4B76A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
645
structure length
645
Chain Sequence
b'GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 211
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b76A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b76A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b76A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b76A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b76A03
3MWIU 3MMGA 4BE7B 2VH0A 3ZVNA 5DG6A 2VB0A 1FUJA 1QY6A 1MTWA 4Z1MA 5E2PA 1GAJA 1KY3A 1FIWA 4OQXA 3RXHA 3D62A 2W5EA 2G81E 5T3HA 1ZCAA 3ADCA 1AQ7A 4A6LA 1LKBA 5CHAC 3RSLA 1S9DA 2XZPA 1FNIA 1G4UR 5AR1A 2XZLA 1WCV1 4A4DA 1K1IA 3KZ1E 3IWMA 4D82A 5E0HA 1E2EA 1NZQH 1QL9A 4OYHA 4NCKA 2BDAA 1U9IC 2VP6A 3GCTF 4JLDA 1RTKA 2BY5X 2OFWA 3CUEF 5UKDA 2ATXA 3TITA 4RN6A 4QGGA 3BIUH 1M6NA 1EAWA 4KKDA 3H86A 3ENSB 2NU0E 2VEDA 1OW3B 4URVR 2VWNA 2Z3CA 4YDHB 4YT7H 4WY3A 2QBYB 4FUJA 3UWOA 5BRRE 3SU3A 4V0ME 2J0VA 4PAQA 1GCTC 1MO4A 1D2MA 3OIVA 1BMMH 4JVSB 1KTSB 2ERXA 3TH3H 4AD8A 1TF5A 2X1VA 2Y7ZA 2QPTA 4X8VH 4B2AA 4DDVA 3QPVA 4HAYA 2QXHA 2VRWA 2CJIA 3V00A 1KIMA 1YP9A 1YPHE 4FUEA 2VIOA 2J0SA 4LC1A 5KSOA 1JBKA 2PGBB 3LH3A 3BG4C 3C41J 2EC9H 4LBZA 2QQEA 4ESTE 1P8VC 4B3GA 1UMAH 5DP4A 1COWD 1XD9A 2FF7A 2ZRMA 1QHIA 2FO9A 2ZNKH 2IYTA 2P59A 1O3IA 2A5IA 4NYIR 3A36A 4A36A 2BD8A 4TQ9A 2BBSA 2NU1E 3OE7A 3B60A 4HYYA 1YZKA 2EW1A 4DJZB 1OKKD 5T6FA 4R98A 2WAYA 1XTJA 4F7WA 4JBYA 1QB6A 3RS2A 3QTVH 1H9LB 3OFND 3BEFB 2NO6A 3U61B 3EA9A 2EFDB 4HDCA 3Q9LA 3JVVA 3R9XA 4PROA 3U3KA 4NKRA 4DZZA 3LGWA 2Q0HA 1CKEA 2A2QH 3RRYA 3VX3A 1V2RT 1NY5A 4IRUB 5JMTA 1WBDA 3NVAA 4RKEA 3EPHA 1XCMA 1QRAA 3LQQA 5FBEA 1FN6A 4A8JA 3TGJE 1MOZA 3EA0A 1KO8A 1QHRB 4DW2U 4TMKA 2GF9A 1EX6A 1JQLB 1FTNA 1BMNH 2BV3A 4HUQA 1CF4A 4FW9A 4CHAB 4M9FA 2YYZA 1C5NH 1WQSA 2ZP0H 3DVLA 1QTFA 3SJOA 3RXVA 1TMTH 3GLHE 2JLRA 2BD7A 1M2OB 1C2FA 1C5YB 4X2XA 4JZIA 4QGAA 1TE0A 2FMJA 1LQEA 2PSYA 1VKJA 2AXPA 3TNTA 5JJIA 1GL0E 4DUGA 2RB4A 2CCGA 1W3CA 1W44A 1EPTC 1E0SA 2QSZA 3AVZA 1GBFA 3KQCA 3VHXA 4IXNA 3QKTA 3T06B 6GCHF 2JLVA 1MKXH 2E1RA 4BAOB 4Z51A 3RC5A 1FDPA 3ASYA 2FWWA 4MNWA 3UK6A 3UMFA 2EFGA 2PX0A 3KUCA 3KHVA 5FTJA 1OHHD 4ABIA 1W7GH 1C1QA 4PFSA 3IHLA 1VHTA 4ABGA 2STAE 5L30H 2PT7A 4NIYA 1PJRA 2VSXA 4JSYA 2BMDA 4QHYA 4C3ZA 3U1IB 3CNNA 4OS2A 1KO7A 3CZPA 1TBRH 1PV4A 2ORVA 3HU1A 4R2IA 1V2QT 2HVXA 3X1DA 3QY0A 4GLYA 3A7TA 5CM9C 4P4UA 2OCYC 2ZDMA 2F1IA 1ELCA 3M5OA 1K28D 2WICA 3RXJA 4R0IA 1O2LA 4IVQA 1IBRA 1QHXA 5JCZA 3FGNA 1Q1BA 2GVZC 1E9CA 2FOLA 3UPUA 1X6VA 3PUVA 1XTRA 2GILA 1RJ9A 3W8NA 2WPDA 2FFHA 1ZNWA 1L1NA 2ZWLH 2D2DA 3BSQA 2BEJA 2JEOA 2VP5A 1N6IA 3F9HA 2HRVA 4IN1A 2PZFA 3T1VA 1HRTH 2GK6A 2CHQA 2ZCLP 2H9TH 2W6JA 3Q8XB 2ZSAA 4O25A 3LJOA 3ZD6A 1AD8H 3MFJA 2ZROA 3T29A 4GFDA 3IGFA 5F9FA 1WQ1R 2WJHA 1A0LA 2DFLA 3F5FA 2ZPSA 1O31A 4ESVA 3RXOA 4J2YB 1O2TA 2F9NA 4ZXXH 3UNRA 4P4SB 2NZJA 1G6OA 1GBHA 3QNUA 3OX7U 1ZRKA 1FZQA 4NA8A 4NA7A 4JBXA 1VGCB 1P9SA 5FPYA 3A7VA 1UF9A 1FPHH 1OSSA 1UKVY 2ZU3A 4M9ZA 1EX7A 4XSKU 2KWIA 3KEEA 3JVUA 1L0ZA 2CV3A 5SZJA 1Z8JB 1AFQC 4MDFA 3NDBB 2OE2A 2RHMA 1SHHB 1BKDR 2FTMA 1Q21A 2GJSA 2ZTSA 1O3CA 3LGIA 2ZHEH 2HXYA 4X6OA 2PSXA 5J4KA 2WV5A 5FBLB 1SFQB 1AHTH 2FSGA 4GCHF 4WZ6A 1SSXA 3GLIA 1L1JA 1NJFA 1S6HA 1G8FA 4KJZA 1LVBA 4RVCA 2DUCA 1UK2A 3NBFA 3RMLH 5JWOA 4ZI2A 1P2UA 2B8WA 1OXGA 5DIFA 3IEVA 4FUDA 1OWKA 1PPBH 3G0HA 5HGGA 1YVDA 2XXAA 4CDGA 4ASUD 1D6JA 1T4VH 1G5PA 1XPUA 2O8TA 5FL7D 2V8OA 4XSGA 3TK6A 3GLHB 1GJDB 3SJKA 4AZ2B 3I29A 1I4DD 1FNNA 4WXIA 3E70C 5P21A 1MH1A 3TK5A 1FMGA 1C5PA 2G00A 1DBSA 3G5UA 2ZDKA 3E2IA 2F9OA 4BOHA 3VR1A 3PV2A 2F7SA 4JLBA 4TYQA 1N5IA 4Q7YA 4EAQA 2J45A 3THWA 4AOQA 2DE8A 5GVRA 4SGAE 3SYKA 2ZM5A 1TA6A 3GY3A 3VQTA 1U99A 4ARZB 2GCOB 3NHAA 4KFTA 3RANA 4B1TA 1DAEA 3JZAA 2WMOB 3SHCH 4UFGH 3WHKA 2QGRA 1T8MA 2GCTC 4NCYA 4O3MA 1YZGA 2FZLA 1FP7A 3QVUA 1TOCB 1UTMA 2H9EH 1QG2A 3SU8A 3TAUA 3RXIA 1SXJD 4WMDA 1Z06A 2H1LA 3BH0A 4B3FX 3K6ZA 3LKWA 3E3TA 1A46H 1FTSA 1KK1A 2YINC 3HPRA 2IEYA 5E2OA 3KNXA 3TQFA 1S0RA 1W5SA 2A5AA 4FMCB 1N2CE 1FNMA 4JLNA 3L43A 3IKJA 3S9CA 1AZSC 2D2EA 4A5TS 3E8LA 3PV5A 1VCWA 2RGGA 3RXUA 2OD3B 3MH7A 4C0HA 2PHBA 2BY6X 3I8SA 1GUAA 4NYMQ 5DI3B 3RUOA 3PEVA 2WKRA 1AWFH 3F1SB 1PPEE 3VR2A 4D26A 2O8CB 3A8DA 3U4QB 5JLJA 3EQ0H 4S2EA 1W4RA 4KODA 4CEIB 3MLEA 1K5GA 2GKSA 3EZFA 1J17T 1HYQA 1K8RA 2EVWX 2VP9A 5EE9A 4TYNA 1KZGB 3ICEA 3MI4A 1SVPA 2FSFA 5GIBA 1MZDA 1HEIA 3PTBA 1EQ9A 1RYHA 3HR7A 5LH8A 2RGCA 4BLPA 4G1UC 1TPPA 3GOVB 1P2KA 1GHXH 2BJVA 4D76A 4DIEA 3HK6B 1G20E 1G16A 3P8FA 2F9BH 1SQAA 3NUMA 1ZBDA 2B5TB 3IIKA 3C5CA 2C78A 1XJCA 2O8EA 2GGVB 1E2JA 4PR0A 5CB6A 3Q3XA 1BTUA 1GDDA 3TLOA 2F43B 2QNRA 5BN3A 4UJ5A 5KHOC 1O35A 1V2NT 2ONJA 3E6PH 2J3EA 1OF1A 4G5RA 5C3NA 2LNCA 3BEIB 4JKYA 4A2QA 1NRSH 2P5TB 1K9OE 3ZZ9A 1JECA 1Z0AA 4BLOA 1IQMA 4B47A 1OIWA 1UEIA 3V7TA 4HAZA 1U94A 2GDEH 4BTUB 2A4GA 3CENA 2F55A 1ZTKA 4B43A 3I62A 4D25A 3ATLA 1W2GA 4V0OA 3AF4A 1ZHRA 1O5AB 3UR9A 2BB4A 5AFZH 4IKEA 3EW9A 3SJBA 1XX6A 2V7QD 4AFZA 1QB1A 1U0LA 3ZZ7A 1EAXA 7LPRA 2OBNA 3D8BA 