4B76A

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 211
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b76A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b76A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b76A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b76A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b76A03
4NTZA 1LVGA 2QUZA 1DAKA 1O3BA 3L82B 1F2TA 3K9LA 4A0HA 2CMYA 2AFHE 3FHCB 4IKEA 2P8OC 1LF0A 3ATIA 5A8ZA 4FVBA 1NSFA 2C8YB 1UJ2A 5DKMA 1ZD8A 4C7OA 4FMDF 1G3QA 1OXTA 3QE0A 3VMFA 4K81B 2HF9A 3MNSA 1O3LA 1FNIA 3IKJA 1G5RA 4HLUC 1AHTH 1P2IA 1JRTA 3F9HA 2OCYC 1WCZA 2ZDLA 3GCNA 1BTUA 3U2QA 2FFAA 2R44A 1C1PA 1DAGA 1WSSH 3LFUA 4V02A 1ANCA 1W0YH 4HZUA 4NFEA 3KKPA 4ZDWA 3GLIE 2KWIA 3F9EA 4LOAA 1MABB 1MD7A 2EW1A 1VCOA 4D6PA 3LAWA 4MPUA 1P9NA 1PQ8A 2WUBA 4RSGA 2HLDA 3M5MA 5E4FA 1T8TA 1LPKB 1Z07A 1NLZA 1UADA 5J4YA 3T1VA 3OX7U 3SV8A 3U3MA 1AI8H 1CHGA 1NROH 3EW9A 1AN0A 2EFCB 3SU2A 2ILNA 3EAJA 1XVMA 1UAAA 3ZZ9A 4Q9KA 2XSZD 3ZIAA 4ACBA 5B58C 1IQJA 1OWHA 4QFMA 4B32A 4RD4A 3KKQA 1J8MF 1PFXC 3U44A 4GZMA 1HH4A 2ZTYA 4Z8YA 3NXSA 4YT7H 1VGCB 1C5MD 1MTVA 1QJ6B 3X2SA 3PUZA 3CKLA 1NBMA 4C2UA 2FV8A 1CRQA 1H8IH 2O0KA 5CJ2A 1YPHE 4R8TB 1SHKA 3H84A 2ONJA 1NU9A 1IM2A 5LB2A 5EE3A 2QXGA 2A30A 4IC5A 4D9QA 3VR4A 3V9PA 3WRYC 2OILA 2AGIX 3BE4A 1SXJB 5TMPA 1F0UA 3FPAA 3NXPA 1A4RA 2UWPA 2FPZA 3I3SR 4M53A 1GAJA 1OH7A 3GY2A 1AZZA 2VGCB 1IN4A 5AK0A 3JVUA 4M1WA 1PYTC 1Z8GA 3PMBB 1O3AA 4Q80A 3OTPA 1U94A 2ZJZA 3GPLA 2TRMA 4PZYA 3U7HB 1ZJDA 5A0BA 2FSHA 2NO1A 3D3QA 1C5LH 2J0UB 1J8YF 1W5TA 1A5GH 2W6JD 1KI6B 2JLYA 4A4DA 3UTUH 3THYA 2GZ7A 1E0AA 5JS8A 2G55A 3FFBA 4RD0A 4O0MA 2VPPA 3I8SA 4DBLC 4FU8A 3A4LA 1QHIA 4BFYA 2FOEA 5HKKD 1GJ7B 2ZWLH 1C5NH 2WINI 6CHAC 3TJZA 2W0MA 3PV2A 1US8B 3SJCA 4FMDB 4AG2A 3CWZA 2MSDB 2ZI5A 4YMUA 1G30B 2ATVA 3PMAB 2NZJA 2OLGA 3VR2A 4YESB 4CT5A 1KZ7B 3JVVA 2J87A 1DAFA 1SGRE 2GCTC 1XD2B 3GFTA 2CXVA 3SU3A 2PKSC 3BB1A 4A5TS 4DJTA 4BTTB 3NIBA 5H8WA 1AGJA 3UWIA 4DSNA 4UDWH 3RRNA 2WWIA 2A7JA 1JQLB 1BHXF 4AC9A 3TUIC 1O3EA 4A0RA 1C1VH 1Z6AA 1T4UH 4MPWA 2H1UA 3ADBA 2PLFA 4C4PA 2H16A 4DIEA 4HSEA 1FX0A 3QKUA 1KSNA 1KSJA 5J4LA 5DISB 4PQYA 4NCJA 1YZNA 3DUXH 1HAIH 3W6PA 4X2YA 1EX3A 4U01A 1MR3F 1WRBA 3E70C 3LDXH 1AK2A 3KJIA 4AG1A 5KTYA 3T5GA 3AEZA 1VHTA 3HPTB 3BC1A 3PJRA 2FOFA 3UOUA 1NRNH 3GJ7A 3U7EB 2RGAA 1TPOA 3STJA 2CJWB 2F1JA 1O3CA 4ZKDA 4AIIA 1WV7H 2VWNA 1NY5A 3TGIE 1XEWY 5E2OA 2IEYA 4R2IA 1CR0A 1YRAA 5GJBA 2IHBA 3KFVA 4QJ3A 4I81A 3R7WB 1ZOMA 2QAJA 4JCNA 5IF9A 1EZQA 3E16B 5SZJA 3OESA 3OY5U 1L1GA 3B1ZA 1IXSB 3EIQA 1CT0E 1GI5A 2P8OB 1TQ6A 1C1RA 2ZS9A 4LK2A 2X19A 4ZROA 2IBMA 4JLMA 2D06A 1CGJE 5EU8A 4EQ6A 2PSYA 4ABIA 4C9BA 3SORA 3AF1A 1NZQH 2ZI9A 5JCZA 2B7BA 1JXOA 3A1WA 5ESBA 2O8FA 1O33A 4L8GA 1ZNWA 2REBA 4HAVA 2XNDD 1O2RA 2I3BA 1O2KA 2CL6X 2J0QA 4BAKB 3RS4A 4FU7A 4PHGA 4M4SA 3KZ1E 1DSTA 4KITB 4PR0A 1J7KA 2QORA 1ZTKA 3FP6E 1JNYA 2GGVB 2QU8A 4X8LA 1A7SA 4A8JB 2ULLA 4KTUA 4UE7H 3L0SA 2BD4A 4YOIA 1LHEH 5EG4A 2AXNA 2A2QH 2W00A 3M3SA 1N5IA 3U6KA 3ONWA 1ANKA 3X1YA 1OYYA 1Z83A 4XSHA 4PHFA 1AD8H 1XCMA 5EQTA 5EOKA 3MFYA 3HWSA 2QPAA 1GHXH 3TVJB 1Q1BA 3BRWD 2HLCA 2ZG0H 3T1OA 2OC8A 1KJZA 4TWZA 4M9FA 3P20A 1AS3A 2M5TA 2XOKA 1W2HA 2O8CB 1DPFA 4HB0A 1LS1A 5DP6A 3MO6A 4B6EA 1QZXA 3G01A 2GCOA 2Y5GA 3MO3A 4X8VH 4B1TA 4RD3A 1SXJE 5G53C 5EE0A 3N5CA 2B7CA 3PV4A 1ZLRA 3ZVBA 5FR1A 5KYKA 3DMDA 3VHLB 5D3MB 2UUYA 5F3WB 1IQNA 1K22H 4PZLA 5JWOA 1QRZA 1W46A 4ZAEA 2VSOA 2Y7XA 1G21E 3RWMB 3EX7C 1R7RA 2YVUA 2RGDA 3VXFH 3GLGA 1IY2A 4KYUA 5F2EA 3IPXA 3GY4A 2V54A 2BM2A 4MRVA 2A4OA 1XM1A 4URWR 3TH3H 1CIPA 3B8JA 4PPGA 3SJBA 2QRZA 2QN5T 1CR4A 1DICA 1IJFA 1BS1A 1N5LA 3IIMA 3W3AA 1P2JA 3TK9A 2WAYA 2RCEA 2HNTF 3PUXA 3GYLB 4YQFA 2OUAA 1TNIA 3TH2H 1GI1A 2OBOA 2SGPE 2Z7FE 4NBSA 2EI8A 3BG8A 1PZNA 4LJ7A 1S83A 4NCHA 4LBZA 4GLYA 3K0AA 4P3YA 4D0NA 4JKYA 1F92A 1KO5A 4V0KA 1DO0A 4AB8A 1WU1A 2OEPA 4TL9A 1LPZB 5L3QB 4DDWA 1G7TA 3SUFA 4W5JA 3R9XA 2CCGA 4AWXA 2IYXA 2IT1A 3NWJA 3IUYA 3MSXA 2ASEA 1TGTA 2ZYVX 2FX3A 3EPKA 4DC9A 2IL1A 6CHAB 2QT0A 1JAHA 3AUYA 5DO4H 3SI4H 2VIVA 5DN6D 4XJXA 4ILEA 1Y5UT 5AFYH 2PW8H 3SHWA 5DYGA 1SMFE 4Q9LA 1E69A 2VIOA 1G20E 1BRBE 4LY6A 1C4OA 1R8QA 3CRMA 3GQBA 1NIJA 1HE8B 3K6YA 2GCTB 4J1YA 2C96A 1BOFA 2ZFFH 1KDTA 3EA9A 2PKSB 3SOPA 1N2CE 1C5OH 3PLPA 1YZTA 2B92A 5L8VA 6ESTA 3AUXA 4Z54A 2W26A 1OXVA 1P2SA 2RGGA 1QHHB 1ZTLA 4DOQA 4JZKA 1P05A 2NIPA 1O32A 1LDTT 621PA 2OQUA 5BXQC 1OYWA 2TMKA 2ZDVH 2JA1A 4C30A 1O37A 1W48A 4CGZA 1A5TA 2RMKA 5LB4A 1FIZA 1HIAB 3A80A 3PLKA 2O0HA 2KJQA 3M35A 4CBOA 2ODQA 1Q0UA 3KL6A 1FP6A 1GMDG 1RFNA 3GJ4A 4D0LB 3M7QA 1GJCB 1GI0A 4XFQA 5JSZB 3LBIA 2BBSA 4D76A 2FI4E 2V7QD 2ZRCA 4IXNA 1G8FA 1QQ4A 4NYJR 4SGAE 1L2EA 2BD8A 2OBLA 1E96A 3ATLA 2ZSFA 3P1JA 4WMDA 5KO2A 4FN5A 1TTTA 2Z5FA 4F49A 3V0XA 2X2FA 4BECA 4B3FX 4Q19A 1NT1A 2STBE 2BX4A 3M6AA 4PSVA 4Y0AA 5FBEA 2A31A 4TMVA 1C1YA 1NKTA 2A5JA 3QQ5A 3FWYA 2WJVA 1U2RA 3A1TA 1AFEH 3CRW1 3RXLA 1KHTA 3RMOH 1D6JA 2ZFTA 3BFVA 3V4RA 1SVOA 2AIPA 2GESA 1YKSA 4CEHB 3PEUA 3PENA 