4B75A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
645
structure length
645
Chain Sequence
b'GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
molecule tags Hydrolase
source organism Hepatitis c virus (isolate bk)
publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
total genus 208
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b75A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b75A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b75A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b75A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b75A03
4PHTA 1JBKA 2FEQH 5FBLB 3T5GA 3FVFB 4IGDA 3ZZ3A 4I1OA 3RS0A 1O3CA 2YZ2A 1NVUQ 2CCKA 5E2PA 1E6CA 3MU4A 3V9PA 3BG8A 1AD8H 2BM1A 1XBTA 4NYMQ 3UG6A 2GJKA 2BKEA 5EE0A 4DT7B 1C1UH 2R44A 2W00A 3EA0A 4CT5A 2NTYC 4LGMA 3QXXA 4G5OA 2VU8E 3C1KA 4M4SA 1IHTH 4D4LA 1ABIH 3SDZA 2OZEA 4GCHG 3BEIB 5FPTA 3BE4A 4YC7A 1YR6A 4LBZA 3UREA 3SHWA 4B2IA 2STBE 1E32A 1N6RA 2PEYA 2FFBA 4ZKNU 4URVR 1TTTA 2ZI5A 4Q9IA 1GI5A 4E07A 4G5QA 3NDBB 2QNRA 2UUJB 4H9GA 4CW7A 2FE4A 3MWKA 4KFSA 2NIPA 3LU9B 7KMEH 3UNSA 2WYJA 3QEOA 2VHQA 1PLLA 4AYXA 2ZRCA 2ZHEH 1A0LA 1SSXA 5IK2A 2AX4A 1EK0A 1SXJB 5EXMA 3C5CA 1OHHA 1GBLA 2WV5A 1YRBA 2QXIA 4F93B 5FL3A 1Z0DA 5EQTA 2BTCE 1QY6A 3PMBB 4QKQA 3FP6E 3WY9A 2YVUA 2JLQA 4KBGA 1KO4A 3AH8A 4CEJA 3BH6A 1VIYA 1W7AA 1F5KU 5JI3E 5FL7D 1ELFA 4MKFA 2IS1A 2CLSA 1D9ZA 3QG5A 4NBSA 1JRSA 4NL4H 1EXMA 3LVRE 2WICA 3ODDA 2AWOA 4TSFD 3CLVA 3BJIC 3VR1A 1P9RA 2RB4A 4Q7ZA 1TMUH 1H9LB 1DFPA 3RXFA 1YQTA 3R9XA 1RTFB 2RGEA 5B6OA 1W2HA 2CMKA 3U8RH 5GIBA 2A7HA 5BPEA 5FTJA 4AYVB 4LY6A 3A84A 2J2UA 3MI4A 4WMDA 3SGAE 6GCHF 2BLQA 4IVPA 3U3RA 4CDGA 2ZU3A 2ZRDA 1P06A 4R0IA 3EW9A 5IDVA 2OILA 3LOXA 4CRDA 2Q6GA 4LHXA 4I1UA 1KNXA 4CRCA 3GLGA 2A9KA 4A36A 4Z0KA 1NBMA 3W5JA 1G2MA 3TGIE 2Z3DA 1R2QA 1ZD8A 5AJYA 4G1UC 1O0DH 3LDXH 2R2WU 2V1XA 5BN3A 1IY0A 3STIA 1J70A 3WRYC 4RD3A 3RRZA 3EPHA 2QUZA 2W3KA 3KJEA 1XX9A 4YTAA 2RGGA 4A8JA 5GJWC 1RRPA 2ZHWH 5GWZA 3PV0A 2OBQA 1Q3XA 2FX6A 3K9GA 2F43B 4Q7JB 4X1PU 2OXRA 2PW8H 3RVBA 1A4WH 5J4LA 7GCHF 1NNEA 1SZPA 3OIVA 4ESHA 1G3EA 1O3HA 3WBKA 1RJ9B 1GHBG 2ZS7A 4TL9A 1JR6A 1S9DA 4LYJA 1C5UA 1AWHB 2F55A 4QHYA 4WW0A 4C2UA 4X8MA 3TQCA 1DOAA 1EB1H 4UJ5A 3DUXH 1D9XA 3SZNA 2XRCA 2ZGHA 3W3ZB 3LT3A 5C4GB 4TPIZ 4W5JA 2ZS9A 1JWTA 4HYYA 3TKLA 1OH6A 3QJYA 1EATA 2KWIA 4PZLA 5EXNA 1IN5A 3EDXB 1MZAA 1LF5A 3K0FB 1RC8A 6LPRA 4ZDWA 2P6RA 1IQEA 1FNIA 3HKJB 2D2EA 1C2IA 4R98A 3N2IA 1GJ8B 4HTCH 1O2IA 2QM7A 5EP3A 5DIFA 1ZCBA 1GI7B 3OSYA 4X6PA 2F7SA 1QFKH 1YM0A 1NLFA 1GL9B 3RXJA 2V0BA 4YLQH 1L4YA 2IBMA 1OJLA 3OX7U 2R65A 2P3TB 2ZSAA 4PO1A 4B2LA 2OO7A 3GFTA 5GJBA 3PROA 4DVAU 1P09A 3MFYA 2Z6BD 1NRQH 4PAOA 3VR3A 1NJFA 4QHTA 3QVUA 2WIBA 3HGNA 1SB1H 2F1JA 2EA3A 3L0OA 2OLGA 2FDAA 3I5XA 2YNAA 1N2CE 3GJ3A 3QPVA 1F2UB 2XC0A 2VIWA 3A7TA 4JT4A 3QUSA 2A5JA 3UR9A 4JZ1A 1SI5H 1ZBDA 1ZPCA 2WWWA 2V3OH 1NMYA 3VKHA 1C5ZB 2EQBA 1AK2A 1DAEA 1WTHD 1ELOA 3FOZA 1N0WA 4RSGA 1TMBH 1BTXA 4O3TA 4FMCF 1XEWY 4DIEA 5H4IB 2BXUH 1XD8A 5KNDA 1YPLH 3HDTA 5E8EH 2WOOA 1AVGH 3Q72A 4CRGA 4QJ3A 3X1DA 4BTTB 2F3CE 4PSKA 1JAIA 3NXPA 4A0GA 3TIFA 1UMAH 3DHKH 2NPIA 2HOBA 3WYAA 3U1IB 2R6AA 4CRAA 4PPQA 1TPOA 2FPMA 2O8DB 3KQUA 4TYYA 3A81A 1G6OA 1DE0A 1T8TA 3F6UH 4IN1A 2BY8X 2V6NA 1W5TA 2XNSA 5CJ2A 4Z51A 1SHZA 1KMHA 3BEUA 4DB2A 3ND9A 2BDTA 3AF2A 4IEIA 1K2I1 4A2PA 1IAUA 3ZYEA 2QYIA 4M2LA 2EWVA 1EFUA 3H5CB 3U3JA 1EAUA 2OINA 3KKQA 2C77A 2ZI7A 2ZRAA 1BQYA 1N5IA 3FHTA 1C5SA 1DSUA 1LPGB 1HQYE 2IYXA 2PKAA 2RGCA 2JETB 1P04A 2AL7A 2UVQA 1IQHA 3TU7H 3THXA 1DM4B 1KK3A 2XBVA 1RIFA 2VINA 1FLEE 5L3QB 3V13A 2ZEJA 2G5VA 4SGAE 5P21A 2NMVA 3TLXA 1QHGA 2JDID 2QMEA 2BQWB 1C1OA 2I1QA 2BLVA 2JLRA 1EAXA 1AFEH 4MYTA 4CEIB 4Y79A 5JBBS 1P02A 1O2KA 4H1UA 1W13U 2C96A 1F2SE 5C1UA 2B92A 4X8OA 5JBCS 3Q3KA 5F3WB 2XTMA 1H8DH 1P01A 3D49H 2OBLA 3EIQA 1A7JA 3H0KA 4LWZA 1RFNA 1BDAA 1F5RA 1KLTA 5KO2A 1L4ZA 1QURH 4NWLA 1VGCC 1EJMA 2O8LA 3UQVA 4OQXA 1UDWA 4XOIA 4URYR 3SFVA 3UMFA 4N1AA 5EGMA 2X2FA 1P73A 1WB9A 3MH6A 3GD7A 4B76A 3TR0A 3NWUA 1AA9A 2R2AA 1PYTC 2BV3A 1N3BA 1CF4A 1O3FA 2XSZA 4OQFA 4A8JC 1SVPA 1RJ9A 1OSSA 2P95A 1S8FA 1OX1A 4AZ2B 1VTKA 4ABDA 1S81A 4PFSA 1O2SA 1ESTA 3QXHA 2CK3D 4H42U 1XJQA 2X19A 1IN7A 1BTYA 3E91A 4Y8ZA 2Z7FE 3B1XA 4VGCB 1NPMA 2R2MB 2CJWA 5JSZA 1ZSKA 3KDSE 5C5NA 4YLUA 4BFZA 3AM1A 221PA 3R8FA 1O2GH 4KHZA 4A15A 1O5AB 1W4BA 2J9RA 2Y80A 1EJAA 2HLDD 2ZRGA 1AGRA 1XWIA 1T3LA 2ZDKA 1C2GA 4EPYA 4VGCC 5DP6A 2JLYA 1T6NA 1BTZA 4B35A 5LPEA 1NSTA 2QTVB 4YOIA 1OP8A 1VIAA 3PCRB 2AYWA 1MH1A 4RZ2A 5EUMA 3FFBA 4GOXA 3GCHC 1RIWB 1ZRKA 3ZV8A 1LMWB 2ZQ5A 1ZW6A 2OBMA 1G3UA 2PR3A 1SVMA 1NG1A 4TL8A 3QX5H 3FKSD 3PV4A 3EZ2A 1ZVQA 1FIWA 4NONA 3QLPH 3A37A 1KHTA 1NESE 1IQFA 1Q22A 2QEQA 4J2YB 3SNDA 4WA7A 3T5FH 1GDDA 5CK5A 1MR3F 1KLIH 1XD2A 3IEUA 1W0JD 1V2OT 2D2DA 3MMGA 1LPZB 1FN8A 5JBQA 1A7SA 1D3QB 3GY2A 1OOKB 3W5IA 4TQ9A 4THNH 1Z1IA 1G30B 3OZXA 5FAHA 1AZ8A 3VKWA 5TJXA 1GIAA 3M3TA 1KXEA 2ZROA 3G0HA 1P2SA 4MYHA 1EPTC 3MJHA 2ZE5A 3FFAA 1S82A 1TA6A 2OESA 2IYWA 1PQ8A 1M1YE 4UD9H 3CF2A 2ZE6A 