4QHSA 1EX3A 2PL3A 4UNRA 4PHHA 1TYNA 3MAAC 2PW8H 4VGCC 2FH5B 3ZV9A 1MQ5A 4OGXA 2FDCA 1IN6A 4HI0E 4K1TA 2OG2A 4OS1A 4MUBA 4IFEA 5E95A 1EZSC 4AYXA 1Z07A 1BZXE 1G9XA 4BAKB 1ZNYA 3TGKE 1GJ9B 4IN2A 3D65E 1QQ4A 2AFIE 2OAQ1 1OE0A 3ELAH 3LVRE 1JXPA 4WIAA 2BVXH 4JL5A 4NTZA 4Q7XA 1VIAA 1BS1A 3RLWH 1GVZA 2I6SA 1GI1A 2WJIA 1CA0B 2XC5A 1U98A 3C4JA 1MR3F 4JKIA 5KDLA 2ZRGA 4BFTA 5FXLA 3RU4D 3ODDA 1R10A 1SKYE 4QC2A 1FQ3A 2JCSA 2FE4A 4TMXA 4B75A 2QF0A 4GOXA 1WTHD 3PR1A 1NTPA 1TNIA 4A1VA 1O0DH 1KZ7B 4ABAA 2ZTXA 3U7HB 4KVGA 1O32A 2ZFTA 1GG6B 3NWJA 2VBCA 4GRAA 2ANKH 621PA 3ND9A 1HPGA 1FONA 2NPFA 2NU2E 2C9OA 1N5KA 3RXKA 2AS9A 2A7JA 1CBUA 1TPZA 3C15C 2V6NA 2WZQA 1UDWA 4Q7ZA 2SGEE 4CEJB 1ANCA 1II8A 3BTWE 2NMVA 2B0FA 1C1UH 5TDHA 2ZSEA 2R8RA 5EXSA 2ZQ1A 2BZAA 3FFGA 4PO8A 3OIUA 3SV2H 2WINI 4L5BA 1XUIA 4D0NA 2CJWB 3FMFA 4LDJA 1E1RA 1NESE 1XDBA 4NH0A 4I8KA 1ZMXA 1G3EA 3LLMA 1NLZA 4PO9A 3KQUA 5JHHB 1KI6B 1S3GA 2BHGA 1XB2A 3HR8A 1MAXA 1SGRE 4JK6A 4Q9IA 4A0GA 2EI6A 2YWGA 1F48A 4IGDA 3A7YA 4XBCA 3MYWA 4Y0ZE 2ZE5A 4Q48A 4NMMA 1H8DH 2ZTZA 3SR0A 1Q3TA 3F9GA 4QOSA 1GVNB 3ATIA 1GJ8B 3R8CA 3W9YA 3CBQA 5JECA 1EWQA 1R8SA 3P1JA 1T8OA 4IJMA 3UOPA 2GZDA 2BDHA 1VCPA 4X6MA 2GEUA 3PB1E 4PTLA 4TSFA 5G3YA 5F2EA 3ZIAA 1DVRA 1KXBA 5A0AE 2XNDD 3Q5EA 3UG7A 4PPFA 3AGQA 1K1NA 1YHNA 2AWOA 2Z9JA 1DTSA 4Q21A 1G2LA 2BQ6B 3ZZ0A 1T0HB 5BN5A 1GILA 3KF2A 4EPXA 2WUBA 1ZPCA 2OFXA 1ANBA 2HGTH 5AJXA 4PSVA 3KJHA 4CEHB 1E3MA 2JLXA 2PKAB 3AVXA 3UNQA 2HDNB 2A78A 1E2DA 1HE8B 1M7HA 1OLOA 1JWTA 1E2LA 2YJTD 1SXJB 1GBMA 3KL6A 2A45B 3U6KA 4KU4A 4D7FA 1E1QA 521PA 3PWCA 3RXLA 3X1WA 5KNBA 4B2LA 1L4YA 3VXEH 3T34A 1BTXA 1V5WA 2VF7A 1KHTA 2D7CA 3CW2A 5FL3A 2YVUA 1JIMA 3QGJA 3AVOA 3F6UH 1FAXA 1THPB 2ZPQA 1P0SH 4HDQB 4PPGA 3U8TH 3RHFA 4NCIA 2BIFA 2ZETA 1ZU4A 2A2XH 3PLPA 1GDQA 3VB3A 4RI0A 3B13B 4D4MA 4TY7A 3IEUA 1MABB 1PJPA 3L0SA 3I5YA 1XKAC 2QORA 3B1VA 4R71A 2ZU0C 1G3UA 4FUFA 5FX6A 3SQXA 3DDCA 4MITA 4NYJR 1JAHA 4LHWA 2G1JA 2GT8A 3SU5A 1BCUH 3LVQE 4YXWA 5JRJA 1M7BA 3LW8A 1EZUC 4P3YA 1SKYB 1NRNH 5ANRB 1HH4A 1OXVA 4FVDA 3SV8A 3UANA 4NP6A 1AWHB 1WRBA 4Y8YA 1GM5A 1JPNA 5A0BA 4MYTA 2BEKA 1Z6GA 1GBLA 4JCNA 2A3RA 4XWOA 4BQSA 1Z71A 1W48A 3H2YA 3M37A 1HAHH 2JKHA 4WF8A 3B8JA 1NSFA 1E98A 5I25A 5J4VA 5FX5A 2AK2A 2WYGA 5B58C 5CDFE 2RHDA 2ECKA 2HOBA 3A1WA 3R8FA 7KMEH 2HPQH 4BASA 1S3SA 1KDQB 1W14U 2REXB 4OBEA 2EWVA 4LZZA 1FUKA 4HLUA 2J5XA 4DEYA 5FUYA 2GNOA 4K1SA 3ICQB 3L82B 3QWCH 1TEXA 4KCGA 3ASZA 1C5WB 2QRNA 3D49H 2ODNA 4LJYA 4ACBA 5JWHA 4E22A 3MUFA 2BHRA 4TTQA 2JIZA 3OTJE 5HTKA 1Z6EA 1G8YA 3U3MA 3CH5A 1RIWB 1C2IA 4QGHA 1EP6A 1QA7A 1YR6A 2CMYA 1SQOA 2ZPRA 1ZJKA 2BOKA 3T5DA 1Z83A 1RTLA 2YOFA 1E79A 2J4IA 2QCYA 1OB2A 1CS4C 3SGBE 2H2ZA 5CM8B 5E0GA 2HCBA 2BKUA 1V2MT 1DANH 1AM4D 1G5RA 1T9HA 3SZRA 3DM9B 4ZH8A 3ZZ5A 1ZC3A 4YMVA 1PUJA 1NS3A 2BYAX 4M1YA 2WPIS 2ZUDA 2GCHG 5JRZA 5KYKA 5I46H 1SGDE 1FPCH 2VH5R 3TBKA 2YNBA 2W26A 2TPIZ 1XMSA 1E0KA 1UAAA 4FUCA 4P32A 3SI7A 2VLIA 2GF0A 3TQCA 5EXLA 2VIIA 4RCZA 1ZPBA 821PA 3EA8A 4Y7AA 5FBIA 1EB2A 2QQ0A 1TTTA 3MOCA 1N6PA 2AD5A 1KSHA 3Q3JB 1UCYH 2O9QA 3I77A 2PBRA 2G51A 2AK3A 2F1RA 3NH9A 2VYFA 2VVVA 3ND8A 1SVIA 4Y11E 3LW7A 3DL0A 4IMZA 2RGXA 3K0FB 3NXSA 3P27A 1ESNA 1DE7H 2V54A 3VGCB 1XMJA 1Z47A 4E09A 3GY7A 2ATVA 1AA9A 4MKFA 1H9HE 1T32A 4MGYR 4X1QU 3A80A 2DB3A 1O87A 2J7PD 3KQDA 2STBE 1GRRA 1NIJA 1TNLA 2ZCKP 2X8AA 1OIVA 5H1YA 2BD9A 3GY4A 2I6QA 1YPMH 4IOKA 1XD2B 3FVQA 3QTOH 3URDA 3QEJA 2XTMA 1P9UA 2FWRA 2C8ZB 5FUWA 1A4RA 1CT0E 4D4KA 1UVPA 3LBNA 1XFAA 1MMJN 3L6PA 4OKSA 2IW3A 3CPEA 1S6FA 2GMTB 3LBHA 3QENA 2J94A 2BVSH 1NVVR 1DS2E 1GRQA 1F60A 4HAVA 4JYTA 4PZLA 4Z8XA 5JI3E 4DCDA 1P7CA 3R3GB 4BAQB 4Q4HB 1E9FA 3HK3B 1XMNB 5C4GB 3RXFA 4LHVA 1U8YA 4AGKA 1V43A 2UUYA 1IY0A 2G1KA 3TSOA 2FS9A 4Y71A 4Q66C 6ESTA 3TH2H 1A0HB 2VJ1A 3PWBA 1K2I1 1C2MA 3I72A 5CLLA 1M34E 1UADA 1C2LA 2PJZA 3BTFE 2OESA 5EG4A 2WWIA 5LPNA 4AKGA 3PO1C 5HCNA 2TGDA 2BBOA 4F4OC 4UNNA 2WYJA 2A7CA 1LTQA 1UBFA 1P2JA 3O8DA 3ADDA 5HKKD 3CONA 3W6OA 3AVQA 1GHYH 3SGQE 3NXPA 4M2LA 5EPYA 1MTNB 2HJGA 3I61A 4MRPA 3FKQA 4C0KA 2A7QA 1W1WA 1YPLH 4TMZA 4H9GA 1U0JA 2IYQA 4AG1A 1YGCH 2QY9A 4ABFA 1NRRH 2OEPA 4EUNA 3EA5A 3ZVMA 3CRMA 1V6DA 4R2HA 1ZSLA 4IFBA 4Q9HA 3JZ2B 3E90B 4A0RA 2P8OC 3M36A 2GBLA 4LK2A 4CT4B 2CNWD 3RXGA 4AK9A 4NG9H 1TL7C 5IF9A 2ZHDA 1QZXA 3RXQA 3V3MA 1X86B 2H92A 1BMLA 1VIYA 1S2MA 2P2LA 1VJ9U 1Y63A 1EKBB 2BDYA 1EATA 4I1OA 1HUQA 4YESB 4TWWA 2FA9A 4ZKSU 3Q85A 3GDVA 3LWNA 4V0MA 3EZ7A 4V03A 2D06A 2KBFA 4AFSA 2R2MB 2J1LA 1YR9A 4I1VA 4D80A 1KY2A 4DDUA 3KTAB 4JLPA 2VIPA 3GLGE 1BTYA 3BF6H 1XXHE 3FANA 2FEQH 3CX6A 2IHBA 3A1VA 4FU7A 1W0JD 5DI9A 1MCVA 4B44A 1E2FA 3NC0C 4DLUA 4HAXA 2HLDA 2CVHA 4URXR 3THXB 1CR0A 4O03A 3PMBB 5AUNB 3STJA 2W6ID 2ZPTX 2ZJYA 5HYOA 2P3TB 3R7WA 1AK2A 3H0KA 4QJ5A 2XOKA 2ZRHA 3TVDA 2FTLE 2OHFA 3R0FA 1J90A 2CK3D 4L4UA 3AM1A 1CR2A 1CTQA 4Z0KA 2D26C 3GLFE 1OH6A 1KDOA 2GTPA 4CBNA 4Y8ZA 3FB4A 4MGIR 1GKUB 3WP1B 1RJXB 5EQSA 1GMDF 3RXMA 3EAQA 3LD9A 2OXCA 3ZZ3A 1ZLRA 1CT2E 2X19A 3DPUA 3LH1A 3GEHA 2ZTYA 3D7MA 4CR9A 4TMVA 1ESBA 1T6NA 