4B76A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
total genus 211
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b76A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b76A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b76A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b76A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b76A03
1G3IA 2BDAA 2FX4A 2SGQE 1TGCA 1NLFA 1KI4A 4ZDIA 3ATKA 4X8SH 4CRCA 2ZRMA 4X0WU 1GVZA 1WQ1R 2OCYC 2NTYC 1Q3HA 3N2IA 3I61A 1PPHE 3CKLA 4B6FA 1ZJKA 3E16B 4JZIA 1D6RA 5DISB 5CMXH 2BZ6H 3B1YA 3WNCA 4L16A 1XTJA 4F4IA 3KQLA 1LVYA 4IC5A 2QPAA 5BN4A 2VVUA 1E2LA 1XCPA 3EYDA 1QIXB 4XVUA 1OKKD 1GSIA 1N6HA 2IJOB 2Q6DA 2ODQA 3IIKA 2K1QA 4XDEA 4KV9A 1FZZA 4LYJA 2Z6VA 4GZLA 2R2AA 1BCUH 1MKYA 3KTAB 4AWXA 2CHVA 4XVRA 3ZIAD 4HB0A 3MJRA 4RKOB 1XPRA 1HYLA 1S85A 2J46A 3ZJYA 4LK2A 2AGEX 1BS1A 3K09A 3D62A 1KXDA 4XD7D 4E09A 5IRCD 3RUOA 1ETSH 1XEFA 4QGFA 3VR5A 2FPLA 1E79D 4KFTA 5L3QB 2A1DB 1RVDA 1BRCE 1LY1A 1ELOA 3DZDA 3TH4H 2HDNB 3PQCA 1GDDA 4BFWA 5CDFE 2SGAA 2BEJA 1SXJE 1TBRH 2UWOA 1CKEA 1GGDB 1TPAE 1Y59T 1M7BA 1O3CA 2P5TB 3ZGXA 3EC2A 4TL8A 2AIPA 1R0ZA 3U3JA 4IXMA 1W4CA 3EWSA 7ESTE 1C4Y2 1J99A 1YPHE 4NA9H 2R3YA 2IC5A 1TTTA 3UKDA 2BXTH 3PROA 3RU4D 2ZTXA 2ZFSA 1H9HE 2GCTC 3ZQJA 2ZDAH 3LH5A 2H57A 3A81A 2GKVE 5KYKA 1ANEA 1A1VA 1C5WB 3MU1A 4AG1A 2ANMH 3S7KB 4IXNA 4DW2U 3B82A 1T0JB 3TSZA 1CP2A 4TWWA 3S9BA 2VINA 2Z0MA 3NBYC 4K5ZA 1YBWA 4DHEA 2RGDA 1L1JA 1DG1G 2OXCA 2PX0A 3E5HA 3RXPA 4Z51A 2F9UA 5FBLB 3O8BA 1VTKA 4MPVA 1W7GH 3KKOA 1V3XA 3BTKE 1QL9A 3SS8A 1MTVA 5LDDC 2VLIA 4U00A 1YPMH 2FOBA 1Z0JA 3ONWA 3VAAA 1ESNA 1E32A 1K8RA 3QKSB 1AZ8A 5DP9A 2QAJA 1AWFH 4SGBE 4LZ1H 2CV3A 1KYIA 2CEAA 2WWFA 3CX8A 2DFNA 2JDIA 1HQCA 3KJHA 4M1WA 3D23A 2IUTA 3EZ6A 1G7CA 1W0YH 3OE7A 1XPUA 4WMFA 2J0UA 3F9EA 1YP9A 1LHEH 3AF1A 1YPJH 5JJLA 1XUJA 4LX0A 1TMUH 4P0TA 5LD2C 3TVDA 4GCHG 2PEYA 4WBSA 4A8JA 1HAZB 1EZXC 2V54A 1N0WA 3BIUH 5C5OA 2C8VA 3LFUA 4A4DA 1N6YA 3KL6A 3P8NA 2C9YA 4DSNA 4X2YA 4UFFH 4THNH 5J4SA 1EJMA 1O2WA 2W3IA 2VEDA 1WCV1 2REXB 2J1LA 1HAXB 2BM0A 3BH7A 1YPGH 4X8VH 3OY6U 1O5FH 4I4LA 4ZDKA 4Q7KA 3BN9A 1NL3A 1IY1A 1YHNA 1XXDA 2PT5A 1ANBA 4ARZA 1S3SA 2ZXUA 2ZJBA 2DWQA 1TPOA 2XBYA 5L3SB 3TGJE 1YPEH 4P4SA 3P8GA 2KBFA 4ZI3A 2HV8A 3KQKA 2XCNA 4Q7JB 1IY2A 3SHFA 1AUTC 1ZZZA 221PA 1E9CA 4TYPA 1E3MA 2MSCB 2GCOB 1TGNA 3I78A 1JOUB 4Q1AA 2QROA 3K70B 2D2FA 3GEHA 1UEJA 4DIHH 1DICA 3CBQA 2OUAA 1SGFA 2P5SA 1JQLB 3IPYA 2JETC 5F98A 3QTOH 1D3DB 1E0KA 3F9GA 1P6XA 1BO6A 3EPJA 4NYMR 1W5SA 4C7OB 1DARA 1S1MA 1O3DA 2DPXA 1GRNA 4EJSC 2I1VB 1QURH 4K1EA 3SN8A 2LKDA 4BFTA 4HLDA 4MRPA 2ZU4A 4D2IA 2R6GA 1LPKB 3GCHB 3TH3H 4MYCA 1ACBE 1R5NA 1SGQE 4OQXA 3GQBA 2ZAMA 3RS3A 2J0QA 3BSQA 1LV7A 1G3DA 4KYIB 4OGXA 4QL3A 1F5LA 4HB3A 2GZ9A 5FFMA 4LJ8A 4JSTA 4EPXA 4FU7A 3SI3H 1H8HA 1ZUIA 5A2MH 3ZZUA 3TAUA 5JWHA 1QY6A 1FP6A 5D3MA 4BXWA 3U44A 4Q1DA 1RTKA 4R9UC 5JZVA 5AUOB 4MKIA 2WVJA 2BD8A 2HT1A 2ESTE 2V1UA 2F83A 1ZRHA 1G37A 3LY5A 1TA2A 2Z9KA 3URDA 2PMDA 5F6MA 1K5GA 2QAAA 2FGJA 4AC9A 4HUQB 1KIMA 2NO9A 3CF0A 4JLPA 1GBEA 2BDCA 5EQRA 2CE7A 2QT1A 1GTVA 1LHGH 2F9BH 2WIAA 3IQWA 1CXZA 1R2QA 1SLXB 4CHAC 1G7SA 1E9FA 4Q2KA 3BTFE 2WWXA 1YZKA 2NU4E 3X1WA 2QPTA 5DN6D 3RXVA 4LJ6A 2NOAA 2O8TA 3PUWA 2RGNA 2OBMA 1GL9B 4LYHA 5BW8A 3A7YA 1H1BA 4W9MC 3PFIA 1DEKA 7GCHG 2J7PA 5EQTA 1OH7A 1Z6EA 1T5LA 1KSGA 1GHVH 2P3SA 1L1NA 4RY2A 2XX3A 1FPHH 1G36A 1G1MA 4JZEH 3KQHA 3WBKA 3S69A 3AM1A 3GY2A 1EAIA 4IHQA 5C4MA 1WTHD 1KMQA 2ZVPX 4Z0KA 3TSOA 2ZEJA 1OLOA 3KEEA 2ZDVH 2QY9A 3VFDA 1AFQB 1XXHA 5GJCA 1FP7A 3A58B 1P72A 1GL7A 2N1BA 2WZQA 4IS5A 1H8HD 3PV0A 4QBFA 1QNJA 1TQDA 3GMTA 3QOFA 2ZU2A 1PVOA 8GCHG 1OXGA 1Q1QA 1T3HA 3H0KA 1AWHB 4OHZA 2IEZA 1UJ2A 4Z1MA 5FTMA 1AFQC 1COWA 3U3RA 1E69A 3RXCA 3Q72A 3W8RA 4ABEA 4BUJA 1R7RA 5JBTA 1S5SA 2WICA 1MQ5A 3RS0A 4QJ4A 2BD9A 1E1RA 5JHGB 3EPHA 1S9HA 4YQFA 4DXAA 1GHZA 1UFQA 5FL7D 3T35A 3AP2A 2WWHA 3RMMH 2OBOA 2JJ1A 4B2AA 4ISOA 1BRUP 3LXRA 2BMGB 2PH1A 5J5CA 5GDSH 1OSSA 3CPEA 2ZYVX 2GEVA 4W7SA 2H9TH 1N6OA 3ASYA 3T2NA 4OI2A 3AGQA 1IQLA 3E0PB 4UE7H 4C2TA 1P03A 2C78A 1ZYOA 1MO4A 3GD7A 5DP6A 3NC1C 1DXPA 1O3GA 3KHVA 2PSYA 2GJSA 4X1RU 1EGAA 5SGAE 1MTNC 1K1NA 3ZVMA 1Z6TA 2WJGA 4I81A 3NTUA 1VCWA 3MNBA 4QOSA 1K1IA 4FUDA 1FOEB 3TR0A 1RTLA 1G21E 4OM9A 3VB3A 2RA3A 3EWAA 3IBGA 1QHNA 3OAAD 5LBIA 3ZVRA 3VU9B 4GMDA 1NBME 3HDTA 1Z6GA 5FHTA 5C4GB 3S1AA 3T5GA 3F1SB 2CDNA 3V13A 5HE8A 4CIDA 3ZV8A 2OC7A 1VCOA 2EFEB 3TH2H 2Z4SA 1LTOA 1FLEE 1VCPA 3M7QA 4ZKEA 2IA5A 1H8ED 5DP5A 1K28D 3EAJA 1HJ8A 4X2WA 1BTZA 1F3OA 5JSZA 5ETXA 1SKQA 4PC1A 1UBGA 1Z0IA 2GV6A 4QHYA 1C9TA 2P3UB 3U3OA 1P9UA 4FINA 1HBTH 3X1XA 1GNPA 2JLXA 1ELCA 3SV8A 1M8PA 1JXMA 1EK0A 2FFHA 2ZQ5A 1N6LA 1SVIA 3E70C 4D4MA 2H92A 2EYUA 2JJ1D 2QY0B 2A7QA 2QXIA 3QI2A 3M6AA 1HAPH 3CP7A 3BEFB 3E90B 3VB5A 4MGKR 2O9QA 4DIEA 4Y6DA 5AFZH 1MZDA 3UNRA 1G8YA 2BX4A 5A0BA 3Q77A 3OF5A 4LHVA 3LONA 3PTBA 1Z1JA 3VKWA 4PHFA 1DWCH 4MQBA 1H8IH 3ITIA 4B3BA 3ZVLA 1XJCA 2EFGA 5EXLA 3V3MA 1MH1A 1NROH 4JZFH 4KKDA 3LGUA 4CEJA 3U5ZB 3QXJA 4MKHA 