4B75A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
total genus 208
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b75A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b75A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b75A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b75A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b75A03
2QXIA 4GBMA 1HYLA 4ZO4A 1A1VA 5GJ4B 1N3BA 2FPLA 3T62A 3DHKH 3TMKA 1SHHB 3CF0A 3T61A 5H70A 5SZJA 4K81B 1Q12A 2FIRH 1HT1E 3U7HB 3PO1C 4DZZA 2ECKA 4SGBE 4CBNA 5A5GA 5BW8A 1O2TA 2XSZD 2I1QA 3ZQJA 1H1BA 4Q00A 2UKDA 1Q3TA 4F4CA 4QBFA 1IAUA 4L16A 1N8OB 1UO6A 3PUXA 3M5LA 3FKSA 4AD8A 4M9SA 1E4VA 4RZXA 1FTNA 3AUXA 4XTCS 4MGYR 3FPAA 1UBEA 3STJA 3QEJA 1KI2A 2THFB 5CM9C 1HEIA 4UJ5A 1OYQA 4ON9A 2YINC 5IHPA 2FSIA 1AI8H 2WM9B 2CCKA 1GMHF 1QRXA 4QM6A 1MQ6A 5TCCA 1BMMH 2ZRBA 2IOTA 1DPOA 3ZD7A 5C1XA 3NKKA 4XE4A 5DGXA 4Y71A 1IN6A 2P95A 2FFAA 1KDQB 4WY3A 2OE2A 1KXBA 1O32A 2ALPA 1MRNA 5EQQA 1LKBA 1TB6H 4DUGA 3TH3H 1C5QA 2WICA 1TF2A 4O2RA 3MG9A 4UQOA 2EW1A 4NSYA 4FI3C 1SGQE 1UKZA 1NNEA 1KXDA 2GZ7A 1GKYA 3L43A 1EB2A 4L5BA 3TQCA 4QXAA 2J38A 1AA9A 2F7SA 3H5CB 1AU8A 4KV9A 1TMUH 3EAQA 4S35A 2GF0A 1OH7A 2VHCA 3X1XA 2FLBH 1S9DA 2J3EA 4Q4HB 1HV8A 2B8OH 4C7OB 3DM5A 4TWZA 4GT1A 1YPKH 2JLZA 4V0LA 4URVR 1U98A 4OK5A 2ZEBA 3ONWA 1H8IH 3NTUA 2DWQA 3B7GA 1NZQH 2WOJA 1BTWA 3UREA 5KSZA 4ZCIA 1O3HA 3IQXA 2F3CE 3SI4H 3RVBA 1TX8A 4DHEA 4UE7H 3SU0A 5EQTA 4CRDA 4G5OA 5J4QA 5K7RA 1V2LT 3LDAA 1IHSH 2CJWA 2W6IA 1F5NA 5H1YA 4NPHA 2ZPRA 4Z1MA 4M9QA 1MO3A 3ECCA 3PG5A 4PR0A 1PQ8A 2GHIA 3WHLA 5JCPA 3LQQA 5A0FA 2AKAB 3QQ5A 4RCYA 1WXQA 1RTKA 1XM1A 2VVVA 3Q5EA 4TQUS 4RN6A 4GCHG 8KME2 4JVMA 1FTSA 2J9RA 4JKYA 2O0HA 2D62A 2HT1A 2NU1E 2EFHB 1AWHB 5FBLB 1AE5A 2WUBA 3JVVA 3IPXA 3P17H 1RYFA 4B3GA 2QMOA 5EQRA 1O35A 2BMDA 1XD2A 3EQ0H 1NRJB 2YWHA 3U3OA 3RDZA 1DPFA 1C1MA 4N0DA 1Y3XA 3GDVA 3ZLJA 2UWLA 3NCLA 3F8TA 3ND9A 4NA8A 3EAJA 1W4BA 1SGDE 3CNLA 2ZRCA 4X8TH 4ARZA 3VB7A 2DYKA 4OI4A 1Y59T 1YHNA 121PA 3LBHA 5E7JA 1XD8A 3F6UH 1ZGVA 1KTVA 4D2IA 1CBUA 3OE7A 5EUQB 5HM2A 3U8TH 2QAGB 1M34E 1H9LB 2WOOA 2IYQA 4OQFA 3JZAA 2EQBA 4HTCH 2Q3FA 4X6MA 2HEIA 3AVQA 3BERA 4PANA 3K2UA 4G5GA 1HIAB 1AMHA 1GHBF 1HDTH 1G7CA 1DADA 3A1UA 4B76A 3K0CA 2GZ8A 3OHMA 3QGJA 4QHTA 4A0HA 1MKXH 3M3TA 1HE8B 1Y3UA 3TJOA 2GT8A 3WY9A 4DCDA 1E9BA 4K46A 4AFZA 5BN4A 1GL0E 1DY8A 2GJKA 5AJWA 4F38A 4GRAA 1ZZZA 5A4JA 1D9IA 1E9CA 3ADDA 4E5UA 2N42A 3AF3A 1GDUA 2FI4E 1A0LA 3PO1B 1QB6A 1MTSA 3E91A 1EASA 4YDHB 5HKKA 1XKBC 4LOYH 1MOZA 4NYIR 1QIXB 2GJSA 5E2OA 4HAUA 4XH9B 2HOBA 1NKTA 1RJ9A 1W36D 1AVWA 1SZPA 4I1VA 4WJG2 2A7CA 1KMHA 2ZVPX 4B47A 1P03A 1Q1BA 1IXSB 2B8WA 1F48A 1MH0A 2Q3HA 4TQAA 2O8MA 2B92A 2PUXB 1AKYA 3KJGA 1EFRD 2B6HA 2JETC 2X19A 1QQ4A 5H4IB 2ZRPA 4TSFA 3QN7A 3ZVDA 621PA 4XDEA 2YKGA 2CCJA 1P2TA 2BKUA 2X8AA 4O97A 1I2MA 3VKWA 1OKXA 4EFLA 3ZVBA 2BD9A 1TL7C 1G37A 2HCJB 2QXHA 5DI9A 5EPYA 1QCPA 3CNOA 1L4ZA 1Q21A 2PH1A 1XWIA 1CJVC 1OXGA 2JLWA 4C2UA 3LH1A 2ZPTX 4RD3A 2ODPA 1TNDA 2YNBA 1KXCA 2A5DA 1T0HB 4UONA 4YZUA 2ZR0A 3RRNA 3THOA 2G77B 2ZVQX 4BFWA 3K0AB 3UQVA 3RMLH 5J5CA 2D7CA 1AZ8A 4CR5A 1DUAA 2WWWA 1DDJA 3A36A 1SHKA 2QT0A 2QQ0A 1ZC3A 4VGCC 1N0UA 2QF0A 1MU6B 3W34A 2YWGA 2OBMA 2OK5A 5GIBA 3TLOA 3NWUA 1V2OT 4I8HA 2H8KA 3LH5A 1A82A 3QVVA 3Q3JB 3AVXA 2JDIA 1TGBA 2ZJBA 2GCHF 2DHRA 3IG6B 1UTQA 2P67A 4ACAA 4QGAA 2Q6GA 2OV2A 2PLRA 3DMNA 3MJHA 2G4TA 4MUBA 4OHYA 2IWRA 1COWD 3VTKA 3EE0B 2DPXA 2AIPA 3NZIA 5F9FA 1PJPA 5DG6A 2OFWA 1SLVB 2QPTA 1BOQA 4IDNA 2XTZA 4DCNA 2ZJ2A 1TU4A 1BRAA 1VG9B 4X8LA 4NYJQ 4PPNA 3ZZ7A 4GOKA 1E96A 3JZ1B 3FZDA 1SXJE 1KO1A 5G40A 4TL9A 3X1YA 3MWLA 2DFKB 1GBLA 1HTWA 4I31A 2ZHFH 2A5AA 1VJ9U 4NCJA 4XBBA 1AZSC 1XEXA 4YXWD 1O5AB 3SU2A 4RFSA 4JLDA 5FI1B 4H6SB 1PUIA 4HUTA 3C5HA 1J8AA 5ANRB 3WP1B 4ABIA 1Y3WA 2QENA 3H7TA 1TGNA 4LYAA 3CZPA 3MGCA 3KX2A 2EFCB 4JVSB 2WJHA 1TYNA 4H4FA 2ZRIA 1M7HA 2QNRA 3KB1A 3CRMA 3G0HA 5TDHA 1BMAA 1W3CA 2OCPA 3MU5A 1KY2A 1E3MA 4TYYA 1DVAH 5HE8A 1M7BA 1W0KD 1NVXQ 3QUMP 3I4LA 5JBCS 3SHFA 1NJGA 1XUJA 4ILEA 3ZZ0A 1G5PA 1MKXK 2IN2A 2O8EB 4FW9A 5K8LA 3ZDQA 4X1QU 1KO4A 3RXPA 2QE7D 2OM2A 4GAWA 1O5BB 3T34A 2QY9A 1Q22A 1MKWH 2XGJA 1E79A 5J4KA 2ZGCA 2VH5R 5ESBA 4V0NA 1KI3A 5DNYB 1E2PA 4I1UA 1L2TA 3OU0A 2ZTYA 4ZXYH 1NMZA 1F60A 2V6JA 4E09A 2FZZA 1T4GA 1XU4A 2JH5D 1CR0A 1P9WA 4MTBA 3OIVA 1HPGA 1XMNB 1IY2A 1K5GA 2W5EA 5FR1A 1FMGA 4GSYA 3A83A 1N2CE 4G01B 1XPOA 5F3WB 1NRSH 3PCRB 4NL4H 3RLWH 2HXYA 3TR5A 5LPRA 1JAIA 3RXOA 3KL6A 1RIWC 4MRPA 1QDEA 4Y0ZE 1OFTA 4GZMA 3E8LA 1QG2A 4GI7A 3MU1A 2OZEA 3UWJH 1RKBA 3ASZA 4DRZA 1J7KA 1K1OA 1SVLA 2IYVA 1TU3A 3S69A 3N5CA 1W7XH 3CW2A 3V13A 5JSZB 3SOSA 1C5WB 1GI2A 4ESVA 3UPEA 3RXLA 4QBHA 3BB3A 2W26A 1VECA 2QGZA 1P10A 3C41J 3SN8A 4UNPA 2JETB 1OP8A 1OW3B 3GY5A 4FU7A 1C9KA 2VSXA 3C14C 1E0KA 4ABHA 1AKSB 3GY6A 2JJ2A 1ZW6A 1G3EA 4XOIA 4ZCMA 2A4OA 1U0HC 2PL3A 3LPRA 2A7JA 5T6FA 4Q7LA 2VLIA 4TQ9A 2HNTE 3LGTA 4HEJA 1E0JA 1NP6A 2CGAA 1BTZA 1R2QA 4YTAA 4TN1A 2Y80A 1W2KH 1E2MA 4DDWA 3VFEA 1TLDA 3PMJA 2WWFA 4CEJB 2KB0A 1DTSA 