5AJZA 2XBXA 1C5XB 2A5DA 3N5CA 1QRXA 5H4IB 1TOMH 3UWIA 3HATH 1P11E 2ZDLA 3AUXA 1UHBB 2EYQA 1BOFA 3B1YA 3NDPA 4HZIA 1VJAU 2VP2A 5AJWA 1VG8A 3MG9A 2H17A 1E2PA 4TL6A 5KNCA 5EE3A 4M1WA 2UWOA 3SV9A 3U5ZB 4UNPA 4YTAA 1S84A 4CBOA 5GJCA 3RM0H 3IHWA 3LGTA 3KUDA 1TX8A 1KDTA 1OB5A 1ZYUA 3QKUA 1QHYA 2SGQE 3HPTB 2HEIA 4Q9LA 1QJ1B 4IC5A 3SHAH 1IXRC 4Y76A 4RSPA 1T31A 1P75A 4HZUB 5L2YH 1DM4B 2IYLD 2BCJQ 3QJYA 1QFKH 3C16C 1I4TD 2BOVA 4HEJA 2V35A 3IIJA 1K5DA 4DC9A 2AKYA 4NU0A 4CGZA 1GI8B 4HLUC 4OI2A 1LPGB 1FY1A 3K09A 1E9SA 1MO6A 3BN9A 3SNHA 3BTHE 4D2IA 1P62B 4I1SA 1X8LA 1JEEA 2HT1A 3NG1A 2A30A 2J41A 2W3KA 4E06H 2VP0A 3O8CA 1NVWQ 1S1MA 4IEIA 1GJ4H 3PUWA 3ZV8A 1GL6A 2ASUB 4IOLA 4W5JA 4Q03A 3M1IA 4TT3D 4URUR 1WYKA 4IOMA 3EDXB 2R6AA 4FCTA 2BWJA 1MUEB 1OYWA 4LPSA 2VU8E 3DKVA 4RSGA 3F9EA 1JNYA 5F9HA 4BXWA 1Q1QA 4YO9A 1V2UT 4HLDA 1BA8B 2AERH 1P09A 1XMVA 3DKPA 1TGTA 3T15A 1FUUA 4Z54A 1N6YA 1XNJA 3EPKA 2FS8A 3EWSA 2OINA 3MD0A 2N42A 2GZHA 3T1QA 1FN8A 2HNTF 8GCHG 1C9KA 4FXGH 1THSH 4INLA 5DN6A 3V13A 1T7CA 3B7GA 1G19A 2ODWA 4HUTA 2CLCX 5JEDA 3ZVBA 3SUDA 1TWXB 4JZFH 2OLJA 1J15A 2P93A 2XEXA 2W3IA 3ZYCA 1NO9H 1HJ8A 1G3QA 4US2R 1B0FA 4HATA 3H7TA 3GLGB 2D1JA 5EXMA 3SGAE 4QL3A 4BPBA 3M6AA 2ZRNA 1YLDA 2WWXA 5CIWA 2FGKA 1ANDA 2F3TA 1PZNA 1D9XA 1A3BH 3QX5H 1P57B 4Q7KA 3KQNA 2K5UA 1KNXA 2ZITA 4CEIA 4B33A 3UQOA 1J7KA 1KMQA 1ABJH 4ZHAA 2XCNA 1QBNA 1EFHA 3T5FH 2H9HA 5F8ZA 3LC3A 2FOFA 1D3QB 3GFOA 5C1XA 4I99A 3TUZC 1E96A 3UMSA 2YOLA 3VNVA 3W8RA 3QQ5A 1P72A 3STIA 3F0TA 2C4FH 1Z3IX 3IDQA 1O2MA 2R9PA 3BTGE 1F2UB 1Q3XA 1FAKH 1KO5A 1PLLA 5KSPA 4IW4E 3QF4B 2G55A 1YCPK 2O8BA 5AVDA 2ORWA 2J9RA 2IYRA 3K9LA 1A61H 2IK8A 4JYBA 3ZZ8A 4E5UA 1GMHF 2FLBH 3TW4A 1P03A 2WSSD 2OFOA 2IOTA 4M1MA 2E87A 1Y3VA 1IM2A 1ETTH 4KP0A 4ITRC 3ZH9B 4TL9A 3LXRA 4FI3C 1TLDA 3TUJC 2EFHB 4TQAA 1GZSA 3OAAA 2ZJBA 5JYIA 5J4YA 1R2QA 5A8XA 2H7VA 3URCA 1FOEB 1YKTA 1ZVQA 5DGXA 5E7IA 1LPKB 4WOPA 3QUMP 3M5NA 3B9FH 3ATKA 1SVLA 4AG5A 1XP8A 4Q9JA 1AU8A 2TIOA 1SLWB 1GNRA 2B8TA 4NBSA 2XITA 2JATA 4CHAC 4C2TA 4EIWA 1HURA 1UDXA 5FOWA 4DCUA 4K1EA 1TONA 5BW8A 1V2OT 4MQAA 3K1JA 3PCRB 3M4YA 1ANEA 1SR5C 1PPHE 2VSFA 2J95A 2AHOA 1DARA 1WMSA 4E05H 1QNJA 4A6PA 1KKMA 4MPVA 1S85A 4EKDA 4XH9B 1GNPA 4FWTA 2EI8A 2EU8A 1NJGA 1ABIH 1PUIA 3SI4H 4B34A 1UK4A 1D4PB 1ELGA 1E2KA 2L0XA 5BXQC 4M9XA 4UNSA 3A81A 4GMXA 1H1BA 1HAVA 5BYJA 3X1YA 2XBWA 1GWAA 3TK9A 1BBRE 1RW4A 1AN1E 2ZO3H 4PX9A 4AIIA 5B30A 1YCPM 1W46A 1VTKA 2B21A 1CBWB 4Q18A 1S0UA 3SU6A 1AE8H 1EUFA 2Y82A 3QG5A 4RKJB 1W4CA 3MCAA 2WJGA 1R5NA 2FLRH 1O36A 4IDQA 3FP6E 3GEIA 2GBLC 1E35B 3SEAA 2FESH 2ZYWX 1HAPH 2GA8A 1O3LA 5KOYA 2AR7A 2R6FA 1C1SA 1GVLA 1OWHA 5HZHA 3UWKA 2IYXA 4FMDB 1G8HA 4CEJA 2ZRLA 1PPZA 4XVQA 4KLZA 2LKCA 1NN3A 4MPWA 2NWNA 1GCTB 3MJRA 1GBTA 3MNXA 2YC4C 2F9LA 1ZM3A 2X77A 1G7TA 4AYYB 4M4SA 2P3FH 3U69H 4Q4LA 2JASA 5A4JA 3VB7A 2OCBA 2QN5T 2ZJ5A 2SGFE 3GICB 4JK5A 1OFHA 3MFYA 4IVRA 1YPHC 4Z1MD 4DEXA 1HIAA 1KI6A 1H8HA 5JHGB 3TIUA 3I73A 1FQKA 4JL6A 3OEED 2QROA 1IHUA 1ESAA 4OGYA 4JVMA 4JYUH 2IL1A 1C5ZB 4V0KA 3EGKH 3WYFA 2HWLB 3W34A 4EQ6B 2WM9B 1ZGIA 4XVRA 1WQVH 1NRJB 4NDZA 4DSTA 2WPJS 1T0JB 1UTNA 1GHBG 1DO0A 1VGCC 3SJ9A 3T1OA 2CF9H 1IN8A 2IWRA 1OYQA 4PC7A 2D8WA 1XEFA 8LPRA 1T5IA 4GZLA 2OTVA 2BDBA 1CXZA 1SULA 4GMDA 2G9NA 1FPMA 3RMMH 5A8ZA 4CEHA 3X1ZA 1GBEA 4NFEA 2CLSA 1YU9A 1KXAA 2DFKB 2VHCA 2ZF0H 1EESA 4ZCLA 3X1XA 3PLBA 1S8FA 2XX3A 3K9XB 4BFUA 1TMUH 1ZU5A 1YPKH 4WXPA 4OHWA 2B7DH 4JLKA 1ZCBA 1QBVH 2P3SA 5JBCS 3QZRA 2FPLA 4CIDA 2BZ6H 3I1FA 3ZZTA 1C9TA 3B1WA 4HDOB 2AGIX 5DE3A 2OZEA 4HI3A 4M21A 4X2WA 1BRUP 1JEDA 3RS5A 4M1OA 1DWEH 4FD2A 1EPTB 1DAIA 1E9AA 3OE7D 4NONA 1GWNA 3C5HA 1KXCA 3HU2A 1ACBE 1XBTA 3ZVLA 2VVCA 4MDSA 1HUTH 1ZRHA 1DICA 1KDRA 1ZW6A 2Q3FA 5D3QA 1SGTA 1UVOA 3TR0A 1BQYA 4C7OB 1WU1A 1O5GH 3VX4A 3B78A 3FWYA 4CH2B 3MNBA 1BO6A 2Z0MA 3GJ6A 3OU0A 4DWJA 4NIXA 1XF9A 4LJ6A 3BB1A 2C3SA 3RMNH 1HA3A 3EPJA 1F92A 5AFYH 4JZDH 4O0MA 1OP8A 2H57A 2OO7A 2IWHA 2ZGHA 3RYTC 2F3CE 3AF3A 3CWZA 5E0JA 1F6BA 5J4LA 2XYAA 1KK0A 4AKHA 2ZA5A 2OC8A 2R6GA 4AB9A 1JR3E 2NTYC 1P2SA 1Q31A 3UY9A 1OKXA 4THNH 3T27A 1KOFA 1ZAKA 1AGJA 5C2JB 4GZMA 1DLKB 1FIZA 2O8FB 1O2HA 5LGOA 1E36B 5L3QB 1SPJA 4DLXA 1RGQA 3DZDA 1OFUX 4Q1BA 1GIAA 2Y7XA 4E03A 3SBDA 2PWXA 1SVKA 4DUGD 1D9ZA 2HV8A 2FOCA 2R6CA 3AKEA 3IO5A 2QPAA 4A7IB 2BTCE 4EPVA 2JDID 4N3NA 3U44A 1Z08A 4QXAA 2ZG0H 3DT0H 4B35A 4B32A 1ZP6A 6CHAB 3U9AH 4Q4AA 4BFZA 3T2NA 1CLUA 1R7RA 1ZINA 3FYHA 2WUCA 1NN5A 4BLTA 1W2HA 5JBQA 1ZD1A 1G37A 1TGSZ 1JJ7A 5K8UA 3BEUA 4A2WA 1V2JT 3RC6A 2FYRA 3LGYA 1AFEH 3S9AA 1MO5A 2IS4A 1E0JA 4BTIB 2Q3MA 3SU2A 1C1WH 3QUSA 1DDJA 3ZZ6A 3I4LA 1VR1H 3OF5A 1ESMA 2IS1A 1TQ7B 4XTCS 3TK1A 1Y5UT 1GL7A 1V2WT 1TUIA 2CCJA 1ZJ6A 2BMFA 6Q21A 1XTIA 2QI9C 4ZKOU 1ELAA 5H68A 2ZREA 3S1AA 3Q5DA 3KIDU 1K21H 2QP3A 1RFNA 2ZRPA 1H8EA 1SLXB 4XBBA 2QE7A 1ZMJA 1N6NA 3LDXH 1BMFA 3SZEA 2BLWA 2WPDD 5FCKA 4S35A 5E3HA 2QM7A 1QBKC 1GDUA 1G4AE 1WB9A 5EJEA 1NN0A 1L7VC 2ZFQH 1ZRBA 5J47A 3OIYA 1E0AA 3AVTA 2Z5FA 1G7CA 4DLWA 4DLRA 2W6JD 1RD3B 3L8ZA 1Q1ZA 4UXHA 5LPFA 4XTRA 1KI8A 