3C41J 4PSKA 2ZDLA 1W49A 1UBEA 4DWJA 4YM9A 1UK2A 4Y79A 2OCAA 2NU1E 4BE7B 3VNUA 2Z94A 1D2EA 3STIA 1SLWB 3D6TB 3Q8XB 1NP6A 3A1TA 3LW8A 4R0IA 1E4YA 4DT1A 4R8TB 2X1VA 4NONA 3LXXA 1FIZA 3PENA 4FW9A 1XBTA 4L8GA 2GJKA 1ZM9A 1U0LA 1SVLA 4BLSA 1BMAA 1SFIA 3SNDA 4PC6A 3KQCA 3GLHA 5JBAS 1OKKA 1GL0E 1QVRA 1DLEA 2TGDA 1KTTB 2G55A 4X8TH 4OJKA 1JQJC 3GLIE 1NRNH 4YONB 2CJWA 4J1YA 2ZGCA 1ID5H 3UUZA 1EP6A 3CNOA 1SBWA 2OZEA 5GPIB 2XWAA 2OCVB 1PLKA 4BLRA 5J4VA 4B2PA 3G0HA 2C8ZB 3SV2H 3A4MA 1P3JA 3D7MA 4B34A 2JLZA 4V0KA 1VMAA 1TX7A 2ZR0A 5L2YH 4NCYA 5TV2A 3EIEA 4IOLA 1P3EA 3BTQE 5T6GA 3R9XA 3MO6A 4L15A 3W34A 4X8HA 5KNBA 2FYQA 2P8OB 3MLEA 2O8EA 1GI1A 5HXFA 5FBRB 2ZITA 4DLWA 3SQWA 1OWKA 4AGJA 4M9QA 2JGNA 2AN9A 4NCHA 1C5XB 4Q9HA 3KXIA 2ZWLH 4LJYA 2R9PA 2DHRA 1C5TA 1TB6H 2BKUA 2A31A 5K7RA 1XTKA 1JBKA 2GJAA 3ZD7A 4ARZB 4RSPA 5E7JA 5L3SA 1MU6B 5CM9C 1SVKA 4LJ9A 4XE4A 2GAAA 3TIUA 3I32A 2J34A 2ZUDA 4BFXA 1YZNA 3F0TA 7GCHF 4F93B 3UWIA 4ESTE 1GWAA 1ZU4A 3MCAA 4NHOA 5FPHA 2XXAB 2ZJ5A 2R6DA 1UVUH 4UXIA 2FI4E 1UTQA 2H1LA 1ESBA 2G5NA 4HEJA 5DNYB 1O2TA 4PO8A 1XDBA 1T7CA 1QHYA 3K0SA 2BLVA 2Z9JA 1C5OH 4L9WA 1FAKH 1O35A 1MABA 2KAIA 2XJ4A 4GCHF 2O8BA 3UG7A 4WVFA 1DAHA 2AK2A 1NFWA 3MWKA 4DURA 1QB6A 1K22H 2OXSA 1E0AA 2WPHS 1ESMA 4YMSA 1Z6AA 1R8SA 3LT3A 3PB1E 2ZI4A 2QXGA 1J8MF 5JSZB 4D4JA 1RIWC 3VKGA 2C03A 2ZJAA 5DYIA 2HUPA 2BM2A 3LVQE 1IAUA 3EA5A 1ZPZA 2BDBA 1K5DA 4JLAA 1W0KD 1EFUA 3SNHA 3W3AA 2ZAOA 1G5PA 1EZSC 3WMEA 4MRRA 2Q9CA 1MH0A 5BYJA 3OIYA 3ASZA 4EFNA 2ZGHA 3K9HA 3OX7U 4M1KA 1W2HA 3UG6A 3Q5DA 3QE0A 2ZETA 2RHDA 2G1KA 1GWNA 2DWOA 2O0JA 1XJQA 3L33A 3ZS8A 2ZU3A 2RGNC 4INHA 2FOLA 4LJAA 1SGYE 3C27B 1G8HA 3MNSA 3A88A 2V3HH 3M5NA 1G7RA 3OHMA 2RG3A 1XEWX 3ETLA 1HAYB 4MPWA 1SHYA 3CF2A 4MNVA 3P32A 1CSOE 3Q9LA 1GBIA 1QVAA 3EIQA 1RJXB 4HI0E 1O30A 2PSXA 1HJ9A 3LNCA 2PLXA 1NG9A 3NXSA 3SUEA 2W2TA 1L8QA 3SYJA 4EQ6A 2YYZA 1ETRH 5IK2A 1Y8TA 4D0LB 1PJPA 2BVXH 3SJ8A 3T28A 4KSBA 1OT3A 2DFTA 4M8NE 4MNYA 1BHXF 1V2ST 3CZQA 4WZ6A 2F43B 2CHQA 3CW2A 5AUQA 2VHJA 2CCKA 2FSGA 2J59A 4BFZA 3K65B 3EA7A 4BNRA 1Z3IX 1G9XA 4WY3A 3BERA 1RFNA 4GSOA 5J4HA 2WINI 2OINA 1GJ4H 4ZUHA 1HT1E 2OLGA 1PLLA 2FI5E 1ESAA 1T4UH 2OG2A 5DP4A 2Y7ZA 1K1LA 4TT3D 2GCHG 2ZJ8A 2W6JD 3CB4A 3LH3A 3FP8E 4IDNA 3MWYW 4LOYH 1BT7A 2DUCA 5DSZA 2ULLA 1HGTH 5CHAC 4AD8A 1N1LA 1TNHA 5K8IA 4QXAA 3GYLB 3GLIA 3D31A 2OC8A 4ISHH 4WW0A 3W90A 5TDHA 4DIDA 3NH6A 1UVOA 4Y7BA 3RYTC 1ZNZA 1ABJH 1FNMA 1HUQA 1MBQA 1Z22A 4MRNA 2THFB 4OS6A 4EFMA 2HJGA 5AR1A 1OS8A 4CRGA 3LBNA 3HU2A 4ABFA 4K8YA 1AN1E 4ITRC 2FSHA 5H1YA 1WQSA 1RC8A 2GZAA 2WPLS 3FE2A 3DMNA 1X7AC 1W12U 2CCJA 4V0ME 3FFAA 4Q1CA 2O0KA 2FPKA 3ADBA 1GMDF 2QI9C 3HATH 1T9HA 3PR1A 4A8JB 3TNFA 1XXHE 4N0EA 4BWYA 4TMTA 3A8BA 1KI8A 2XEXA 2BB4A 3S0NA 3PUXA 2D3WA 2V4ZA 1GJ9B 1AKYA 4ISLA 3M7TA 5E3HA 5DLQC 1LF5A 3GY4A 4CREA 3MH6A 2HWLB 2J92A 3OTJE 4AG2A 3PG5A 2ZIAA 2RDLA 2QORA 2AS9A 4DJZB 5TCAA 2ONKA 4Q1EA 1VGCB 1CGIE 4B44A 5HTKA 2WPKS 4TPIZ 5HE9A 4JK6A 1KI2A 2HLCA 1SHZA 4UFEH 1A0HB 4P4SB 3NH9A 1WA5A 2RGXA 2RCEA 1GJ6A 3O8RA 1N8OB 2CBZA 4AORA 1MRSA 4AG5A 1MZAA 2RGAA 1MUEB 4DDVA 1SVPA 4IDHA 1A2CH 2YWEA 2UUFB 1XP8A 3QVVA 4INKA 1TEXA 3ZVBA 3GY8A 2AXNA 1GCDA 4WF8A 1AI8H 3C8UA 1KY9A 4ABYA 4V0LA 1Z6XA 4JLVA 4AK9A 3TRFA 5B64A 2ZM5A 5ABWA 1LW7A 4MVNA 1HV7A 3A8AA 4BAMB 3MWIU 2ZRJA 5CIWA 2OSBA 4UNRA 2XBVA 1CRPA 3T06B 3X1ZA 1YR7A 3QX5H 3PLKA 2A78A 3UWOA 2RGBA 1N25A 1LS1A 3NKVA 3RXDA 3RMNH 1OFIA 1DBSA 5F8XA 3LBIA 5L3QA 3KQNA 3IO3A 2OFXA 1JWTA 1E2MA 3QF7A 2JJ8A 1XZQA 1XMJA 1YLCA 2OCPA 1FTNA 1O2OA 3REGA 2I3BA 3GEIA 3K0CC 1GMCF 3B8JA 1TUEA 2RHMA 3SHAH 2XTZA 4JSYA 2WIBA 5EE3A 1ZJDA 1GBTA 2IEYA 3N2EA 3GLFB 4ZHAA 1G19A 3TSWA 3BG8A 1GBJA 1G8FA 2L0XA 5DP8A 1AE5A 1D8TA 2GT8A 4K81B 3THYA 1O2IA 3CR7A 1QR3E 2VJ1A 4B6EA 2OBLA 4AFQA 2ZYWX 3W6NA 1II8B 2KB0A 2GVZC 1W36C 1O3HA 2ZRBA 5KPDA 4B2BA 2NPFA 1BBRK 2GMTC 3QPUA 1NRQH 3GCTF 1Z07A 3NBZC 3GLGA 1HTWA 3QZRA 1ZMNA 4QBIA 4VGCB 5G3YA 2BKEA 1ANDA 4O25A 1JXOA 2J0VA 2ASUB 3AUYA 1V2JT 1KAOA 4Z54A 1Z8RA 1GZSA 3AUXA 3AVOA 3RABA 3SGBE 3WRYC 1Z0DA 4Q9KA 2ZU5A 2ZJOA 4C0SA 1G7TA 2JJ2D 1T3LA 1UDWA 2ZI5A 5DKMA 4UKDA 5AUPB 5E7MA 1KMHB 2GBLC 2BD3A 3CS0A 4M1YA 5AHGH 4QBHA 1ZIOA 1J15A 1MR3F 2FA9A 1DSUA 2ZR9A 4CT4B 3LKWA 3QEOA 2TGPZ 4YMWA 4X1PU 3DOFA 3OEEA 4ZDWA 1O2ZA 2OQ5A 2GBLA 3BTEE 5FX6A 4JVNA 2C8WB 1MO3A 3P26A 4PO1A 4GOKA 1CE5A 3V7TA 3SQEE 1II9A 4Z8XA 3SUDA 3GJ7A 4HZIA 3PXGA 2AXPA 1ZYUA 3RXAA 1XM1A 1QB1A 2FX3A 4FUEA 1FNIA 1S6HA 1KDTA 5C2JB 1P01A 2YVUA 4YOGA 5FOSA 4UEHH 2VWOA 3RC5A 1CJTC 2J4IA 1G8GA 3CF6R 5BXQC 1O0DH 4XSHA 3MI4A 5J40A 1IXRC 1OW3B 1BTYA 1C2GA 1GBBA 1UBFA 2V8OA 5DO9A 5L2ZH 1P2IA 4NSYA 4C0AC 1P8VC 5FX5A 5HCNA 3ATIA 3Q00A 1EG7A 1TX6A 4Y8ZA 3AVPA 3A87A 1CRQA 4A6XA 3F9HA 3RXBA 3VB4A 2VHTA 4IVPA 4BAHB 4Q9LA 2HRVA 3E0NB 4BPBA 3THYB 1KXFA 2JLQA 4WH6A 4BZPA 2ZGXH 1OWEA 3GJ6A 2OE2A 2XB2A 3PCRB 1CT0E 2J7PD 3MUFA 3ND8A 3P8FA 4HLQB 5KDDA 4R7ZA 3MNCA 5FXLA 1IOZA 4A1TA 3SJOA 4ZAEA 1E2EA 4JK5A 2J9NA 3VXFH 1GIAA 1O2SA 3UNQA 1FUJA 3SNEA 4OS4A 2JLYA 4URZR 3DD2H 4DVGA 4FVBA 