1VCIA 1A2BA 1QRAA 3VNUA 1L4UA 3GJ6A 4EQ6B 1QL9A 1KI4A 1UEJA 4DCVA 1TF7A 1ZJKA 3QG1A 3JVVA 2B7BA 4DDVA 2PWXA 1C5MD 1BMFD 2XYAA 4P33A 4BFSA 2ATXA 3LJJA 2CL7X 1XUHA 1SVOA 1MABA 2FOLA 3ZQJA 1UDXA 2VB0A 4ESVA 3A1TA 1GCTB 2HT6A 4A6PA 5FTLA 5FCKA 2QROA 5A0CA 2RHDA 2OG2A 3A7YA 4BLTA 4NA9H 1GP2A 2GDJA 1GCDA 1LS6A 2FWWA 2WINI 2H5DA 3BSQA 5GVSA 3GLGB 4O2LA 2C8VA 4L15A 1OLOA 3Q3XA 2SGQE 1ZTLA 1N5JA 1GI9B 2P65A 3RP2A 1QVRA 4MA4A 1E0AA 1K1IA 3AASA 2ZUBA 2P94A 4M9ZA 2CF8H 2BMGB 3W8RA 4ZAEA 5EG4A 3SJKA 5JCZA 1S1MA 3IQXA 3MO6A 1NO9H 3K09A 2BB4A 3RXMA 4JSTA 1SKQA 4JLAA 4XIGS 1RYHA 2ODNA 3LGWA 4JZIA 2BCGY 2B7CA 4JYCA 4JLOA 5A0BA 3L0PA 2JJ2A 3S1AB 2CXXA 4QHSA 5IF9A 3DMNA 3BIUH 4EJSB 2A5IA 4LV6A 1EX7A 2VRWA 3FP7E 3A4NA 3PWBA 4KELA 4HAZA 2STAE 4QGHA 3KQKA 3EC1A 5AWFC 2IA5A 4D7FA 3BTQE 4M0LA 3EA8A 2OLKA 3SZEA 3JVUA 2FDCA 4NWKA 1XZQA 2IF0A 4DIHH 3A7XA 4ABBA 5KSOA 1R7RA 1V2MT 1SGDE 2VHUA 2Z4RA 3LW8A 1TADA 1L2TA 1XTRA 1OP2A 3IEVA 4JVLA 1GMHG 2WWYA 2J87A 4HDCA 5HMAA 1FPMA 1BHXB 4QGGA 5DP5A 2HF9A 5FUWA 2EW1A 2QAJA 2ZREA 2GCHF 5FI0B 3VB5A 1DDJA 4O03A 2F3TA 2CEAA 1GBMA 4Q2KA 2ZUCA 3PJRA 5LH8A 1CS4C 1KSJA 2EFEB 3I92A 1TYNA 2ZAMA 2QXJA 4TMKA 1US8A 2GJAA 4B47A 1EX3A 2VSXA 1AJEA 4K2YA 5CYOA 5F8XA 2H1UA 3A8CA 2TMKA 4DCUA 3NDPA 3ZVGA 5AHGH 1VITF 1UTJA 4K3JA 1MD7A 1UKZA 2GJ9A 4TT3D 3NG1A 2OBNA 2WWFA 1G4UR 1ONBA 3P1JA 2ZDMA 1ZM7A 1O37A 1TPAE 2ZU0C 4GUXA 2DFNA 3CKLA 1A82A 1IQKA 4ZCMA 3DMDA 2TGDA 4CBOA 2J0VA 1ELCA 5KDOA 3DKVA 2WHXA 2IYSA 2AGIX 4UNRA 1VPLA 2BY6X 5FBIA 4R71A 4F92B 3BFKA 1K1MA 5AF9H 4BFYA 3OIYA 4B3XA 1G21E 2ODEA 4Q4JA 2AFHE 1RS0A 4BOHA 4QBFA 4XSHA 4TQUS 1HB0B 4C7OB 4XBCA 1GNPA 3QXSA 3ZS9A 3PIRA 4OHXA 2ZGXH 3TH2H 4Q21A 2VF7A 5FBVB 3RXSA 2BWJA 1KO7A 1M74A 4HDOB 3REGA 2CHVA 4P4TA 3LLMA 1UTQA 4WXIA 4PAQA 3KGPA 1KK2A 3URDA 1U2RA 1VHLA 2PTCE 1GBAA 3TPIZ 2R0KA 4Q7MB 4BFTA 1X7AC 1TU4A 3MG9A 2WUBA 2RAPA 2REBA 2R8RA 3QBTA 5FBEA 1GI3A 5L8VA 3RXLA 3B2EA 1EAIA 4FUJA 1CQQA 3TQFA 2DWPA 3T1QA 1WQSA 1E96A 4CEHB 2I3BA 4EUNA 4NCNA 2KE5A 4PSAA 1FN6A 3WHLA 1AM4D 2IC5A 2QT1A 2Z83A 4Q5IA 1BBRE 5EW2H 2CDNA 1HPGA 2ANYA 3SFZA 1XPRA 1SR5C 4HLCA 1NFUA 4LYFA 7GCHG 1XD2B 3V00A 2J7KA 2ZO3H 3QF4A 3THWA 4Z8YA 4UJ3A 1W2KH 5FH9A 5AUQA 5EE1A 4FCWA 3H86A 3SU5A 4ZHLU 3ZZ6A 2Z6VA 3QPUA 6ESTA 1HQCA 2FPLA 1MT0A 1IQGA 1X86B 1ELDE 4BLPA 1X1SA 3ICQB 3SNHA 2GTBA 1HH4A 1H8HA 1G7CA 2JJ8A 2XEXA 1WCZA 2AEIH 3RMNH 2PKAB 1KSFX 4FMBB 1MUEB 1TL7C 3UPUA 3AP1A 2J5XA 2ZA5A 2GF0A 2O0KA 1AVWA 4JIMA 3HJNA 1NN6A 4BASA 2A7JA 3E0PB 4BWYA 1GG6B 2P5TB 2GWHA 1BRUP 5KUTA 2TGPZ 4BXSA 1P5ZB 1Z29A 4X6MA 3T27A 1O87A 3KZ1E 5DO9A 2IUTA 3RYTC 3GLFE 2GESA 3TGJE 1XRJA 3LNCA 1YZLA 1UK2A 3A7VA 1BHXF 4BAOB 2FSHA 5HM9A 4GPTA 2Z9IA 5EP4A 2ANBA 1UCYK 3HPQA 5G40A 5C20A 2BM2A 2UWLA 4MGIR 3A87A 1QB9A 2XZOA 4B2PA 4QXAA 4MRNA 1BMLA 1Z0KA 4BTIB 1UVSH 1V2NT 3UXMA 2R0LA 1GPZA 1G8HA 3TNSA 1II8B 3NKKA 4DZZA 1XEWX 3T1TA 4FUBA 1DUEA 4INKA 2ZTZA 3DFJA 1F2UA 5J4VA 1KTVA 3LGVA 1N0VC 4HSEA 1GL1A 4J0QA 2RDLA 1XP8A 5C1XA 4B2CA 1F6BA 4LJYA 1N0UA 5DH9A 4LBWA 1HAVB 1GBDA 1MH0A 1H65A 4GHTA 2GAAA 2HJVA 2N42A 1QG2A 3MGCA 4A82A 2R6GA 4HUQA 3CPEA 1NVWQ 2ZU2A 3C41J 3BWDD 1FY4A 1B23P 4LZ1H 1C9PA 1S6HA 2ZRNA 1B0EA 4MKGA 3NKVA 1XCPA 1FDPA 2ZTYA 1XKAC 4Z1MA 3VFDA 5LD2C 1COWD 1A5IA 5AUOB 1WYKA 3L82B 3TJZA 1HLTH 2ZFTA 5EJEA 4MYCA 3ZVNA 1UVUH 2Y5GA 2GK6A 4JVNA 1UO6A 2OC0A 4GFDA 2JEOA 1R5NA 3GEIA 5JS7A 5KDLA 1TQ7B 4D76A 1G1MA 1MMJN 2VPPA 2AGGX 2VQSA 4HAVA 4D2IA 1JOUB 2CVHA 3A83A 4MDSA 2VSOA 1PZNA 4IDHA 3LDAA 3PG5A 3ADCA 4NYIR 2QP3A 4F4CA 3UG7A 1TALA 4S35A 2IXFA 1ELGA 1SGNE 7ESTE 3LVQE 4TYNA 3LH5A 1GRRA 2V1UA 2QGZA 1OB2A 5J4SA 1GBTA 3MNXA 1YR9A 1ANBA 3BB3A 2ODQA 1TMTH 2B0FA 4CR9A 2WYGA 1L1JA 4EIWA 3RWOA 3P27A 4LZZA 3SC3A 3SUDA 1O2JA 3LX5A 3WNDA 1CGJE 1OIXA 3RSLA 5FFMA 1WTGH 4BFUA 2FYQA 2GCHG 1MO4A 2GF9A 2FF7A 2NO6A 2EEKA 2FOMB 3MWIU 3OE7D 3EPKA 2PLRA 1S4QA 1ZMJA 2PUXB 2CLCX 2GD4B 1G7TA 4A92A 2P3UB 4NCIA 2Z9LA 2ZF0H 2FIRH 3K6YA 4JLBA 4XWAA 1C4Y2 1NFWA 4DCTA 2WJJA 3L3TA 1TRMA 3EG5A 2AIPA 3PEVA 3B1WA 1VYUA 1E2NA 2WWXA 2Z5FA 1D6WA 2P59A 2E87A 2G88A 3UWIA 4DXAA 5CLLA 4Z6AH 2VL7A 2C3SA 3TH4H 2C9YA 3H7OA 4JT2A 5F2EA 2YWGA 1G7RA 2VIIA 3QDZB 2C90B 2GILA 1SLUB 3KX2A 5BWMA 5JEDA 4Q7LA 1DLKB 1T4VH 4NIWA 3PLPA 5LGOA 2QQ0A 1GM5A 5TV2A 2C99A 5DI3B 2F43A 4TTPA 1GJ6A 1PV4A 1ESBA 1AZTA 4KXFB 4B3BA 1TQ6A 8KME2 2W6JD 4UFEH 2J34A 1F0TA 4E05H 3GJXC 4DSOA 2ESTE 1BJVA 1NN0A 3MNCA 1TA2A 2C2HA 1ZC4A 2QP9X 3KL4A 1O3BA 3W9YA 3UIRA 1NKTA 3T62A 2ZECA 2ZIQH 3L2OB 3ZD7A 4O0MA 2HVXA 3IBGA 1M9UA 4BZPA 2H5CA 1EB2A 2GKVE 2VBCA 3QSYA 2VSFA 1EP5A 4UNQA 1E9EA 2FOBA 2RGXA 2FX3A 1ZCAA 4WXPA 1CXZA 3LD9A 1G291 4W7SA 3UNRA 5DE3A 4PPFA 4DCNA 2BXTH 3BRWD 1L8QA 2YKGA 1BS1A 2ZGJA 3SQXA 1A3EH 1QA0A 1OYQA 4BAKB 1C1TA 1BCUH 1S5SA 2AHOA 3P8OA 2GDEH 4MKHA 1VG1A 2D4HA 1BT7A 3BTHE 2GX4A 3QZQA 2QI9C 1TE0A 4O2RA 3K09C 3T34A 4GRAA 1OWIA 3BTGE 3DOEA 2I4IA 5CDFA 2ZI9A 3Q7QA 4F38A 3U3OA 1OWHA 1AKYA 5JWRA 1VECA 1HTWA 4ARZB 1HYQA 4CIDA 1T8MA 2GCTB 2R3UA 1PLKA 1NBME 2B8TA 1GHVH 4Q9LA 1FXYA 1N1LA 1LKAA 2IUSA 1PJRA 2XJ4A 5DISB 4LX0A 