1AS0A 5F3WB 3M3TA 1KO4A 3QLPH 2REBA 2CF8H 1TPAE 5TB5A 3TRFA 2FG5A 3EASA 3OY6U 2PTCE 4GNKA 4A9AA 1UKYA 2W7SA 3KB1A 5C20A 2OUKA 5C2ZA 4LHXA 3FHTA 2NGRA 2VINA 1TQ2A 1WBGB 1MZAA 5FTKA 2HXSA 2Q21A 2VP4A 3NEJA 2GJ8A 1WBBA 1NRPH 3U6BA 2CHAC 2QMEA 4CRCA 5HE8A 2K1QA 3DOEA 4NYMR 2TBSA 2OXSA 3PFIA 2C77A 2XTZA 3FFBA 1GITA 3A84A 4MYHA 3V9PA 3K70C 2JGNA 2P6RA 1AIXH 1GFIA 1KLIH 4PPNA 1D6WA 4ABBA 1AQYA 3TSWA 4TWZA 1ARCA 2QGNA 3GJ8A 3GP8A 1U90A 4K46A 1QHGA 1S5SA 5F8TA 2OBLA 2EEKA 1KMHA 1MKWK 3RABA 3MSXA 5ESBA 4BFSA 1KXEA 4GHTA 4UXJA 1IJEA 4IC6A 5AHGH 5J40A 2GJKA 2P6NA 4MH0R 1E9DA 2FEOA 2ZVQX 4GSOA 1XEWX 4QKQA 1JXOA 1GG6C 3RXBA 1C4Y2 4FIDA 4HLQB 2JJ8A 1EASA 4X1PU 1SKQA 3CO5A 1VCQA 5CDFA 1HJ9A 1IOZA 4LJ5A 4TTRA 2JJ2A 1EOLA 3NKKA 3TW8B 3VR3A 2QMUA 4NCNA 2FSIA 1EJNA 2AD1A 4JLVA 4MNYA 4RZ2A 3D31A 3U7GA 1EFRA 1PYTD 4DCNA 4Q80A 5JWRA 2A1DB 1CT4E 1MO3A 3SHWA 2WPKS 4JLMA 2ZSFA 3RDZA 5GADl 2HF8A 5EP1A 4M1TA 1IXSB 4QNRA 1TBQH 1FFHA 2FZ4A 3PITA 2IUSA 1Y3WA 2ZI6A 2ESTE 1YZTA 1O3YA 3ZZAA 1CGIE 2ZI4A 2R0LA 3WHLA 1P2IA 2QY0B 1FY5A 3QOFA 2OV2A 2R3UA 4X8HA 5CMXH 2RDLA 2W7UA 1TNKA 1R5OA 4TYYA 3VR5A 1AGRA 1NVXQ 5AUQA 2D74A 3AF0A 2TGTA 1KK2A 4B6EA 2EI7A 1X8JA 2A0QB 3MTYA 1KI3A 3K9HA 4JMYA 4KSBA 5DP7A 4DGJA 1AN0A 4UFEH 2UUJB 3KQBA 5PTPA 2YWEA 1OIXA 1EXMA 1O3DA 1XEXA 1KIGH 5J4SA 5FUVA 4WJG2 2Z83A 4MNVA 2PH1A 1TA2A 5JSZA 5FHTA 1G5TA 1W7AA 5LDDC 1DWDH 2QAGA 1O2QA 4YC7A 1US8A 3T26A 4A8JB 1A3EH 1D9IA 4PC2A 1UVUH 1SXJC 3L0OA 2W83A 1SHYA 2J92A 1P3EA 1S4QA 1QL8A 3M7UA 2VVUA 2O8LA 4HUQB 3H84A 2RGDA 1B0UA 1HT1E 3SOPA 1B5GH 2WPLS 1U81A 1NBME 1O37A 1DITH 3TJVA 3THXA 1VITG 1UTPA 3RXRA 5IT5A 4DT7B 1DE0A 1HAOH 4X2VA 4YMTA 1THRH 3U7EB 4TY6A 4JBWA 3EZ2A 4JSTA 4AY2A 1L1GA 2FNAA 3AVVA 4Q1DA 1T4UH 4EFLA 3MO3A 4BRUA 1BRBE 1O2YA 4EJSB 1KLJH 1HV7A 1Z0IA 2ZFSA 3MNCA 2J0QA 4ZV4A 2QC2A 2FN4A 2C98A 1N6OA 1OWJA 4KELA 3AUYA 5G3ZA 5KNDA 3MU5A 1OWIA 1X8KA 1F0UA 4X2YA 1PLKA 3KKMA 3DZ8A 4H1UA 2O8DA 4JLOA 3UMRA 1W8BH 2F9MA 4DCTA 1SOZA 1XUGA 1YZLA 3GQBA 3B5JA 2NU4E 3H5CB 2V0BA 4MRVA 1ONBA 1DG3A 3AP1A 1XTQA 1GHBF 4QRHA 5DP8A 4U02A 1Q57A 1BTPA 2PV9B 3CS7A 1NI3A 2OP9A 3SOSA 4KFSA 3IG6B 2UZ3A 1LY1A 2IF0A 2QTHA 3EG5A 1XZPA 4WW0A 2KI5A 2Q3HA 4YQFA 4D9RA 1RJ9B 1VCOA 2A7HA 4TWYA 1HGTH 1VMAA 3WBKA 4DLYA 2QMHA 5C46F 3CM0A 2UWLA 4OJKA 1GBJA 5FR1A 3O8BA 4E7RG 2R6DA 1U6QA 1T8NA 2JA1A 5AJYA 3BTME 5IK2D 2BDTA 2O5VA 4BLRA 2ZRIA 3UIEA 3W6NA 4R7ZA 3L33A 1W13U 3RXDA 4XD7A 3AQ4A 5A5GA 1T3LA 5TV2A 4DOQA 3QE0A 4DLTA 3HP1A 4LYFA 5GDSH 1AUJA 7GCHF 5ELXA 1X1RA 3GCGA 1RXPA 3KDSE 4A6XA 1CJVC 3M5LA 1DY9A 5K8LA 1A0JA 1UVTH 4UFFH 2OBQA 2BDIA 4ISHH 1GG2A 1GMCG 3RNLA 1OXSC 2ZFFH 4YOJA 4MNXA 4H6TA 4URZR 5TY0A 3TH5A 3TPIZ 2BMJA 2GDDA 1OXTA 2DWQA 1Z63A 1IQHA 2QRZA 2Y5FA 5DP3A 1VCIA 1CGHA 2ZRKA 1EZXC 5FI1B 1G291 4II7A 1W11U 4KYUA 1K6MA 3QKRA 2EFEB 5JCPA 3UIRA 3GLIB 4G5OA 4ABDA 3E1XB 1DG1G 1Z6AA 4XOIA 4B76A 1E1RD 2ZRFA 3IO3A 2BVNA 4B48A 1EOJA 2Z7FE 1QQUA 2A32A 1FY3A 1LVMA 5EXPA 1C2KA 2O0JA 3IPXA 1TAGA 1XXHA 2XXAB 2ONKA 4ZUHA 2NG1A 4H6SB 4DDTA 1G2MA 4MPXA 2CN0H 2ZE7A 2QENA 4GL2A 1NMXA 2AIPA 1L8QA 1LF0A 2ANYA 2XWBI 2BBTA 2QT0A 3OYPA 2HALA 4CRAA 1E38B 4NFFA 5DP6A 1UTKA 1LW7A 4JS0A 5CE1A 1V2KT 1OP2A 4IHQA 2A5JA 2GESA 3BS4A 1MBMA 3GLFA 4W5WA 4TSFD 1SGFA 1NY6A 1L4UA 4PC3A 1C5VA 2O8WA 1EAIA 1CQQA 1M9UA 1Y5AT 4GT1A 2ZRDA 5FAHA 2ZR7A 3CRQA 1MRSA 2EFCB 4JJZA 4K2YA 1Q3HA 1BIOA 2ANMH 3SNEA 3LY5A 3THWB 3UPEA 1ZSJA 2V3OH 3Q7QA 3CNOA 5SGAE 2H5CA 5HKKA 3QF4A 1N6KA 2ZI9A 4JVLA 4UJ3A 2SHKA 1HAYB 1A7SA 2BD2A 2BLOA 1CJUC 2OCAA 1KO1A 1NVUQ 2G4UA 4QBFA 1S0QA 4JL8A 4OK5A 3GY2A 5DSZA 1K1LA 3LA6A 4ISNA 2OSBA 3A89A 1AZ8A 1TFXA 5IDKA 1YBWA 2GMTC 1SGQE 1C1OA 1E1QD 5B6LA 4PSAA 2C8WB 2YNMA 1P9WA 3THYA 5HR5A 4OHVA 2ZJ8A 2Y6TA 3RXTA 4P33A 2G5NA 4B3DA 4FCWA 5C1YA 3CF6R 4AKIA 1HNEE 1H9IE 4AX9H 1OH7A 2GVFA 4A0FA 1C2DA 1P2TA 1ZJDA 1SGPE 3M3SA 2F9VA 1FI8A 5IRCD 4FU9A 1IN7A 3MHWU 3EA7A 3U2QA 3ESTA 1AI8H 5GJ4B 3VMFA 2G0NA 2OK5A 5JEEA 4D7GA 4GOKA 1VHLA 2J38A 3I78A 2WIBA 2GZ8A 5DYGA 2LCFA 1XX9A 4AYTA 1KI1A 1SMFE 5BN4A 3NZIA 3BERA 1IHSH 1O2WA 2ZEBA 1MTNC 4MVNA 1GTVA 4YXWD 1BUIA 3AVPA 3QSYA 1QCPA 1TRMA 3HYTA 4QBIA 4TL7A 4ZHLU 3P17H 3BTDE 3KQEA 1KSNA 1NVVQ 4UKDA 2FFBA 1YCPH 2QF3A 4NCHA 4WMFA 2CK3A 2WBLC 2BDGA 3AK5A 3GFPA 4D8NA 1DUEA 1S1CA 3EIQA 2O8EB 1G41A 2FDAA 4LV8B 4DB2A 1KSGA 3G82C 2IN2A 1E2MA 3V12A 4BFVA 2AIQA 4WXVA 4G01B 1O2RA 1F2SE 1TGCA 3AASA 4OM9A 2YOHA 2JJ1A 4LWZA 1TB6H 3V0XA 3VU9A 4RD4A 3KJEA 5CYOA 1W5TA 4CREA 1VYVA 1F7ZA 1D2EA 4YONB 4CZ2A 3AVWA 5DO9A 1XVMA 2YV5A 3T5GA 3TJOA 1SI5H 4ON9A 1YYY1 2QAGC 3CF2A 3PJRA 1H4WA 1LKAA 1CU1A 1VG1A 1R8QA 4LHYA 1Z0DA 4QJ4A 3QXCA 3GCOA 5EW2H 1BT7A 4B2BA 3LNCA 4IDNA 5A0FA 1KAGA 4UQOA 1TQDA 1PQ7A 1C4OA 3AVYA 3SNAA 2YC2C 2G83A 2IYZA 4I31A 1E79D 1S81A 2I4IA 2QTFA 3PEYA 4TLBA 5C1BA 1AIPA 3LQRA 5AJVB 2IYYA 3A85A 4NWKA 1GPZA 2DPXA 4IDHA 4GP7A 3VTKA 4EQ6A 2IUTA 3TVJB 3TNSA 2R62A 2ALVA 4G0NA 1DAGA 3CIOA 1KSFX 3GDUA 5EQTA 1F2TA 3N2EA 5FOUA 2PLRA 3G01A 1OPXA 2VHTA 4B2CA 1AJEA 2AWNA 4KTSA 1UJ1A 3VKHA 1GCDA 3K53A 1HAXB 5CITA 1SGCA 