1OHHA 4JBXA 2FS9A 3ETLA 2GVZC 3UKDA 1VCMA 1T8LA 1GJ5H 1SQOA 3SNEA 4Y0VA 1PLLA 1LQEA 1NFYA 1NS3A 1J99A 2HJVA 4HLUA 3KNXA 4TYDA 1A46H 1TEVA 1UEIA 3AGPA 4HLDA 1KY3A 5AVDA 5HTKA 1T8MA 1PUJA 3LIWA 3ADBA 2Y7XA 4VGCB 3T12A 1K21H 2P0EA 3DKVA 1GBTA 2SGPE 3SO3A 4Q03A 3BTKE 3RXEA 3IBYA 3BTEE 1KMQA 4JSTA 2FZ4A 2ZTXA 2XWBI 2FPZA 1FPMA 1YF4A 3TSZA 1BYIA 3GYLB 3SFVA 3Q77A 2WJVA 2RDLA 3MHWU 4TWYA 4NONA 1THPB 1VCOA 5GDSH 2CL7X 5FTKA 4Q4AB 2A32A 4S2EA 2YNAA 4US0R 2PLXA 1ZRBA 2J92A 2FOCA 2MSCB 5BRRE 2FJUA 2J1LA 1EOJA 1Z2CA 2F9OA 3T25A 5CLQA 1L4YA 4N3NA 1NSFA 1C5RA 4UXJA 2CN0H 1KXAA 4C0JA 5TXGA 3PV5A 3FP8E 4OQLA 5FBQB 2FYQA 2RGCA 3V4FA 4IXNA 4Q9LA 4URUR 5EE9A 5E3HA 1AGRA 2J7PA 1KK0A 1DAIA 1S8FA 2IYZA 2JASA 1NI3A 1Y3YA 2A7QA 3H09A 3L82B 2I3BA 4QHSA 4H6TA 3DEFA 3NPSA 4IKEA 4JS0A 2ZUCA 1VCWA 3A37A 2R3UA 1TGCA 3V0XA 1K1MA 1JECA 4FWTA 3EIQA 2C04A 2BC9A 1J9CH 5LDDC 5EODA 4LHZA 4CRWB 3H4MA 1G7TA 3ZZUA 2A1DB 2BZAA 3TPIZ 1SVIA 1H65A 1GVNB 1YZQA 3C4JA 1MKWK 4FINA 3EWAA 4GDFA 4FCTA 3P8FA 4A2PA 2UUKB 2HJGA 1YP9A 2Y5FA 3KN2A 1OXSC 3SGBE 5JEEA 3EWSA 3PUZA 4WXIA 4PHGA 4C0HA 4XVQA 3TGIE 4LV8B 2Y81A 3VB3A 2XOKA 4GOJA 1KZGB 1ELDE 3RABA 3MFJA 3BBPA 3Q9LA 1MTUA 1D2MA 3L0IB 3NBZC 5T1VA 2XTTB 3I8SA 2NZ8A 2C9YA 1NC6A 2WJJA 2P93A 2N46A 4X6OA 3A8DA 5E95A 2IYYA 3LH3A 5IRCD 4QRHA 1AWFH 4H1UA 1X1RA 3OEHA 2BY7X 5EOKA 4NTZA 2WVJA 4C9BA 2ZR7A 1LF0A 4FCWA 2R6AA 3CKLA 3UOUA 3LV8A 2ZRAA 1LTQA 2Z9GA 3UIEA 1S2MA 2G00A 1T7CA 2FDAA 5DISB 1OXUA 3TUZC 1TEXA 1T91A 4B33A 4HI0E 1CEEA 1XZPA 3OIUA 3BIUH 5HCIA 3ODDA 4LHVA 3KJIA 4Q2KA 5KSPA 1RIWB 4UXIA 4AKIA 1Z8FA 2NIPA 4YT7H 1UK4A 4Y6DA 4OHWA 4B73A 4GCHF 3UMRA 1UKEA 2IF2A 3CO5A 4GFDA 1G32B 1V2RT 3QKRA 2UWPA 4X8HA 3ZV9A 1G4UR 1C5LH 1Q57A 2AWOA 2GXSA 3G01A 2HT6A 1KK1A 1Z08A 2Q1JA 4BFSA 3S0NA 5C5OA 3WXMA 2ZI6A 1Z1IA 3EZFA 4PC1A 5DP9A 2F1HA 2W0MA 4BPBA 2AWNA 1SVKA 3SU1A 4FUEA 3F68H 4M1YA 2DWOA 1E37B 1P2VA 3QG5A 1YCPH 1TBRH 2QXGA 3AKCA 5AUOB 3PUYA 1C1TA 4RKEA 3TBKA 1FNIA 1TF7A 4LBZA 2GEDA 2NO6A 3O8DA 1R4AA 2VSFA 1H8DH 1E2QA 3NBFA 2UUFB 3AH8A 3GEHA 5L3VA 3AEZA 3T28A 4E7RG 3CRVA 2L0XA 4IC5A 2XBWA 1NU9A 4K69A 1FMJA 2FMJA 1GL1A 2AK3A 4BTUB 2XX3A 4LDJA 1HAXB 1BT7A 2JIZA 2BLVA 2TIOA 4BFUA 1SVOA 1KNXA 5AJZA 3M1IA 4V0ME 4YOGA 7KMEH 2CVHA 1KSNA 1D6WA 1J8MF 1F6BA 3RXVA 1A2CH 2ANMH 1W44A 2PTNA 2FOFA 1QHGA 4DDTA 5JLJA 2DBYA 4I8GA 1IQPA 1JNYA 1DS2E 5A09A 2OC1A 2IYTA 4O0MA 5GCHF 1GBCA 1YR6A 2QMEA 3TNFA 3TAHA 4LSGA 4TPYA 1OWHA 2XITA 4YLGA 3LXXA 5D3QA 2AX4A 1CT4E 2P65A 1G3RA 3RHFA 3VXFH 1EP5A 3NK8A 3THWA 1O2QA 4M0LA 3WBJA 2R3YA 3AV0B 4RD4A 3LY5A 5FPKA 1HQCA 1CXZA 2A2QH 1TBZH 1E2DA 3FMIA 3KDSE 5KHOC 1BZXE 4Y0YE 4YO9A 3TJNA 5FCRA 4TL8A 2VBCA 1WA5A 4D0LB 1ONBA 3PVSA 1KGDA 3KQCA 1Z28A 5L3SA 1G41A 4LK2A 2FTMA 5CDFE 1SLWB 1O3EA 2RGXA 1FXYA 1WUNH 1GAJA 4QJ3A 1RRFA 5EP3A 2ATXA 4I4LA 2P6NA 5FR2A 2LKCA 2Z9JA 4II7A 4IDPA 2LWIA 3T1OA 1BTXA 1EFTA 4LGMA 3SZRA 5FHTA 1L8QA 2A5JA 2YNMA 2HALA 1GHWH 2UZ3A 4ZKOU 5EE3A 2EI8A 3OZXA 2A31A 1ELFA 4Z1MD 4US1R 1LVGA 4P3YA 3GICB 3AM1A 5FX6A 4MPWA 1A61H 1DWEH 3S7HB 3U5ZB 5G53C 3U60B 2PFEA 1XDBA 4CDGA 4X1NU 2BQWB 2BXUH 4ZDJA 3A7YA 1US8A 3PITA 1P60A 1N6XA 2VIPA 4TTQA 4JCNA 2BDBA 3ZZ6A 3PMHB 2FEMA 1H9HE 1NRRH 1GBMA 1GJ8B 1ZCAA 1G18A 1KO7A 2CLSA 2PBRA 1Q3XA 4XSKU 3ODFA 2D26C 1F5RA 1QHNA 4LBWA 5FH9A 3LX8A 1OSNA 3CH5A 2Q0HA 3RSLA 2EC9H 4UJ3A 4G5RA 4LJ5A 3KQUA 1V2QT 4MQBA 1KI6B 4IVQA 5AF9H 2GXUA 4JLBA 2D4HA 3TRFA 4BFVA 3M7QA 5FPHA 3GJ5A 3U44A 2GNOA 1TPZA 1S81A 3SZEA 2ZI5A 2H57A 1UVPA 1IJEA 1NMXA 3GLFA 2LNCA 2G5VA 1R0XA 1ELGA 3VX4A 4DIIH 3U8OH 5BWMA 3SHCH 3OE7D 1OXXK 4D9RA 2GA8A 2KI5A 4QGFA 5A0AE 3RXAA 3ATLA 1E0SA 2V9PA 3EZ6A 1P3CA 1MO6A 4L15A 1AZZA 3BXZA 1Q3HA 4K1TA 5B6LA 1YCPK 1XTIA 5FUWA 2O8UA 4PROA 3BJIC 2V55B 2EFDB 1OIXA 3IPYA 2X77A 1LVOA 3G5UA 3A8AA 2AFQB 1Y3AA 2GDJA 2BD4A 3UTUH 4AURA 4M1KA 1R0ZA 2QA5A 1P2SA 4HB2A 2XXAA 1DT2A 1LCYA 1ANBA 3OAAD 2ZJZA 4HUQA 4TWWA 2ORVA 3R7WA 1P2OA 3MJRA 9ESTA 1GRNA 3NWJA 1RGQA 5FPSA 1BTYA 1DFPA 2ZTSA 3U1IB 4EPXA 3LT3A 3RXDA 1HJ9A 2REBA 2B9LA 4KFTA 1CT2E 1O2MA 2P2LA 2J34A 3SGAE 5HKKD 1XMVA 4M1WA 1G3MA 4TYPA 1Z1JA 2H5DA 1FUUA 3RM2H 4NYJR 2SGEE 1HB0B 1E9RA 3R20A 4ESTE 3W90A 4WIAA 4I8LA 2FXRA 5JBTA 1KK2A 2QYIA 5JRJA 3RLYH 3GY8A 2W00A 5CK5A 2GV6A 3R0FA 1SHYA 1HUTH 3K0CC 2VIOA 2BJWA 1SKQA 2WWHA 2FEQH 1MCTA 4BZXA 5DHAA 2CXVA 2QPOA 4FD2A 5CB8A 1GVZA 1TUEA 4B3FX 1KSFX 2GXQA 5CLLA 2ZS7A 4NYMR 1JXOA 4HZHA 3RXQA 4YMSA 5FI0B 4X2XA 3F9FA 4HB0A 2C9CA 1EB1H 1KZ7B 3HYTA 3BC1A 2QAAA 3TSWA 3AQ4A 2CEAA 5CE1A 4AKHA 3OIYA 1D6JA 1Y5UT 5F9HA 4OQXA 1O3CA 3SU8A 2XWAA 1VGCC 4D9QA 4MGZR 1UVOA 2VJ1A 3LVQE 3MWIU 4DVGA 1XF9A 2YJTD 1C2FA 3BEUA 1MTVA 1FUJA 2ZA5A 4KSBA 4JLVA 4FCVA 1G291 1KI7A 4B2PA 5DP4A 1SGRE 3RS3A 5GXPA 2PCLA 1Z0FA 2UZIR 1TADA 4MDEA 3C8UA 2ZFRH 4FUHA 2JDID 3W95A 3BTTE 1D5CA 2FN4A 2O8LA 3CRQA 4DLWA 2J4IA 1SKYB 8ESTE 1C1OA 4Y8ZA 2PHBA 3T1TA 2H6MA 3SN6A 3TH5A 5EXNA 4FMDF 5ESTE 2J5XA 2GAAA 1KXFA 3T06B 5GVSA 3WYFA 2AXPA 1LMWB 1WTGH 3OTPA 4O25A 5DYGA 2M5TA 2OILA 2GBLA 4K5ZA 1O3FA 1ZYOA 1AVXA 1V2PT 2W7SA 