1PVOA 1J90A 2P0EA 3SQWA 5GADl 4K8YA 3TK5A 1NJFA 2R6DA 3ZVCA 2V54A 1C4V2 1LVYA 3TIUA 3GLHE 3BG8A 3HKIB 1OB2A 3PB1E 3BTHE 3C14C 2MMCA 1GFIA 1EB1H 2CGAA 1G32B 1SGPE 1SGCA 2J7KA 1G8GA 4AY2A 4LZ4B 1K5GA 1C2DA 5FUXA 1C2JA 3LX8A 3KTAB 1UTPA 2GT7A 1QJ6B 3B1XA 1KO5A 3T06B 3MFJA 4OQFA 3RXEA 2J46A 4LPSA 4BFXA 4V0KA 1RRKA 4W5JA 3M7QA 4JYTA 4A2PA 1COWA 1ZJ6A 2Z4SA 2OFXA 3ZZ0A 1U98A 2H6MA 2VTKA 1MRSA 1O2HA 3PLKA 1E2KA 1GBCA 1O2RA 3VGCC 2VSOA 3W6PA 4ABDA 5L3SA 3R9IA 1UK4A 1AZTA 1JRSA 4CRGA 3CPHA 3KUCA 3R20A 3RXRA 2OG2A 5GDSH 1XXDA 3GEEA 4Q2KA 2OLKA 1C1QA 4MGKR 1QY6A 3S7HB 4OK5A 1OF1A 2V3HH 2XBWA 1KO8A 3FZDA 3G0HA 4OHYA 5ESBA 3P8NA 1SLUB 4TWWA 1HB0B 2BLOA 4NYIR 1WV7H 3P95A 2OC7A 4R0IA 1TNLA 3FDIA 2IC5A 1YKTA 1BZXE 1Q3XA 3KKOA 5FBWB 4NCNA 2BV3A 1KY9A 2QBYB 2HPPH 2HF9A 1YZKA 4MG3A 1ZC3A 1DX5M 2BWJA 2CCJA 2QTVB 4UQOA 1GDNA 4KP0A 5E2OA 1ZRBA 2BMDA 3D23A 1IN8A 2BEKA 5C4GB 1JR3D 1ZJKA 2XNSA 3OEHA 4OS6A 1KI9A 3BGWA 1WF3A 3RRZA 2ZROA 5CDFE 2SNWA 4ESHA 3PUXA 1AFEH 4Z1MD 4PZYA 2QXJA 2ZSBA 2VP2A 3CW2A 2C9CA 1IOZA 2QV1A 4ZCIA 1CA8B 4XBCA 1GBEA 1C5YB 2IYXA 1CA0B 1O3FA 1UPTA 1FP6A 1GI8B 2C93B 2JKHA 4MPXA 3SJZA 9LPRA 2BZAA 1IQPA 4D81A 3LGTA 4TQ9A 4EUNA 1NVXQ 3A37A 1CHOG 2BDTA 4KITB 5TXGA 2CHAC 1S0UA 4IXMA 1K22H 3CRMA 1US8A 1O2MA 3RS3A 3B8JA 1XWIA 3Q3XA 1BUIA 2VP5A 3GY6A 2IHYA 3FFAA 2WINI 1GMCG 1XX9A 3VEQB 3W9YA 1YU9A 2C2HA 1HAIH 1OXGA 1G6HA 1DBSA 4ZAEA 3NEJA 4AOQA 4BWYA 3SGQE 1BRCE 1JXOA 4G3XA 3GCOA 3HYTA 1SVIA 4YLQH 5F98A 3A4LA 3IBYA 1Z6EA 2F9NA 1U2RA 5L3QA 2YOHA 2OUAA 2BM1A 1JIRA 2G0NA 1YZQA 3RS0A 2H2ZA 2BD4A 3REGA 1GL7A 2GAAA 3FHTA 3QVUA 1KDQA 1KGDA 3E0PB 5HE8A 4XOIA 3RLYH 2XOKA 4QXAA 2AIPA 1SGDE 5H70A 1NRJB 2GZ8A 1W48A 1Y3YA 4FUFA 2WPDD 1W8BH 2QXHA 2XXAB 1O2PA 1UVOA 3SV2H 2ZRGA 4OI2A 1FN6A 2NMVA 3RWMB 4WMFA 2W3IA 2J59A 2KSQA 2VHTA 3AH8A 3AUYA 3NBFA 4G5RA 3GOVB 421PA 1JALA 4M1SA 3U3OA 3QSYA 1WBGB 4I8JA 2IYYA 2WJJA 1R0WA 2G0TA 1ZGIA 4WA7A 4JLDA 3F0TA 3L82B 3AVVA 4PANA 3C8UA 4RD2A 3W3AA 4Q9IA 1PPGE 2D7CA 1ZMLA 1LF0A 3RM0H 2QNRA 2XXLA 4TZ0A 4LK2A 2OQUA 4DLXA 1UTQA 4PHHA 4Z1MA 1GHAG 1CJKC 5AR1A 4BPBA 5J5CA 2Q1JA 3BRWD 1QGFA 4CBNA 2O8CB 1Z6YA 1SPJA 1WQVH 4UFFH 3AVWA 3NHBA 3QOFA 2QU8A 3T29A 1FONA 4D2IA 3U6KA 3LLMA 2ZRLA 4X8MA 2A1DB 3KFVA 3R9XA 4Z6AH 1XM1A 5AF9H 2H7VA 4KFSA 1CR0A 2XSZD 1HIAA 2PWXA 1TQ2A 2GF9A 4AFSA 3SHFA 3ADDA 4JK5A 1A2KC 1EWQA 1M8PA 3CS0A 3BE4A 3A1TA 1WTGH 4H4FA 3HK3B 2ZJ8A 1O31A 2OTVA 1BITA 2WPJS 4E5UA 4MPVA 1AN0A 1UVTH 3Q3JB 3G5UA 5KUTA 2GVDC 2ZGJA 3JZ2B 2WJGA 2A5FA 2RHDA 2NO9A 2PLRA 4WXPA 2BDCA 4CEJB 2CL0X 2GDDA 4RZ2A 1RTKA 2VP4A 2VWMA 2WYJA 3VAAA 2FSGA 3DPUA 2ZWLH 5EXPA 1TRYA 1CJUC 1KJZA 1ZTLA 3PUYA 4UNPA 1AJEA 1C2LA 2DWQA 3GLFB 2OAQ1 4Q66C 3OTJE 1OXXK 3Q5DA 2WPDA 4LC1A 1U99A 3PWBA 1EGAA 5LH8A 1AE5A 3LAWA 1TBRH 1OFIA 1T7CA 3U4QA 1C1MA 4MNXA 3O8BA 7LPRA 4B3BA 1PQ5A 3D8BA 2BLQA 2C4FH 3IIKA 1Q2WA 3MOCA 1ZD1A 3LH5A 1T8MA 1JPNA 2X77A 1D3DB 2O8UA 5F2EA 1GG6B 4A2QA 3OIUA 1C1NA 1WXRA 3ICQB 1THPB 3T1OA 3OIYA 4M1YA 2FFBA 4Q7ZA 3ZZ8A 2JLSA 1ELGA 4BE7B 3CF0A 4I32A 3GCHB 4TTRA 1BJUA 2VSXA 5C5NA 3ZVFA 4UXJA 3U98H 4AORA 3LPRA 1U0LA 1X8LA 3M0EA 4QHYA 1XD2A 2ZDVH 1F0SA 