2ZRBA 2RCNA 2QAJA 1G8PA 1QL7A 3U60B 1F5NA 1NM6A 1ZM9A 3FTQA 1UJ2A 2ZHQH 1GI2A 2VIDA 4U00A 5L3SA 1O2GH 1KK3A 4FMDF 1AKSA 3IBGA 1Y59T 3FDIA 3FMPB 4K69A 5AUPB 1E32A 1A4WH 4D4LA 1A5IA 2GETA 4RKOB 4V0NA 4A0HA 4HB3A 1Q1EA 1SVSA 4MUAA 3U3JA 5TCAA 3BC1A 4LJ9A 1II8B 5CB8A 2OQ5A 4OHXA 3QDZB 3QZQA 4OS5A 1U2RA 1SXJE 4AYVB 1PLJA 4LC0A 1QJ6B 4P0TA 3MWLA 3BBPA 2ZU5A 2Z43A 3FHCB 4X0WU 1C4U2 4K60A 3PO1B 3F68H 1C5RA 4NZQA 2AFQB 2BD4A 1ZTJA 2ZJ2A 2P67A 2P16A 1DY8A 3B9PA 1U8AA 1GSIA 2ZIAA 1Y3AA 4IEEA 4DSUA 3AEZA 1O2VA 1Z8RA 3S7HB 4XDEA 4WAUA 4K8BA 3IQWA 1ZD9A 4F4CA 1FX0A 1W4AA 3S9BA 5A0CA 3GY8A 2N1BA 1QHHA 2PX3A 4DLSA 4MRRA 5JJKA 3NWUA 4NE2A 3A4LA 1ZMLA 1DLEA 4PQFA 2WV9A 5L8VA 4GVUA 1LHCH 4NIVA 5LBIA 4BZXA 3P20A 2ZC9H 3CS0A 1WP9A 4GCHG 3ZVCA 3AP2A 3BORA 1LHEH 2ZEJA 4C0QC 1Z6TA 1TBZH 2LKDA 1OYYA 4P4TA 2NQ2C 2P8OB 1DAHA 3H4MA 3SJIA 4Q47A 4KHZA 4NPHA 3T61A 2AL7A 1XPRA 3OZXA 4PAOA 1W36C 2G3YA 4K5ZA 2UUFB 2UKDA 3RLYH 1CJKC 5C1UA 4YLGA 1V3XA 1IHTH 1CVWH 2QN6A 3FKSA 3QPWA 2ZS9A 1LVYA 4YOGA 4K81B 4X1SU 4CYMA 2DE9A 1TMBH 4CRFA 1NG9A 3ZVGA 5B6OA 1SGFG 4Y0AA 1MBQA 1JRSA 2UUKB 4FWIB 2OLGA 3A4MA 2ZE6A 3CR7A 5DYIA 1P9NA 5D3MA 1UTLM 1G3CA 1NLFA 2QIQA 5DHFA 3BAFA 5KDOA 5KDDA 3FVFB 4RFSA 2OBMA 1KI4A 1XCPA 1W12U 1EFCA 1BRAA 3EAJA 2ZUCA 4GPTA 1O2UA 2HPPH 2C90B 1O3AA 5J5CA 2AH4X 1Z28A 1SQ5A 3BIFA 5EE1A 4XBDA 2BXUH 4LBVA 3QO6A 2BM1A 1SGEE 4NWLA 1Y8TA 3LBIA 2F6RA 4ZIRB 3DFJA 1Z1IA 1ZR0A 1GJAB 1V2PT 3VEQB 5CJ2A 1CRPA 1GBCA 4BXSA 3KKQA 3RS7A 4NGAH 1HJAC 4Q02A 2VWLA 1Q22A 5GVSA 3KQLA 4LV6A 5EGMA 3QK1A 3NC1C 4DIIH 3MMPA 4WMEA 3IIMA 3KJGA 2IYSA 1XXFA 1LFDB 3TMKA 4TYDA 1LHFH 2QUZA 5GCHG 4ZKEA 5E8EH 1NN1A 1K22H 3U98H 1X7AC 3KGPA 1J8YF 1HDTH 3D23A 3ZS9A 2KE5A 3BE4A 4A92A 1SQTA 2Z3DA 4FUBA 2WWFA 1IQFA 4YMUA 1WSSH 2VA8A 3B1XA 3RWMB 2BM2A 1HT2E 4X8TH 2E9SA 3ECCA 2HLDD 5KU1A 8KME2 3WMFA 1ELTA 4ESHA 3BB4A 1NMYA 3RXSA 2EA3A 1HXFH 2JLUA 1ELOA 7ESTE 3RU4E 3SE0A 1FV9A 3RS0A 5DKMA 1LS6A 2GHIA 3UFAA 1TQ6A 3P92A 2FX3A 1C1RA 2Q6DA 3AVUA 1MAYA 3AW1A 1O2NA 1FP6A 3BJIC 1Y3XA 1GL9B 3GCHC 4HSEA 1WUNH 3CPJB 2FOGA 3QKSA 3FAOA 1KJYA 5M04A 1OFTA 1KLTA 1MKYA 5KO2A 1OFIA 1VG9B 2EQBA 4KSCA 4TL8A 1OWDA 1PVOA 4A1TA 3CB4A 4ZCMA 2FEMA 3LONA 1GJ5H 2Y8EA 2QZ4A 4RZXA 1IAQA 4RY2A 2BMEA 2ZS7A 1MT0A 3W90A 1C2JA 1Z6YA 2M5TA 1EFTA 2F9PA 2C95A 2ALPA 3RMOH 3PUXA 3OEEA 5TMPA 5FBVB 3TAHA 1RRCA 2ZGCA 4DBLC 1CBWC 4DB4A 1A2BA 4LJ7A 1P06A 2BY9X 3ZD7A 4DIDA 1JR3A 2PGQB 2V6IA 2WJYA 2J0UA 2AGEX 1JALA 5IHPA 3SI3H 4BFXA 2QXIA 5FTNA 4C0SA 2OLKA 3ZVAA 2VGCC 4I81A 2SNVA 4Q4JB 1MQ6A 1LHDH 2IJOB 1G36A 221PA 4OI1A 2R3YA 4EFNA 4WVPE 1BTWA 2ZU6A 4CRDA 4LBWA 2V3CC 3WNCA 2GZ9A 2Y80A 3LO5A 4HGCA 5HXFA 4O9VA 4PAMA 4LGMA 2GTBA 1RRGA 4MPUA 1PQ8A 4I32A 1UTJA 1P04A 4Q1FA 2XWAA 3HU3A 3NTUA 2AEIH 2JLWA 1GHZA 1DPOA 2BMGB 5HCIA 1MD7A 3NCLA 4HTCH 3NEYA 3ZJYA 4I33A 3AKCA 4O97A 2G0TA 2YWHA 4F4IA 1DPFA 1KI9A 4IOJA 2V1XA 1J9CH 1SHZA 1ELBA 5BYKA 4GAWA 4B6FA 2B6HA 1FY4A 2RMKA 2YZ2A 3ZZUA 3T12A 4OJQA 4OK6A 3W3AA 3RC3A 4Q5IA 1TPSA 1E2NA 5T6DA 4Z6AH 2JETB 2XGJA 2FMXA 4XWKA 3NHBA 1P9RA 2QPOA 1BJVA 1AY6H 4OQFA 2C9YA 5DN6D 3SNCA 5TARA 4I8LA 2PCLA 1NFXA 4F91B 2R2AA 5T1VA 1MKWH 3GJXC 3RC4A 2I3BA 3W3ZB 3BH7A 4B3BA 3AGPA 1SC8U 1ZZZA 1IJFA 4X8MA 6LPRA 2C9CA 1O3FA 3UATA 4MRSA 5GJWC 1JMOH 4TZ0A 1NPMA 4KLNA 2IXGA 3WBJA 2Z6VA 5KSYA 1RRFA 2JAQA 5DH9A 3DUXH 2GK7A 3KKPA 3M7TA 1QBOA 1PFXC 3WMGA 3B6EA 4Q9KA 4C0AC 4LXBH 4Y7BA 2H1UA 1JOUB 3CR8A 4V0LA 1WXQA 2GRJA 2GJ9A 3HKJB 3K0AB 4YMSA 2QBYA 1TPOA 1E2GA 3U7FB 5AUOB 3HGPA 1XRJA 4IXMA 4Q1EA 5A8YA 2PLFA 1YLCA 3UWJH 1LF5A 3K9NA 5GJVC 2ULLA 2MMCA 3PIRA 1WXRA 1XUFA 4YLUA 1QURH 1ELDE 3M61U 1P4SA 2IT1A 3KX2A 1V2ST 3CP7A 2IXFA 3EXAA 3W95A 4F49A 1G9IE 2OCVB 1QA0A 3WRXC 1SL3A 1J99A 2GJAA 2D4HA 4R8TB 4EJSA 2JDIA 2F3RA 5DGJA 1NMZA 2XAUA 2XCFA 3LC5A 3LGUA 2IA5A 3IPYA 2GXQA 3MWKA 4KV9A 4FUGA 4XOJA 1UBGA 3TNFA 2GD4B 2XSZA 1ETUA 1HCGA 2ODPA 1YQTA 3EWAA 1FQJA 4H1VA 2GCPA 3OAAD 1R0YA 4B3XA 3MJHA 1IQGA 3TVTA 2FFQA 4LCBA 1HAZB 5HM9A 2JH5D 3N2IA 2VF8A 3BTTE 1D3TB 2Q9BA 2A5FA 2PTNA 5LD2B 2IS6A 4ZKNU 4MYCA 1J16A 3JZMA 4U7DA 3PQCA 4Y10E 4DT1B 3OEHA 2AX4A 1S83A 3RP2A 1X1SA 4BECA 3MU0A 2W00A 2N46A 1C2EA 1D8TA 1SFIA 2CBZA 2ZS8A 1WAYB 4JZEH 4ZDWA 3H7OA 1K1OA 4ZXYH 1BBRK 2ZXUA 1BTZA 1S82A 4G5GA 1F3OA 2PEYA 1WCZA 5HPYB 2VO1A 3K70D 4J1YA 2XB4A 2SNWA 1E4VA 1GGDC 2CXXA 4M0LA 2XNSA 1R0XA 3QIAA 5CIQA 1LPZB 1E34B 6CHAC 1G3BA 1HTWA 1E99A 4M9SA 2ZECA 2FOEA 4AG6A 4O2RA 5GWZA 4WBSA 1C5UA 4JIMA 4Q01A 2CEAA 1DUAA 3R7WB 1EK0A 1ANKA 1OV4A 2Y5HA 1TALA 4KBGA 3L8YA 1A1VA 4PHGA 4R9UC 5SZKB 4KYIB 2P6UA 5JS7A 3MU1A 3VAAA 1AB9B 2PKSB 1B7XB 4OS6A 1R5BA 2IYUA 3EPLA 1CE5A 4IBLH 2FP7B 2ZAOA 3A82A 3MNSA 1YZQA 2QP9X 2GDJA 3NKVA 4ZO4A 5FH9A 3SNBA 2EYUA 1DOJA 5DO4H 1SLUB 1W0KA 2ODQA 4RCYA 1RS0A 2V3HH 4BTTB 3SDZA 2CL0X 2R9VA 1A5HA 4X8SH 1HV8A 1A2KC 3T62A 1Z5ZA 5JB8S 1CR1A 1P01A 4INHA 4UXIA 2C03A 2IF2A 4EFMA 4X1NU 3KFXA 1EFUA 4H42U 3UG6A 1L4ZA 4DDWA 1O5BB 2BOHB 3QVVA 2ZQ5A 1SGYE 2YKGA 4L8GA 1AGPA 5DHAA 3ZQ6A 1UBEA 1E9EA 1H8HD 3F8TA 5EQQA 1BJUA 1BHXF 4E07A 2KB0A 1NBMA 