1W46A 2BM1A 3AKYA 2HXSA 1SL3A 1P02A 2ZJYA 1MD8A 1KTTB 1QB9A 2PSYA 4HAXA 2H2ZA 1T32A 5G3YA 1ANKA 4TLAA 3V7TA 1MU8B 1T8UA 4HGCA 2VWLA 4IC6A 1ZUNB 3SHAH 4KKDA 1NJFA 3C16C 2F3RA 4CEHA 2VGCC 4KBGA 4ZMAH 2O5VA 2ZPQA 4BAQB 2ZRNA 2GEUA 2ZSDA 5PTPA 3SUDA 3B1ZA 3B1YA 2FF7A 2GK6A 2BY6X 2O9QA 4EPYA 3OY5U 2CF9H 1KLIH 3OFNA 2CK3D 2FX3A 2NG1A 4JT4A 5EJEA 5FOUA 2DY1A 3FDIA 4RZ2A 2OQUA 3K1JA 2VO1A 3MO9A 1FLEE 1AN1E 1FQKA 4UFEH 3CWZA 3SI3H 4FMBB 2PTCE 1ZSLA 1CLUA 3U4QB 3K09A 4HSEA 1NRQH 1P3EA 2R6GA 1SGPE 1Z5ZA 3NIBA 1RRGA 5FTNA 2A9KA 1NY6A 1ELOA 1O3YA 2OXRA 1O3BA 5FX5A 1BUIA 1V2KT 2RGNA 2OQ5A 3GMTA 4K1SA 1DAKA 3E70C 2FGJA 2FWRA 2R9VA 1O33A 5B2ZA 3KTAA 1GOTA 3SQEE 2ZYTX 1NBME 3LDXH 3BFKA 4PXAA 4TMTA 1WQVH 5BN5A 3OYPA 3E90B 1CA8B 3RXIA 4DJZB 1AUJA 1RVDA 4MNWA 2XB4A 4IHQA 1X6VA 3FAOA 2GJAA 1MZAA 2WHXA 1CU1A 1V2NT 4JZFH 3M61U 5FCKA 1CJMA 3C7KA 3U7EB 2I4IA 1O3PB 1P2IA 1W2HA 2GDDA 1O30A 4WH6A 3A7VA 3TIUA 3BD9A 2CCGA 2HVXA 4HFPB 4CRFA 4CRAA 3DPUA 1Z6JH 4XBCA 5F2EA 2ZIQH 4BFYA 4CZ2A 1EWRA 4NIWA 1NN6A 4TTPA 3TUIC 5EUMA 1SGTA 3SBEA 3KJHA 2J0SA 3EA8A 4A5TS 1C2JA 3T26A 5JFGA 3IBGA 1AK2A 1ZIOA 1GVKB 2ZRLA 1AO5A 1YZTA 1G7SA 4IDOA 2JJ2D 1U0LA 2XC5A 1EATA 4UNRA 2HGTH 1GJAB 1GJBB 1FW6A 4BAKB 2ZSAA 4DLVA 1A5HA 4U30A 2EEKA 2V3CC 1LDTT 4Q48A 4BE7B 1O37A 4Y7AA 2GTBA 4KODA 4OQMA 4ZPXA 4A1TA 1AY6H 2MSDB 4XFQA 1CIPA 1UAAA 1RJ9B 3A7XA 1Y5AT 4ABDA 3S7KB 4WVPE 1M8PA 2FU5C 3MUFA 4V0OA 4W7SA 1KMHB 1OWEA 2BMFA 2SGQE 2J0QA 1R7RA 1V5WA 1OPHB 4NA7A 1VGCB 2SNWA 4B43A 1DWBH 4B3BA 2AYWA 3ZH9B 1HBTH 4IDHA 4BLOA 2IYWA 4MYHA 3PV4A 1OF1A 2FDCA 2YWEA 1NM6A 3ZVAA 1XTKA 1T4UH 4MLFB 3A4LA 5LBIA 2KBFA 1NRNH 3ATWA 1JBUH 3ZZDA 4B74A 1AN0A 1BMFA 1MH1A 1C5VA 2OCYC 2HLCA 2NU0E 1GVLA 3KQBA 1JQJC 2V54A 1BIOA 1O2VA 4FMCB 3DD2H 4PX9A 4ISOA 1MO5A 1JIRA 5EW1H 1GBBA 1L1GA 1PYTD 2BBOA 2CJIA 2XBVA 3HP1A 1ZMLA 5L2ZH 4NBSA 1S0UA 1N6KA 2CHGA 2F6RA 2VWOA 3SV8A 3QSYA 3W6NA 1TABE 3LGYA 4I1SA 4HLUC 1DY9A 2W83A 1E35B 4EQ6A 3NXSA 1RXPA 4JL6A 1P9SA 3ADKA 1C4OA 1CSOE 1EJNA 1U9IA 5DSZA 3DFLA 1GG2A 5JDUB 1Z8GA 1Q1ZA 4WVFA 1PV4A 2BVSH 5SZIA 3UNRA 3GY2A 4AN7A 2C2HA 4QGHA 3CF2A 5EU8A 3D6TB 5DLQC 3CBQA 4KJZA 5DH9A 5DKMA 1N6LA 5LD2C 1P5ZB 1E0FD 3TK9A 2VGCB 4FVBA 4EFMA 2OC7A 1XTSA 3RMNH 4JYTA 1QVRA 1XVOA 1JR3A 3M5OA 1TNJA 1VHTA 1SQAA 2WPLS 1PYTC 4AG1A 2AKYA 3K8YA 2FX6A 1PPFE 2W58A 1G5TA 1O5DH 1C1PA 2G52A 2VINA 2UVQA 3WMEA 1G3IA 4BEJA 1YYY1 3ZZ3A 1ESMA 3WP0A 1FX0A 2C77A 1F2SE 1GCDA 4XSGA 4DDVA 4URWR 2FM2A 1FNMA 2CXXA 4PZYA 1AFQC 4Q01A 4B3DA 1IQJA 5F8XA 4DW2U 1FAKH 5EQSA 1XJ0A 1YPGH 5JWHA 2ZGBH 3KB2A 4XWKA 2W2TA 1CGIE 1CA0C 1SULA 3B9QA 3QPWA 1HAIH 4L4UA 3RU4T 3Q3XA 1NLFA 3CX7A 2XOKD 2J0UB 1D2NA 1OWJA 1N0VC 2J46A 2FP7B 2KJQA 1JXMA 4RFSB 5BN3A 1S85A 4B6EA 1MBQA 3HK6B 3DVLA 4OI2A 1FJSA 4LJ6A 3QGNB 2FOAA 1SQTA 2W3IA 5HZHA 1RTFB 3K9HA 3KUDA 4CRGA 1R10A 2OLKA 1SXJC 1J17T 2PW8H 1PPCE 2BOVA 4QC2A 5CJ2A 1I4DD 2GVFA 2ZDAH 3ZVRA 1F2UA 1BBRK 2QI9C 5A8YA 3I1FA 2HYDA 6CHAC 1C2IA 1ZR0A 3M5NA 2FESH 4DLZA 5M04A 1ZUIA 4NH0A 2CF8H 4A92A 1WAYB 1DAMA 1T0JB 1ZNWA 3AAVA 2WSMA 1E2IA 821PA 2QTFA 3U7FB 1XTJA 1RTLA 5AR1A 2AK2A 3MU4A 3VXEH 2WKRA 1WYKA 4GL2A 4ZI2A 4LHWA 1C1NA 2PLFA 2XW9A 4QOSA 3GLHE 3FKQA 1II0A 3A84A 4AWXA 1INCA 3T1VA 1J16A 4G0NA 4BXWA 1BH2A 1FN8A 1R0YA 3KQLA 4W5JA 3VB5A 1IOZA 1HLTH 2H1UA 3RXJA 4A6PA 3QZQA 4K2YA 2RGBA 3KXKA 1F2TA 2D2FA 2ZJAA 1N1LA 2BCJQ 3HR8A 3H2YA 3A4NA 2IYXA 1FY4A 5L6NH 1HJAC 3ELAH 5J40A 4D4LA 2BBSA 3T29A 3HDTA 3VKHA 1GHZA 2YC2C 4NZLA 2BQ6B 2BOHB 4JK5A 1KNQA 1L0ZA 4HB3A 1W0ZU 3M4YA 2ZAOA 3QG1A 1TRMA 2JIZD 1TGSZ 3VNUA 1TF5A 5AJVB 2JLQA 2BD5A 1A1RA 2XNSA 1M9UA 2FEOA 2BIFA 4C3ZA 1D9ZA 1UKVY 1SR5C 1OT3A 1OWDA 3ZVMA 1EX6A 1E2EA 2CHAC 1QBOA 2OBOA 2VH0A 4QG7A 3GDUA 1ESTA 1SVPA 2ANYA 4KTCA 4AY2A 4Y76A 1SGNE 3GISB 4BTTB 3BTME 2Q21A 4EPRA 2FA9A 3F3YA 4LK4A 5F6MA 5GJBA 2VP5A 2BVNA 1GM5A 4DLSA 1QFKH 1E2LA 1OWIA 5JJLA 1ELAA 2NO9A 4A0RA 1V2TT 5DHFA 1V2UT 1F3OA 1C1UH 2JJ1D 1HAYB 1LO6A 3VX3A 1IN5A 4ASUD 1D3QB 2ZS8A 3GFOA 3UANA 1TNKA 3QF4A 4JLNA 3IIJA 2AGEX 4JYCA 1QG4A 4RKFA 3W5IA 4KVGA 3JZ2B 2YWFA 2CDNA 2PZFA 1JMOH 1VPLA 4ISLA 1GZSA 3BIFA 4AG5A 5JRZA 1T3LA 1PLKA 3FVQA 3MH6A 4Q19A 3RXSA 2BWJA 1P6XA 2ZP0H 1CR4A 1CR1A 1NLZA 4M1OA 1RE0A 1LVMA 3AW0A 2B21A 2IYSA 5EXLA 1HFDA 5LD2B 3RNLA 2Z6VA 2A4GA 2WPHS 2QM7A 1KK3A 2BCGY 1X8LA 1P3JA 1CHGA 3KJEA 4K8YA 1FNNA 3W6OA 1OKKA 3K0SA 1KHTA 1HT2E 2P3UB 2HUPA 3U8RH 4FVDA 1UCYE 3EA7A 4B2IA 1ESAA 2HYIC 3QJYA 4B2BA 3RXMA 3PENA 4POAA 4UD9H 4YOJA 1AFQB 5TARA 1VITG 3PB1E 4TYQA 3I78A 2ZFQH 4OYHA 1ZSKA 1ZM3A 4JYUH 4HLCA 4LYJA 1CA0B 1CHOG 3CX6A 1XEWY 3B13B 3MFYA 3B78A 4EDHA 4DB4A 8LPRA 3B1XA 4AI6A 1E98A 4R7ZA 4C0SA 3V4RA 3SJZA 2BQ7B 2HLDA 2C8WB 1TOCB 3CENA 2ZKSA 1EXMA 1JWTA 2G0TA 8OHMA 1AHTH 1SXJB 3J81k 3PFIA 4D0NA 4A6XA 3ZVEA 4ZCLA 1U90A 1YR9A 2WTUA 1OYWA 1TNGA 5C46F 1OFHA 2IK8A 4E07A 6CHAB 3UK6A 4DT1B 2TRMA 1ZSJA 2B7DH 2IXGA 1RW4A 4ISHH 1E38B 4G5QA 4Q1AA 4TY6A 3QNUA 3MI4A 1E4YA 2J87A 3MH4A 4LJ8A 1QJ6B 4V02A 1MMJN 1GWAA 4THNH 3ZYEA 1KYIA 3M35A 1EAIA 1FOEB 3SBDA 1OOKB 4E05H 2BM2A 