2O8WA 1D9ZA 4B2LA 4L9SA 4Q1AA 2AX4A 1S6FA 3GJ5A 1O2MA 1KXDA 3U3KA 4ABGA 3PV5A 2KAIB 2Z6VA 2ZYWX 2PV9B 2QQ0A 3CNNA 1UTJA 3A58B 2GAAA 3SU4A 4RKFA 4JSYA 4AKHA 1C2DA 5FUVA 1JBUH 3KKNA 4Q5IA 2VIQA 4UFFH 1DAEA 5HZHA 2BTCE 2GHIA 3B60A 3A87A 2BLQA 2GKSA 1FUUA 1GHZA 4PO9A 1GJDB 1PQAA 4TSFD 4WF8A 5DP8A 4Q7YA 1GTVA 1OH6A 3BIUH 2GBLC 3P6ZB 1NFUA 2WM9B 1ZHPA 1ELGA 1Z6TA 1II0A 2A1DB 3S1AA 4G5OA 2JJ2D 3Q7QA 3QG1A 4IJMA 3OF5A 5AF9H 2NU4E 1KTSB 1BMFA 5J4SA 2VHTA 4PC7A 1ONBA 4OJQA 3MWIU 1GJ6A 1HT2E 5FTKA 4D0GA 2QE7A 1BCUH 2THFB 3UY9A 1CE5A 1O5AB 3FZZA 4JVSB 2TIOA 1LQDB 4MYHA 3A85A 5EXPA 2GCNA 2QAAA 3W95A 1N5JA 1EAUA 4EAQA 5CDFE 1Y3XA 2RGNA 2ZVPX 3RSOA 1TFXA 2QROA 3UMRA 4JLBA 4A1XA 4OQMA 5EE5B 1ETUA 1GILA 1SOTA 3A7YA 1UJ1A 4PHHA 2GV6A 4YLQH 4WH6A 1C2FA 3LY5A 4MLFB 2XZPA 1GKUB 2CLCX 4Q00A 2GF0A 3UWJH 4OS4A 1SVIA 1V5WA 1HQCA 4Q4JB 4TT3A 1LCYA 1Q12A 1GRNA 3OIWA 4ZH8A 1XWIA 4OHXA 4E09A 4DZZA 3OHMA 3QKRB 4HAWA 3KXLA 3TBKA 3P92A 5FH9A 2YNBA 1UTKA 3ZH9B 4BAQB 4TLAA 3SJKA 1W4CA 1C5RA 1FL9A 5DGJA 1KO1A 2ZRDA 1DITH 4AG5A 4Y7BA 4GSOA 1E0JA 1YZUA 3LH1A 3FMIA 1ZU4A 4QHYA 1OF1A 3CH5A 4OJKA 3FDIA 1N6RA 3N2IA 1NMXA 1M1YE 5JB9S 2F6RA 3PUWA 4RFSA 4HDQB 3W5JA 3LC5A 4OI0A 3VR3A 1N5KA 1OFHA 2FO9A 3BEUA 4NZQA 4HLQB 3NKVA 4Z6AH 2FDAA 4JT2A 5C5NA 2HDNB 4IDPA 1GOTA 4RD1A 1EX6A 4H1VA 1G41A 4GDFA 4FCTA 1PLLA 3WHKA 2JCSA 3A6PC 1K1OA 1HAPH 3UFAA 2XW9A 2VHQA 3QK1A 4EPRA 5C18A 3Q76A 3QWCH 2VU8E 3VNUA 1XPRA 2WJJA 3VKGA 1KLIH 4E7RG 3BH6A 3W8NA 3NBYC 1BYUA 4TLDA 2G9NA 3A8CA 2WPJS 1UCYH 2H2ZA 2FWWA 3AKYA 1WXQA 7GCHG 1QTFA 1V2ST 3BEIB 4O3UA 3WHLA 1V2JT 3THXA 3U8RH 2CE7A 3HPQA 1C2LA 3W34A 2ZRGA 4IDNA 1A2KC 2BD9A 2DWOA 6GCHG 1SGEE 4DB4A 1G16A 2QENA 1GBHA 3GLFA 3LXXA 4NHOA 1J14A 2VWOA 4R98A 2QSZA 4LZ4B 2ZU5A 1AGPA 1C9TA 1YHNA 1YR9A 5C2ZA 2HT6A 1QR3E 2IXEA 1FV9A 2XTZA 3U5ZB 1PPFE 4NA8A 1P2UA 3KIDU 2CEAA 2RDLA 2ANMH 4ZI3A 3ZD7A 2FGJA 2A4QA 4A1FA 5FOWA 2GZHA 2J3EA 1TMTH 4U30A 3SO3A 1C1MA 1EPTB 1MU8B 1W10U 5GNDA 1ZJ6A 3CRVA 4CRGA 3K09C 2ZSBA 3Q3KA 3S0NA 3V13A 5E95A 1HFDA 2WJYA 1E1QD 2W3IA 3IEUA 5G4BA 2C5LA 1O5CB 3F9GA 1L1JA 5EXMA 3T27A 3FVQA 2QMHA 3M4YA 4OI4A 3RS7A 1T8NA 3ZVDA 1SGDE 1KI7A 2OP9A 3VB5A 2MMCA 1W7XH 2BMEA 3T25A 2AFQB 2I1QA 3O47A 1W0KD 2A4RA 2W58A 4IVQA 1XMVA 3RXEA 1QB6A 4ABYA 4BQSA 2P3FH 3E91A 4CEIB 2KBFA 5DYIA 1OPXA 3PLBA 3GLHA 4A7IB 4ZDIA 2R6GA 3R20A 4LGMA 4IXMA 3K8YA 4HUQA 1TPSA 1QHXA 4BXSA 4YXWD 1E2PA 5LPFA 5J4KA 3MU5A 1V2PT 1TRNA 1I2MA 2XXAA 4MRRA 3W5IA 5KNDA 2V3HH 4X1PU 1U9IA 3KFXA 4DLTA 2KB0A 1P61B 1E9BA 3LJOA 2JJ1A 2C8XB 2TGAA 3A37A 4LJ6A 3AW1A 2GETA 1D2EA 2CK3D 1HEIA 4JZFH 2WSMA 2O8BA 1RYFA 2EI7A 4NCYA 2ZJAA 3FMFA 2ZI7A 1GFIA 1RVDA 3ENSB 3A7ZA 3PEWA 5IK2D 4I32A 1OIXA 2GP9B 2J7PA 4FMCF 4DJZB 5FXLA 1GWAA 2V0BA 1ZSLA 4FUIA 3IIKA 3CIOA 4JKIA 4NL4H 4O25A 3P95A 5FX5A 4YMWA 1HTWA 1MTNC 3HKIB 1WXRA 2VWLA 1AVWA 3RHFA 4DDTA 1FNMA 1OXUA 3L3TA 4EPXA 8OHMA 3DVLA 2VINA 2HCJB 1PPEE 1CU1A 4E06H 1GBMA 4CT4B 3BTQE 1XP8A 5GVRA 4Z8XA 2HJVA 2ZJ2A 1E2MA 3E3TA 1FDPA 2FF7A 4H42U 5C1BA 3LONA 3DHKH 1LVYA 4NCIA 1ZIPA 3PWCA 1Y3AA 5CHAB 2BQ6B 3LGVA 1KO7A 1VCMA 1A0JA 1S82A 1IQGA 4P31A 4XDEA 2CV3A 2FS8A 4H6SB 4DUGA 1W0JA 1W36B 3KQUA 2ZC9H 4CDGA 2YWFA 1XEWX 5EZ5A 1KDQB 2V6IA 2BOHB 1BUIA 4AKEA 4LDJA 1D6RA 4TTPA 3SBKA 1TNDA 1DWDH 1Z2CA 5GJVC 2QP3A 1E9CA 4AGJA 4NIVA 2UUJB 1C2EA 3QPWA 4JZIA 2BDCA 2OBMA 1EZSC 5CK4A 1XBTA 1PQ5A 3L33A 3H4MA 3LQRA 1W13U 3ZLJA 3QEJA 3U6BA 2J5XA 4EJSC 5TCCA 1Q2WA 1N25A 1ELFA 1P72A 1L4DA 1CJTC 1O3FA 2ZI3A 1O3JA 3GCTG 4MITA 2NQ2C 3MH5A 3K0SA 1XJCA 2ZU1A 1P57B 1NSTA 5JB8S 3GEEA 2N42A 1KI1A 4B3CA 3AF3A 1FMLA 3PM3A 2WWWA 4RKEA 1YE8A 1KO4A 4OL0A 2ECKA 2R9PA 2ZR7A 1JB1A 2ZIQH 2PZEA 4US1R 3SDZA 1CJKC 3P27A 1D6WA 2ZDNA 4WA7A 1GKIA 2ZJOA 1P9SA 2ZNKH 1IN6A 4MYCA 3UQVA 3V3MA 4MYTA 5IT5A 1E2KA 1OP8A 3H0KA 1O5EH 3C15C 2Z0MA 1GHYH 5JI3E 2MSCB 3T28A 1RE0A 1ELBA 2FYQA 1HPGA 3UR6A 2JETC 2IF2A 3FHTA 2WWFA 1XU4A 4LX0A 1WE2A 2K5UA 3ASYA 5DE3A 1F0RA 2C04A 7KMEH 1AE8H 4JL8A 1Y63A 2FP7B 1L7VC 2BDAA 3CM0A 1KI4A 3T2NA 2NMVA 4HEJA 2DY1A 1MO5A 1KGDA 4EFLA 3QUMP 1JEEA 1DUAA 2P94A 2QZ4A 1FJSA 2IYUA 2YNMA 5GJWC 3QGNB 4DRZA 3RXJA 5K8UA 2GMTB 1NN1A 1O2YA 4K2YA 3VB6A 1WP9A 3BTKE 2J2UA 3WY8A 5L2YH 1BMLA 2DCUA 1PPCE 4A2WA 1C2JA 1HXFH 4Y8ZA 3BTME 4FD2A 5AR1A 1UO6A 1GL9B 5K8IA 3SW2B 3A8TA 4GMXA 3MG9A 3MD0A 3DFLA 2R2AA 2V4ZA 3A4NA 1X7AC 1EASA 2DBYA 2ZDMA 1OHHA 1UBCA 1QBOA 2ZRIA 4OQXA 2E9SA 4BEJA 1GDQA 1MABA 1A0LA 2A7QA 4CRFA 4DLVA 3EGKH 5C20A 1UVTH 1VJ9U 4E05H 1RIWC 3UR9A 1AVGH 1N0UA 2G51A 4MGYR 1B7XB 4UEHH 4LPSA 4CHAB 1LB1B 1RD3B 1HBTH 2JH0D 5BRRE 4DHEA 3Q3YA 3RDPA 2ZCLP 4X8MA 1GMCG 4RKJB 1C1SA 1Z8FA 2BVNA 2GDEH 1DPOA 3K0EA 1A4WH 1HNEE 1YJ5A 5HE8A 4YM9A 2ZP0H 1IQEA 2IYRA 2Z9KA 5L2ZH 2OUKA 3ICEA 1KTTB 4G5RA 3IWMA 1HGTH 4ZUHA 1ARCA 3MU4A 1SSXA 1TNKA 4V0OA 2QY9A 2CN0H 5EPYA 4PPQA 1QL7A 1G5PA 4TL8A 3CX6A 2A45B 3O8DA 3LDAA 2GT8A 1VR1H 3U9AH 4LZ1H 3FAOA 1GNQA 2Y7ZA 1RRGA 1QNJA 3VGCB 5DO9A 4TMZA 1P3JA 3QIAA 1AKEA 3QENA 1SGPE 1AIPA 2YINC 1FIWA 1TNHA 3ZZ8A 4ZCLA 2IS1A 2YC2C 2C93B 3U1JB 2XZOA 2QPTA 