4B8AA

Structure of yeast not1 mif4g domain co-crystallized with caf1
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
232
structure length
232
Chain Sequence
QEMIPLKFFAVDEVSCQINQEGAPKDVVEKVLFVLNNVTLANLNNKVDELKKSLTPNYFSWFSTYLVTQRAKTEPNYHDLYSKVIVAMGSGLLHQFMVNVTLRQLFVLLSTKDEQAIDKKHLKNLASWLGCITLALNKPIKHKNIAFREMLIEAYKENRLEIVVPFVTKILQRASESKIFKPPNPWTVGILKLLIELNEKANWKLSLTFEVEVLLKSFNLTTKSLKPSNFIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GENERAL NEGATIVE REGULATOR OF TRANSCRIPTION SUBUNIT 1
publication title Architecture of the Nuclease Module of the Yeast Ccr4-not Complex: The not1-Caf1-Ccr4 Interaction.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Transcription/hydrolase
total genus 86
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2012-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16415 CNOT1_CAF1_bind CCR4-NOT transcription complex subunit 1 CAF1-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4b8aA00
4CRWA 4IULA 4JHJA 2VSXE 4GMJA 2FULA 4B89A 3RK6A 4C9BB 1PAQA 1H2UA 2KZTA 2I2OA 1HU3A 2RG8A 1N54A 3EIQC 4JHKA 4B8AA 2NSZA 3L6AA 2ZU6B 4B8CB 1H2TC 2HM8A 1UW4B 4GMLA 4CEMA 2IOSA 3JUIA 2IU1A 2VSOE 3FEXA 4LUNU 2GGFA 1H2VC 1UG3A 3EIJA 3FEYA 3D3MA 4CT4A 1H6KA 5ANRA 2IOLA 2IONA 1N52A 2KZTB
chains in the Genus database with same CATH superfamily
1E8XA 3CIAA 3DSVA 4O1PA 3KS2A 4HORA 4L7TA 3TAXA 2WQ6A 4NIKA 4F1SA 3G2TA 5AARA 1NI1A 4FADA 3OAWA 3UIPC 2DZNA 2Y3AA 3MZLB 1IQRA 3B7SA 3JQ1A 4HQDA 4R7LA 3HXBA 4Z68A 2AVPA 4GA0A 1K1BA 4WNEA 3ASHA 3MV3B 3U66A 5G04J 3FTZA 3TWTA 1MJ0A 4NQ0A 2F37A 4GZCA 3T5VA 2DZOA 3SF4A 2DWZA 2VJ8A 3V2XA 4QFVA 4LCTA 3IV0A 2LUHA 4GZDA 5IY5E 4UI9J 4AY5A 5DBKA 4K5AB 3N71A 3PE3A 4ANVA 3X2QE 3L08A 4KVMA 2XRZA 3PE4A 4WWNA 5JJ7A 3Q4AB 2LSVA 4UQZA 3C3RA 3C3QA 2RFAA 1A5EA 2WVIA 5B1BE 4DX2A 5KNHD 1KZPA 1DCQA 2CHZA 5EX3A 3UI2A 3RRMB 3CEQA 4GB9A 5LCWJ 5AENA 3LVQE 1HG5A 1UN9A 1ZU2A 2A5UA 4BX8A 2XGMA 4XI0A 1TNYA 2ZXWE 2PM7A 2KCKA 5D0QD 4EBAA 4MKTA 2XS8A 3E4BA 4HNAD 4GTOA 3ASGA 5FIOA 1JUQA 4FC8A 1OWOA 1U3DA 5KJMA 2CFZA 4DI4A 1S70B 3EUVA 3KAEA 4K0RA 4F6RD 2C2LA 3IXEA 1DNPA 4MLPA 5AYWD 3FUHA 2WXFA 4E6HA 2GRLA 3FUEA 2VGEA 4UUCA 4OAVB 3CHMA 2E2EA 3FU5A 2ZU6B 3GW4A 3JUEA 4I2WA 2GW1A 3AG3E 4IULA 1BLXB 5JHBA 4X8QA 3IEGA 1B89A 1WG0A 5FZQA 5BXOA 4PS8A 4J6IA 4GA2A 3CHOA 2EINE 4CGVA 2X6HA 5C1DA 3SFZA 2I1JA 3DSUA 3MGBA 3FUMA 2KCVA 1IXVA 5J08A 2ILRA 3FH8A 2VGXA 4GTTA 4XIFA 4CT4A 1UN8A 1O1SA 3DSTA 3ONLA 3DSSA 2WXRA 4K03A 5FQ4A 3D9MA 3I4GA 2DYRE 1KT0A 3IKOB 2Y69E 3S7BA 2VGYA 3AS5A 2XZDG 1W3BA 2J08A 2F0YA 4GCOA 5JJ6A 2XS1A 2XEEA 3APDA 4KMOA 1O1TA 3Q7FA 3TJPA 3ZNGA 2WXIA 5D0OD 3CHRA 2FO7A 2BF0X 3HVEB 5BV1A 1WDYA 1PAQA 3JXIA 2J8SD 2FBNA 1KPSB 1U3CA 2J4BA 1E7VA 5B1AE 1K8KG 4CYMD 2BUGA 5CRVA 3UM3A 3CK8A 5CRUA 4EECA 4HB5A 4FJYA 4U8YD 3TG5A 4JHKA 4JL0A 4AV7A 1SVXA 4AM9A 2R17C 4GZ3A 1N94A 4GMLA 4PS7A 3EHRA 3UKRG 1OCOE 2HYZA 1SA5A 4HBDA 5KWDA 4GTMA 1PY1A 4ILIA 4BWRA 1D9SA 3LJNA 2XPZA 1OCRE 3L6AA 4BSZB 3AU5A 3MYVA 3OXGA 3UM2A 4EZLA 2P9KG 1H2UA 3HRAA 3SBTB 3Q78A 4AIFA 3OXFA 1SA4A 4ZFHA 1K3ZD 1H19A 1BI8B 4DK5A 3HXDA 1SZ9A 2WXPA 2WMNA 5EIBE 1EYHA 5FT9A 5AN8A 3FUNA 4I6JA 4HFGA 4JZYA 5BUZA 4ANXA 4JVSA 3WG7E 4AJWA 3O4ZA 2J4DA 2M63A 3I3NA 3HXFA 4L23A 1OWLA 5LX8A 2IOSA 3PVLA 4BT9A 2XPIA 1DVPA 3ZYQA 2IQCA 2B6CA 3CK9A 1QQEA 1HU3A 2EIKE 3EIQC 4HOUA 2J49A 3QK0A 3Q7AA 3T9KA 2X6JA 1ZBPA 3SGHA 4DRXE 3J5QB 4EZJA 3F6QA 2CG2A 1E96B 3ZKJA 2LXMA 4W9RA 4HRLA 1XNFA 3BG0B 5HRYA 4ACKA 2YINA 5AQBA 4K5CA 4WWPA 2YHEA 1TNOA 3ESKA 3DBSA 3KD7A 5G2NA 5T4YA 1TJCA 3G2VA 3MCXA 4U07A 3FEXA 1UG3A 3MV2B 5ANRA 3CVNA 3PZ1A 1FVFA 4HOQA 5AAOA 4ANWA 3ASDA 5H7PA 4HRNA 3S7DA 3R9MA 3LDZA 2PM6A 3BUAA 2X38A 2J07A 3UT4A 4G2VA 4XX5A 2V5QC 4CZ2D 3T8MA 3ISMC 4JC8A 2H6IA 2IOLA 3LY9A 3B13A 2OVFA 2AXZA 1HFAA 2XEVA 2VSXE 4PS3A 4B89A 3ZHEB 2WXNA 3FHEA 2HR2A 4EZKA 3ZGQA 3QWWA 3GZSA 4GYYA 4BESA 1UOHA 1XGWA 4I43A 4TXPA 4WNDA 4TV3A 3ZW3A 2MHKA 2WXHA 4WNFA 4L2YA 2YNQA 3UQ3A 2GRMA 1V54E 4FA6A 2KZTA 3EHMA 3QKYA 2AXVA 1N0RA 4WUYA 3ZRHA 5ENTD 4IYPA 3T5XA 3E33A 2MOWA 5CMWA 5CECB 2IFUA 3AS8A 1H2VC 3FDHA 4J8YA 1H6KA 3PNTB 1UJJA 4U0SA 3LPZA 3CHQA 3DPYA 3GZ1A 1A17A 1RZ4A 1S64A 5G05C 3ZPJA 2FI7A 3B95A 4A63B 4ACLA 3BQOA 3NBNB 4TUMA 3C98A 3TWXA 4FHJA 4U04A 3FTXA 2CG3A 4BSXA 2IF4A 4P29A 2Q7FA 4V3IA 3PDNA 4AP2A 4HS2A 5CMYA 5ENPD 2RD0A 2IEJA 3AAAC 5FINA 1S63A 5E75A 4WWOA 3VTYA 4HXIA 4B93B 5FJYA 2KM4A 2V0PA 1L5JA 4G23A 3RSEG 2I6HA 3RO3A 1MQSA 2J9QA 3DPDA 4J8SA 3FH5A 4DX6D 5KJLA 3CVLA 3B7RL 3PZ4A 2P9UG 3ABLE 1K1AA 4FU3A 3PZ2A 3CLJA 3DXKG 3QOUA 1H6OA 4A1SA 3LYAA 2VYIA 3RIBA 4GPMA 4FLBA 2WXOA 4PH4B 1BD8A 3HHMA 3Q5MA 2JLBA 4G1TA 3G2WA 3S2AA 4OVVA 1HF8A 2UY1A 2IU1A 4N3AA 2ZIRA 3BG1B 3ZXPA 4HI8A 4GTRA 4LSZE 4ILGA 3FFLA 3ABME 5ENSD 3QC1A 4XI9A 3MKRA 2XEHA 4BT8A 3ZXSA 4J7WA 3RRNB 4GTSA 2KXPC 4A1GA 1N4RA 