2VWOA 2ZDNA 1HE8B 3AVPA 3AAUA 4K1TA 2J94A 1K5GA 3DHWC 1LY1A 4Y0YE 4TLCA 1E2QA 1QVAA 3EX7C 1OFTA 1NL3A 5ELXA 2PT7A 2FPZA 2VTKA 4OQNA 4QRHA 1O2VA 2YWEA 2FLRH 1JMOH 1BRBE 4GOJA 3O8CA 4YO9A 3CPHA 3A8TA 2VH5R 4AYYB 1KO1A 5FTMA 1AKSA 3AKDA 1SULA 4B2BA 2FYRA 4D4MA 3LW7A 4WY3A 3SNEA 4NU0A 2CCJA 1Z2CA 1U9IA 1FONA 3L33A 5TVKA 5SGAE 2TIOA 4X2YA 1LHFH 2H6MA 1HAVA 5GADl 4OI0A 2AFIE 4IXMA 5B57C 2BD8A 5I46H 1P2KA 3IHWA 4A1FA 2IYZA 1T8OA 4INHA 4FW9A 2ILNA 2Q6TA 1UTKA 1H8EA 3CB4A 4ISNA 3M1IA 2Q1JA 3PEWA 1U8YA 3GJ8A 1FUKA 1UKVY 1FZQA 1SLVB 4QFMA 4DLRA 1X6VA 3SN6A 4Q4JB 2ODWA 4A5TS 2GXUA 4PC1A 1O3KA 1E36B 1ZNYA 1ARCA 1CJKC 3B23B 2IUUA 1AO5A 3AK5A 1ORFA 3SJ9A 1X8JA 4AD8A 4ABHA 1VJAU 1EJNA 2QXHA 1OH5A 4A1VA 1TBRH 4HATA 5EE3A 1GCTC 3QWCH 1NT1A 4LBYA 3KKNA 3TH3H 2A2XH 3F5FA 1XVMA 1X1RA 3X1ZA 4YLGA 3MH4A 1G37A 1UBFA 1FY5A 3D6TB 1BMFA 3CO5A 1P75A 1QB1A 2VP2A 5GJVC 1U8ZA 3W6OA 3C14C 1NJGA 3TW4A 1ZHPA 3CNNA 1CLUA 4EAQA 2TRMA 1TBZH 3F9GA 1R10A 4LHZA 1EFRA 1BTWA 4Y8XA 5AUNB 2QMOA 1KIMA 5KSYA 1W0ZU 4FXGH 1ID5H 2A5YB 5CB8A 5HZHA 4MDFA 4I8KA 3ZZCA 4I8LA 4TT3A 2FJUA 1Y3VA 5DYIA 3ZIAD 1KZGB 1O3NA 4K46A 5JWHA 3LBHA 3EGKH 1SPJA 2WPHS 3LGUA 3M7TA 1N25A 1P2JA 3RC8A 3WRXC 1O2PA 1P2QA 3PUZA 1DELA 4IKEA 4CBNA 1EWQA 5EU8A 1BTPA 1T0HB 1C5OH 3GP8A 4A0HA 1R0XA 4ZKSU 2BLWA 1C5TA 1HCGA 2CV3A 1KO8A 4C3ZA 2QIQA 5KPJA 1AIPA 1YZNA 2V3CC 1B0FA 4Y0ZE 3BIFA 3SBEA 2R6DA 2VHJA 1ZRHA 2XBXA 3B8JA 2FP7B 4PC2A 3RXVA 3BK7A 2B6HA 4KLZA 3GDVA 3PYHA 3I8SA 2BMJA 1GHWH 1I4TD 1Y8TA 1UVPA 1TBQH 1XEFA 5L2ZH 3EQ0H 3PUXA 4YMSA 1INCA 4QBHA 2IWHA 1G32B 4Q7XA 1ZM3A 4KKDA 2A5AA 5HYOA 3VMFA 3NEYA 2G4UA 2ONKA 1FL9A 4AB9A 4V0MA 1W0KA 1DAKA 3W6NA 3GQBA 5DI9A 1Z6JH 4FIDA 4GSYA 2AFQB 4FUGA 3U8TH 3IDQA 3IIMA 4G01B 3RRNA 1NMXA 1W4RA 4ACAA 4DB4A 3RXKA 3WP0A 1O2RA 1C1MA 3CF0A 1OKXA 1AFQC 2ORIA 3I72A 5DN6A 5B2ZA 1V2ST 1PVOA 1U98A 4Q4HA 3MRSA 2C5LA 5LPNA 4FUFA 1E9AA 1O3AA 3A1VA 3H7TA 1TGNA 2QN6A 2EFHB 3UQOA 4D80A 1YF4A 1UJ1A 4NDZA 4KSBA 1Y3UA 2BVRH 1COWA 1Z22A 3REFA 1CR1A 1G3BA 2CXVA 2QY0B 4NCJA 4KSCA 1TAGA 5FOXA 3Q5DA 3NBXX 2ZJZA 2RGNC 4YOJA 1C4V2 4LPKA 2ZU5A 1JJVA 3D62A 1JXOA 3SJIA 5C2JB 3U7EB 2GXSA 1KI2A 1QHHA 1MKWH 4Q47A 2ZXUA 1GJ9B 4JL6A 5DP7A 4IEEA 2GZ9A 3K8YA 4MGYR 3FYHA 4KJZA 1XNJA 1DOJA 3SV9A 3DOFA 3T15A 1ZPZA 2FSFA 1A3BH 1Z8IB 5M04A 1P2OA 1WF3A 5JJIA 4KITB 1TWXB 2J3EA 2FTMA 3THWB 4LJ4A 3PR1A 3K6ZA 1U0LA 2C03A 4L16A 4A7IB 4Y76A 121PA 1ZHRA 2GTPA 3UMSA 4D0GA 1OXXK 3ZZ4A 4DIIH 1DWDH 3AV0B 4AK9A 1UK3A 2F6RA 3NVAA 1C4OA 4ISOA 5GJ4B 2ZDVH 1Q0UA 1US8B 2MSEB 2D74A 5KU1A 5ESBA 2C8ZB 5C1BA 3SW2B 1ETSH 5HR5A 2BBSA 2D7DA 4LSGA 2QU8A 1N6NA 3NTUA 3EWAA 2B8OH 3TW8B 4BRWA 3AW0A 4MRSA 1DX5M 2A2QH 3CUEF 1KI3A 1A2CH 3SV6A 3T06B 1ETTH 4M1TA 3RSOA 4C0KA 3BB4A 3ENSB 1CEEA 4BEJA 3JZMA 3TR5A 2ZJ8A 3TE6A 1O39A 1SHKA 3SOPA 3K0AA 4DHEA 4KAXA 5KNCA 4IDOA 4KFUA 4LC0A 1F48A 1A2KC 3U44B 3I61A 4D4KA 2ODBA 1P7CA 1EQ9A 1C1RA 1Z6AA 2CGAA 5F8TA 3GYMA 2SGEE 4Q01A 4A2QA 3IG6B 3HU2A 5AJXA 5G3YA 5LD2B 4AYWA 2Y5HA 2DPXA 1LFDB 3MCAA 3LFUA 3FHCB 4ZO4A 3B6EA 3GY8A 2PMKA 4KLNA 1ZYUA 1TQ0B 1EGAA 1MKYA 1HAIH 4MUAA 1XUKA 3TJVA 4TYWA 1P9WA 3D3QA 1JQLB 4ESTE 1H9HE 2F9OA 1MTSA 3CX6A 2FS8A 3NIBA 1ESMA 3MSXA 3GLFB 1QNJA 2XTTB 1A0HB 3AAVA 1HJAC 2ZHFH 4YOGA 8GCHG 1KSHA 2IYTA 2CNWA 5L3SA 3SJZA 5C4MA 4XSKU 2DHRA 3PM3A 1W7GH 1GDUA 4HGCA 1OH8A 1E69A 1SOZA 3OAAD 2OSBA 4JZFH 4Q02A 4OGXA 4RVCA 4CGZA 1EAWA 3VQTA 4ACBA 4B6FA 2VIOA 2KJQA 3PUWA 4DLZA 2EYQA 2ZHQH 1MO6A 3H84A 4RKOB 4YQFA 3OY6U 1V2PT 2QG6A 1VCPA 5AVDA 2FH5B 3KQCA 1YBWA 1WP9A 3Q85A 3SYKA 3LY5A 4ZI2A 2QGNA 621PA 3PO1B 1JPJA 2GNOA 1O5BB 4PC6A 2GCPA 2FOEA 5EQRA 2FXRA 3HR8A 1BB0B 5DYGA 5LDDC 1CJTC 2FZLA 2OQUA 2BBTA 1LQDB 4MG3A 2VP6A 1C1QA 3HKIB 4WH8A 5DLQC 1PPEE 3FAOA 2F9BH 2GZAA 4P32A 4O3UA 1JAHA 1J7KA 1SVLA 3PMJA 3C5HA 1Z47A 2VH0A 4XD7D 3LXRA 1JEDA 4DKXA 1C1WH 1XDBA 1E2MA 1NM6A 2NU4E 1XMNB 1IOEA 3M0EA 2O8UA 1YPJH 2Z3EA 4URXR 3LV8A 5JJKA 1HY3A 2G1JA 1BBRH 1ESNA 4JYBA 2IT1A 3LRPA 3ATLA 1FAKH 1F7ZA 4B73A 3A1SA 1IJEA 1EP6A 4TQAA 4FXPA 1F0RA 3QN7A 4DT1A 4GCHF 2JLVA 3IWMA 4UFFH 1ZNWA 2Q6FA 3WP1B 2JATA 4PQRA 2XSZD 1TX8A 4JJZA 1BRAA 1D6RA 2BIFA 2QE7A 2VO1A 4X6NA 4YXWD 3X2SA 1NMZA 2W26A 3F9EA 4HZHA 1CA8B 2YOFA 1FX0A 4KU4A 4B43A 1KTTB 4WXVA 3T1VA 4OHWA 2PV9B 1Y5BT 2HPQH 5K0HA 2IJD1 1YP9A 4Q7YA 2VVVA 3HP1A 4NFFA 5ABWA 4OK6A 4MNWA 4OGYA 1KJYA 1IXZA 1TLDA 4A1TA 2NOAA 4XDEA 1KY2A 1TU3A 2GZ7A 3OIWA 1I4DD 1XXHE 2Y6TA 1N8OB 2A5KA 3K0AB 1GG2A 5EXXA 1S85A 1ZAKA 4U00A 4ZDJA 2JH0D 3E5HA 2JLWA 2FWRA 1IAQA 2PMDA 1O33A 3MH7A 3OYPA 1THPB 1B7XB 2BCJQ 1O3PB 1ZSJA 3N70A 1H9IE 4G5GA 4GT1A 3ADKA 1XVOA 2SGFE 2IS6A 3ZDQA 4OYHA 2W3IA 3K0CC 4HAYA 3A86A 4DG4A 2RG3A 3EA7A 5FOUA 5HTKA 2PH1A 4I7YH 2QV1A 4R7ZA 1TX4B 1UM8A 4C0BA 1O31A 1GG6C 1S6FA 3PUYA 1CJMA 2BZAA 2C8YB 1EKBB 5EW1H 3D7MA 2WPKS 2KB0A 1AFQB 4AKIA 1HT1E 2GVZC 2HWLB 2EU8A 5CYPA 1P2IA 3PO1C 3UWOA 2QORA 5JJLA 2BDIA 1Q3TA 1F2TA 4TYDA 3EXAA 4CEHA 1AQYA 1XF9A 1JALA 3S69A 4Y11E 1BYIA 1PLJA 1E79A 3RS2A 2A2ZA 2WWHA 2CNWD 2GEDA 5BYJA 1G18A 3U2QA 2J95A 2JJ2D 1L7VC 2VP4A 4ZV4A 2FS9A 2OUKA 4ZKDA 