4PC2A 3ITIA 4AYTA 1KI3A 5SZKB 4BRUA 3FKQA 4WMEA 3OYPA 2YKGA 1G9XA 4RFVA 3ZDQA 2L0XA 1KKLA 1MTWA 4UNSA 1EFRD 4ZHMU 4L16A 1KMHB 3QXJA 2Z9JA 4QXAA 1XEFA 3LGYA 1CJMA 2GTPA 4BPBA 2BXUH 1E9SA 2CHVA 2J0UA 4MH0R 3SEAA 4HZIA 1INCA 1A1VA 3X1WA 1KI6A 1XD9A 4DSTA 3RAPR 1UDXA 5JEEA 4B47A 5GVSA 2B7DH 3BH7A 2GJ8A 1R5OA 1VECA 3GDUA 2IYWA 3SOSA 1E2QA 3M0EA 2O5VA 2XXLA 1YZQA 1VITG 4YDHB 1ESMA 1W47A 4UFEH 4KBGA 3FE2A 3AVTA 1GMDF 3AK5A 3DHWC 4JBYA 1P4SA 2ZSDA 3X1ZA 1US8A 3VR6A 1OWEA 1AKYA 4NZYA 5JFGA 4GOJA 3DOFA 3TAUA 4R0IA 4NKRA 1XXHE 2EWWA 3KKMA 1DTSA 3EZ6A 5ABWA 1TBRH 1VCIA 1XD2A 2P65A 3S9BA 5HTKA 3D23A 1S81A 3M3TA 1JR3E 3VHXA 2WMNB 1ESTA 3SYKA 4ZDKA 1EJMA 1V2MT 3PUYA 2ALVA 3LX5A 4A0FA 5AUOB 3QF7A 4MNWA 1O2TA 1FQKA 3SFVA 1X1SA 1CULC 1GHBF 421PA 3F3YA 1EZUC 1KK3A 1GUAA 1ZUIA 1OXGA 2SNWA 1MQ5A 4O3TA 1C5YB 3RXAA 4O97A 1JPJA 1ZU5A 4YMSA 3QPUA 3KJHA 3RXBA 4AG6A 3KKOA 4Q7JB 4Q9IA 2QP9X 4H6TA 2FU5C 4X2VA 5FAHA 2P0EA 4RVCA 1MZAA 5EP4A 4AFUA 1L4YA 3NBZC 1QHNA 4E03A 2ZS7A 4P32A 1GM5A 1DY8A 1GG6B 2BLWA 2JASA 4TL6A 1EESA 2D7DA 3CBQA 2JETB 3LW7A 5C2JB 1C5QA 1KXBA 1QG4A 1T8UA 5TXGA 3SYNA 3R7WA 2WPMS 2ZEJA 4IOLA 3TU7H 3TSWA 4Q1EA 2CL0X 2ZAMA 4P33A 1UTOA 1QDEA 2DWPA 1VCPA 4CVNA 3A7XA 1ZM2A 2ATXA 2UWOA 5T3HA 8LPRA 2UWLA 2ODEA 4QBGB 2GCHG 4F4OC 1YCPK 3GJ3A 3IBYA 1DOAA 4LHVA 4MKFA 1NN5A 4Z1MD 4KELA 1BMAA 2HJGA 3ZZCA 1E2EA 5JRJA 4CR9A 1BBRK 3OY6U 1NP6A 4OS6A 1G3CA 5AJVB 2QC2A 5CIWA 4FXGH 2BYAX 1G7CA 5EODA 2GWHA 3SJ8A 1Z8RA 3CLVA 5FPHA 1HV7A 3SU6A 2ODWA 3RXFA 4XSKU 2ORWA 3UK6A 1YR6A 2Q6DA 1DE0A 2C98A 1SGYE 4A8JA 3A89A 4Y8YA 1O34A 1U6QA 3BN9A 1R5NA 3BTDE 1EJNA 2XSZA 4YLUA 1C4V2 3K9GA 4IEIA 3VFEA 5L3VA 4A36A 1T8MA 2ESTE 4JK5A 1GSIA 1UKVY 3I5XA 1O2VA 1XTSA 3SN6A 4WZ6A 4LC0A 2FX6A 1FOEB 1FZQA 1HXEH 3RXIA 3T5DA 2PMDA 2IYLD 3JZMA 2O8CA 5K7RA 1GHAG 2J46A 4K5ZA 2O8MA 4CH2B 3MH6A 2G0TA 1TB6H 2YOHA 1Z6YA 1H8EA 3OIVA 3WY9A 2WPLS 5D3MA 3BEFB 4LBVA 2CLDX 1BKDR 1WBBA 2FYRA 3A4MA 3DL0A 1NKSA 1T4GA 3TRFA 3GFPA 3QF4B 1ANDA 2PBRA 1UTPA 1ID5H 4B3XA 3Q8XB 4AGKA 2IYZA 2XTTB 2J0SA 1DAMA 3FKSA 4AURA 1WCV1 1DWCH 1NLFA 3NKKA 3RXCA 2WPDD 1NRRH 5EP2A 2STAE 3TVDA 3SI3H 5ESTE 4A9AA 3B78A 2A7HA 1TGCA 2GV7A 1UK3A 3ADKA 5JBAS 2NU0E 2NO0A 4JK6A 5FHTA 1G8HA 1TA2A 2QMUA 2W6JA 3M7TA 4J0QA 4PAQA 2H18A 6GCHF 1XJQA 5DP9A 1HJAB 1S0QA 1ZZZA 5TJXA 3NTUA 1C2MA 2FFQA 3K70C 2XC4A 1ORFA 3LH3A 3ESTA 4IDHA 2OK5A 3U7FB 4RN6A 2ZRAA 1HAHH 3K70D 2ODBA 1Z28A 4K69A 2HLDD 2K1QA 3QUSA 4EPYA 1MAYA 4HAUA 2FG5A 2YOLA 3D7MA 1Z63A 3RXRA 5M04A 2D2DA 3IPYA 1CR2A 2QMEA 3QVUA 1LMWB 3E90B 3W6OA 1TWXB 4WW0A 3P8OA 3RC4A 3ZIAD 4QGGA 4NA7A 1A2BA 2QTFA 3RABA 5TY0A 2WJHA 1UKYA 5CE1A 2FS9A 3LVQE 4LK4A 2ZDKA 1SKQA 3LKWA 2VH5R 1NLYA 3ZZAA 3AVZA 1H9HE 1LVBA 4NA9H 4M21A 2GJKA 2C95A 3RS3A 5KHOC 3BIVH 1J16A 1II8A 1OT3A 1QHHA 3IGFA 3TGPA 4BLOA 4B2BA 2PHBA 2JLZA 2ONKA 4HYYA 4AN7A 2ODNA 1NBMD 1O2UA 2VNTA 1AWFH 3RM2H 2F7SA 1AE5A 3AGQA 1QIXB 4PSAA 3HYRA 3KHVA 3AVVA 1HQYE 4I8GA 2IPHA 4W7SA 1THRH 5JS7A 4BZXA 2TPIZ 4UNQA 3VB3A 1AZTA 4KU4A 2OXRA 1HIAA 3BB3A 3U4QB 3OEED 3THWB 3IHLA 2CHQA 2VWMA 1T91A 2IXFA 3MHWU 2VVVA 1VJAU 3UNRA 5JSZA 3NC0C 2ZJYA 3NG1A 4D4JA 3CX7A 3RP2A 3A1SA 4X2WA 1U81A 4LYJA 1E98A 3OFNA 1YPHC 1M7GA 4QG7A 4XBCA 3W90A 3ATWA 3ZYEA 2EU8A 1CQQA 3EZ2A 3L0IB 1CP2A 4DLUA 3RXDA 2BWJA 4THNH 1XXFA 4TLEA 2EFHB 1P2MA 4QKQA 4RD2A 4B2IA 3RXTA 4UQOA 1Q3XA 3FB4A 3SV6A 3QKSB 1VTKA 2ZGJA 4DVGA 2QY0B 1M7BA 4BFXA 4AKIA 2P59A 1XPUA 5IDVA 4DCTA 3E1SA 4JT4A 3V00A 4CEHA 4C0BA 1AQYA 3SNAA 2BCJQ 2ZROA 3L2OB 4II7A 2BV3A 1IN5A 1PUIA 2C9OA 3RUOA 1G1MA 4W9MC 1UEJA 2J0VA 1ANEA 4FUBA 1WF3A 1MQ6A 5EJEA 2Z9LA 1JEDA 1AUJA 1QJ7B 1XNJA 2PLRA 1J17T 3GP8A 1YZKA 1G8PA 4P0TA 1FNNA 4GRAA 1CA0C 4LC1A 1ZMNA 3MCAA 2ODYB 2RHDA 2FEQH 3KQNA 3KQKA 2OC1A 1O3DA 1E9RA 3SU8A 1T9HA 3ND8A 1FAKH 3I8XA 3KB2A 1S9DA 3AP1A 2ZRPA 4QM6A 5DI3B 2TGPZ 5C3NA 2CL7X 4TTQA 4YT6H 4M22A 1S85A 1ESNA 2AFIE 4TQUS 5DGXA 3FVFB 4NYIR 2AHOA 3OIUA 3ZVNA 1AJEA 4OYHA 3R9IA 4B35A 2EWVA 2OM2A 2GXQA 5CB8A 3CUEF 1O3GA 2Z4SA 4R2HA 1NJGA 4S2EA 4BLQA 2J41A 1C4Y2 1P06A 3FGNA 4URUR 1X8LA 1G2LA 1BJUA 3KTAB 1S0RA 3QZQA 2VP9A 4RZ2A 1XMJA 4YZUA 4GAWA 1O3HA 4AK9A 3GCTF 2ANYA 2RA0A 4AKGA 3GICB 4XOJA 1YR8A 1FY4A 1C2GA 1TLDA 4Q48A 4Y11E 4M9ZA 1JI0A 5TARA 4Q4JA 4AFQA 3IO5A 1QF9A 4GOXA 1ZTJA 1CSOE 4RZUA 2QM7A 3GJ6A 3QKRA 4PANA 3RWOA 1YZGA 2Y5HA 2J34A 5TDHA 3ODFA 2GVFA 4QM7A 2GF9A 1ZGVA 2YYZA 4AZ2B 1XUFA 2D3WA 2IF0A 1F5LA 1L1NA 1O2WA 4MDEA 2FI5E 2A0QB 3K70B 2Z9GA 3RXSA 2W7SA 3BD9A 2ZU3A 1CS4C 3CENA 3D6TB 1MT0A 1F2SE 1NS3A 1EFHA 2HEIA 2CLSA 1PLKA 3SGBE 4QC2A 1K8RA 4BAHB 1NIPA 1R0XA 4Y7AA 1G36A 2I4IA 1BMNH 1CJVC 1SVSA 2EYUA 3HATH 3LJJA 5BW8A 3QXHA 2QSYA 3URDA 3SU5A 2ZRBA 3GYMA 821PA 5EUMA 3U44B 1R2QA 4GFDA 2IW3A 4D81A 3CO5A 5TV2A 2WSSD 2FE4A 4TWYA 4G5GA 1OXXK 3EE0B 1NN0A 4HB4A 1O5DH 1KDOA 4OBEA 1CTQA 2F1RA 1Z06A 3GLIB 2ZCHP 2ZU2A 4I4LA 3ELAH 2CHAC 3RNLA 1MCTA 1QJ1B 1YZLA 1OJLA 2PX3A 4URXR 4ISOA 4GL2A 2BBOA 2JLSA 4EKDA 3L8ZA 4IRUB 2B5TB 2FWRA 1CF4A 1N6PA 3PEYA 2Z43A 1B5GH 1GRQA 2BEJA 4ZIRB 2YC4C 2VP2A 3FANA 