4B76A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
total genus 211
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b76A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b76A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b76A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b76A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b76A03
5LBIA 3LWNA 3T35A 2QAGB 4RD1A 1LS1A 4TL7A 2F9LA 2GTBA 5IDKA 1MKWK 2KSQA 1Z8FA 1UCYK 5IT5A 4V0OA 1MCVA 3KXLA 1O3GA 2ORVA 1A82A 4A92A 1BRAA 4Q7JB 2EWWA 4XBDA 1GL1A 3GJ4A 3C5CA 1OHHA 3GLGB 3CW2A 3TSWA 1ONBA 4QT8C 2QG6A 4ZAEA 5C1UA 8LPRA 3LNCA 5JBCS 3SYJA 2F1HA 4WVFA 2BMDA 4WXRA 3A85A 4DB2A 1C1MA 1EXFA 3RU4D 3N7OA 1DOJA 1WAYB 4RKOB 4IMZA 3OIYA 5H68A 7ESTE 3ATMA 4GAWA 3SQEE 2Z3EA 5DYIA 4B48A 5J4QA 2F9OA 3K9NA 3R20A 1DVRA 2ZC9H 3H86A 3T1TA 1O2RA 3MO6A 3OFND 2ZE8A 2I1QA 4TYYA 2O8LA 2AFIE 3FE2A 3NC1C 4HAWA 1E37B 3VR3A 5FHTA 3A8CA 5A5GA 4LK4A 2VJ1A 4KODA 3RXKA 3LDXH 2KB0A 4DVGA 4JL5A 1Y5AT 1NY6A 3TVDA 2GCHG 4Q7XA 2M5TA 1T9HA 2EFGA 4MRRA 3BXZA 3SI3H 4CRDA 1W46A 1GI8B 2NO7A 4TSFA 3SV2H 4PHHA 3EE0B 1SXJA 1OYYA 4I1UA 2UZIR 2GEDA 4MTBA 4A6PA 3HU2A 1LB1B 1MZAA 4IRUB 3MMPA 3GJ3A 3C8UA 1NRNH 1DE7H 4XE4A 4QKQA 2O8FB 2AEIH 3AKEA 3A7XA 2QRZA 2HPPH 7LPRA 1HAVA 1AB9B 1GDDA 3TJNA 2GCOA 4M8NE 2R2AA 3BG4C 1C2EA 3KN2A 3F9GA 2NPIA 1BDAA 1E32A 4KVGA 3OEHD 1J99A 2GK7A 4HB3A 3VR2A 4NGAH 2B7CA 1GI7B 4HTCH 3KL4A 1ZJDA 3EW9A 3CZPA 1E2GA 1TNHA 1ZM2A 4OI2A 2TBSA 5C3NA 1QTFA 1W0JA 5BN3A 2J5XA 4L9SA 1IQFA 1DAMA 4Y7AA 2PV9B 5AFZH 3K8YA 2OFOA 4ITRC 4AG5A 1YCPM 1GCTC 3NUMA 4NCHA 1N0UA 4KXFB 4B3FX 1BA8B 2NU2E 2FFQA 1E98A 2REXB 3GP8A 5SZIA 3L82B 5FR2A 1TX7A 3KUDA 3PWCA 1YC0A 3A4LA 3CR7A 4AX9H 1K22H 2R3YA 2QE7D 2OLGA 1O3NA 4W5WA 4IBLH 1MAYA 2WVJA 3QXJA 1FPMA 1O2TA 2NTYC 1YYY1 1O3AA 2OBOA 3VFDA 4D82A 4DT1A 2ZE5A 2GMTC 4TN1A 1BIOA 2C4FH 4NP6A 2JLXA 1AS2A 4I32A 2EWVA 2OT3B 3TNTA 4OKSA 5FUYA 1P3CA 3VXEH 5C18A 4D76A 1ZSKA 1QVAA 5EZ6B 4BFTA 1WB9A 4KITB 1T3HA 1DAIA 1I2MA 4DIDA 3A1TA 1NPMA 1R7RA 4GNKA 4ZKEA 2JLQA 3MRSA 1LO6A 1ZMLA 1D3DB 3JZAA 5IK2D 1OH5A 1HQCA 3THXB 1E2FA 3IPXA 3KQEA 3LX5A 1O2JA 1AFQC 2GESA 2GF0A 2O9QA 4FMBB 3C1KA 4UDWH 4CDGA 1V2WT 3NDBB 1CU1A 4KTUA 2XTMA 3BGWA 1BTPA 4JIMA 3JZ2B 2G4TA 3LX8A 1B7XB 2AK2A 1Y5UT 4BRUA 1H9IE 1LVBA 1KZGB 3KJIA 4AFSA 2WM9B 1CT2E 3GLHB 1DS6A 4HSEA 2QZ4A 3W8NA 3ENSB 3MJHA 3FKSA 2H1LA 1SGWA 1F2UA 3WYAA 1WE2A 3LC5A 1Z28A 1HIAB 3V4FA 3HYRA 4ABHA 4NYJQ 4ZCLA 1UJ2A 3EPHA 2Z3CA 1YZKA 1SOZA 1XXDA 4ABAA 1OXXK 1SQAA 4BFUA 2RMKA 3QTOH 1L4YA 3ZZ6A 1GRNA 5HXFA 4E07A 2BDCA 2FEOA 2VP4A 4TLEA 1Y8TA 1SHZA 3PLKA 5FBEA 1QR3E 2TMKA 5E3HA 2F3CE 3GDUA 1UK2A 3LONA 1A4RA 4LZZA 2KAIA 2YC2C 4AG2A 4X6MA 3BH6A 5EXLA 4GCHG 1PQ7A 3MNXA 3IIJA 3QKRB 3DVLA 3LLMA 3L0OA 4Q02A 4X2YA 4A2PA 1N5JA 3LIWA 2FZLA 3K70B 3T5DA 1LKAA 1TQ0B 4KELA 3IILA 4Y0VA 2JLYA 3I77A 1TQ2A 2IYTA 1N25A 1DFPA 4ON9A 1RFLA 1T5IA 1M7GA 1US8A 1XUKA 5JSZB 2B8WA 4KLZA 2DFTA 1XTRA 4LJ4A 3PO1C 1I4TD 2YNMA 1VR1H 4C2UA 1C1PA 4BTIB 2AN9A 4GVUA 2FTLE 1GL9B 2DWOA 1ELCA 1IN7A 1F5LA 1H8HD 1ANDA 3U7GA 1IN4A 1OIVA 3D65E 5JECA 4ZO4A 1IJFA 3DFJA 2ASUB 2CV3A 3AVUA 4V0MA 4Q9KA 4B6EA 1GP2A 1C5XB 4JYUH 1ZU5A 4AZ2B 1A0JA 2A5IA 4G5SA 1O2VA 3N5CA 1A46H 3I61A 2H16A 8GCHG 2C03A 1C2HA 4NA7A 3WMFA 2VHUA 4A9AA 4HUTA 1HT1E 4O25A 3LGIA 1RIWB 3CB4A 1C5RA 2D1JA 1E6CA 2G6BA 2A5FA 1WTHD 3THWB 2XB4A 4X1QU 2ECKA 5FI1B 2QC2A 5DI9A 4ASUA 4IEEA 4P4SA 2W7SA 3RWOA 2C96A 3ITIA 1NSTA 2RGGA 4ZDIA 1SKYB 1YPMH 1YLCA 1M2OB 1ETSH 2BV3A 1BIFA 1ZNZA 4ZUHA 1TLDA 3S9CA 4RZ3A 2FPZA 4JLMA 1EKBB 2J9RA 2ZQ2A 2WJJA 3T5GA 3EIEA 4SGAE 4Q00A 2P6NA 5KSZA 2FX6A 4U5XA 1G9XA 2ANWA 2EFHB 2FS8A 4GSYA 4DCTA 2P3SA 2FTMA 1Z6JH 2GT8A 2HDNB 1EZQA 3CRMA 2Q9CA 3CIOA 3BFKA 2V1UA 5KOYA 4TTQA 1TQDA 4B35A 5EE3A 2FOAA 3G0HA 1XUFA 4LWZA 4L4UA 5ANRB 2D2EA 4FINA 1D9IA 4XVUA 2REBA 1GPZA 2Z94A 4ABGA 5AUNB 3GLIB 4DCDA 1QFKH 4YTAA 2JJ1D 4JK5A 1KYNA 4M2LA 2ZTXA 2Q1JA 4O3TA 2KI5A 4K1EA 3LXXA 2BVNA 2PLRA 2KBEA 4UNRA 2BCGY 1DSTA 4L16A 2GCOB 1XCPA 3ZZ0A 4D81A 4BASA 5CDFA 3VB3A 1M7BA 3U3RA 4AKIA 4JL6A 4C30A 1GAJA 1VCOA 2F9BH 1TGSZ 1GILA 1W0ZU 4BLTA 4GPTA 2QF0A 4EQ6A 2H7VA 4DSNA 2A32A 1PZNA 4GOXA 1CLUA 1JAIA 1P7CA 1JR3D 5G40A 1KOFA 3I32A 1SXJC 1ETTH 2ZRDA 2Z3DA 4PHTA 3KF2A 1T4GA 5JCZA 4S35A 1CS4C 2HJVA 2QV1A 1MRSA 2C90B 1AS3A 3GJ5A 2B6HA 1NMXA 1A4WH 5ESBA 4ZCIA 2IHBA 1FY3A 3QY0A 2O8WA 2D06A 5EXNA 1BS1A 4OS5A 2GAAA 2P93A 2C99A 1D6RA 2ODQA 1MTUA 1C5YB 3A88A 3NK8A 1GHBF 4G1UC 2VQSA 4Q48A 2HXSA 2WJGA 3E90B 1FQKA 4KJZA 2SGAA 1A1VA 3BEUA 2IS1A 4NBSA 3TPIZ 1C5NH 4XD7A 4B2BA 1NJFA 2HLCA 3A8AA 1FI8A 1IN6A 2R2MB 1DPOA 3MMGA 5A09A 1ZD9A 1XX9A 1N2CE 2VWLA 1WDTA 4B1TA 4M22A 2GJ8A 1C5SA 5FX5A 5KYKA 4BEBA 1E9CA 4UNSA 4Q4JB 4F49A 1TQ6A 2KBFA 4OQFA 4FD2A 2P6UA 1G7TA 3B6EA 4G0NA 2N46A 4AC9A 1KSNA 1PPEE 2F6RA 1G7CA 1AZZA 3ADCA 3AK5A 2GXQA 1SGTA 1FMJA 3NCLA 4BZPA 4QBHA 3CO5A 2ZEJA 1R0YA 1OX1A 4QHSA 3I78A 1IAQA 4E7NA 3T15A 4DUGD 4YT6H 1J15A 2OCPA 4HI3A 1ZMNA 4YLQH 2PT7A 4DLWA 1XWIA 4R0IA 3SFVA 2VP5A 5JWRA 3T1VA 4X1PU 5EPNA 1CR4A 