1FIZA 1PPBH 1DAIA 3NUMA 1PQ5A 2F1RA 1P72A 1QJ7B 1FV9A 1SGFA 5A5GA 3D23A 4R9UC 1SKYE 3T5DA 5CDFE 3P4XA 5FXLA 3GDSA 2B9LA 1UF9A 3ZIAA 3P4YA 4EJSA 1ZMNA 4A4DA 3ODFA 4DRZA 4TPYA 1GVZA 2DE8A 3CIOA 3RC5A 1BUIA 2QA9E 3QTOH 4TY6A 2W7UA 2NGRA 3A4MA 3NBZC 3BXZA 1XEXB 1UKEA 1U9IC 3QKSA 1WCV1 3DZDA 3T2NA 1OWDA 1RVDA 3I29A 2VF8A 1NRSH 2W0SA 3WMFA 3PMAB 2EFDB 3SU6A 2C8XB 1NVXQ 3T12A 4LJ5A 2BQ6B 3VAAA 1WBBA 3FMPB 1CHOF 2DYKA 1VZQH 1S3SA 1CSOE 3AF1A 2BVSH 4PQYA 1ZINA 4H1VA 3KKMA 2B8WA 2GCOB 2W6IA 4X8VH 4WWYA 1KSNA 2X77A 3CH4B 1WBGB 4QM7A 3KN2A 3A4LA 3X1YA 3MNSA 3I77A 1OKKA 5F9FA 1GNRA 2P8OB 3SR0A 2JH6D 5A8YA 4TLEA 3KXLA 2Q21A 5JRJA 1SQ5A 4C30A 5LB2A 3MU1A 5L3RA 3VR5A 3E70C 3FVQA 3BF6H 4M9QA 1RE0A 1N6OA 3Q3JB 1N8OC 2OEPA 2OXCA 4HI3A 4AOQA 3QZRA 4JK5A 4DJZB 4LC1A 2NWNA 2YOGA 3M7QA 4AX9H 2VIDA 4CEIA 2VIVA 1KXFA 4OJKA 4OK5A 2GZ8A 1Z3IX 3EIHA 2ZQ1A 1ZJDA 1F60A 1LVGA 1KK0A 4LZ4B 2GEVA 5K8UA 3ZZ9A 3K9HA 5D3MB 2YJTD 1CRQA 4RD4A 4AFZA 4YMUA 2BY5X 2ZPSA 4FUDA 3QKUA 4QJ4A 4X8SH 2NU0E 2E1RA 5E0GA 1DS6A 1A1RA 4BRUA 1O5GH 2X2EA 1C1VH 4L4UA 1O38A 1KXAA 2CE2X 1UHBA 1NROH 1TX7A 4MPXA 1QHIA 4BUJA 2W7SA 3F0TA 2ZPQA 3BGWA 4ILEA 2PLXA 4MPWA 1E2FA 1EG7A 2ZTSA 2ZJBA 2NO0A 5EQQA 1AUJA 4DLVA 1GGDB 2CVFA 1P60A 3P8FA 1XTQA 3AKYA 3NBYC 2E9SA 2WOJA 1VMAA 1O2LA 1EFTA 3FTQA 4UNPA 2V6IA 1TFXA 2O8EA 2BX4A 2MMCA 1IHUA 1QJ6B 2ZR7A 1DS2E 4K1EA 4UFDH 4B74A 2UUKB 2PT5A 4K1SA 2GP9B 1G41A 1W2GA 3HK3B 1FQKA 3RXPA 2VWNA 3KXIA 1G5TA 3DZ8A 1FPHH 2FODA 2G77B 5A8ZA 2QL6A 2QF0A 2Y5FA 4ZROA 4E22A 3RXTA 2B5TB 1EZQA 3O47A 2FO9A 4I4LA 3UPEA 4CEJB 1OWKA 3JZAA 4LBVA 3FZDA 1ZYOA 3U61B 1GI2A 2ZFSA 2ZP0H 2R6FA 5JLJA 1W36C 1CTQA 2C98A 1AQ7A 1I2DA 3GJ0A 2ZYUX 5EZ5A 3UNQA 3BTFE 2QBYA 1QA7A 1GBEA 1NY5A 4UXHA 3LJOA 1VG9B 5D3QA 1CR2A 4I31A 2VJ1A 2H9TH 2YV5A 2OAQ1 1E9CA 4UFGH 2RGBA 3CBQA 1XU4A 5HM2A 4DVGA 1NN5A 2Z9JA 1MV5A 1P2UA 2A30A 1R6BX 2ZCLP 2A78A 4ITRC 3ATMA 4MH0R 4NIVA 1CU1A 1UJ2A 4NZLA 3DKPA 4NYIQ 3GY7A 4NIYA 5A8XA 1KXCA 4IOLA 2OE2A 3C4JA 2IYVA 2FOHA 1XEXA 4BFWA 6GCHG 5TCCA 2WPDD 4DDTA 1QBVH 2OFWA 4KBFA 1GHAF 4Q1DA 3TUJC 5JB9S 1XPUA 4RKEA 2WJYA 4WAUA 3TVJB 1JIRA 1VCNA 1IQIA 4ON9A 2ASUB 3AVXA 3STJA 3I3SR 3E16B 3P70B 4KI0A 4TTQA 1KJZA 4AKHA 1O36A 3LXXA 2A4OA 1ELBA 4JLMA 4GMXA 5GDSH 2XTZA 1GJ5H 1GFIA 2Y8EA 3R20A 3VB7A 4TL6A 4JLNA 1O2UA 2IXEA 1ABJH 1VGCB 4W5WA 1YKTA 1A0JA 4CRWB 3GEHA 3SI3H 1TF5A 2SNVA 4ZHAA 4MGZR 1HJAB 3O8DA 1W7XH 1ZC3A 1JXMA 1GNQA 4A0RA 3IPXA 1GL7A 3VXFH 1F5LA 3GLIE 4BAQB 1TF2A 4D9RA 1T4UH 3IO5A 1OXUA 1GMHF 3ZZBA 4ZUHA 4ZI3A 3TK5A 4CH8B 1OKKD 1XTJA 1NKSA 4LCBA 2OQ5A 4JYTA 1OXTA 3CRQA 2ORVA 2ZRJA 4BLQA 1C5YB 2CF9H 5J5CA 4G5SA 1T4GA 1E0FD 4JL8A 1E2DA 2G00A 1HUQA 1GWAA 4Q03A 1SXJE 4P31A 4URUR 2NO1A 1IQLA 4NGAH 5J4YA 3FKSA 1KY9A 3N2EA 5BN5A 3SQEE 1G9IE 3CP7A 2OAP1 4YXWA 5FTNA 1NN3A 3P6ZB 1KI6A 2JGNA 2HF8A 1NIPA 4NYMR 3S9CA 2CHAB 3VGCC 4X8LA 1GI6A 4PC3A 1AWFH 1M7BA 2O8WA 4I81A 4HZIA 2A31A 5EXLA 1L4DA 2PZEA 4O97A 1A5GH 3P26A 4RFSB 1NF3A 4UONA 3TK1A 1C5WB 1Q31A 1FW6A 3MTYA 2O9QA 3GY6A 4GOKA 1DEKA 1SGEE 2JJ1D 2OLJA 2G3YA 2FMJA 3BG4B 2IPHA 4TMWA 4JBXA 5SZHB 1M34E 4E5UA 4ZHMU 2G0TA 1NY22 1JJ7A 1RGQA 4FUIA 5L30H 3NK8A 2H8KA 2P0EA 6CHAC 1HAOH 3QE0A 1SXJC 2IXGA 5A0FA 1GMDF 2MMGA 2VWMA 3IILA 5IYTA 1AKSB 2G9NA 2BMEA 3T25A 3VHLB 1HDTH 1I4LD 4AC9A 3FFGA 5CHAB 1XM1A 4CZ2A 5F8ZA 4TLAA 3PXGA 1OXVA 3OF5A 2Q3FA 1H4WA 2ZFFH 4F7WA 4FMDB 5JBTA 4GLYA 2O8CA 3U4QB 1OHHD 2PHBA 4OS2A 2BJWA 4Q1AA 2BDCA 2O52A 1HXFH 2REXB 4QC2A 2BDYA 2GCTC 3B9FH 2GVDC 3ASYA 1GBIA 2ERXA 4NG9H 2KSQA 4M53A 1DAFA 2I6QA 5GCHF 5AFZH 3HWSA 4BE7B 3OEED 2J41A 4WZBE 3SYNA 5JMTA 1U90A 1EASA 2ZITA 3B1VA 1DARA 2P2LA 2AERH 2X8AA 1XMIA 5LPRA 3W3AA 2ZCHP 3V3MA 2TGAA 8LPRA 1EFRD 3WXMA 1LHGH 4HEJA 1O30A 1OWEA 1H8IH 3UWKA 3A89A 4Y0AA 1ZJ6A 2DR3A 2WZQA 1X8LA 3TNFA 4V03A 4INLA 4GZLA 2N1BA 4LHVA 4TMZA 4M1MA 4IN2A 2FOFA 4AN7A 3OE7A 2WJVA 2LKCA 3KUCA 3KB2A 1UBCA 1VDZA 1G4AE 3SJCA 5AJZA 1H8HD 4BNRA 3LA6A 5AR1A 1EOLA 1ARBA 1MKXH 1E1QD 2PCJA 3ZZ0A 3U60B 4MLFB 2VH6A 4BANB 1CHGA 2EI6A 721PA 4CRBA 1JB1A 2PL3A 2Q3MA 4URWR 1GKIA 2CMYA 2FV8A 3B60A 1ZSLA 1PJPA 1KLJH 1E94E 3GCOA 2H5EA 1T5IA 5C1YA 3W90A 5EUQB 3FANA 2XNDA 4BLOA 3EASA 1YCPM 2FGJA 3BTEE 2QAGC 2HLDA 5KTYA 4IOJA 4L5BA 1OFUX 2A45B 3PEYA 3RXHA 2DFTA 3ZD6A 4LV5B 2W5EA 3BH7A 2HXYA 2ZYVX 5TY0A 4HUTA 3I8XA 2P93A 3CRW1 4G0NA 1W0JA 2FOCA 1DUAA 4Q80A 3DDCA 5EQSA 2RGNA 5K7RA 4ZCIA 4OHZA 3ZVBA 4UXJA 3GLFA 1O2WA 2QGRA 1QCPA 2H16A 4WVFA 1WA5A 4D8NA 2AXPA 4RZXA 4M9FA 1R8QA 1BITA 4U01A 3BIVH 3ZYCA 4K8BA 3QI2A 1H1BA 1CRPA 2FEMA 4AWXA 4FCTA 3UOPA 5C46F 4GBMA 2J0UB 3ZH9B 1JR3E 3K0FA 2CCGA 1D4PB 4V0ME 2YOLA 1SXJA 2XB4A 3MNBA 3W94A 5JDUB 1MO3A 5DO4H 3CZPA 1O3OA 4QGAA 3SHFA 3AKCA 4JZDH 2J4IA 3BC1A 3PMHB 1Z8FA 3KQLA 4RD6A 4NPHA 4IW4E 2QPTA 4P3YA 4MGKR 2ALPA 1FAXA 2D62A 4NSYA 3ZS8A 3T35A 2KBEA 1K1OA 2ZRIA 1C2JA 1E0SA 1AZSC 1H8ED 2WJGA 3B1YA 4RKJB 4FINA 5A2MH 2HUPA 1ACBE 2ZE7A 4AY2A 1DG3A 3VTKA 3Q00A 4TZ0A 2FX4A 2AXNA 2JLZA 4TWWA 3ELAH 1DWBH 3CPJB 2ZGCA 2KBFA 2GCOA 3J81k 5HPYB 1TABE 1ZPBA 5JZVA 1HAHH 2WJIA 2VLIA 5GCHG 2IHBA 4XVUA 