1X8KA 4OKSA 3ZYCA 1O2MA 4US2R 1GP2A 2WSMA 2GZHA 2GDDA 1OHHD 3ZD6A 4UNPA 1Z06A 2H8KA 2G8TA 2CNWD 3NBXX 1LVBA 3KF2A 3CRW1 5FTLA 2ZHEH 4GAWA 1TF5A 4PHTA 2PGQB 3AH8A 1U2RA 1C4V2 4K60A 2ZRKA 3K1JA 2Y5FA 2JLUA 3P4XA 1AMHA 2VP6A 3HGPA 3C1KA 4DY7B 1A1RA 1QCPA 2G52A 1FZQA 1COWD 2RH5A 1PUJA 3B78A 3O8DA 1GILA 1KHTA 1I2MA 3QDZB 1I4LD 2GRJA 1O31A 3TGKE 2A5KA 1TX4B 3T5DA 4KFUA 2JATA 1KXAA 4PPFA 1P05A 3L8YA 9ESTA 3UPUA 2DE8A 3E1XB 3CS7A 4K46A 1TNIA 4D76A 4ABBA 1J8YF 3UR6A 1TX8A 4K1TA 2ZDKA 1TNGA 2QRZA 4HLCA 1QBVH 2WJIA 2BBSA 2ZVQX 3HK3B 2FFBA 3CM0A 4LRWA 1ZSLA 3PMAB 3A89A 1FY4A 1NMXA 1OXUA 1E0SA 1MMJN 1IJFA 5C1BA 1VCMA 1GDQA 1KI6A 2FWRA 4BAQB 1NVUQ 2R9VA 1L4UA 3FKSD 1DITH 5FUWA 4FUIA 2QCYA 2VHQA 1ZW6A 1UCYH 1YPKH 1GBLA 1US8A 1OWJA 4AYWA 2OO7A 3U3KA 5EZ5A 1OFHA 4Q80A 1NS3A 1OKXA 4KGAA 3RXUA 2P6UA 2EFDB 1KY2A 1ZHPA 3OAAA 4TMWA 2F9VA 4FMCF 4PHHA 1QQ4A 2F1JA 4UXHA 5EODA 5EUQB 3DO6A 1N6KA 1B0EA 3PM3A 1GNQA 4HLUC 5HM2A 2ZI9A 1IOEA 3QG5A 1RXPA 4PC2A 2V9PA 5F03A 2XNIA 3AKEA 3OIVA 3EE0B 1P2JA 1UJ1A 3ZZ8A 2PJZA 4M1MA 4G5OA 3T29A 4TYYA 2F1HA 3RXLA 2WJHA 3RP2A 1OPXA 4DLUA 3KTAA 2FH5B 3AF3A 4A0GA 5JJKA 1EKBB 4O97A 5E4FA 1SFQB 2J95A 1FQKA 2XZLA 4Q19A 4I32A 4M2LA 3QQ5A 3MNXA 1F2TA 1W4BA 1FX0A 3K0EA 2REBA 2BIFA 4OI4A 5SZJA 5CHAB 3E6PH 1KSJA 1E2PA 5DI9A 2RGGA 1P2UA 1J8AA 1G32B 2BDTA 1Q44A 3UQVA 3MYWA 3MD0A 3RNLA 3SW2B 2VVCA 2IL1A 4RFSA 2CHAB 4TQ9A 2XBXA 5JI3E 1TNKA 3M3TA 3HU3A 1YVDA 4GPGA 1HA3A 3UQOA 4GNKA 1JR3E 2STBE 1V2OT 3EASA 4JL5A 3QBTA 4US1R 2IJD1 3AW1A 1IHTH 1TBZH 2XWBI 3THWB 3TUJC 3QENA 1G6OA 1SVMA 1IHSH 3RRZA 3EG5A 4TZ0A 3HGNA 5LPNA 3A7WA 3AP1A 1HAOH 1PPBH 1RYFA 1IJEA 2ZROA 2ZFFH 3RWOA 2BBWA 2FZLA 2WJJA 1F92A 3K9NA 2JA1A 1BOQA 4FUFA 1O5CB 8GCHF 2F3RA 1RRPA 2QRNA 1II8A 1CHOF 2XC4A 2DYKA 1HCGA 4X8UH 5I25A 4BLOA 3LOXA 4ZKDA 1A3EH 4OK5A 2FFQA 5JEDA 4GI7A 4IW3B 3BF6H 2QQEA 2HEIA 2A5YB 5TCCA 4HLUA 3DMDA 4A15A 4LWZA 4WXPA 3SJ9A 3RC3A 1P5ZB 2QG6A 4D7GA 3ZZAA 2CL6X 1C1YA 2ZHQH 4AKGA 5FPTA 1O2PA 1MO6A 4JVMA 1HJAC 2HCJB 2IF2A 3A85A 3SZNA 1Z2AA 2IBMA 1HY3A 2G51A 3MFJA 1OJLA 4Y0ZE 3FPAA 1ZJ6A 4RD0A 2BY7X 2WTUA 2SNWA 2PEZA 3KJGA 1D6WA 2BOKA 5EW2H 2CE2X 3LJOA 3MU4A 2VF8A 1GNRA 2OESA 1UKZA 4PZYA 1E2IA 2R44A 5JS7A 2NU0E 2FGKA 3HKIB 1HB0B 2BLOA 4DDWA 3LJJA 1ZHRA 4TL9A 1NRJB 1OWIA 5HGGA 1ELEE 3P6ZB 3MU0A 1P2OA 2VF7A 2RAPA 1UTJA 2QN5T 1SQOA 1DG3A 3DM9B 4JBWA 2VP9A 3VFEA 2H1UA 5LH8A 1SB1H 4MNWA 1GVKB 4O0MA 4OS5A 2BY8X 1EX7A 3U4QA 4EDHA 1C4U2 4B47A 3AKDA 4JT2A 5C5NA 1AY6H 5FAHA 2WV9A 1A2BA 3JZMA 2B9LA 2WKQA 2YOHA 2ZNKH 3TAHA 4BTUB 3W95A 4B76A 1TQ7B 1P2VA 4HGCA 3KL4A 3MTYA 4TSFD 4BAKB 2ZI2H 2QEQA 4DLVA 1IHUA 1GKUB 2W2VA 4A2QA 2JH6D 1OWHA 4MKFA 2J41A 4PANA 3SHCH 4FUGA 4DSUA 2RGEA 1D3PB 3SBKA 3MFYA 2IS1A 4AY2A 4WZAE 2XZPA 4WMDA 4FCWA 1KDPA 3DPUA 1BITA 4C0KA 1Z47A 2HLDD 4S2EA 3UREA 2FLRH 4WXVA 4Q02A 2TGAA 1O2JA 2GKSA 1C9PA 2F43A 2EI7A 3KIDU 3W8NA 5FBEA 3EIHA 4GT1A 1QBNA 4U5XA 4AI6A 5HPYB 4AB9A 3N5CA 4D4KA 1GM5A 2HGTH 2VIIA 4CR9A 3QKSA 4YT7H 3OTPA 2KWIA 1J70A 4B73A 4XWKA 1NU9A 1O3MA 4P3YA 3G5UA 4C7OA 2VSFA 5H68A 2ANKH 2OBNA 3BB1A 2G1JA 1E4VA 4IOJA 3CH4B 1C2JA 3W9YA 2QUZA 2VRWA 3R7WA 3HU1A 1N6IA 1SOZA 5KUTA 5A8ZA 1SGFG 1TALA 4ZCIA 1YKTA 4AKEA 5FPSA 4KTCA 4P33A 4MUAA 1O3KA 5LD2B 1QHRB 1AQ7A 1BTWA 1CS4C 1YC0A 1O5GH 1R6BX 4BAOB 4A9AA 2P0EA 2YINC 1PJRA 2G81E 1W13U 2NU3E 1G3QA 2NZ8A 3QK1A 1FQJA 2IYQA 3IHLA 4BFSA 4U30A 1JR3A 2Z4RA 1GRQA 2PKAA 4Q18A 4XFQA 1KO4A 2A2ZA 4D8NA 1NLZA 3K6YA 1NNEA 3M36A 4L4UA 4E7NA 2SHKA 1T8LA 1YR6A 2SGDE 2WAXA 3QKTA 2NPIA 3T25A 1UTNA 3H1TA 4B48A 4JYUH 3U1IB 1E2GA 4KLZA 4YMVA 1PQAA 1DAFA 3VXEH 2GETA 2RCNA 1GDUA 4GOJA 1AKSB 1E2QA 2A5DA 2FOCA 1ZNWA 3D49H 1SL3A 3NDPA 1O32A 3N70A 4Q4AB 1IQKA 1SLVB 1CIPA 1E2KA 4B33A 1D4PB 2EA3A 2UZIR 2VIOA 3TVTA 5DJ7A 1I2DA 2EQBA 2KAIB 4GFDA 2BBTA 1P2NA 3TGPA 5B30A 4ZCLA 2Z3DA 4JZDH 4F92B 2O8CB 1TNLA 1LKAA 1NU7B 1OFTA 1P57B 1Z8JB 3NHBA 1BRBE 2X19A 1HLTH 3BD9A 4C0JA 8LPRA 5BPEA 2R3UA 4CRWB 4XTRA 3P20A 5J4QA 1R0WA 4L5BA 1EASA 5JRJA 5EW1H 1MTUA 5FOXA 2FZZA 1NN5A 1HYQA 3SUGA 2GV7A 1QJ7B 1PPEE 1BIFA 5A0AE 1X8LA 4LC0A 2EYQA 1AS2A 1LHCH 1W0ZU 2GXAA 2ZE7A 5JI2E 3TNTA 1BA8B 4N1AA 1M9UA 5IDKA 4X2XA 1QG2A 2I6QA 1U0HC 5E0GA 2EWVA 4ZIRA 1SXJB 3A86A 3WMFA 4IKEA 4BRUA 1ELFA 2BVRH 3WP0A 3WNBA 4IGDA 1RRFA 2V6IA 2OV2A 4I99A 2AMDA 3PO1B 2BVNA 4CGZA 3EARA 1Y5AT 3CWZA 2D2DA 4VGCC 3SHWA 1O2GH 2TMKA 2JLVA 1G6HA 1IM2A 4NMMA 1PPFE 5B6OA 5JB8S 2JEOA 1TPZA 1UEIA 4U32A 2BYAX 2KJQA 2VP4A 2Z9IA 2GESA 4H42U 2A7CA 3I1FA 3CRVA 2JASA 5IF9A 1ANCA 2BD2A 4MH0R 5EP1A 6GCHF 2SFAA 3T15A 1TOMH 1KZGB 2QT0A 1IQIA 4DG4A 1MO5A 5G40A 3TH5A 1NY5A 1XCGB 4POAA 1TL7C 4PX9A 1ZD9A 3FDIA 1AKSA 2Q3FA 3B9FH 4Q5IA 2OBQA 1CT4E 4M9ZA 4DLZA 3L0PA 1E98A 2OC1A 3HPRA 4EJSB 5TVKA 2F7SA 2XNSA 5BQ5A 1TNJA 3QTVH 2B5TB 1D9IA 2NO1A 1DE0A 1IN4A 1C5VA 3B1ZA 1N6RA 1CA0B 4HB4A 1XEXA 3IUYA 2GCTB 4CYMA 1IQEA 1DXWA 2Q1JA 3GLHE 3QVUA 1BMMH 4LPKA 1FV9A 2PZEA 2CMKA 2YNBA 3SBDA 4NCNA 2QM8A 1ZNYA 2A7HA 2F9PA 4KJZA 4KVGA 3H5CB 1Y5UT 3U6BA 1ZGIA 1QJ6B 3VHLB 2V7QA 1HRTH 4F4CA 1GBMA 4Y8XA 