4O60A 1FT2A 3D9PA 4LNBA 3UX4A 4ANUA 2RG8A 3PUKA 4CDMA 4RVBA 2VGXB 2B0OE 2MRIA 3VLDA 3FUKA 4N3CA 5CEDB 4N39A 3AJIA 2GROB 4CRWA 3HXCA 3R9AB 3CQCB 5G04C 3TWUA 4UWFA 4TXRA 3RJVA 4WNGA 5T8IA 3UPVA 3LVRE 1MX2A 3DEOA 1N11A 5ENRD 3QWVA 3IHVA 3DSWA 4LRZA 1YYHA 2X3MA 5CERB 4UI9C 4EHMA 4BEPA 3E30A 2HE0A 2P9SG 2V4LA 2WXJA 5CCMA 5AJDA 3UT8A 2XGSA 3AU4A 5JHAA 2VSOE 4C0MA 2VTBA 2DCPA 2XZTG 2GRRB 4RSYA 4I9EA 2Y1LE 4YDYA 4N5QA 2YHCA 4RG6A 4L1BA 2E0IA 4U95D 1KZOA 5LCWC 1N0QA 3CVWA 2L0TB 3Q73A 2DIWA 3AG1E 4F1PA 3B7UX 3HG0D 4DX5D 4B94A 3RAUA 4F53A 3Q79A 4QQIA 2XCBA 4M3OA 3NZSA 3C72A 3CVVA 2R03A 4BFRA 3SD5A 2VSNA 1LTXA 3L16A 4XE0A 3AG4E 3FTWA 5LOZA 4I9CA 3ULYA 4WAFA 2ZGGA 4RG9A 4G24A 3D9OA 1AP7A 3W9GA 4ZHBA 3EHNA 3JQ0A 2HM8A 1QNFA 4KT6B 4JA9A 4PDXA 4UI9K 4BERA 3APFA 4JHJA 1QBQA 4I1AA 5FQ6A 3SBSA 2BEDA 2WXMA 3CSTA 1INZA 3BU8A 3UMVA 4Y6CA 5HS0A 3D9HA 1O1RA 3FTUA 4NRHB 2EILE 3QARA 4LNUD 5AQAA 2WM9A 2XPYA 3G2SA 2QZAA 4U7EB 3HYMB 4GYWA 5D2MC 1U2VG 2H6FA 4AXHA 4Q94A 4APOA 5CHEE 3S7FA 1WM5A 1G3NB 3SZ7A 4MBGA 3DWLG 3E32A 3I5PA 4XEIG 5FZRA 3CKBA 5BW8C 3BEEA 4KYOB 4C0EA 3ZFWA 3QNKA 4J0UA 3C5RA 2PL2A 2QYJA 1QZ2A 3HDXA 4FP7A 4ATZD 1NA3A 4LG6A 2RKKA 4CGWA 2XENA 4E85A 4CCAA 4YDEA 4B8AA 1MX6A 1FVHA 3CSFA 2XHEA 4MRUA 1ELKA 1OCZE 2R02A 3AG2E 4HOTA 4GYOA 5JJTA 5ANLA 2P2CP 4KBQA 1E90A 2F8YA 1FT1A 3G2UA 1YMPA 3HIZA 1AWCB 2QY7A 4GU5A 3E34A 4ATGA 4D10C 1X5BA 3HVEA 3MKQA 1TN7A 3ONKA 4BTBA 3B7BA 3LCAA 3R7RA 4HI9A 3TXMA 2WPVA 4A3VA 4HRMB 3C3OA 2OOEA 4GMJA 3CVPA 3QJZA 2LO6A 2OV8A 3CHSA 3UUXA 3V79K 4U0ZA 1MHQA 2KCLA 1Z3XA 3ZIMA 1OWNA 3KEZA 5EDSA 2FF4A 2EQXA 5CBOA 3P1UA 4GPKA 1GW6A 2LNIA 3UIOC 4GTVA 4KXKB 1QYMA 3ENEA 4CT0A 1S0PA 4AVXA 2HO1A 5AQ7A 4H7XA 3IBEA 2GRPB 4GTPA 3FTSA 4U8HA 2KATA 3D3MA 4APFA 3NOCD 2FEZA 2C0MA 2H6HA 2KZTB 2FO1E 1X81A 1NZNA 5ARGA 5BT1A 3OTNA 2ETAA 1JWFA 3ML8A 1SZAA 2WXGA 3U3WA 3DSXA 1HH8A 4XKBA 4GTQA 3PUJA 5BV0A 1TR4A 2IONA 1EF1C 5FTPA 2RFMA 3CVXA 2FULA 2XQ0A 4I6GA 3V2OA 3JCKC 3FUJA 3CHPA 1N54A 5ENOD 5B3SE 3NOGD 4GMRA 1H6PA 2IJGX 3B7TA 3ASNE 4UWGA 4I1MA 4L2LA 1Q2ZA 2GRNB 2H6GA 3R7QA 3RRUA 2WXQA 1DCEA 1NP7A 1YCSB 3EDTB 3TGOA 5ENNA 4C48B 1NA0A 3MX3A 4B8CB 1IHGA 1WAO1 4N2QA 5KJNA 4I17A 3TWRA 5G55A 1Z6TA 3SO8A 3L13A 4KZCA 5KCMA 5A6CA 3ASFA 3Q15A 3TWVA 1MYOA 4GCNA 2GRQB 4N3BA 1TNBA 1MZCA 3LY8A 4DX1A 1N4SA 5T3RA 1DC2A 3FULA 3AS4A 4RQIA 3RU0A 4A3TA 2ZISA 1HX8A 2NYJA 3CKCA 3MEKA 2WMOA 5EILA 4A55A 3FTYA 4B0ZA 3FUDA 4TRQA 4XKCA 4YNDA 2WXKA 4DI3A 3NF1A 3KSQA 4FLHA 2A5EA 5KBAA 3UKUG 1HO8A 3PZDA 4L9PA 3L17A 3PRZA 5DIZA 4JB8P 3W9FA 2Y0BG 3I4RB 3FY4A 3LEWA 4F7AA 2KBXA 3CV0A 1KT1A 3HXEA 4DJAA 3FUIA 3UTMA 2R2LA 4NACA 2WXLA 3ZHEA 3LJ3A 1SQMA 4LERA 4LUNU 3U4TA 5A23A 1H0AA 1TEZA 2YQ8A 5FZSA 3ZYKA 4XZ4A 2CFUA 3D9KA 2WQHA 3CQGB 3UXGA 2I2OA 4EQFA 1RW2A 3ULQA 4G26A 5LP0A 4OAUC 1MX4A 3FWVA 2X6IA 5JA4D 3SFYA 2NC9A 3GYZA 1FPPA 4URKA 3P2BA 3PREA 2P9LG 2P9PG 4HLLA 2IO3C 3LY7A 1EPUA 5AQ9A 5HQ8A 3VTXA 5BNWA 4BETA 3Q49B 4J8EA 2X6FA 1ELWA 4DLOA 2VTBB 4JD2G 1JCRA 4GZ6A 2P58C 3NAWA 2F8XK 3D9LA 5E76A 3ULEG 4UWLA 4GAAA 3SNXA 1Y8MA 4TXQA 2C0LA 2JEKA 3FH7A 3LKUA 3L54A 2XRYA 3SQVA 5FWQA 2BKGA 4AY6A 1HZ4A 3T8KA 3V30A 3J5PA 2ETBA 4LEUA 4GA1A 1TYQG 5FQ7A 3CR3A 2QFCA 4G25A 2R05A 1LD8A 4DX7D 3TWQA 3Q9UC 1LD7A 3NZUA 3UM1A 3TWWA 3KSLA 4U96D 4JHRA 4JW1A 4PUCA 4DPRA 2ONDA 2LSUA 3O48A 3OXLA 4Q69A 2BTDA 3V31A 2I1KA 2LAHA 1SW6A 3SHFA 3CVYA 4HOSA 1N4QA 4ME2A 1HS6A 2P9IG 5EKQD 3ZN3A 3JYSA 1OY3D 1BPOA 1HXIA 1Z3YA 3L9TA 3PEUB 4JEUA 2L6JA 1N95A 1JCQA 2BKKB 3D9NA 4C9BB 3IHYA 3RO2A 2PQRA 5ARFA 3ZUVB 3PS6A 1D8EA 5J90A 3D9JA 4DLQA 4JEHA 1TNUA 1IHBA 4LNGA 5EYLA 4U8VD 2R59A 2KC7A 5KNGA 1OWPA 3QAQA 2XCCA 4UQXA 2I9CA 1N9AA 3MA5A 1PC2A 4K5BA 2MYOA 3QDNA 4AEZC 3DRAA 4YVOA 1ZB1A 3RK6A 3MKQB 4GZ5A 3FTVA 2NXPA 3ZEFA 4JPSA 3JXJA 3DXMG 5EYPF 4DUIA 2OEVA 3EHQA 2V4HC 5CBNA 2DVWA 2Y4UA 2JABA 5HKPA 2CHXA 3ZVVA 4I1OB 3ZYMA 2P9NG 1IKND 2PZIA 4UWKA 4O6FA 1Y6IA 3FU6A 4YVQC 1NL4A 3Q47B 4UQYA 3SFXA 2V5FA 2X6KA 1N4PA 2R5SA 1YA0A 2IO2C 4IRUA 2CHWA 3D9IA 3CVUA 3PNLB 1TN8A 4OVUA 5AIJA 5FQ8A 3LS8A 3FU3A 3EU9A 4OYSA 3PZ3A 3Q9NC 3DEPA 5AJLA 2IY0C 1BU9A 4Y6WA 2PNNA 1TJFA 2LAIA 3FU0A 3FP3A 3UT7A 3SY2A 1JWGA 2AJAA 3CVQA 4G8LA 3QWPA 4YDWA 3TWSA 4HLEA 4NURA 1OT8A 1ELRA 1O5MA 5ITZF 2LXLA 3WXXA 4U0UA 5ENQD 1TNZA 4FULA 1IQUA 2QYUA 4BY6A 5EX0A 4TUUA 3VLEA 2A4ZA 3APCA 3VLFA 1EDUA 4KZ0A 3L22A 3MJWA 1OUVA 1OXJA 3PH0C 2DYSE 2NSZA 4CDRA 4O1OA 2L6BA 1FCHA 4I2ZA 3TL5A 2PQNA 3ZYLA 2AXUA 2L9BA 3TXNA 3UM0A 1V55E 4ILHB 4BTAA 2L0IA 4CDNA 2XGOA 3EJNA 1E7UA 3K9IA 3FUFA 2J09A 1H2TC 4JA7A 3E37A 4RLYA 5M72A 5CCLA 1LF8A 5BPPA 1TN6A 4Q96A 2VSYA 5CEAA 2VQ2A 1JCSA 1IYGA 5G05J 3TG4A 2V8SE 3ZU7B 3ASOE 1KLXA 3JUIA 3QB2A 3GZ2A 1N52A 5KJKA 4EBAG 2EIME 4KVOA 2UWJG 1HE8A 3ESLA 5BXUA 3SI5A 5HI7A 4U63A 5JMND 3LXUX 1UW4B 1BI7B 1D8DA 3U9WA 2GGFA 4IN3B 4JXTA 1P5QA 2Y4TA 5EIDA 2ETCA 4G11A 3L82A 3S7JA 2OCCE 2WB2A 1JPLA 4G8KA 3UINC 3ABKE 4H7YA 3Q75A 4F3VA 1E8WA 3PEVB 4UWHA 4N5CA 4YDOA 3RKVA 1VDYA 1OWMA 4EPZA 3NB2A 5LFAA 2WQ7A 3EU5A 1UJKA 1OCCE 1E8ZA 2OEWA 2ZGDA 2UY1B 4J8FA 4FHKA 4I6EA 1NFIE 4MS6A 4CEMA 4BX9A 5A7DB 2AWIA 3U64A 3EIJA 4FJZA 4N2SA 3KEAA 4ABNA 5EN5D 1Z5SC 3CK7A 2QC9A 4M7CA 4HVBA 4J8DA 1E8YA 1HG2A 2AW6A 3CGHA 2DBAA 5D66A 3NQPA 4AOFA 2OVBA 3FEYA 2EIJE 5C2YA 3URZA 3ML9A 1WY6A