4NP6A 3NZIA 3HATH 5L6NH 3QGNB 6CHAB 3IO3A 3W34A 1KZ7B 1KI7A 1UPTA 4AKGA 3UKDA 3MO3A 2IW3A 3NH9A 1QIXB 1AI8H 2REOA 1T3HA 1GMCF 3NH6A 2F9LA 1PPCE 3L0IB 4RD0A 2VA8A 3V4FA 5CHAC 4OL0A 3EZ6A 1IONA 1TONA 2NO9A 1F0UA 1CP2A 5I25A 3SN8A 3SQHE 4GDFA 5F6MA 4F91B 2JKHA 1ELVA 1YZGA 2WV4A 4I8GA 5EZ6B 1ZM2A 3E2IA 3OESA 3P17H 3QVVA 1B5GH 1KKLA 2C04A 1YJ5A 1SQOA 4NCYA 1BA8B 2UZ3A 3A82A 1CT4E 1XMSA 1GMDG 5F03A 1KDQB 2ZSFA 3OIUA 1ELEE 1QRXA 4A1XA 3WNBA 1Y5UT 3TVDA 4E09A 2WWGA 3AVUA 1LQEA 2ODYB 5DGJA 4HB4A 2BEJA 1GBFA 1D3DB 3LKWA 2GBLA 3SU3A 4QGFA 4TZ6A 1XXDA 2OP9A 5BXQC 1VJ9U 3U98H 3BORA 3SU1A 1GBKA 2ZS8A 2H92A 1MRNA 2A4QA 1B0UA 1XUIA 4N3NA 4C0HA 4DLSA 2YWFA 1Z28A 1ZUNB 4U32A 5KPDA 2WKRA 5E2OA 2CN0H 3SV7A 2CLDX 2BM0A 4IVQA 3TMKA 4C0AC 1QHYA 3UOUA 4TN1A 2X1VA 3LPRA 5JS8A 3RXRA 3IBYA 1NVVR 3MAAC 4GVUA 4JVSB 5DP9A 3QK1A 1MU6B 2H18A 4Q7KA 4TMXA 3D31A 2J45A 3M5MA 2GETA 2HV8A 3PEUA 4FU9A 3RLWH 3ZVLA 1SVSA 2CK3A 4PZYA 1RD3B 1QHNA 4PQFA 2AN9A 3U69H 4ISLA 1DTSA 1D2NA 3Q7PA 3AVTA 1DSTA 3FP8E 3QF4B 3URCA 2F1HA 4NH0A 3ECCA 1C2HA 4P4UA 5KHOC 1S1CA 1NBMD 4MRPA 1XJCA 2ZYWX 4OS6A 2FZ4A 4B75A 1DY9A 1E2IA 3AF4A 1DVRA 4UNNA 3K70D 1TNHA 4OI1A 3CS7A 2BX3A 2YYZA 2HCBA 2GGVB 3K53A 2AK3A 4M21A 1G8GA 1TX6A 5L3SB 5BN4A 4YONB 3P8GA 1LB1B 1GHZA 1C2FA 4DCSA 4K8YA 2F3RA 4ASUD 4E06H 4LOYH 5E95A 1O3JA 2BD4A 5E0HA 1V2TT 2LWIA 4BQSA 5IHPA 1O2OA 1Z7KA 2PSXA 3DO6A 1AB9B 3GCTF 4X2XA 4JVMA 2FSIA 2Q9CA 1G7SA 1ETRH 2HDNB 1Q21A 3MU8A 2V55B 1FUUA 4K8OA 2G4TA 5SZIA 2BDGA 5CK4A 1RZ3A 3M3VA 2W6ID 1GI1A 3T1OA 4XFQA 1HA3A 5C2ZA 2GKSA 2BOHB 1XXHB 2GA8A 1MTNB 1TGTA 5CB6A 2XNDD 1UCYH 4V0NA 1U6QA 2WSSA 5H68A 1SGQE 1Z83A 1WXRA 5H70A 2EFGA 2D8WA 1N6XA 3ZZTA 4I1VA 3DM9B 4XOJA 1W4AA 1YHNA 2ZANA 4Y10E 3WNCA 1K28D 2PEZA 3TK6A 1R8SA 2ULLA 3SBKA 2VVCA 2GT8A 4TLDA 3OFND 3HU3A 1SGYE 4JMPA 2GCNA 1S83A 4AYTA 4PHGA 4Q1EA 1GJAB 3I1FA 1Z06A 3GCGA 3P95A 2V8OA 3CNOA 3JZ1B 2RKOA 5G41A 3EAJA 3BBPA 3IPYA 5DHFA 2R3YA 3ZZUA 1P4SA 5HGGA 1UADA 3KKPA 3UIEA 3MH5A 3FHOA 3SU8A 5CIWA 3S9BA 2PTNA 5JFGA 1A46H 5L2YH 1CA0C 3OEHD 3UANA 2P8OC 2SGDE 3U7HB 4OS7A 3CR7A 1ZTJA 4H4FA 2QP4A 2BD7A 3CNLA 3TSZA 3FZZA 3ZZ7A 3QKRA 4IDNA 1YE8A 2OCPA 1E1RD 3RLFA 1LDTT 1HEIA 4Q4AB 2ZE8A 1Q1QA 1O34A 4RI0A 1IY1A 1D9IA 2V6JA 2W2TA 3AUXA 2HEIA 3E90B 2BLOA 4CVNA 3QEJA 3GISB 4GPGA 3RU4D 2H9EH 2FESH 4RD1A 3M36A 1CKEA 1FTNA 3OEHA 4TWZA 5DSZA 3SBDA 1N6HA 4GNKA 3U9AH 3EWSA 5SZKB 3RDPA 1SHYA 2P5SA 3TRFA 2A1DB 2ORWA 3GDUA 4CHAB 2F9UA 1P2NA 3FMOB 2JH5D 3AF3A 1HE1C 5KDDA 1PQ7A 1W1WA 4I8JA 3NHBA 1OXGA 1N5KA 2PSYA 4ISHH 5A09A 1SFQB 4JLJA 1WDTA 4KCGA 4DJTA 1W5SA 4WMFA 2D06A 4GSOA 3KJHA 4C0SA 4I32A 3R7WA 4MDEA 5LB4A 5FPSA 1GJDB 2QSYA 2XC5A 4XH9B 3UUZA 4WIAA 1TB6H 2QMUA 4QNRA 4BZXA 1DT2A 4DBLC 4JZEH 2A32A 2O8MA 1D2EA 1A5HA 5EE9A 3CX7A 1GDNA 1KTSB 4Q9HA 4OK3A 2BMDA 1C1SA 3RXUA 1RRGA 2D1JA 3E3TA 2W83A 2O5VA 1YKSA 1LVOA 1XCGB 4CREA 4GP6A 1KYIA 3PQCA 1Z5ZA 2WIAA 1AUTC 4PROA 1ZIPA 3BEFB 4Y6DA 1TPZA 1J90A 4UNSA 1JR3A 5CLQA 2BHRA 4E7RG 1L1NA 3AGQA 3AVZA 3UMRA 2VVUA 2GJSA 1E2KA 4KODA 3LBIA 1GHXH 1U0HC 3Q5EA 1EX6A 1TQ2A 1BYUA 4IVRA 1VITH 1W0KD 4EKDA 1P8VC 2CE7A 2BBWA 3IGFA 2MSCB 4IMQA 2YC2C 1Z71A 1HJ9A 4JBYA 2WMOB 4IFEA 4RSPA 1TUIA 3CWZA 3SNCA 2ZU4A 2Z9KA 1KDOA 2QPOA 1W4CA 1LS1A 4F4JA 2UUFB 1CBWB 2WSSD 1CIPA 2C9CA 1LV7A 1RRKA 4ZMAH 2IL1A 1YPGH 1CGIE 4NA8A 2OCBA 3ADDA 1Z6XA 4V02A 4YMVA 4MVNA 5KSPA 3U4QA 3QKRB 3MOCA 2PFEA 3DT0H 3PVSA 4LHWA 5DHAA 4F49A 1BMAA 3K70C 3OAAA 1UK4A 2ZG0H 1KSGA 1AS3A 1FJSA 1LPKB 1VR1H 1UTPA 4C2TA 1YPEH 1JNYA 5DN6D 1OB5A 2ZRMA 2ZDLA 4FWTA 2ZFQH 1UHBB 3RXBA 3M5NA 2Y82A 2R9VA 1OYTH 1XB2A 2FGKA 4ZDIA 2NU2E 2J0UA 3VR6A 1OXSC 1QRZA 3KQDA 1J8YF 4HAWA 1Y3XA 1FUJA 1YZQA 2IWRA 7LPRA 4DDUA 1YCPK 4MITA 3ZZ8A 1J17T 4OS5A 1G2LA 3Q3YA 4WVPE 1E3MA 3CH5A 1F0SA 4OQMA 2DBYA 3GY3A 3EE0B 5SZJA 1D3TB 3TUZC 2J38A 1P3EA 3QKSB 2G55A 3OTJE 4NCHA 3ETLA 5C5OA 4FU7A 2BVNA 3SUFA 3B85A 1FX0B 1E2PA 1E4VA 2LNCA 1A4RA 1RYFA 3KCGH 2EC9H 1M7GA 2RGAA 3TVTA 3TSWA 3RXCA 4PZZA 3X1XA 4AORA 1O3EA 1KMHB 5H1YA 1J15A 1BTUA 1KNQA 1QGFA 1AHTH 1PPFE 4JSYA 1ELAA 1LVMA 4UE7H 2FI5E 4WZ6A 1Z07A 8OHMA 5HE9A 3FPAA 3C16C 4XVRA 1SLXB 4QJ5A 2WVJA 1MO5A 1GKUB 1LVYA 1IQMA 1KI6B 1ZM9A 3SJ8A 1SVWA 4A2WA 2FZZA 3PFIA 3ZV9A 1WRBA 1GZSA 2JDIA 4AKEA 3BH0A 2R6CA 3RU4T 3VNVA 1YR8A 3V7TA 4DDWA 4F4IA 2XWAA 3SHCH 1W47A 1QTFA 1J9CH 4R2HA 2OC8A 4U5XA 1P9NA 4PAMA 1OFHA 1C1PA 1THRH 4PANA 3RS4A 4B1TA 3SI4H 1MRSA 1NC6A 1AIXH 1Q1BA 5HKKA 1GBJA 1TUEA 2QAAA 3P20A 1AN1E 1S84A 2WAXA 1KDQA 3TIUA 2QTHA 2J7PA 4RZUA 1CE5A 4ZXYH 2F9VA 2WV9A 2FN4A 2IYUA 4TSFA 1C2DA 5JCPA 4XWKA 4B44A 4D6PA 4DOQA 2RA3A 1MKWK 2B7DH 2WKPA 1FQ3A 3SORA 1YU9A 2OC7A 1JR3D 1ODFA 5E0JA 3RWMB 1TAWA 2H9HA 5F9HA 3BB1A 1GHYH 5TXGA 1HT2E 3THYB 5K8TA 3C7KA 1NFYA 5TB5A 1C5RA 1G36A 4V0KA 1GOTA 2GVFA 1RFLA 1R4AA 3MO9A 1IXSB 4TY7A 1HGTH 1HUTH 2QZ4A 4K69A 1S3GA 1OE0A 5FOVA 1T91A 4IFBA 4WH6A 2NQ2C 2BJVA 1GBHA 2IS4A 4D9QA 4YT7H 1NVVQ 3OHMA 4HFPB 2GJ8A 2R9PA 3SNAA 4XWOA 3ZLJA 2A3RA 1BOFA 2BMFA 1IY2A 4XJXA 2FOGA 4EPXA 1HFDA 4LRWA 4AIIA 4LHYA 1QDEA 1TOCB 5L3QA 2ZJYA 1YPHE 2GDDA 2EI7A 