5FOVA 1V2RT 1IQIA 2Y5FA 1GGDC 1E4YA 2BC9A 5AUNB 5HM9A 2J38A 2RGCA 2XX3A 1Z29A 1S3SA 4JLDA 4I31A 4WXPA 3MJHA 1AN1E 1BBRE 3KQBA 1VKJA 2XWBI 1ELTA 4LJ5A 5LH8A 4NWKA 1ZM4A 1AA9A 2R6DA 2WOOA 3QXXA 3RRYA 1GMCF 5JMTA 4TYPA 2VLIA 1ZNZA 1EPTA 1L8QA 1Q22A 4Q9HA 3A7WA 3PMHB 3EDXB 3DZ8A 1UVOA 3BF6H 2Z3CA 2IYSA 1NVVR 1ARBA 3SNHA 3U8TH 3E5HA 4BLRA 5GPIB 1T3SA 1XCPA 1SVKA 2I1VB 1PJPA 1HJ8A 2OFOA 3P4XA 2ZO3H 1SL3A 1W12U 4OS2A 3MGCA 2QG6A 1BZXE 1HB0B 5CB6A 3HR8A 5KU1A 1LV7A 2C4FH 3AF0A 3KEEA 4GOKA 4XWOA 3KQDA 1OV4A 2NU1E 3AB3A 1H8HD 2FM2A 2QCYA 1MOZA 4UFDH 1P60A 4JVNA 1O2SA 1UVUH 3RLFA 2H17A 4TMXA 3ZJYA 2F9OA 4V0MA 2AMPA 2ZITA 4WIAA 1T7CA 2C90B 4AFSA 2WKRA 2CF9H 5D3QA 2DYKA 5BN3A 2C77A 4MGZR 2QIQA 1VG1A 1DXWA 4BFTA 2XC5A 1PUJA 4TSFA 2ERXA 1W7GH 2R3UA 1CA0B 4D82A 2CE2X 4BUJA 4JMYA 1O2XA 4TWWA 3SNEA 2HOBA 3KGPA 3ZZ3A 2RH5A 2MMGA 1W11U 3ZZ5A 2XBVA 4L15A 1HURA 5EXTA 1CRPA 4AYVB 5F9HA 1F0SA 2VP6A 4K60A 2OTVA 1W0ZU 4EUNA 1SQOA 3B1VA 2WIBA 4NCKA 4MNYA 2P5TB 5KPDA 2IS4A 3HGNA 1R0ZA 3T61A 1OH5A 1X8JA 3PEVA 1D9XA 2V9PA 1LHCH 2Q6TA 2F1HA 2DR3A 5CM8B 3UNQA 1SVLA 2P6RA 5EE1A 1WA5A 3S7HB 1RTLA 4MNVA 5P21A 1LKAA 4QRHA 1ZHMA 1D2NA 4ZCMA 2ZJ5A 4QBFA 3BTGE 1VIYA 2BXTH 4Q1BA 1G4UR 4NIXA 2P3SA 1R0YA 1EUFA 2ZXUA 1FI8A 2NOAA 3TPIZ 2ZPTX 2J9NA 4KVAA 2FI3E 2JLRA 5EZ6B 3NDBB 5AHGH 2GZ8A 3WMFA 1UDWA 1DOJA 1O3OA 1KNQA 4ABFA 1W4BA 3RMLH 1RJ9B 3I29A 2ZGCA 1NRPH 1ZD9A 4BOHA 4N1AA 2R0KA 1CBWB 4OKSA 1V2QT 4QHTA 1Z47A 4MKGA 1IBRA 4TYQA 1NBME 1IQMA 4B33A 4D8NA 1AZSC 2G0NA 3TH4H 4URZR 1UMAH 1K21H 1G7RA 1M74A 2WYGA 1L2TA 1U90A 1W44A 4G0NA 1QA0A 1XX9A 5EP1A 1K1JA 4FUEA 1RW4A 1FXYA 1HYLA 3U61B 1Z7KA 4QT8C 3AKEA 2GCOB 4KVGA 1A0HB 2DFKB 4DEXA 1GVZA 2FOMB 2XTMA 2HXYA 1TX7A 1KI2A 5JYIA 2GCHF 1G3RA 3VPKA 1GL7A 3K0FB 2CHAB 1A2CH 2QE7D 4ISNA 3X1DA 3FMOB 2RGNC 3C5CA 1OKKA 4C0QC 2VYFA 221PA 3BG4C 2X8AA 3DMNA 1TBQH 2FOGA 1COWD 1XTKA 3BBPA 1SGCA 3DZDA 3QXCA 4N3NA 4LJ8A 1G8YA 4ZKEA 4R7ZA 2ZI2H 1HYQA 2BKUA 3TE6A 1F3OA 5CLQA 3RS5A 3SUEA 5EE9A 5LD2C 3RMNH 3SS8A 3U69H 3SQHE 3F8TA 2GXSA 1SQ5A 3WXMA 4JBWA 2PJZA 1XTJA 3BK7A 3UG6A 4JLJA 1K1IA 1F5KU 1BITA 2ZU0C 1BIFA 1SFQB 4CRAA 1TMBH 4F91B 4HB3A 1HAYB 3VQTA 2XYAA 1E1QA 4DURA 1NN6A 3K09A 5L3RA 3K0AB 4CRWB 3MU1A 1XJ0A 1P9UA 2QAGC 1EOLA 1Q1QA 3W94A 2OZEA 1EFTA 4O2LA 1GHAF 2BCGY 4PZZA 4GT1A 1SLUB 4RKOB 1N6NA 4EFMA 4M1OA 4I33A 3EZ9A 1GBJA 1OSSA 1VDZA 4LHWA 1PYTD 3A83A 2BBWA 3A82A 4K1EA 2AK3A 4B34A 2QBYB 1B0EA 1SGTA 3TGKE 3EA0A 3CPHA 4WVPE 3IHWA 4K1TA 2ZEBA 1ZM9A 5IYTA 4DEYA 5K8TA 1XUJA 1KDPA 2ZFPH 3SUDA 4CYMA 2XZLA 2P67A 1GBLA 3V7TA 4ABBA 3TIFA 1O35A 1AM4D 4DKXA 2ZAOA 1NJFA 1O30A 2JIZA 4KODA 1G19A 3ATMA 3TSZA 2FEOA 2ZDAH 3BS4A 5C1UA 2V3CC 1L4ZA 4INHA 2AYWA 5LBIA 1RGQA 3VXEH 1P02A 1KXAA 4QBIA 1MCVA 4W5HA 5DP4A 1G32B 2DE8A 4F7WA 4M9QA 1YCPH 4IDOA 3EWSA 1C2IA 4I8JA 1E2GA 2IYVA 4N0DA 4PC1A 5E7MA 1LFDB 4A0GA 2CK3A 1V2UT 1SULA 1BBRH 4CEJA 5JRZA 4RCZA 2J94A 3N2EA 4DLXA 1TGNA 1R4AA 1E79A 3AAVA 4BGDA 3SJOA 1AU8A 1A5HA 3TSOA 1ZYUA 4KI0A 1GJ8B 5B57C 2ZRNA 1T5LA 4OQFA 2HT1A 1Q57A 2ZHDA 4ZHLU 1YRBA 4GHQA 1BTWA 1IHSH 1N0WA 2NO9A 4I1OA 2ANKH 5DK1A 3MU8A 3HP1A 5DHFA 4F4JA 1DBSA 4Y76A 5DLQC 4X8SH 1O87A 1T31A 3L6PA 5CYPA 4C0JA 2D1JA 2BM1A 1LHGH 1UM8A 1QCPA 2ZPQA 5JI2E 2QTHA 3IO3A 1VCWA 2AK2A 1YF4A 3ZV9A 2X77A 3SZNA 1VPLA 1MRSA 4Q1FA 3UG7A 1KMHA 4LUCA 3QI2A 2A5KA 5HE9A 5EP3A 2IEZA 3GEIA 3PIRA 1NRJB 2XBYA 4LOYH 4FU9A 4OS1A 4ZKNU 3GCOA 5DIFA 5A0AE 2BDTA 4M0LA 4QL3A 1P3CA 5HMAA 5FBVB 2BQ7B 3K0CA 2ZE7A 3KXKA 1P62B 2P2LA 3RC3A 3MNXA 1U98A 3ZVCA 3FHOA 4A15A 3B5JA 1GRRA 3QVVA 4UNRA 3RXPA 2REXB 2QM8A 2ZGBH 1G3UA 1QBVH 3BERA 1U9IC 3KUCA 4JLPA 1H4WA 1KI8A 1G37A 3B82A 2ZZUH 3MH7A 1E32A 3GLGE 2VB0A 4KO8A 4GUXA 3T1QA 2FH5B 2N1BA 3S1AB 2ZPRA 2A32A 3CRQA 1LHFH 3MYWA 3TUZC 4JL5A 2Y6TA 4EFNA 3LT3A 3TJNA 1V43A 5GJCA 4A1TA 5EQRA 4NG9H 2G77B 3RXQA 1HCGA 2KBEA 4OS7A 3HPRA 1TEVA 1U0HC 2P3UB 3V4FA 2D74A 4HI3A 2J7PD 1GI4A 1WBGB 3QTOH 1O3IA 3Q00A 4IW3B 3ZS9A 3RM0H 2W2VA 4LWZA 1E2JA 4Y6DA 3UWOA 1XMIA 3AF4A 3CONA 1A61H 1FN8A 3SNCA 3AKCA 1D9IA 1V2LT 3FFAA 2QP4A 1E1RD 2G4TA 2ZIAA 1NNEA 1BTYA 1C1OA 5LD2B 1BHXB 1Z6EA 4J2YB 5L3SB 4M2LA 1XUGA 4I1VA 2DB3A 2XWAA 4YMTA 2R3YA 3VX4A 3BORA 3TJUA 4XBDA 3RXGA 4NYJQ 2WVJA 1LNZA 4ZO4A 5FBLB 2VL7A 1GI6A 3FP8E 1W49A 4Q01A 4I8KA 2GJSA 1Z0DA 3LVRE 3C14C 2OAQ1 3KJGA 3PFIA 1Z5ZA 2QAGB 4FWIB 3SC3A 2JGNA 3AM1A 1YQTA 2OC7A 5FI0B 4AYXA 2A7CA 2HPQH 2SGFE 1N8OC 1N3BA 2R8RA 1EAWA 2BZ6H 2JLXA 4DIHH 4FWTA 5I46H 2OCAA 4NZLA 3A7TA 2FXRA 4Q02A 3O8RA 2ANWA 1OXSC 1X86B 1QVAA 1FW6A 1WDTA 1NG1A 4TY6A 4KJZA 4OK6A 2Q9AA 4FUFA 2J1LA 5GJ4B 1KZGB 4FUJA 4MKIA 2G5NA 1GVKB 3THXB 2BY7X 1OB5A 1M9UA 3K6ZA 2ZUCA 1S1CA 1EJAA 1FY8E 3URCA 1MO4A 3BOSA 3EAQA 1J8AA 3QLPH 3GCHC 4PPFA 1O31A 3SJAA 4ITRC 1ABIH 1J90A 3ZQJA 1C5VA 3A81A 2H5DA 1TU4A 3GY7A 4NFFA 2ZJBA 4RZXA 1L0ZA 4ZPXA 1GI9B 5J4VA 1T5IA 3QO6A 4BXWA 2SFAA 3IITA 1YM0A 2BDHA 2VIWA 4FVDA 3QY0A 1HUTH 5JLJA 2OFWA 3JZ2B 1Z0FA 1TMUH 2Z3EA 1VYTA 1RPZA 1NPMA 4Q4HB 3W6NA 1O2PA 4RI0A 3WYGA 3QF4A 3ASZA 1WYKA 4XD7A 2RG3A 2H1LA 2BDGA 