1E1RD 1HFDA 4HYYA 2GDEH 1LHGH 4MLFB 4O3UA 4AFQA 1NLZA 4MNYA 4ABAA 1R4AA 3A4MA 1GBJA 1C1TA 1LNZA 5DP6A 1Q20A 2ZKSA 4NIWA 2V0BA 4DLWA 4DJTA 2FZ4A 2HWLB 4GT1A 1C5OH 2GP9B 1ELBA 3MI4A 4GZMA 1TNJA 3HPTB 5ANRB 4BFUA 1TGNA 3AVXA 3AK5A 3GCTF 1H9LB 3MO6A 4UFEH 5K7RA 1VDZA 4F91B 1O3DA 2CCKA 3RS2A 1E2FA 4XE4A 3NKKA 1XPOA 1CKEA 3RLFA 2TBSA 1D9IA 4P3YA 2W2XA 3REFA 4K1SA 3M7UA 1P9UA 3CH4B 1VJ9U 3GLGB 3VPKA 4RKEA 4RSGA 2Z5FA 1XKAC 1PV4A 1O30A 4X8UH 2H17A 5FTNA 1P2OA 4I8KA 2ZRMA 6LPRA 4MRRA 3TQFA 5LB4A 2UWLA 3U44A 1G3EA 2B92A 1F2UA 4PQFA 4AFUA 1XUIA 1FY4A 4DLSA 4MKFA 2DBYA 3B1WA 3QTOH 2EQBA 2A5DA 5J47A 4TYYA 2OBOA 4JZDH 2A0QB 4DWJA 1V2OT 1SVLA 3RXKA 1QRWA 2VINA 5FTKA 3ZZDA 1XUGA 4TY6A 3AGQA 4D4JA 3SJKA 4LJAA 4XSGA 4AG6A 2GT8A 4B34A 2FSIA 2HLDD 4GVUA 5HKKA 4JJZA 2ZG0H 4LOAA 3M35A 4DC9A 3AP3A 1GJ5H 3BFKA 1P2NA 4Y7BA 1T91A 2KE5A 2BTCE 2F55A 1GCTB 2FWWA 2PEZA 1U9IC 3RXBA 1KMHB 1BIOA 1OKKA 2WOJA 4DLUA 1N2CE 2BQ6B 3BIVH 2HT1A 1THSH 3QKTA 1J8YF 2FTMA 2VIWA 1QHYA 5CM8B 2C78A 2OP9A 2W3KA 2OT3B 4RD4A 3RUOA 1GG2A 1C5NH 1LHDH 3A87A 1T31A 2TRMA 1IXZA 2BBWA 1GHBF 1JBUH 3FMIA 2G5NA 1IXRC 4WBSA 4I1SA 5KTYA 2ZRIA 5BQ5A 3RXLA 3P8FA 2XW9A 4HZUA 1SGTA 1E9RA 1UTOA 1OH6A 1IQLA 2JATA 3FVQA 3JVVA 4GDFA 2NGRA 4B35A 3RRMA 1SQOA 1YC0A 3QWCH 4OYHA 3KIDU 2Y82A 4KLZA 1DUEA 4Q4HB 2ZGXH 1U8YA 1E2MA 3M6AA 2IOTA 3TJZA 1E0FD 1II8A 3QUSA 1KXAA 1VYUA 1RRPA 1WP9A 5EW1H 4B76A 5B2ZA 3TAHA 5BW8A 5DGXA 4CRBA 1TYNA 3WXMA 2Q21A 2O52A 1BJVA 3SI3H 3IO5A 4B3FX 2P3SA 1N6IA 2O8TA 5EQSA 1E2NA 4ISNA 1AZSC 4OS1A 1O34A 2OCAA 5BWMA 2UVQA 3CLVA 1WBDA 1Y3VA 3A7WA 5AJWA 4YT6H 5TCAA 3GQBA 4TWYA 1T8LA 5KSOA 5JYIA 3K0AA 4FXGH 4HFPB 2Q3FA 1TAGA 3URDA 4DGJA 2ZRHA 1O35A 1RYHA 4A8JB 1HAGE 5BN4A 2QGRA 3LWNA 3EA7A 3OYPA 3WBJA 4KELA 2BMFA 2PV9B 4ISIH 4Q7JB 3IEUA 2B6HA 2I1QA 1C5UA 1UVPA 1Z22A 5HM2A 1W14U 2XNDD 3PEWA 5HYOA 5L3QB 4FU8A 1GBTA 4Z8XA 1IM2A 3U5ZB 1GIAA 2HLDA 1ZAKA 1NLYA 5DI9A 1IOEA 4AI6A 3BEFB 4QM7A 3U3KA 3RRNA 1KDQB 1S1CA 2UUJB 4NYJR 2YVUA 4H42U 3IG6B 1FQ3A 1G3RA 4GL2A 3ASYA 1E0SA 3P20A 3EZ7A 2ZTXA 2OO7A 1KI8A 4X8OA 5EGMA 1GWNA 2PZGA 4I1OA 3CIOA 1EFHA 3KN2A 3UR9A 4H1VA 1Z47A 2WTUA 4NYMQ 3V12A 1UBFA 1O87A 4TMTA 1DAEA 1CJVC 4MYCA 2QYIA 3UWKA 1A5HA 4Q7YA 2BDYA 1CGJE 3QEOA 3GLIE 1EOLA 3DD2H 2XYAA 4AKGA 2VP0A 1CBWB 2YOGA 1D6WA 1F7ZA 3MWKA 1QHGA 3T61A 5BRRE 1QL9A 3TVDA 2EU8A 4VGCC 1CHGA 4GUXA 1RPZA 5EPNA 2WKPA 4X0WU 2XZPA 1X1RA 3BJIC 1GHXH 2AK3A 1X7AC 1UCYE 4PSAA 3MMGA 3LLUA 4THNH 2AFQB 3ZZ5A 2ZE6A 1PYTD 2CL7X 5K8UA 3U7FB 4H6TA 1Z8JB 1TNIA 3S0NA 3A7YA 1ELEE 4Z8YA 3SR0A 1HLTH 4QJ5A 4EFMA 3GYLB 3QG1A 5L30H 4OGXA 1G9XA 3OE7D 4HUQB 1SHHB 3MNBA 1KHTA 1E79D 4KU4A 5J4KA 4A6XA 4ESTE 3AVPA 2J0UB 1NBMA 4AKHA 1P61B 1Y5UT 2CLCX 3O8CA 4BNRA 4GOJA 1ZUHA 1XEFA 1YR6A 4KFUA 2VH6A 1UDXA 3SV9A 2BDGA 5DIFA 1TPAE 4Q1EA 3ZVBA 1HRTH 4OI4A 4EFLA 5EE3A 4BFVA 1G4AE 4GP7A 3ZLJA 2Y5HA 4D0LB 2AMPA 4DVGA 5L2ZH 2Q9AA 4MKGA 2XNDA 4MGZR 1O0DH 3X1YA 4TMVA 3OAAA 1JXPA 3VKHA 2F9LA 2PFEA 3F5FA 2XTMA 221PA 2DFTA 3TGPA 1HQYE 1XFAA 1UCYK 4O03A 3LC3A 4MVNA 4CRAA 2EI6A 1EG7A 2O8MA 1F5RA 2J7PD 4K81B 2RGGA 1D3TB 2I3BA 5JS8A 4TSFA 2GILA 2CNWA 4WJG2 2ZCKP 3HP1A 