1O5EH 2QBYB 1DO0A 4P4SB 3ZQ6A 3SYJA 2HLCA 2J9NA 4NZYA 2BY7X 4B48A 3ZVCA 3SUEA 1E0JA 1CT2E 2XZPA 4Z54A 5T1VA 1GVKB 2LKDA 4MRRA 5JECA 2XXAA 4US0R 4AG2A 4NIXA 4IMZA 2NU1E 1Q44A 2BEKA 3GLIA 1C5LH 5FPKA 3GLGE 4G3XA 1OW3B 1Y3YA 4OM9A 3ITIA 5TDHA 1G6HA 3LBNA 4PO8A 1KOFA 1MQ6A 4OI4A 4N0EA 3RXIA 1BIOA 1LHDH 2AWNA 4PPNA 1E9RA 2PKSC 4M9XA 2HYDA 1MCTA 4E7NA 3HPRA 2J0QA 2ZVQX 4FN5A 5KYKA 1M2OB 4ABFA 1VCOA 2BDBA 3K0CA 1TEVA 3RXAA 2IEYA 1SQAA 1MQ5A 2WWIA 2GAOA 3S0NA 3TNTA 5JRZA 3LC5A 3KIDU 3M35A 1AZZA 3B1ZA 4B3DA 1W36D 3PTNA 1RIWC 5TCAA 2ZJOA 4BAHB 5DP8A 1IHSH 1GJ4H 2IJOB 3R3GB 2YINC 1KIGH 3VPKA 4A9AA 4M1WA 2HCJB 4NA7A 4I99A 2VGCC 1E34B 1GRNA 1P2VA 2VNTA 1P9SA 3EPJA 1QBKC 4ABEA 2QQEA 3F1SB 2ZPRA 3I32A 2A5FA 3F9FA 3ESTA 2VIPA 1YGCH 3H09A 1ZZZA 3PTBA 1AB9C 3RU4E 5K8LA 5FR1A 3HU1A 2XZLA 3EA5A 1OIWA 2ZU6A 3SJAA 2ZI6A 5EOKA 1G19A 1NN1A 5FX5A 5FOWA 4BGDA 3CRRA 1E0KA 4BLRA 4GAWA 2IYLD 1E2HA 4LJ8A 3GFOA 3U3KA 3QXJA 3SHAH 3SV8A 2FPKA 1KJWA 2FNAA 1I2MA 2XAUA 2LCFA 1DPFA 1GJCB 1O5DH 2FU5C 3UFAA 1UKYA 5HZKA 1GWNA 3B13B 1Z6GA 2GZDA 4U02A 2ZIAA 2ZSBA 1K1PA 2F1IA 1DG1G 5C67A 1YZUA 2ZU1A 1Q1ZA 1XTSA 1II9A 4G5RA 2FI3E 1QL8A 3KFXA 5A0AE 2ZRLA 2FFQA 2AR7A 2RMKA 2ZAOA 3VR2A 2GK7A 4ARZA 2FOAA 2F83A 3KQEA 3BD9A 4WOPA 1Z0IA 2HNTE 4Q4LA 3X1WA 4AFSA 4FI3C 4MYUA 2AD5A 1NRRH 1XD9A 2O8BB 2Y7ZA 2AKAB 1FPCH 2QAGB 4TLBA 2J59A 2O8FB 2JASA 3NCLA 2ZPTX 3IUYA 4OS4A 1KK1A 2PBRA 1Y63A 3K9XB 4EDHA 4Z8XA 1VG0B 3T61A 5JEEA 1O5FH 1TNGA 2HGTH 1P05A 1Q12A 3A1WA 2W2XA 2PZFA 4ZH8A 1Z8JB 1DANH 2YC4C 3RUOA 1LHEH 3SOSA 3VXEH 2WMNB 4B33A 3BOSA 4C0JA 1Y59T 1AGPA 4B6EA 4HLUC 4PPGA 4KO8A 5IRCD 1SL3A 2VYFA 3KQBA 1J2JA 2CHGA 5A4JA 1X3SA 1U94A 1F92A 1GMCG 3AW1A 1UFQA 4NMMA 2CJWB 5JSZB 2QM8A 1EWRA 2HALA 3LLUA 3QPWA 2BKUA 2FI4E 3K2UA 1T3SA 1EPTA 1ZR0A 4DUGD 2RGDA 4X0WU 1VCWA 2Q0HA 5JPMH 3SGBE 1NRPH 2ODPA 4KTSA 4OI2A 1ELTA 2W58A 1P0SH 5K8IA 2ZTXA 4DEXA 4NZQA 4DW2U 4C0QC 1P03A 1WQVH 2UWPA 4AFQA 3GPLA 4EPVA 3BV9B 3BTWE 2XOKA 4LJAA 2AGEX 1KO5A 1O2TA 5DJ7A 4PO9A 4YDHB 2P67A 4ZDKA 3WBJA 1M7HA 3QQ5A 5AUPB 1GAJA 1OS8A 1K1LA 1PQAA 1KGDA 1BZXE 3IHLA 4LUCA 1WUNH 4XD7A 3RXEA 1KXBA 2KI5A 2YHSA 1R0YA 1C5NH 4D4JA 3VX4A 1K1JA 2XTNA 5FUVA 4UQOA 1ANCA 3RS7A 1P6XA 1II0A 4X2VA 4FVBA 2WAYA 5EPYA 4D7GA 1E2JA 3ZZAA 2VEDA 3SZRA 3F68H 1T8NA 2CHAC 3GYLB 2FEOA 2KAIB 2PX3A 5FPHA 1Q3HA 4YMTA 3RRYA 1ZM4A 5JWOA 1CBWC 4DGJA 4XBBA 3LX8A 1YCPH 1NTPA 1G9XA 5E7IA 4MRVA 4PXAA 3MWYW 2XWBI 2XX3A 4UXIA 2VGCB 3WMEA 2WPIS 2O8EB 1E1QA 1ZNXA 1DY8A 2VP0A 2D7CA 5TARA 1SGRE 3W8NA 9ESTA 2BDHA 4WZAE 1QHHB 3W6PA 2OCVB 1Z0AA 5HE8A 1GGDC 1V43A 1NY6A 1M8PA 3ASZA 1QZXA 2ZI3A 5KOYA 1V2WT 5FUYA 1V2LT 4DLYA 4P0TA 2QXGA 3QNUA 2A5DA 3MWLA 3DL0A 3A80A 4A6XA 3DA9B 4B71A 4UDWH 1MBQA 1O2ZA 4POAA 1J14A 1XXHA 2ANKH 2Q9AA 4X8UH 3THOA 3EZFA 1J8AA 5J4KA 1HAGE 3QGJA 1E9DA 4EFNA 2P3SA 4JS0A 4FMCB 3A88A 3G01A 1SC8U 2I6SA 2EVWX 4ABYA 2ZJAA 1GILA 4D0LB 5UKDA 1W14U 5HCNA 1UAAA 1SVIA 3SYLA 4GL2A 1HV7A 4ZXXH 1Z08A 2OC1A 2YOHA 4LYHA 3SJOA 1ZUHA 1G5RA 3B5JA 1AS2A 1SGFG 4L9SA 2VWLA 1XTKA 1OF1A 4FCVA 1HIAB 3TITA 2FG5A 4CRFA 2ZJ5A 2NPFA 3CENA 1Z63A 4K5ZA 4MPUA 5G53C 1KKMA 4LOAA 3RXQA 2SGAA 2XB2A 1A5TA 1O3DA 3B82A 2ZI4A 3F8TA 3NC0C 2ZFRH 3KHVA 2ONJA 2FFAA 3TAHA 4Y8YA 4IDQA 1QF9A 4ZKOU 1R5OA 4MPVA 1J8MF 3RMMH 5DI3A 4N0DA 1U81A 1TGSZ 4GP7A 2PCLA 2K1QA 1QG4A 2OHFA 4OS1A 2XC4A 4US1R 2BDAA 1SVKA 4ASUA 5G4BA 1QL7A 2ZNKH 1CO7E 3R7WB 4J1YA 521PA 1SGIB 1G8YA 1XUGA 4EPTA 1U8AA 5GXPA 1S0RA 2P6NA 2OK5A 3KB1A 3LONA 3AVYA 1SGWA 3M3SA 3U6KA 5GPIB 1FZZA 5E7JA 4BZQA 4OJQA 4ABIA 2P16A 5DNYB 3B7GA 3EAQA 1OPHB 1R0ZA 4JJKA 3AF0A 2C95A 3F3YA 2A0QB 1N6LA 2L0XA 4M1SA 4CH2B 4HUQB 4Q1FA 2RHMA 1XMVA 2OUAA 3GLIB 1Q2WA 4B2AA 2UKDA 2M5TA 3U7FB 3JZ2B 2Q9BA 4NYJQ 2QAGA 3KUDA 1V2JT 1PUJA 4JYVH 3EPLA 1Y3WA 4DSNA 1O3GA 3MMPA 1DVAH 4U7DA 2PJRA 2Z9GA 4Y0VA 3K1JA 1DBSA 2G52A 2WBLC 1P9UA 3H2YA 4DT1B 2F9NA 2IS2A 2DE9A 2QMHA 1S0UA 1P62B 1C9KA 2BD9A 3WHKA 2UWOA 3SQWA 1ZTKA 2EYUA 2V3HH 4GMDA 1L2EA 1C1YA 3LC3A 4MNXA 3SV2H 2XOKD 2ZRBA 3V4RA 2JLXA 5ETXA 5B30A 4ERNA 4K60A 3AKEA 3FWYA 3A8BA 3AVWA 1DPOA 3VB4A 4S2EA 1TMKA 1TRYA 3ZVMA 4EJSC 4Q66C 3VU9A 1NZQH 3SU4A 4Q18A 4HB0A 4KP0A 4NKRA 5JI2E 1OSNA 3AP3A 3T29A 1AE8H 3AP2A 1T5LA 3KTAB 5J47A 1IQJA 4GZMA 4FUCA 2J46A 2ZRKA 1PPGE 1NP6A 3QKTA 421PA 5TMPA 4BPBA 5AFYH 3UY9A 2Q6DA 2ZETA 5IK2D 1FMLA 1IM2A 3U5ZB 1GTVA 1C5PA 1OV4A 3M37A 2HYIC 1G8PA 2Y81A 1G64A 3ZVAA 5HXFA 1DAMA 3KF2A 1VYVA 2GT7A 3SU0A 3EZ9A 1RXPA 2NG1A 2J0SA 3A58B 2EI8A 4IC5A 3NWJA 1MKXK 4RZ3A 1THSH 2JAQA 4RN6A 1G16A 2G1KA 3DM5A 2RCNA 1MTNC 1E9FA 1TNIA 2BOKA 1HURA 3LH1A 4K81B 1FOEB 1MTVA 1G17A 1DWCH 1KYNA 2HNTC 4HB2A 4KFTA 1QHRB 3M4YA 3RDZA 3VFEA 3ZVFA 1XTIA 1ZGIA 4PHHA 3LIWA 1WU1A 2AH4X 1GHAG 4HLQB 1CULC 3S7HB 4JKIA 2P6UA 2Z0MA 1EZUC 2G81E 4IXNA 1C2MA 4PC7A 1ANEA 1AU8A 2HT1A 1T0JB 4EFMA 1QBNA 5DG6A 3LWNA 1P61B 1MCVA 1GL6A 3G5UA 4DEYA 3ADBA 1EXFA 1TGCA 3G82C 2W6JA 4AFUA 4X8HA 3AVOA 2H2ZA 3N7OA 1DITH 3WMGA 3L6PA 2O0HA 1K8RA 1IJFA 4QM6A 4BECA 4NTZA 2CJIA 2SGPE 1XXFA 1SHHB 2MSDB 1CVWH 4A8JB 2ASEA 1V3XA 1HIAA 3GICB 3FMFA 3PV2A 