3THOA 2J92A 1GBKA 2Q1JA 2AWNA 3F6UH 1OW3B 4FW9A 2W2TA 3SYJA 1ZP6A 1UTQA 4VGCC 1EFRA 4XOIA 3LV8A 2BIFA 5HM2A 1KMQA 1V2VT 2PH1A 4UFGH 2ZGHA 3GY3A 1J9CH 1TRYA 4M9XA 1E4VA 5JHHB 3F5FA 4HATA 1FY1A 3KUDA 5EXSA 3Q5DA 2HXSA 1DS2E 1TA6A 2AKAB 1P2QA 3REFA 1GHBG 2PR3A 3NK8A 4O9VA 2CXXA 3T1TA 2H8KA 4LZZA 5G3YA 4ESVA 3I4LA 1MKWK 3KCGH 1PPGE 1HE1C 3UKDA 3ZVGA 1OHHD 2G5VA 4NP6A 1GIAA 2BY6X 4LV8B 4KXFB 2XXAB 3J81k 4ACAA 5EW2H 4A6XA 1P01A 1FP7A 2Y8EA 1Z2AA 2WIAA 4Y0ZE 5KSOA 1SR5C 4JVMA 2ZHEH 1GL1A 3A36A 2LCFA 4D80A 1KXEA 4GP7A 2LKCA 1HAVB 3I5YA 1SG8B 3ETLA 5A09A 1WTHD 2NU3E 2EVWX 4OK5A 1V2KT 3ZZDA 1SGWA 2FPKA 2W7UA 3MJRA 4AX9H 4MGIR 1N6OA 4KLZA 4XBBA 2W5EA 1VGCC 3C7KA 3AP3A 3TR0A 4UD9H 4ARZB 1UTNA 1UBGA 4B6FA 1S8FA 2V55B 3QN7A 1ELAA 4YO9A 5ETXA 5FL3A 2F1IA 4BASA 3WYAA 2BBTA 4N0EA 4INKA 1VHLA 1E9EA 4B2AA 4K8YA 1WB9A 3MWYW 1G18A 2PZFA 1KJWA 3K9NA 2FTLE 2QF0A 1CXZA 2BY9X 3BJIC 4BAMB 2EQBA 1TL7C 3R3GB 5FPKA 2EFEB 3RXVA 4ZMAH 2NO6A 3E8LA 1OB2A 3B6EA 1HRTH 3LLUA 3U4QA 1OYTH 3THWA 1IN7A 3SZRA 4UXHA 1YPKH 1GNPA 3Q9LA 2CF8H 2VGCC 4XSGA 4TL7A 3VFDA 4X8OA 4KV9A 4BFWA 4MQBA 2PGBB 3OE7D 1X3SA 8GCHG 1N6IA 4GBMA 4OK3A 3CW2A 2Z4RA 1W14U 1CR1A 4GVUA 2YZ2A 2XCFA 3LC3A 4JZDH 3BTEE 1P0SH 4S35A 3VX3A 2JDID 1RRFA 4NSYA 3NPSA 4XVUA 1SKYE 2V8OA 2BVRH 2PFEA 1F6BA 4MPVA 1S5SA 3C27B 2ZECA 1KSGA 3RU4E 4R9UC 3QKSA 5DJ7A 4LI0A 1IONA 5FI1B 4E22A 2ZFSA 5LGOA 3SR0A 4MRPA 4AI6A 1AZ8A 1N8OB 1CGHA 5K0HA 3E6PH 1ZCAA 1AO5A 1MTSA 1MU6B 4LYFA 1E36B 1OP0A 1GI7B 2BKEA 4Y71A 3SN8A 5BN4A 1N1LA 3NHBA 3GLFE 3TLOA 3OAAA 1HAOH 2C9YA 2ZRHA 2VIIA 2H92A 3Q3XA 1AMHA 4O3MA 4BZPA 4FMBB 5F98A 1F7ZA 4DCDA 2B21A 5FUXA 1OE0A 1ZR0A 1WUNH 3CWQA 3RLWH 1E6CA 2VH0A 1TGSZ 3IEVA 3PITA 1TE0A 3VB7A 2XB2A 2XRCA 1VITH 3GCGA 5FBIA 2FLRH 5ELXA 3GCHB 1J15A 1K5DA 1QL8A 2SNVA 2Z83A 1ZINA 3GJ0A 1SGIB 2LNCA 5DI3A 1FMJA 4JJKA 1K1MA 1O5BB 3K9XB 3WP0A 4M1KA 3OTJE 3GEHA 1CEEA 2QGNA 1TPAE 2PUQH 2ZA5A 3H5CB 4AORA 1O2IA 5KSPA 5G41A 1VMAA 5HR5A 3BTTE 3A1UA 2QEQA 2PUXB 2FFBA 5HCIA 4WAUA 4W5WA 1KIMA 1NTPA 1IY0A 3SQEE 5DNYB 1JR3D 1UVPA 1WQVH 1ZRBA 1MTUA 2OINA 2NG1A 1NG9A 2CCJA 4LBYA 4UKDA 2ZCKP 1SGNE 1Z6GA 2QA9E 3TAHA 1UF9A 2ODPA 4RY2A 1XZPA 2BHGA 4YTAA 4O2RA 3GLHE 3KTAA 3UOPA 4MDSA 1W5SA 1DM4B 5FBRB 2JAQA 1SHZA 5AUPB 3LIWA 2O52A 4GPGA 2ZRJA 3WNCA 1ZM3A 2WPDA 1DADA 1TPPA 3NWUA 4VGCB 1VYVA 4Q66C 5GDSH 2OFXA 2JEOA 1ELVA 1W3CA 5DG6A 2GRJA 4E7NA 2R6AA 1NVUQ 3SGQE 2AXPA 2ZRKA 3QX5H 4Y8XA 2CNWA 2ZHQH 3TIUA 1AKSA 2VVCA 4RCYA 1IAUA 1UTLM 1PJRA 5J4QA 2OXCA 3CR8A 4YLGA 2BMDA 4TZ0A 4B74A 3TQCA 3CNLA 2C3SA 1RZ3A 4TQAA 4A8JC 1C5UA 2HYDA 3MFJA 1P75A 2W6ID 2REOA 1RJXB 5EGMA 1Y3WA 2LWIA 2HPPH 3U3RA 1D4PB 1DO2A 4MG3A 3KXIA 1XVOA 3I1FA 5BPEA 2BMFA 1BH2A 2J59A 4K1SA 3ND9A 1JMOH 2DUCA 1KI9A 2OBQA 2FFHA 3B1XA 3WP1B 3AQ4A 5JECA 4FINA 3L43A 2FGKA 4C0KA 3I73A 3GDVA 1LF5A 3LGUA 5FOXA 3TW4A 3TR5A 2EC9H 4HZHA 7ESTE 2BJVA 2DHRA 4DW2U 4X1RU 2C03A 1FUKA 2G81E 1PPHE 2O8TA 3DD2H 3BWDD 5KDDA 4F93B 3GLIA 1RRCA 2KSQA 4I99A 1H8ED 4PFSA 1K6MA 3MRSA 1GDUA 4HAYA 4NYMR 4KCGA 1JJ7A 4ZIRA 1SHYA 2BOVA 2C8WB 3CPJB 4NDZA 1F48A 1O3MA 2HVXA 4V03A 3OEEA 3B9QA 1AIXH 4YMVA 3A86A 2CCKA 1AB9C 5EPNA 5BN5A 4JBXA 1ELCA 3P8GA 3DA9B 1DLKB 1F5NA 3AVUA 2D4HA 1YLDA 1JWTA 3UPUA 3FKSD 4DT1B 1Z22A 2OSBA 3K2UA 1QA7A 3HYTA 4OQLA 3Q77A 4X2XA 4PC3A 1GBAA 2FLBH 4H9GA 2XITA 2P3TB 2BD3A 2GKVE 1G17A 1RTKA 4Q7LA 4LJAA 4D26A 4EDHA 2QI9C 4PO8A 2GT7A 2ZQ5A 1BQYA 2ZKSA 4A1VA 2OCVB 2WKPA 1ELOA 3SJ9A 2EI6A 3TK5A 1KK0A 3LBHA 2IUTA 3PWBA 2ZTSA 2GZDA 2P6NA 1Q3HA 4TYDA 5FPSA 4OQNA 3H2YA 3MO9A 1C5ZB 1IHTH 1FPMA 3OZXA 2GVDC 4P4SB 1UHBB 4V0LA 2BY5X 3NEYA 1K1LA 1ODFA 4PPNA 2IWRA 2TGTA 2A2ZA 3H86A 2HYIC 2UKDA 4P4TA 1UBEA 2VIDA 2H57A 4IGDA 2IHYA 4HDOB 1ZSKA 4MKHA 5CITA 4WMFA 5H4IB 1WOFA 1A5IA 1O2ZA 1UKZA 3IBGA 2OQ5A 2VTKA 4XTRA 3SBEA 4ERNA 4TN1A 5E2PA 3SI7A 2OLJA 2QXJA 1Q31A 3W8RA 1GHWH 4NONA 4UNNA 1TADA 4F4CA 4YOGA 2J9RA 3BV9B 2XJ9A 1HT1E 2J45A 1T8LA 1VCQA 1P03A 1FONA 2GXUA 2NO7A 1G3MA 1GKYA 1Z0AA 3BIFA 4TQ9A 2C9CA 3LGWA 3R0FA 1PPZA 4DT7B 2ZI6A 1GDDA 1T0JB 1DAIA 3PQCA 1E2FA 5JBBS 3M36A 4NWLA 4DLWA 2OBNA 2WPHS 4IN2A 2PKAB 4HUTA 2GDDA 2RCNA 4U32A 4OI1A 1ESBA 1GBEA 3HDTA 3CF6R 4AY2A 1HDTH 1JECA 2OXSA 1XXHB 5AWFC 2BOKA 2PTCE 1SC8U 4TYYA 1VYUA 3ZGXA 3VKWA 2FOCA 5E3HA 1O2JA 8KME2 4M8NE 4MUBA 2B8WA 2PEYA 2PWXA 3A88A 4D2IA 3SYLA 1FQ3A 3VTKA 1O3YA 3QXSA 3RXUA 3ZYCA 2B8TA 4OHWA 2F43A 1AQ7A 3QGJA 3A7VA 1TBZH 1TUIA 5G3ZA 3OFND 3DO6A 1P73A 2VEDA 4QGHA 2ZYUX 4U2WA 1RKBA 3UMSA 3EZ7A 3LPRA 4PX9A 2XC0A 3B1YA 2OHFA 2QA5A 3LXRA 121PA 1KXCA 2CJIA 3GMTA 1G3DA 4URVR 5UKDA 1CVWH 2ASUB 2HUPA 3H1TA 4FMCB 1ZJKA 4NE2A 4JYVH 2WICA 4BLTA 1GJ4H 1BRAA 1TAGA 3LD9A 1U8AA 5EXLA 4OHVA 2WKQA 1J70A 1XTQA 3Q85A 1M8PA 4U02A 3T5FH 3TNFA 2HNTC 1V2TT 2ZUBA 5JCPA 4OM9A 4YOJA 2BVSH 3ZYDA 2A5YB 1MH0A 4CREA 1E9AA 1RJ9A 1HAXB 1C9KA 1IJEA 1RXPA 1FZZA 3LW8A 1KNXA 3S9AA 1SVMA 2CGAA 3WBJA 2G52A 4E5UA 2PLXA 2IXGA 1ZW6A 4DIIH 1T4VH 2HF8A 1E9DA 4XTCS 2NGRA 3MI4A 3M3VA 1TEXA 4KSCA 1KAOA 1XTIA 1TMKA 4UXJA 3HK3B 2WSSA 4B48A 3SGAE 1YPMH 4X1SU 