3RU4D 1O3OA 4YQFA 3V7TA 4OGYA 3SQHE 1N0VC 3BC1A 4KVAA 1K28D 3PROA 2P67A 2ODPA 1B0FA 4F49A 4IOLA 1T8TA 3Q72A 1NY6A 2QTHA 2XZOA 1LB1B 1XBTA 4QNMA 1S84A 4DSTA 4Q9HA 3SHAH 1A0HB 3EX7C 1YR7A 2GESA 3SOPA 1G3IA 5KHOC 2XCNA 1MBQA 1DWEH 3KHVA 4GSOA 2FI4E 3ND9A 4BXSA 4MKHA 2AEIH 2PTNA 2VLIA 3TQCA 2ZRJA 1KI6A 1KXCA 5AHGH 3TVTA 1FNMA 1DWCH 2IA5A 1N1LA 1W7AA 3OY6U 4KODA 3ZZ7A 3LV8A 1NFUA 3H4MA 2JLVA 4BTIB 2JLRA 1CJMA 1YVDA 2UWPA 3CF2A 2XGJA 1CO7E 4FMCF 5EUQB 2REBA 3GCTG 2JLZA 1IQJA 3U60B 1Z1IA 1FIZA 2ZSDA 1E79A 1P6XA 2HJGA 1NMYA 1ESAA 1BBRH 2RGNC 3AGPA 3PMAB 1JB1A 2IX3A 4B6EA 1G7RA 1UM8A 3M7TA 1G8FA 1TGCA 3ZVMA 4LJYA 1AZ8A 3PM3A 3P92A 4D76A 3WP1B 1ZYOA 2AH4X 1ZRKA 2ZRPA 1JJ7A 2GV7A 3MU8A 4IGDA 3B1YA 1QBKC 4DUGA 4ON9A 3OZXA 5TJXA 2MSDB 1ETTH 1E2EA 4JVLA 2ODWA 4JZ1A 4V0MA 4BZQA 4D8NA 2IW3A 1OYQA 3H1TA 2CF9H 2PX0A 2OHFA 1T0HB 5E7JA 1AMHA 5A8YA 5FI0B 3TJOA 1GVNB 1H1BA 4DLYA 1PQ8A 4D0GA 3SORA 2PMDA 2Z6VA 2JLQA 4BTUB 4FCVA 2G8TA 1ZOMA 3RSLA 3CRW1 1EOJA 3I72A 2NO7A 1IN4A 1GG6C 4EFNA 1L1GA 1P03A 1OH7A 3NK8A 4PTLA 4INHA 2FF7A 3SFVA 1KI2A 3VMFA 1R6BX 4DIHH 2ESTE 3SJBA 1ACBE 5DP9A 1MV5A 2RAPA 1HJ9A 3GCHC 2ASEA 2XTZA 2J5XA 4LDJA 4HEJA 1T5LA 1VECA 2GKVE 5C67A 2JIZA 4DLVA 3CH5A 1DXWA 1EATA 3PV2A 1ZCAA 1GHBG 1E9CA 4MYHA 1O3EA 1GCDA 5HZHA 1NLFA 1CSOE 2E9SA 1E2LA 3TGJE 3KEEA 5C2ZA 2PSYA 1OXUA 2ZA5A 4KHZA 2ZHQH 2JH5D 4NBSA 2YWEA 4NP6A 4MTBA 4LHZA 5A5GA 4DLRA 5EXNA 2VU8E 1E2IA 3F6UH 1NKSA 4ASHA 3V0XA 4AYYB 4JLNA 4HZUB 5JBAS 4DOQA 5B58C 3PYHA 2CLSA 3TE6A 2IHBA 1E37B 7KMEH 3BH6A 3SQXA 2SGFE 2BMEA 2Q9CA 1YR9A 3C7KA 3I61A 2XZLA 1II8B 1T32A 2GBLC 1GHWH 3SNDA 3VR6A 2GKSA 1MZDA 3VXEH 1EAWA 5DP3A 2DUCA 3IPYA 1ZUNB 1XJ0A 1W0KA 1AD8H 1QL7A 1S96A 5HCIA 2BVRH 3NVAA 5DP5A 3CZPA 2P6UA 2GCOB 2EA3A 4X1PU 1NJGA 3ZVEA 3NIBA 2ZTSA 1OWDA 1O2LA 4B47A 4XVUA 4EPYA 4DSNA 2VIPA 4CRDA 1GJCB 3K0AB 1AWFH 3RU4T 2Y6TA 1SOZA 1GBBA 1YP9A 1W7GH 3C5HA 2CE2X 1OXSC 2SGEE 4QM6A 4HZHA 2J9NA 1R8SA 2A4OA 1YZTA 2UUYA 3VFEA 1UF9A 4JMPA 3ZV8A 2D74A 2MSEB 3FTQA 2QRNA 1QF9A 5FCRA 2GJSA 5UKDA 4Q1BA 4JL5A 3NDPA 2JAQA 4GRAA 5HTKA 1MTNB 1QCPA 2JGNA 5EE5B 1Z63A 1Q57A 3CR8A 1IQFA 5JI2E 2BCJQ 4INLA 3DFJA 2Z3CA 3KQCA 2OZEA 4AKEA 1AKYA 4SGAE 2C8VA 2J34A 2FEMA 3K0FA 4HB0A 3RC8A 1P57B 2FOAA 4I99A 5C1BA 4JZEH 2J0QA 4H6SB 3X2SA 3TLOA 4OI1A 5L6NH 5DKMA 4FW9A 1UVUH 1TTTA 1XDBA 1Q12A 3QXCA 3RABA 1ZSKA 5H8WA 1QHXA 1DARA 4LBYA 4B44A 3E3TA 2R2WU 2IL1A 1Y3XA 4HAYA 3ADBA 1QRZA 3K9XB 4UD9H 1SLWB 2QY0B 8KME2 4OK3A 1C5SA 1IY0A 3LFUA 1KOFA 1ZNYA 1A2BA 3ENSB 2GJKA 3WYGA 1MOZA 3A1VA 1O3AA 4PR0A 2OC1A 3RS7A 4L15A 4NDZA 4O3MA 1SVSA 1ESMA 2F43A 1NN3A 1DT2A 4LJ6A 2J0SA 3PENA 1P09A 4BAQB 1T3HA 1SXJD 3ZV9A 1ANCA 3VX3A 5C4MA 1V2PT 1F6BA 4MPWA 4US0R 3KX2A 4ACAA 2X8AA 4NE2A 4PC6A 2G83A 1HQCA 1TADA 4N0DA 2A2QH 4FUIA 3KL4A 3STJA 2Y80A 5C5OA 1JI0A 3AV0B 3VR2A 1AQ7A 1QBNA 4GSYA 2ZPRA 1GI2A 1G4UR 2DWPA 2IBMA 3KCGH 3KKMA 3CUEF 4GI7A 4JBYA 4HZIA 1P2KA 3AM1A 2H9EH 3VQTA 3M3TA 3C4JA 4JS0A 3RMMH 1KIGH 1CT4E 4TYPA 6CHAC 1EJAA 2IUUA 1Z0IA 2G88A 2WV4A 5DN6D 1O5BB 5TARA 1ZD9A 1YPKH 3TK9A 1TOCB 2C8WB 4Q9JA 3UK6A 5J4VA 1IQNA 3G82C 1G41A 1OSNA 2RGAA 1OXTA 5CK4A 3GLHA 