3LBNA 1O3HA 4UXIA 1E2QA 5AJVB 1Z6GA 3B82A 1P75A 1PPZA 4ABFA 1OYWA 2ALVA 3GISB 1Q3TA 5F8XA 4AK9A 3Q7PA 4X8HA 2ZO3H 1NC6A 2BLWA 2H2ZA 1JIRA 2GX4A 2REOA 3EA0A 3BTTE 2J7KA 3QKRA 1Q3XA 1I4DD 4MGIR 3CX7A 4INKA 2VIWA 2ILNA 3FGNA 2PR3A 3UOUA 1EP5A 1W48A 3SUFA 3LC3A 2FU5C 2ZI4A 2BBTA 2CHAC 2O8CB 4URYR 2PKSC 1SULA 3M5NA 1YPJH 4AIIA 3OY6U 5CITA 1WBBA 4WIAA 2NGRA 4D80A 4MKHA 3SNBA 1E99A 3ZS9A 1TEVA 4Y8ZA 5H8WA 4I1VA 1TNGA 1US8B 1O3KA 3SC3A 4CW7A 4Y11E 1NLYA 1W4CA 3TGKE 3A83A 2E87A 2ERYA 2BJVA 2R65A 1WA5A 3AM1A 2GBLC 1G2LA 4BQSA 5FUVA 2CGAA 2PCLA 1EZSC 4I8LA 2A1DB 4XTCS 2G51A 2W2VA 3SU8A 3GJ6A 4QM7A 4CRGA 2O8BB 5IHPA 3RWMB 1KDRA 5HCIA 1N6RA 5CM9C 3A7YA 1GBFA 5KPJA 1DUAA 4CIDA 4XD7D 3ODDA 2PJRA 4QM6A 4LXBH 4TPIZ 3TJUA 1II0A 2AMPA 5B30A 3AGQA 3SNHA 1RC8A 4DJZB 2VHJA 1Z08A 2KAIB 1V43A 2FWRA 2Q6FA 2DWQA 2ZI5A 1OS8A 1JWTA 4B3XA 3S69A 2G88A 1L4UA 3LH3A 2W2XA 4IDHA 5FBWB 1KHTA 1O2SA 2RGNC 3IGFA 1AVGH 1YR7A 5FOXA 1O87A 5C46F 1GBAA 4P4SB 2IUUA 4NCYA 2GF9A 2W6IA 4A1XA 3Q85A 5EUMA 1OKKD 2WJIA 1MCTA 2OQ5A 4TTRA 2Z9LA 1S3GA 3EA9A 2WINI 1CXZA 1TUEA 4TYNA 1QGFA 1E0AA 1UBFA 4D0GA 2GKSA 6GCHG 2Q9AA 2H8KA 5EXPA 5DPAA 2I4IA 4V02A 2BXUH 1I2DA 5BN5A 1YZQA 1NN3A 1DXWA 2AR7A 2ZRIA 2ZJOA 1Q1BA 1ZMJA 4IDPA 4IHQA 4D9QA 2IYRA 1SGIB 1T91A 2QT1A 1ANCA 3ETLA 2YWFA 1W2KH 1KAOA 1YGCH 1SQ5A 1G3MA 4RI0A 2HOBA 3CF0A 1AD8H 3N2EA 1XCMA 1D9ZA 3DPUA 1H9LB 1BRBE 2IYUA 3LXRA 1RW4A 1CULC 1ELAA 1W0KD 2AGIX 5E7JA 3VGCB 3PMJA 1SXJE 3SHWA 1FN8A 1IQKA 2QU8A 2FSIA 3FHCB 4Z8XA 2B7BA 4F7WA 2JLVA 4URXR 621PA 4V0KA 1GJDB 2YKGA 1WQVH 3K2UA 3T34A 3O47A 1RIWC 4LHVA 4RSPA 1ODFA 4TYWA 1AUJA 5CYOA 3CPEA 5CIQA 1K1LA 3M5MA 1KI3A 3UNRA 3L8YA 1Z6XA 4W7SA 2IUSA 1LVYA 3A36A 1QURH 4HLUA 5J4YA 3I73A 5GPIB 1LPGB 2Y8EA 3X1DA 1GGDC 3PUYA 3IO3A 3BE4A 5FBIA 1N6OA 5EXTA 4P3YA 2XWBI 1EFRA 4U00A 1GTVA 3M36A 2WKQA 2GEVA 2UWLA 3MD0A 3K1JA 3AAVA 4PC3A 1PYTD 1INCA 1GKIA 3K53A 2BX4A 2ZRAA 2XBYA 2GVDC 3GDSA 2QP9X 2G52A 5HCNA 1F5KU 2JLUA 3A1UA 1C1TA 3EZFA 4FI3C 1TBRH 2ZVQX 1LHDH 1X8LA 1W36C 1JBUH 1C5MD 2WBLC 1PUJA 1G5TA 5LD2C 2FM2A 5FBRB 3P4XA 1R0WA 5C5NA 2IF0A 3VB7A 2V54A 3H7OA 1E38B 2QMUA 1EZUC 3LJJA 1DG1G 4ZI3A 3AP3A 1E1RA 3TK9A 4A82A 4JZFH 2OBLA 1S84A 2V0BA 3AVWA 2J7PD 2W6JD 1GHXH 4ZHLU 1GJ4H 5GIBA 3AVOA 1OWKA 3M61U 1PQ8A 3GY3A 2JLSA 4OQXA 1Y63A 1BO6A 1YZUA 3T61A 2HJGA 1C5WB 1KK0A 4TMXA 5AHGH 1YP9A 2ZDLA 3QVVA 3SFZA 5EQSA 2G55A 4I31A 3K0EA 1NVUQ 1LV7A 2VRWA 2ATVA 3JVUA 1L8QA 3I8SA 1CJMA 1JR3A 2GT7A 4FCVA 1T32A 4D8NA 4KFRA 4Y71A 3WHKA 1BOFA 1BKDR 3RRYA 5GDSH 2XX3A 2P59A 2WYGA 3MH7A 4OBEA 5JHGB 1GHZA 3LH1A 5DN6A 4B3GA 3IIMA 1MO3A 4M9SA 5A0FA 4NDZA 4D0LB 3TR5A 3FZDA 2ZSFA 1N5LA 4WMEA 1XM1A 2DCUA 1P62B 2PSYA 1TF5A 3A7VA 1QBVH 3UKDA 2ALPA 3QGJA 1ZU4A 2QAJA 4ESHA 3MJRA 4TTPA 1P2TA 1EXMA 1Z83A 2FV8A 2VIQA 1CT0E 1Z8JB 1G1MA 2J45A 2CF8H 4DC9A 1Y3XA 4V0ME 1N8OC 2JH0D 5TY0A 4INLA 1U98A 1C1YA 1P9SA 2P6RA 1E4YA 3NBFA 3BIUH 3WNDA 2EFDB 3CNNA 3MWJA 3HGPA 4Q9IA 2QN5T 1NJGA 3PEWA 3E0PB 2X77A 3HYTA 1OE0A 4X6PA 1C5ZB 4DVAU 4ZCMA 3GYMA 4MQBA 4BFXA 3BG8A 2QY0B 5FX6A 5E0HA 4XWKA 4KSCA 4LJYA 1ZRHA 3NH6A 2UWOA 1OF1A 2C8XB 1PVOA 1MKXK 1G19A 4N0EA 3F1SB 4TZ6A 2XC5A 4DSTA 2PX0A 1AFEH 2Q21A 1DAFA 3FFAA 3C41J 5CK4A 2OD3B 3C4JA 1MTNC 2HCBA 3HJNA 1UAAA 1KXBA 1V2JT 1TUIA 3LDAA 1XTQA 1ACBE 4DUGA 2GXSA 3W5IA 3QBTA 3EWSA 4WXIA 2ZU0C 2YOLA 3ZDQA 4IW4E 1T0JB 4IKEA 3T28A 1HB0B 3L0PA 2V3OH 2HCJB 3MWIU 4ZIRB 3ZJYA 3I5YA 2OINA 3IEUA 3VR6A 4V03A 4US2R 5DH9A 4PPNA 3NH9A 1EAUA 3PEUA 4Q1BA 2Z83A 1NZQH 3LQQA 1XEXA 4UFEH 4LX0A 4DCVA 4LSGA 3VKHA 5G41A 3AKDA 3IIKA 2I1VB 1E1RD 4AORA 2GETA 4ZKNU 4GHQA 2GDJA 1AO5A 2J46A 2JIZD 9LPRA 1CEEA 1DUEA 1IQMA 2VU8E 2AIQA 4LHXA 2GD4B 2ZHQH 5L30H 1XMJA 3OIUA 3WNBA 4K3JA 1G21E 1PV4A 3OY5U 3S9AA 2FPLA 1P2SA 1YU9A 2A5DA 1YPLH 3RSLA 4RKFA 3SORA 4PC1A 2FDAA 2V7QA 4G5RA 2VF8A 2OBQA 5B57C 2IYZA 1N6XA 2TGPZ 3DEFA 2IS4A 3SU3A 2XJ4A 4XWOA 2AMQA 1IXSB 4B2PA 3MLEA 1IY1A 4QXAA 4DB4A 3CZQA 1KI6A 2WWHA 4URVR 5BXQC 2JH5D 4B2IA 1KNXA 5C1YA 1O39A 4AD8A 3LBIA 5HZHA 4K46A 1C1OA 1D3QB 4Q1CA 1BZXE 2FN4A 1SPJA 1VDZA 4IGDA 3AVTA 2AD5A 4Y0AA 2IYVA 3SU5A 5JBTA 3PLBA 4I7YH 4WJG2 1TPOA 3QKSA 5DI3B 3EXAA 1HCGA 1GMCG 5AJZA 1KY9A 2VBCA 1Z2CA 2IYQA 1XUIA 1UBCA 4WOPA 3F3YA 4OM9A 1ZM4A 2F4LA 4PQRA 2C04A 3KEEA 1S0QA 5M04A 4X8VH 2R0KA 1UFQA 3GFOA 3EAJA 1TX6A 2W7UA 2CNWA 1XB2A 1GJAB 2V35A 4CR9A 1GL6A 1NU9A 4QHTA 4GBMA 5GJCA 2IXFA 3FPAA 2YV5A 3AUXA 3HGNA 2UUFB 2HYDA 2YC4C 2QTFA 4RD3A 1XEXB 3ZYEA 2OESA 1AWHB 3B13B 2V6JA 5TMPA 1XPUA 4ABBA 4NH0A 1Y5BT 2PMKA 2ZRHA 1HTWA 3PFIA 3R7WA 2Z9KA 4EAQA 3AF4A 2RGCA 1AA9A 4EFNA 1H9HE 4QRHA 1P01A 3W94A 5E0JA 2GVFA 4O9VA 1FOEB 1V2UT 4C0QC 1FP6A 2O8DA 1UMAH 1UK4A 3OZXA 2WZQA 4HYYA 3K0CC 2D2FA 2H5DA 1T0HB 1OH7A 2BLOA 1TONA 1GJ8B 1MKWH 3PR1A 5AUQA 5A8ZA 3A8TA 5EXXA 3W34A 2QBYA 1LVMA 3GY7A 1O5GH 4IMQA 1KXCA 3REFA 2BD4A 1KSGA 3SYKA 1UPTA 4AI6A 1V2RT 1F0RA 4YXWA 1UEIA 3BK7A 1COWA 3OAAD 4AGJA 5FL3A 4DLSA 2XZPA 3T29A 2F1IA 2AXPA 1AZSC 4JYCA 4NCJA 3B1XA 1PPFE 1G30B 1ZIPA 2Z4SA 3KQNA 3P26A 3FWYA 1QVRA 3NXSA 5KNCA 