chains in the Genus database with same CATH topology
3S7FA 1WM5A 4WWPA 3SZ7A 1E8XA 3CIAA 2YHEA 3NZUA 3ESKA 3I5PA 3DBSA 3KS2A 4HORA 3KD7A 4L7TA 3TAXA 2WQ6A 5FZRA 5G2NA 4F1SA 3G2TA 3CKBA 5T4YA 1TJCA 5BW8C 4JHRA 3BEEA 4KYOB 4FADA 4JW1A 4C0EA 3OAWA 3ZFWA 2Y3AA 3G2VA 3MZLB 1IQRA 3MCXA 4U07A 4PUCA 3QNKA 2ONDA 4DPRA 4J0UA 3B7SA 3FEXA 3JQ1A 2PL2A 1UG3A 2LSUA 3MV2B 3O48A 5ANRA 3CVNA 3OXLA 4Q69A 1QZ2A 4R7LA 3HDXA 4FP7A 1FVFA 4HOQA 1NA3A 4ANWA 4CGWA 2BTDA 2AVPA 2I1KA 2LAHA 3ASDA 4GA0A 3SHFA 4E85A 4CCAA 4WNEA 3CVYA 3ASHA 3S7DA 3MV3B 3U66A 4HOSA 4ME2A 5G04J 1HS6A 3FTZA 5EKQD 3ZN3A 4B8AA 3LDZA 2PM6A 1FVHA 2X38A 2J07A 3CSFA 2XHEA 3UT4A 4G2VA 3JYSA 4MRUA 4XX5A 1ELKA 4NQ0A 4GZCA 3T5VA 1BPOA 1HXIA 1Z3YA 3T8MA 3SF4A 4HOTA 2VJ8A 4JC8A 3PEUB 4GYOA 4QFVA 2IOLA 4LCTA 3IV0A 5ANLA 3LY9A 3B13A 2OVFA 2AXZA 4JEUA 2L6JA 1HFAA 4KBQA 2XEVA 1E90A 4GZDA 2VSXE 4PS3A 4B89A 3D9NA 3ZHEB 3G2UA 2WXNA 3FHEA 3HIZA 2HR2A 2QY7A 4UI9J 4GU5A 4C9BB 4ATGA 4AY5A 3ZGQA 4EZKA 3IHYA 5DBKA 3QWWA 4D10C 1X5BA 3RO2A 3GZSA 2PQRA 3N71A 4GYYA 3HVEA 3MKQA 5ARFA 3PS6A 3ONKA 3PE3A 4ANVA 1XGWA 5J90A 4BTBA 3LCAA 3D9JA 4DLQA 4JEHA 4I43A 3L08A 4WNDA 3R7RA 4TV3A 3ZW3A 2MHKA 4KVMA 2WXHA 4WNFA 2XRZA 3PE4A 2R59A 4WWNA 2WPVA 3TXMA 5JJ7A 2KC7A 4A3VA 4L2YA 3Q4AB 2LSVA 4UQZA 2YNQA 3UQ3A 2OOEA 4GMJA 2GRMA 3CVPA 3QJZA 4FA6A 2LO6A 2OV8A 3CHSA 3UUXA 4U0ZA 1MHQA 2KCLA 1OWPA 2WVIA 2XCCA 3QAQA 2KZTA 3EHMA 1Z3XA 3QKYA 2AXVA 3ZIMA 2CHZA 1OWNA 2I9CA 4UQXA 4WUYA 3KEZA 5EX3A 3ZRHA 5EDSA 3RRMB 3CEQA 4IYPA 3T5XA 4GB9A 2FF4A 5LCWJ 5AENA 2EQXA 2MOWA 1HG5A 1UN9A 3LVQE 5CMWA 1ZU2A 2A5UA 4BX8A 2IFUA 2XGMA 3P1UA 4GPKA 1GW6A 3MA5A 2LNIA 3AS8A 4XI0A 1H2VC 1PC2A 3FDHA 4KXKB 1H6KA 3PNTB 1UJJA 3QDNA 3ENEA 4AEZC 2PM7A 3LPZA 3CHQA 2KCKA 4U0SA 4YVOA 5D0QD 3RK6A 4CT0A 3MKQB 1S0PA 1A17A 3GZ1A 4AVXA 4EBAA 2HO1A 4GZ5A 3FTVA 2FI7A 4MKTA 5G05C 2NXPA 3ZPJA 3ZEFA 4JPSA 4ACLA 3E4BA 3ASGA 4H7XA 1JUQA 4FC8A 3IBEA 1OWOA 1U3DA 3C98A 5KJMA 2CFZA 4FHJA 4U04A 4DI4A 2Y4UA 2CG3A 3FTXA 4BSXA 3KAEA 2IF4A 3FTSA 4P29A 2KATA 4U8HA 3D3MA 4K0RA 2CHXA 4APFA 3ZVVA 2Q7FA 2C2LA 4I1OB 2FEZA 4V3IA 3ZYMA 1DNPA 2C0MA 2KZTB 3PDNA 4MLPA 5AYWD 4AP2A 3FUHA 4HS2A 2PZIA 4UWKA 2WXFA 1Y6IA 3FU6A 4O6FA 2GRLA 4YVQC 4E6HA 3Q47B 4UQYA 1NZNA 3FUEA 5CMYA 2V5FA 2RD0A 5ARGA 2X6KA 5BT1A 3CHMA 2E2EA 3FU5A 3OTNA 1JWFA 3ML8A 2R5SA 1YA0A 2ZU6B 1SZAA 2WXGA 3U3WA 3GW4A 5E75A 4WWOA 1HH8A 4I2WA 4HXIA 4IRUA 4XKBA 3VTYA 3PUJA 5BV0A 2GW1A 2CHWA 3D9IA 3CVUA 5FJYA 2KM4A 2V0PA 1L5JA 3PNLB 4G23A 2IONA 1EF1C 4OVUA 5FTPA 4IULA 2I6HA 3RO3A 1MQSA 2J9QA 3CVXA 2FULA 5AIJA 2XQ0A 4I6GA 5JHBA 5FQ8A 3JCKC 3DPDA 3FUJA 4J8SA 3IEGA 1B89A 3CHPA 5FZQA 1N54A 3FH5A 3LS8A 5KJLA 4PS8A 3CVLA 4J6IA 4GA2A 3B7RL 3FU3A 2IJGX 4OYSA 3B7TA 3CHOA 4UWGA 4FU3A 4CGVA 3CLJA 3QOUA 2X6HA 4I1MA 4L2LA 4A1SA 3LYAA 2VYIA 5AJLA 5C1DA 3RIBA 3SFZA 3R7QA 2I1JA 3RRUA 4FLBA 2WXOA 3MGBA 4PH4B 2WXQA 3HHMA 4Y6WA 3Q5MA 1NP7A 3EDTB 3FUMA 3TGOA 2JLBA 2KCVA 5ENNA 4G1TA 3G2WA 1NA0A 3S2AA 3MX3A 4OVVA 5J08A 1TJFA 1IHGA 2ILRA 2LAIA 4B8CB 1HF8A 3FU0A 1WAO1 2UY1A 2IU1A 4N3AA 3FH8A 2VGXA 3FP3A 4XIFA 3UT7A 3BG1B 4CT4A 4N2QA 1JWGA 1UN8A 5KJNA 3ONLA 4I17A 2WXRA 3CVQA 3QWPA 4K03A 5G55A 5FQ4A 3D9MA 1Z6TA 3I4GA 4ILGA 3L13A 3FFLA 1KT0A 3IKOB 4KZCA 5KCMA 4HLEA 4NURA 3QC1A 3S7BA 5A6CA 3ASFA 3Q15A 1ELRA 2VGYA 3AS5A 1W3BA 4GCNA 4N3BA 2J08A 3WXXA 3LY8A 4GCOA 4XI9A 3MKRA 4U0UA 5JJ6A 4BT8A 3ZXSA 3APDA 4FULA 3RRNB 1IQUA 4KMOA 4BY6A 3TJPA 5T3RA 4A1GA 3FULA 2WXIA 5D0OD 3AS4A 3CHRA 3RU0A 4A3TA 3D9PA 2FO7A 4TUUA 5EX0A 2BF0X 3VLEA 2A4ZA 3HVEB 5BV1A 3APCA 3VLFA 1EDUA 1PAQA 3UX4A 1HX8A 4KZ0A 4ANUA 2RG8A 3PUKA 4CDMA 3L22A 2FBNA 3CKCA 1OUVA 3MJWA 3MEKA 3PH0C 4RVBA 2NSZA 4CDRA 2VGXB 2WMOA 1U3CA 2MRIA 4A55A 3FTYA 4B0ZA 2J4BA 1E7VA 3FUKA 3VLDA 4N3CA 1FCHA 3FUDA 4I2ZA 4N39A 4TRQA 4XKCA 4YNDA 3TL5A 2PQNA 2WXKA 3ZYLA 2AXUA 2L9BA 3TXNA 2BUGA 4CRWA 4DI3A 3CK8A 3NF1A 4ILHB 4BTAA 4EECA 3R9AB 2L0IA 3CQCB 4FLHA 5G04C 4CDNA 2XGOA 4FJYA 4UWFA 3RJVA 4WNGA 3TG5A 5T8IA 3UPVA 4JHKA 3EJNA 4JL0A 1E7UA 3LVRE 4AV7A 1HO8A 3PZDA 4AM9A 5JJTA 3K9IA 3FUFA 3L17A 2R17C 4GZ3A 3PRZA 5DIZA 2J09A 1H2TC 4JA7A 4GMLA 4PS7A 2HYZA 5M72A 5CCLA 3QWVA 1LF8A 3I4RB 3IHVA 3FY4A 5BPPA 3LEWA 4LRZA 4F7AA 2X3MA 3CV0A 4Q96A 1KT1A 2VSYA 4UI9C 4DJAA 3FUIA 2VQ2A 4NACA 2WXLA 3ZHEA 1PY1A 4ILIA 1IYGA 5G05J 3TG4A 2V4LA 2V8SE 2WXJA 3LJ3A 5CCMA 4BWRA 1SQMA 2XPZA 5AJDA 3L6AA 3UT8A 3AU5A 1KLXA 2XGSA 3MYVA 3OXGA 