2HNTF 2TGAA 5EP1A 2V0BA 3RC3A 4K1EA 3LW7A 1KI4A 2BB4A 3ZZTA 1ELCA 2ODYB 1GJ4H 7LPRA 2ODWA 2ORIA 4RZUA 1V43A 3TNSA 3EG5A 2RHDA 1EAUA 1KIGH 1EZSC 1VITH 3TGPA 1NROH 4D8NA 1WU1A 5BYKA 1J2JA 2QBYA 3WMFA 1B5GH 5BYJA 5CIWA 2OP9A 2V1UA 2ZTZA 2ERYA 2FG5A 2RGGA 2BD8A 1QHSA 3Q7PA 4ABFA 1CJKC 1ZOMA 2GESA 3AUYA 2UUYA 3LWNA 1A3EH 4UNSA 1G21E 1ZU5A 1HJAB 1G8YA 1WP9A 1HAZB 3UMSA 4FUFA 1LQDB 1O3GA 2AD1A 1E94E 1KI1A 1JRSA 1YPEH 3DMDA 2XSZA 1F92A 1BMLA 2DFLA 2FZLA 4JVNA 2OXSA 1AB9C 3QZRA 2SFAA 1C2DA 4IOJA 1F7ZA 3QKRB 3SUGA 3LNCA 1G19A 4KU4A 1TOMH 2VIVA 1IBRA 1FY3A 3P8NA 1GILA 4AYYB 3PWCA 4C0BA 4M1MA 1Y8TA 4IDQA 2FFQA 2GKVE 4JZEH 2QMUA 2IUUA 1W11U 2P3FH 2CHAB 5GNDA 3CRRA 1SVMA 4BFXA 3RC6A 1E6CA 5ABWA 5KOYA 4XSHA 5C4MA 4A1FA 2WIBA 2ODQA 4D25A 3DL0A 3H1TA 3A1WA 3TITA 3LO5A 1XX6A 4YMTA 5SZHB 3QK1A 4MUAA 3M3VA 1MT0A 1W2GA 2ZWLH 3WY8A 4I7YH 1Z8JB 5DP6A 3ZGXA 4FUCA 5IT5A 1O2UA 1PPEE 4RD2A 1F0RA 2VHJA 1OP0A 4IVPA 3D3QA 4F91B 1XUHA 4US2R 2BLQA 2QPAA 1YRBA 3RRMA 5KUTA 1ETUA 2GCTC 1JIMA 3GLGA 2BMEA 1C5NH 1JPNA 1P73A 3AVPA 2VP0A 1Z06A 2VIIA 2W6JA 3NHBA 3E16B 5HYOA 4AGJA 2PJZA 4FUIA 1CP2A 3BORA 1EX3A 3LKWA 2VRWA 2OUAA 1GBDA 2O8BB 3C27B 4Q21A 3Q3YA 3TK6A 3A88A 4JK6A 4U2WA 4BGDA 5J4VA 3RU4D 1G1MA 2ZI9A 2E1RA 1A5GH 1O3LA 4Z54A 1EFUA 1S3SA 3WYGA 2ZRFA 3THWB 2A5IA 221PA 1O2JA 1W4RA 4X0WU 4IW3B 3CR8A 1DELA 1UVSH 1GNQA 4D26A 2BY9X 3K6YA 1GTVA 1FONA 1GHXH 4A6LA 3M3SA 5EP2A 1AJEA 1OH5A 1EGAA 5L3SB 3PJRA 1G17A 3K0FA 4BLSA 1W14U 2QQEA 4MKHA 3CNNA 5DGJA 2AFHE 1GSIA 1Z6EA 1THRH 1Q1QA 2ZEJA 4PC2A 3CPEA 4ASHA 4NP6A 1JJ7A 2QP3A 4DIDA 3LVRE 4MQAA 1SB1H 3BS4A 4JMYA 1O2OA 1U99A 1C2KA 5B58C 9LPRA 1ANCA 1BDAA 5F03A 3QXJA 1EXFA 2I6SA 2IS6A 1YZKA 1G3QA 2BMGB 1X86B 2GBLC 2GDEH 1GBKA 1GI3A 2IF0A 4JLJA 3UPUA 1KIMA 1G8FA 4YT6H 1BMNH 2E87A 2IYRA 3OF5A 4HZUB 3BH6A 1SGYE 4SGAE 3U6KA 1NG1A 3FHCB 1BOFA 1W47A 1UF9A 1P04A 1TQ2A 2FS8A 3BB1A 1US8B 1WQ1R 1KO5A 5E8EH 2IBMA 1XXHE 2AEIH 3P8GA 3U4QA 1QL7A 4R98A 4MDFA 2C8YB 3NC0C 4MPUA 5FXLA 1VG1A 1O3NA 5KNBA 2Z7FE 1WBBA 3SNBA 1Q0UA 2XXLA 3VMFA 4JBWA 3KXIA 2ZSBA 2DCUA 4G1UC 1E9DA 1A4RA 5L3QB 1BJVA 1TE0A 6GCHG 2BDGA 3QVUA 4HYYA 2ZFPH 2F3TA 4MKFA 1P2NA 2O8DA 2Z9KA 3KKNA 4KP0A 3A89A 3M5MA 1DAGA 2VHUA 3U44B 1NMYA 1NG9A 4ABEA 4X8SH 3K0EA 2ZFSA 2FGKA 3FHTA 4IN2A 2R6CA 5TVKA 2GX4A 3LGIA 3GLFB 3K09C 1A7SA 3SJOA 1K5DA 3EX7C 1GBAA 4GVUA 4EJSA 4LXBH 3AAUA 5EZ5A 1TPPA 3PLKA 3EPHA 2RGNC 3TE6A 3G82C 2OO7A 4ZH8A 1RRCA 1Z6AA 2BEKA 2R9PA 4DSOA 4BLRA 1AB9B 4Y8XA 3VHLB 3U6BA 3I8XA 1TQ7B 3S9BA 5KTYA 4NU0A 4OGXA 1ZBDA 4LZZA 1SI5H 2XXAB 3AVYA 1IJFA 4HUQB 2GD4B 2ZCLP 2J45A 5DN6A 1OX1A 2RAPA 1JPJA 3GLIA 3R7WB 1HAVA 4PC3A 3T5DA 4LOAA 1ZJDA 1DEKA 2CL0X 3WNCA 3MOCA 2JH0D 4E7NA 3HGPA 3QKSA 2GZHA 3N7OA 5FBVB 3CS7A 1A7JA 3A7WA 2QGNA 3KHVA 2YVUA 3QBVA 1Z47A 2IUSA 1NFUA 2O0KA 3REFA 3MYWA 2ESTE 2W2VA 2Q9AA 2ZFFH 3HPTB 1C1WH 1EFCA 1QRAA 4L9WA 1P01A 2ZDNA 2FPKA 3V00A 4AIIA 3HR7A 3OTJE 5AWFC 1ZAKA 2QRZA 1AIXH 4QL3A 4TLEA 4QJ5A 2XTNA 3TH4H 1OJLA 1ETRH 3DT0H 1ZNYA 1O2WA 4NCHA 5CB6A 4Q7YA 2GCTB 3KKOA 3TJZA 5GJWC 2CMKA 4IXMA 4ZHAA 1BMFD 1H8HD 1ZRHA 1ANDA 3EC2A 4IOKA 1FL9A 1UKYA 2V8OA 3RUOA 1GGDC 1UJ2A 3O47A 4RCZA 4B71A 1EKBB 1P2QA 1HAGE 3THXA 2XEXA 4KYUA 3QY0A 2Z94A 3AB3A 5EE0A 4B2CA 1NN3A 3RSOA 2PEZA 3RWMB 4PQYA 3X1DA 2F9UA 1EESA 5EW2H 4DSNA 3NBXX 2ORWA 2VF7A 4BZPA 4X2VA 4NKRA 2ZRGA 4A8JC 4H1VA 5C1BA 1E0AA 1DE7H 3QIAA 1COWA 3SNCA 4RY2A 1S83A 1KAOA 2VQSA 3Q7QA 5JJIA 3QX5H 1L4UA 2J59A 4XVRA 2IYUA 3ND8A 4Q9JA 2XB2A 3F9HA 3VR5A 2FI3E 4BRUA 2ZCHP 3RS7A 2XTMA 1NIJA 3FMPB 3HYRA 521PA 4ZV4A 3QPUA 4F49A 2J0VA 5LB2A 1TIOA 5IDKA 1QHHB 3L2OB 1W4CA 5EXMA 5BXQC 3FOZA 1V2WT 2D8WA 3D23A 3EIEA 1TAGA 1JR3D 1H4WA 1SOTA 4LHXA 3DOEA 1ZVQA 1RFLA 4V03A 2VEDA 3RLFA 1MD7A 2CBZA 1YCPM 1DG3A 2UWOA 1IQNA 3N2EA 1IY0A 5DP7A 2GJ9A 4TL7A 2EI7A 2OC0A 2ASUB 1BJUA 2R0KA 1JEDA 1LFDB 1C1RA 1BB0B 1U9IC 4C0LA 4G3XA 2CL6X 4KELA 4AYTA 4M2LA 1KYNA 1W7GH 4F92B 3UATA 5JMTA 5L8VA 3QF7A 2Q9CA 4GHQA 3BK7A 1Z71A 1WQSA 1FIZA 4P0TA 2Z83A 1G6HA 2FE4A 4BAMB 5FPTA 3KKMA 2RGDA 4RSGA 1UBCA 3MH7A 4HZIA 4CEHB 3ZZ8A 3BTQE 3L3TA 3KQNA 1QF9A 1Z6YA 4GP6A 1CQQA 2K1QA 5FBEA 2NU4E 1GHVH 1HE1C 2J0UA 2FNAA 3TVDA 3DDCA 4O2LA 1MRSA 4Z8YA 4R2HA 1MAYA 2PSXA 1H8ED 1NLYA 3M7UA 3KF2A 4GLYA 1IQGA 4NIYA 3B85A 5KO2A 2NGRA 3U2QA 1J90A 1JI0A 4LYHA 1EP6A 3H7OA 4ABGA 5KYKA 3M36A 2WPDA 1FPHH 1Q44A 2IEYA 2ZITA 1PQAA 3QDZB 2IUTA 5CYOA 3I5XA 3SYNA 1U0JA 4OJKA 4N1AA 1R5OA 1TMBH 3DA9B 3ZV8A 5JBAS 2A5GA 2ODNA 4DLTA 4C0KA 4YMUA 2F91A 1Z7KA 3KFXA 3IO5A 1RD3B 2ZXUA 1JJVA 3RMMH 4YONB 1BRBE 3GCHC 3ZD6A 1C9PA 1PQ7A 3GOVB 2WWGA 4A15A 1DWCH 4DOQA 2Q6TA 3KTAB 1B23P 3UQOA 3LJJA 4JLPA 5CYPA 5IF9A 1DOJA 1JAHA 3X1WA 3ZVFA 2Y6TA 4X1SU 2HDNB 5AJXA 1DO0A 1VITF 1CGHA 4XBDA 4CREA 1II9A 4M9XA 5KSOA 1C2MA 4J1YA 4NIVA 5FL7D 4MH0R 2OLJA 1CHOF 4FIDA 1XCMA 2F9VA 1LHCH 4F7WA 4JJZA 2A3RA 5KDLA 5FTMA 5JB8S 1P09A 4DLRA 3K53A 1FDPA 5LGOA 3LOXA 5E7MA 2GEVA 1GMDG 1W4AA 4D76A 3TNTA 1N5JA 1YPJH 2YOFA 1BYUA 3A1VA 1YZNA 1DLKB 5DE3A 2Q9BA 4WF8A 5D3MA 3PTNA 3DZDA 1IHTH 3BE4A 1S9HA 3WBKA 