2EYQA 1N6YA 2DPXA 1TX4B 4MQAA 1OSNA 1CO7E 4X6MA 3EPHA 3OIYA 9LPRA 4DCSA 3CF2A 2ERYA 5AUQA 1E35B 2ZSAA 3OEHD 3TMKA 4FI3C 1G2MA 3K0FA 1OP2A 3TLXA 1BA8B 1QGFA 1ZVQA 2AMQA 1IXRC 4GZLA 4ON9A 1UCYE 4TZ6A 1DARA 4CBNA 1J99A 3I32A 5A2MH 3VEQB 1MO6A 4B75A 1P6XA 2PX0A 3RDZA 2G6BA 4LJ4A 2O8DB 4WXRA 1V2NT 3FP7E 2ZE6A 4WXIA 5C4GB 3X1XA 1AB9B 4EPTA 1OWIA 1P5ZB 2WWHA 1MTNB 1UTMA 1PV4A 3GOVB 1QRAA 1LPGB 4ZHAA 1SXJA 4FIDA 1MUEB 3KB1A 1ZHRA 2O8EB 1F2UB 2ZR0A 1D3PB 3TJVA 2OC0A 1XUIA 3VU9B 4HLDA 4BLSA 5E8EH 1BYIA 2GA8A 5FUWA 4P4UA 3ZVFA 5KSZA 1DUEA 3BSQA 3R9WA 3Q5EA 2X1VA 4UJ5A 2HGTH 2XB4A 1E0SA 5GIBA 4JJZA 1R6BX 1QURH 2F3TA 1S9HA 1KY9A 1G8GA 2YWGA 1DY9A 1S1MA 4LYHA 1ZUHA 4JSTA 2QBYA 3LLMA 3LBNA 2A2XH 5C5OA 1XTRA 5JBQA 1PPBH 1H8HA 5BQ5A 4TLCA 2WV5A 4PTLA 2PCLA 3WMEA 2ZTXA 1XD8A 1IXZA 3UANA 2LPRA 3UWKA 5B6LA 2V6NA 1XF9A 4I8HA 5BWMA 3KQHA 4I8LA 2YWEA 5AJYA 4TPYA 4JVLA 4ASUA 2GTBA 3NC1C 4DXAA 3LOXA 3IILA 2CVHA 2IK8A 1PVOA 5H1YA 3T26A 1GI2A 4EJSB 4LHZA 3KN2A 1E94E 1C2HA 1TONA 2WJIA 1NC6A 1Y59T 1II8B 2H7VA 5EUQB 1IOEA 1ZD1A 1OFUX 2OLKA 3EXAA 3PYHA 5JZVA 4WZBE 2HCBA 1Q21A 2QNRA 4KAXA 4X6OA 3I77A 4BLPA 1D5CA 3TKLA 1D3QB 2I6QA 2SGDE 2ZREA 3LWNA 1FN6A 2VJ1A 3PB1E 2AD1A 2YOFA 2ZYTX 1XUHA 1KKMA 4FUDA 3QNUA 4DY7B 5JWHA 2VRWA 1HAZB 3MTYA 2WOJA 3RLYH 4I1SA 5FL7A 3LH5A 4ASHA 3FYHA 4MUAA 1E34B 2DFTA 5IDKA 2PT5A 1TPZA 4MNXA 2BHRA 1GBTA 1KY2A 3MLEA 2H5CA 2FN4A 2IS6A 2ZUDA 1EPTC 1N6XA 1Q3TA 1EFCA 1RTFB 3U3JA 3FMPB 1BOQA 2A3RA 1MV5A 2CJWA 2ZSEA 3EC2A 1LS6A 1NI3A 2HV8A 1JXMA 1QL9A 1TX8A 4OGYA 3REGA 4Q7XA 4URYR 1QB1A 4BRWA 3PROA 3WBKA 1R0WA 3ZZ6A 4HB2A 3CS7A 2AMDA 1LVOA 4OHYA 2BD5A 3QZRA 1K28D 1Q20A 1QB9A 3A8DA 1TX6A 1OH8A 2BDYA 4CF7A 2P5SA 3CP7A 5AJXA 4LJ9A 1C2KA 4XH9B 4X1QU 1RIFA 2AL7A 2D26C 4HLUA 1UFQA 2B6HA 2JLWA 4TYNA 3AKDA 3BAFA 3M5OA 1OOKB 1UVSH 3QBTA 1C1NA 3STIA 3H7OA 1TNJA 1N6LA 1SZPA 4OHZA 3VAAA 1WAYB 4BE7B 3KQLA 4RJLA 2H9EH 1C4U2 5HCNA 2AH4X 4ESTE 4WY3A 4Q03A 5A8YA 8GCHF 3WNBA 1P09A 1RIWB 1S3GA 1WBDA 5KNCA 5HPYB 2C99A 1T32A 3RXHA 1GI3A 4CIDA 1E2HA 1O5FH 4Q7ZA 3O8CA 1TABE 3NBFA 1ZRHA 4AYWA 4KGAA 4HFPB 2BX3A 4Z0KA 4ISLA 1TU3A 2F3CE 5DPAA 3CZPA 5C1YA 4GCHG 1DVRA 1G4AE 4Y79A 1EK0A 3AVQA 1MKWH 1MKXK 4RD6A 1P8VC 1QHSA 4HTCH 2G00A 3AF2A 1MAXA 2W2XA 4FCVA 1COWA 1WMSA 2FPLA 4L5BA 1NESE 3MH4A 3MOCA 1P2VA 1KXFA 1CT2E 1K5GA 2GZ9A 1GBIA 3I72A 3MWLA 4TYWA 4H1UA 5EXNA 4KFUA 3Q3JB 1TQ4A 5FTMA 5T6FA 3EA5A 2JH5D 5L3SA 4AD8A 2AGEX 4TPIZ 1XPOA 2WZQA 5CHAC 1XEXB 5FOSA 2QT1A 1I4LD 1G291 4ZI2A 4BFVA 1NM6A 5AFZH 4KYIB 1W36C 1FPCH 5JHGB 5KPJA 3PO1C 3C4JA 1EQ9A 1OKXA 5LPRA 1TQ0B 3BB4A 2VP5A 5CDFA 2B8OH 2QAGA 4WXVA 4TMKA 2FMXA 1GBCA 1W36D 5CIQA 1ZPBA 3B7GA 1YP9A 1FPHH 1AS0A 3MUFA 1GWNA 5FR2A 1EP5A 3QBVA 1FMGA 2FX4A 2PGQB 2GCPA 4Q47A 5F03A 1C5PA 1NF3A 1XMSA 2P6UA 1YPGH 4Y10E 3VR1A 4JZ1A 2F9LA 2ZJ8A 5L3QA 3G82C 2Z9IA 4C0HA 2W83A 5E7IA 3AVPA 5HKKA 3ZVMA 1BB0B 3EARA 1YU9A 3CS0A 3UPEA 3M37A 5GCHG 2LKDA 2Q0HA 1MBQA 4QGAA 3K53A 1CHOG 4B2CA 1B0FA 4EPWA 1X8KA 1DAHA 3MAAC 3A8AA 2AKYA 1WQSA 4KFSA 1KYNA 1IHUA 1OWKA 2FTMA 3N70A 3G0HA 2CMKA 3EPJA 1IQFA 5FUYA 4BTIB 4Q1CA 1EZXC 4B2PA 1YKTA 5FFMA 4D4LA 1B23P 5BYKA 5KDOA 2OO7A 3BXZA 1N0VC 2ANCA 3B85A 1DG3A 2N46A 2WUCA 4Q4AB 3DM5A 1LTQA 1JPNA 1FY5A 1KAGA 4YONB 5JEDA 2CBZA 1OKKD 2H9HA 4OGXA 1NVXQ 1HA3A 3WMGA 1Z0JA 4LJYA 2CVFA 3L0PA 2VHUA 1P7CA 1SFIA 4IW4E 3HR7A 3CRRA 1QVRA 1Z08A 2F9UA 4F92B 1NN3A 4NYIQ 2Y81A 5AJWA 1OWJA 3PTBA 3SV2H 3SQWA 2RB4A 1D8TA 2XEXA 1TF7A 1I4TD 4PQFA 3U60B 1SVPA 4IFBA 3IQXA 4Q4HA 4DLSA 3AV0B 3ZV8A 2WPIS 1JR6A 4ZKSU 2IWHA 4XIGS 4Q4LA 2YJTD 2IC5A 2HNTE 3GY6A 2NU2E 3QDZB 2IS2A 1QY6A 1C5XB 3I62A 2GMTC 3RRMA 1V2OT 4QOSA 2F83A 1F5RA 1THPB 2IOTA 1BTHH 1ZMLA 3A1VA 2J4IA 1MH1A 3NH9A 1OPHB 3NVAA 3ZZ0A 3H09A 2F9BH 5IRCD 3B23B 4DCUA 2XNIA 521PA 3GJXC 1XX6A 1CJUC 2XNDA 2QXIA 1XB2A 4BEBA 4WOPA 1HJ9A 1YGCH 1NMYA 1CKEA 1OS8A 3RS2A 1QHRB 4HLCA 2P95A 2ZRLA 3KF2A 5C46F 1BTPA 4TLBA 2DWQA 3LA6A 4JLAA 4CHAC 2XTNA 4KFRA 2JIZD 4ESHA 4F4IA 1P10A 5PTPA 3TNTA 1P2NA 3AW0A 1AQUA 2JJ8A 3AH8A 2ZETA 4B3GA 2KAIA 3TK1A 2WYJA 1ZMXA 3B8HA 2R6CA 2DE9A 2C78A 2ORVA 1HAVA 2D7CA 2A4GA 5A0CA 2V1XA 3KNXA 2BDBA 3RXKA 1MKYA 2NTYC 2ZF0H 2G88A 1IQPA 1KTVA 3L8YA 3EIEA 1EAIA 2BMGB 1C5TA 5F8XA 3KJEA 3LO5A 4ARZA 5DP3A 1E79D 4TY7A 5L30H 4D9RA 4JYTA 1P3EA 5L6NH 4LCBA 2Q9CA 2UZIR 1YPJH 2VP4A 1HAGE 1GCTC 2PL3A 3VGCC 3QG5A 2I6SA 1MD8A 4IVRA 1S6HA 3AVYA 3FTQA 1GJBB 2GNOA 3PVSA 1P11E 1DELA 3PCRB 3M61U 3SV7A 1ZNXA 2GXAA 4EIWA 2GDJA 3TGJE 1EFUA 2A5GA 1G9IE 4Y0YE 3UXMA 3EA7A 1R8SA 2D62A 3BFKA 3EYDA 1C1UH 1E1RA 3D62A 3P70B 1F2TB 2SGEE 1S96A 1MBMA 3B1WA 2VSXA 2WV4A 1GBDA 2PTNA 1NVWQ 2F4LA 3TK6A 3R8CA 4UONA 2OV2A 3M1IA 3EZFA 1I4DD 1T6NA 2BLOA 1G3IA 3E2IA 1G7SA 2Q3MA 2QTVB 3AVWA 4C7OB 1J2JA 3FOZA 1C5WB 1E0KA 3S9CA 2FSFA 1Y3YA 2BVXH 1OIVA 1QQUA 1GJ9B 4LRWA 3RC6A 5FPYA 2ZE8A 1HV8A 3WNDA 3K0CC 1SLWB 1C1TA 1GVNB 1YVDA 1DE7H 1G3BA 1KLJH 1W8BH 4CR5A 1GMHG 2FA9A 3HU1A 4B3BA 2EFDB 2EFGA 3PO1B 1TUEA 3SHAH 2IJOB 1VG8A 1DSUA 2RKOA 4KKDA 721PA 4SGBE 3N7OA 1NVVQ 2FOLA 4A6PA 1OIWA 3SQXA 