2CCGA 2FOGA 1G17A 3FANA 1TGBA 4HI0E 3WRXC 1CT0E 4URXR 1O5DH 5LPEA 2OESA 3ATMA 3HGNA 1SKYB 5F3WB 1GPZA 5IF9A 1AFQB 2GV6A 2Q6TA 1W36B 1CBWC 2ZHFH 1DG1G 3IO3A 1C1RA 1BTZA 3RXFA 1H8HD 3QK1A 1FIWA 1J99A 1S4QA 7GCHF 1CU1A 5FBVB 2Z7FE 3TLXA 5TY0A 2AGIX 2PUQH 3BWDD 4FN5A 1DE0A 1H9HE 3KJGA 1LQEA 1S8FA 2DHRA 5E7IA 2Z43A 3I29A 3NKVA 3PMHB 4C0LA 5C2JB 1C2IA 1KXBA 1M7BA 4C9BA 2OM2A 2GEDA 1TBQH 1KLJH 3WMFA 3EDXB 2KBFA 5BXQC 4KYIB 4NA7A 1SXJA 4XD7D 1GSIA 1XTKA 4ZKDA 2RGEA 2ZE8A 1BT7A 3O47A 3BN9A 3HU1A 4DEXA 5CB6A 1SMFE 4B75A 3RXHA 1KK1A 2B8WA 3WHLA 3MJHA 2NZJA 1E4VA 4PPNA 1E2QA 1R8QA 1GVZA 5EUMA 4TLBA 4YTAA 2IF0A 2P93A 1XCMA 2D26C 3SNHA 5TV2A 4P0TA 4CHAB 3BG4B 3QZRA 1XP8A 1E9EA 3T35A 5CDFA 4OBEA 3BTWE 1K1PA 4YDSA 5A2MH 1G16A 4M1OA 1HNEE 1TQ6A 1XTJA 1KMQA 1OPHB 3EARA 4OHXA 4UEHH 1KYIA 1V2ST 3NPSA 3WNBA 1O36A 4KTSA 3IGFA 5KPDA 1BMFD 1O2OA 1V2QT 3L8ZA 5T6GA 3QKSA 1OFTA 2HCBA 1EKBB 2IYTA 4ZO4A 2ZFQH 1XMSA 2ZVPX 2V4ZA 3QXHA 3VU9A 2RHMA 1WUNH 2CXVA 1MH0A 3TGIE 1XXHB 2RMKA 4ARZA 1G20E 1G3DA 2KWIA 2H1LA 1BMAA 4X8TH 2YNAA 5GIBA 4GMXA 1WCV1 4Y0AA 2BXTH 4JLOA 4KJZA 1GI7B 4IEIA 4PAOA 2STBE 2D3WA 1C5QA 1E2HA 2JLWA 2WWFA 2BD2A 4X2VA 2OV2A 1V2VT 1Z71A 2QA9E 3HGPA 5DP4A 2ODQA 1NVWQ 3KF2A 2HNTE 3RXMA 5GJWC 2OC0A 2CK3A 1GGDC 2FP7B 2GJ8A 5TVKA 2D62A 3AKDA 2O0KA 2AFIE 1VCPA 5A8ZA 5DO4H 2BVXH 4JBWA 1A4WH 1HUTH 1S81A 4OQMA 1ZLRA 3QBTA 2FPLA 1V6DA 2C96A 5FPHA 4RCZA 4Q9KA 3FP7E 4C7OA 1SFIA 4YC7A 4I33A 1PPEE 4B43A 1QBOA 2PH1A 2WWGA 1AE8H 4XTRA 2THFB 4DIDA 3PIRA 3OHMA 2C9YA 1Z29A 1RZ3A 2JA1A 3S9CA 3MUFA 4BZPA 3I8XA 2ZRAA 3NC0C 3VB5A 5FOXA 4X6NA 2Z9IA 1EP5A 1FP7A 3E70C 2HYIC 1T9HA 1LV7A 1K1IA 5EU8A 2YZ2A 4WWYA 2PEYA 5J4LA 1YCPM 1E2JA 4QJ3A 4CEIA 1Z0AA 1Z5ZA 4EPTA 1EFRD 4ABYA 2ZI3A 2WV9A 4MUAA 1GKUB 1W12U 3PLBA 3U7EB 1BHXF 2DPXA 2CJIA 2ZU6A 1XKBC 4NIVA 3T27A 1BMFA 2ZR7A 4HGCA 4AB9A 2FI3E 4NYJQ 1SB1H 1F60A 3S9BA 2QA5A 4RVCA 2VIOA 1ZRHA 2QF3A 2FOEA 3GDUA 1SGYE 3V3MA 1A46H 3P1JA 4MRNA 4U02A 1MABA 2PT5A 3T1QA 2F91A 5EP2A 5FUWA 2BDBA 5HE9A 5GJ4B 1DSTA 1L4YA 4TMXA 4KSCA 1QNJA 3RXJA 3HDTA 3LH1A 1MKYA 2ODEA 1HCGA 4M1TA 1DVRA 5H4IB 2ZSFA 2VJ1A 4XTCS 3B60A 4QKQA 1NG9A 2RH5A 5JRJA 1P4SA 5E2PA 3KZ1E 4FD2A 2VGCB 4D9QA 3M5NA 4LK4A 1Z6AA 2FGKA 3ZD6A 1E0KA 5EP4A 4QGHA 2MMGA 4PZZA 5AK0A 1AIXH 3UWOA 1A5TA 3SNBA 4MDSA 3IQWA 3KB1A 3UQOA 4BFZA 4NCHA 1ZCBA 1O5EH 5IHPA 1AS3A 2EWVA 5LB2A 2WSSA 1PUJA 1CR2A 1YCPK 3U7GA 4BAHB 3SDZA 4KTCA 3I92A 4B1TA 4K69A 2AS9A 4WMEA 3KFXA 1ZIPA 3RHFA 2FOCA 4QC2A 1T5IA 3FHOA 1F2TA 1R7RA 1P06A 1UKZA 1P75A 5HM9A 4ACBA 4RKJB 1MU8B 4C30A 1P05A 2Y5GA 2H5EA 1G8PA 5AUPB 2UZ3A 1NU7B 5JPMH 1BCUH 1WE2A 4DB4A 3ZVAA 2F43B 2FXRA 3BTGE 2AKYA 1XVMA 2YKGA 2C5LA 4PHTA 1EFRA 1IONA 4DLTA 4CREA 2IYWA 1O3IA 1AB9B 1W47A 3LBHA 2XTTB 1K6MA 1ZU5A 3LT3A 4D25A 4BAOB 3I5YA 3BV9B 2Q3MA 3W6NA 2X2EA 4E09A 1OX1A 4QNRA 1FLEE 2HVXA 3CPJB 2D8WA 4CYMA 5FBLB 1XB2A 3ZZ6A 4NCIA 2FI5E 1RS0A 2H9TH 5JWRA 2ANCA 3ODFA 1DVAH 2ZRDA 2HEIA 3UNQA 5JHGB 4Q02A 5HCNA 5F9FA 4A9AA 2FPZA 2ZJOA 1ZIOA 4A1TA 1DPOA 1A0JA 3CM0A 2WICA 2NPIA 1C1WH 3SEAA 3HJNA 2A7QA 4Q19A 4QJ4A 4YO9A 1O3LA 1WQSA 2VVUA 5FBEA 3GLHB 4AYWA 4U32A 2G52A 1C1UH 4GP6A 