1EASA 1ZMXA 5A8YA 5J47A 1K1MA 3NBZC 1XBTA 4XTRA 5L3QB 3TRFA 1NFUA 2FOFA 3QKSB 1OV4A 1JRTA 4YXWD 1UTJA 1QBOA 4ISIH 2ZU4A 2Y80A 1TF2A 2R9PA 1GG6C 1K9OE 2AWNA 1SZPA 1MABB 1RRFA 2FOGA 4Y0YE 1E2KA 1O2ZA 5GJ4B 3NEYA 1C1WH 2G81E 1P09A 3RM0H 4LGMA 1VG8A 2UZ3A 2FS9A 1UVOA 3QWCH 1KO8A 1QB1A 4AKGA 4JZEH 1E2EA 4R71A 1JQJC 4IVRA 1WCZA 3TQFA 121PA 5FBVB 4IEIA 1R5NA 2NQ2C 4Q9LA 2D62A 1W49A 3BTGE 2ODWA 3RMNH 1KY3A 1G17A 3QENA 1A0HB 3TE6A 1H8HA 4TYPA 3MFYA 1TPPA 3ZQJA 1KAGA 4C0KA 3THXA 1C2DA 2RCEA 2W3IA 2FZZA 2QXJA 1C1QA 2XAUA 4NTZA 3S7KB 2PEZA 1Z07A 1RD3B 3L33A 3U60B 2GGVB 3ZV8A 5JWOA 5FTNA 3S1AB 4UD9H 4KTSA 2DHRA 1C2MA 1NKSA 3A4MA 5EZ5A 4R8TB 2BD2A 2C9CA 2JJ2D 4H6TA 2G77B 2FI5E 4FMCF 2ZCKP 1U2RA 2WWXA 4UJ3A 1DWDH 4PSAA 1Z7KA 4NYJR 2WJHA 1Y3VA 5I46H 1K1IA 3EX7C 5KSPA 3V9PA 3KB2A 2I3BA 1RJXB 2J94A 2JATA 4SGBE 1Z8RA 1SFIA 3C15C 5B6OA 1AKSB 1O5FH 4UQOA 4D0NA 1DADA 2CVHA 1RPZA 2FI4E 1OXUA 3UPUA 4B74A 4MPVA 3GLFE 4JVNA 1CA0B 5KSYA 2QXIA 2XNDA 1ZGIA 1DOAA 1EFRD 3TGJE 4O3MA 3LH5A 3HKJB 4LUCA 1LPKB 1SVMA 2D3WA 4BFSA 3TSOA 3PCRB 3ND9A 1HA3A 5H1YA 5EQTA 3WRYC 3SO3A 5P21A 1O2HA 2O8CA 2QTHA 1C9PA 2IF2A 1BMFA 5JWHA 1HAYB 5A0BA 4HUQA 2J95A 5D3QA 5EQRA 3DM9B 4TT3D 1UVPA 1EESA 4H4FA 3TK5A 5K7RA 4NU0A 1N6NA 2V3CC 1X1SA 4DLVA 2FFAA 1XTSA 4TPYA 1CO7E 4CT5A 3GY5A 1IONA 3M5LA 3EZ2A 4B75A 3U4QB 1HJ8A 1W36B 1NN6A 3SUDA 4XBBA 2EQBA 3UWJH 3JVVA 1E9EA 1XEFA 1TE0A 4LYHA 3CH4B 3X1XA 4XVQA 1GM5A 4BAOB 2PZFA 3FP6E 4TLAA 2QGZA 3LGVA 3KQHA 1NI3A 1TQ7B 1KI4A 3CLVA 1FQJA 1Y3YA 1JXPA 4BNRA 1PPGE 5HM9A 5K0HA 4X6NA 2BM1A 2BLVA 2QT0A 1OXVA 4TWZA 1XVMA 2DFKB 2H92A 1GRQA 1NKTA 2QA9E 4HZIA 1QG2A 4GP7A 1HYQA 3E16B 5DHAA 4Y8YA 1IN8A 1T6NA 1U9IC 2F43A 4KCGA 1NG1A 3C14C 1W47A 1CGJE 3B1ZA 2QGRA 1JR3E 3GYLB 1NRSH 1F2TA 2ZXUA 2FMJA 3WBJA 2QGNA 1YZTA 3GLFB 2ONJA 4JKIA 3V13A 3B9FH 2HUPA 3VB5A 3THYA 1FTNA 2H18A 3A8DA 3UANA 4GCHF 3WXMA 3REGA 4K2YA 1E36B 3D31A 3PG5A 2ANMH 4AYXA 3G82C 1GWAA 2LKDA 3WY8A 3ZZ8A 2PSXA 3MWYW 3I1FA 3VHXA 5BQ5A 1Z1JA 3BIFA 3SHFA 2YZ2A 4BFWA 1G3CA 1GI0A 3DKPA 3U7FB 1N0VC 2ZI3A 3VQTA 2XSZD 5DP5A 3UG7A 1DY9A 1JNYA 4MPUA 2J41A 1K6MA 3NKVA 1UDXA 4PO9A 4PPGA 4MNYA 1F0UA 1CP2A 3AH8A 1DWCH 3GD7A 2C8WB 1QRZA 1ETUA 1V2OT 3C7KA 4JK6A 2OLJA 4WZBE 1DPFA 1TA6A 4KLNA 4FU7A 2G1KA 1YE8A 4BANB 1C1VH 2HRVA 3PROA 1MU6B 3FFGA 1EG7A 1TGCA 1EP6A 1DICA 1SLUB 3KQKA 1Z8IB 1ZRBA 2FFHA 4K8YA 4PQFA 1S9HA 2Z5FA 5FCRA 4IOLA 4A0HA 1VECA 1S0UA 3QI2A 2V6NA 3RXMA 3RVBA 1NRRH 5DP8A 2ORIA 3AAUA 2C5LA 2IEZA 4C7OA 1FONA 2F9MA 2J92A 3MH5A 4M9ZA 1OFHA 5CDFE 3KFXA 2ANKH 2O0KA 1Q57A 2PJZA 4P33A 4B34A 2ZI9A 1DWEH 4TMVA 3SR0A 1ZD1A 2RH5A 4M1KA 1BMFD 2AFHE 2B21A 1OWJA 4HAUA 4I8GA 2GXUA 3CH5A 2CL6X 1KSFX 1AGPA 1IQNA 2XXLA 3SGAE 2GZ9A 5F6MA 2OSBA 1HXFH 3QX5H 1LY1A 1MABA 5FPTA 4RZXA 1XTJA 4GI7A 3ZZ4A 2FZ4A 4JLDA 5F9HA 1AUTC 1UVUH 1S2MA 4JKYA 3A37A 3CX6A 3VR5A 4MRNA 3FANA 1ZAKA 1SXJB 4LYAA 3PXGA 3W6OA 2R9VA 4X2WA 1AKEA 2Z0MA 2F83A 3QTVH 5I25A 1SGCA 1W2GA 4PAMA 1VJAU 2OFXA 1MRNA 2RGBA 1MOZA 3OIWA 3KXKA 1IQJA 1QHRB 4I81A 1GJBB 3GY8A 2PHBA 1UCYH 1KO7A 3RS4A 2H1UA 1SGEE 2P5SA 1E9FA 2OHFA 2ZYTX 4GZLA 2SGPE 3LU9B 4FUGA 1ID5H 4EIWA 3JZMA 1OT3A 1MAXA 3I72A 3LY5A 1W0YH 5HMAA 2ZS9A 2BVSH 2P8OC 4RN6A 2GJKA 5AUPB 2HV8A 2QRNA 3AVZA 1C9TA 4DHEA 1QCPA 3PO1B 1J70A 5F2EA 3K0CA 1TRNA 3TAHA 1IN5A 2WWYA 3BTHE 1HAVB 4OYHA 4URWR 1QHIA 5KNBA 1FPCH 1S82A 3MCAA 4PXAA 1NVVQ 1W3CA 3KDSE 1CJTC 1WCV1 3BTME 3QGNB 4GLYA 1ZPCA 1V6DA 1XTIA 3P20A 1VYTA 4A2QA 1OPXA 3U7EB 2CJWB 4WW0A 1P9NA 4LC1A 5FXLA 1ZOMA 2ZTSA 5FTKA 1VCWA 2NZ8A 3S9BA 3ATLA 1G3RA 1V5WA 1SVLA 3TLXA 3DUXH 4MYTA 4Y0ZE 3MU1A 1SLXB 1W1WA 1C4OA 3SE0A 3RXRA 1QJ7B 2GA8A 1A61H 5K8UA 4QGHA 3OHMA 4X1SU 4C0JA 5K8TA 2ERXA 2C95A 3QXCA 1R4AA 4JLBA 2PKAA 4LJ6A 3IUYA 5LB2A 2XC4A 1TGTA 4U30A 4GDFA 4FMDB 2EYQA 3OFNA 2C93B 4Q7LA 2AGGX 1N5IA 2OE2A 2AIPA 3KKMA 5HTKA 1CJKC 3B9QA 3M7TA 1AVWA 5D3MB 4L8GA 1RYHA 3V0XA 4YLGA 1FX0A 3WYGA 4OI4A 3ASZA 3K0FB 3CENA 2ZPRA 3RXDA 5JJLA 4B73A 3LT3A 3O8RA 3AGPA 2WJYA 2JETB 1N0WA 1DAHA 2W2TA 4Q47A 1Z6TA 1WMSA 2Q9BA 5KDOA 3SUGA 1TAWA 3DA9B 1UTKA 1PJPA 1IQEA 2C8ZB 1O2YA 2J34A 1U8YA 4PZYA 1COWD 4C0LA 3E1SA 3EPJA 3CS7A 5FUWA 1C9KA 1JRSA 3SU1A 4H1UA 1GNQA 1L2EA 4QGFA 3PWBA 1W7AA 1M9UA 2EI8A 1P2MA 1B5GH 2WSSA 2O8EA 3ZVCA 3ONWA 1AU8A 1H8EA 3F0TA 3W9YA 2CE2X 4HAVA 1VG9B 3IBGA 3LAWA 1S81A 1M7HA 1FIZA 2MSCB 2BIFA 2BM0A 2ODBA 1FMGA 3UWKA 5C5OA 1VCPA 2ZGCA 3CBQA 3QDZB 4M1OA 3Q3XA 1QHNA 3T27A 1B0UA 1SGPE 4UFDH 3BFVA 3SGQE 2PTNA 4OS6A 2SGQE 2PKSB 2OILA 4BTUB 1GKUB 2CJWA 1QJ6B 2B5TB 2ZYVX 3K70D 1Z2AA 5E2OA 1C2LA 4WF8A 1SQTA 2FWWA 5CHAB 2PH1A 2A4OA 1SHYA 1C1UH 1C2KA 4FWIB 1TNJA 2GEUA 4ISNA 1ZP6A 1M6NA 1RRPA 1IQLA 4KO8A 5K8LA 2IHYA 1J8MF 1O5CB 2Y82A 1FAXA 2C9OA 4NIXA 1UTNA 2FODA 2ZGJA 1ESMA 2G0NA 4NFEA 4P4TA 2AXNA 3EWAA 3AF3A 5GADl 2R6CA 1X8JA 3RXOA 1A7SA 3QZRA 4EPYA 3B5JA 1YPEH 2WICA 3SU0A 2IT1A 2QENA 3ZD6A 1QA7A 2BMFA 1O2KA 3QBVA 2VYFA 5IYTA 1UO6A 1TADA 3C5HA 4P31A 3RMOH 2ZANA 3QG1A 1KI9A 5GJBA 2O8MA 4VGCC 1A5IA 3L6PA 1SVOA 4HAYA 3FZZA 1MR3F 4TMTA 4NL4H 2O8BA 4ABJA 