3U69H 1P09A 2C3SA 1TPSA 4RZ3A 3DDCA 4Y8YA 3HR8A 1YZGA 5DHFA 2C8XB 2ANWA 1ZD8A 3SGAE 1VYUA 1TMTH 4D80A 1FW6A 1EXMA 2PUXB 4GZMA 1IN6A 2LWIA 4WA7A 4AG6A 2Y6TA 5ELXA 4LJ5A 1C1OA 4OS1A 1X1SA 2QZ4A 3TJZA 3UMFA 1VGCC 1DVAH 3E2IA 1FN6A 1KI3A 6Q21A 4NFFA 1ZGVA 4MTBA 1U8ZA 4CEIA 1G3RA 5D3QA 3A82A 2G0NA 4MRSA 2RKOA 1YRAA 4BFYA 4EAQA 4MLFB 1GHBF 1V2VT 3GICB 2IT1A 4KXFB 4NZLA 4Q4AA 3W5JA 3W3ZB 5CYOA 1UCYK 1T91A 3EA8A 3HR7A 1LB1B 1EAWA 1SQTA 3MJHA 1UTMA 4LJ7A 1AB9B 4N0DA 4JZKA 1DUEA 1BJUA 1VZQH 4PFSA 1D9XA 2BQ6B 2FEMA 4CVNA 2ODPA 1W8BH 2QSZA 3RWMB 1IY0A 4TMZA 4BEBA 4AFZA 3VNVA 2PCJA 2A5GA 3B8HA 1THSH 1BBRH 4KI0A 3JZAA 1AVXA 2J94A 1VJAU 2AX4A 2WSSD 3SR0A 2A9KA 2Q6TA 1BYUA 3TQFA 5A8XA 1DTSA 4PAMA 1JI0A 3B1VA 3K0FB 4ZKOU 3P8OA 2NGRA 4KSCA 3FFBA 1GG6C 5EPYA 1QQUA 3WBJA 1VG9B 2HCBA 2R2WU 3SJBA 1YCPK 1E0FD 4B2IA 1KI1A 1GG2A 3TK6A 2UWPA 3IBYA 3SJZA 2AK3A 1G8PA 1O5AB 4WIAA 1RIFA 4GUXA 2ZFRH 2GTBA 1ZCAA 1KJWA 1GJBB 1A0JA 2X77A 1SLUB 2BD7A 3PLBA 4UNQA 1PYTD 2ZS8A 3VKHA 1NLYA 4X1QU 2IYRA 1DO2A 3BB4A 1N6PA 1SGEE 3ZZ6A 2XSZD 1XTIA 3QN7A 2F9MA 3GFPA 2FEQH 4EPWA 1DSTA 2IXEA 3VGCB 5ESBA 2XYAA 1XVOA 4I31A 4A7IB 1MAYA 2Y80A 3GCOA 3MH7A 1KOFA 4AKHA 2ZU0C 3MHWU 3B23B 4IFEA 2BXUH 3WXMA 1DWEH 2HPPH 2F9LA 5C46F 3NEJA 1AS0A 1SGNE 4DJTA 2A4QA 2AKYA 2IF0A 2HALA 3FGNA 1OHHA 4CEIB 4Y0VA 4A5TS 3L43A 5FL7A 4UNSA 1P2SA 3IILA 1D9ZA 4IRUB 2EFCB 1W11U 4O03A 1ZMJA 1GBHA 5EPNA 2M5TA 2Y5HA 3JZ2B 3ADKA 2P16A 2BM1A 3HPQA 2ZA5A 1YRBA 2P2LA 5DN6A 1P3CA 5K8TA 2RB4A 4Q9IA 3SEAA 2FSIA 1C1RA 3P70B 3I8XA 2IWRA 1QZXA 2CGAA 4CZ2A 4FMBB 4A92A 4X2VA 1UHBA 1GCTC 8ESTE 1U99A 2BBOA 3LO5A 2FJUA 1F5RA 1Z2CA 4JKIA 4A6LA 2C93B 1XJ0A 4LZ4B 7LPRA 1T32A 1O2KA 3IEUA 3T27A 4O3MA 2XTMA 1UMAH 1ZM4A 2AL7A 4FUCA 1SOTA 2B7CA 2KE5A 4X8LA 4BECA 4YLQH 3RS4A 3ODDA 5CM8B 1BMFA 3EW9A 1EWQA 1GVLA 4FU9A 1WTGH 4AKIA 2ZSEA 2QTVB 4LK4A 4DCSA 3ZDQA 2XJ9A 1QA0A 1XCMA 3H4MA 2J5XA 1ELVA 4ACAA 4OQLA 5FR1A 1FONA 1RW4A 1ZTLA 1AB9C 4BTTB 4F49A 3VR6A 1AD8H 6GCHG 1O5BB 1O3EA 5AJZA 1BH2A 5JCZA 2Y8EA 4URYR 5H4IB 2VA8A 3W5IA 3X2SA 3CRRA 3QF4A 5T3HA 1W0JA 4XOIA 5L30H 4HAWA 2VH6A 5CITA 5C20A 1Y5BT 3DUXH 1IN5A 3VX4A 4Q1FA 4RFSB 1HIAB 1S2MA 2VIPA 3N7OA 1G2LA 3T1TA 2O8WA 1TRNA 2Q3HA 1V2LT 4CR5A 4AYVB 1FI8A 3Q3YA 4NP6A 2VL7A 1SMFE 5GCHG 4URVR 3GY7A 3NG1A 4TLAA 1UTOA 3BIFA 1T31A 2BQ7B 1W1WA 1OE0A 5DP7A 2OUKA 1W48A 1L4YA 4Q01A 5AK0A 1GI0A 4NSVA 2W83A 1G9IE 1MCVA 1MT0A 1NKTA 4QNRA 2WBLC 1GMHF 1JRTA 2TGTA 1C1VH 1NI3A 2AWNA 3VQTA 4NFEA 4Z8YA 1WSSH 5LGOA 4IW4E 5BYKA 4OI0A 2BHRA 2G4UA 2XOKA 4TLDA 4B74A 2ORVA 2ZCHP 1JAHA 3BH0A 4B3FX 1XUFA 2IHYA 2D62A 3Q3XA 2C8YB 1E9SA 2GT7A 1LKBA 2GZ8A 3ZQ6A 3M3VA 1RIWB 1OWDA 5KOYA 4C0HA 1VHLA 1YCPH 3SNCA 1PPZA 4H6TA 2RMKA 2ZG0H 4FN5A 4CHAB 2VYFA 3SQHE 1O2VA 3FZZA 1UK3A 4EPTA 2IPHA 1JEDA 1ZUNB 2YC4C 1UO6A 2ZHWH 4ZO4A 2HYDA 1XTQA 2IS2A 3M3SA 4NIWA 2Y7XA 3LW7A 1A5GH 3FAOA 3K8YA 4ZXYH 1GI7B 4WH8A 4D9RA 4LXBH 4GBMA 3QJYA 2IW3A 4X8MA 2J38A 3QPWA 2G3YA 4IN2A 2FODA 3SYLA 4CBNA 1N5KA 2FOEA 4YOJA 2JLWA 1OIXA 1IQGA 2ERYA 2O52A 3NPSA 1XKAC 1XX6A 1L0ZA 2FOFA 4JJKA 5FUVA 1IQFA 3DL0A 1UTLM 5EXSA 2ONJA 1DAGA 1HV8A 3U61B 4NYMQ 1P06A 1GUAA 1ZU5A 5JEEA 3TR5A 3RDZA 4NCKA 1OXTA 4ZKSU 3OEHD 1P62B 1M34E 5E2PA 3FB4A 4HYYA 2FG5A 3CH5A 2GCOA 3VTKA 5TB5A 1GJCB 2OQUA 1INCA 1Q3TA 3A8CA 1A4RA 4QHTA 2BTCE 4B3GA 1Q1BA 1AGPA 1UDXA 2BD4A 3ZVCA 1O3PB 1R5OA 1AO5A 1XD2A 2W0MA 2IK8A 4G5RA 4ON9A 4R2IA 1DY8A 3J81k 1K1OA 1FMLA 3ZVEA 4FVDA 3UANA 5C2ZA 3QKRA 4KBGA 1GHWH 2SNVA 5AF9H 4BASA 1WXQA 1YQTA 4DVAU 3SNBA 1S96A 3UWKA 1ESTA 1N5LA 1AU8A 4FD2A 2FMXA 3PV2A 5KSOA 4JL6A 1ARCA 3SO3A 2ZSBA 3AAVA 2AERH 3BG4C 3ZZ0A 1THRH 4E07A 1AZSC 3MOCA 1BZXE 3M5OA 5D3MB 3U44B 1NVWQ 1KKLA 1UBCA 1CA0C 2QMHA 4NYIQ 4V0NA 4TYQA 4K1SA 4AYXA 1DY9A 1AQYA 6LPRA 2PHBA 3R0FA 1ZTJA 3AF2A 4TSFA 1HNEE 1E94E 3M1IA 3TJVA 4PXAA 1O3OA 4PAQA 2OP9A 3RLWH 1HPGA 121PA 2AR7A 1TGBA 2F55A 5C1YA 1W4RA 2GCHF 4LZZA 1D6JA 4LSGA 2X2FA 2IXGA 4AFSA 3LVRE 1VG0B 1P2QA 2D26C 4HAUA 4XVQA 4XH9B 3C14C 1KAGA 4XBDA 1G5TA 1E79A 5JMTA 4R71A 1WRBA 1R4AA 2ODWA 3EA0A 1HURA 5DP3A 2ZCLP 4OI1A 3V4FA 2OC0A 2H9EH 4XJXA 1VR1H 1C2KA 3QEJA 3RXOA 2K5UA 1Z5ZA 2ORIA 3CRQA 1VHTA 4AN7A 1U0JA 3B2EA 1O3NA 4HB2A 1RTFB 2YWFA 2QC2A 1JXPA 2BEKA 1WCZA 2ZYUX 1SQAA 2ZKSA 3ND9A 4M22A 2PZFA 1O3IA 4KFRA 2YV5A 2IS6A 2P8OC 3SJCA 2P95A 1P61B 5HMAA 2PJRA 4MKGA 1BYIA 1KO5A 3RXEA 2OLKA 1ZSJA 1JJ7A 1IXZA 4I1VA 1NRSH 4IEIA 1EJAA 5HYOA 1EX6A 3PV4A 1YZUA 1PYTC 1Y3UA 3A1UA 2GEUA 5EJEA 3KUDA 4Q47A 3BG4B 1CGHA 4RN6A 2UUYA 2QSYA 4HDQB 2PGBB 1ELTA 4GDFA 2W6JA 1Z0KA 1ZRKA 1TWXB 2QP9X 1KO7A 4MPUA 1E9AA 2ZS7A 2REOA 4MYTA 3S1AB 3K9XB 3BK7A 3ECCA 3RDPA 2QBYB 2FPMA 3U6KA 3ZZTA 3QKRB 2CVHA 1NZQH 3NIBA 1R0XA 2IXFA 1BIOA 3AF0A 1VECA 1H9IE 5EG4A 1WMSA 4D6PA 1MD7A 1C1UH 1BTHH 2BDHA 1NVVQ 3NDBB 3JVUA 3GJ8A 5E95A 1V5WA 1MKWH 1M1YE 4A2PA 1UM8A 3BTHE 3SFVA 4DLSA 4NWKA 3SJIA 1NPMA 4IC6A 4OQNA 1X3SA 3A8TA 3HPTB 3PUYA 4MITA 4TWZA 3T62A 2B21A 2PWXA 4NZQA 3LGVA 1FNNA 2WM9B 1A5TA 3F6UH 3VB6A 3ATWA 2BMFA 5GJWC 1GHAF 1HJAB 5EXNA 2ZC9H 4OK3A 3SJAA 