4LERA 3AU4A 3JUIA 5JHAA 2VSOE 3QB2A 4LUNU 4C0MA 4EZLA 3U4TA 5A23A 2VTBA 1H0AA 2DCPA 1TEZA 2YQ8A 3GZ2A 5FZSA 3ZYKA 1H2UA 1N52A 4XZ4A 2CFUA 3D9KA 4RSYA 2WQHA 3SBTB 4I9EA 3CQGB 4AIFA 5KJKA 4EBAG 2YHCA 3OXFA 4L1BA 4KVOA 2UWJG 4RG6A 2I2OA 2E0IA 4EQFA 1HE8A 1H19A 3ULQA 4G26A 3ESLA 4DK5A 5LP0A 5LCWC 3FWVA 5HI7A 3SI5A 1SZ9A 2X6IA 2WXPA 3CVWA 2WMNA 4U63A 1EYHA 3LXUX 1UW4B 2L0TB 4APOA 3U9WA 2GGFA 2DIWA 4IN3B 2NC9A 4JXTA 1P5QA 5FT9A 2Y4TA 3B7UX 3FUNA 3GYZA 4I6JA 4HFGA 4URKA 3P2BA 3PREA 4G11A 3S7JA 4JZYA 4B94A 5BUZA 4ANXA 4JVSA 3LY7A 4F53A 1EPUA 2WB2A 4AJWA 3VTXA 5HQ8A 1JPLA 2XCBA 3O4ZA 2J4DA 5BNWA 2M63A 4M3OA 3NZSA 3I3NA 3Q49B 4H7YA 4J8EA 2X6FA 1ELWA 3CVVA 4F3VA 4DLOA 2VTBB 4BFRA 4GZ6A 4L23A 1OWLA 2P58C 1E8WA 3PEVB 3SD5A 5LX8A 2IOSA 3PVLA 4N5CA 4UWHA 4BT9A 2VSNA 2XPIA 3RKVA 3L16A 1VDYA 4XE0A 1OWMA 4EPZA 1DVPA 3ZYQA 3D9LA 2IQCA 3FTWA 5E76A 3CK9A 5LFAA 2WQ7A 5LOZA 4I9CA 1UJKA 4UWLA 1QQEA 4WAFA 4GAAA 3SNXA 1Y8MA 4RG9A 4G24A 3D9OA 1HU3A 3EIQC 1E8ZA 4HOUA 2J49A 3EHNA 2C0LA 2JEKA 2UY1B 4J8FA 4FHKA 4I6EA 3JQ0A 3FH7A 3QK0A 4MS6A 2HM8A 1QNFA 3LKUA 3L54A 2X6JA 4CEMA 2XRYA 4BX9A 1ZBPA 4KT6B 2AWIA 5A7DB 3U64A 3EIJA 4FJZA 4JA9A 3SGHA 4N2SA 4PDXA 4UI9K 5FWQA 3APFA 4JHJA 4EZJA 4ABNA 4I1AA 5FQ6A 4AY6A 3SBSA 2WXMA 3CSTA 3CK7A 1INZA 1HZ4A 3UMVA 4Y6CA 4HVBA 4J8DA 2CG2A 1E96B 3FTUA 1E8YA 1HG2A 4NRHB 2AW6A 3CGHA 3QARA 4W9RA 4LEUA 2DBAA 1XNFA 4GA1A 3NQPA 2WM9A 5FQ7A 3CR3A 2XPYA 3G2SA 2QFCA 4G25A 3HYMB 4GYWA 4AOFA 2OVBA 3BG0B 3FEYA 5C2YA 4AXHA 4ACKA 3URZA 3ML9A 4Q94A 2YINA 5CHEE 1WY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CRW A;  4IUL A;  4JHJ A;  2VSX E;  4GMJ A;  2FUL A;  4B89 A;  3RK6 A;  4C9B B;  1PAQ A;  1H2U A;  2KZT A;  2I2O A;  1HU3 A;  2RG8 A;  1N54 A;  3EIQ C;  4JHK A;  4B8A A;  2NSZ A;  3L6A A;  2ZU6 B;  4B8C B;  1H2T C;  2HM8 A;  1UW4 B;  4GML A;  4CEM A;  2IOS A;  3JUI A;  2IU1 A;  2VSO E;  3FEX A;  4LUN U;  2GGF A;  1H2V C;  1UG3 A;  3EIJ A;  3FEY A;  3D3M A;  4CT4 A;  1H6K A;  5ANR A;  2IOL A;  2ION A;  1N52 A;  2KZT B; 
#chains in the Genus database with same CATH topology
 1E8X A;  3CIA A;  3DSV A;  4O1P A;  3KS2 A;  4HOR A;  4L7T A;  3TAX A;  2WQ6 A;  4NIK A;  4F1S A;  3G2T A;  5AAR A;  1NI1 A;  4FAD A;  3OAW A;  3UIP C;  2DZN A;  2Y3A A;  3MZL B;  1IQR A;  3B7S A;  3JQ1 A;  4HQD A;  4R7L A;  3HXB A;  4Z68 A;  2AVP A;  4GA0 A;  1K1B A;  4WNE A;  3ASH A;  3MV3 B;  3U66 A;  5G04 J;  3FTZ A;  3TWT A;  1MJ0 A;  4NQ0 A;  2F37 A;  4GZC A;  3T5V A;  2DZO A;  3SF4 A;  2DWZ A;  2VJ8 A;  3V2X A;  4QFV A;  4LCT A;  3IV0 A;  2LUH A;  4GZD A;  5IY5 E;  4UI9 J;  4AY5 A;  5DBK A;  4K5A B;  3N71 A;  3PE3 A;  4ANV A;  3X2Q E;  3L08 A;  4KVM A;  2XRZ A;  3PE4 A;  4WWN A;  5JJ7 A;  3Q4A B;  2LSV A;  4UQZ A;  3C3R A;  3C3Q A;  2RFA A;  1A5E A;  2WVI A;  5B1B E;  4DX2 A;  5KNH D;  1KZP A;  1DCQ A;  2CHZ A;  5EX3 A;  3UI2 A;  3RRM B;  3CEQ A;  4GB9 A;  5LCW J;  5AEN A;  3LVQ E;  1HG5 A;  1UN9 A;  1ZU2 A;  2A5U A;  4BX8 A;  2XGM A;  4XI0 A;  1TNY A;  2ZXW E;  2PM7 A;  2KCK A;  5D0Q D;  4EBA A;  4MKT A;  2XS8 A;  3E4B A;  4HNA D;  4GTO A;  3ASG A;  5FIO A;  1JUQ A;  4FC8 A;  1OWO A;  1U3D A;  5KJM A;  2CFZ A;  4DI4 A;  1S70 B;  3EUV A;  3KAE A;  4K0R A;  4F6R D;  2C2L A;  3IXE A;  1DNP A;  4MLP A;  5AYW D;  3FUH A;  2WXF A;  4E6H A;  2GRL A;  3FUE A;  2VGE A;  4UUC A;  4OAV B;  3CHM A;  2E2E A;  3FU5 A;  2ZU6 B;  3GW4 A;  3JUE A;  4I2W A;  2GW1 A;  3AG3 E;  4IUL A;  1BLX B;  5JHB A;  4X8Q A;  3IEG A;  1B89 A;  1WG0 A;  5FZQ A;  5BXO A;  4PS8 A;  4J6I A;  4GA2 A;  3CHO A;  2EIN E;  4CGV A;  2X6H A;  5C1D A;  3SFZ A;  2I1J A;  3DSU A;  3MGB A;  3FUM A;  2KCV A;  1IXV A;  5J08 A;  2ILR A;  3FH8 A;  2VGX A;  4GTT A;  4XIF A;  4CT4 A;  1UN8 A;  1O1S A;  3DST A;  3ONL A;  3DSS A;  2WXR A;  4K03 A;  5FQ4 A;  3D9M A;  3I4G A;  2DYR E;  1KT0 A;  3IKO B;  2Y69 E;  3S7B A;  2VGY A;  3AS5 A;  2XZD G;  1W3B A;  2J08 A;  2F0Y A;  4GCO A;  5JJ6 A;  2XS1 A;  2XEE A;  3APD A;  4KMO A;  1O1T A;  3Q7F A;  3TJP A;  3ZNG A;  2WXI A;  5D0O D;  3CHR A;  2FO7 A;  2BF0 X;  3HVE B;  5BV1 A;  1WDY A;  1PAQ A;  3JXI A;  2J8S D;  2FBN A;  1KPS B;  1U3C A;  2J4B A;  1E7V A;  5B1A E;  1K8K G;  4CYM D;  2BUG A;  5CRV A;  3UM3 A;  3CK8 A;  5CRU A;  4EEC A;  4HB5 A;  4FJY A;  4U8Y D;  3TG5 A;  4JHK A;  4JL0 A;  4AV7 A;  1SVX A;  4AM9 A;  2R17 C;  4GZ3 A;  1N94 A;  4GML A;  4PS7 A;  3EHR A;  3UKR G;  1OCO E;  2HYZ A;  1SA5 A;  4HBD A;  5KWD A;  4GTM A;  1PY1 A;  4ILI A;  4BWR A;  1D9S A;  3LJN A;  2XPZ A;  1OCR E;  3L6A A;  4BSZ B;  3AU5 A;  3MYV A;  3OXG A;  3UM2 A;  4EZL A;  2P9K G;  1H2U A;  3HRA A;  3SBT B;  3Q78 A;  4AIF A;  3OXF A;  1SA4 A;  4ZFH A;  1K3Z D;  1H19 A;  1BI8 B;  4DK5 A;  3HXD A;  1SZ9 A;  2WXP A;  2WMN A;  5EIB E;  1EYH A;  5FT9 A;  5AN8 A;  3FUN A;  4I6J A;  4HFG