2OXCA 4JT2A 4NWKA 2R3UA 3VR4A 3GMTA 4LHYA 5DYGA 1R0XA 1CBWC 4BZXA 2W58A 2QORA 4X8OA 1FP7A 1GSIA 4CF7A 1SKYE 4TZ0A 4J2YB 1HNEE 3ZD7A 5EJEA 4MKIA 4R2HA 5C1XA 1DO2A 2Z4RA 3MG9A 3QPWA 4F4CA 1KIGH 3H0KA 1XUHA 2CHAB 2BLQA 1AIXH 3RS0A 2HNTC 3K9XB 3RAPR 2EI7A 4TY6A 3U8TH 1WOFA 4M21A 4EPRA 3CPHA 2RGAA 2ZP0H 2GV7A 3VR1A 1Q31A 1R8QA 2OLKA 2F3RA 2X1VA 1GL7A 4X1NU 2IUTA 5FPKA 3LVRE 4AKEA 4HLDA 4QBIA 1GBLA 3VGCC 2ZCHP 1ZTJA 1WBDA 2Y5GA 1Z0JA 4WZ6A 1RE0A 5JHHB 4AN7A 1BRCE 1J7KA 1DEKA 1H8ED 3IQXA 1UKEA 3TGIE 1GOTA 1PUIA 5EPYA 3A1SA 1VMAA 4MUBA 3D8BA 4NFFA 4I1OA 1NO9H 3U44A 4LHWA 1EUFA 5JEDA 4CZ2A 4TMZA 5DP9A 4DCNA 1V2LT 1BBRE 4L15A 1SFQB 1LVOA 3AASA 1GJ7B 2Q0HA 1QB9A 5EP3A 3FTQA 3CWQA 1E0SA 3WBKA 3W90A 3KKQA 1BMNH 4BAHB 1A2KC 5DIFA 2P3UB 4OGXA 2UUYA 2Z6BD 2IXGA 4XOJA 2YNBA 1OSNA 2WSMA 3KKPA 3FVQA 1CF4A 1ZM7A 1GI5A 3AUYA 2O5VA 1GJ5H 2NPFA 1VTKA 1O5DH 3FKSD 1R2QA 4OK3A 3U1IB 4KVAA 4LV8B 1X3SA 1X8KA 2P2LA 2F1JA 3OIVA 2FOBA 4DIIH 2J0VA 3SW2B 5CLLA 3I62A 5G4BA 4NMMA 1WXQA 1GBKA 1TNLA 2IWHA 1XEWY 1GBCA 4DT1B 1AN1E 3GJ8A 4TSFD 1TMTH 1QG4A 2GCPA 1G4UR 2E1RA 3B85A 3IKJA 2FX4A 3BB1A 4NZQA 1GHWH 1O38A 2QYIA 2BVXH 2XEXA 4OQNA 1R6BX 2HNTE 2YINC 1FL9A 1KYIA 3F9FA 1ZUHA 5E8EH 3MSXA 1TEXA 3GCNA 1E1QD 4GOKA 4AURA 3DZDA 4IDNA 1S96A 4TY7A 1AI8H 3M4YA 3RXIA 4RKEA 1FW6A 2ZJ8A 3NTUA 1O5BB 3FAOA 5J4KA 2VH6A 1NG9A 4Q18A 3EZ9A 1S9DA 3X2SA 1QRWA 1O2IA 2XCNA 2G9NA 3ZH9B 3PJRA 2Z43A 3TBKA 2WV4A 3UWIA 1Y3AA 4WVPE 1E9RA 4ZPXA 3U8RH 4ISLA 2YWHA 1XEWX 3MU8A 4TLCA 2EFCB 2G5VA 1U81A 4JLPA 3U61B 3P92A 1YR6A 1D4PB 1K5GA 5AFYH 3ZVFA 1ZPZA 4A2WA 3SOSA 2R2WU 2CK3D 1FQ3A 3ZS8A 2JDIA 1KMHA 3LFUA 2HF8A 5G53C 1E0FD 1T8NA 3EIHA 3Q5DA 2ZU1A 1SB1H 1KDQA 4HEJA 1SVWA 2ZROA 2NO6A 1RTKA 1HAOH 3W3ZB 1UTQA 1CR1A 1O3MA 2UKDA 2O8EB 3EG5A 2AX4A 2IYLD 1EFHA 1IM2A 1NY22 1B23P 2LCFA 2WAYA 1MTSA 3A6PC 1UVSH 3MOCA 2BMGB 1QZXA 4ABDA 5JJKA 3SN6A 2VVCA 2NWNA 3ZVEA 1OWHA 4PQYA 1L0ZA 2OQUA 4CHAC 2W0MA 1GUAA 4Q03A 4I99A 1G36A 3GICB 3NVAA 1AKSA 1TIOA 3ADDA 2HPQH 1T31A 3OTJE 4EJSB 3QOFA 2ESTE 4H1VA 1E34B 5DKMA 1THRH 1C5QA 4KP0A 3I4LA 4A4DA 1E2PA 3CRQA 1KTSB 3W6NA 1GBIA 4OJKA 1N1LA 1MO6A 2JETC 2MSEB 1YHNA 1T4UH 4HGCA 1T4VH 1SHHB 1NVXQ 1E96A 1SGFG 2SGDE 2NZJA 3STIA 4DG4A 2NO9A 1YKTA 4MA4A 3RC8A 4C7OB 4U2WA 1ESAA 3EPKA 1TRYA 2WWWA 1KK3A 3OESA 2ZRFA 1UEJA 4ZIRA 1W0KA 1II9A 4YMUA 1TX4B 3FKQA 5T3HA 4A6LA 3EIQA 4UXJA 5FTJA 3B78A 2FNAA 3E6PH 1BMAA 2BQWB 3SJZA 1KXFA 1O2QA 5C2ZA 1FNMA 4Q7MB 1SVSA 3EZ6A 1VGCB 1SGRE 3AVQA 3QN7A 2ZRGA 3B1VA 1K28D 2BY8X 1O2MA 3ZVNA 4DLXA 4ZDKA 4JLJA 2ZI2H 3BG4B 4BZQA 1GCDA 5LGOA 1GDQA 3K0FA 1OWIA 1HAIH 5AF9H 4PC7A 4MITA 3MHWU 4ZROA 2AERH 2YOHA 1PLKA 3NPSA 2ZUDA 1XKAC 2BX3A 5ETXA 1E79D 3EGKH 2XNSA 1KO4A 1R8SA 2KE5A 4C9BA 1KO5A 3RXVA 3RANA 4B76A 4HDCA 2J59A 4LJ7A 1EWQA 3LGYA 1OKKA 1J16A 221PA 5JBQA 1EFUA 4UNPA 5DP6A 4EPWA 1Q1ZA 4QBFA 4A0FA 1C5UA 5CLQA 1UDWA 4IOJA 3QF7A 4IC6A 4YMWA 3VKWA 2GDDA 1N3BA 1XUJA 1D6WA 2CK3A 3UQOA 1GMCF 2B8TA 4WMFA 2QAGA 3TU7H 3E91A 4HFPB 4ISOA 4Q19A 3P70B 5FTLA 1V2PT 3R3GB 2IS6A 4E09A 3TITA 1SHKA 4Q4HA 3RMLH 3RUOA 1G6OA 4CH8B 4M4SA 2WPJS 4VGCB 4K69A 4GHTA 2GZDA 2P67A 4IN1A 1AZ8A 5AJWA 1H65A 4WXVA 1UTLM 1TAGA 3PQCA 1S5SA 2B7DH 2ZHWH 2PLFA 2BDAA 4B2AA 4LV5B 1U8AA 1RIFA 2ZDMA 3ZVDA 1ZTKA 1MD7A 5J4LA 3QLPH 1ZSLA 2IX3A 4Y7BA 3DM5A 2WPKS 3UIEA 3BB3A 3U3JA 5A0AE 4II7A 1E0KA 2CF9H 2H9HA 1PLLA 5TDHA 1T8UA 5DE3A 5JRJA 2WUCA 1MO4A 4F4IA 1NMZA 1YZGA 2QMHA 3ESTA 2V6IA 4YT7H 1EZXC 3P8OA 4X8TH 1HAZB 1O35A 3FVFB 3K0SA 4OHZA 2VIDA 1U8ZA 5CIWA 3CRVA 4LY6A 1P72A 4DKXA 1SBWA 3A82A 3X1WA 2GZ7A 5L8VA 4CT4B 1U94A 4JLNA 1ABJH 5A8XA 2JASA 1SC8U 2BY9X 1ZPBA 3A7ZA 1A3EH 5DJ7A 5LPRA 2VA8A 1VCNA 4KFUA 2QBYB 2IJD1 3U5ZB 2ODPA 2VP2A 4HZUA 3NEJA 4N0DA 4LCBA 2LWIA 4E7RG 4CRWB 2ZZUH 4JLVA 1P2QA 2F3TA 4Q7KA 1DAGA 4DDVA 3TK6A 5DO9A 1HGTH 4H42U 3H84A 1F0TA 1BTYA 4OQMA 3PYHA 3HWSA 4ACAA 1UTMA 1LHFH 1S83A 4HATA 1RZ3A 3ZVRA 1P2UA 1OW3B 1ETRH 2GCTB 1AZTA 3QEJA 2CDNA 2GWHA 1ZM3A 2Y5HA 4NA8A 4UNNA 4JCNA 3ZYDA 1Z29A 3ECCA 2ZGXH 3D23A 3HR7A 3HR8A 1F3OA 4JMPA 4YDHB 4PC2A 2RGEA 4H9GA 4LBZA 4NCNA 2J4IA 5FBLB 1W5TA 2WWFA 1AKYA 2IK8A 4A36A 1WQ1R 3UK6A 2VGCC 1E2NA 1DAKA 3FYHA 3SJBA 4AWXA 4JZIA 1W8BH 1NVWQ 4N1AA 2F91A 4M9XA 3GLIE 2HT6A 2XGJA 3KQUA 1XMNB 2JJ8A 4JLAA 2QNRA 3WP0A 3S7HB 5T6DA 4P32A 3QF4B 3RXFA 1EPTB 3AP2A 3BTEE 4EQ6B 1W4AA 2QA5A 1NFWA 3UFAA 4TQ9A 2WPLS 3AVPA 1XD9A 3AQ4A 4A5TS 3ICEA 1O2NA 2V55B 1JQLB 3DO6A 1T8MA 1TRMA 4QG7A 4Z1MA 5GJVC 5JYIA 1C1NA 3T12A 3D62A 1QRXA 1YZLA 4UFFH 4Q1DA 1O3EA 5GJWC 2IC5A 1XX6A 4FUBA 4MNVA 5J4VA 1KMQA 1DWBH 2HALA 1ZUIA 2ZREA 2H17A 3T06B 1XKBC 1HYLA 4GRAA 1XCGB 5KHOC 1FNNA 4MPWA 1SKQA 3OEEA 2FYRA 2VP6A 4ZHAA 3I5XA 4DDWA 3IHLA 2A4QA 1W7GH 4RKJB 1QHSA 3BTWE 1GDUA 1ELVA 2H57A 1Q20A 5FOVA 3IHWA 2D74A 3M3SA 3EARA 1LTQA 3WRXC 2MMGA 6ESTA 2CMKA 5BYKA 1G5PA 3SN8A 2GV6A 1Q2WA 2D4HA 3K6YA 1YF4A 3MI4A 3WHLA 4LBYA 3ZVLA 4EFMA 3CONA 1P9UA 5J40A 2ZA5A 1BYUA 3K09A 4MGKR 2I6SA 2A7HA 3EAQA 1ZNXA 1LQEA 3MTYA 2DYKA 3RC4A 1JOUB 2A7CA 5UKDA 1NFYA 3PMAB 4MNXA 4TMWA 4WH6A 