2ZRCA 4OQMA 4NE2A 1G3CA 2DCUA 3Q3JB 1PV4A 1AA9A 3B6EA 1D2MA 3UOUA 1LPGB 3RAPR 3UMRA 1VCNA 3UR9A 1SC8U 3EQ0H 1F60A 2ZR7A 5KNCA 1GL6A 2PLFA 4US0R 2JLSA 3B60A 3SV6A 1JECA 3WRXC 2F9OA 2TPIZ 5KTYA 3ZZ7A 3MWJA 5CIQA 4IOKA 3TUIC 2J9RA 3GY3A 3S9CA 1LVMA 2G6BA 1C4OA 1QTFA 3B1WA 3GCNA 1HE8B 3B9QA 4YTAA 1XF9A 5G4BA 1PUIA 3U2QA 2FOHA 5JLJA 1WU1A 2PX3A 3HWSA 2GZ7A 5FPKA 5A0FA 1YZQA 4FWIB 5E0JA 3FTQA 1TMKA 2GVDC 2ZRPA 4Y10E 4Q7YA 2AGIX 4D0NA 4EPYA 3THXB 4Q4JB 4W5JA 2XC0A 3K0AB 1XVMA 5IDVA 4ERNA 2R6AA 2HPQH 1ZC4A 3FYHA 4H9GA 4U02A 2QENA 1TBQH 4M9FA 1IN7A 1FY5A 3BFKA 4OJQA 5KDLA 2Y82A 2FPZA 2OM2A 1KLJH 2WWGA 4JS0A 1SKYB 3BEIB 1LPZB 2PMKA 5DE3A 3KUCA 1SVSA 1SPJA 3ZS9A 1N0VC 3TW4A 2HF8A 3U3MA 5KPJA 4ZPXA 3BBPA 2HNTF 1WF3A 3GYMA 4AYTA 4WXRA 1C1QA 3CR8A 1WE2A 4KBFA 2GJ8A 1SGCA 1G4UR 3KXLA 1TNDA 4KTSA 1NY22 3FVQA 1V6DA 3HP1A 4B35A 1U8AA 2YZ2A 2ANBA 4FUJA 3SU6A 3DM5A 3FMFA 4JLOA 3EPKA 5FI1B 2J87A 2ZFPH 2PT7A 3M0EA 1SKYE 1T8MA 5DK1A 1W4AA 3GCHC 3MH5A 1Z28A 4M1OA 1DELA 2H18A 1T8OA 4FCVA 2TRMA 2ZIQH 2PTCE 3P92A 3A7XA 2ATXA 2BZAA 3T26A 3SNAA 2QPOA 3SYNA 3NWJA 2G4TA 1TONA 4U01A 1VITF 4AFUA 3UATA 1UF9A 3CNLA 1Z8GA 1EOJA 1C2FA 2STAE 2ZRHA 2P3TB 3UY9A 4Q66C 1ZAKA 1JAIA 4MYHA 1ZTKA 4M1TA 3SORA 5C1XA 3R9WA 1SULA 3PMJA 5HM9A 1GBDA 2E87A 1BRAA 1VCQA 1V2TT 1YF4A 4OS2A 5J4YA 2VHCA 4L9SA 3ZZCA 3ATLA 1C5PA 3AKCA 3TK5A 1EUFA 4IMZA 1EATA 1FQ3A 4PPNA 2FN4A 2UUKB 4CRFA 1H65A 2WV4A 5F2EA 4RFVA 2F9NA 4KAXA 4MG3A 4YT6H 1CHGA 4PC3A 3SFZA 4JBXA 4ACBA 3MU8A 5JBBS 4J2YB 4CEHB 1EFRA 3E3TA 1YE8A 3BFXA 3BORA 1CBWB 3RS2A 3AVYA 4NPHA 4TMXA 3EZ7A 3A1WA 4EPRA 2OXRA 1SHKA 4LI0A 4X1SU 3Q5EA 2ZZUH 4QT8C 1SG8B 4BTIB 5UKDA 1MAXA 3AVXA 1HXFH 1MKWK 1DS6A 1AS3A 1O2RA 1HAHH 2WOJA 4PAOA 2UKDA 1KSFX 1V43A 1XD9A 1W14U 4RKFA 5A4JA 1DANH 3V00A 2F3TA 1E2JA 5FOTA 5C18A 2XAUA 1P73A 1C5NH 2BX3A 2QAGC 1M7GA 2AEIH 4HDCA 4I8GA 3H2YA 3UPEA 1TIOA 1G17A 2PKAB 4O3TA 3LC5A 3OIWA 2MSEB 2LPRA 4D81A 1Q20A 3V4RA 4EKDA 1O3AA 3CENA 2YWHA 1KI6B 3TK1A 2JIZD 5CLLA 4ZROA 4HAZA 4Q00A 3FOZA 3V9PA 2YHSA 1DDJA 1KKMA 1DOJA 3K70C 1QRXA 1Y63A 1CR2A 3F9FA 3GLGE 4M1SA 2ZHDA 1EPTA 4GHTA 5EP2A 1ZPBA 4FUHA 3L0IB 5DI3A 2ZS9A 1QHSA 3QLPH 3LV8A 3KDSE 3FHCB 4YLGA 1GMHG 3BIVH 1YU9A 5TY0A 5EGMA 1KJYA 3FZDA 3ZVAA 1Q12A 2C96A 1XKBC 3U8OH 3AVTA 1Q1ZA 1U81A 4TT3A 3ZZBA 3IPXA 1CLUA 5EE1A 1T8UA 1GI5A 1HE1C 3LX8A 2QV1A 2G88A 2VU8E 2BQWB 2XB4A 1P0SH 1V2PT 2ZUBA 3U8RH 2ZU1A 4M4SA 5AJVB 1L4ZA 2I4IA 4TWYA 4B71A 4G3XA 4CF7A 3AK5A 5FTKA 3VEQB 2JIZA 1DWDH 4JLMA 3ESTA 2GDEH 2P59A 2ZTYA 5KO2A 4FMDB 4NIXA 2CL0X 1BTUA 3GJ4A 4ABGA 3IIJA 1KXCA 3WYFA 4IN1A 4NA8A 2GP9B 2R6CA 4MDFA 4B2CA 2QAGA 3PUZA 3A80A 1AIPA 2VNTA 5DPAA 2W3KA 3PIRA 1WB9A 4NCIA 1LQEA 2J7KA 1XTRA 2HF9A 3RC8A 1ORFA 4P31A 3O47A 2DY1A 2HNTC 2SGFE 3QG1A 1LHFH 2FS9A 2PFEA 4C3ZA 1K2I1 4Q4HB 2VP2A 3IITA 5EXXA 1Q21A 2DE9A 2XNDA 4DCDA 1C5LH 3I5XA 1AM4D 5LB4A 3IO5A 1U9IA 2VP0A 2EFHB 4OQFA 4Y7AA 1F2UA 4X6NA 4A0HA 1MBMA 1DAKA 3IDQA 2ZDMA 1S0RA 4AOQA 4CH2B 1C1MA 2QP3A 1TRYA 3AVUA 1X1RA 1E6CA 3IIMA 1RPZA 4G5GA 2H17A 1FPMA 4A82A 1TADA 1QB9A 3TUZC 2IUUA 4AX9H 1E9EA 1HIAA 1E34B 1V2UT 2C4FH 3LGTA 2ZREA 4BOHA 3ATMA 3TBKA 3RRYA 4H4FA 3W94A 4X6OA 1O2XA 2VIQA 1BOFA 4FIDA 4KFSA 4QGGA 4QC2A 4WVPE 5E0HA 3EPLA 4HI3A 1Q0UA 1TQ2A 3C5CA 1NG1A 1XEXB 2WPDD 1DS2E 2CJWB 2ODNA 4ISNA 2FOGA 3NZIA 1OB2A 1DAIA 1SHHB 1ZD1A 4RD3A 3UOPA 3UIRA 2HNTE 2ZGJA 2WKPA 1A5IA 1PQ8A 3SC3A 3RMLH 3VR4A 1RKBA 3JVVA 4BZXA 4MNXA 2OHFA 2PZGA 1VKJA 2JH0D 2OFOA 4JVSB 2C90B 3UIEA 4MQAA 1SGDE 3RXRA 5J4KA 1E2DA 1XU4A 3BGWA 1R5BA 1NBMD 3GOVB 2ZJYA 2VH0A 5JDUB 3BTWE 4P4TA 3B7GA 2VVVA 5AJYA 3KQEA 1MQ6A 1LQDB 4C0QC 4JZ1A 2XGJA 2QGNA 2O8EB 4BXSA 1GJDB 1RZ3A 3CNNA 1J14A 2A2QH 4C0BA 2PL3A 2BJWA 4UD9H 4JJZA 4IMQA 4AURA 2FDCA 1MCTA 5HCIA 1BJVA 1E9RA 2FV8A 3IKJA 1IQPA 3PEWA 2QAGB 4YDHB 2AGGX 2Y5GA 2CLCX 4LPSA 2IX3A 1ZHMA 2H5DA 1VYTA 4UXJA 3SZEA 1LNZA 3EZ2A 1CJVC 1MTSA 1S84A 2C99A 3BEUA 2WPDA 1W36B 4PHGA 3GJ0A 2VTKA 4CW7A 1FJSA 4KU4A 3I73A 2IHBA 3UK6A 8KME2 2OFWA 3IG6B 1OH5A 2Y81A 2V3CC 3LC3A 3V12A 2OCBA 4OS7A 3SYKA 2H6MA 4ZCMA 4PSAA 1KSHA 3Q7PA 3GEEA 4SGAE 3VR1A 2Z7FE 1LMWB 1GI2A 2CNWA 4ESVA 1MU8B 4RI0A 4ASHA 2O8BB 1BBRE 3ZZ5A 1S9DA 4BFVA 2B7BA 2O8MA 3C16C 4QJ5A 3WHLA 1UVPA 4KITB 4F91B 3SU4A 3SI4H 4D9QA 2P6NA 1RFLA 4NIYA 1O3BA 5JWRA 5HKKD 2CMYA 2UZ3A 4Q7MB 1HQYE 2ZDNA 2HT6A 1CEEA 4ZDJA 3I4LA 1KTVA 4KVAA 1O36A 3U8TH 2AYWA 4MYUA 3K9LA 1ZUHA 4QHSA 2ZJ2A 1OSNA 3VU9A 1BKDR 2DB3A 3CO5A 2ODBA 2PLRA 4PPQA 1OXXK 1OYWA 4JYTA 2H16A 1D3QB 1P60A 2FIRH 2QP4A 4CDGA 5CYPA 3I5YA 4V03A 4CRBA 5L6NH 1UPTA 3B85A 621PA 2FEOA 4FCTA 2A2XH 2RA0A 3W6PA 5CK5A 2BHGA 5SZHB 3VMFA 2HXSA 1DAEA 4Q4HA 4A8JC 4RKEA 3U9AH 3I8SA 1SR5C 1WV7H 5DO4H 4RVCA 4BGDA 1UVTH 4HZHA 1G3EA 1NRPH 2W7SA 3WP1B 5G53C 1RYHA 1GKYA 3KN2A 4Z6AH 4OGYA 1S0UA 4A0RA 2VB0A 1RD3B 3UMSA 3KNXA 1G30B 1L7VC 4B43A 5E8EH 3LPRA 4WMEA 3SU1A 4DLTA 3FP7E 4UFGH 2A4RA 4Q21A 4HSEA 1M74A 1ZBDA 2KBEA 3DHWC 4GOXA 5GJVC 1O2LA 1S4QA 2NWNA 1HH4A 1NMYA 1O5EH 3TGIE 3H86A 1TF7A 2ZQ2A 4Q48A 3CRMA 2O8UA 1I4DD 3A1VA 2A5JA 3ZZ9A 