A;  4JZY A;  5BUZ A;  4ANX A;  4JVS A;  3WG7 E;  4AJW A;  3O4Z A;  2J4D A;  2M63 A;  3I3N A;  3HXF A;  4L23 A;  1OWL A;  5LX8 A;  2IOS A;  3PVL A;  4BT9 A;  2XPI A;  1DVP A;  3ZYQ A;  2IQC A;  2B6C A;  3CK9 A;  1QQE A;  1HU3 A;  2EIK E;  3EIQ C;  4HOU A;  2J49 A;  3QK0 A;  3Q7A A;  3T9K A;  2X6J A;  1ZBP A;  3SGH A;  4DRX E;  3J5Q B;  4EZJ A;  3F6Q A;  2CG2 A;  1E96 B;  3ZKJ A;  2LXM A;  4W9R A;  4HRL A;  1XNF A;  3BG0 B;  5HRY A;  4ACK A;  2YIN A;  5AQB A;  4K5C A;  4WWP A;  2YHE A;  1TNO A;  3ESK A;  3DBS A;  3KD7 A;  5G2N A;  5T4Y A;  1TJC A;  3G2V A;  3MCX A;  4U07 A;  3FEX A;  1UG3 A;  3MV2 B;  5ANR A;  3CVN A;  3PZ1 A;  1FVF A;  4HOQ A;  5AAO A;  4ANW A;  3ASD A;  5H7P A;  4HRN A;  3S7D A;  3R9M A;  3LDZ A;  2PM6 A;  3BUA A;  2X38 A;  2J07 A;  3UT4 A;  4G2V A;  4XX5 A;  2V5Q C;  4CZ2 D;  3T8M A;  3ISM C;  4JC8 A;  2H6I A;  2IOL A;  3LY9 A;  3B13 A;  2OVF A;  2AXZ A;  1HFA A;  2XEV A;  2VSX E;  4PS3 A;  4B89 A;  3ZHE B;  2WXN A;  3FHE A;  2HR2 A;  4EZK A;  3ZGQ A;  3QWW A;  3GZS A;  4GYY A;  4BES A;  1UOH A;  1XGW A;  4I43 A;  4TXP A;  4WND A;  4TV3 A;  3ZW3 A;  2MHK A;  2WXH A;  4WNF A;  4L2Y A;  2YNQ A;  3UQ3 A;  2GRM A;  1V54 E;  4FA6 A;  2KZT A;  3EHM A;  3QKY A;  2AXV A;  1N0R A;  4WUY A;  3ZRH A;  5ENT D;  4IYP A;  3T5X A;  3E33 A;  2MOW A;  5CMW A;  5CEC B;  2IFU A;  3AS8 A;  1H2V C;  3FDH A;  4J8Y A;  1H6K A;  3PNT B;  1UJJ A;  4U0S A;  3LPZ A;  3CHQ A;  3DPY A;  3GZ1 A;  1A17 A;  1RZ4 A;  1S64 A;  5G05 C;  3ZPJ A;  2FI7 A;  3B95 A;  4A63 B;  4ACL A;  3BQO A;  3NBN B;  4TUM A;  3C98 A;  3TWX A;  4FHJ A;  4U04 A;  3FTX A;  2CG3 A;  4BSX A;  2IF4 A;  4P29 A;  2Q7F A;  4V3I A;  3PDN A;  4AP2 A;  4HS2 A;  5CMY A;  5ENP D;  2RD0 A;  2IEJ A;  3AAA C;  5FIN A;  1S63 A;  5E75 A;  4WWO A;  3VTY A;  4HXI A;  4B93 B;  5FJY A;  2KM4 A;  2V0P A;  1L5J A;  4G23 A;  3RSE G;  2I6H A;  3RO3 A;  1MQS A;  2J9Q A;  3DPD A;  4J8S A;  3FH5 A;  4DX6 D;  5KJL A;  3CVL A;  3B7R L;  3PZ4 A;  2P9U G;  3ABL E;  1K1A A;  4FU3 A;  3PZ2 A;  3CLJ A;  3DXK G;  3QOU A;  1H6O A;  4A1S A;  3LYA A;  2VYI A;  3RIB A;  4GPM A;  4FLB A;  2WXO A;  4PH4 B;  1BD8 A;  3HHM A;  3Q5M A;  2JLB A;  4G1T A;  3G2W A;  3S2A A;  4OVV A;  1HF8 A;  2UY1 A;  2IU1 A;  4N3A A;  2ZIR A;  3BG1 B;  3ZXP A;  4HI8 A;  4GTR A;  4LSZ E;  4ILG A;  3FFL A;  3ABM E;  5ENS D;  3QC1 A;  4XI9 A;  3MKR A;  2XEH A;  4BT8 A;  3ZXS A;  4J7W A;  3RRN B;  4GTS A;  2KXP C;  4A1G A;  1N4R A;  4O60 A;  1FT2 A;  3D9P A;  4LNB A;  3UX4 A;  4ANU A;  2RG8 A;  3PUK A;  4CDM A;  4RVB A;  2VGX B;  2B0O E;  2MRI A;  3VLD A;  3FUK A;  4N3C A;  5CED B;  4N39 A;  3AJI A;  2GRO B;  4CRW A;  3HXC A;  3R9A B;  3CQC B;  5G04 C;  3TWU A;  4UWF A;  4TXR A;  3RJV A;  4WNG A;  5T8I A;  3UPV A;  3LVR E;  1MX2 A;  3DEO A;  1N11 A;  5ENR D;  3QWV A;  3IHV A;  3DSW A;  4LRZ A;  1YYH A;  2X3M A;  5CER B;  4UI9 C;  4EHM A;  4BEP A;  3E30 A;  2HE0 A;  2P9S G;  2V4L A;  2WXJ A;  5CCM A;  5AJD A;  3UT8 A;  2XGS A;  3AU4 A;  5JHA A;  2VSO E;  4C0M A;  2VTB A;  2DCP A;  2XZT G;  2GRR B;  4RSY A;  4I9E A;  2Y1L E;  4YDY A;  4N5Q A;  2YHC A;  4RG6 A;  4L1B A;  2E0I A;  4U95 D;  1KZO A;  5LCW C;  1N0Q A;  3CVW A;  2L0T B;  3Q73 A;  2DIW A;  3AG1 E;  4F1P A;  3B7U X;  3HG0 D;  4DX5 D;  4B94 A;  3RAU A;  4F53 A;  3Q79 A;  4QQI A;  2XCB A;  4M3O A;  3NZS A;  3C72 A;  3CVV A;  2R03 A;  4BFR A;  3SD5 A;  2VSN A;  1LTX A;  3L16 A;  4XE0 A;  3AG4 E;  3FTW A;  5LOZ A;  4I9C A;  3ULY A;  4WAF A;  2ZGG A;  4RG9 A;  4G24 A;  3D9O A;  1AP7 A;  3W9G A;  4ZHB A;  3EHN A;  3JQ0 A;  2HM8 A;  1QNF A;  4KT6 B;  4JA9 A;  4PDX A;  4UI9 K;  4BER A;  3APF A;  4JHJ A;  1QBQ A;  4I1A A;  5FQ6 A;  3SBS A;  2BED A;  2WXM A;  3CST A;  1INZ A;  3BU8 A;  3UMV A;  4Y6C A;  5HS0 A;  3D9H A;  1O1R A;  3FTU A;  4NRH B;  2EIL E;  3QAR A;  4LNU D;  5AQA A;  2WM9 A;  2XPY A;  3G2S A;  2QZA A;  4U7E B;  3HYM B;  4GYW A;  5D2M C;  1U2V G;  2H6F A;  4AXH A;  4Q94 A;  4APO A;  5CHE E;  3S7F A;  1WM5 A;  1G3N B;  3SZ7 A;  4MBG A;  3DWL G;  3E32 A;  3I5P A;  4XEI G;  5FZR A;  3CKB A;  5BW8 C;  3BEE A;  4KYO B;  4C0E A;  3ZFW A;  3QNK A;  4J0U A;  3C5R A;  2PL2 A;  2QYJ A;  1QZ2 A;  3HDX A;  4FP7 A;  4ATZ D;  1NA3 A;  4LG6 A;  2RKK A;  4CGW A;  2XEN A;  4E85 A;  4CCA A;  4YDE A;  4B8A A;  1MX6 A;  1FVH A;  3CSF A;  2XHE A;  4MRU A;  1ELK A;  1OCZ E;  2R02 A;  3AG2 E;  4HOT A;  4GYO A;  5JJT A;  5ANL A;  2P2C P;  4KBQ A;  1E90 A;  2F8Y A;  1FT1 A;  3G2U A;  1YMP A;  3HIZ A;  1AWC B;  2QY7 A;  4GU5 A;  3E34 A;  4ATG A;  4D10 C;  1X5B A;  3HVE A;  3MKQ A;  1TN7 A;  3ONK A;  4BTB A;  3B7B A;  3LCA A;  3R7R A;  4HI9 A;  3TXM A;  2WPV A;  4A3V A;  4HRM B;  3C3O A;  2OOE A;  4GMJ A;  3CVP A;  3QJZ A;  2LO6 A;  2OV8 A;  3CHS A;  3UUX A;  3V79 K;  4U0Z A;  1MHQ A;  2KCL