4JLJA 2WAXA 1E1QA 3JZAA 7GCHG 3R8CA 3CP7A 2C8ZB 3GFOA 4Q1AA 2C8XB 4M21A 2LWIA 2G4UA 3OTPA 4XSHA 1N8OC 1MBMA 4IN2A 4P32A 4NTZA 3K09A 2R8RA 3TW4A 1UMAH 5KDDA 1S85A 4ZHMU 4YXWA 4ABFA 1HAOH 1SGEE 4RKFA 1IN6A 4IRUB 3A4NA 5CJ2A 5FFMA 4JLMA 1FY1A 1LVBA 4JLVA 1TGSZ 1VCOA 4M1KA 3SU2A 3WMEA 5EZ6B 1VYVA 1S82A 3NBZC 4MRSA 2V8OA 1YF4A 1GOTA 2ZITA 1XD8A 2HGTH 5JMTA 2YC4C 1FZZA 2BB4A 3E16B 1MUEB 1YRAA 1GBAA 3F9HA 1H4WA 4IFEA 2ZU4A 2QBYA 4ABEA 4AFZA 2VVCA 3BTTE 1XZPA 4MGIR 1FI8A 4XSKU 1CTQA 4IOMA 2ZYTX 3BBPA 2JLYA 4Y7AA 5I25A 1ZMJA 4AC9A 4S35A 1EPTA 1JBKA 1E94E 4TL7A 4D4LA 3AAVA 4HB4A 5AJZA 1JQJC 3BTKE 4OQNA 1DM4B 4WW0A 2ZHDA 3TSWA 4LHXA 1CEEA 1NY22 4LX0A 5JHHB 1YR8A 1Z0DA 1DY8A 1Y3WA 2C04A 2RGCA 3DUXH 3H2YA 4IHQA 1YM0A 5FPKA 1AFQC 3GJ0A 1Q0UA 2Q3HA 3MFYA 3U6BA 5E8EH 4TL9A 4Z54A 5LPRA 1PLLA 3CB4A 1LHFH 2ZSEA 3QEJA 1AKSA 2ZS8A 4FCWA 5DH9A 1M74A 1LS6A 1GL9B 1K1OA 1EFCA 1W44A 4GZLA 2VPPA 3QKSB 1ZTKA 3PV4A 3K6ZA 3E6PH 2WJIA 2G5VA 2DYKA 1MMJN 1BHXB 3CWQA 3Q76A 4Y8XA 3VU9B 1MO6A 4O2RA 1SVWA 4FINA 5HPYB 3RAPR 1IQKA 4BASA 4E07A 2ALVA 1E9BA 2NU1E 4Y8YA 4B2BA 4ARZB 3ZH9B 1TU4A 3RC5A 2O8EA 1P10A 3PQCA 4AYXA 5AJXA 3W8NA 4F4OC 3AP2A 4ZH8A 2Z83A 1MD8A 2REOA 3A7ZA 1L2TA 1XMIA 5KSZA 2FZLA 3HATH 4C0QC 2ZRNA 5FUVA 1KAGA 3Q00A 4A1VA 2IYSA 4OKSA 3CRQA 1BTUA 1J16A 3WHKA 2BHRA 5KO2A 1T4UH 4CT4B 1ODFA 4I8LA 5KPJA 4OJQA 1GBDA 2G55A 3NG1A 1U90A 4XOJA 4NHOA 3U8TH 4NWKA 3CNNA 4CHAC 1NS3A 4P4TA 1G3CA 3UTUH 2W0MA 4QBGB 4XBBA 3FP8E 1WBBA 1HGTH 1OWKA 5G3ZA 4DCNA 3GFTA 2V35A 3ICEA 3PUVA 1M7GA 4A0FA 4KKDA 4X1SU 1LF5A 4ISHH 1ZZZA 4EDHA 4IMQA 1OYYA 4UFDH 3SHCH 1G9IE 4TT3D 3SNCA 1N6LA 3L6PA 5KNBA 2I4IA 2FX6A 2SHKA 3F3YA 3MWJA 1JOUB 4OS4A 1OH5A 1D8TA 2XNIA 1O2GH 2BQWB 2QE7A 1GBIA 1ARCA 2VHUA 2Q6FA 2ZU5A 1K8RA 5G4BA 3S9AA 2AMQA 2ASUB 4RFSB 1VITF 2F3TA 4K46A 1M7HA 2W0SA 2Y5FA 2FODA 2GAOA 1FX0A 4EKDA 3DKPA 1D2EA 2F1HA 2WPMS 1SG8B 2W6JA 3A89A 4US1R 5CHAC 1ZR0A 1DG3A 5HXFA 4ZKNU 1MKWK 2ZE5A 2VA8A 2ZR0A 5CE1A 3RMNH 3TUZC 1JR3E 1LPGB 2ZZUH 1XMVA 1TALA 1GI3A 1SR5C 3QVVA 2EI7A 4DIEA 5L3RA 4LI0A 1O2SA 1TPSA 3SBDA 1W5SA 2RGNA 1AQYA 4QRHA 3GDSA 5E0JA 2BMGB 1P3JA 2R3YA 4HAZA 4X6MA 1S9DA 4EJSA 1XPUA 4N3NA 3QPUA 1NU9A 3PO1B 2FOLA 2PGQB 2EC9H 1P2VA 2VEDA 4BGDA 2JJ2A 1EJMA 1DWDH 4MRVA 2WV5A 1VHLA 1KJWA 3UPEA 5FTMA 2BY7X 3PCRB 1COWD 4TL6A 3DVLA 4TYWA 1OYWA 4LYFA 4FU7A 3W90A 1O3JA 2IPHA 1W2GA 3B5JA 4RD1A 1AUJA 4GCHF 1XU4A 1TQ0B 3KXLA 1SHZA 5D3QA 1LCYA 1SOTA 1Z0FA 1AGPA 1W46A 2TPIZ 2PCJA 1XEXA 4D6PA 1P2TA 4CRFA 2BY9X 1AWHB 1Z0JA 1UBEA 2G77B 1QL8A 2ZYUX 4CR9A 5CIQA 3AB3A 5K8LA 1W0JD 1ZINA 4TT3A 3K70C 1F2TB 1FY8E 1W13U 1NN1A 4C3ZA 2FX3A 2GK7A 3BTQE 1X86B 1W4AA 2V7QD 2BBOA 2QPAA 2O8LA 4UJ5A 1AIPA 4L8GA 3I5XA 4FUHA 2W83A 5DPAA 1RKBA 1N5JA 1J7KA 3ZZ3A 5JSZA 1UK2A 2A45B 4GBMA 3PFIA 1KTTB 1L4DA 2NQ2C 3DDCA 2R2AA 2GCTB 3EAQA 1HBTH 2C98A 3BD9A 4DHEA 1A7SA 4LCBA 4G0NA 3LGWA 3OEHD 1AGJA 2VGCC 1V2MT 3BOSA 1TABE 5DI3B 1XJCA 1XCGB 4PO1A 4NZYA 3KQLA 1G1MA 3KJHA 4LV5B 4WAUA 5IYTA 5AFZH 1BOFA 2ZYVX 2XB2A 4IVPA 1W49A 2ZI4A 1N0WA 5AJYA 4LHVA 3QI2A 1MTUA 3GLGA 1SGNE 1NVVR 5B64A 2BDHA 4ABJA 4L9SA 1HE1C 5GVSA 5FCKA 4IVRA 2GBLA 1AK2A 