2BV3A 4LV6A 3VHXA 2G83A 4TY6A 1DO0A 4I33A 1LCYA 3IQXA 3E91A 2A3RA 4G0NA 2V55B 2QMOA 3GJ3A 2A32A 1SGRE 2OAP1 2GNOA 2V1XA 2D2EA 2OD3B 5CLQA 2BDYA 2VIWA 4D7FA 3LRPA 3GLIB 4W5WA 1NFXA 3KQBA 1E2NA 1LTQA 3MGCA 3PMBB 2D06A 1O34A 2DFLA 1TF2A 1SXJC 4Q03A 3EC1A 3B9PA 4M21A 1H4WA 5LPRA 1Z6YA 5EP4A 1CR0A 1F48A 2AWOA 1O2UA 3QPVA 4DLRA 1FIWA 5FR2A 3R8CA 2B7DH 1JRSA 1ZC3A 2ZHFH 4RD4A 4G5SA 1A0LA 2ATVA 4RSGA 4H6SB 2Z43A 4RCYA 1OX1A 1XD8A 3QZQA 5FBVB 1U98A 4I7YH 4HAXA 5KSPA 4LBVA 1GFIA 1YR9A 3RC6A 2QA5A 1NN0A 5EXTA 2QTHA 1E2HA 1T3SA 3AGPA 1G291 3AVQA 3L0SA 5K0HA 4QM7A 3PJRA 4B1TA 1NVXQ 3KB1A 1IONA 1KK2A 3QUSA 2WPIS 1A61H 3KKMA 2KSQA 2JLRA 3ZVFA 4DCVA 3NVAA 1OF1A 4JLJA 1V2NT 3RXIA 4C30A 1IBRA 4XWAA 2VIVA 3TLXA 1IAQA 3SOPA 3MO9A 2G9NA 2CXXA 3ZV9A 1ZMXA 4INLA 2LNCA 3PUVA 5B6LA 1EPTB 3LX5A 4X6MA 1O2YA 2FS8A 3P4YA 4A1XA 5JB9S 1J7KA 4OBEA 1FUKA 1V2QT 4IVQA 5F9FA 2FI3E 1OH8A 1B5GH 5G3ZA 1TABE 1GBCA 3LGWA 4FU8A 1NESE 4DUGA 1A7JA 1EFHA 2LKCA 1G20E 3TLOA 2XXAA 5AUNB 2VBCA 1ABIH 3A84A 2FTMA 1ODFA 1Z0AA 2I6SA 4EJSA 2AFHE 1G18A 4NCJA 2BCGY 5T6FA 2EI8A 3B1XA 3QGJA 3SE0A 4D82A 5LB2A 5CB6A 4JYCA 1GI8B 4ABAA 2QIQA 3T1QA 1O3JA 4DRZA 5FL3A 2OT3B 4GRAA 2O8FB 3OEED 1KO1A 1KMHA 3CX6A 1AFEH 3CPJB 1AN0A 1VYVA 1RE0A 2RGCA 521PA 4G1UC 1J90A 3A6PC 2C9OA 2FOAA 3RVBA 1QL8A 4YDSA 1X8JA 4NU0A 4EIWA 1TU4A 2IS4A 4ESHA 4AGKA 4NL4H 5GVSA 3GDVA 3CPHA 4ZXXH 3SV9A 3BXZA 4WJG2 4DB4A 4GL2A 1J2JA 4K3JA 2FXRA 1O37A 2BCJQ 5L8VA 5A8YA 3TJOA 2FSFA 3DVLA 5B57C 3GCGA 3P95A 1QGFA 1TOCB 3CX7A 2ANCA 2XNDD 4ABDA 3RM2H 4D26A 2ZE8A 3E8LA 1NO9H 3LU9B 3K53A 2Q6GA 3CUEF 1P2MA 4UONA 3I92A 2FOMB 4BQSA 3TK9A 3VR2A 2OK5A 2XOKD 2A5AA 1UAAA 4MGYR 4YC7A 1NM6A 3SU2A 2NIPA 2VO1A 4ABJA 2WPMS 5F3WB 4NYJR 4IOMA 3F68H 3C15C 2IYZA 1N5IA 3CZPA 1P75A 3K09C 3L0OA 5FOVA 2MMCA 2ANYA 1DWBH 1JALA 3AQ4A 1KO8A 1OB5A 2O8CA 1R0YA 3CWQA 1E0JA 1OIWA 3OE7D 2BDIA 3F8TA 2CHAC 1G4AE 4NGAH 1D2NA 3RSOA 1X86B 5AVDA 3Q3KA 1KTSB 1A7SA 1QBOA 2WUBA 1PPGE 4GP6A 2FZ4A 2A0QB 4OHVA 1XZPA 1M2OB 3IGFA 1TLDA 4ASUD 2CN0H 3QO6A 2FESH 2SGEE 4TYNA 4JVLA 5A09A 2D7DA 3C5HA 1BTPA 1TAGA 2EW1A 4XSGA 4JMYA 2V6NA 6CHAB 1ELDE 1FY1A 2J0UB 2ECKA 5FBIA 1T4GA 4O2RA 3BE4A 1DUAA 5IT5A 1YKSA 2DBYA 3TU7H 4A0FA 3NK8A 2F6RA 2Z5FA 1G64A 1XB2A 1TQ0B 1TGSZ 2NQ2C 1BUIA 1ZM2A 4C9BA 4DCNA 4YZUA 4H1VA 4P32A 3M37A 3ZVGA 1AVGH 5KU1A 1U8YA 3THWA 4Q7LA 2PW8H 1W46A 4BFUA 2FNAA 5FUXA 3FMPB 4DLXA 3OFND 4HAVA 4B2LA 2BY6X 2BC9A 1NN1A 3O8CA 1E38B 2CF9H 3SGQE 3GDSA 2VWLA 4CBOA 2QQ0A 1B23P 3FP6E 1H8DH 4CH8B 5GCHF 2GCPA 3GFTA 3L8ZA 4LV8B 3AVZA 5F9HA 2OILA 2PCLA 2W6IA 2IWHA 1QRZA 5DYGA 8OHMA 2WJYA 5EXMA 1Z83A 3QIAA 2F91A 1EZQA 2C5LA 1WAYB 2PTNA 1C2MA 1UTPA 4RD2A 4IEEA 4A2WA 4HTCH 3KZ1E 2VWNA 3ZLJA 5DI3B 4RD1A 2IYWA 3T61A 2H2ZA 3FWYA 2ZANA 4MA4A 1FMJA 2ZECA 2ZI7A 2FO9A 1GOTA 5IK2D 4DKXA 5FTJA 5JJIA 3D3QA 3AEZA 1RJ9A 1MTWA 1P7CA 3R20A 5T1VA 3PEUA 2EWWA 2P67A 4A1VA 1NY6A 3RXHA 1NTPA 2PUQH 1N5JA 2NO6A 4PQRA 1O2QA 1H8EA 1LO6A 1XXHB 1ZM3A 2R65A 4RZUA 1J17T 2Q9BA 4RZXA 3KFVA 1E36B 1S6FA 1GJAB 3RU4T 5L3VA 4B3CA 2CL7X 1ZMLA 1Q57A 3AW0A 1TPPA 4A6PA 3D65E 2WMOB 4TQUS 1MRNA 1C2IA 4NZYA 3U4QB 2QGZA 1OH6A 2WYGA 1XMVA 2HXYA 1E1QA 4Y11E 1XRJA 1NN6A 2GJ9A 3UNSA 2MMGA 3I29A 3LGYA 2ZCKP 4DC9A 3ZYEA 4WOPA 1BDAA 5K8UA 2B8OH 3U60B 2Q6FA 4M0LA 2FP7B 3SOSA 2IYYA 3K0CA 3MMGA 1O3FA 5CB8A 3K70D 2XXLA 1CR4A 4PO9A 1XXFA 3K9GA 1TQ4A 2W0SA 5E2OA 5BN5A 1G3MA 1ZRBA 3VPKA 3ODFA 1DOAA 4TN1A 1FTSA 1F0TA 1UKYA 5C3NA 2G5VA 1MD8A 1YPHC 2YC2C 1Z7KA 2D7CA 1BB0B 4WWYA 1NC6A 1GCTB 2ORWA 5TJXA 4JCNA 4XWOA 2W2XA 3NXPA 3LA6A 6ESTA 2FM2A 1Z8IB 1UADA 1O5DH 5C67A 4YOIA 4LHXA 3DFLA 1JJVA 1GBAA 3L82B 5CK4A 2NZJA 1P11E 2I1QA 2AHOA 1ZSKA 1EZUC 5HKKA 4PC7A 2WAYA 5AJXA 3GPLA 1C5RA 2W58A 4YXWD 4KO8A 4E06H 2Z3CA 4MPXA 4DDUA 2OAQ1 5FPYA 2N42A 1KLIH 2B0FA 1E1RD 2EVWX 1SGTA 1TYNA 1C5QA 1T8TA 4QGAA 2ZSAA 4Y0AA 1C5YB 2JDID 2BVSH 3R3GB 4BLPA 3VGCC 2NO0A 2KI5A 1RRGA 3I72A 1AJEA 3RXMA 1RGQA 4I8KA 1HEIA 2Q9AA 1JBUH 4KELA 1MTNB 3BC1A 1BMLA 4K69A 3FMOB 3RANA 5SZKB 5BRRE 1WBBA 1K1MA 1AHTH 3ZH9B 1E1QD 2GD4B 1P04A 4JMPA 1E2FA 2IYSA 1A3BH 3LBHA 1DVRA 1T8NA 1P9NA 2GAOA 4DEYA 4PZLA 1QL7A 3GFOA 4Y0YE 3L6PA 3A7VA 5EE5B 3EXAA 2A5IA 3TJNA 1FL9A 3P27A 1KI9A 5BWMA 1CGJE 2Z6BD 3G01A 1THPB 1MOZA 3FMIA 2WUCA 2CXVA 4RD6A 3G82C 4B3DA 2BMJA 3HK6B 2JH5D 1TE0A 1W47A 3LAWA 1DT2A 2DFKB 3BJIC 3RMOH 5HZKA 1D3TB 2EEKA 4LHYA 1JMOH 1G3UA 5JS8A 2D4HA 2R62A 4AB8A 3GISB 3TW8B 1K1JA 2YWGA 1KIGH 4KCGA 1VITG 1C1TA 4YESB 1Q3XA 2P93A 1NSTA 1A5HA 4FMCB 1JPNA 1OOKB 1ETUA 1IN8A 2XTNA 4KHZA 4ZI2A 3SU8A 4OK6A 1C1NA 1HXEH 2FMJA 2GK7A 1YZTA 1L2TA 4NG9H 4B3XA 2CLSA 1QHXA 1V2WT 3GY5A 2E1RA 5I46H 3UFAA 2QXJA 2WSSA 1LVOA 1W0JD 2Q3MA 5FBWB 1CHOG 4C4PA 2GTPA 1OXSC 1GKIA 2O8FA 4IBLH 1IQMA 1SQ5A 4I1SA 5E7IA 1P9WA 1YCPM 3U98H 1G5RA 4ZV4A 1K21H 4GSYA 1X6VA 1GMCG 3A7TA 4M53A 3HKJB 4MDEA 1TA6A 4V02A 3OYPA 2Z9LA 1Z71A 3FKSA 3F3YA 5GJBA 2R0LA 2WOOA 3RXGA 2QE7A 3PWBA 3LLUA 4LY6A 1ZR0A 3EDXB 2ZI3A 1EXFA 3AVWA 1GMDG 1UK4A 1L1GA 4TL6A 3KB2A 3KQDA 2P6RA 2XZOA 4E05H 1O38A 2EC9H 1GITA 