5CMXH 4HZUB 3T34A 2GILA 1IQLA 2V3OH 1OX1A 5A0FA 1IOZA 3RXMA 5JBCS 1Z71A 4FCWA 4D4KA 4MA4A 4LV6A 1GPZA 3D49H 1U8YA 1H1BA 2BY8X 4D4MA 1WTGH 2G4UA 3RYTC 4MGKR 2YV5A 3BTHE 5DN6A 1THSH 4BNRA 1QRWA 1M2OB 1B0UA 3C8UA 2H9TH 1GCDA 1NO9H 2FJUA 1LW7A 3BGWA 4G1UC 1TNGA 3C41J 3TNSA 5KNBA 2BDIA 1MMJN 1TF5A 4WZAE 4FUCA 1G5TA 1KOFA 5H68A 1DANH 4JLNA 2A5DA 2IYQA 1ZBDA 2TBSA 2XOKD 1SQTA 2WWYA 1VZQH 5DP7A 3QOFA 3MU0A 3KDSE 2JH6D 4LBWA 1SGFA 4OS5A 2A78A 1CT4E 1AGRA 2PMKA 1O5GH 2GD4B 2H5EA 4PAOA 4ISHH 2R62A 1O2GH 1Y5BT 3AVXA 1IY1A 1CA8B 3PMJA 2PEZA 2ZRFA 1T0HB 2BB4A 1GG6C 1NRSH 4US2R 3DEFA 3CF0A 1Y5AT 3QKTA 1BT7A 3SUGA 1BMMH 3QPVA 2ZE5A 2A5FA 4QNRA 1VG9B 5JJIA 1Z8IB 1BTXA 1DEKA 3T62A 2ZM5A 3EWAA 3KL4A 3UQOA 4CRCA 2X2EA 2V7QA 1ZYOA 5T6DA 4XVQA 2G8TA 2F9MA 4HI0E 1K1NA 3P17H 2QN6A 5CK5A 2DFLA 1E38B 4TTRA 3E1XB 1CBUA 2FSGA 1S2MA 4V0ME 5F8ZA 2SGQE 1GZSA 3THYB 3F1SB 4D7FA 2OE2A 4CW7A 5K8LA 4DDUA 3DDCA 2G1KA 4DDVA 1GG2A 5SZHB 4ZXYH 2ZU6A 3IG6B 3F9FA 4NPHA 3MMGA 3BTFE 4DGJA 5HXFA 4AYYB 2F55A 3ADCA 1M7HA 1FLEE 2PCJA 3UMFA 2AIQA 2ZU4A 3S69A 4MYUA 4CH8B 3AASA 4QJ5A 4B76A 1EWQA 3M5LA 4CEIA 4GNKA 5KOYA 4D7GA 4E07A 1ESAA 1O2NA 3UREA 4IEEA 1GL0E 1LKBA 4JYBA 3GY8A 2AWOA 1QBKC 1K9OE 3NH6A 4DVAU 1SBWA 3GY5A 4IHQA 1GBFA 4YDSA 4M9SA 4RZ3A 5ANRB 1G64A 2R6FA 3DKPA 4LYAA 4G5QA 1JRSA 3UIEA 3Q72A 1EATA 2O8UA 1IN8A 5F6MA 2RGEA 3ZZ7A 4CEJB 4M1YA 2BQWB 2FESH 2RGXA 1E2LA 4ISIH 4UXIA 1H8DH 4AFZA 4PC6A 3PTNA 2XAUA 1FX0B 1SHHB 2JJ2A 3WRXC 1TAWA 6LPRA 2GBLA 4ABEA 3DOEA 1EGAA 2WWGA 3KQCA 2AN9A 5FBQB 2C2HA 5B2ZA 1GCTB 1GJAB 2QQEA 2F9NA 5H70A 3RRZA 5HGGA 3MNBA 5I25A 3B13B 7LPRA 5JJKA 4MDFA 3MMPA 1S84A 4WWYA 4ABHA 1MRNA 1Y3UA 3SNBA 4DLRA 3UNSA 4XD7D 1FUJA 5GXPA 3ATKA 2PZGA 3SE0A 4H4FA 4KLNA 3RSLA 3ZS8A 4XVRA 4LV5B 1ZPCA 1SLXB 4MVNA 4C0AC 3OE7A 2ZR9A 2WJGA 3UIRA 4DT1A 2O0JA 1P2KA 4POAA 4EQ6B 5TB5A 4B43A 4ZCIA 1GI8B 2JATA 1E3MA 1HY3A 4X6PA 3ZZ4A 3D31A 1YPLH 2JDIA 1Y3VA 4NU0A 2O8FB 4LHXA 1O2OA 4XWAA 4PAMA 1SPJA 1HJAC 4JLOA 4K3JA 3K9HA 4KP0A 1SGQE 2KE5A 1PQ7A 5CM9C 1Q44A 1W1WA 4ABDA 1EWRA 4C0SA 2FOBA 2FODA 1QHYA 1ZCBA 3LNCA 3DT0H 2FOHA 1JXPA 2Y82A 5KUTA 1KDQA 1E2NA 1D3DB 5DI9A 4WJG2 2Y80A 4YC7A 4P4SA 3GJ8A 1JBKA 2ZFRH 4V0NA 1UHBA 1TIOA 4Q1DA 1V3XA 5JDUB 2GK7A 3LX8A 1JQJC 1KIGH 2ZRMA 4M1MA 4ZKOU 2UUFB 4BZQA 3TVTA 4TMTA 8ESTE 3U1IB 4ABAA 4GMDA 3W3ZB 1P2OA 2SGAA 4FUGA 2AERH 3SHFA 3B9FH 2HRVA 4R71A 4DWJA 1TQ7B 5BYJA 2R65A 3FZDA 1N6HA 2GJAA 2OCBA 1DVAH 1BMFD 4DSOA 4B71A 5TCAA 1VIAA 1OWDA 2WHXA 5A5GA 4MRSA 2PKAA 1RFLA 1XFAA 4NGAH 1U99A 4NH0A 2AD5A 2OAP1 4QHSA 1LVMA 4ABJA 4Q21A 1C9PA 2FEMA 2AGGX 1TQ2A 1XXHA 4ZDJA 2XBWA 2BM0A 1Z1IA 3GLGB 2ZI4A 1JR3A 5E7JA 4ZXXH 3SJZA 4HAZA 1SB1H 5CLLA 1GGDB 1A7JA 4HAXA 1N6KA 1AY6H 4JS0A 3I78A 3EG5A 1DT2A 4MRNA 1ACBE 1Z6JH 3ZZUA 4A82A 2D8WA 3SV9A 2GEUA 4TT3D 2OT3B 4NCNA 4M7GA 4KHZA 1DWBH 1NY22 1ETTH 4BTUB 5C67A 1ABJH 3D65E 4KTSA 2QPOA 3PV0A 2WPKS 4DIDA 4GCHF 3GISB 1KYIA 1XXDA 2D2FA 2RHMA 1XUKA 1QRXA 1KSHA 1UEIA 3QSYA 2FMJA 1P04A 3GD7A 3L0OA 1W0KA 1ANBA 1ZC3A 4L4UA 3UUZA 1BRUP 2W6IA 3BH0A 4BFUA 4LXBH 1FTSA 1A82A 4Q18A 3ZQ6A 4G5SA 4U7DA 1SLVB 3OAAD 1EP6A 3DKVA 2QRNA 2VQSA 3AAUA 1EAXA 1K2I1 4GP6A 2Q3FA 1G6HA 4YXWA 4LSGA 4PROA 2JKHA 5A8XA 5JBTA 2GJ9A 1KJYA 3JZ1B 5E0HA 4BAOB 3ZZTA 4EPVA 5CJPA 1RYHA 5F8TA 2YHSA 1NY6A 1BTZA 1GP2A 2FPMA 1Q1EA 3RU4D 2VBCA 2ZTZA 1OYQA 2QYIA 2ZPSA 3DFJA 3JZAA 1EKBB 1HLTH 3QEOA 2FIRH 2A5IA 3RANA 2Z6BD 3NCLA 4JYUH 3P26A 3CR7A 1EOJA 3BFXA 5LDDC 1D2MA 5EQQA 5CYOA 4A2PA 2QXHA 3TQFA 5HZKA 2HALA 5EQSA 1RRPA 1BDAA 2RA3A 1ZAKA 3ZZBA 2Z94A 5IK2A 4OI2A 2XCNA 3SU1A 4PQRA 2IX3A 1JOUB 1E2IA 3LRPA 5GCHF 4LPKA 1O2HA 1C1WH 1CHOF 1T8OA 3EQ0H 1UK2A 3HGPA 1YCPM 3VR5A 1UK4A 2O8DA 1Z8JB 1W7AA 2IN2A 2EEKA 1GJ5H 1NFYA 3G5UA 1FY3A 3W9YA 5HYOA 4X0WU 2GEDA 1IQHA 1XCGB 1OLOA 4BFZA 3CPEA 1GHVH 1RRKA 4C0LA 7GCHF 1ZUNB 2AR7A 2PT7A 5FOTA 2O8EA 3SZEA 3KQEA 1F2UA 1M34E 3T12A 1MKXH 3VU9A 2CNWD 1T3HA 2FZZA 1AWHB 3B9PA 4IOJA 4WH8A 1P2TA 4M1SA 2F9PA 3GDSA 1O3KA 4I1UA 1DX5M 4JMPA 2TGDA 2WBLC 4DB2A 5JJLA 3RMMH 2JLUA 3TITA 3ZVEA 4A6LA 1IAQA 4AB9A 3AGPA 4X6NA 2WAXA 3RS0A 4O03A 1FQJA 1ZPZA 1KDRA 4BFSA 4QJ4A 1ELEE 3I92A 1C1QA 1ETRH 4NIYA 1MO3A 1YR7A 2WWXA 1Z0IA 3OU0A 1YPEH 1SQAA 3LQQA 3PXGA 1II9A 3ODDA 1E99A 4HGCA 1TQDA 2GEVA 1ETSH 3MNCA 5J40A 4U5XA 2AS9A 2UZ3A 3Q7PA 4MTBA 1RC8A 2F9VA 4EJSA 2Q3HA 2JJ1D 1KK2A 2CHGA 2JLVA 1SOZA 1TF2A 2XJ4A 2QGRA 9ESTA 2ZVQX 3ICQB 5E0GA 3RC8A 2YNAA 2QV1A 1QBNA 1W2GA 2GX4A 5A4JA 2WV9A 3AP2A 1Y8TA 4L9WA 2BD7A 1EG7A 3RU4T 5FPTA 1U0LA 3RXOA 5FTJA 1KO8A 2FNAA 1TYNA 3T35A 4BANB 5JPMH 3B2EA 2Z3DA 1SVWA 4IBLH 2IA5A 4PXAA 4PSKA 1W2KH 3BG4B 2FZ4A 3HU3A 1VCNA 3ECCA 4IMQA 4DG4A 1X1RA 2PJRA 1ZIOA 5DP5A 2ZGXH 1QHGA 1Z3IX 4G01B 4JL6A 4KSBA 1LTOA 4IOKA 3TUJC 4FXPA 5B30A 3AVOA 2Q6FA 2A9KA 3T06B 3K1JA 3OSYA 4AOQA 3PUVA 3A8BA 2IYYA 3K65B 5DHAA 3A84A 3SU0A 2WTUA 2A5AA 3CB4A 4JIMA 1R5BA 3SHCH 2V35A 2VSFA 3HJNA 1UKEA 3BTWE 2ZS8A 3E0PB 1AFQC 4GHTA 1OFTA 1KLTA 2R2MB 4LHYA 1FAXA 3R8FA 5FX6A 4GPTA 4Q9JA 3SFZA 1L4UA 1Z6XA 1ZSJA 3LU9B 4HDCA 2R2WU 4F38A 