A;  1Z3X A;  3ZIM A;  1OWN A;  3KEZ A;  5EDS A;  2FF4 A;  2EQX A;  5CBO A;  3P1U A;  4GPK A;  1GW6 A;  2LNI A;  3UIO C;  4GTV A;  4KXK B;  1QYM A;  3ENE A;  4CT0 A;  1S0P A;  4AVX A;  2HO1 A;  5AQ7 A;  4H7X A;  3IBE A;  2GRP B;  4GTP A;  3FTS A;  4U8H A;  2KAT A;  3D3M A;  4APF A;  3NOC D;  2FEZ A;  2C0M A;  2H6H A;  2KZT B;  2FO1 E;  1X81 A;  1NZN A;  5ARG A;  5BT1 A;  3OTN A;  2ETA A;  1JWF A;  3ML8 A;  1SZA A;  2WXG A;  3U3W A;  3DSX A;  1HH8 A;  4XKB A;  4GTQ A;  3PUJ A;  5BV0 A;  1TR4 A;  2ION A;  1EF1 C;  5FTP A;  2RFM A;  3CVX A;  2FUL A;  2XQ0 A;  4I6G A;  3V2O A;  3JCK C;  3FUJ A;  3CHP A;  1N54 A;  5ENO D;  5B3S E;  3NOG D;  4GMR A;  1H6P A;  2IJG X;  3B7T A;  3ASN E;  4UWG A;  4I1M A;  4L2L A;  1Q2Z A;  2GRN B;  2H6G A;  3R7Q A;  3RRU A;  2WXQ A;  1DCE A;  1NP7 A;  1YCS B;  3EDT B;  3TGO A;  5ENN A;  4C48 B;  1NA0 A;  3MX3 A;  4B8C B;  1IHG A;  1WAO 1;  4N2Q A;  5KJN A;  4I17 A;  3TWR A;  5G55 A;  1Z6T A;  3SO8 A;  3L13 A;  4KZC A;  5KCM A;  5A6C A;  3ASF A;  3Q15 A;  3TWV A;  1MYO A;  4GCN A;  2GRQ B;  4N3B A;  1TNB A;  1MZC A;  3LY8 A;  4DX1 A;  1N4S A;  5T3R A;  1DC2 A;  3FUL A;  3AS4 A;  4RQI A;  3RU0 A;  4A3T A;  2ZIS A;  1HX8 A;  2NYJ A;  3CKC A;  3MEK A;  2WMO A;  5EIL A;  4A55 A;  3FTY A;  4B0Z A;  3FUD A;  4TRQ A;  4XKC A;  4YND A;  2WXK A;  4DI3 A;  3NF1 A;  3KSQ A;  4FLH A;  2A5E A;  5KBA A;  3UKU G;  1HO8 A;  3PZD A;  4L9P A;  3L17 A;  3PRZ A;  5DIZ A;  4JB8 P;  3W9F A;  2Y0B G;  3I4R B;  3FY4 A;  3LEW A;  4F7A A;  2KBX A;  3CV0 A;  1KT1 A;  3HXE A;  4DJA A;  3FUI A;  3UTM A;  2R2L A;  4NAC A;  2WXL A;  3ZHE A;  3LJ3 A;  1SQM A;  4LER A;  4LUN U;  3U4T A;  5A23 A;  1H0A A;  1TEZ A;  2YQ8 A;  5FZS A;  3ZYK A;  4XZ4 A;  2CFU A;  3D9K A;  2WQH A;  3CQG B;  3UXG A;  2I2O A;  4EQF A;  1RW2 A;  3ULQ A;  4G26 A;  5LP0 A;  4OAU C;  1MX4 A;  3FWV A;  2X6I A;  5JA4 D;  3SFY A;  2NC9 A;  3GYZ A;  1FPP A;  4URK A;  3P2B A;  3PRE A;  2P9L G;  2P9P G;  4HLL A;  2IO3 C;  3LY7 A;  1EPU A;  5AQ9 A;  5HQ8 A;  3VTX A;  5BNW A;  4BET A;  3Q49 B;  4J8E A;  2X6F A;  1ELW A;  4DLO A;  2VTB B;  4JD2 G;  1JCR A;  4GZ6 A;  2P58 C;  3NAW A;  2F8X K;  3D9L A;  5E76 A;  3ULE G;  4UWL A;  4GAA A;  3SNX A;  1Y8M A;  4TXQ A;  2C0L A;  2JEK A;  3FH7 A;  3LKU A;  3L54 A;  2XRY A;  3SQV A;  5FWQ A;  2BKG A;  4AY6 A;  1HZ4 A;  3T8K A;  3V30 A;  3J5P A;  2ETB A;  4LEU A;  4GA1 A;  1TYQ G;  5FQ7 A;  3CR3 A;  2QFC A;  4G25 A;  2R05 A;  1LD8 A;  4DX7 D;  3TWQ A;  3Q9U C;  1LD7 A;  3NZU A;  3UM1 A;  3TWW A;  3KSL A;  4U96 D;  4JHR A;  4JW1 A;  4PUC A;  4DPR A;  2OND A;  2LSU A;  3O48 A;  3OXL A;  4Q69 A;  2BTD A;  3V31 A;  2I1K A;  2LAH A;  1SW6 A;  3SHF A;  3CVY A;  4HOS A;  1N4Q A;  4ME2 A;  1HS6 A;  2P9I G;  5EKQ D;  3ZN3 A;  3JYS A;  1OY3 D;  1BPO A;  1HXI A;  1Z3Y A;  3L9T A;  3PEU B;  4JEU A;  2L6J A;  1N95 A;  1JCQ A;  2BKK B;  3D9N A;  4C9B B;  3IHY A;  3RO2 A;  2PQR A;  5ARF A;  3ZUV B;  3PS6 A;  1D8E A;  5J90 A;  3D9J A;  4DLQ A;  4JEH A;  1TNU A;  1IHB A;  4LNG A;  5EYL A;  4U8V D;  2R59 A;  2KC7 A;  5KNG A;  1OWP A;  3QAQ A;  2XCC A;  4UQX A;  2I9C A;  1N9A A;  3MA5 A;  1PC2 A;  4K5B A;  2MYO A;  3QDN A;  4AEZ C;  3DRA A;  4YVO A;  1ZB1 A;  3RK6 A;  3MKQ B;  4GZ5 A;  3FTV A;  2NXP A;  3ZEF A;  4JPS A;  3JXJ A;  3DXM G;  5EYP F;  4DUI A;  2OEV A;  3EHQ A;  2V4H C;  5CBN A;  2DVW A;  2Y4U A;  2JAB A;  5HKP A;  2CHX A;  3ZVV A;  4I1O B;  3ZYM A;  2P9N G;  1IKN D;  2PZI A;  4UWK A;  4O6F A;  1Y6I A;  3FU6 A;  4YVQ C;  1NL4 A;  3Q47 B;  4UQY A;  3SFX A;  2V5F A;  2X6K A;  1N4P A;  2R5S A;  1YA0 A;  2IO2 C;  4IRU A;  2CHW A;  3D9I A;  3CVU A;  3PNL B;  1TN8 A;  4OVU A;  5AIJ A;  5FQ8 A;  3LS8 A;  3FU3 A;  3EU9 A;  4OYS A;  3PZ3 A;  3Q9N C;  3DEP A;  5AJL A;  2IY0 C;  1BU9 A;  4Y6W A;  2PNN A;  1TJF A;  2LAI A;  3FU0 A;  3FP3 A;  3UT7 A;  3SY2 A;  1JWG A;  2AJA A;  3CVQ A;  4G8L A;  3QWP A;  4YDW A;  3TWS A;  4HLE A;  4NUR A;  1OT8 A;  1ELR A;  1O5M A;  5ITZ F;  2LXL A;  3WXX A;  4U0U A;  5ENQ D;  1TNZ A;  4FUL A;  1IQU A;  2QYU A;  4BY6 A;  5EX0 A;  4TUU A;  3VLE A;  2A4Z A;  3APC A;  3VLF A;  1EDU A;  4KZ0 A;  3L22 A;  3MJW A;  1OUV A;  1OXJ A;  3PH0 C;  2DYS E;  2NSZ A;  4CDR A;  4O1O A;  2L6B A;  1FCH A;  4I2Z A;  3TL5 A;  2PQN A;  3ZYL A;  2AXU A;  2L9B A;  3TXN A;  3UM0 A;  1V55 E;  4ILH B;  4BTA A;  2L0I A;  4CDN A;  2XGO A;  3EJN A;  1E7U A;  3K9I A;  3FUF A;  2J09 A;  1H2T C;  4JA7 A;  3E37 A;  4RLY A;  5M72 A;  5CCL A;  1LF8 A;  5BPP A;  1TN6 A;  4Q96 A;  2VSY A;  5CEA A;  2VQ2 A;  1JCS A;  1IYG A;  5G05 J;  3TG4 A;  2V8S E;  3ZU7 B;  3ASO E;  1KLX A;  3JUI A;  3QB2 A;  3GZ2 A;  1N52 A;  5KJK A;  4EBA G;  2EIM E;  4KVO A;  2UWJ G;  1HE8 A;  3ESL A;  5BXU A;  3SI5 A;  5HI7 A;  4U63 A;  5JMN D;  3LXU X;  1UW4 B;  1BI7 B;  