2ZE7A 2F9PA 1G7TA 1FPMA 5C3NA 2IEZA 5B6OA 3UG6A 4ASUA 2XBYA 2PX3A 1BRBE 2ZSAA 4UXHA 3BIUH 1O3GA 5A0BA 2ZUDA 1Z6GA 4N0EA 5DYIA 4K8OA 4OQLA 1EAXA 4JLPA 3KQHA 4BOHA 2P3TB 3QG5A 3SU3A 2ILNA 4WXRA 4IOKA 2V6IA 1G5PA 2GZDA 2BY6X 2DB3A 2JASA 3B9QA 1C9KA 1WOFA 1NM6A 3RXIA 5JB8S 3K6YA 3BERA 1NC6A 1WAYB 1TMBH 3DT0H 1KLIH 2A30A 1MKXK 3GJ5A 1SZPA 3LBIA 1AB9C 1BRUP 3LBNA 4PXAA 4TQUS 1DDJA 2VWLA 1W0JA 2XOKD 1KMHA 4Q47A 4MA4A 1FV9A 4U2WA 2GA8A 1ZPBA 2V7QA 2EWWA 2OXRA 1E9DA 2WMOB 2YWHA 4NIXA 1DITH 1D6JA 1QHRB 2D2FA 2A78A 1KDPA 3DMNA 3DM5A 4NCKA 1AVWA 4KCGA 3RMLH 4AKIA 2BOHB 2RG3A 4BQSA 1CQQA 3MU4A 1E34B 1R5BA 2FMJA 1DAHA 3IHWA 3CRRA 1D4PB 2WKRA 1NN5A 4Y0YE 1P3CA 3LJOA 1T3SA 1DPFA 3L0IB 1DXPA 4Q4HA 4RFVA 3PEVA 3PJRA 1OHHD 5FOUA 1EPTB 1A4RA 1GRNA 1GM5A 1PQ7A 1E6CA 3AVZA 1Z06A 2B5TB 1W11U 4NU0A 4RI0A 4Q7MB 1EZSC 621PA 3EZ2A 1QA0A 4Q4AA 1IHUA 2JETB 3SS8A 3Q9LA 4C0SA 3FFGA 1NL3A 1ZTJA 4CH8B 4WY3A 3EWSA 1EZQA 5HR5A 1KIMA 1Z0KA 2XC5A 2BMJA 1AKSB 1RD3B 1T4GA 1UK3A 3IWMA 3RC4A 4IDPA 1H9IE 1GI9B 2Z3DA 4CR5A 2CMYA 2GMTB 1CLUA 4FUBA 4WVFA 2BD5A 3EA0A 4A8JA 1HYQA 4RY2A 3TUJC 3H7TA 1UEIA 5CITA 4RD0A 3OIWA 3SU1A 5C18A 1C5RA 1AQUA 3SGAE 2K5UA 4R2IA 2O8EB 3KDSE 3SGBE 4CBOA 3SI4H 4HDOB 4X2XA 7ESTE 5FTJA 2E87A 2BBSA 1M6NA 1XXFA 1C9TA 1DELA 4W5WA 3ZZAA 1GHZA 1C2EA 1GWAA 4C0HA 1QG2A 3KJEA 3P8OA 3GY5A 3T62A 2H57A 2ZPSA 2PLFA 2BDAA 4YESB 3UR6A 3N5CA 1YQTA 1GDDA 3N7OA 3N2IA 3GDVA 4A0RA 3KGPA 5FOWA 3DO6A 1SXJC 2YV5A 2PKSC 2SGAA 2NO1A 3LA6A 3ZQJA 1WMSA 1O38A 1RW4A 1P5ZB 4A36A 1HAXB 1SI5H 2O0HA 2PHBA 4LZZA 2KJQA 3H5CB 1QVRA 2AXPA 3VB7A 2FDAA 2IYLD 2PZFA 1C9PA 1OP8A 1QR3E 3ATWA 2WWYA 4NA8A 3KQKA 1C5TA 4NMMA 8OHMA 2FFQA 4UKDA 2VIIA 6Q21A 2ORWA 3MG9A 5KDOA 1D3QB 5TCCA 1LVMA 4E7NA 821PA 4JZIA 1NIJA 1DAMA 4DCTA 5E3HA 2FOMB 1WCZA 5JCPA 3A85A 5K8TA 2DE9A 2F9MA 4JCNA 3VTKA 4YOJA 3MH5A 5C20A 3SNAA 1KO1A 3Q8XB 4B2PA 3GLIB 1VITG 1OHHA 1VCNA 2QM7A 1NNEA 1DO2A 2FGJA 4V0LA 2O8DA 1MT0A 1KZGB 2BZ6H 1Y3UA 3CWZA 3EG5A 1FMLA 1C5XB 2BXUH 1AY6H 5T6FA 5E0GA 1VKJA 5EE1A 4CRCA 4F38A 2QC2A 1JRTA 1EXMA 4HUTA 3PV5A 4KLNA 5FL7A 4IVQA 1E2PA 4HUQA 4JSYA 4Y8ZA 3GEHA 2RGDA 2AKAB 4GOXA 3VB3A 1FX0B 3SJCA 3IIMA 1KXFA 2ZGCA 2J0UA 1O3NA 2BX4A 1ANKA 2J1LA 3ESTA 1OV4A 4LUCA 4ZKSU 2BJWA 1D9ZA 4CVNA 3QTVH 2RA0A 1CGHA 3TIFA 2J9RA 3ZS8A 3G01A 5DG6A 4TTQA 1GITA 1GL6A 2XCFA 1K1JA 2F1IA 1YGCH 5EP1A 3SZNA 2JDID 2A5KA 2ZU2A 4Q4JB 1TNDA 2OXCA 1FMJA 2QRZA 2NU0E 4ZKRU 4J1YA 1U6QA 1GTVA 1O2IA 4ILEA 1LPZB 5BYJA 1O37A 4BLQA 4TMKA 5BN5A 4EJSB 2TGTA 1DAFA 3EIQA 4GCHG 1MAXA 5GNDA 2QPOA 3KKNA 2J92A 5KNCA 8ESTE 1RYFA 3PWCA 3TW8B 2GZAA 4D7FA 3T1TA 1I4TD 2EI8A 3MLEA 1DS2E 4Q7LA 3LKWA 3ATKA 4MQBA 4ZKEA 4WMDA 1FNIA 4KV9A 1P3EA 3H7OA 5JI3E 2V1XA 3K65B 1Z6TA 1ZMXA 3TITA 3M5MA 5A4JA 4BANB 4HLCA 4BLTA 1BTWA 4WF8A 4NSYA 1Y5BT 1XTIA 4K5ZA 5HKKD 2X1VA 4NG9H 4OS2A 1GL1A 1C1VH 1SBWA 1XEXB 5EG4A 2ZPQA 3Q7QA 4TYDA 5BYKA 1VR1H 1OKKD 3EA5A 4DT1A 1RFNA 3VB6A 3CF6R 2FN4A 1FPCH 3RXGA 1A5IA 4Z51A 3SJAA 1G7SA 1LDTT 2W7SA 2TGAA 5CYOA 1ELCA 3SU8A 2ZCHP 1XTRA 2F4LA 2HRVA 3QBVA 2REXB 3HWSA 3BF6H 1W4BA 5AJVB 3UATA 4LHWA 1JEDA 3ZDQA 2O8BA 4LJ7A 3U69H 1TNKA 1CRPA 1ZSJA 5JSZB 2RGBA 2SGDE 1ZVQA 3ASZA 3K2UA 4MQAA 1VG8A 3TH3H 2VYFA 3OY5U 1G5TA 2ZGBH 3SYKA 1DY9A 1B23P 1S3SA 1S9HA 3EA8A 4E03A 2XWAA 1ZUIA 1M1YE 1PLJA 1E69A 1N6PA 2ZI5A 1AI8H 4BAKB 2R44A 3LC5A 4DY7B 4RZUA 1Q1QA 2JDIA 1YPLH 2P59A 3QIAA 2CXXA 5C1XA 2QXGA 1DLEA 3LO5A 4IBLH 5J4YA 4AZ2B 3CKLA 4B71A 1TAWA 4GLYA 3B82A 3ITIA 4AD8A 2TIOA 4V03A 3U2QA 3ADKA 4BEBA 1SVPA 2PGBB 3RWOA 1FQJA 3V4RA 2B7CA 2ZS7A 1GVKB 3UQVA 2WIBA 3OX7U 2AYWA 4LRWA 4M22A 1GMDF 3GFPA 2V6NA 1GBKA 1CXZA 5JFGA 4IDOA 2QMOA 2P6NA 2A5GA 1J8AA 4NL4H 1NFXA 1DAIA 4B48A 4HB3A 4B33A 4FUJA 1NF3A 4QGAA 4FWTA 2WWXA 2ZTZA 3Q7PA 4DDWA 1GDUA 1DUAA 4UONA 3OIVA 3SI7A 5DK1A 4LBVA 3GJ8A 2BLVA 2NWNA 2GCTC 3UUZA 3TNSA 1JWTA 4IOJA 4TY7A 1G64A 5GWZA 4PHFA 1ZNWA 2ZRKA 3SN6A 1QFKH 2BKUA 3LGVA 3OFNA 5ABWA 1R0ZA 2BEJA 3HPQA 4Q00A 3DZ8A 1VZQH 4Z0KA 1O5FH 3ZZTA 1W5TA 3J81k 3DM9B 4OHVA 1TWXB 3MD0A 5IDKA 2A4RA 1Z08A 1ZGVA 2G1KA 3SO3A 3ZVDA 2ZVQX 4CZ2A 1UJ2A 5M04A 3BORA 4A82A 3RU4E 2OFOA 3EPJA 3FGNA 4RN6A 2ZU1A 2VO1A 1O5CB 2BC9A 2OCVB 1A3EH 1GRRA 5FPTA 5AUNB 1VIYA 1VGCB 1Y63A 4TLAA 3THYB 1BOQA 2QEQA 3Q77A 3ELAH 2G4TA 4GNKA 5K0HA 1SQ5A 3DOEA 3TR0A 2ERXA 3EPLA 4U00A 2XC0A 1TRNA 2BD9A 1CJTC 1OW3B 3L0PA 3AEZA 1GVLA 4XFQA 5IDVA 2V3OH 2R6FA 1ESTA 5AVDA 1XUJA 2ZEJA 1O2VA 4Q4AB 2G1JA 1O3PB 1TLDA 4IS5A 1NTPA 1MAYA 3IKJA 3P6ZB 3ZYDA 2ZPTX 2OLGA 2G6BA 2GCOA 3K09C 1NN0A 1HH4A 1JXMA 4YM9A 2FNAA 2ATVA 1E36B 1ID5H 2AK2A 4IDHA 2H92A 1MTWA 1ZM2A 4QHSA 1C2KA 3GJ6A 1NBMD 1D3PB 1P9NA 2DFLA 4GMDA 1TMKA 3DFLA 2QN5T 1HURA 3SUFA 1BKDR 3EIHA 1GKYA 2Q9BA 1XNJA 2W2TA 4UXIA 5JZVA 2QXIA 4A15A 4KO8A 3SJ9A 4ABHA 2F1JA 4D4MA 2ZRCA 1ZHMA 3B78A 1HAYB 2STAE 1C5PA 3TGKE 3U1IB 1G2MA 3I3SR 4TMWA 4OQXA 2XITA 2PKAB 2HNTF 5JEDA 2ZM5A 3OAAD 1OIXA 1ANBA 1AGRA 1PUIA 2ZJAA 1PPFE 2ZFFH 2XBVA 3ZD7A 4QT8C 4N1AA 3P4XA 3UMFA 2F9OA 5DP7A 1IQMA 1JECA 3BIFA 1FOEB 4LWZA 3ZS9A 4P33A 2CF8H 1N6NA 3JZMA 2DCUA 3B1ZA 2VHJA 2QG6A 1W36D 2A5YB 3IUYA 2BDIA 4LC0A 4TL8A 1JQLB 4YLUA 1Y5AT 4TSFD 3R9WA 2CNWD 3ATIA 1N3BA 4G1UC 2H5CA 3QDZB 3EASA 1EPTC 5KDLA 1V2TT 1Z07A 4QBHA 3UY9A 2TGPZ 1XRJA 1Z83A 1N0UA 3A86A 1CA0C 4OS7A 2I1VB 4DCSA 4I1VA 4JLAA 3ZVGA 3OEED 1NI3A 3SUEA 1FUKA 4U5XA 1ABJH 3AF2A 4BZXA 1HAHH 4C0AC 4I8HA 1Z8FA 1UTKA 1FY3A 1KY3A 2PJZA 4E22A 4HAXA 2ZDAH 1VCWA 2O8DB 1LFDB 4Y79A 4JYVH 2GMTC 1W0YH 5FH9A 1EASA 3TU7H 4BXWA 5T1VA 2CHQA 2AXNA 3E1XB 4FI3C 5C1UA 2VP6A 5BPEA 1DANH 2IWRA 1SGRE 4M1MA 2IJD1 1B5GH 2GEUA 3O8DA 5SZHB 2W5EA 1KTVA 1MO4A 2QGZA 2FM2A 5B57C 1O3KA 2OQ5A 2G00A 2HLCA 1QHHA 2G51A 4DG4A 2QSZA 1SHKA 5GJVC 4IKEA 1FMGA 4G5GA 1Q22A 3CX8A 4W7SA 1UBCA 2R6GA 3E8LA 4Q1CA 5JWOA 3LH3A 4A7IB 1ELTA 3AVUA 3FE2A 1P2UA 1YZGA 1K2I1 4DUGD 2RA3A 3GYMA 2X19A 3TJUA 1UAAA 3ZQ6A 4TYQA 1UFQA 4KTUA 2GTPA 4Q48A 1C1OA 3GP8A 3D65E 2ZP0H 1DLKB 1WDTA 4X8VH 2SGQE 2ODNA 3A7XA 3FKSA 2BCGY 3F68H 1V2LT 4XWOA 1T3LA 5AWFC 3DMDA 1WU1A 4KVGA 1YPEH 2GHIA 4ZCLA 3IIJA 1O2XA 1ZM9A 4EPRA 1ZD8A 2FYQA 4V02A 1RTLA 1N5KA 2FS9A 4X1NU 3RDPA 4EQ6A 5B30A 1CR1A 5FI1B 5CLLA 3SU0A 2TMKA 3QENA 4ZROA 1WXQA 5JS7A 2JIZD 3RDZA 3OEEA 1ZP6A 5LD2B 4U30A 1F92A 1AU8A 3ONWA 2ZHEH 2QMEA 4P4SB 1P9SA 4B3GA 1ZYUA 2OK5A 4DT1B 3M61U 4XH9B 