4K60A 2Z9IA 1IXZA 4NCYA 3AVZA 2WPKS 4M7GA 1JB1A 4M1TA 2MMGA 2WV4A 3EW9A 2YHSA 1V2MT 1E9AA 3KL4A 3I72A 1HNEE 3PROA 3FHOA 4ZKEA 2C9OA 4WA7A 1DG1G 1SKYE 2QMHA 4DLYA 2FODA 3ATIA 4XWAA 1EZXC 2A30A 1VKJA 1Z29A 4P4TA 3B5JA 4AKGA 2NU2E 1YM0A 2FOHA 4M4SA 2VA8A 1UCYH 1RC8A 5EPNA 4MNVA 4JZ1A 4YC7A 4B6FA 3ZS8A 3GY7A 4JBYA 3B9PA 1NT1A 2ZQ2A 4G5SA 3KKPA 1C1QA 1KXEA 2WJYA 2GVDC 1GGDB 1XZQA 1IAQA 1GRQA 2WAYA 2ZQ1A 4MRVA 2PEYA 2JCSA 3D8BA 3EXAA 4K3JA 4TTRA 2WBLC 1ZD1A 4U00A 3NG1A 3DO6A 1C1YA 2OFXA 1ZHPA 5BPEA 4NCIA 5KNCA 4Q7JB 1YLDA 2O8TA 3RC8A 2ZF0H 3T2NA 2SNVA 5C18A 2YOHA 3RS4A 1MV5A 4WZ6A 1R6BX 2G5NA 3U3JA 4A8JB 1AUTC 2PMDA 2DWPA 4GPGA 1AQ7A 2XCFA 4LPSA 1G8HA 2AIQA 5B30A 3GCTG 2QGRA 3UY9A 5DP3A 5FPYA 1O3DA 3M37A 1HJ8A 1YR7A 3TJUA 3IIKA 1UBGA 3DOFA 1EQ9A 5IDVA 1FMLA 1C5ZB 5A0BA 5DO9A 3WNDA 5JCZA 3E0PB 1OKKD 2TGPZ 4DDUA 2OBLA 1AS3A 1C5PA 1YZLA 4W5WA 4KBFA 1WTHD 5KPDA 1OXTA 4BTIB 1FFHA 2H92A 1P9RA 1O2SA 4I81A 5C1UA 5CJPA 1HAPH 2ZSFA 4WMDA 1UPTA 1K8RA 2QUZA 4LC1A 2VP4A 3QTOH 4TLCA 2Z9LA 5FBRB 4EQ6B 5CITA 3ZZBA 4C2TA 4DBLC 3LD9A 3SJAA 4XOJA 1ELVA 3CS0A 4D0GA 4INLA 5B64A 1B0EA 1O38A 3C1KA 1XNJA 4CRBA 1IQIA 3A8CA 3K65B 4F4IA 1S4QA 5TCAA 2FO9A 2XYAA 3U1JB 2FMXA 5FUVA 1UTMA 4GNKA 1C4V2 1O2ZA 3NUMA 3RC4A 3MU8A 3BG8A 1AQYA 1S82A 3P20A 1KO8A 4TMXA 1YPLH 4WXVA 4OQNA 1KJWA 4D4JA 1Z07A 1XRJA 2V7QA 2FFHA 1ZM2A 2ZRKA 1JRTA 1FX0B 4Y8YA 2DE9A 1WDTA 3RM0H 4JLOA 1SXJA 2ONJA 4WMEA 1GHYH 4XJXA 1O3KA 1W12U 2ZJ8A 5H68A 1KSGA 4WAUA 4IOMA 3GD7A 1P8VC 1WOFA 4HAVA 4PZZA 4FU8A 4DT7B 4DT1A 4DXAA 4CYMA 3Q76A 2AD5A 3BF6H 1Z6GA 4MRSA 2Z4SA 2QSYA 5KDDA 3MRSA 2R2AA 1D6RA 1GJ6A 3ATMA 1QRWA 1A3BH 1VIAA 4DB2A 5EG4A 2DR3A 4ACBA 4JIMA 2C78A 3GJ4A 4PPGA 1XX9A 3GCHB 4D81A 3DZ8A 5DPAA 5HCNA 1N6HA 1P11E 4ZXXH 4L8GA 2GAOA 3RS5A 3DM9B 2KAIA 2PT5A 2BVRH 1VIYA 1E1QD 1OP2A 1D8TA 1O31A 4DY7B 1NVWQ 2XAUA 2ERXA 1F2UB 1XB2A 5GPIB 1C5UA 1NU7B 1GFIA 1D3PB 1WE2A 1E9SA 1QB1A 2WZQA 2OUKA 1GJ9B 4Q7XA 1PLJA 5J47A 2IHBA 1ABJH 3AASA 4JL8A 3QLPH 1CKEA 4AK9A 1S1MA 3UIRA 1ZLRA 2D2DA 2ZQ5A 2QSZA 1NY22 1GI6A 1UDXA 1Z2AA 3KEEA 1IQKA 2ZSEA 1HRTH 2NWNA 2QL6A 1UCYK 3BH7A 1PPBH 1HCGA 1SGEE 2JLRA 4OGYA 2A4RA 1OV4A 1S3GA 1SG8B 4P4UA 1XXFA 2CMYA 3RXKA 3HGNA 2C96A 3K70C 4INHA 4ZI3A 4NSVA 4ZKNU 3REGA 2Q3MA 3P95A 4OBEA 4ZIRA 5CMXH 5EP4A 4OHZA 1AS2A 2BHGA 3P6ZB 2F9MA 3P8OA 5AFYH 2ZROA 1HAHH 5AUNB 4Y7BA 1EZQA 3RC5A 1YZGA 1LNZA 1THSH 1F2TB 1SGFG 1LW7A 1LF5A 2ZIAA 3VAAA 3T5GA 4EIWA 3EZ7A 3MWJA 2TGDA 2SHKA 1TA2A 2C98A 4MYUA 3SUFA 1P62B 3L8ZA 3SGQE 1O39A 1TPOA 2C99A 3SUEA 1C9TA 3NBYC 1WF3A 1W1WA 6GCHF 1DLEA 1G8GA 3HWSA 2H9EH 4UFDH 6ESTA 1Q20A 2WPIS 1C5SA 5EE1A 2IJOB 3CLVA 3FKSD 2A2ZA 1TQ6A 3MNSA 1YPHC 3I61A 2EA3A 1E2FA 2ATVA 2Z5FA 2K5UA 3CF6R 1ZHRA 2FTLE 4JZKA 1TNLA 4DSUA 2XZOA 3TIFA 4L9SA 3EA0A 1XEWX 3PUWA 4W9MC 2BBWA 1EX7A 3BAFA 1BTUA 4RKJB 1ODFA 3IHWA 4KTUA 3C5CA 1K1IA 1XCPA 2OCVB 2W6JD 2QORA 1LHGH 2ZHDA 4XWOA 3W8NA 1T5LA 1E2GA 3GYMA 3UR9A 3QI2A 5T3HA 2A7HA 4Q9HA 4DUGD 2C4FH 2YYZA 1V2ST 2O8BA 3MMPA 2XBYA 2BBTA 4PAMA 1Z0IA 3AF1A 4IN1A 3SU6A 2JKHA 2IA5A 1G16A 1P06A 4O3MA 2XZPA 3QF4B 1AZTA 2MMCA 1W7AA 2B0FA 4D7FA 4OKSA 5FOWA 1XTRA 4EPTA 3LA6A 2VL7A 3U3KA 4B35A 2BD2A 1T3SA 2ZRHA 3HJNA 3AP1A 4Q7KA 2H9TH 4BFZA 2VIDA 4LJYA 4Q1EA 2FX4A 1D4PB 4IS5A 2XBXA 3RANA 4AG2A 4LJ9A 2QCYA 3IKJA 1LY1A 2VF8A 3ZZCA 4Z0KA 2G83A 4Q80A 4OHXA 3IIMA 1BITA 4URZR 2ZPSA 4Q5IA 2IS2A 4TMKA 2JLXA 1UBFA 2DFTA 3PLBA 1LS1A 2Q6DA 5EE5B 2ZE8A 2W6ID 4OL0A 4KGAA 3R9WA 1ESBA 1EPTC 2OBNA 1LPKB 4OS7A 5AHGH 2D2EA 3FFBA 3ICEA 2BD3A 1TQDA 3HPQA 4DG4A 1LVYA 5JS8A 1TX7A 4HZUA 3ITIA 4CRCA 3B1VA 1QGFA 5C5NA 3SV7A 1MR3F 1GKUB 3GJXC 1P72A 2XZLA 1IN8A 2C8XB 2GCPA 3WMGA 2RGEA 3RDPA 1MZDA 4QHYA 3LBIA 1G2LA 1WBGB 3BN9A 4FUBA 2QTHA 2G9NA 4URYR 2C90B 1LPGB 2WPJS 4NHOA 1TTTA 4LZ1H 5T6DA 4URXR 3PIRA 1N5KA 4WH8A 5SZKB 1X1SA 4WXPA 1S5SA 2RCEA 4OK6A 2ZZUH 5GJVC 4DURA 5DIFA 3ZZAA 3WYAA 3TSOA 3U3RA 1KI8A 4ERNA 2IS4A 5HZKA 5EXXA 1GWNA 1LTOA 1MO4A 3A81A 1TRNA 1DWDH 1GI9B 4AG6A 1UJ1A 2G55A 1II8A 1A5IA 4ZDKA 1MQ5A 1G9IE 1HY3A 1RIFA 4YMWA 1V2JT 1O5GH 5L3QA 1ZRKA 2PT7A 3V9PA 3VKGA 1C5YB 5GCHG 2BDIA 2F43A 1TA6A 3AF4A 3T35A 1ID5H 1TPAE 3MH5A 1P61B 3VR1A 4LV6A 5ELXA 5LPNA 2QRNA 1WCV1 5IK2A 1G64A 3OAAA 3T15A 2FH5B 4B3CA 2AXNA 5FOSA 3R8FA 3UG6A 1KSHA 1EUFA 4TZ6A 4MNXA 2ZAMA 3EIHA 2EWWA 4U02A 1FI8A 1UTKA 5JZVA 1EK0A 1QQUA 2OCBA 1UMAH 2P5TB 4MDSA 1KJYA 1VR1H 2ZDMA 3HKIB 1G6OA 2BY8X 4HAZA 1CT0E 1K9OE 1TALA 2YOGA 2QAJA 4ZDWA 5C20A 4PSAA 4BNRA 1GJ7B 3A80A 3TQFA 1DAHA 3AVTA 1R5BA 1E2HA 2WWYA 2OLGA 2CHQA 3MO6A 1XPRA 2WV9A 3K70B 3GJ6A 2HWLB 4MRNA 5DN6D 3F9EA 4K8BA 1L4DA 3PWBA 2QBYB 4C0QC 3QBTA 4LJAA 4X1RU 3VR4A 1BKDR 1FY1A 1JXPA 4TLDA 2G4UA 2OCAA 2OFOA 1PJRA 5LPFA 4LYFA 4EJSC 3TK5A 4B32A 3GLHB 1W10U 3UG7A 3P70B 4XIGS 2NQ2C 3GJ0A 3RXCA 1WSSH 1YQTA 2EYQA 4KCGA 4U5XA 2NO7A 4D82A 4D7GA 1W49A 2A5KA 2QEQA 2AERH 2F9LA 1HXFH 1W36C 1U6QA 2ODBA 1TONA 3P27A 4E03A 3GY3A 2OG2A 3VQTA 2C93B 4TY7A 2W7UA 5FTLA 1A4WH 4B44A 3GCGA 1TMTH 4D6PA 3ZS9A 3IEVA 2ZM5A 4MYTA 2P8OC 3ADCA 3A58B 3GCOA 3EA9A 