1D8D A;  3U9W A;  2GGF A;  4IN3 B;  4JXT A;  1P5Q A;  2Y4T A;  5EID A;  2ETC A;  4G11 A;  3L82 A;  3S7J A;  2OCC E;  2WB2 A;  1JPL A;  4G8K A;  3UIN C;  3ABK E;  4H7Y A;  3Q75 A;  4F3V A;  1E8W A;  3PEV B;  4UWH A;  4N5C A;  4YDO A;  3RKV A;  1VDY A;  1OWM A;  4EPZ A;  3NB2 A;  5LFA A;  2WQ7 A;  3EU5 A;  1UJK A;  1OCC E;  1E8Z A;  2OEW A;  2ZGD A;  2UY1 B;  4J8F A;  4FHK A;  4I6E A;  1NFI E;  4MS6 A;  4CEM A;  4BX9 A;  5A7D B;  2AWI A;  3U64 A;  3EIJ A;  4FJZ A;  4N2S A;  3KEA A;  4ABN A;  5EN5 D;  1Z5S C;  3CK7 A;  2QC9 A;  4M7C A;  4HVB A;  4J8D A;  1E8Y A;  1HG2 A;  2AW6 A;  3CGH A;  2DBA A;  5D66 A;  3NQP A;  4AOF A;  2OVB A;  3FEY A;  2EIJ E;  5C2Y A;  3URZ A;  3ML9 A;  1WY6 A; 
#chains in the Genus database with same CATH homology
 3S7F A;  1WM5 A;  4WWP A;  3SZ7 A;  1E8X A;  3CIA A;  2YHE A;  3NZU A;  3ESK A;  3I5P A;  3DBS A;  3KS2 A;  4HOR A;  3KD7 A;  4L7T A;  3TAX A;  2WQ6 A;  5FZR A;  5G2N A;  4F1S A;  3G2T A;  3CKB A;  5T4Y A;  1TJC A;  5BW8 C;  4JHR A;  3BEE A;  4KYO B;  4FAD A;  4JW1 A;  4C0E A;  3OAW A;  3ZFW A;  2Y3A A;  3G2V A;  3MZL B;  1IQR A;  3MCX A;  4U07 A;  4PUC A;  3QNK A;  2OND A;  4DPR A;  4J0U A;  3B7S A;  3FEX A;  3JQ1 A;  2PL2 A;  1UG3 A;  2LSU A;  3MV2 B;  3O48 A;  5ANR A;  3CVN A;  3OXL A;  4Q69 A;  1QZ2 A;  4R7L A;  3HDX A;  4FP7 A;  1FVF A;  4HOQ A;  1NA3 A;  4ANW A;  4CGW A;  2BTD A;  2AVP A;  2I1K A;  2LAH A;  3ASD A;  4GA0 A;  3SHF A;  4E85 A;  4CCA A;  4WNE A;  3CVY A;  3ASH A;  3S7D A;  3MV3 B;  3U66 A;  4HOS A;  4ME2 A;  5G04 J;  1HS6 A;  3FTZ A;  5EKQ D;  3ZN3 A;  4B8A A;  3LDZ A;  2PM6 A;  1FVH A;  2X38 A;  2J07 A;  3CSF A;  2XHE A;  3UT4 A;  4G2V A;  3JYS A;  4MRU A;  4XX5 A;  1ELK A;  4NQ0 A;  4GZC A;  3T5V A;  1BPO A;  1HXI A;  1Z3Y A;  3T8M A;  3SF4 A;  4HOT A;  2VJ8 A;  4JC8 A;  3PEU B;  4GYO A;  4QFV A;  2IOL A;  4LCT A;  3IV0 A;  5ANL A;  3LY9 A;  3B13 A;  2OVF A;  2AXZ A;  4JEU A;  2L6J A;  1HFA A;  4KBQ A;  2XEV A;  1E90 A;  4GZD A;  2VSX E;  4PS3 A;  4B89 A;  3D9N A;  3ZHE B;  3G2U A;  2WXN A;  3FHE A;  3HIZ A;  2HR2 A;  2QY7 A;  4UI9 J;  4GU5 A;  4C9B B;  4ATG A;  4AY5 A;  3ZGQ A;  4EZK A;  3IHY A;  5DBK A;  3QWW A;  4D10 C;  1X5B A;  3RO2 A;  3GZS A;  2PQR A;  3N71 A;  4GYY A;  3HVE A;  3MKQ A;  5ARF A;  3PS6 A;  3ONK A;  3PE3 A;  4ANV A;  1XGW A;  5J90 A;  4BTB A;  3LCA A;  3D9J A;  4DLQ A;  4JEH A;  4I43 A;  3L08 A;  4WND A;  3R7R A;  4TV3 A;  3ZW3 A;  2MHK A;  4KVM A;  2WXH A;  4WNF A;  2XRZ A;  3PE4 A;  2R59 A;  4WWN A;  2WPV A;  3TXM A;  5JJ7 A;  2KC7 A;  4A3V A;  4L2Y A;  3Q4A B;  2LSV A;  4UQZ A;  2YNQ A;  3UQ3 A;  2OOE A;  4GMJ A;  2GRM A;  3CVP A;  3QJZ A;  4FA6 A;  2LO6 A;  2OV8 A;  3CHS A;  3UUX A;  4U0Z A;  1MHQ A;  2KCL A;  1OWP A;  2WVI A;  2XCC A;  3QAQ A;  2KZT A;  3EHM A;  1Z3X A;  3QKY A;  2AXV A;  3ZIM A;  2CHZ A;  1OWN A;  2I9C A;  4UQX A;  4WUY A;  3KEZ A;  5EX3 A;  3ZRH A;  5EDS A;  3RRM B;  3CEQ A;  4IYP A;  3T5X A;  4GB9 A;  2FF4 A;  5LCW J;  5AEN A;  2EQX A;  2MOW A;  1HG5 A;  1UN9 A;  3LVQ E;  5CMW A;  1ZU2 A;  2A5U A;  4BX8 A;  2IFU A;  2XGM A;  3P1U A;  4GPK A;  1GW6 A;  3MA5 A;  2LNI A;  3AS8 A;  4XI0 A;  1H2V C;  1PC2 A;  3FDH A;  4KXK B;  1H6K A;  3PNT B;  1UJJ A;  3QDN A;  3ENE A;  4AEZ C;  2PM7 A;  3LPZ A;  3CHQ A;  2KCK A;  4U0S A;  4YVO A;  5D0Q D;  3RK6 A;  4CT0 A;  3MKQ B;  1S0P A;  1A17 A;  3GZ1 A;  4AVX A;  4EBA A;  2HO1 A;  4GZ5 A;  3FTV A;  2FI7 A;  4MKT A;  5G05 C;  2NXP A;  3ZPJ A;  3ZEF A;  4JPS A;  4ACL A;  3E4B A;  3ASG A;  4H7X A;  1JUQ A;  4FC8 A;  3IBE A;  1OWO A;  1U3D A;  3C98 A;  5KJM A;  2CFZ A;  4FHJ A;  4U04 A;  4DI4 A;  2Y4U A;  2CG3 A;  3FTX A;  4BSX A;  3KAE A;  2IF4 A;  3FTS A;  4P29 A;  2KAT A;  4U8H A;  3D3M A;  4K0R A;  2CHX A;  4APF A;  3ZVV A;  2Q7F A;  2C2L A;  4I1O B;  2FEZ A;  4V3I A;  3ZYM A;  1DNP A;  2C0M A;  2KZT B;  3PDN A;  4MLP A;  5AYW D;  4AP2 A;  3FUH A;  4HS2 A;  2PZI A;  4UWK A;  2WXF A;  1Y6I A;  3FU6 A;  4O6F A;  2GRL A;  4YVQ C;  4E6H A;  3Q47 B;  4UQY A;  1NZN A;  3FUE A;  5CMY A;  2V5F A;  2RD0 A;  5ARG A;  2X6K A;  5BT1 A;  3CHM A;  2E2E A;  3FU5 A;  3OTN A;  1JWF A;  3ML8 A;  2R5S A;  1YA0 A;  2ZU6 B;  1SZA A;  2WXG A;  3U3W A;  3GW4 A;  5E75 A;  4WWO A;  1HH8 A;  4I2W A;  4HXI A;  4IRU A;  4XKB A;  3VTY A;  3PUJ A;  5BV0 A;  2GW1 A;  2CHW A;  3D9I A;  3CVU A;  5FJY A;  2KM4 A;  2V0P A;  1L5J A;  3PNL B;  4G23 A;  2ION A;  1EF1 C;  4OVU A;  5FTP A;  4IUL A;  2I6H A;  3RO3 A;  1MQS A;  2J9Q A;  3CVX A;  2FUL A;  5AIJ A;  2XQ0 A;  4I6G A;  5JHB A;  5FQ8 A;  3JCK C;  3DPD A;  3FUJ A;  4J8S A;  3IEG A;  1B89 A;  3CHP A;  5FZQ A;  1N54 A;  3FH5 A;  3LS8 A;  5KJL A;  4PS8 A;  3CVL A;  4J6I A;  4GA2 A;  3B7R L;  3FU3 A;  2IJG X;  4OYS A;  3B7T A;  3CHO A;  4UWG A;  4FU3 A;  4CGV A;  3CLJ A;  3QOU A;  2X6H A;  4I1M A;  4L2L A;  4A1S A;  3LYA A;  2VYI A;  5AJL A;  5C1D A;  3RIB A;  3SFZ A;  3R7Q A;  2I1J A;  3RRU A;  4FLB A;  2WXO A;  3MGB A;  4PH4 B;  2WXQ A;  3HHM A;  4Y6W A;  3Q5M A;  1NP7 A;  3EDT B;  3FUM A;  3TGO A;  2JLB A;  2KCV A;  5ENN A;  4G1T A;  3G2W A;  1NA0 A;  3S2A A;  3MX3 A;  4OVV A;  5J08 A;  1TJF A;  1IHG A;  2ILR A;  2LAI A;  4B8C B;  1HF8 A;  3FU0 A;  1WAO 1;  2UY1 A;  2IU1 A;  4N3A A;  3FH8 A;  2VGX A;  3FP3 A;  4XIF A;  3UT7 A;  3BG1 B;  4CT4 A;  4N2Q A;  1JWG A;  1UN8 A;  5KJN A;  3ONL A;  4I17 A;  2WXR A;  3CVQ A;  3QWP A;  4K03 A;  5G55 A;  5FQ4 A;  3D9M A;  1Z6T A;  3I4G A;  4ILG A;  3L13 A;  3FFL A;  1KT0 A;  3IKO B;  4KZC A;  5KCM A;  4HLE A;  4NUR A;  3QC1 A;  3S7B A;  5A6C A;  3ASF A;  3Q15 A;  1ELR A;  2VGY A;  3AS5 A;  1W3B A;  4GCN A;  4N3B A;  2J08 A;  3WXX A;  3LY8 A;  4GCO A;  4XI9 A;  3MKR A;  4U0U A;  5JJ6 A;  4BT8 A;  3ZXS A;  3APD A;  4FUL A;  3RRN B;  1IQU A;  4KMO A;  4BY6 A;  3TJP A;  5T3R A;  4A1G A;  3FUL A;  2WXI A;  5D0O D;  3AS4 A;  3CHR A;  3RU0 A;  4A3T A;  3D9P A;  2FO7 A;  4TUU A;  5EX0 A;  2BF0 X;  3VLE A;  2A4Z A;  3HVE B;  5BV1 A;  3APC A;  3VLF A;  1EDU A;  1PAQ A;  3UX4 A;  1HX8 A;  4KZ0 A;  4ANU A;  2RG8 A;  3PUK A;  4CDM A;  3L22 A;  2FBN A;  3CKC A;  1OUV A;  3MJW A;  3MEK A;  3PH0 C;  4RVB A;  2NSZ A;  4CDR A;  2VGX B;  2WMO A;  1U3C A;  2MRI A;  4A55 A;  3FTY A;  4B0Z A;  2J4B A;  1E7V A;  3FUK A;  3VLD A;  4N3C A;  1FCH A;  3FUD A;  4I2Z A;  4N39 A;  4TRQ A;  4XKC A;  4YND A;  3TL5 A;  2PQN A;  2WXK A;  3ZYL A;  2AXU A;  2L9B A;  3TXN A;  2BUG A;  4CRW A;  4DI3 A;  3CK8 A;  3NF1 A;  4ILH B;  4BTA A;  4EEC A;  3R9A B;  2L0I A;  3CQC B;  4FLH A;  5G04 C;  4CDN A;  2XGO A;  4FJY A;  4UWF A;  3RJV A;  4WNG A;  3TG5 A;  5T8I A;  3UPV A;  4JHK A;  3EJN A;  4JL0 A;  1E7U A;  3LVR E;  4AV7 A;  1HO8 A;  3PZD A;  4AM9 A;  5JJT A;  3K9I A;  3FUF A;  3L17 A;  2R17 C;  4GZ3 A;  3PRZ A;  5DIZ A;  2J09 A;  1H2T C;  4JA7 A;  4GML A;  4PS7 A;  2HYZ A;  5M72 A;  5CCL A;  3QWV A;  1LF8 A;  3I4R B;  3IHV A;  3FY4 A;  5BPP A;  3LEW A;  4LRZ A;  4F7A A;  2X3M A;  3CV0 A;  4Q96 A;  1KT1 A;  2VSY A;  4UI9 C;  4DJA A;  3FUI A;  2VQ2 A;  4NAC A;  2WXL A;  3ZHE A;  1PY1 A;  4ILI A;  1IYG A;  5G05 J;  3TG4 A;  2V4L A;  2V8S E;  2WXJ A;  3LJ3 A;  5CCM A;  4BWR A;  1SQM A;  2XPZ A;  5AJD A;  3L6A A;  3UT8 A;  3AU5 A;  1KLX A;  2XGS A;  3MYV A;  3OXG A;  4LER A;  3AU4 A;  3JUI A;  5JHA A;  2VSO E;  3QB2 A;  4LUN U;  4C0M A;  4EZL A;  3U4T A;  5A23 A;  2VTB A;  1H0A A;  2DCP A;  1TEZ A;  2YQ8 A;  3GZ2 A;  5FZS A;  3ZYK A;  1H2U A;  1N52 A;  4XZ4 A;  2CFU A;  3D9K A;  4RSY A;  2WQH A;  3SBT B;  4I9E A;  3CQG B;  4AIF A;  5KJK A;  4EBA G;  2YHC A;  3OXF A;  4L1B A;  4KVO A;  2UWJ G;  4RG6 A;  2I2O A;  2E0I A;  4EQF A;  1HE8 A;  1H19 A;  3ULQ A;  4G26 A;  3ESL A;  4DK5 A;  5LP0 A;  5LCW C;  3FWV A;  5HI7 A;  3SI5 A;  1SZ9 A;  2X6I A;  2WXP A;  3CVW A;  2WMN A;  4U63 A;  1EYH A;  3LXU X;  1UW4 B;  2L0T B;  4APO A;  3U9W A;  2GGF A;  2DIW A;  4IN3 B;  2NC9 A;  4JXT A;  1P5Q A;  5FT9 A;  2Y4T A;  3B7U X;  3FUN A;  3GYZ A;  4I6J A;  4HFG A;  4URK A;  3P2B A;  3PRE A;  4G11 A;  3S7J A;  4JZY A;  4B94 A;  5BUZ A;  4ANX A;  4JVS A;  3LY7 A;  4F53 A;  1EPU A;  2WB2 A;  4AJW A;  3VTX A;  5HQ8 A;  1JPL A;  2XCB A;  3O4Z A;  2J4D A;  5BNW A;  2M63 A;  4M3O A;  3NZS A;  3I3N A;  3Q49 B;  4H7Y A;  4J8E A;  2X6F A;  1ELW A;  3CVV A;  4F3V A;  4DLO A;  2VTB B;  4BFR A;  4GZ6 A;  4L23 A;  1OWL A;  2P58 C;  1E8W A;  3PEV B;  3SD5 A;  5LX8 A;  2IOS A;  3PVL A;  4N5C A;  4UWH A;  4BT9 A;  2VSN A;  2XPI A;  3RKV A;  3L16 A;  1VDY A;  4XE0 A;  1OWM A;  4EPZ A;  1DVP A;  3ZYQ A;  3D9L A;  2IQC A;  3FTW A;  5E76 A;  3CK9 A;  5LFA A;  2WQ7 A;  5LOZ A;  4I9C A;  1UJK A;  4UWL A;  1QQE A;  4WAF A;  4GAA A;  3SNX A;  1Y8M A;  4RG9 A;  4G24 A;  3D9O A;  1HU3 A;  3EIQ C;  1E8Z A;  4HOU A;  2J49 A;  3EHN A;  2C0L A;  2JEK A;  2UY1 B;  4J8F A;  4FHK A;  4I6E A;  3JQ0 A;  3FH7 A;  3QK0 A;  4MS6 A;  2HM8 A;  1QNF A;  3LKU A;  3L54 A;  2X6J A;  4CEM A;  2XRY A;  4BX9 A;  1ZBP A;  4KT6 B;  2AWI A;  5A7D B;  3U64 A;  3EIJ A;  4FJZ A;  4JA9 A;  3SGH A;  4N2S A;  4PDX A;  4UI9 K;  5FWQ A;  3APF A;  4JHJ A;  4EZJ A;  4ABN A;  4I1A A;  5FQ6 A;  4AY6 A;  3SBS A;  2WXM A;  3CST A;  3CK7 A;  1INZ A;  1HZ4 A;  3UMV A;  4Y6C A;  4HVB A;  4J8D A;  2CG2 A;  1E96 B;  3FTU A;  1E8Y A;  1HG2 A;  4NRH B;  2AW6 A;  3CGH A;  3QAR A;  4W9R A;  4LEU A;  2DBA A;  1XNF A;  4GA1 A;  3NQP A;  2WM9 A;  5FQ7 A;  3CR3 A;  2XPY A;  3G2S A;  2QFC A;  4G25 A;  3HYM B;  4GYW A;  4AOF A;  2OVB A;  3BG0 B;  3FEY A;  5C2Y A;  4AXH A;  4ACK A;  3URZ A;  3ML9 A;  4Q94 A;  2YIN A;  5CHE E;  1WY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...