5TJXA 3IO5A 4E06H 2IBMA 2CLSA 4JT4A 2TRMA 4UE7H 4EJSC 3IPYA 4JYTA 3PB1E 1TOMH 2ZGBH 1QHXA 4BLSA 4YDSA 3GPLA 4ZI2A 1NRQH 7KMEH 2ZJBA 5JJIA 1DELA 1DO0A 4NSVA 4ABYA 1BJUA 1TOCB 2GILA 1ORFA 5B64A 1JMOH 4W5JA 3F9EA 1JJ7A 1G37A 3UNQA 4KHZA 1T8OA 2GHIA 2LKCA 1OXGA 1NRPH 3PUVA 1KDOA 5EG4A 2QPTA 2J1LA 3RXAA 2EC9H 4MGYR 2H5EA 3WP1B 3U9AH 1WXRA 2XCFA 5TCCA 4J1YA 1FFHA 1TALA 1ZNYA 4BE7B 4IC5A 6CHAB 1W10U 4KGAA 5HE8A 2EFEB 4FVBA 3QKUA 3VTKA 4X8LA 1NIJA 3L43A 4CR5A 5L3SA 3KTAB 1LHEH 2IW3A 3RXPA 1AMHA 3RXQA 4JVSB 5GNDA 3GLIA 2ZPTX 1MH1A 1GI4A 4A1TA 1XXHA 1GHBG 5FFMA 1XMSA 3OAAA 2FOCA 4B43A 5C4GB 3GEHA 4B6FA 4V0NA 1E2MA 1MO5A 1O3FA 2JH6D 3AW0A 3WNCA 3MNCA 2A9KA 3TH3H 3VHLB 1EPTC 2OBNA 4MYHA 4Q2KA 3X1YA 2W3KA 1EX7A 5FOSA 2SFAA 3SZNA 2DB3A 2ZWLH 3SJ9A 4C2TA 1ANBA 4CEIA 1KLTA 4G5OA 1GMHF 1FUJA 5FH9A 2DR3A 4CEHB 3K9HA 2CHGA 2WPIS 3L0IB 1C2JA 3OU0A 4BECA 4XH9B 4HB4A 2F43B 1U6QA 4ABEA 4NPHA 4CHAB 1JIMA 3W8RA 1OLOA 2QPAA 4UXHA 1O2LA 4RCYA 3K9GA 4F92B 2JLZA 2NO0A 5AWFC 4CGZA 4B3DA 2IA5A 2ZPSA 1XXFA 2ZKSA 3OF5A 4MPXA 4JVLA 2ZPQA 1FLEE 1ZYUA 5EXSA 3D3QA 3PEYA 4D2IA 2ZRKA 1C5TA 8OHMA 3FDIA 4MLFB 1GZSA 1AIPA 1GBEA 1O2PA 1KMHB 4O2LA 2ZSAA 3PUZA 1HJAB 1O2GH 1IXRC 2CJIA 4LOYH 3LQRA 2V7QD 2HNTF 5J4SA 1HLTH 1G3EA 1J2JA 2CCKA 1HUQA 3A86A 3KXIA 4DSOA 4OI1A 1C5VA 4E05H 3G01A 2BOHB 2PUXB 3D49H 3OX7U 3P95A 2ZI7A 1Q1EA 2VP9A 3UUZA 1QL9A 4OHWA 4DCUA 4HZHA 3LO5A 1U0HC 4EUNA 2BC9A 1D3TB 2CXXA 2D26C 4FMDF 4RJLA 1BHXB 4DDTA 1HH4A 2P5TB 4C0AC 2O8UA 5E4FA 4GSOA 3A80A 1XMVA 3U69H 2IS2A 4KYIB 3V3MA 3U3KA 4PZLA 4MUAA 3MYWA 1VIYA 2Z7FE 3MO9A 1G8HA 6GCHF 4V0LA 1VGCC 5EU8A 4FCTA 3UR6A 2JDID 1WYKA 4D4MA 2GK6A 4DDUA 4AYYB 4B33A 3TW8B 2OUAA 4BTTB 1PPBH 1G3QA 1RRKA 3VEQB 5FPHA 5JRZA 3ODFA 4KYUA 4PPQA 1S0RA 6CHAC 2W6JA 4QL3A 3TSZA 3AF2A 3X1ZA 4ARZB 3QIAA 4M1TA 3U7HB 1FZQA 4MQAA 1CQQA 821PA 4O0MA 4D25A 2IN2A 2CBZA 4RVCA 2F9VA 3MU5A 4TYQA 2JEOA 3T5FH 3BORA 2ZR7A 4QJ3A 2V1XA 4DLZA 4OHVA 2W6ID 2AHOA 1KNQA 3RNLA 3PM3A 4KBFA 2GZHA 1KXDA 2QXHA 1HXEH 1OPHB 1ELBA 5FOTA 4E22A 4JJZA 1NY5A 2VSOA 3Q72A 1F6BA 3SJ8A 3MNBA 2VWMA 4ZHMU 4A0RA 3PV5A 1HJ9A 3FMIA 4M9QA 1R10A 1LNZA 4BFYA 3R9IA 4INHA 2VVVA 3P32A 4OHXA 4M1YA 1FUUA 3T1OA 2YHSA 2OXRA 4Z51A 1G3UA 3L2OB 3L8ZA 2QAGC 2FEQH 3RC6A 3VNUA 2D2DA 4XVRA 5B6LA 1TBQH 1V2TT 3RXCA 1F2SE 1GHYH 2FOMB 1SL3A 2R44A 3P8GA 4YMSA 5SZHB 3RRZA 5BWMA 5HYOA 4NIWA 1QJ1B 3B7GA 1O5AB 1Z0IA 1WF3A 3QQ5A 5E95A 1W44A 5JEEA 1IQPA 2PEYA 2H5CA 2I6QA 5EOKA 4N3NA 1TB6H 1F2TB 2R62A 4JZ1A 4DBLC 3RABA 2BZAA 3SUEA 1H1BA 2NU0E 2J38A 1K1PA 1LKBA 1ZSJA 3RP2A 3UOPA 1NN5A 4IXNA 3QXXA 4M1WA 5CM8B 2OAQ1 2CLDX 5F8TA 5DISB 5IRCD 1FX0B 2WTUA 1G3BA 3KUCA 2BDYA 2HT1A 1WBGB 4Q80A 2R6AA 2VIPA 5C67A 3A89A 5BW8A 4B32A 2ZDKA 2GZ8A 3BN9A 2HXYA 2CVFA 5DP4A 1Z47A 2ZFFH 5KTYA 1CR0A 1GJ6A 1N6HA 5JZVA 1QRAA 3QKTA 4EJSA 4XBCA 1D5CA 4MGZR 4LV6A 1EAWA 4PR0A 3ZV9A 5LDDC 3SZRA 1AB9C 1O3YA 1Y59T 2F55A 3L3TA 1RRCA 3VU9B 1VYVA 3QE0A 3QG5A 1EB1H 4RSGA 2ZFTA 1BT7A 5CJ2A 3L0SA 3SBEA 3P8NA 1LTOA 1SMFE 1AWFH 2BZ6H 1ELTA 4CREA 1J9CH 4TLBA 5EUQB 1KK1A 3PITA 3AKYA 1G4AE 4AGKA 1MKXH 3EA7A 3I92A 5FI0B 1BTXA 2HWLB 3D6TB 1SGDE 4NYMR 1NF3A 1MD8A 5JCPA 2Q6DA 4LJAA 4WZAE 4QJ5A 4GFDA 5K8IA 2XW9A 4QGGA 2VNTA 2GAOA 1IHTH 4CRFA 5EE1A 1E2JA 1TPAE 3KQCA 1GCTB 3V12A 1YPHC 1EOLA 5JDUB 1NVVR 1YCPH 4IN2A 2VEDA 2A31A 1E2LA 2BTCE 1P3JA 2YNAA 1QNJA 5CE1A 3VMFA 1I4LD 4URUR 2ZTZA 5FOUA 3J81k 4K8OA 2EVWX 4PHGA 2VGCB 1Z6EA 2WHXA 1Z0AA 2WOOA 2ZFRH 1BCUH 4ZMAH 4F93B 3Q5EA 2EA3A 1IQIA 1Z0KA 1J8AA 3A84A 5EE0A 2STBE 2OK5A 1HV8A 2QMEA 4OHYA 4HAXA 1UTPA 3T25A 3HPQA 4G01B 4ISHH 4WAUA 1R5OA 3F5FA 1A7JA 5DI3A 2XTNA 2HLDD 2FX3A 4IOMA 4JYBA 2XOKD 1QBKC 1C2GA 2BVRH 1Z6AA 1UBGA 2HGTH 4FUFA 2RKOA 2OTVA 4XIGS 2ZU5A 1LFDB 5JSZA 5EW2H 1RKBA 1P2KA 2J3EA 1NT1A 8KME2 4DSUA 2V4ZA 3ZVAA 3B23B 4TYDA 2SNVA 3MWLA 3WMGA 3CF6R 1K1JA 3R0FA 4EPXA 3UTUH 4ABIA 3MWKA 2OFWA 4GUXA 3EZ7A 3R9WA 2A5JA 4NWLA 2VB0A 1BTUA 3GDVA 3QK1A 3QSYA 4YMTA 3LOXA 4E03A 4DEYA 1FPHH 1ESBA 1LHCH 1O5EH 3VB6A 1NRJB 1Y3UA 1BTHH 4FU8A 2WSSD 3GFTA 2PUQH 1JJVA 1EJMA 5KSOA 1JI0A 2NOAA 4FXPA 5EW1H 2QMOA 2FLRH 1VCIA 1G7SA 2X19A 4ZKRU 2MMCA 3TUZC 1DG3A 4CEJB 4M9FA 1CA0C 1DDJA 3HU3A 1AQUA 2WOJA 1A5TA 1AJEA 5TXGA 1ZM9A 2WKRA 2GNOA 2VIIA 1WQSA 1KI7A 2VLIA 5T6GA 2QAAA 3UG6A 1QHYA 1T7CA 1M34E 2QI9C 2P3FH 1VCQA 4DIEA 3BIVH 2OCVB 3ZZBA 2VP0A 1Q0UA 3AF0A 4KBGA 2BYAX 4LZ4B 5AJXA 3LPRA 2BCJQ 3SV7A 3BH7A 1XPRA 2NMVA 2FSFA 3ATIA 1ZNWA 2IEYA 2VHCA 4X8MA 5TVKA 3EA5A 1NS3A 2AD1A 5IK2A 1GBTA 4LC0A 2HEIA 3D7MA 3PLPA 3EPLA 1WRBA 3UWOA 2DE8A 5L2YH 3E3TA 5T6FA 4JZDH 3SQWA 3MFJA 1MT0A 1GRRA 3UMRA 1ELFA 3HP1A 3P4YA 4YOGA 3TH4H 1XXHE 1X86B 4M7GA 2WAXA 2FYQA 4BLQA 4RFSB 1EGAA 4KSBA 4I8HA 4PAQA 3SHCH 1EAXA 2OCBA 2R0LA 1GBHA 1ZTLA 2BD7A 3IDQA 1U0JA 1L1JA 1O34A 1HIAA 4IFEA 4KI0A 3MH6A 1CKEA 1S3SA 3O8CA 3RYTC 5FAHA 2BDTA 3GOVB 4I8JA 3KJGA 3RDPA 5A4JA 1CBWB 3HK6B 1AVXA 3GCGA 3QXHA 4HAZA 3GCHB 2CMYA 2BB4A 1AM4D 2JKHA 4HLUC 5DK1A 1JEEA 4NE2A 4D7GA 4ZH8A 2N42A 2R6FA 2ZITA 1NM6A 1QQUA 1YQTA 3GEIA 1SGNE 4BRWA 2ZRMA 2F7SA 