1IN4A 3B78A 1QHXA 3SE0A 1W11U 2OFXA 3THYA 1QR3E 4L9WA 3TGKE 3VR4A 1C5VA 2O8CB 5GVRA 4M22A 4ZCLA 2GMTB 3KFVA 3KQHA 3QY0A 1RRFA 4ABGA 1K1NA 3PITA 1UVTH 3K9NA 3QXCA 3DEFA 1O2QA 1Q1EA 1T31A 3HYTA 1G3CA 3FDIA 2AS9A 3GCHB 4LJ9A 4PTLA 2IN2A 3BG4C 1D2MA 5EXSA 3IIJA 3V0XA 2IEZA 5FBWB 2OXSA 2O8DA 5EPNA 3KXKA 1QBOA 3CM0A 4MUBA 2NU3E 4AGJA 2AK2A 2ZUDA 9LPRA 3I62A 4WXRA 1XX6A 1P57B 1T8UA 1FNNA 3OU0A 3GEEA 2RA0A 4KTUA 5CITA 3FMIA 2G6BA 4TMVA 4XTCS 2JJ1A 1C5XB 1C2LA 2QY9A 3CONA 2V9PA 1DO2A 1AS0A 4IHQA 2A4GA 1K6MA 4URZR 2Z43A 4LK2A 5KSZA 2OCAA 1A61H 2TPIZ 4DURA 2BD3A 3CWQA 5ANRB 2FTLE 1FNMA 1FMJA 1NLYA 1EPTB 2IX3A 2GBLC 5DGXA 4I1SA 1TNJA 1JPNA 3S7KB 1O2YA 4AG6A 3OTPA 2G8TA 1YC0A 1FTSA 5FTKA 4Q1BA 1FMGA 4TL7A 4KFRA 1ANKA 3UWJH 1Z0JA 1R0WA 4C9BA 4L8GA 1W10U 3DPUA 1CT0E 3MHWU 4QOSA 1YZTA 2YNMA 1LHCH 1WXQA 3VKGA 1TNKA 1DLEA 5FPYA 4LYAA 4QBGB 2WM9B 4AB8A 1YPKH 1O32A 1GBCA 1WSSH 4R2IA 3QOFA 4MTBA 2SHKA 4BEBA 4I8HA 1O2MA 3TJUA 4MQBA 1OP0A 2QCYA 1GRQA 4D0NA 1TEXA 3Q9LA 1GI8B 1QB6A 1IN8A 1VKJA 1XJ0A 1BJUA 4O25A 2XGJA 1DAHA 3GCTG 3MYWA 1KY3A 4QBIA 4O3MA 2V7QD 2PZGA 2OTVA 3B8HA 3TGPA 1BBRK 1QRWA 1CHOG 2ANWA 1C2KA 2FLBH 1IBRA 4HI0E 1ZP6A 2GZHA 5HKKD 4JLVA 5B58C 1GJBB 4LJ7A 4M1OA 4KVGA 2WJHA 2ECKA 1JBUH 1DXPA 3KJIA 1S0QA 2ANMH 2WPJS 4AURA 5BRRE 4Q9KA 1W3CA 1ZGVA 2D3WA 3ZVRA 1NG9A 1O3IA 1IOZA 2BHGA 4IW3B 3GCNA 1JIMA 3R0FA 4U2WA 1ZIOA 4XSGA 2F9MA 5EXPA 3ZVDA 3SU2A 1GI0A 2IOTA 3RNLA 1P2TA 2ZI2H 4FWIB 1W48A 1EOJA 1YVDA 1TNDA 4Q1CA 1D3PB 4R8TB 2Z4SA 1J16A 1D8TA 2SFAA 3M5LA 1UTLM 5CMXH 4PHFA 2BBOA 4Y71A 3SI7A 1XUJA 2LPRA 1BO6A 4I33A 3RS3A 1GUAA 3CF6R 2W2VA 3UATA 1TQ4A 1K5DA 2JLSA 2CBZA 4TTRA 5AK0A 2ZC9H 1S2MA 1NU9A 3RC3A 1OPXA 2TGTA 3GJ5A 4Y7BA 5L3VA 3P32A 2YNBA 3MD0A 3PWCA 1LTOA 2ZJ2A 3MUFA 3RC6A 5CIQA 1O2HA 1KAGA 1GJ7B 1PFXC 1BH2A 1OT3A 2XITA 1VITG 4LI0A 2O0JA 2QENA 5FR2A 1ZNZA 2P3FH 2QN5T 2Y7XA 1ZD1A 2ZFPH 2BY9X 3BERA 1UTMA 5FOSA 1XKBC 5DP3A 1BOQA 2JCSA 1AKEA 3M6AA 1XZPA 3SEAA 1BKDR 4B32A 5F98A 2ANCA 1O3MA 1MABB 3EA9A 1Y5AT 5B6LA 4OQLA 2C8WB 1ZU4A 5T6GA 4CHAC 3AVQA 3RMLH 2JIZD 1U0JA 4PR0A 4ZKEA 2ZQ2A 3CS0A 1VHTA 4DSTA 2Z94A 1Z2AA 4C0LA 1RJXB 3W95A 3LGYA 4MNYA 4II7A 4NFEA 1Z8GA 3C8UA 3FB4A 2AMPA 2UUYA 5FHTA 2GV7A 3RAPR 1DXWA 1V2QT 1BMMH 2BOVA 2G5NA 3R8CA 8ESTE 1HRTH 2QTFA 3VB6A 4BXWA 1ZU5A 2DFLA 3I78A 1T8LA 4QG7A 3UR6A 4AG5A 3U3MA 4X2WA 3NPSA 1Z1JA 1KAOA 2BD2A 4D25A 2D2FA 2THFB 1QHSA 1PPZA 2ZDAH 4LPSA 1E9BA 5D3MA 1HAYB 4D81A 2A7CA 2HPPH 2H57A 3TAUA 5T3HA 3BTME 1LO6A 3FGNA 4TYQA 3CX8A 1P3CA 5C18A 2ZVPX 3U1JB 1F3OA 1MU8B 3HYRA 2F9PA 4Q4AA 1P10A 3EARA 3K65B 2QT0A 5G3ZA 3VX3A 2XXAB 4ZIRB 3U7GA 4GI7A 2O8TA 2GHIA 2ZHDA 3T28A 4PX9A 4DWJA 1NFXA 3A36A 1HBTH 4NSVA 3FE2A 4AI6A 4SGBE 5DPAA 2XXLA 5CM9C 2VP9A 4QNMA 5HCIA 1VYTA 1AY6H 4OBEA 3ZYDA 2HNTF 1JRTA 3RMOH 4P4SA 1MTWA 4D26A 4A6LA 1SFIA 1LF0A 3TLOA 2Z3CA 1AMHA 3U8OH 1Q57A 1SGCA 1AE5A 1MBMA 1TPSA 2ALVA 4M8NE 1FY1A 3O8RA 3NEJA 1F5NA 4QL3A 1E35B 4KYIB 1C9TA 2J92A 4DC9A 2AD1A 5BYKA 3EYDA 2GXAA 4LJ6A 1E99A 1AVXA 2F91A 2ZRFA 1OYWA 3KNXA 1II8A 4AG1A 5GNDA 2BVXH 4LXBH 1CA0B 1EZSC 5PTPA 1MZDA 3L43A 4Q9JA 3TBKA 4WBSA 1W46A 1SGTA 3A8DA 2NZJA 3MU0A 4ASHA 5FL7A 2D26C 3Q8XB 3GLHA 3BTTE 1KDTA 4NHOA 1WAYB 2BZ6H 4JBWA 1W8BH 3MWJA 4X8TH 1GL0E 1ETUA 5FBRB 3PV5A 4EQ6A 3LAWA 4HZUA 2QSZA 2ZSEA 1O5CB 1XUFA 2IF2A 5FCRA 4XE4A 4V0OA 4Q19A 1FP6A 3QF7A 1YYY1 4KGAA 2JA1A 3GJ4A 4WF8A 4M1YA 8GCHF 2N46A 1O3YA 3IIKA 3A1UA 1SGPE 1NI3A 1OIVA 1YZKA 1V2VT 1NRNH 4DLXA 4BFXA 3R9WA 1IXRC 2C4FH 2H1LA 3MLEA 2V7QA 3BS4A 2WKQA 3WY8A 1LKBA 4O9VA 3VHXA 3LO5A 2DFKB 1O2NA 1SG8B 3RANA 3OY5U 1GDQA 2DCUA 2FSGA 5JHGB 4HLUA 5LPFA 2PLFA 2PKSB 2G0NA 3PUVA 3MJRA 2PJZA 2F4LA 1HYLA 2A7QA 1E98A 3TK9A 1W36B 5CE1A 2FM2A 1ZMXA 2R62A 3E0NB 1E2LA 1F2TB 4QT8C 1RKBA 1TRNA 5DK1A 5E7MA 2FFHA 1O3LA 1ANDA 5FUXA 4YESB 1GITA 4RD2A 3A7ZA 4LK4A 5DKMA 1GVLA 5LBIA 4E03A 4X6OA 2ZR0A 1LVBA 1MOZA 4ZPXA 4BFVA 3E1SA 1FY3A 1MTUA 3O8BA 1Z6TA 1XFAA 2AKYA 1G8FA 1V2RT 2XCFA 3V12A 4X1RU 1DICA 4HLDA 1KMQA 2OM2A 3I4LA 1DAGA 1FI8A 3M5OA 3GOVB 1EESA 3D8BA 2BD5A 2ATVA 3H1TA 4X1SU 1C2EA 2WTUA 4RY2A 3LH3A 1QJ1B 1S96A 5IT5A 3NXSA 3PENA 1N6YA 4JLPA 4H6TA 2H7VA 1G3IA 1LTQA 1K21H 4RFSA 5EP2A 3BAFA 2A5GA 5J4QA 3RABA 5CJPA 4FVDA 1G3DA 4RCYA 821PA 3K0SA 1N6IA 5AJVB 2CL0X 4HZUB 4B34A 4M7GA 1ZHMA 4A0FA 4DLUA 4JKYA 3ZGXA 2ZWLH 4FUHA 3GY5A 3A8AA 1E2EA 4MQAA 3RLYH 2DB3A 1ZRBA 1SXJD 4TWYA 2ZRHA 1E2GA 4V0LA 3SNBA 4Q00A 4XTRA 2ZM5A 4RKFA 1GI4A 3GMTA 3HGPA 2AMDA 1DADA 3TSOA 3C27B 1XMJA 4NCKA 5GJCA 3BN9A 2DWOA 1HJ8A 3BFXA 1U99A 2KAIA 1WBDA 4B3CA 2WPLS 1PPHE 1ZMLA 3QENA 2IYYA 1ZOMA 5BQ5A 4JZKA 3A6PC 3DD2H 1V6DA 1HV8A 1QQ4A 1P3JA 4ABJA 4DY7B 2ZKSA 2V35A 4JYUH 1QQUA 4X1QU 1C4U2 1WMSA 2O8FA 3BFVA 1WV7H 1KI8A 1IQPA 1NS3A 1JECA 2ZZUH 3UK6A 3ND8A 1Z6EA 1YRAA 3GLHB 2O8BA 3E8LA 2PGQB 1UTNA 2ZGBH 1E1RA 3K0EA 2BQ7B 2C93B 2BYAX 2OV2A 4JMYA 1SQTA 5J40A 2SNWA 5EODA 2JLUA 4XBDA 1W0YH 2OBOA 2V4ZA 4MNVA 2I1VB 1GSIA 1TNLA 4IJMA 1FY8E 2GXQA 3Q76A 2NZ8A 1CJVC 2OFOA 1E38B 1DWEH 4BTUB 1YPMH 1HAXB 2QPAA 1LNZA 1SMFE 1LW7A 2XNIA 3IQWA 1KXDA 5KNBA 5JHHB 