2ASEA 4TSFD 1TGTA 2CHVA 3K9XB 1D3TB 3WHKA 1G9XA 2R6DA 5TJXA 4MG3A 4C0AC 2XJ9A 1Z63A 1ZMJA 1Z6TA 2ZS9A 4GOXA 2TMKA 2J41A 2Y82A 2Q6FA 2H17A 3RWOA 2SGAA 2ZI4A 1O5EH 5TY0A 4P33A 4R2IA 1S0RA 4DCTA 5JJKA 4LZ4B 2JLYA 1TX6A 2R2MB 4CT4B 3I77A 4BFTA 1O34A 2ALVA 2G6BA 2GETA 4V0MA 3W3ZB 1O3OA 1G36A 3GPLA 4AB8A 1N6OA 4Z8XA 3RXFA 3SORA 3LX5A 2IS1A 2VIWA 1GMDF 1RRKA 4O9VA 4EPVA 1TMKA 4IFBA 3GLGB 2VH6A 4ABYA 3B2EA 1CF4A 3IHLA 4OI0A 1ORFA 2GZDA 3ZVGA 4JT2A 2OEPA 1Z8RA 2OINA 1GBIA 3LFUA 1AFEH 3PV0A 2I6QA 5JWOA 2PCJA 2C95A 1P2KA 4JKIA 1HXEH 1KAGA 3TGJE 4U32A 1FP6A 1QHHA 4TYNA 2OAQ1 2CE7A 5E7IA 2VTKA 1HV7A 3KKQA 3SNHA 3ZVCA 4DCSA 3VFDA 3QO6A 4O3UA 1GL9B 4TT3A 2EFGA 3EC1A 2GGVB 4CEIA 3LGVA 4NYMQ 1TRYA 4AZ2B 3A1SA 2ZYWX 4TMVA 2G1JA 3TH2H 3QXXA 2BD7A 1S0QA 3HU1A 4NFEA 1GBJA 4LBYA 2LCFA 2QV1A 1EPTB 4AYWA 2CK3A 1L1NA 2SGFE 4B3XA 5CDFA 1OWKA 3S9AA 1CS4C 1VG8A 1AKEA 4AC9A 1NPMA 3NHAA 3FP6E 2STAE 1OS8A 3K0FB 1U8ZA 1QHRB 4JMPA 4LI0A 1C1SA 421PA 1P7CA 3ZQ6A 3Q85A 4MNYA 2F9NA 1F5LA 2ZR9A 1ZD8A 1DSTA 1E99A 1A0JA 4CIDA 2GV7A 4P31A 3AVVA 2ILNA 1GHAG 4UFGH 4WW0A 3I73A 3CONA 3EZ2A 3M0EA 2PX0A 4PHTA 4BOHA 2GF9A 3GCTF 1OFUX 2WPDD 4MITA 4UNNA 4I33A 3KQHA 1QHIA 1E1RA 1DARA 1L7VC 3HPRA 1C5XB 4HAWA 4RD1A 2GZ9A 1U8AA 1N0WA 1TX4B 1UVUH 2WKQA 3F5FA 1KDOA 3NVAA 4PC6A 2KBEA 1TBQH 1WCZA 2WPMS 2QP4A 1ZINA 3UMFA 1RPZA 4ZHMU 2ZANA 3MLEA 1YGCH 1P05A 4F4JA 3MTYA 3Q72A 5DJ7A 1BA8B 4OK3A 5A8ZA 2ZU3A 2KSQA 1EZUC 2GCOA 1EWQA 4RI0A 4EFNA 1HH4A 3S1AA 2ODEA 1P4SA 1W0JA 1YZUA 5JEDA 2Z0MA 4B48A 5HGGA 1FY5A 1E79D 5KDOA 2V1XA 5K8TA 2FPMA 2J2UA 3F9GA 3CIOA 4D4MA 5FL3A 2GTPA 4PAQA 4MA4A 5FUXA 3OIWA 1A0HB 4D4KA 3ZVNA 2W0SA 1O2NA 2O8DB 2Y5HA 2G51A 4Q4LA 2A5YB 2B7BA 3U98H 4WXRA 2RGAA 1QURH 4I1OA 4OI1A 1EFHA 5C3NA 4FMDB 3SE0A 3L0OA 3MCAA 1TWXB 4WZBE 4NMMA 4HLQB 2VP6A 4EJSB 3FGNA 1ZMXA 2P59A 3IUYA 1BTHH 3M7TA 1VHLA 1OLOA 5G41A 2PGBB 3KZ1E 2H1LA 3QE0A 1ZCBA 1B0FA 4OS1A 5JPMH 4JLMA 4HDCA 3TGKE 3RXTA 3AF2A 3K6ZA 1W36B 1R0WA 1GG6C 1E2JA 2H9HA 1T8TA 2ZETA 4LV5B 1YU9A 3A1TA 4EAQA 1M2OB 1R8SA 2H16A 1M1YE 3TU7H 1W5SA 3Q8XB 4KHZA 4DGJA 2P8OB 2G3YA 3GLIB 1HAVB 3ENSB 3SU4A 2H7VA 4IVRA 1W8BH 1ZTJA 3R3GB 1HURA 1XBTA 3CP7A 1T31A 3QKSB 3FFGA 2JATA 2C03A 2Y5GA 5F8TA 2BDTA 3CH4B 1ZNZA 3JZMA 4NE2A 4JLKA 2GK7A 3UNSA 2IHYA 1BBRE 3EGKH 1KI9A 3VEQB 3TLXA 1QR3E 1NVUQ 2O8CA 2PMKA 1OHHD 2WYGA 1LS6A 2ANBA 3OX7U 4YDSA 1RJXB 4FXGH 1NL3A 1P12E 3RXGA 1M6NA 2BM0A 1KJZA 1JOUB 2B7CA 2V35A 3ZIAA 2PJRA 1G3DA 1WV7H 3TAUA 2IXEA 4PAOA 2QY0B 2D3WA 4A8JA 2PX3A 1ZPBA 5ETXA 3BH0A 2IXFA 4ZAEA 2O8WA 5DO4H 4M9ZA 1E9EA 4UNQA 2FFBA 2AMPA 4BAOB 2WJGA 4HDQB 1SFIA 5GJCA 3A6PC 3MAAC 3BSQA 3KCGH 5AUQA 4BASA 5J4LA 1O3AA 1GL6A 3THXB 4BWYA 1AD8H 1TNHA 1Q31A 4CH8B 5C2JB 5E4FA 1UEJA 2PGQB 4GHTA 3VB6A 1EAWA 1WMSA 1ZPZA 1D2EA 2ZDVH 1IXRC 1TPSA 4DIEA 1K1LA 4JL5A 3OEEA 4CH2B 1VCNA 2PV9B 4NWLA 1KLTA 2BDYA 2GJ8A 4P4SA 3GFTA 4B34A 5JI3E 3K9NA 1CULC 1O87A 4JVLA 1JQLB 5UKDA 3MNXA 2WINI 3PXGA 1P57B 2G88A 4DLXA 1LVBA 4JYVH 3L33A 1P2JA 4Q9IA 2HCBA 1O2GH 1PPHE 1O5CB 3W3AA 2OSBA 3FWYA 1GIAA 1ZIPA 1YPMH 1SVSA 1XUGA 3KQEA 1KDPA 1YR8A 5A0CA 8GCHG 2J7PD 1I2DA 2EWVA 2V6NA 1O2RA 3NH9A 3Q5DA 1BTPA 3SOPA 4DJTA 3PEYA 2ZGHA 3BFXA 4NGAH 3A8TA 2VP2A 4QM7A 2YZ2A 4Q1BA 1MABA 3GLFE 4TZ0A 3IEUA 1IQLA 2P6UA 3BOSA 2EVWX 2V7QD 2HRVA 3VU9A 1HGTH 5L3RA 5TMPA 4Q4JB 1O2HA 2QA9E 1ZC4A 4ZHLU 1SXJD 2VIQA 3KFVA 2FLRH 1SLUB 4FWIB 4JLAA 3OSYA 3FP7E 1GP2A 4ZKRU 4FUGA 5H8WA 2FSGA 2ZE7A 3LLUA 1QA7A 1VMAA 1T4VH 1LHDH 4CVNA 1DAEA 2VVCA 3MD0A 1KSJA 5L2YH 1MKYA 3T1QA 4O3TA 3WRXC 1IY1A 2PKAA 1O2PA 2AH4X 1QBKC 2WIAA 5FFMA 3SNDA 3GEIA 4RKOB 5C1YA 2R62A 4D80A 5JI2E 2QN6A 1QJ1B 1UTPA 1OH6A 1I4LD 3ATKA 1ZYUA 4NDZA 4TYWA 1BRCE 3UFAA 1SHZA 3CUEF 3SW2B 1AM4D 2BLWA 3L8YA 3BRWD 4LHYA 2NO1A 4NWKA 3NEJA 2NMVA 3THYA 2IJD1 1XXHB 5FOTA 5HM9A 3OEHD 2G1KA 3TKLA 5E0GA 1OXVA 2REXB 4KVAA 4ISNA 1NN0A 2NU3E 3B60A 5KU1A 6LPRA 4DC9A 4ZROA 3AP2A 1TUIA 1ETTH 1JEEA 4Y79A 4LBVA 1Z8IB 4CF7A 4MKIA 4JJKA 5K8UA 1NBMA 3SJ8A 1AGJA 4A0GA 2HF9A 1AS0A 2G0NA 2FSHA 4X2WA 2GKSA 3E3TA 1IONA 3SQXA 1ACBE 3CB4A 2ULLA 2NPIA 1VDZA 1HYQA 1GDNA 4TL6A 4BLQA 3FTQA 1QHYA 3AKDA 3FE2A 2Z3EA 2ANCA 3LW8A 1SPJA 2BXTH 2ZU0C 2WUCA 1GG6B 1NKSA 3SQWA 3MWYW 3BTDE 1BIFA 3HU2A 2P3SA 4Y0AA 1NF3A 3I3SR 2X1VA 1SQ5A 4WWYA 2ZU2A 4GP7A 3MSXA 1A5TA 2PKSC 3DFJA 3KIDU 2FSFA 3D7MA 3A82A 1V2VT 1ARCA 2Z4RA 1GDDA 4DWJA 4BRWA 1HAOH 1ZD9A 4LX0A 4Y11E 1S6HA 2ZFTA 5D3MB 5EXPA 4OHVA 1KDQA 1Z0JA 4PSVA 2W3KA 4EPWA 2IW3A 4Q9KA 1GITA 2WSSA 5T6GA 4PC7A 1OB2A 4DIHH 3SV9A 2BDCA 4FN5A 2A78A 2V3OH 5F98A 2JJ1A 3QWCH 2O8FB 3PTBA 4ASUA 1DXWA 4HI3A 2XC4A 3K9LA 3IDQA 2SGDE 3T27A 4Q02A 4AKEA 1MBMA 1S84A 3BTWE 4A9AA 2GP9B 1K28D 4YOIA 4DVAU 1O5FH 3RU4E 2BX4A 3VR6A 4Q4HA 4ISIH 4C7OA 3O8CA 1SOZA 3H86A 2VU8E 1SC8U 4KXFB 2JH6D 3L0SA 2AN9A 5DP8A 1IQEA 1GMCG 2OHFA 4U7DA 2ZREA 7GCHG 1KDTA 2QZ4A 3P1JA 4Q1CA 1OB5A 3W6PA 2IEZA 3BB4A 1X3SA 1FZQA 5GVRA 4IRUB 4A36A 1EG7A 4QNMA 1E69A 1GI4A 3SV6A 1C5OH 1O3MA 3UR6A 1T6NA 4CHAC 2CLDX 4JZDH 4KFSA 3QXHA 3U69H 3SI7A 1FQ3A 4AB9A 2HNTC 1ZM9A 