1THSH 3TH2H 2E9SA 4U7DA 3SI7A 1Z71A 1C4V2 2AFQB 4JMYA 1W14U 3GJ7A 2AS9A 5HM2A 3ZZ3A 3RRNA 2W5EA 1MV5A 1C5PA 3T2NA 1D3PB 1TQ4A 2VIVA 4XSGA 3AKCA 1UHBA 2IXEA 1BHXF 2BD9A 2QPOA 1O3CA 1BRUP 1EPTA 3AW1A 4EPTA 3U6KA 2FLBH 4LPKA 5CMXH 2ZSDA 3SYNA 1YPGH 3OE7A 4LDJA 1FAKH 3TMKA 2XTTB 2VPPA 2PKAB 2IOTA 1AGJA 2ZU2A 1PPHE 2ZM5A 2A7JA 4U01A 5IF9A 4GT1A 5AUOB 2Q6GA 1BBRH 1KSJA 1G16A 4KFSA 2ZGHA 3VAAA 2Y7XA 5HGGA 5FL7D 3QVUA 3KJHA 1QIXB 1KKLA 1Z22A 1FY5A 2BEJA 1KDPA 4A8JB 1QA0A 4M1SA 3EDXB 2JA1A 1QL8A 4DZZA 2PGQB 2ZYUX 1CGHA 3K9LA 4XSKU 4Q4AB 1IJEA 2ZAMA 3GJ0A 4RZ2A 2QM8A 5ESTE 1EJAA 5KDDA 3PV0A 3M37A 3GY4A 5SGAE 1H8IH 4R2IA 1CVWH 1W0JD 3MO3A 2SNWA 2ZRPA 4K81B 1TMBH 1WU1A 1L1NA 1C4Y2 1MZDA 4CYMA 5G3YA 2AMDA 1GMDF 1SI5H 3DHKH 1W12U 2ZECA 1CJUC 2JJ2A 4O97A 1KDTA 4BXWA 2ULLA 4DRZA 2QXGA 4LRWA 2B8OH 4C0BA 1ANKA 2OP9A 5GCHG 4LHZA 2HLDA 1BTWA 3NKKA 4C3ZA 2ASEA 4MDEA 2GTPA 1W13U 2ZEBA 1L2TA 2RB4A 1MBMA 1FN6A 4HLCA 1ZVQA 1DE0A 1FY8E 4BUJA 1D9XA 5JI2E 3SJAA 2Z6VA 1SVIA 3SNAA 4JSTA 4YONB 3U1JB 2BWJA 4URZR 1R5BA 1CE5A 2IYSA 1GMDG 2QY9A 2UWPA 1V2QT 1OWDA 1A5GH 3Q00A 1P04A 4A7IB 2XNDD 3QXSA 3K6ZA 5EQQA 1TTTA 1G9IE 2OCAA 3B2EA 1W11U 3SNDA 2XYAA 1L7VC 1VIAA 2XSZA 1MQ6A 1OJLA 5T1VA 4OL0A 2OO7A 4Q4HB 2WWIA 3RMMH 3KX2A 3RC5A 1TABE 1Q12A 2YVUA 3CRW1 3RU4T 1GMHG 1E9DA 2NO1A 3SZEA 2BDGA 1PLJA 1OFIA 2O8TA 1TGNA 2ZJ5A 3SEAA 1XUGA 4QC2A 4A8JA 3M1IA 5L3SB 1NBMA 4K5ZA 2CHQA 1DBSA 5DSZA 1FJSA 2ZJ2A 2SGFE 1F48A 1P4SA 4A6XA 1UF9A 4K8BA 3CPJB 5CYPA 1A2CH 5JS7A 5L3QA 4I8KA 1D2MA 1J8YF 1SVPA 1XD2A 2ZI6A 1ZW6A 2ZFPH 2DWPA 3ZIAD 8GCHF 2GCNA 4UJ5A 1E9SA 3GEEA 3SHAH 2CN0H 4MKFA 1DANH 4CEHA 2OC7A 2Q6TA 3WMEA 3A1WA 1AN0A 4OS4A 1K21H 2VSFA 3M0EA 3RSOA 3KFVA 1MKYA 1VG0B 4Z6AH 1YM0A 1HRTH 3PTBA 3A87A 4O03A 2ZIAA 1IHSH 3NBXX 1GI1A 3CNOA 3TIUA 3TLOA 1II8A 1O2XA 2XOKA 5DO4H 3FB4A 3NWUA 3THWA 3PENA 3FP8E 2FOHA 1P2NA 5AJYA 4A8JC 1P03A 1GBJA 1G291 1XPOA 1TFXA 1Z0FA 4TL9A 1BYIA 4OI0A 2ZE7A 3TR0A 5JBBS 3CX8A 1Y3WA 1DSUA 1YR9A 2FOEA 1VKJA 1E69A 2NG1A 2ZETA 4C0SA 1LCYA 1X7AC 2QROA 2YYZA 5JB8S 5F8ZA 3JZ1B 4LPSA 1LF5A 2G00A 4RFVA 1X6VA 1E2DA 1A5HA 1XTKA 3RS3A 1YKSA 3P27A 1OHHD 3S1AA 3BRWD 1TL7C 2AL7A 2N1BA 3OEHA 2ZDAH 2GRJA 3F8TA 1RYFA 2FF7A 3CWZA 5ELXA 1TU3A 1NBME 3SS8A 2BBSA 2ZS7A 2ZHFH 2PL3A 1G6HA 1ZUNB 1OSSA 5F3WB 4YOJA 1F2UB 4UONA 3BBPA 2K5UA 1W2HA 2BKEA 4ZDWA 4BWYA 4CVNA 1ZZZA 5L3VA 4NYMQ 1UM8A 4NYIQ 3TVTA 1WSSH 3ADBA 2A2XH 4LJ8A 2IWRA 1IOZA 5DLQC 2BDHA 1TA2A 1TF7A 1MMJN 1Z3IX 1LPZB 3U6BA 4HI0E 2UVQA 4FUIA 3FP7E 1D2EA 1N5KA 4HB0A 4TWWA 4ARZA 2A30A 1DXPA 4JYVH 5B58C 2QP4A 3M3TA 3O8BA 1YJ5A 4AKHA 3DMDA 1ZD8A 3B8JA 3V00A 4FUDA 2WUBA 1XU4A 1Q1QA 1LMWB 1JPJA 1W36D 1RJ9A 3LW7A 3PTNA 5DHFA 4CH2B 1T5LA 1K2I1 2B9LA 1G5RA 1SXJD 1P8VC 1SQOA 4HZUB 3PV4A 2IYXA 3OYPA 4Y6DA 1EB2A 2A78A 2EU8A 4PC6A 2JJ1A 4LJ9A 1B0FA 3U4QA 3SV6A 5ABWA 1RXPA 1V2VT 2W0SA 1N8OB 4MYCA 4WBSA 2D8WA 4FUHA 3ZQ6A 1W5SA 1G7RA 1PQ5A 2FSHA 1Z63A 2ZS8A 4NA9H 1XFAA 2WIBA 3THOA 3RRMA 1MQ5A 5FCKA 1PFXC 3KQLA 4F91B 3KCGH 3ZZUA 4MRVA 6Q21A 1ZCAA 1SOTA 4XFQA 1JXMA 4D26A 3VX3A 1QHHB 3UPEA 1ZHMA 1KDQB 1KLIH 2PTCE 1L4DA 3TJVA 5SZKB 3GY2A 2WPHS 4YM9A 1O3JA 2X2FA 1XZPA 3GLHE 4IVQA 4IDQA 1ELGA 1BITA 3E1XB 1HT2E 2HF9A 4ZXXH 1FUKA 1NLFA 1YPKH 521PA 1S8FA 3PEVA 3Q9LA 3KJEA 3SBDA 2DE9A 1P9RA 3M6AA 2AGEX 1TMUH 5H4IB 2ZSBA 3FMOB 2PLXA 1AY6H 3KIDU 421PA 1GHAF 1FY1A 1G8FA 4BAMB 1DITH 4XWAA 2DFLA 4Q7YA 1P2IA 3ADKA 1CJVC 4ESVA 2ZU3A 5LPNA 4L9WA 1NROH 1GVZA 4OK5A 3P17H 3TJOA 2V3HH 1ZRKA 3M7UA 2OBMA 2QIQA 1F0SA 2QE7A 4X8SH 3FOZA 3KGPA 4PSKA 1V2NT 1PYTC 1BOQA 3UMFA 1R0ZA 4DLRA 1FXYA 4JSYA 1G32B 1CIPA 4MRPA 2NU4E 4MRSA 4YMVA 2XXAB 4X2VA 3BB4A 4W5HA 1WUNH 5AR1A 5L2ZH 4B3BA 4EPVA 4IVPA 4GMDA 1HJAC 1HDTH 3RLYH 2BJWA 2VTKA 4LI0A 3AF1A 3EASA 4I4LA 4IDOA 4X0WU 4DY7B 2Q3HA 3SJIA 2FXRA 1IOEA 1D6JA 4S2EA 1CHGA 1O0DH 4Q5IA 3RS2A 1S6HA 1O32A 5PTPA 1S4QA 1TGBA 1N6KA 2QM7A 1YRAA 4CRCA 1AE5A 2FE4A 5HR5A 2AWOA 5JMTA 2Q3FA 4M0LA 4NZLA 1KXAA 2STAE 1AK2A 3A1VA 2BD5A 2C3SA 1LS6A 4F38A 1NFXA 1OXSC 4RZUA 2P95A 1HQYE 2VH5R 2BHRA 1NP6A 5KDLA 1NSFA 3GCOA 1S1MA 1H4WA 1ARBA 1G41A 1YZNA 1W4BA 3ZZCA 3GLGA 1IY0A 1XJQA 4OS1A 1ESNA 2ZYWX 4ASUD 5SZJA 2VHTA 4Z8YA 3UQVA 1MTWA 3BEIB 1MUEB 4Q4AA 1OXTA 1C1SA 3SBKA 2J0UA 2WIAA 3LGTA 4PZZA 3ZYCA 3UATA 2UUJB 2VIOA 1XZQA 2OCYC 3LW8A 2PW8H 3CRRA 1ZHPA 1BMMH 1L4ZA 1EFTA 4X1RU 5EXMA 4FCWA 4BFVA 2ANBA 2KJQA 4B2LA 4PFSA 5GXPA 4X6OA 3CF2A 1XVOA 3BFXA 1GI3A 2THFB 1AQYA 3SJKA 1KXEA 4I1SA 2CE7A 4DW2U 3IEVA 1OWEA 1XJ0A 4BPBA 3SYLA 4DOQA 3EC2A 2WKPA 1HY3A 3QEOA 5DP3A 4NSYA 1V2MT 2X8AA 1DT2A 1HAPH 3RS5A 3MNSA 5FPYA 4Y76A 4DURA 2FMXA 2D7CA 3MUFA 2GJAA 2P16A 1GFIA 1NBMD 1O3PB 2FESH 5JS8A 1QF9A 3UR9A 4Q1AA 2ZR0A 2DY1A 2GJ9A 1TNDA 3U98H 2NU1E 4U02A 3NBYC 4NONA 2WV5A 1QL7A 3BTDE 1FTSA 5E2PA 5IDVA 4TMKA 1P0SH 1C4U2 2QSYA 4HLQB 3LV8A 2GDEH 3DOFA 5FUXA 1E35B 3ND8A 1G8PA 1P9WA 2Y7ZA 2GCHF 1C2IA 5EP1A 1IQGA 5GCHF 4RD0A 2F9UA 3BOSA 4IJMA 1SGFA 2P65A 1O2WA 3K65B 2Z9GA 3GLGE 3AVVA 1FNIA 2OM2A 2ZQ1A 2Y6TA 2W00A 3NZIA 2C98A 2DFNA 1GHAG 1IAUA 4HDOB 