2GEUA 5JB8S 2OT3B 4HAUA 3S1AA 1UVOA 2WSMA 4ISIH 2ZRPA 4RFVA 3SJBA 2G51A 3AVVA 1NIJA 1OH7A 4XVQA 5FBQB 4IDPA 5E4FA 2WPMS 3OFNA 2DUCA 1P12E 3QUMP 4YM9A 3WYFA 4JCNA 1FQJA 1CBUA 2JIZA 1CGHA 3ZZ5A 3QIAA 3L8ZA 4M1KA 2IYQA 4DSUA 2GV6A 4IRUB 3EZ7A 5B64A 1G20E 4JK6A 1VG8A 1MD8A 2XW9A 2IHYA 3GJ7A 4KVAA 3TJOA 1Q20A 1O2XA 3RXGA 4DLWA 2AIQA 4BLSA 1FP7A 4CF7A 3DVLA 1W44A 1HNEE 3HK6B 2QA5A 3ZJYA 1IN6A 3B9PA 3RS5A 1UCYE 3I5YA 4CYMA 1MAXA 1CJUC 1A1VA 3LGIA 1YLDA 3SGQE 3SUGA 1KDPA 3SS8A 3GLHE 4Q4HB 1UBGA 4DCDA 2PUQH 3EIEA 1AGJA 4DIDA 5AJWA 1D5CA 2GMTC 1K22H 1XPOA 4C4PA 1WOFA 4DUGA 1OYYA 1KDRA 4JLDA 3Q77A 3U6BA 3C15C 1TQDA 2ZR9A 3P8NA 2J7PD 3BTKE 4IS5A 1E4YA 1W12U 2A4RA 2VIQA 4RJLA 3U44A 3DFLA 1IQNA 3EC2A 2K5UA 3VB3A 2RCEA 3CRMA 3R9IA 2CHQA 3CRVA 1X8KA 1WQ1R 1BMNH 1GHBF 1T7CA 4IBLH 5IDKA 5H8WA 4ABAA 1T9HA 4KTCA 2UZIR 4LV8B 3ONWA 4ZKRU 3KL6A 4UKDA 2PX0A 2J1LA 1YLCA 1G3QA 2VHCA 2XJ9A 4JLKA 2BC9A 1NLZA 3RHFA 3AB3A 3M61U 1CR0A 5C3NA 3IITA 4MKIA 2WUCA 1BIFA 4D82A 4GHQA 1LCYA 4B3GA 4H6SB 1TPPA 1UTOA 3S9AA 1OWJA 3QTVH 5FOTA 4B3FX 1C1NA 3CR8A 1EZXC 1BRCE 4OKSA 5CM8B 1MAYA 3ICEA 2JETC 3AQ4A 3THXB 1L0ZA 1RW4A 2HXSA 1EUFA 1JXPA 3VGCB 3GFPA 1RRCA 4OHYA 5DP4A 1SBWA 1Y3AA 3P92A 3RM2H 1YPHC 3RM0H 1EFCA 3KQNA 1P11E 2ZSDA 3N5CA 3E1XB 4CR5A 3FKQA 1M6NA 1UBEA 3RRMA 3LQQA 3TUIC 3T26A 1G3RA 4NE2A 1E9SA 1YR7A 4YT6H 3LGTA 5T6DA 1PUIA 1Z0FA 2QRNA 3KTAA 2AMQA 1NRJB 1J99A 2HJGA 5FI1B 1GKYA 4IOKA 3TH5A 1R5BA 2DWQA 5BW8A 3NC1C 3AEZA 1CR4A 3ATWA 2VP5A 4KYUA 1TIOA 4ZIRA 1RPZA 4YZUA 2ERYA 2PGBB 2QRZA 2EWWA 1JI0A 4HB3A 4W5HA 2XBWA 4BAMB 4Q48A 3K9LA 3MFJA 3F9HA 4FUEA 2WPDA 1GBBA 4HAXA 3TJNA 2ZCKP 1OFIA 1EFHA 1SLWB 4FD2A 2NO7A 2QC2A 3IKJA 3NBFA 2Q3HA 1P2MA 3RC4A 1FFHA 1ESAA 2H17A 4NYJR 1N6PA 1D6JA 1G3MA 2G83A 2QE7D 1SOTA 4X1NU 2IK8A 1JQJC 4KV9A 3VU9B 3L8YA 1E37B 2DY1A 1DE7H 1Z8RA 2QF3A 4AGKA 2C9OA 3MU5A 1XCMA 5FX6A 5JBAS 1KI9A 1KI1A 2FMXA 3RXOA 2FA9A 3UTUH 4YMWA 4YDSA 3LQRA 5EP1A 3KJGA 1HAPH 1T32A 3SO3A 3K70B 2HRVA 1TOMH 3H4MA 4WJG2 4PSVA 1SKYB 3HPTB 3E6PH 1K9OE 4U30A 6Q21A 2EFCB 3D65E 3NHAA 1V5WA 1VCQA 1WE2A 1V2UT 1O35A 1JEEA 3QBVA 1RTKA 1G5PA 3ATKA 1TGBA 3QO6A 3PLKA 3AGPA 4EPRA 2CL6X 5ESTE 2XCNA 4Y7AA 2ZEBA 5EXTA 2V54A 1V2KT 4WMEA 4FMDF 2ZYTX 1ZLRA 1ZD9A 3ATIA 4JL5A 2XBYA 2GRJA 3I73A 1NU7B 2B21A 5J4HA 1L1GA 3A7WA 2IYRA 5JYIA 4IOMA 4US2R 4LDJA 5T6FA 1UEIA 4CT4B 4OHVA 3OEEA 1C5QA 3A85A 5E3HA 1AN0A 2C78A 3AUYA 3VEQB 1GVNB 3WYGA 4EFLA 4TMTA 4HDQB 1Z6YA 1HAZB 2TBSA 2OCYC 4M9SA 4DLTA 2VHTA 1VCMA 1RTLA 3KKOA 3BTDE 1AQUA 1PYTD 4UEHH 4C7OA 3CW2A 1NSFA 4RCZA 4IC6A 3ZVEA 1BTHH 4FU8A 1N5LA 1N6KA 3B9QA 2W0MA 2YWHA 1E79D 4TYPA 3PB1E 3HR7A 2OD3B 3CZQA 4Z1MD 3M7UA 4EPWA 5EE5B 3GY4A 3ZZDA 3PLBA 1W49A 3RXDA 3L0SA 2RH5A 4F4OC 1S9HA 1ZUIA 4W9MC 3KEEA 1HXEH
chains in the Genus database with same CATH superfamily
4PHTA 1JBKA 2FEQH 2D0IA 2XMZA 4BY9E 5FBLB 3S5UA 3T5GA 3FVFB 1ECJA 1JEQB 4IGDA 2R751 3ZZ3A 1WJGA 1FLDA 1FQWA 1XP5A 4G65A 2R8XA 4I1OA 4YCSA 2RH9B 4QD3A 3RS0A 3HQ4O 1O3CA 1JG1A 1Z6PA 2YZNA 1NVUQ 2CCKA 2YZ2A 3EYWA 3OD5A 4LE2A 1RHUA 3JQAD 3KJNA 3RO7A 3UMJA 5E2PA 2E48A 2YICA 3B36A 5CBPB 3EDOA 4ARAA 2BUAA 2DLDA 4IJVA 4KQGA 1E6CA 4MQFB 3N7DA 2BGWA 3MU4A 3V9PA 5J63A 3BG8A 4RESA 1AD8H 1KIAA 3C8ZA 3DWEX 1U2GC 2BM1A 1XBTA 3EGEA 3Q1LA 4H17A 4NYMQ 5CPFA 3W7BA 3BGIA 3HA7A 5GWXA 2R25B 2O1SA 3PQFA 3UG6A 5JSUA 5IM4F 2GJKA 3FGPA 5ENDA 3TLAA 2BKEA 4ZEWA 1JA1A 8GPBA 5EE0A 1QCCA 3LHKA 4DT7B 1SPXA 2Q8NA 3D8NA 3TIVA 1JP7A 1WZNA 1C1UH 2RHHA 3NTVA 2R44A 2W00A 3EA0A 1NKVA 4J4HA 4JENA 4N82A 1E1CA 2NTYC 4LGMA 4HY3A 4YP9A 4CT5A 3ZXIA 1QZ8A 3NBMA 3L0DA 3WR5A 3ZCXA 3K2BA 3QXXA 4WXEA 1IM5A 3R5SA 3A6DA 4YP7A 3E9DA 4G5OA 2P2SA 4MULA 2VU8E 3C1KA 2ON6A 4M4SA 4OXQA 3L05A 3U9TA 1H5NA 1IHTH 4D4LA 1L7XA 1V8PA 2PLNA 4NHEA 5B7NA 1UP7A 2WZCA 1ABIH 3HRIA 3SDZA 4NV0A 2OZEA 4GCHG 3NTLA 3BEIB 5FPTA 3BE4A 4YC7A 2H3EA 1OFGA 1YR6A 4LBZA 1Y3BE 3UREA 3SHWA 4F9GA 2Q4OA 5ICFA 4D3ZA 4B2IA 3FRIA 2WP8J 4FKZA 2HO5A 2VF2A 3OQBA 2VQEB 4NZZA 2STBE 3R5FA 4PLWA 3NXKA 3SX0A 1GYPA 2HK6A 2HW8A 4HH1A 3JU3A 4BO7A 3L1KA 1GADO 4A6EA 4KMRA 1APBA 1D6MA 3NBAA 1E32A 1X9GA 2PH5A 2VK4A 5EKSA 1N6RA 1R66A 1RRVA 3PNQA 2WTAA 2PEYA 1Z5PA 2FFBA 3QE3A 4FBMA 3I2FA 4BKQA 4HDKB 1Z7EA 4ZKNU 3IAM1 5HM8A 4O4IF 3BE5A 2WEKA 3QYAA 5CR9A 4AJNA 2XBUA 2P75A 3EFHA 4LVUA 4URVR 5C37A 1TTTA 3AWDA 1LBHA 4Q3DA 3U1VA 2ZI5A 5AKLA 5IKMA 4N01A 4Q9IA 1EJBA 2PV0A 4ZGBA 1EJ0A 3WTBA 3LXUX 1BD4A 4B5KA 1UZMA 3I5UA 1GI5A 1NVBA 3L8HA 4GMHA 3WFIA 3TL3A 3OTOB 1Z5VA 3U28C 2X4DA 4E07A 4G5QA 2BR5A 1FDTA 4NJEA 3NDBB 1UDAA 2QNRA 3P0JA 2GZSA 2UUJB 4AIRA 4CKCB 4H9GA 3D5EA 4RH3A 4O63O 3P2OA 3WYNA 4CUJA 4CW7A 2XIQA 4G4JA 2FE4A 2JD1A 3CKYA 4DKJA 1FP4B 3MWKA 4LTMA 3CHYA 3KYDB 4O2BF 4XQ9A 2H31A 4OFWA 1WPGA 4IINA 4KFSA 5ESRA 3B38A 2GT1A 3PE4A 2NIPA 4HV4A 3NRJA 5IJ9A 3QMPA 2IY9A 2Z5LA 5K09A 1C9DB 4KR0A 3LU9B 3SQXA 7KMEH 3UNSA 1ZL0A 2WYJA 3QEOA 2E2WA 2VHQA 3QYJA 2H5IA 1PLLA 3F7MA 4PG6A 1EXNA 4AYXA 2ZRCA 4B1FA 4BGIA 2JIBA 3UK7A 2VRCD 4DUZB 3TLGB 2ZHEH 2VJYA 1JL3A 1CWUA 2BKAA 2XRMA 5DLEA 3K6SB 4ZHQA 3PHCA 2XWPA 3JWHA 5DPM