1ZHMA 1LO6A 4OQLA 2Z94A 2ZKSA 421PA 1MV5A 2BLQA 2WKPA 3GY5A 1W47A 5JI2E 1VITH 1LV7A 2P0EA 2QG6A 1EXFA 3A83A 1WA5A 1QR3E 2V1UA 4U2WA 4UE7H 1HAGE 1Q0UA 4F38A 5EZ5A 1PPGE 2WKQA 4KAXA 1AVXA 5JBBS 1M74A 1E9RA 4MRNA 4TTPA 4M1SA 4LRWA 4LZ1H 3L0PA 3NBXX 1XPOA 4EDHA 2G88A 3A7ZA 2H8KA 1O3KA 4BRWA 4P4SA 2OM2A 4CVNA 4RD3A 1UCYE 1IQJA 1XJ0A 4ZDJA 2RAPA 3SQEE 2ZJOA 1LB1B 2PZEA 1GNQA 1QRWA 2GV7A 1D3PB 2B92A 1H8IH 3GEEA 4LJ4A 4X8OA 2ZDNA 3GYLB 1RPZA 4UEHH 1UO6A 1GOTA 2ZQ2A 4US1R 4Q00A 4RZ3A 3IUYA 2R2WU 4KTCA 3ZZDA 3RS3A 3NIBA 4I8JA 3EYDA 1S9HA 5BPEA 1OYTH 1WDTA 2PUQH 1L2TA 4M7GA 3QXHA 1E2IA 4Q7MB 5GCHF 3SYNA 1G6HA 2RGNA 2YWFA 3SQHE 1N6HA 1H65A 3AH8A 1SGWA 4QBGB 2NIPA 1N8OB 2XXLA 4NSYA 3TU7H 1CJMA 3CZQA 1MTSA 4NZYA 1RVDA 4LV5B 3EC2A 5G53C 3SQWA 1GHWH 1G64A 1TGNA 3UUZA 1N0UA 3DO6A 1G3IA 2FPMA 2RCEA 4JZKA 4BANB 1NF3A 4PSKA 2OC7A 1Z8FA 3GLHA 3PUZA 4DVAU 2WVJA 1F5LA 2WJJA 5F98A 2ZYTX 3GFTA 3VR4A 1ZIPA 4MGKR 1ID5H 3M3VA 4URWR 5SZIA 5LB2A 4BFWA 2FIRH 1QVAA 3KN2A 1E0FD 2AKAB 4FINA 3W6PA 2A5KA 3L3TA 2WTUA 3K0CA 4GSYA 2IS2A 2Y81A 4PO1A 4EPTA 1EB1H 4M8NE 1MH0A 4QGFA 2VHQA 4ZDKA 4ARZA 2GCOA 3LXXA 3FHOA 2OC0A 1J14A 2OBOA 5CLQA 5LPRA 3RXEA 2VL7A 2O8BB 3U3OA 3TJUA 1KSJA 1COWA 2AMPA 1AE5A 1MRNA 2B7CA 2XTNA 4A2PA 4I8HA 3J81k 1KJWA 3A37A 5ETXA 2J87A 2ZE8A 2CMKA 3P8OA 3Q76A 4HAWA 1TQ4A 2C8VA 3DOFA 2PMDA 3N7OA 4QHTA 2CHGA 1OKKA 1CR4A 5G40A 4I7YH 1CRQA 4A8JC 5BWMA 1Z6XA 2ZDVH 3GJ0A 1JRTA 1P6XA 3OFNA 2VHJA 1GBIA 2FU5C 2ZI7A 4DSOA 2JLYA 3WXMA 2RGAA 2GZ7A 4JLJA 2ZI3A 3P4XA 5DI3A 2BQ7B 4JJKA 1KNQA 2HYIC 3Q77A 1P2MA 2HLCA 4FN5A 2BY7X 4NHOA 1GL1A 2O8CA 2CE7A 3U4QA 1LDTT 5LPEA 2QV1A 4RKFA 3CF0A 3WYGA 1P10A 3I3SR 1CEEA 3FP8E 3KCGH 3I92A 2GAOA 2CHAB 1MU6B 3SJAA 3SC3A 2RKOA 1P2VA 1A82A 1D6RA 3EZ9A 2ZJZA 4AFUA 2C96A 3K70B 4EJSC 4A15A 3A8BA 3W94A 2F91A 2FPKA 2VPPA 1H8ED 1CP2A 4WVFA 1BITA 2QE7D 3CX8A 3CRW1 3LH5A 5IK2A 3SU0A 1BMFD 3RVBA 1CGJE 1C5QA 1P02A 3HKIB 4KXFB 2WOJA 1HAVB 4M9QA 3SJZA 2B8OH 4OS4A 1GJCB 4Q19A 1UPTA 2UVQA 1EJAA 3U8RH 1KJZA 1NT1A 2J9NA 3SU1A 4FUHA 4QG7A 3MWYW 1W0YH 3ADKA 1GI0A 4WXRA 4OI0A 5EP3A 2F43A 1W49A 4F93B 5B64A 4KTUA 4D4JA 1G8GA 3QXJA 4LYJA 2O8MA 4B3CA 3SYJA 4GP6A 1OHHA 4TPIZ 3KXIA 3BK7A 1Y3UA 4KVAA 2JLSA 2TMKA 1Q44A 3Q00A 2AFHE 1TF7A 5G41A 2KJQA 4C0LA 1XZQA 1ETRH 2PT5A 4WH8A 2A9KA 4W9MC 2C5LA 4KFUA 2BVRH 2ERYA 2GCHF 1DWBH 1FXYA 4U01A 1P2QA 4URYR 3TKLA 2Z6BD 2RA3A 2PEZA 3QI2A 2SGAA 2F1JA 1ZTLA 3MO9A 4A82A 1TX7A 2PR3A 2H5EA 2ILNA 3D6TB 2FI3E 4F92B 1A2CH 4MTBA 3CKLA 1KYIA 5L6NH 1VDZA 5IYTA 5FI0B 1BMAA 2FXRA 2IYWA 4TYPA 4LUCA 5SZHB 2D7DA 2HYDA 4NYIQ 4KFRA 1HQCA 1HIAB 3SFVA 3ITIA 2VH6A 2GT7A 4DIHH 3WP0A 5KUTA 3BOSA 3ONWA 1GMDG 2G8TA 2DBYA 1ORFA 1I2MA 4GOJA 3CRVA 3T28A 4Q1CA 1NRQH 2QL6A 1KI2A 3UXMA 2GEDA 4FXPA 3PLKA 1D2NA 2A31A 1QG4A 5FBWB 1O2XA 3GYMA 1TMKA 1ZD8A 1P2NA 1GRNA 4ISLA 2HJVA 1SBWA 2AXNA 5HM2A 4Y6DA 1BDAA 3E5HA 2XNIA 3P32A 5CHAB 2OCPA 2JJ2D 4NSVA 1DWCH 4P31A 1DAMA 4XWAA 1SB1H 2IPHA 4LSGA 1TNDA 3K6YA 1O30A 3A7WA 3DEFA 4UDWH 4RD2A 1UKEA 5EUMA 5KPJA 4GI7A 2RA0A 1HQYE 1F5RA 1EFRD 3KKNA 3ZVFA 2FYQA 2WOOA 1OX1A 2CXVA 4NL4H 1C5SA 2Z3EA 1XU4A 4BZPA 1C1MA 3H09A 2XB2A 3MGCA 1N1LA 4Y0VA 5KSZA 3REFA 1W10U 4A1XA 1DAKA 3B82A 1Z1JA 1NN6A 4GPGA 3T1TA 3KKOA 2CJWA 5FOVA 1TGBA 5F03A 3SUEA 1DT2A 5TXGA 1IN4A 1G21E 9LPRA 1YZNA 2QYIA 4C0BA 1JJVA 2QT1A 5GXPA 1VG0B 3A8CA 1JI0A 3KFVA 1JPJA 4FVBA 2WWYA 1DELA 3KL4A 5EE0A 4ASUA 1Z0FA 1YPJH 3OY5U 3VB5A 2WIAA 2G4TA 3ZZCA 1HE1C 3BG4B 4ZIRA 5FL7A 1PYTC 3VKGA 4LPKA 3BG8A 2J59A 2XBVA 1HBTH 2V6JA 5KPDA 3O8RA 2WV4A 1O2OA 1A5TA 1GI9B 2Z4SA 3TE6A 2ZHWH 1KXFA 4H4FA 4ZKRU 3A86A 1S96A 1YKSA 1ZNXA 2C8XB 5K8TA 2FX4A 4PC1A 1NROH 5T6GA 2WWHA 1VCNA 1NU7B 1TX6A 2R65A 1Z6JH 3VFDA 4BEJA 1HFDA 4DVGA 1GBDA 4Q2KA 5EZ6B 2SGDE 1BYUA 4X8LA 2WHXA 4XVUA 3S0NA 4CF7A 3ZLJA 4CRWB 4KI0A 2MMGA 2ANWA 2PKAA 2WPHS 4MKGA 1HLTH 4DKXA 2RGEA 3SN8A 4CRGA 1SVWA 3MU4A 2HNTC 2RGNC 3BFVA 3K0SA 4AI6A 1SXJA 1I4LD 4X6NA 4K8OA 2V55B 4JLAA 1GI4A 3BWDD 1G7RA 3SZNA 4B71A 2KAIB 1C4V2 4U32A 2A5YB 4US0R 1NNEA 3U44B 3SORA 2RH5A 1LHGH 1ELVA 3QEOA 2IX3A 5DNYB 4RD0A 2NU3E 4Q4AB 1TX4B 1Z2AA 3VR6A 3A58B 1C1TA 2Z9GA 3MWJA 1QDEA 2ZZUH 3TH4H 2C8YB 4BWYA 4CT5A 2Q9AA 3FMOB 4HB4A 1SGIB 4G5SA 2J7KA 2BD3A 1L4DA 4X1RU 1LMWB 3TSZA 1MABA 4YMWA 1JXMA 1GMHG 1JR6A 5AK0A 1O3GA 4LK4A 3K0CC 4LJAA 1T4GA 4M53A 5L3VA 2C93B 3E1SA 4G3XA 1XWIA 4N1AA 1QIXB 4EPYA 3TLXA 1AKEA 8ESTE 1IQIA 3S69A 3M0EA 4C9BA 4RZUA 4XFQA 1TRYA 3S1AB 5FOTA 5ABWA 2BXTH 1JAIA 3KB2A 1T8LA 1IQLA 4Q4JA 4ZROA 3KXKA 1DX5M 1X3SA 4OHYA 3W5JA 3ZZBA 1DEKA 1XUJA 1ZUHA 3TGIE 3AF2A 4F4JA 2AN9A 2X2EA 3P6ZB 2DWPA 2QU8A 5FPKA 1RE0A 2FZZA 1IOEA 4L15A 4AN7A 3CRRA 4U5XA 8OHMA 4CRBA 3GJ7A 1G3MA 1TQ0B 4M1KA 1WV7H 3K65B 1FMJA 1FL9A 1HB0B 2F83A 4XD7D 3TR5A 2NO1A 2WJVA 1INCA 1KDQA 1O5CB 3BIVH 1SVOA 4HAUA 1JB1A 1F0SA 4ZHMU 3LPRA 3P8GA 3S7KB 1FMLA 2ZFPH 3FMIA 1EP5A 4PQYA 2V7QA 1O5EH 4B2IA 3PMJA 1RYFA 3N70A 2W0SA 2VWOA 5TVKA 1ZUIA 2IBMA 5FCRA 3PROA 3CNLA 5EOKA 2IC5A 3A1TA 4ASHA 5CYPA 1W36D 3LFUA 3VKWA 1C5LH 3AAUA 4OHZA 4Q1AA 3HGNA 1RKBA 3A1SA 3JZ1B 