1P57B 2C8VA 4XJXA 4CEJA 5BPEA 1K1OA 1HEIA 5CJPA 3UREA 3SQHE 3LA6A 5F9FA 1F5NA 2IL1A 5C4MA 1N6IA 1YLDA 4BOHA 3MU0A 1ELEE 2OC8A 2C2HA 3KL6A 1CTQA 1VHTA 5DGJA 2OEPA 3AEZA 4DCSA 3U8OH 3W5JA 4QGAA 7GCHF 1EQ9A 4FUJA 1TBZH 2A0QB 2ANYA 2IYYA 5HKKD 3H4MA 4Y8XA 5DP7A 5FL7A 4D6PA 1C1RA 3P1JA 3ICQB 5JBAS 1HE1C 2C9YA 1J14A 3GCHC 3C16C 2ZR9A 1GIAA 2RG3A 4TLDA 2Y5FA 2QTVB 3BEFB 5LH8A 3DZ8A 5LPEA 3TQCA 3TJZA 2JCSA 1KK2A 1AS0A 2WMOB 3ZZ9A 1SLWB 1VCMA 3AV0B 2BDBA 4KV9A 3KHVA 1FIWA 2PZEA 1BJVA 5HE9A 1LDTT 1SR5C 3PMBB 2C8YB 3IQWA 1CBUA 2RHMA 3DD2H 3ZVMA 1WTGH 4WXPA 1P2VA 4Q4JA 1DY8A 3AB3A 3HATH 2ZNKH 3QZQA 2BXTH 4RCZA 4P0TA 3U2QA 1TX8A 1GITA 1P61B 4QBGB 4GL2A 3UXMA 5L6NH 2EYUA 3IWMA 3GY6A 1O36A 2FDCA 2ZRLA 4AG6A 1XP8A 1OKXA 3UMSA 4TL6A 1M74A 1CGIE 3AP1A 1PJRA 4Y79A 2ZHEH 4WWYA 3CP7A 1Q22A 2NIPA 4A1VA 5EP2A 5EP4A 1JALA 2VSXA 2ZRJA 2MSDB 5D3MA 2PZGA 5KU1A 1ZINA 3B1YA 3A81A 1YRBA 2WV9A 1OIWA 3MAAC 2AK3A 4Q21A 2TGDA 1QQ4A 1ARCA 3RXLA 2ZDVH 3MH4A 3OTPA 3G5UA 1UBEA 5HZKA 2OV2A 4IW3B 1KI6B 3M3VA 3M7QA 1UHBB 3LGUA 1F5RA 1ZCBA 4FVDA 3TW4A 1GBMA 3BJIC 4PAOA 3LKWA 2P3TB 3Q3JB 3PUXA 3BC1A 3R8CA 1F92A 1UJ1A 4X2XA 3RLWH 3CUEF 3WY9A 5C1BA 1JEDA 4ZKDA 1AE8H 1S6FA 2F9PA 3U3OA 3ZVGA 4M53A 1TYNA 4DWJA 5TARA 1GHVH 2WMNB 1E94E 1UVTH 2RCNA 3HPTB 3GCTG 3DFLA 4DLUA 2WPDD 4PPFA 3THYB 3LBHA 1UKYA 1C5LH 1EOJA 2G5NA 4ACBA 4QJ4A 1YVDA 4ERNA 2KWIA 1MTVA 3SU6A 2VHQA 3RXUA 2R6DA 2P0EA 3S0NA 5DNYB 2XWAA 1AHTH 1JBKA 3NHAA 2IJOB 1Z5ZA 1EJNA 5BN4A 4PX9A 3TVJB 1PPCE 4MKGA 1CSOE 2EEKA 1DTSA 1XDBA 2BKUA 3RU4E 2QP3A 4US1R 3ELAH 5KO2A 2A3RA 5CK5A 3TK1A 4Q4LA 1HFDA 4D9RA 1KIMA 4PHFA 4KU4A 1KSHA 2D7DA 2A45B 3N70A 4UEHH 7GCHG 1KI1A 1U0LA 4MG3A 2B92A 5EE5B 3RXHA 4YOIA 3QPUA 1QY6A 2A7QA 1VJ9U 1O33A 4NZYA 4F4JA 4BAKB 4OS7A 3BS4A 3A58B 1O3BA 4KFTA 1X1RA 5J5CA 3URCA 4GOJA 2RGDA 4LOAA 4THNH 5DG6A 4FU9A 2YJTD 5FBQB 1DM4B 1GBDA 1OOKB 1JPNA 3QPVA 1D2NA 3HDTA 3RXJA 2ANCA 1GJCB 1L1GA 3ZZ7A 1SGQE 1TPZA 2XJ9A 1J90A 1T3LA 2GBLA 5FOWA 3DHWC 4HUQB 4JLKA 2GCTC 1YBWA 2CLCX 3FMPB 1ELOA 1JB1A 1ELDE 4Z1MD 5C2JB 2CHVA 2G83A 1VITG 2XBVA 2H9EH 3H1TA 2XZOA 1D8TA 1G8YA 2TGTA 2PCJA 3Q3YA 4TQAA 3AVXA 1OYQA 5TB5A 4BAQB 1GG2A 2PMDA 3SU4A 1VITH 4DIHH 4MDFA 1Z1IA 5KNDA 3RXEA 1U99A 3DDCA 3F68H 3VKGA 3I8XA 4KTCA 3FMFA 1TU4A 3VXFH 4B2CA 3BAFA 1GI2A 3H7TA 4B47A 1FDPA 2Z9JA 1GVKB 2RGNA 3BH0A 2SGEE 2XC0A 5JI3E 1NIPA 2FI3E 3VU9A 2J9NA 2FSGA 1CHOF 1MTNB 5LB4A 1UK3A 1ZR0A 3H2YA 1E3MA 1MU8B 3FHTA 5JLJA 1XF9A 1UCYE 4H6SB 2A5KA 3PMHB 1GJ9B 2AYWA 4QFMA 1KJYA 1XD2B 4XDEA 3O8DA 3BERA 3SV8A 1OH8A 3CNLA 2RGXA 4LZ1H 1Z06A 2FA9A 2G1JA 1P73A 1W4RA 1SG8B 3UY9A 3VFEA 1ZIOA 4Q1EA 2R6GA 1BB0B 4WA7A 3GFPA 2ZJYA 4LBWA 4D4KA 3KNXA 1XMIA 3HU1A 1KJZA 3BV9B 3H5CB 3ZVBA 4FW9A 3SJOA 2OZEA 3P8FA 2BM2A 1O3LA 1THPB 2Y81A 2A5GA 4D7FA 3R9XA 1ZC3A 3RS7A 2X2EA 2WPDA 3NDPA 4AYWA 3K70C 2O8DB 1G20E 2G3YA 1HUTH 1IHUA 1P3EA 1PQAA 1ZBDA 1IY2A 1GGDB 5KUTA 1E9BA 4QOSA 1IQHA 4NG9H 1FZZA 5B2ZA 4KAXA 2O8FA 3C27B 1GBBA 2ZVPX 3LRPA 3SU2A 4BFZA 2RA3A 3TUIC 1J17T 2FFBA 1GVLA 2QUZA 4QNMA 2O0JA 1A1RA 4Q9JA 3E8LA 1EX6A 2BY5X 1NN0A 3TH5A 3B9PA 1H8DH 3QJYA 4EKDA 5KPDA 3HKIB 3BTQE 3E70C 1KTTB 1SSXA 4CBNA 4PO8A 2HVXA 2Z9IA 4WH8A 1CA8B 5FTMA 3BSQA 2CCGA 1OYTH 4Q7ZA 2JAQA 3RC3A 1WP9A 3RDZA 4RD2A 4AFUA 2JLWA 5A0CA 4Z54A 2VO1A 4YESB 2NU3E 3U44B 1RTFB 2P8OB 1E2IA 3TIFA 5DN6D 3SGBE 1RTLA 1NESE 1LW7A 2G0TA 1G64A 2A5AA 2BDIA 4XSHA 1KI8A 2ZHDA 5BRRE 2C78A 3NIBA 2BMEA 2QN6A 1OIXA 4POAA 1YR8A 2ZAOA 2ZF0H 1ZYOA 1EK0A 1ZLRA 1VG1A 4YZUA 1OB2A 1K8RA 4D4LA 4Q01A 1NMYA 1BH2A 4M1MA 2BOKA 2ZJAA 3BTKE 5JPMH 4AFQA 4BLPA 1LVGA 2ZUCA 3DL0A 3KKNA 1GI9B 2ZTYA 4BLRA 4K1SA 3SNCA 2ORWA 2QQEA 2J87A 4D4JA 4AOQA 1VITF 4LBVA 1RGQA 2BOVA 4RD4A 4DT7B 3RXSA 5E7IA 1QBNA 1F60A 2W83A 1RJ9B 2A4RA 5FPSA 3ZZDA 4A0GA 1DVAH 1E2HA 4PANA 2J7PA 1K1NA 1KGDA 1BUIA 3CR8A 2ZUBA 1GWNA 3SJCA 3OEED 2FO9A 2DPXA 4MVNA 1P5ZB 5JFGA 3A7WA 5GVSA 5E7MA 2LNCA 4NIVA 4X8UH 4R98A 2RA0A 2XITA 1A0LA 5EODA 1OP0A 3SNEA 1VPLA 1Z6YA 5F03A 2YOGA 4YO9A 4RD6A 3GLHA 4O2RA 1OP2A 3DOEA 4LYFA 3PVSA 1U90A 3DT0H 3Q76A 5GVRA 4JS0A 1P12E 3ZZ5A 2CNWD 2QEQA 3T26A 1HPGA 3MU4A 3LLUA 4ASHA 1CRQA 4MDSA 1Q3HA 2FGJA 1QDEA 3GQBA 4NCKA 2CCJA 1F7ZA 1W7XH 4PROA 1E1QA 1MBQA 3EC1A 1NL3A 4B44A 2K1QA 3A8BA 3VPKA 1HBTH 1U9IA 3SI4H 5A2MH 1ZJKA 1TMKA 3NXPA 1KI2A 2QF3A 2TPIZ 1A2BA 4KKDA 1ESTA 1RFNA 2PGBB 3QF4A 4PTLA 5BYJA 4GPGA 3W3AA 1E0JA 4NHOA 5J4HA 1ANEA 1EFCA 2VH0A 2WPMS 1NTPA 5HKKA 2EW1A 3KQDA 1A3BH 2DUCA 2JLRA 3WYFA 3ZLJA 2JGNA 4OS2A 3QNUA 4GP6A 4P4UA 4Q66C 2XBWA 2V9PA 3FFBA 2ZSEA 2GZAA 4GMXA 2GJSA 1OH6A 1EATA 2ZQ5A 2XZLA 5LD2B 1QHGA 3EA8A 4JBXA 2ZRNA 2IYWA 3A7TA 3EQ0H 1EX3A 3ZZAA 1P6XA 3RM2H 2VF7A 2YWGA 1NLZA 1Q21A 4RY2A 4TL8A 1CR2A 1QB6A 1DS2E 1HURA 3QO6A 4WMDA 4IXMA 4FMCB 4EFLA 2YOFA 4AB9A 4BGDA 1E79A 1OFTA 4FN5A 1QHHA 3N2IA 1LF0A 3GLFA 2CEAA 1NU7B 1Q44A 2WWGA 2QL6A 4YLUA 1C2FA 1BTZA 9ESTA 3VB4A 2GP9B 1GI6A 4J0QA 1E9AA 2AKYA 4OK6A 4A15A 3SDZA 1O31A 1OFUX 3TNSA 1M1YE 2VWOA 2EI6A 5CB8A 1AGRA 2QCYA 3EYDA 4AFZA 3A4NA 2VINA 3K09C 2OC1A 1HAGE 1Z0DA 4LK2A 