2FV8A 2CNWA 1G4AE 3P92A 1BHXF 2JJ8A 4I32A 1N6YA 4DEXA 5HR5A 2R2WU 3BEIB 1F5KU 1O2LA 2RG3A 721PA 1XMJA 1ZPCA 4CW7A 1X7AC 2V4ZA 2HPPH 2FOEA 3UNQA 4X1PU 3MMGA 4AYXA 1E2NA 2YC4C 3ZZ4A 4X8VH 4Q7ZA 2EFEB 1GBHA 5JWRA 1Z0AA 2GWHA 2ZCKP 1UHBB 1KKLA 5FOXA 3T5FH 3CWQA 1E36B 1RRPA 4RD0A 5DI3B 3B6EA 4C30A 2ZG0H 4CT5A 2A2XH 2IPHA 3RXRA 4LC0A 3SS8A 1Z3IX 2QT1A 1IHUA 2D74A 4YQFA 1GCTC 4RVCA 2OT3B 4QKQA 2O52A 1C2LA 2RKOA 1U81A 3R8CA 2H18A 4R0IA 5AK0A 2VB0A 3NH6A 2AGGX 4GMDA 2BJVA 1Z22A 1VJAU 2EU8A 4GPTA 4H42U 1XD9A 3S9CA 4BQSA 3FVFB 1K2I1 4BUJA 2X2EA 1OSSA 4UXHA 1NFWA 2LPRA 2ZU1A 1DICA 4A7IB 1QBNA 3HKJB 2GCNA 5FUYA 3IGFA 2R6FA 1W48A 2OESA 1E34B 2R8RA 2QAGA 5TB5A 1VCQA 2JGNA 4HATA 1CRPA 1C5TA 2BHRA 1GI8B 3URDA 2VWMA 3LAWA 2HPQH 4X6PA 1P2UA 2ZECA 1U2RA 1DBSA 2QXJA 3EA5A 3HU3A 1HIAA 5IK2D 3LRPA 1KDRA 2BDAA 4YM9A 1J15A 3PMBB 3N2IA 2Z3CA 3I92A 4R71A 2DE8A 1Q2WA 2I1VB 2IWHA 5GWZA 4YLUA 3SDZA 2JAQA 3H84A 1S6FA 4NG9H 4RZ3A 1ZUHA 4B2AA 5K0HA 2P5SA 2G8TA 2ZDLA 2ZO3H 3BEFB 3LGWA 2B5TB 1OYYA 3PQCA 1GPZA 1BHXB 4KSCA 4NIXA 3PM3A 1A2BA 1FQJA 2OC8A 1XKAC 5DYIA 3LJOA 3P4XA 3W9YA 1R8QA 2FOLA 2KAIB 3B82A 4ITRC 3JVUA 1QL8A 1CRQA 1AE8H 3RS0A 1NO9H 3D62A 1NFXA 1PZNA 4XD7A 4NCKA 1QVAA 4BECA 5A8XA 3AP3A 1JR6A 2BV3A 2XNDA 1ZTKA 1E2KA 2H5EA 4HAYA 3IWMA 1IQMA 2AR7A 2NTYC 1G5RA 1NVVQ 2PKSB 1XXDA 1GHAF 5LPEA 1Y5BT 3GLHA 1F0TA 3MWKA 2ZU4A 1G3CA 2AL7A 4CGZA 1XUFA 2J95A 4IBLH 1C4U2 2ZGJA 2ZRJA 3SC3A 1XUKA 4IW4E 2NO0A 1Q1EA 4JYBA 4ZIRB 2VHTA 4J0QA 2OXCA 4KLNA 2J9NA 2BEJA 4KLZA 1RYHA 3K0AA 1AQUA 5B57C 1JBKA 1TAWA 5LB4A 2FOBA 1GKIA 3I32A 2ZNKH 5E0JA 1N6RA 1FV9A 3VPKA 1SLXB 4IFEA 1P2MA 1P9UA 1C2EA 1QZXA 3GP8A 4GSOA 2WYJA 1N6IA 1PPGE 1DITH 2J7KA 3UWOA 1C4Y2 5J4HA 1TFXA 4YMVA 2ZI2H 1XP8A 1RS0A 3KXLA 4DSTA 3E2IA 5A2MH 3QKUA 3SJBA 2VWNA 1S1CA 1RFNA 5JS7A 5JHHB 1XTQA 1FIWA 5FOVA 4PTLA 2ZU5A 1OE0A 2LKDA 1QL9A 1EJAA 4M22A 4NZQA 3OY6U 3GDSA 1DUEA 3LU9B 4IEIA 2XJ4A 1ZMNA 5HXFA 4ABBA 2QG6A 2D06A 3O8BA 4TLBA 4CHAB 1E9FA 3IILA 1L2EA 1JR3E 3MU0A 1FZZA 3U3MA 3NXPA 3AVWA 3EARA 3AVUA 1QTFA 2OAP1 5KPJA 1C5MD 3B9FH 4I8JA 1XEFA 1V6DA 1PFXC 2J94A 3W8RA 1EJMA 2F1JA 2GMTC 2CV3A 2BOKA 4Q18A 4W5HA 2ZE5A 3BIVH 3EZ9A 3SYLA 4TT3D 5JECA 5I25A 1LHFH 2UUJB 1VTKA 3LLMA 1O0DH 1G8PA 2BX3A 2VHQA 1YC0A 1XPUA 1ANEA 4B2LA 2CJWB 5IYTA 2AS9A 1NN1A 4XVUA 4QJ4A 3A4MA 4KFUA 4OS5A 2YV5A 1VG0B 4ABAA 1GBEA 3KUCA 1AIPA 1GCTB 1EPTA 2FYRA 4KO8A 1SSXA 5G4BA 3R9XA 3N70A 3LONA 2FOGA 3SU3A 1MTNC 1FPCH 4PPQA 1S96A 1UVTH 3GFPA 2C8VA 1GNPA 1O2KA 1TNIA 1ESNA 2FOMB 4MKGA 2PUQH 3F0TA 4GMXA 3SJ9A 2RH5A 3PR1A 4MYCA 4PFSA 2O8EA 1XJQA 3RXHA 3KQDA 2XNIA 4HDOB 1XD2B 3RRZA 4V0KA 1LKAA 5AFZH 4IGDA 3OFND 1DO2A 1EAXA 1CGJE 4OJQA 2OD3B 4ZUHA 2F4LA 3LC5A 2YOLA 1YVDA 1E1RD 2RA3A 1O2YA 1DVRA 4DCUA 2TGTA 4ESHA 3AVOA 4FMCF 4FXPA 3FYHA 3B1WA 3CR7A 5KSYA 1GNRA 1KOFA 4ARZB 4DEYA 1K1JA 3F1SB 4PQFA 1G3BA 4M53A 3RS2A 1ELTA 1CR2A 2OTVA 2ZHEH 3VB4A 4INKA 1MTWA 1WBDA 1IM2A 2F55A 1VZQH 5JB9S 4B75A 3CZQA 5BQ5A 2REOA 1GMHG 1OIVA 1W0JD 5K8IA 4RFVA 3V3MA 2VVUA 4WMFA 3EASA 1BBRH 2NPFA 3SJCA 1DE0A 1II8B 2G81E 1Z0DA 3NC1C 3BWDD 2NOAA 5C2ZA 2F83A 3PV2A 3B8JA 1F0SA 1C2HA 2F43B 1R5NA 3SZNA 3P26A 5JSZA 3HK3B 2V3HH 5GADl 3TJVA 1OPXA 8GCHF 1P9NA 2Y8EA 1HQYE 3D31A 5FBWB 4DCVA 4KFRA 1DSUA 4OM9A 3PEWA 3LC3A 4ZKSU 1BS1A 3SYJA 1UK2A 1QA0A 1LHEH 4K8OA 2WMOB 1NY5A 1AKSA 3PYHA 5B6OA 4Z6AH 3RXBA 1U8YA 4A1VA 3BTFE 4F93B 5HPYB 1SGCA 4QNRA 4ZDIA 1IQFA 1OIWA 4PO8A 4KTSA 3SEAA 3SBKA 2R0LA 2O0JA 5EXTA 4I99A 4YLQH 2QU8A 4QFMA 1GUAA 3PUVA 4CEJA 4IMZA 1C2GA 1IN4A 2MSEB 2P3TB 5HE9A 5J4YA 2TPIZ 4QGGA 1V3XA 3KGPA 1AGPA 2ANWA 2ZE6A 2WWIA 3SV2H 1N5IA 1CJTC 2QTVB 1EFRA 4LJ7A 4A1XA 1T8NA 1QJ7B 4R9UC 3L6PA 4LCBA 3NKVA 1PPZA 1ZJ6A 4BZQA 1XMSA 1H8HA 1ELBA 3ESTA 1O3IA 3SU5A 2IC5A 1XCGB 4P32A 4DKXA 1M7GA 3A87A 2GILA 1G20E 3GEEA 3U9AH 3EYDA 4AX9H 2ZU6A 2ZRMA 3ICQB 1NSTA 3ZIAD 3FANA 3E1XB 4X8MA 1NTPA 5AJYA 2NZJA 2AMDA 2WAXA 5FBIA 4Q4AA 2N1BA 1FP7A 1P0SH 1XMIA 3QTVH 4Q7MB 2E9SA 1O3JA 1T8OA 4B1TA 1Y63A 2FI5E 3A7TA 1ZU4A 3QEOA 3PEUA 3LBNA 1PQ5A 3TW4A 4ZKDA 2D7DA 3VHXA 4UEHH 4A82A 3OESA 2GXAA 3GJ8A 3V12A 1D9XA 1JALA 4LY6A 5F8ZA 2GMTB 1MAXA 4WOPA 4E06H 5I46H 4BXSA 4NA9H 3NEYA 2BLOA 4UDWH 3BGWA 2JLVA 2ZHWH 4X8OA 3W5JA 3TR0A 2QM8A 1NESE 3P4YA 3QUSA 5FTJA 1N25A 2WJIA 2EI6A 1RZ3A 3OEED 1DXPA 3U61B 4PO1A 3WRYC 1ARBA 4AOQA 3UXMA 1W13U 5EGMA 4KYIB 4YESB 4E22A 4QT8C 3B23B 2JEOA 4UKDA 4A2WA 3VR2A 4NCNA 1QRZA 4DLUA 4AYVB 3BG4C 3A8BA 1GJDB 4NYIQ 3D65E 3M6AA 1FN6A 3LGUA 2XCNA 4M21A 1MTNB 4U01A 2P6RA 3L0PA 1SVWA 2F9PA 3AF0A 1ETSH 2BDHA 1GHBG 2RHMA 3R9IA 1UADA 2ZRDA 1XEXB 3SYKA 2QROA 1T5IA 4LPKA 4PQRA 2STBE 1ZM7A 3FMFA 4CEIB 3DHWC 3A7ZA 3AW1A 4WZAE 4RSPA 4YXWA 4AORA 5AUPB 3FZZA 2F1RA 1ZHMA 1SMFE 2KWIA 1H8EA 2P16A 2CVFA 3SNAA 4Q4JA 1VCPA 2ZGXH 1W5TA 3SHWA 4FUJA 4KITB 1OYTH 1G30B 3KQKA 3ASYA 2AGIX 1J70A 1Z83A 1N6PA 2WKPA 1GMCF 5CHAC 1YKSA 1CBWC 2BKEA 7GCHF 3D49H 4ABJA 1ZTLA 1ZJKA 3PLPA 3VGCC 1X8KA 3B8HA 3QXCA 2ZJOA 2QF3A 3RAPR 3SJIA 2V6IA 1WB9A 1W0KA 3CPHA 4X8UH 4QBIA 1UK3A 3CPJB 1MUEB 1HA3A 4A4DA 1DM4B 