4JLBA 4TMKA 4ZHMU 4E22A 3A1SA 3SJKA 3VR3A 3VX3A 1W5TA 3NBFA 1O33A 2J3EA 1AKEA 1BMNH 3BTDE 4TTPA 4ZKNU 2FYRA 4YMUA 3SU5A 1C5MD 4K8OA 3FHOA 4W5HA 1XMNB 4U7DA 2YKGA 3LQQA 3ZZ3A 1KYNA 1C5UA 4A36A 1F2SE 2X8AA 2SGPE 3FANA 2LCFA 2XSZA 2BMDA 4U2WA 3TQCA 2F1RA 2P3FH 2IYUA 1S82A 3ZVNA 2OLJA 1L2EA 1LFDB 2CCGA 3BTME 2W26A 1VITH 4RZ2A 4F7WA 3WMGA 5A0CA 5GVRA 5L3RA 1R8QA 3KXKA 3RS5A 2QF0A 1GDNA 4GLYA 2GWHA 3T5FH 2QNRA 1IXSB 5ANRB 2R6FA 2BWJA 2VH5R 1U90A 3DKPA 3PYHA 3WHKA 1V2KT 1GJ5H 4ABIA 1KK1A 2CHGA 2H5EA 1EFRD 5JPMH 3WNDA 5KDOA 2IYVA 3GJ5A 2J45A 2QMEA 4JLDA 4LBYA 1TAWA 1T6NA 4JLKA 1GL1A 3H7OA 1K6MA 2XITA 1SI5H 2UVQA 3UXMA 721PA 1XMIA 3DT0H 3Q85A 1A46H 2FX6A 3THXA 2ZO3H 2ZF0H 4DZZA 3DA9B 3LDAA 3TIFA 2XC5A 1HDTH 3AF4A 1KDOA 4KTUA 5JFGA 2HYIC 1A82A 1LS6A 3H84A 2ZQ1A 4DCUA 1TGTA 5K8LA 2N46A 1EAUA 1ZOMA 3BWDD 2QN6A 3A4LA 4UJ3A 3X1YA 4LCBA 3ELAH 3ZZDA 4GMXA 4DCTA 4HZUA 3ZYDA 1CULC 1SGPE 4DLYA 1S81A 3KJEA 3T1VA 1F5KU 2ILNA 2GDJA 1N8OC 4NTZA 4OHWA 5TXGA 4PQFA 1W2GA 1NRRH 3P17H 5TARA 3KKPA 4TL7A 1F2UB 2AFQB 4QGHA 1CQQA 1EJNA 5JWOA 3K2UA 1ZCBA 1QHHA 3QBVA 4V0OA 1XTSA 2FWWA 1LVGA 1VIAA 1GI6A 1AGRA 3BV9B 2A5FA 4BEJA 1NIPA 4C0LA 3KCGH 2W5EA 1OPHB 3LIWA 5DHAA 1MV5A 2V6JA 1FAXA 2AIQA 1SGWA 2ZU6A 5DGJA 3SZRA 4KLNA 4LGMA 1OIVA 1DADA 4Q4LA 4DBLC 3T34A 1P9RA 4IFBA 4HDOB 1V2MT 2UWLA 1HUTH 3B13B 2ZTZA 3NEYA 3NHAA 1AVWA 2AKAB 4PQYA 4HUTA 1Y3WA 3MRSA 1EX3A 4UNNA 4X6PA 2V7QD 3NC0C 5TMPA 3QGNB 1PQ5A 2ZRFA 4FI3C 1GBFA 3K0AA 2A4OA 1YJ5A 1QRWA 4Q1BA 1EWRA 5FOUA 3SU0A 2JJ2A 1QBKC 1NIJA 7KMEH 3REFA 1HAIH 2VSXA 1EP5A 5FH9A 2VHUA 5FI0B 4Q7ZA 1EOLA 2ZPRA 1JR6A 3RU4E 4URUR 4Y71A 3C7KA 1QA7A 3DKVA 2ZFTA 4FMDF 1WP9A 1YZLA 1Y3XA 1GG6B 1CJKC 1MKXH 4TLBA 3DOEA 4DIIH 1DPFA 2IUSA 4XD7A 4RCZA 4XSKU 4ZHLU 1F2TB 2GF0A 1EFCA 4YMTA 1CVWH 2QBYA 3EAQA 4QNMA 1GJ8B 5FTNA 1CF4A 3B5JA 3NKKA 3CONA 3HJNA 3LGIA 2DWPA 3PV5A 3EA9A 2ZRDA 2JAQA 1KLTA 1LF0A 2IOTA 3QUMP 1Y3YA 3AV0B 1CJUC 1EQ9A 4LUCA 4BANB 4I1OA 4UDWH 4NA7A 5CJPA 3SQXA 4KYUA 4C2UA 2TIOA 1JIRA 1XMSA 1B0FA 1WBGB 3OZXA 2AMPA 4QG7A 5FCKA 4G5QA 1W36D 1O39A 1NT1A 1NJGA 1C9KA 4WXIA 5DGXA 3A7ZA 1OP0A 1G41A 2GHIA 1SZPA 1JNYA 3P1JA 2WWIA 5LPFA 2A30A 3BOSA 3HYRA 3A83A 2EU8A 4GHQA 1QHHB 4S35A 5JYIA 2CVFA 3AP3A 1CBUA 4LV5B 3M61U 1IQJA 4BZQA 4Q7XA 1N6NA 4HUQA 1CJMA 1PLJA 1O2NA 3RXFA 1W44A 1F0UA 3PO1C 4MUBA 3BH6A 2GEDA 5FOWA 2FFAA 3MSXA 2R2MB 1US8B 4YLUA 3RRNA 3QXSA 2CF8H 3M5MA 1KI7A 1GI4A 5PTPA 3QKUA 4JKYA 1FN8A 4D4LA 4IDPA 1O3LA 1T0HB 2F3CE 4PPGA 1MABB 3U7EB 3PWCA 1H9LB 4JIMA 3JZ1B 4UJ5A 3U1JB 1UHBB 3KQUA 3IEVA 2JETB 1JIMA 3T12A 1ELGA 1W7XH 3SN6A 1M6NA 3A37A 3MWLA 3RS7A 1QHIA 4NH0A 5JRZA 4GPTA 1QF9A 1B7XB 2NG1A 3BAFA 2VQSA 3HYTA 2FU5C 1CTQA 4ILEA 2ZEBA 1E37B 4EUNA 4I8JA 1F0RA 4GVUA 3M4YA 2ZPSA 2J0SA 1M7HA 1S8FA 1Q22A 3QXHA 5DG6A 1HAVB 5GNDA 1DFPA 1XX9A 3AB3A 5KSYA 4Y76A 3K0FA 4NYJQ 1KJZA 1GVNB 4LYFA 2ZI6A 3KGPA 1WXRA 1F6BA 1E9DA 2ZRAA 1GAJA 1FX0B 1C1SA 2ZYTX 2JKHA 2IN2A 2C2HA 2AH4X 3GJXC 2XBWA 1P2TA 4TTRA 3L2OB 4TYWA 3QF4B 1D5CA 5T6DA 1AQUA 4BLTA 2Z83A 4MRVA 5BN3A 4LC1A 1GHAG 1GHYH 1J16A 4NYIR 5FCRA 3OESA 1FDPA 1KXEA 3TITA 3W6OA 1CR1A 3LQRA 4N3NA 1S0QA 1TRMA 1NVVR 5H70A 3WYAA 1XWIA 1DM4B 2ODYB 4PSVA 1KNXA 1TU3A 1EB1H 1KGDA 1G2MA 3QWCH 1A2KC 5J47A 4ABHA 5A5GA 3SDZA 1GI3A 4JLNA 2A4GA 5H8WA 4BLQA 1CA8B 4I8HA 4TY7A 1QJ1B 3Q7QA 1FY8E 4QKQA 3RXJA 1YGCH 4CRAA 2GF9A 1NMZA 1HAGE 5EZ6B 1KDQB 3RHFA 5JCPA 1XUHA 2CK3A 1ZIPA 3THOA 5GIBA 1AIXH 1TEVA 2TBSA 1T4VH 1CO7E 1N2CE 5B2ZA 2O8DB 4WZBE 2XTTB 4DT7B 4AYYB 4NKRA 4HFPB 2AD5A 2VP5A 3AVVA 2B92A 4ASUA 5G41A 1V2RT 1AZTA 4XBCA 3H09A 6CHAC 1EFTA 2YNMA 3RSLA 2VGCC 3ICEA 1KK0A 2B6HA 1E9BA 1ZNXA 2P65A 5GWZA 1VDZA 3TE6A 4O9VA 1W2KH 1PFXC 5EE9A 3MU5A 2ZE6A 3GY6A 1RJ9B 1VCIA 3ZVDA 4MDSA 2ZTSA 1ARBA 1DX5M 5AFYH 2HLDA 3T1OA 1FUUA 3Q76A 2W00A 1HAVA 4KODA 3R8FA 3I77A 1C2DA 1WBDA 1C2EA 2YOFA 4URWR 2CK3D 1TMBH 1DE7H 3RXQA 1JB1A 1ZM7A 2J2UA 1C5ZB 1ONBA 2G77B 4F4OC 5GADl 4EQ6B 3SBEA 1Q1EA 2BJVA 5EUMA 2ZRGA 1Q2WA 1EESA 3RXTA 3EGKH 3UWJH 5CE1A 2BD5A 3AASA 2NMVA 3BTTE 1KSNA 1TFXA 1WOFA 3H7TA 2CJIA 2BOVA 4ZH8A 3KKQA 3RRMA 1JR3D 2D8WA 4IDOA 4ZIRB 1CT2E 9LPRA 1NFYA 1P2KA 3GLGB 2VPPA 2BDGA 3GLFE 2IYXA 2QMUA 3LD9A 2XRCA 3MG9A 1XD2B 3K6ZA 2Z3EA 4ZMAH 2B8WA 4XOJA 3MAAC 1YPLH 3QNUA 1DAMA 2VIDA 3BFVA 1OXVA 2GILA 1XFAA 3DFJA 2IYTA 1O87A 1ZPCA 4CRDA 2W7UA 5EE0A 3SUFA 1NN3A 5ESTE 3RLYH 2BLWA 1Z0FA 2WV5A 1Z08A 4JT4A 4OHYA 3ZIAA 4DT1B 4J0QA 821PA 1P10A 3PLPA 4D25A 3EX7C 1UKEA 1KDQA 3SU3A 3A36A 3U7HB 1G3BA 2FF7A 4I1UA 4CT5A 2GXQA 1BQYA 3C4JA 4JYBA 1VG1A 2H9HA 1NBMA 3RXKA 4EFLA 3MH4A 1DPOA 2GX4A 3NUMA 1QDEA 2O8DA 1JEEA 3DZ8A 3LWNA 2QTFA 4BRWA 4XBBA 1T5IA 1P12E 2A45B 4K8BA 3WY8A 2ZGBH 5LPEA 2O0HA 2IYLD 3ZZ4A 3KKNA 4FWTA 2O8LA 2R0KA 1A4WH 1C1WH 1YLDA 2QE7D 3R7WB 1ZINA 3X1DA 1O3YA 2BMEA 2YNAA 2HJVA 3SI7A 5B58C 3TNSA 2GXUA 4DOQA 1WYKA 2MSDB 1BHXB 1ZVQA 421PA 1YR8A 1XUIA 2ALVA 2DR3A 3DHKH 3GCTG 1W7AA 1KDRA 3S7HB 2C95A 4O2LA 2HOBA 4TTQA 1TQ6A 3RC4A 4QFMA 2AMQA 4CEJB 4P4UA 2HVXA 1QRAA 4URXR 4B75A 3GP8A 1CU1A 3EZFA 1OYTH 1ELAA 3QXCA 