3DKVA 2BEKA 4TWYA 2GMTB 3RXBA 2Q3MA 4NCIA 3B60A 1T3SA 4ZKOU 2J2UA 1NNEA 1JAHA 2B0FA 2BD3A 3W95A 2PBRA 5CB6A 3HPRA 4IS5A 1HAHH 1T8TA 4R9UC 2ZRBA 3ATWA 1N6LA 1P2JA 2J0UB 3R7WB 3RXGA 4XOIA 3TKLA 4DLTA 1RRGA 4QHYA 4NYIR 3ATKA 1FV9A 2XNIA 2PFEA 1KLJH 3I29A 2GXAA 2BBWA 3ZGXA 3NC0C 4US0R 4DLYA 2J0QA 4F4OC 4JBYA 2WYJA 1CRPA 2ZFQH 1SGYE 1TNKA 2FH5B 4AB8A 4NIYA 3E2IA 5JB9S 1CHOG 1DLKB 3Q77A 3K0AA 4K1TA 2XTZA 2OAP1 4IOKA 2VWNA 2BBOA 1TNIA 2TIOA 2G8TA 3QUMP 4FXGH 2FOLA 1XJCA 1G3DA 3SOPA 5TCAA 4QNRA 2OG2A 2GVZC 2QSZA 3K0AB 1DAEA 1P2OA 4UNQA 5FR1A 3UNSA 1RS0A 3T1QA 1O3IA 4B3CA 3V4RA 3ZIAA 3UIRA 1NN1A 4TQUS 1WV7H 4G5QA 2PX3A 2VVUA 1N6PA 1ZGVA 3GCTF 2FG5A 1DX5M 2H6MA 3M5OA 4OQLA 4NKRA 1XRJA 1G3IA 5AK0A 3IBYA 1C5OH 4HB2A 5G3ZA 1OB5A 3B1WA 1V3XA 2BMJA 1HE8B 2OUKA 4TT3A 2SHKA 4FWTA 5HPYB 5LPFA 3SQXA 4CRAA 3KQBA 3LGWA 3U3MA 3F6UH 4BLOA 1HAXB 3CS0A 2TGAA 1IXZA 1KJWA 2ZRCA 4R7ZA 1GKYA 5E0GA 3RLFA 2FPKA 4RFSA 1O30A 2FIRH 2V8OA 3QUSA 1MH0A 4LJ5A 1P11E 4Z0KA 1O2UA 4ZKSU 1XNJA 2ZIQH 4C4PA 3NHBA 1XD8A 4MYUA 4ZXYH 3AVYA 2A5YB 1DLEA 1T8LA 1KZ7B 1GG6B 1GNRA 5DGXA 4L5BA 3URDA 2BQ6B 2P94A 4E5UA 3E5HA 2FGKA 2ODEA 3LD9A 4HDQB 4MH0R 2GKVE 1ABIH 1ZHRA 4WY3A 1P02A 2A2ZA 4G3XA 2UUKB 3PV2A 1VYUA 2FPMA 3STJA 5EGMA 3Q7QA 2XRCA 2BY6X 1RVDA 3RXTA 1UKVY 3TUJC 3RHFA 4CRBA 4UFGH 1AFQB 2DBYA 5EE9A 4DEXA 1G8GA 1O37A 1BMLA 2FP7B 2IPHA 4DGJA 4GZMA 3T62A 2VL7A 2F1RA 3IITA 4JBWA 3W6PA 4O3UA 3Q8XB 1LQDB 2XBXA 2WJVA 2ONKA 3BTFE 2ZDNA 1OP8A 3H09A 3E0NB 1LHGH 4MNWA 4DJTA 4FUEA 3VX4A 1DARA 1B0EA 2BD8A 4C0HA 2FEMA 2ZE6A 2PWXA 4IFBA 3IG6B 3CM0A 1P60A 4EDHA 3KB1A 1V2ST 2LPRA 2XB2A 4ILEA 4B71A 2OXSA 2ZU6A 2ZJZA 2BHGA 1GDNA 1BQYA 4AG1A 3KKOA 4YQFA 2AKAB 2XXAA 2CL7X 3P6ZB 2JIZA 1TPSA 4PO1A 2FJUA 2ZCLP 1KO1A 4BXSA 3DMNA 3NG1A 4FUCA 2R8RA 1O3OA 1SVKA 3HK3B 1JECA 1Z8GA 2W26A 1O2OA 1EWRA 2ODYB 3R8FA 1M8PA 4JZKA 2O0HA 5GWZA 721PA 2G4UA 3TNFA 1P10A 3MGCA 1VHLA 3LVQE 1YCPK 4ZDJA 3GJXC 1GNPA 1G18A 1E4VA 3PUWA 2OC0A 2BY7X 4DXAA 4AYTA 2QQ0A 2ZG0H 3ZZTA 1ZC4A 2F9NA 1P05A 3TAUA 4U32A 4AYVB 4OJQA 5TV2A 2J0SA 2CXVA 3PIRA 5AVDA 2ODNA 4Q9HA 3KTAA 3TGPA 1S85A 4K60A 8ESTE 3SV9A 4CBOA 4JVMA 4AY2A 4PSVA 1IBRA 2PT5A 6LPRA 2BQ7B 4JJKA 4I33A 3VNVA 2O52A 4FIDA 1P06A 1KY2A 5CHAC 3F9HA 2A2QH 1G2MA 3OSYA 2A4GA 2RDLA 4ZV4A 5H70A 1FMLA 1ZJ6A 1GVNB 3KZ1E 4UKDA 1BBRK 1GL0E 1YPHE 1JXOA 1CT4E 2ATXA 3FHOA 4YC7A 4JLOA 1EAIA 3I3SR 4W9MC 2AH4X 5L3RA 1SLVB 2HYIC 1UKZA 4BEJA 1AQ7A 4Y10E 3B8HA 3LJOA 4ESTE 4CEIB 1KTVA 2RHDA 3ASYA 1V2KT 4A1FA 2YWEA 3M35A 3BF6H 3BWDD 2RAPA 4Q1FA 1KKMA 4G5GA 4LYJA 4JL8A 1HV7A 2ZFSA 1JR6A 3CKLA 3Q3KA 1N6YA 1K5DA 5C20A 1TWXB 2H9TH 2L0XA 3BD9A 2C77A 3NWJA 1S1CA 4OGYA 5F98A 1UADA 3V7TA 2CL0X 1O3DA 1FY4A 1UTOA 1II8B 3OE7D 1XXHB 1VZQH
chains in the Genus database with same CATH superfamily
5CCDA 2EKLA 1LJ8A 1F2VA 3LWNA 3F4LA 4KXQA 1TK9A 2QAGB 5LBIA 4RD1A 3T35A 2FG7C 1PT7A 1LS1A 3IBTA 2NT3A 4TL7A 2F9LA 2WHEA 2GTBA 2LPMA 2W2KB 4L5AA 3KCQA 3NYIA 4G0XA 3U0VA 4CM8B 4UUPA 5JV5A 1HKHA 5IDKA 1MKWK 4QYIB 4CF4A 3LYAA 4RJIA 3JYHA 2KSQA 5AQEA 4CBVA 2NUTB 4WH0A 2XQGA 1WQ3A 4NATA 3RIMA 3ISVA 4YJ2A 2R1VA 1Z45A 2W8BB 2WP8J 3FVRA 1F7UA 2AJLI 2DTEA 3PX7A 1N8SA 2GO7A 1Z8FA 2P9BA 2OO5A 1HE4A 5KOHA 1I7DA 4NY1A 3BTVA 5EZQA 1UCYK 3AUJB 3ENVA 1PT5A 5IT5A 3OA0A 4V0OA 5SZIA 2E6KA 1MXHA 2WTNA 1MCVA 3KXLA 1UC5B 3G0DA 4C05A 4OV6B 3IRUA 3FN8A 1EGVB 3DT6A 3SQNA 1PS9A 5L51A 4J3JA 3GBPA 1D6NA 3BDVA 4BNYA 5JAOA 1O3GA 1J8DA 3LGAA 3WYNA 1DBQA 3PQDA 4C7VA 2ORVA 1A82A 4A92A 1RDFA 3EMDA 3LUAA 2ZUUA 1BRAA 1VGVA 4EHDA 4YDQA 3N99A 1U1IA 4MV6A 2BH9A 1QYDA 4Q7JB 5IC5A 3BILA 2ORYA 3ZV5A 1COZA 3CTMA 4YRFA 1E2UA 2EWWA 1AXRA 3OCCA 4YJ3F 1QO7A 4XBDA 2XCLA 1GL1A 3AINA 1QYRA 1KL7A 4L8VA 3GJ4A 4RH3A 3C5CA 1OHHA 4HDKB 3GLGB 3ZI4A 1TYAE 3CW2A 2YWCA 1VKRA 4QU8A 2O6LA 4QWWA 4R1UA 4EVQA 3TSWA 1ONBA 4QT8C 2QG6A 2YHIB 2QTGA 4R69A 4ZAEA 4NLLA 4DMCA 5C1UA 8LPRA 1DC5A 3LNCA 3EXEA 3PPYA 5JBCS 3PGLA 2Q6IA 2BUCA 2FMHA 3I52A 3HB9A 3L4BC 5SYAA 5CGZA 3SYJA 1ZRSA 3M6UA 2F1HA 5JD5A 4TLMB 2DFVA 4WVFA 1XVUA 4PFJA 1O96A 4TT8A 2FOXA 2WJ4A 2PKEA 4TUYA 3P45A 2BMDA 3H5OA 5KVAA 5KNLA 4BNMA 4CLEA 4DJFC 4WXRA 3A85A 1YL6A 1JFVA 5DNAA 2NZUG 5BSKA 5KQMA 2RGRA 4DB2A 2KS6A 5ADHA 1C1MA 1EXFA 3CH6A 1I5EA 1JSZA 3RU4D 1DOHA 3GARA 3JPYA 4G9GA 1MA3A 1XLUA 1NT2A 3ZWCA 1MMFB 4EUKA 1L5ZA 3N7OA 1UPBA 1DOJA 1WAYB 1SB9A 4KR0A 4ZVVA 1SD1A 3G79A 3EPPA 3Q40A 1ND5A 3WRXA 1HYGA 1YS9A 4CQMD 4RKOB 3P9NA 5CVCA 3RVRA 2JFOA 1ZS9A 2C9BA 4IMZA 3O4VA 1T1RA 3DTVB 3OIYA 5H68A 4U6QA 1TA0A 2R2GA 4X1KA 2AZ4A 1E3SA 4OFZA 4U7FA 3ZLTA 5JO0A 3J81A 4MEAA 7ESTE 1M8FA 3TO5A 4XM1A 1SUDA 3ATMA 3MHPA 1YA8A 3OHPA 3P2JA 1PBTA 4F3CA 1YBFA 3RWBA 4GZ3A 1QV6A 1ZCJA 3G8DA 5DGIA 4GAWA 1KEEB 3SQEE 2FR0A 3OM0A 1ZH0A 4KMRA 2Z3EA 4AJ9A 1G1AA 1NVMB 1CS0A 1M2OA 2I3DA 5DYIA 3WL7A 4B48A 4ETMA 3U16A 3PQ7A 2V0NA 5J4QA 4ALJA 2F9OA 1BDHA 1ODKA 1H6AA 3AESA 3K9NA 3OY7A 2H59A 3R20A 4UM8B 5HG0A 4I7EA 5FHQA 2F3PA 4BFLA 2FLVA 1ABFA 1DVRA 4INPA 2ZC9H 3H86A 1LPBB 2H1HA 3N0XA 3EZGA 1T9AA 3T1TA 2D59A 1QAOA 1O2RA 2CLKB 4MX8A 5A2QA