2ZFRH 1UFQA 3U3RA 3IQXA 3B85A 4MKHA 3DD2H 4A1FA 1KMHB 4B73A 2GXSA 1ESTA 5J4HA 5DPAA 2PUXB 3MU8A 1O3OA 4MGZR 3SJCA 5C67A 2O52A 4V02A 1AFQB 1V2VT 1UTQA 4SGBE 1RRKA 1G17A 1GBBA 3V4RA 1OSNA 1YR7A 1C1YA 1T8TA 3SW2B 1W0ZU 2P65A 5FR2A 1NL3A 3ZYDA 1B0EA 3A87A 4RFVA 4B74A 3SO3A 1E4YA 5L3RA 3E0NB 3VB4A 4LOAA 5AF9H 1L2EA 3K0AA 1M8PA 4ABHA 1D5CA 4BEBA 1T91A 1JQJC 3KQKA 2XTTB 3U8OH 1MCTA 1MD8A 2QXJA 3ATWA 4ISIH 2UZIR 1NKTA 8GCHF 3QGNB 3UKDA 1GI5A 1TNGA 2XW9A 4WH6A 1OT3A 2J46A 4PZYA 2Z9KA 2Q1JA 1K1MA 2G6BA 2FODA 4J0QA 2ZJAA 1C2HA 3A8TA 3K0FA 4LZ4B 3SHFA 4DY7B 3GY6A 2BLVA 3AB3A 1O34A 3ODFA 2XRCA 1O2ZA 3K0EA 5EXXA 5GPIB 4I1UA 3ZVDA 3UOUA 1UVSH 2QTVB 2MSDB 2ZIQH 1I2DA 4IDOA 5FPSA 2SFAA 4TPYA 3EIHA 1LS1A 4L9WA 3E16B 1XD2A 2THFB 1FLEE 2W2VA 1CA0C 1NC6A 4W5HA 3AKDA 3BFXA 1RTFB 1DAFA 1P05A 2CCKA 2GCTB 3LGVA 3DA9B 3LIWA 2GVDC 5H8WA 1E2QA 1AZTA 1XMIA 2VIQA 2LWIA 1EZQA 3VFEA 4LJ8A 3PTNA 1UM8A 2NPIA 3A7XA 3MH6A 1J2JA 2A4OA 1RFLA 1AVGH 4QM7A 4PC6A 1XEXB 1ZM2A 1WF3A 2ZRJA 1U0HC 4DT1A 1G3RA 4AFQA 1QVRA 1E2HA 2ZU4A 5FPHA 3WRYC 4BAMB 1P73A 2V4ZA 5JSZB 4LOYH 2GEVA 1E69A 1VPLA 2XNDA 2QAGB 1US8B 3BRWD 4Q4HA 3C7KA 2NO9A 3TJZA 1IN5A 5C18A 3GCNA 1QRZA 3SV7A 4TLAA 5B57C 5JJLA 1BOQA 3LAWA 4CR5A 2OUAA 2Q9CA 5FFMA 3QXSA 4E7NA 3GJ5A 2A5GA 4ACAA 1WTGH 1TU4A 2VIWA 4OI4A 4WZAE 2QGZA 4FUIA 1IONA 1YRBA 2DFNA 121PA 2JH0D 5LB4A 3T35A 1DADA 1WOFA 3LT3A 3RU4T 3A88A 4CH8B 2BCGY 5B2ZA 4KO8A 4OQNA 1SOTA 5DK1A 2R44A 2CVFA 4TYWA 5JBAS 1KGDA 1XTSA 5FOSA 4HB2A 3ZVEA 4K8YA 4BGDA 1BH2A 1MKXK 3RLFA 1O2JA 1XM1A 1A1RA 1NLYA 2JJ1D 4YDSA 2P3UB 4JT4A 3BB3A 1N5JA 3UREA 2GXAA 5DISB 2IHYA 4AGJA 4ABEA 3B2EA 2O8DB 1N0VC 3MRSA 3EX7C 2GKVE 1GKIA 2FPZA 1O3PB 1UBCA 1CHGA 1LTOA 4HZHA 4DLVA 1DSUA 1CIPA 4LYAA 2VQSA 1IQKA 2O0HA 1E9BA 5JBTA 3NBZC 2TGAA 4MQBA 4QBHA 1BRCE 3I8XA 1Z8GA 2F9UA 4TMTA 3QG1A 1CHOG 3ZZ4A 1N6RA 1O39A 3AW0A 4AURA 4UD9H 4Y79A 2ZRCA 2YOGA 2DY1A 1VYTA 3BXZA 1YC0A 2ZSBA 3FOZA 2A4QA 1KKLA 1AVWA 4IVPA 1BBRH 3GLIE 2ODYB 2CHVA 2QXGA 1C5MD 4YLQH 2SGPE 2XC0A 1T5LA 2OXRA 3AKYA 2P95A 2PMKA 4BZQA 3ADBA 5C5OA 3KTAA 5E4FA 4L9SA 1NIPA 4JYCA 3TGPA 2OAP1 2XZOA 1Z0JA 3KJIA 4VGCB 4JZ1A 5DLQC 2EWWA 2C2HA 1O3NA 4FCVA 2REOA 2QAAA 3AAVA 2ORIA 2XJ9A 2YHSA 5JB9S 4UNQA 2GZAA 1ZHPA 3LU9B 3LJJA 5FUXA 3QXXA 2VNTA 3NPSA 1G3DA 3BV9B 3EIEA 2D2FA 1SZPA 2ZUBA 2R0KA 3UQVA 5FTMA 3WY9A 2AYWA 3LX5A 1KI7A 5DP5A 1EGAA 4LYHA 3OTPA 2BX4A 4C30A 1GJ7B 1ETSH 5H70A 3SBEA 3WMEA 1ARBA 3DFLA 2FOMB 4FMBB 4LBYA 4YM9A 1KDPA 3RRZA 2G77B 1ZPZA 4I4LA 2IUUA 4N0DA 1QB9A 2JLZA 2AGGX 2ZDAH 4GDFA 4LI0A 3RXPA 1N6LA 1ZOMA 2QP4A 5FOXA 4B2PA 5EP4A 4NCJA 2ZRAA 1W36B 2VSOA 2OT3B 4ZI3A 1UHBA 1TRNA 4U30A 2YNAA 4ZKDA 3FZDA 2H16A 2W2TA 4PQRA 3MO6A 5EUQB 3ZQJA 1Z29A 5CK5A 1V2TT 1C5OH 1GI6A 3QKRB 2BX3A 3K2UA 3W5IA 5TCCA 3WNBA 2BQWB 1R6BX 3SNDA 1LCYA 3M7QA 2BBWA 1R0WA 3BFKA 3T25A 4QNMA 5C4MA 9ESTA 2D3WA 1XXHB 4IS5A 3BD9A 2HNTE 2Q6FA 3B23B 4ZCIA 2BKEA 4HZUA 1UK3A 1P5ZB 5HZKA 1YM0A 3QN7A 4NA9H 1NKSA 1GHAG 1NP6A 4PPQA 4UFDH 3ZDQA 1P3JA 2CL6X 4ZAEA 1BHXB 4EPRA 4DCVA 1GI7B 2I1QA 4IDPA 1MU8B 4NYJQ 3V4FA 1EWRA 5HMAA 1IY1A 3GLFB 1G32B 3OHMA 2J34A 2ZSDA 2PZGA 4I8GA 5C5NA 1TNHA 1ZM7A 4JVNA 1EJMA 4RJLA 2JETC 2LPRA 2BD5A 5K8IA 1RIWC 1NU9A 1FW6A 3O47A 1OS8A 1HJAB 3UR6A 5EODA 3AF1A 1AS3A 3DMDA 2Z9LA 2O0KA 3GJ4A 1C1VH 4GUXA 3SUFA 1AQUA 1QF9A 1GP2A 3FKSD 4LHZA 5EXTA 4LX0A 2WMNB 4GBMA 4D0GA 1RIFA 2J7PA 1DXPA 1LVOA 1KXDA 1C1NA 4FMCF 2JLQA 2GWHA 3SV6A 4TZ6A 1ZYOA 2Q6GA 2F4LA 3RAPR 4Q7JB 3RRNA 1SLVB 4BLQA 3Q7PA 721PA 1M1YE 1OJLA 2VIVA 3THYB 1DS6A 4PZZA 3IILA 1LVGA 3TUIC 4OK3A 3KXLA 2PLXA 4ZMAH 3BTKE 3CX7A 3VB6A 1O2KA 3B1ZA 3EARA 1IY2A 1K1PA 4KBFA 2Y5GA 5DP9A 2FV8A 2ZGJA 4X6PA 1ZNZA 2ZHFH 2ZR9A 3GLGA 3R20A 3MH5A 3SUGA 1QJ7B 3FFAA 4YOIA 1KY9A 1N0WA 1DXWA 1PQ5A 1NFWA 1NFUA 3GCHB 4YZUA 3SBKA 2VWMA 3R9IA 1TNJA 2JH6D 3VGCC 3IBYA 1BYIA 1J8AA 4MYUA 1P61B 5BQ5A 1OPHB 2DR3A 3ZIAD 3P70B 1P2OA 1O3MA 3RWOA 1P60A 1F2UA 2TRMA 3K8YA 2I1VB 2G5VA 1NSTA 3ZS8A 4FU8A 3GDSA 3DHKH 3GCTG 4QFMA 2RGBA 3PENA 1TU3A 2QEQA 1C1PA 5EU8A 3A1UA 2ZGBH 3X2SA 1IQEA 2VGCB 5KTYA 1WE2A 1GBKA 1VZQH 3HWSA 1Y5BT 4DLZA 3VU9B 1CULC 5LD2C 3C1KA 1YZUA 1DOAA 2OQUA 2FJUA 1R4AA 4D81A 1XUKA 1AUTC 3SFZA 1FJSA 1N3BA 3E91A 1QGFA 2J2UA 2NO7A 3FE2A 1FY8E 4KGAA 4HFPB 1CSOE 3SJ8A 1V2LT 3NH6A 1F5KU 3OESA 1PQAA 3Q72A 1IXZA 1XTKA 2FOAA 3I32A 1K1JA 1BTHH 1CJTC 2CNWA 2VHUA 5E7MA 3CPHA 4M22A 1B23P 4C4PA 4Y0YE 1A7JA 2A2ZA 3B9QA 4D6PA 1ZC4A 4TMWA 3ATMA 5ESTE 3A4NA 2ZAMA 5K7RA 4N0EA 4BAHB 4ERNA 2ZU2A 4OS7A 1ZUNB 2DFTA 2ZYVX 4O3UA 1W2KH 3UTUH 1Z2CA 1W4BA 2QA5A 1G1MA 1Z22A 4TLEA 3WYAA 1P12E 1AKYA 1O5FH 2FI5E 3LX8A 2ZI5A 1JR3D 3REGA 1JIRA 4DXAA 2IEZA 1NY22 2ZCHP 4BNRA 2BY8X 4IMQA 5L2ZH 1W0JA 1AB9C 2PKSC 3L0IB 5TJXA 3DHWC 3THOA 2C99A 1O5DH 1DVAH 4AKEA 3ZVRA 3GJ3A 1NFYA 3FP7E 1F2TB 1XJQA 2W6IA 3D3QA 4ILEA 2GCNA 5AWFC 4W7SA 1TIOA 1YF4A 2WPMS 2Q6TA 2WSMA 2ZYUX 5EPNA 1CO7E 4PXAA 4L16A 1N25A 1BIFA 3OSYA 4BUJA 2QMOA 3BTQE 1U9IA 2DYKA 1DFPA 4YT6H 3DMNA 3QF7A 4OQMA 1OP0A 5L3SB 5G4BA 4AG2A 1AKSB 1MTUA 1T8UA 1TEVA 3CLVA 5FBRB 1F0TA 1O2PA 