2OBQA 1DAFA 1T3HA 2TBSA 2QE7A 4FUDA 4LJ4A 3GJ3A 1G3UA 5EXSA 1EOLA 1KLJH 1XXHA 3GJ7A 3SQHE 4UFFH 1BRUP 3X1ZA 4MVNA 2RB4A 4JSYA 1X8JA 3TW8B 5TV2A 1TQ4A 4IOLA 3IITA 2RMKA 3P32A 5FL7A 3PEVA 1UTJA 1OH8A 3URCA 1DS6A 1GDQA 1YPHE 4IMQA 1SGFA 3ZVLA 3NDBB 1M74A 4TPIZ 1D3DB 1NBMD 1XJCA 4X6NA 1MCVA 2C5LA 1F0UA 5JBBS 7ESTE 4Q1FA 2R44A 1G2MA 3BFVA 4C4PA 1IQHA 2GCOB 1NIPA 5CM8B 3S1AB 1PVOA 3I62A 4MRRA 1WRBA 2A5FA 3TVJB 4CR9A 3A85A 4BAHB 1Z6XA 1NRPH 2IL1A 3QKTA 3E0NB 3O8RA 5CIQA 2GCHG 1O2XA 4KAXA 4FU9A 4TMWA 1GI1A 3A86A 1VYTA 5HMAA 1ZNXA 5G3ZA 1KTSB 2QC2A 5P21A 3CM0A 3SJKA 1UDWA 2ZC9H 2Y7ZA 5JHGB 2DUCA 2FWWA 1CTQA 1Z0KA 3UUZA 2Z6BD 4LRWA 1I4TD 3AK5A 1OFIA 4H9GA 2F1IA 3GLGE 1N5LA 2WSSD 4GUXA 4BANB 3EDXB 3EPJA 5LH8A 2F9BH 3SR0A 3UWKA 3C15C 1N8OC 1ZM4A 3ZYCA 2WMNB 4Q66C 4Z51A 1B0UA 2BYAX 1DOAA 4EKDA 4A2QA 2XC0A 1ELEE 1J14A 4F4OC 3NDPA 2P94A 2O8FA 2RA0A 1U94A 1ZGIA 2Z3DA 2ZYUX 1QY6A 2A45B 5C67A 1J8YF 1LPZB 1GI7B 4AFQA 2AFIE 2BMJA 2WWXA 2D1JA 3TVTA 3WNBA 1IOEA 4AGKA 3AKEA 1L1JA 4WBSA 2VSOA 1WXRA 2VYFA 4EUNA 4XTRA 5E0HA 2ZYVX 4BLPA 4O03A 3IO3A 2O8CB 2Z43A 1LV7A 2ZI3A 2PZEA 2BY5X 3E5HA 2X2FA 1UTOA 2ONKA 1UTNA 4MGKR 4J2YB 1VYUA 2H5CA 1UTLM 4LWZA 5SGAE 1XVMA 1Y3VA 1B7XB 3Q3KA 1GL7A 6Q21A 3AGQA 2CNWD 1YKTA 4JZIA 3Q00A 3FFAA 4RJLA 2PR3A 3H0KA 2QIQA 3STIA 1QHXA 3FB4A 4AFSA 1BQYA 3BTGE 3DUXH 1BCUH 1KY9A 1SFQB 3BG4B 5CK4A 2BVXH 4MPXA 2DB3A 1CE5A 3U7GA 1UM8A 4KI0A 1BO6A 2IX3A 2RCNA 1DX5M 1YRAA 1VCIA 4QBGB 3MO3A 1CVWH 5JBQA 3QOFA 2A0QB 2VNTA 4NZYA 1QBVH 2CLCX 4NFFA 3IQWA 4OS6A 1K22H 1UHBA 4R8TB 3CRW1 2ZUBA 3RRYA 1NVVR 1H9IE 3FMOB 2QN5T 5DI3A 1A2KC 1FUKA 1YLCA 1ABIH 1ZP6A 3RP2A 1HUQA 2BTCE 2IYLD 3LXRA 3I5YA 4OS4A 3GCNA 4IEEA 4P4SB 4PZLA 1FY8E 4CBOA 2ZDKA 4Q1DA 4I8KA 1KKMA 3W94A 2JA1A 4TMZA 2C8ZB 1KI6A 2CE2X 2R65A 1P75A 1K1PA 1O2IA 4OS2A 2VP9A 4M8NE 1VYVA 1FAXA 1YBWA 3SFZA 2XRCA 1E32A 5E2PA 4PSKA 1XFAA 3I29A 5CHAB 4PPFA 1K6MA 2B8TA 1CBWB 2AMQA 1SGIB 3QENA 1G7RA 2DFNA 2ZUDA 3PMAB 3VGCB 3RXUA 4BLTA 2EYUA 3VNVA 1GI0A 2W2XA 2IT1A 4AFUA 1N6NA 2PWXA 2C3SA 3ZZ5A 3GQBA 3RYTC 4M9FA 2GZAA 1MABB 3EPKA 3ZZ9A 1O36A 3VR3A 1DANH 2HLDD 2ZJ5A 3VU9B 2VPPA 3X2SA 3E6PH 2AHOA 4M1SA 1GBFA 2JLUA 1GJCB 1CO7E 4X2YA 1SBWA 2HF8A 1QNJA 3HATH 1YE8A 1K1NA 5KNDA 2PZGA 4A0FA 1E1QA 4MGIR 2A4QA 3QPVA 3TK1A 2QP9X 4RD6A 4MPVA 1GRRA 5C4GB 4Y10E 3CX8A 1C1VH 3DKPA 3BTHE 1CJUC 5J4SA 1GI5A 2PKAB 1YJ5A 3GY4A 3QXSA 3MNBA 1UFQA 2HV8A 5EZ6B 3EPLA 3UOPA 4PO9A 3RMOH 1AVGH 3GLIE 2GT7A 1XUIA 3BV9B 2ZHQH 5DK1A 3TUJC 2QAGC 1T9HA 4HB4A 2ZI7A 3MNCA 4LUCA 5FAHA 4N0EA 2BZ6H 4GZLA 2KE5A 1W0YH 1NN5A 3ZYDA 5JYIA 5DP5A 3K9GA 3UWIA 2JLSA 4PHHA 5L30H 1TQ0B 3K70D 3THYB 4XD7D 2ANKH 2GRJA 1SGWA 3E1SA 2XNDD 4BEBA 4PHFA 2WV5A 1LB1B 3LQRA 4Q47A 3ZJYA 4IJMA 1IN7A
chains in the Genus database with same CATH superfamily
3F3KA 2QXIA 4GBMA 1L5GB 1HYLA 4R16A 4MHSA 1O9GA 4TXLA 5GJ4B 4BKOA 2YMSD 4YXFA 3N2ZB 4K81B 3IH5A 1VBFA 4FKMA 4F9EA 3U7HB 3DV9A 3D7RA 3OPMA 3SMVA 3OFSA 3HCNA 2O7VA 1O2TA 3TW6A 1SG0A 3S8EA 1H1BA 1JSXA 1YCHA 3HKCB 4GI2A 3RB8A 4H59A 4P98A 1N8OB 5L95A 1P17A 5JXJA 1GGFA 4KN5A 3MOSA 4I8XA 1E4VA 4RZXA 4WHMA 4XTCS 4WZBB 3SNKA 1KI2A 1J9EA 5JNUA 1K88A 2C57A 3VV3A 1OYQA 3OPYB 4IIDA 3D1LA 3Q2KA 2WILA 3AILA 4RTMA 4W8GA 2O3UA 1GMHF 1HYEA 1QRXA 1JFFA 1Y1PA 5DHRA 4JB8A 4FHDA 5TCCA 1KH3A 2FF5A 1U9ZA 1D1QA 5C1XA 5C7LO 4IIVA 2P95A 3ASVA 3Q4GA 4WY3A 4XVHA 3ZY5A 2OE2A 2Z3ZA 3IX7A 1O32A 2ALPA 5EQQA 1LKBA 1TB6H 1RPJA 1UIRA 4FFWA 3ONVA 3QUTA 3E4DA 2J4FA 1I36A 3O94A 1NW9B 2EW1A 1SGQE 3BCRA 2VN8A 2GZ7A 1EHYA 3UAOA 2VBIA 4GOMD 3RWBA 4HUJA 1K8ZB 4NPAA 2GPWA 3AETA 1EB2A 4COKA 1B6RA 4BO6A 1Z0ZA 2F7SA 4LCJA 1AU8A 3X1XA 3K8ZA 1ATIA 2ZJ3A 1J33A 4OREX 3MTBA 2HQRA 4GT1A 4V0LA 4URVR 3GZJA 4M9CA 1E8NA 4GYKA 4OK5A 2ZEBA 3ONWA 1GUFA 4PINA 2BF4A 1GRCA 1LBIA 3QLVA 2WOJA 1MX3A 3UREA 4ZCIA 1R6AA 4I5DA 1GA6A 2QGFA 5EPUA 2C2KA 3H5TA 1AV7A 2CDCA 4BO4A 5IXJA 1GQOA 1PR4A 2I2XB 1LBSA 3U9SA 4M7OA 2ZIWB 2JAXA 3LDAA 4G0YA 2W6IA 1F5NA 3AZPA 4NPHA 3MMZA 2WMYA 1JB9A 1T10A 1MZVA 4KAFA 2LUOA 4E30A 5TPZA 5BYBA 3ECCA 3LBAA 1PQ8A 3WHLA 4JK3A 5A0FA 3N8KA 4Y9DA 1NJ6A 2NNLD 4ENRA 1RKVA 1AXGA 4TQUS 4RN6A 2Y99A 4MROA 2J9RA 1C9MA 2O0HA 3ABZA 5HTOA 3CGWA 1BCRA 2HT1A 1DC6A 1ZUD1 5HVNA 3EGWA 3GWZA 1L5NA 4ER0A 2DLDA 1CQWA 5K2OA 1FYXA 4IDCA 1Y1LA 1TLTA 8LDHA 3F0PA 2AHRA 1PQUA 3EQ0H 3HDHA 4ENTA 1DWUA 4GLLA 3RDZA 3L1UA 1C1MA 4N0DA 2QW0X 1Y3XA 1FVFA 3TL6A 2VZ8A 1QQTA 2Y05A 4HQOA 1C8KA 8ADHA 4EG1A 3ND9A 4KQMA 2GNAA 3CNLA 4EX6A 4X8TH 5K3SA 3GG9A 3VB7A 1JHRA 3FTPA 3Q9SA 2XOEA 1Y59T 1YHNA 1QIJA 3VZPA 3V1NA 1OR8A 4A0SA 5E7JA 3MT7A 5BMVB 2WYHA 3CNEA 1LC0A 1ZGVA 4GRDA 1SO8A 4D2IA 2QTAA 2R96A 3SEZA 3U8TH 3HVJA 1NHGA 3DVAB 1M34E 1H9LB 1YRYE 2IYQA 4OQFA 3OI7A 1UOPA 1QR6A 2EQBA 4YV7A 4HXGA 3R41A 2Q3FA 3E9RA 3PX7A 4X6MA 3AVQA 1CB7A 2H4ZA 2O2EA 3SR4A 2GZ2A 3IQHX 1HIAB 4NE7A 3NIDB 1AMHA 3EC7A 3JXEA 1GHBF 1G7CA 1VE3A 2V3WA 5HEKA 2R7NA 3AY6A 3QGJA 4QHTA 3R6LA 1Y3UA 3TJOA 3T1YB 3FWKA 3D8HA 4DCDA 1E9BA 2PKWA 3IQDB 4N6OA 2GPJA 1EFDN 5BV8A 1CUBA 4HYTA 4RDCA 4F38A 1B0AA 1E9CA 3AF3A