3NZIA 2H6MA 3CNOA 1E37B 1W0JD 4DUGD 2ZQ1A 3M7UA 1H9LB 3EA8A 4Q2KA 1AUTC 1ZRKA 3DPUA 1BO6A 2J95A 3CZQA 4RFSB 1Z0KA 4CRDA 1NFWA 2GVZC 2ZFQH 2ZANA 4X8UH 1GVLA 2ANBA 1DG1G 2BZAA 4US0R 3HU2A 5FCRA 5C4MA 4ZV4A 4WBSA 1F0TA 4IOMA 1VG0B 1SKYB 4C2TA 1I2DA 1TOMH 5T6GA 2OESA 4DLYA 3HK6B 4FUHA 1G6OA 3U8OH 3WYFA 1O2QA 1C5SA 4U00A 5B64A 4KFTA 4B44A 4DCNA 3C5HA 2GAOA 4DLZA 5JWRA 2AEIH 2IUUA 1DS6A 2Q9BA 1GMHF 1O36A 1P9RA 2ZHWH 2OCPA 4X8TH 4G3XA 1T3LA 3O8BA 3OEHA 4GI7A 2FOAA 3GLFB 5SGAE 3EC1A 1DFPA 3F0TA 2VF7A 1XKAC 3RVBA 1GL6A 4K8OA 2B9LA 5FCKA 3LGTA 4PHTA 2F91A 5LPNA 1X6VA 2IYTA 5B6OA 4K8BA 2NPFA 1DXPA 4UNPA 4JLKA 2O9QA 3CH4B 3TJOA 2E1RA 4IFEA 4QNMA 2BEKA 1WQ1R 1ZNYA 1PLJA 1KY3A 1E9FA 4GSYA 1QFKH 1LHDH 3FFGA 2G3YA 2VIPA 2NZ8A 1JIMA 4XE4A 1CLUA 1S0UA 1H9IE 1D3TB 1RS0A 5FTLA 1UPTA 1TNLA 2XBXA 4C3ZA 1ELDE 1U0JA 1W4RA 3TH5A 1XEXA 1EXMA 2ZHFH 1DDJA 5J4HA 1AKSB 5FBWB 3F68H 2E87A 1TALA 1ZC4A 4K46A 3NHAA 3QTVH 5KSYA 1EB2A 1E0FD 1NU7B 1O3NA 2VHJA 3E0NB 3C1KA 3KX2A 5F9FA 5J47A 1YYY1 1KK1A 1UBFA 2BD2A 3GLHB 1YLCA 1CBWC 2BMJA 4D25A 1E2DA 1G3EA 3ZVRA 3D8BA 3UATA 2FSIA 4TMWA 5LPEA 1LY1A 4HUQB 4DSUA 1R10A 3RC5A 5DSZA 2ZQ2A 2RGBA 4NSVA 1XZQA 2SHKA 1CGIE 3LGIA 1QG2A 1O3PB 3SJIA 5SZIA 2P16A 1AS2A 4PO1A 4JYCA 5AVDA 3SBDA 1BJVA 3P8NA 2VF8A 1XKBC 3S7KB 1JJVA 3H7TA 2D2EA 2JLQA 4IS5A 2WMOB 1HUQA 2BLVA 1ZMJA 1EB1H 3I61A 3P32A 1MZDA 3HKJB 4JZEH 5TVKA 2C8ZB 2O8BB 2KI5A 2RAPA 3SNDA 3EPLA 5EXXA 4A92A 2DFNA 4M1TA 4Y0VA 4WVFA 2QF3A 4Q7KA 4Q4AA 5C1XA 3IDQA 3EASA 5GADl 4JLVA 1P12E 4IMZA 2HWLB 1BIOA 3P8FA 1NRQH 3MWKA 1AVXA 3GFOA 3U7GA 1SI5H 1GBBA 3TW8B 1K1PA 1SGFG 3T15A 4X1NU 2Q6GA 4IDQA 2J7KA 1YBWA 2GZAA 2C8VA 1H65A 5FTNA 4KTCA 1OFIA 1A1RA 2OG2A 1V2WT 2FZLA 3ZVLA 1SXJC 3EIHA 2FDCA 3DM9B 2ORIA 1M6NA 1YC0A 1F60A 2UUKB 4RSPA 2O8LA 2QMOA 5E0JA 1SXJD 4DCVA 1GDNA 1LO6A 2YWHA 1NFXA 2W0SA 5FOUA 4XWKA 2B0FA 1ZGIA 4IN1A 2G1JA 4I7YH 3PR1A 3VKHA 1O0DH 3C16C 1S4QA 3M5NA 1XMNB 2GK6A 3P4YA 2W3KA 3NUMA 4X8HA 3T29A 1AFQB 1LQEA 1JIRA 2NWNA 4NIWA 1UCYK 5GWZA 4UJ3A 5DH9A 5T1VA 3ADDA 5G40A 4Z51A 1FFHA 1KSFX 3IIJA 4MPXA 1DWEH 2CDNA 2R9VA 4IC6A 1JALA 4Z1MA 6Q21A 3IQWA 3MWJA 4INLA 1XDBA 1U8ZA 3ZVAA 2V1UA 1BRCE 1W4AA 5IHPA 3NDPA 2G83A 1DLEA 3VNVA 4NMMA 1NMZA 2MSEB 2XNSA 1FTNA 2V6JA 3QJYA 1Q1ZA 2VA8A 1A3EH 1P9WA 2NPIA 1XRJA 1ZM7A 4CRBA 2Q21A 4ASUD 1IQKA 2IUSA 4CZ2A 3NBXX 1GNRA 2UVQA 3CX8A 3U3OA 2YOGA 4QBHA 2QL6A 1NL3A 1TRMA 2VO1A 1A46H 5AJZA 2XGJA 1EXFA 4IVPA 3VB4A 4KBFA 1JAIA 2BJWA 2VHCA 2QGZA 4BWYA 2R0LA 1A3BH 1TOCB 1TGBA 1Z1JA 1O38A 5KDLA 2OD3B 4ZKRU 5J5CA 4Q7MB 2IJD1 1GITA 2F3RA 4A2QA 5FL7D 1VITF 4QGFA 2P93A 3U98H 4B73A 2VP0A 2ALPA 2EA3A 2VVUA 3ZD6A 1O2LA 4B3DA 1V6DA 2VH6A 1EX7A 4NYMQ 2F43B 1O39A 2PSXA 3V12A 3NEJA 5EW1H 3PG5A
chains in the Genus database with same CATH superfamily
4EH1A 1RVV1 3IQFA 1LVGA 5A06A 2P2GA 1O3BA 3RS9A 5LKAA 4Y2SA 2BE7A 2RKWA 2C1EA 1HYHA 1OMOA 3FHCB 2QN7A 5DMHA 1NSFA 1ZKMA 5E38A 3IIIA 3TLYA 4FMDF 2C5FA 4CF6A 1SOUA 3VMFA 3AI3A 3VKUA 1YAJA 4M7WA 2X3YA 1J0AA 3KYDA 3PT9A 1E8NA 1Z4MA 3ER8A 1AHTH 1P2IA 1DBWA 1Q84A 1DOZA 3TWOA 1XU9A 1WCZA 3DONA 4R0MA 1BTUA 4YREA 3HUDA 1FFXA 1C1PA 1Z17A 1IBKB 2WFLA 4C5AA 1ANCA 3TOXA 1W0YH 2CXRA 3E9RA 1KARA 3KKPA 4ZDWA 4WASA 3LZ6A 1S4MA 4NV1A 1C7IA 3M5MA 5E4FA 3RIHA 1Z07A 3UW3A 4MW2A 1XL1A 4PU0A 4H4DA 3T1VA 4ZU6X 3S3TA 1GN8A 1L4LA 1AN0A 4MVJM 3BF8A 4I50B 3SX2A 4I1PA 2I2WA 5BOVA 1M1NA 2NSLA 4YT7H 4FILA 2ZCJA 4W1PA 3BCSA 1C5MD 3SVTA 1ADCA 4FCCA 4MEBA 1M72A 3CEPB 3II6X 3PUZA 4C2UA 2FV8A 1B74A 1H8IH 4EI7A 3HDYA 1SHKA 4BAGA 1DEOA 5HGXA 4C3VA 5DCLA 3NAMA 2A30A 1CB7A 1RWWA 4D9QA 1MG5A 2X2OA 3TCXB 3PC6A 3QYJA 2AGIX 4QUGA 3AU8A 1SXJB 5TMPA 4DQUA 1L7BA 1A4RA 3C3JA 3LY8A 2FPZA 4M53A 4ENTA 4HO1X 3CCBA 2VI5A 1RHRA 1OH7A 1UK9A 1UPBA 3A11A 4GMKA 1AZZA 5DCWA 1IN4A 1OQAA 3LUKA 2YW2A 4RMIA 1PYTC 3PMBB 4Q80A 2ZJZA 4PZYA 4MDHA 1VLHA 5A0BA 3C4VA 2AJLI 4RS4A 1WHTA 3RSZA 1N2OA 1KI6B 1O5OA 1YY3A 1H93A 4UZEA 3FFBA 4HDSA 1QOQB 1E5XA 4O0MA 4DIBA 3I8SA 3ZDCA 5BW5A 3G7NA 4BGUA 4LQLA 3B89A 3SJCA 3A28A 4AG2A 2ZI5A 4E1VA 3FWHA 3VR2A 4YESB 1JHAA 1CT9A 3JVVA 2J87A 1WXHA 1SGRE 3TFOA 2RARA 1XD2B 2ZB2A 1Z7EA 1GPWB 3MJEA 1DZ3A 2R751 4COKA 4CDNA 4PZCA 2A0YA 4QXMA 3ROPA 1AGJA 4Y9TA 4LYDA 3WTBA 1BHXF 2HO5A 1O3EA 3EAGA 3AJRA 2FEWB 3BMNA 1QQBA 4G5YA 4MPWA 4D9GA 2PLFA 4C4PA 4DYDA 1V4VA 2P9ZA 1OV6A 2VJMA 3ZTWA 3EA4A 4OHOA 2Q7XA 4NCJA 1OAKA 1Y1TA 1HAIH 4O4HF 3ZVKA 4WCVA 1H9CA 1N2CB 1GSOA 1WRBA 2ZB8A 2AJCA 1P4HA 3WC4A 5B1YA 1RQPA 3AEZA 3HPTB 4RZSA 3OVMA 4BWVA 3STJA 2CJWB 3KQSA 1O3CA 3DD5A 1Y5MA 3C70A 1XGKA 4F9FA 5E2OA 4P22A 4PLZA 2DQSA 3ZZNA 5JYEA 4QJ3A 3R7WB 2QAJA 4C3UA 2GA9A 2Z1DA 4JCNA 2CKMA 1JVNA 3E16B 3ICOA 4PGMA 4UTXA 4HS9A 1U63A 4JSRA 4BNUA 2P8OB 3T5AA 1H94A 5AKLA 3L02A 1CGJE 1QGZA 5ALLA 4DNPA 4ABIA 4C9BA 3SORA 1NZQH 2B7BA 2B36A 4BVKA 5KMGB 4OBWA 1C1DB 2O8FA 3PC8A 2E89A 1ZNWA 3KJQA 2REBA 1USIA 2XNDD 1O2RA 3E82A 1O2KA 2CL6X 1VLMA 4F3TA 4D3XA 1C2YA 1DSTA 2P30A 4JY7A 4PLTA 4FFBA 9LDTA 1XO1A 5BXYA 3ND5A 1QX4A 3RKUA 2EZTA 1ZTKA 3FP6E 3SCZA 3B48A 3DVQX 4Y3UA 1Z2NX