1YPEH 5F6MA 1KTVA 2IJD1 2B7BA 2WAXA 4RD1A 1XCGB 3SU4A 4AORA 4CW7A 4GHQA 1OOKB 3A6PC 4HLCA 2NZ8A 1XD8A 1Q20A 1E6CA 4MKIA 2AMDA 3HJNA 2ZR0A 3HDTA 2DWOA 3PXGA 1Z8IB 2AMQA 6GCHG 4DHEA 2JIZD 1GDNA 4QJ3A 4X8UH 2BDCA 7GCHG 1HY3A 2HT6A 3PVSA 2CL7X 3E0PB 3WNDA 3RXAA 3K09C 1O38A 1LNZA 4XE4A 1TABE 5EQRA 4D0LB 1O2SA 1HAIH 1O3HA 1XXDA 1TF2A 1VCMA 2BJWA 1TADA 1FX0B 1O3JA 5DJ7A 2D62A 4XJXA 4Q7LA 3LV8A 4ABJA 2B9LA 3LDAA 1QHHB 2FSHA 5F8XA 2XJ4A 2MSEB 2TGPZ 3LRPA 1ODFA 4ZPXA 4QT8C 4O2LA 3Q3KA 3SN6A 2IXEA 4DURA 4DSNA 2CDNA 2XBYA 2GV6A 1UTOA 4PANA 2MSCB 1ZIOA 2KSQA 1KTTB 5CK4A 4K3JA 1SHKA 2C04A 2DHRA 2PFEA 2P94A 1UEJA 1Y3YA 5EP2A 1OH8A 4TT3A 1R0ZA 1AO5A 1M7GA 2ANCA 4POAA 4DRZA 3KQHA 3PUYA 3C27B 4Z8YA 1W7XH 5GJBA 2DCUA 2FGJA 2HUPA 1OXUA 5EW1H 2QSYA 1XEWY 1OH5A 1T3SA 2A4RA 1II9A 1A5GH 1KYNA 3C14C 5GNDA 1QHNA 1IAUA 2ODEA 2FX6A 1O3EA 3PMAB 3PMHB 1N8OC 2BC9A 4HB0A 3K9GA 4PHTA 2KAIA 2FI4E 4ABYA 1YPGH 2ANBA 1CHOF 2IYVA 1SGNE 1GGDB 2P5SA 5D3MB 1T3HA 1E94E 1VECA 2Z4RA 1P3CA 4D9QA 1YR8A 4RFSB 1JBUH 1GI3A 2PJRA 2HF9A 3M35A 4NZLA 3PYHA 1ZM4A 5FTLA 3A8AA 3RS4A 2VTKA 3SYLA 1VYUA 4XSHA 3R9WA 3U1JB 5JDUB 4TLDA 2XSZD 1DSTA 4OL0A 1CA8B 2H6MA 1LQDB 4EPWA 1EPTA 1FZZA 4O3TA 1C2GA 5HE9A 3IITA 2H18A 1ZGVA 1U8ZA 1YJ5A 5A09A 4G5QA 3UNSA 2FFAA 1J8MF 1KAOA 4C7OA 1VITF 5JZVA 1TAWA 3MH4A 4MLFB 3I5XA 1C5TA 2H5DA 2ZGXH 5FPTA 2UWPA 3OEHD 3VXFH 3CH4B 3ETLA 4WWYA 2PCJA 3HPQA 4DJTA 1TUEA 2ZI2H 1J70A 4IW3B 3AV0B 4JT2A 4RD6A 1GJ6A 3H1TA 3L2OB 1PPCE 1UKZA 4AYWA 3P26A 5A2MH 3PEWA 4C2UA 5K0HA 1D3DB 1AS2A 5EXNA 2O8UA 3GPLA 3PV0A 4C0JA 2QM8A 3GMTA 2ZU1A 1BB0B 3HYRA 2BM0A 2ODBA 4PHFA 1HXEH 3RXCA 1HYLA 2OILA 2ASEA 2O8FA 2ZANA 5L3QA 5FBQB 3BH6A 2WSSA 2GXUA 5JS8A 1YE8A 5CJPA 3P95A 2Z9IA 1SG8B 3BTEE 4BLSA 4DCSA 3PV4A 4TQUS 1E37B 4WZBE 4BFYA 3QBTA 3B8HA 4AC9A 3VHLB 1YRAA 3GD7A 4MDEA 1EG7A 4INKA 3RSOA 3RDPA 4TN1A 1EAUA 5JPMH 2FM2A 5EE5B 3VNUA 3P8NA 3PG5A 4NIWA 1IQNA 3OIWA 3QKSB 3TJNA 2XC4A 1XUHA 2GX4A 1MTVA 2GAAA 2W0MA 3EC1A 4ISOA 4XIGS 3VPKA 2FOHA 1W0KD 2ZVPX 1GHAF 3WY8A 4UONA 4JMPA 4Y8XA 1ELFA 3RC8A 3FZZA 1II0A 2FOBA 3AP3A 5JFGA 1Z0KA 2GP9B 3RM2H 4DG4A 2F1HA 4KITB 3NK8A 1OXXK 2RG3A 3QPUA 2X2FA 4WA7A 3PM3A 2W2XA 1O33A 2G52A 1F0RA 1ELEE 3M5MA 1C9PA 1N5LA 2CGAA 2J0UB 3F3YA 1QHSA 1SVMA 3FPAA 1RRPA 1RZ3A 1Z7KA 4MA4A 4LY6A 3CWQA 1GJBB 3NBYC 1OWEA 3DM5A 1NBMD 1N6XA 1ZMNA 3EE0B 3ZYEA 3ZGXA 1XKBC 2OC1A 2HCJB 5J4QA 5E7JA 3EZ6A 2WWWA 1AMHA 1Q12A 1GMCF 2QA9E 4TLCA 4AWXA 3TIFA 1DO2A 1PPFE 1XVOA 1Q2WA 1G18A 4MG3A 1GBAA 1NG1A 1G30B 3GISB 1AZZA 2CLDX 3RRMA 3LLUA 1UCYK 2W58A 3SS8A 1GVKB 1ZSKA 3P4YA 3F9FA 1GHVH 2CE2X 4AB8A 5IDVA 3BGWA 4JYVH 4ZDIA 2XOKD 3C8UA 2KBEA 1IQPA 3QBVA 1RC8A 2NO0A 1G7SA 2V9PA 3PEUA 4QM6A 1O3BA 1O2IA 3Q3YA 2NOAA 2WWGA 1GKYA 3LOXA
chains in the Genus database with same CATH superfamily
4W9NA 4H60A 4BE7B 4DHWA 3FVWA 3ZVNA 4EB6B 5FRDA 1JFLA 4HMQA 2HU8A 3QLVC 3E48A 1FUJA 1YMVA 1QY6A 5F2KA 2WI8A 5E2PA 3DA8A 4XEHA 1JEYA 4OQXA 4GVPA 2I4OA 4MPPA 4DKJA 5HFJA 2G81E 3CE6A 1SR8A 2XUDA 1N1DA 1PRYA 5F5LA 5CHAC 1VE6A 4YHHB 3WKAA 2H1SA 1G4UR 5AR1A 4A4DA 2QL5A 3IWMA 5E0HA 1RJEA 3CISA 3HN2A 3OPXA 3IT1A 3TEMA 1JQAA 2IZ7A 4Z9XA 2BDAA 1U9IC 4IHAA 4ZOCA 5CFZA 8ADHA 1A98A 2ATXA 2H2IA 3WGTA 3NWPA 4OHCA 1EAWA 3PJGA 3H86A 3N7AA 3IXLA 3TW8A 3W0LB 3Q3VA 3U3ZA 4L95C 4YDHB 4YT7H 1K9SA 1YWUA 4ZCTA 2FK8A 1V26A 2AJLI 3GOHA 3EGWA 3C3JA 4YT8A 3OIVA 3MQ2A 2ERXA 1YOVA 2CF5A 3SX4A 4RK6A 1K75A 3LUAA 2BE9A 1T10A 4MWCA 1PKXA 3PGKA 2F3SA 4XDYA 4ND5A 3UA3A 1R5JA 1KIMA 4L85A 4AWBA 2GYYA 4FUEA 1Z75A 1MAVA 4LC1A 1Q84A 2PGBB 2PX6A 3EGEA 1KAEA 3NZEA 2EC9H 1H4VB 3A10A 1UMAH 5DP4A 1XRLA 4FHEA 1HZZA 1J23A 2FF7A 2ZRMA 3AJEA 4NYIR 5DXFA 2X9LA 5TPWB 2BD8A 3OE7A 1H2HA 2XBLA 2FP4B 4UREA 3OM1A 5TGDA 5JAUA 1U0FA 2WAYA 3TD2A 2CUKA 4JQCA 4JBYA 1H9LB 4MZXA 4EKNB 4HDCA 4UNIA 3U4IA 4NKRA 3WYCA 3OO1A 3LGWA 2Q0HA 4M8SA 3LJKA 1K2WA 4H7JA 3VX3A 1V2RT 4IRUB 2YXDA 5JMTA 2BR4A 5F1PA 4RKEA 3EPHA 1XCMA 1QRAA 3LQQA 2CUNA 5FBEA 4A8JA 2EY4C 1KO8A 5AVXA 4TMKA 2GA9A 2Q07A 1EX6A 3BDAA 2YYZA 4UEOA 1C5NH 2ZULA 4E13A 2ZP0H 5DNWA 3DVLA 4UZFA 4YV2A 1WPRA 5H9VA 2BD7A 1M2OB 3ESXA 1C1DB 1VKJA 3TNTA 5E6UA 2Y1CA 4G0WA 2YMLA 2RB4A 1W44A 1EPTC 4EGCB 4C6RA 3RK0A 2R8PA 3VHXA 4RQTA 4ZTUB 2VYVD 4BN0A 4Z51A 1J5EB 1FDPA 2FWWA 4MNWA 3UK6A 4UMEA 1LRLA 2PX0A 4QOHA 4NMLA 3IHLA 1VHTA 5L30H 4F84A 5C7OO 2HSWA 1EPUA 1O6GA 4G97A 2XQIA 4C3ZA 3ZE9A 1KO7A 3CZPA 1CUUA 4UUPA 4R2IA 1F6DA 4QU9A 3ZI0A 4BOYA 3PF9A 3X1DA 2WC1A 3MUOA 2WHEA 1GEGA 1YI1A 2DTXA 2OCYC 5AESA 4IP0A 4R83A 4X93A 3WISA 4JR1A 4R0IA 2XD4A 1QHXA 1XRMA 5JCZA 3FGNA 4B17A 5JZSA 2FOLA 4YGXB 2XT0A 3S28A 3W8NA 2WPDA 2OK7A 3VZPA 2FFHA 3ZDRA 1ZNWA 1L1NA 2ZWLH 3DLTA 2YXNA 4WZAA 1N92A 1SQRA 2PZFA 2VNKA 4MPDA 3GGSA 3UAXA 2ZCLP 4E3ZA 1VGVA 2R25B 3Q8XB 3N0XA 3LJOA 4LF9B 3ZD6A 4TXJA 5L6LB 2JI7A 5H7XA 2ZROA 3N9IA 4WFJA 3IGFA 1WQ1R 1FLAA 5CD9A 1A0LA 1A8SA 3SD7A 1K6XA 2V6FA 4TV8F 2DFLA 4IGAA 4Z7NB 3F5FA 3BN3A 1EGMB 5ITVA 4J2YB 1O2TA 2XQFA 2CW5A 2F9NA 4P4SB 2R86A 3ECSA 2NZJA 1G6OA 1GBHA 1ZRKA 4Z4EA 1KJJA 4IIGA 1T0UA 4NA7A 2VJNA 2WAO