1W4RA 5JLJA 1QIXB 4LZ1H 4PSKA 2YNMA 5SZKB 2XJ9A 1NVVQ 3FFBA 1ANDA 4A1FA 3X1DA 5FL3A 4DB2A 1W3CA 3GY2A 2CVFA 1JPJA 2QY9A 3BEUA 1MZAA 3BTME 2O8BB 3A7TA 1CVWH 4UNRA 3K0CA 2VP9A 1WQ1R 1LVGA 4ZKOU 2Q6GA 4MH0R 2DFNA 4TN1A 4J2YB 3SV8A 1HAPH 2FWRA 4R8TB 2FX4A 4PQRA 3QF7A 4ZPXA 3Q5EA 1EZUC 4EJSC 5CMXH 3T5DA 2GCHF 1XEWX 4Y10E 2OCYC 4HLUA 4TZ6A 2DFKB 3FMOB 2QMHA 1EAIA 2BIFA 3UREA 1W0KD 4WH8A 2V1UA 3K70D 1GMDG 5DJ7A 3GICB 1Z7KA 2Z4RA 2ZNKH 3H09A 4E7RG 3C15C 4W9MC 1SXJE 1G37A 3LD9A 5JBTA 4F92B 1GHVH 3IDQA 1J8MF 1XXHA 4M9SA 4NYIQ 2WUBA 3LOXA 4I31A 1EK0A 4AG1A 3QJYA 3R8FA 4XDEA 1K1LA 1EESA 3UOUA 4DCUA 3UWIA 1GI5A 1P04A 4DBLC 5T6DA 2R65A 1B0UA 2C77A 1O2QA 4WXIA 1CIPA 2C99A 2FSFA 2K1QA 4DDUA 1BIFA 3L33A 3MTYA 1TPZA 1C1SA 3RVBA 4GOKA 5FOVA 3RSOA 3KJIA 1O39A 1YKSA 3NWJA 3K9HA 3EZ6A 2ZIAA 2ZGHA 1A1RA 5EXTA 3URCA 1B0EA
chains in the Genus database with same CATH superfamily
1YL6A 2BELA 3Q5GA 2YYAA 4MOWA 2HDOA 3ENWA 2X8BA 1PJBA 1PR3A 4PIVA 4DLZA 3VR1A 1KK0A 1X1DA 4L4SA 4DGQA 4F04A 4DILA 1I7PA 2Q2QA 1T8NA 4ERNA 4CU5A 1TZMA 4EB8A 3PRKE 3CPEA 2PD4A 5KJ1A 3VNVA 3N2EA 5JWHA 1F9EA 4ABBA 3RC6A 3MQFA 2L6OA 1UFKA 1WUYA 1ACLA 4J49A 4RJ2A 4MHTA 3C0KA 3I2KA 1MB4A 1QCZA 1SXQA 1ZGAA 4ND8B 3MRSA 4X41A 5JDIC 4QXMA 2BJHA 5SY6A 3MJTA 3RSHA 4MKXA 5B3JA 4X65B 4G84A 3VR2D 1ZNXA 3TH2H 1LI4A 4P5DA 5AQ1A 4K6FA 4RCYA 3WWOA 2GF0A 1HPGA 2A0UA 3Q88A 2GYUA 4Q3EA 3MN1A 3ZCUA 2HPZA 4JC8A 5KJ6A 4E5SA 1QB1A 3PD0A 2XWBF 3ZOKA 2JLXA 4JKIA 4AJEA 5SZJA 4ZTZB 2A3RA 2QMUA 3S2ZA 1GCTC 2FPGA 1CQIA 4AO6A 4DMMA 5JBQA 5AW8A 2FDRA 3RUAA 3IAUA 3BWYA 1BTXA 4LRTB 2YW9A 1V1JA 2SECE 2H18A 3RU3A 3CNHA 3SEZA 1QURH 2HSJA 3EG9B 2H06A 5FPSA 1T13A 2WIAA 2IW1A 4GDMA 1BMNH 1V5GA 2YH2A 1KSJA 1ZRSA 1MHPA 3TNDA 1HDOA 4FPXA 2WJ3A 3DMYA 3PQEA 1KP3A 4PG7A 3T3HA 1ZU4A 2R25B 2C9BA 3HKCB 1VGCC 3GT0A 1HJAB 4MV0A 1Y89A 1CUCA 2CL6X 4MVJM 2GRJA 3N7TA 3PHGA 4CM9D 1RQRA 1L0ZA 1DIRA 5FQOA 3U3MA 3RH0A 4IC5A 4FDVA 1MVOA 2A9FA 4ODIA 2EFJA 1TRMA 3HY3A 2UYGA 4M53A 1TLTA 3RRBA 3O75A 1Q1EA 1UPBA 1QDLB 2AYYA 3NP7A 1JA0A 2YYSA 4HQ6A 4GAEA 2YUIA 4TQAA 3FWHA 4R1LA 2OE2A 3VM6A 1NFRA 5JW6A 1QDUA 4B6RA 2DWOA 3TL6A 3T9CA 2JIPA 4POAA 2HLHA 1TFXA 4C6RA 2CDRA 3V1MA 3W5VA 4UVHA 1YWGO 1G3MA 4DUPA 1NRQH 5SZIA 1WZIA 2HRCA 4D0NA 3GMSA 3OUUA 2B5WA 1P2MA 2AC7A 5DX1A 2NO6A 4MP8A 3F96A 3WJ2A 3FNEA 3NT4A 1O3MA 1EX9A 3U0BA 5KX5F 3TBKA 2H48A 3Q6NA 2UU9B 1XCBA 3FPHA 2P78A 1F1BA 2KAIB 1F0TA 1FNNA 5A09A 3BXGA 5CHEA 3ZZNA 3ILSA 1U7HA 5LA6A 2VJLA 4E0BA 3H9CA 3SQMA 4RDIA 5EPUA 2I1LA 1I5RA 8GCHF 4R8LA 5L2YH 4KQWA 1ETHA 3RXCA 4E2FA 3SUGA 3D31A 3SF0A 5AVKA 4PROA 1F5KU 4ALLA 1LVOA 2J2UA 3LUGA 3MWFA 2NTNA 1DG9A 5SV2A 2XSZA 3FWKA 3NIFB 2W9XA 2NYRA 3E53A 4JV5B 2ECKA 3QSGA 4ZT2A 4NFHA 5AHXA 1CE8B 1AGYA 1JE1A 1QA7A 4UMVA 4QO8A 2V96A 3C4QA 5J1SB 3B6JA 1ZMBA 2QD4A 1T2DA 3OFJA 1JDVA 5KS2A 2VK2A 4AROA 4K9QA 2VF7A 5HMMA 3RM2H 4YRQA 3SC4A 3WIEA 4I81A 4BNDA 1ZSLA 2Q1XA 1VJAU 3BQNB 1V7QA 4I19A 1RXVA 3DNMA 3IITA 3DFMA 5G0UA 2YV4A 3LU9B 2I4RA 1U9YA 1Z8GA 3VZPA 1TM1E 3TPZA 3UHAA 3LX5A 3PGMA 1Y5LA 3CNLA 4FS3A 1LU9A 4MR7A 4BX9A 2X4GA 2OCXA 2M5TA 2NVUB 4DIIH 3SOZA 2X42A 2FZWA 4GEKA 3HA3A 4TLDA