4LJ4A 2WJVA 1OP8A 5P21A 4DSOA 1PZNA 4K2YA 4EPVA 3ENSB 4QM6A 3PEVA 5HZHA 1FPCH 1Y3VA 1GPZA 4DUGD 5AJWA 1W3CA 2BY5X 2PKSB 1NKSA 1ANKA 1S1CA 5C1UA 1XEWY 1S3GA 3NWUA 3M5LA 3TJUA 4TQAA 4NIVA 1KK3A 2XCFA 2C9CA 4JBYA 1J9CH 1L4DA 2WHXA 1CBWC 3NCLA 4YXWA 4PZZA 4JYVH 3OIUA 3BTGE 2EI6A 4DDTA 1P02A 2GGVB 2WWWA 2V35A 3IWMA 2ZSDA 2ZFQH 3PVSA 4AZ2B 2H5CA 2WMNB 3URCA 3MO3A 4Q4JA 4OHXA 1Z29A 1XUGA 2QA9E 2G0TA 1C2LA 1VJ9U 1E35B 3OSYA 1PPCE 2WKRA 2ZRIA 2A7JA 1FFHA 5KSZA 4V0MA 5KNDA 1NFUA 4WAUA 4E03A 5FBQB 1P4SA 3LDXH 4LOAA 1FY3A 4H1UA 3IHWA 1RRKA 1QHGA 2Z9GA 1AK2A 4LHWA 4KP0A 1NF3A 4E5UA 2OTVA 4F4JA 1SSXA 2E9SA 3FVFB 1OP2A 5EXPA 3M7UA 4QJ3A 2AD1A 5IHPA 3GLFA 2ZPTX 1OYQA 1ELBA 3BB3A 2Q0HA 3R9IA 1YYY1 2FDAA 1S83A 3TKLA 1C5SA 3FFGA 5F8TA 3KFXA 2F4LA 2GXSA 2X2EA 5F8ZA 1W10U 3ICQB 3PTNA 5GXPA 1SVOA 3WYGA 4HAYA 1BTXA 1UKVY 3U7FB 2VSOA 4ZKRU 4JL8A 1VG8A 5EQSA 4DGJA 2FTLE 2R8RA 4RJLA 4R98A 5EOKA 2H7VA 2QGRA 4LHZA 4IJMA 1YM0A 2OEPA 4MGIR 2P94A 3KJIA 1HT2E 4X1NU 4TMVA 3D8BA 1IQNA 2CLDX 1WDTA 3TMKA 1LDTT 4I8LA 1JPJA 2XW9A 2GK6A 4TYDA 3E1SA 1KNQA 4UFDH 3LLMA 5DIFA 4Q9JA 1II0A 2GMTB 1EPTC 2ZRLA 1XNJA 4LBZA 1ZLRA 1XUKA 4XIGS 4LYAA 4IDQA 3OU0A 3STJA 3TVJB 2WPJS 2ZJZA 1U6QA 5M04A 3CIOA 1OYYA 1MKXK 1Z1IA 2VGCB 3GDUA 5EQQA 1K9OE 3RM0H 2WYJA 2QXHA 2B8TA 1KY3A 2PV9B 4DEXA 2ZE5A 4II7A 3MMPA 1KXBA 1F5NA 4PR0A 1HFDA 3I62A 2BY9X 3LH1A 2G00A 1Q31A 5IYTA 1AGJA 1QFKH 2GA8A 1GHXH 5EU8A 3PITA 3QY0A 2F1IA 1Y3AA 2ERXA 2QM7A 2ODEA 3AAUA 1AZZA 2VWMA 5J4LA 1Z8FA 4FUBA 2AFIE 3A8DA 3ADDA 2V0BA 1F0SA 4PTLA 1SXJA 4XTCS 3BS4A 4DB2A 1GGDC 2ALPA 4NWLA 3UTUH 4LBWA 2GVFA 2ZP0H 1R10A 3AKYA 3F5FA 3QSYA 2ASEA 1GI9B 2V3OH 1C2HA 4AIIA 1N6XA 3OFNA 1RS0A 4OYHA 2WWYA 3U7GA 1O2HA 4QBGB 2YOLA 3EZ9A 5KHOC 5HR5A 3RLFA 1K1PA 1P9SA 4LDJA 1AUJA 1G16A 1OFUX 3KX2A 1F7ZA 4TZ6A 4F38A 5JECA 5FUYA 2ZRNA 2BOHB 5GJ4B 5JHHB 1NJFA 2O5VA 5CDFA 3FKQA 4A1FA 2JCSA 3VB7A 3S9AA 2D1JA 1ZP6A 3RXSA 1EB2A 2FE4A 3PEYA 2BLQA 2PR3A 1ETTH 1UCYE 1GRRA 3BRWD 1I4TD 2PBRA 2GZDA 4D0GA 3WY9A 3GLHB 4UQOA 1C1PA 3ADCA 2NU2E 1E96A 1UTKA 2W6ID 1AE8H 5JBQA 3PMHB 4CEHA 4O3UA 5CJ2A 1WUNH 4PROA 4ISIH 1GBKA 1B0UA 1GJ7B 4FXPA 3QXXA 2FLBH 1VIYA 4NBSA 4M9SA 4RKJB 1N3BA 5AWFC 1WQVH 2PKSC 4HATA 1IQHA 4E7RG 2QU8A 4OL0A 4G01B 2ZUCA 3DEFA 2QL6A 3OY5U 4NDZA 3OEHA 3A4NA 1KZ7B 2ZPQA 1Z63A 4X8OA 3CLVA 2C77A 4B32A 2GCNA 4IVRA 2D74A 4HZUB 5SZIA 2C98A 3L3TA 1SXJD 4M9XA 1RRCA 4R2HA 4Z1MD 1SVWA 1SGIB 1GHBG 2C04A 4TLEA 4DSTA 2NO7A 2QYIA 1DLKB 5DH9A 1PQ7A 2ZSFA 1Z6JH 3SV7A 2Q21A 1OV4A 5JBCS 2YOGA 1LHDH 2QF3A 3M35A 4YO9A 4GP7A 1U94A 4FXGH 1N0UA 2YJTD 4QRHA 5EP3A 3V0XA 1EAXA 4TPYA 1QG4A 1UVSH 1E99A 1W0KA 4M7GA 1VPLA 4TLCA 1FMGA 4MGZR 1FXYA 1XPOA 2UUJB 3FHTA 3I3SR 3TPIZ 1TUIA 1NSFA 1U9IC 1BMFD
chains in the Genus database with same CATH superfamily
1G3IA 2BDAA 3CUWA 2B6NA 2FX4A 2SGQE 4CMEC 1FU7A 3DCLA 3B3JA 4JLSA 1TGCA 1NLFA 1KI4A 1NDQA 2ZSJA 5CVJA 3O1HB 1ZH4A 1Y6QA 2QVXX 4NNPA 3ATKA 4ZDIA 5LU8A 5AOAA 3NHKA 3O9VA 3V8BA 4MVJH 4X8SH 4CRCA 1UIRA 2WQZA 3CR3C 3QK7A 1J21A 2ZRMA 3M4JA 5HF6A 1Y7PA 2I7CA 3H5NA 3KLPX 2BR5A 3HABA 4ER7A 3JW8A 2HSGA 4X0WU 4TKZA 1GVZA 1WQ1R 2OCYC 2NTYC 1L7NA 3CUVA 4PU0A 1Q3HA 4YAWA 2R1TB 5B7NA 5HIYA 1R5JA 4EMTA 4MS4B 4QYIA 5TGDA 1MAHA 5ILQA 4BAZA 3N2IA 3I61A 1PPHE 3DC2A 3CKLA 2BP7A 4BO5A 3TCNA 1I4WA 4RTLA 2M9MA 4B6FA 1LKZA 1R8XA 3AM3A 4LDAA 2AKEA 1C7RA 1ZJKA 3E16B 4JZIA 1UKAA 2QTGA 1D6RA 5CLFA 1Q14A 4RV9A 5DISB 5CMXH 4H6XA 4XOUA 3GBVA 1EKXA 4IMRA 2BZ6H 4BQFA 1K5HA 4GMGA 1RAEA 4B84A 1N75A 3B1YA 4RM3A 4GI3A 5F35A 2PYZA 3R5SA 2PGJA 3DAHA 4O4JB 5GONA 3QI7A 3WNCA 5BXYA 3JSXA 1XTJA 4L16A 2OFPA 5LQCA 4F4IA 3KQLA 3L7CA 1LVYA 4NFSA 4YT4A 5AI4A 3EGDA 4IC5A 1WXEA 1TCCA 2QPAA 2V7BA 3FPCA 4LISA 4MV9A 3MA0A 3EVFA 1PJ4A 4Z49A 1VRWA 5BN4A 1C7IA 2AIRA 3OCJA 5HEKA 3COJA 2VVUA 3OA2A 4CMEA 3SZLA 3CWCA 5I7OA 2L74A 4O59O 1E2LA 3RRBA 3VC7A 1XCPA 3I5MA 3CO0S 3ORHA 3EYDA 2OVFA 1KZ6A 3NHYA 4RELA 2QMQA 2XBMA 1QIXB 2BFDA 1OKKD 2V5VA 3HJHA 3HZRA 1GSIA 3U49A 4XVUA 3K5HA 1N6HA 2IJOB 4V3BA 3OVMA 4ZOBA 4AMZA 2Q6DA 1R6XA 2Y68A 1EX9A 2ODQA 2ZB7A 3JWHA 3IIKA 4HGNA 2O07A 2K1QA 4XDEA 5CLHA 2TRSB 4KV9A 2PSJA 1FZZA 3ELDA 4LYJA 4I1RA 2C42A 2Z6VA 1NTOA 2R2AA 4GZLA 3WJAA 3M6UA 1BCUH 1MKYA 1V8DA 3KTAB 3E7WA 3O0DA 5E9JA 2CHVA 5CTAA 4AWXA 3ZIAD 4LDNA 4XVRA 3FOEC 2B1GA 3KOZA 4HB0A 3MJRA 4BJ6A 5CDSA 5LM3A 4RKOB 1CB7A 1XPRA 5BUCA 1HYLA 1S85A 1UJ4A 2J46A 3PDIB 1P74A 3ZJYA 3MJTA 4IJWA 2JZOA 3D8HA 5F1KA 4CR8A 1TZ2A 4Q39A 1SU4A 4B0PA 3S2SA 3BX1A 1M8GA 4LK2A 2AGEX 1BS1A 3K09A 3D62A 4R2JA 3EGCA 5E9AA 2D5BA 1FRQA 1KXDA 3HJFA 4ADSG 4XD7D 3UBMA 4E09A 4RULA 4P3XA 2JFPA 1OA0A 4UAVA 5HSGA 5IRCD 3RUOA 5C37A 5EYPB 3JQQA 1NXPA 4Q63A 1ETSH 2RHHA 3NIFB 2G1AA 3WZLA 1GLGA 3JQDA 1AO3A 1UINA 1XEFA 2G1UA 4QGFA 1SQFA 1Q1NA 1Q2XA 3VR5A 4HTFA 4MQ6A 2FPLA 2C4UA 3ZXXA 4QVIA 2O23A 4JBLA 4CF3A 1PZMA 1E79D 4KFTA 3SSAA 1VKHA 2E18A 3WJ2A 1PWXA 4XIYA 5L3QB 3K9WA 1CZNA 2A1DB 4FC6A 1GQRA 1RVDA 2W48A 1Q83A 1PL8A 3V8EA 3H5TA 2FMIA 4YV1A 1BRCE 4FONA 5L6MB 3GVHA 1LY1A 1ELOA 5IKMA 3Q3GE 1T0PA 3K2EA 3WRXA