4B8AA

Structure of yeast not1 mif4g domain co-crystallized with caf1
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
232
structure length
232
Chain Sequence
QEMIPLKFFAVDEVSCQINQEGAPKDVVEKVLFVLNNVTLANLNNKVDELKKSLTPNYFSWFSTYLVTQRAKTEPNYHDLYSKVIVAMGSGLLHQFMVNVTLRQLFVLLSTKDEQAIDKKHLKNLASWLGCITLALNKPIKHKNIAFREMLIEAYKENRLEIVVPFVTKILQRASESKIFKPPNPWTVGILKLLIELNEKANWKLSLTFEVEVLLKSFNLTTKSLKPSNFIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Architecture of the Nuclease Module of the Yeast Ccr4-not Complex: The not1-Caf1-Ccr4 Interaction.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Transcription/hydrolase
molecule keywords GENERAL NEGATIVE REGULATOR OF TRANSCRIPTION SUBUNIT 1
total genus 86
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2012-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16415 CNOT1_CAF1_bind CCR4-NOT transcription complex subunit 1 CAF1-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4b8aA00
3D3MA 4JHJA 2GGFA 4B8AA 1PAQA 2VSOE 3JUIA 1H2VC 3RK6A 2RG8A 2FULA 2KZTB 2I2OA 1H2UA 1H6KA 4GMLA 4CEMA 2HM8A 4C9BB 4JHKA 3L6AA 4IULA 1N54A 1HU3A 2KZTA 2ZU6B 1N52A 2VSXE 3EIQC 4B89A 2IU1A 1UG3A 5ANRA 1UW4B 1H2TC 4CT4A 3FEXA 3FEYA 4B8CB 2NSZA 4GMJA 4CRWA 3EIJA 2IOLA 2IOSA 2IONA 4LUNU
chains in the Genus database with same CATH superfamily
3FULA 3TGOA 4GZ3A 4N2QA 4TUMA 2XGSA 3FUFA 4AEZC 4CT0A 1NL4A 2EQXA 4N2SA 4XEIG 2YINA 3MKQB 3B7UX 4U8YD 4XZ4A 3C5RA 4URKA 3HXEA 2L6JA 3UI2A 3APFA 1OCCE 5E75A 1KPSB 4UUCA 1U3DA 2VJ8A 2KZTB 4GTQA 5KNGA 3LYAA 4GCOA 2CHZA 1H0AA 1DCEA 3LDZA 4B89A 3LY7A 5ANRA 4EZJA 1GW6A 3FTYA 4U7EB 2AVPA 4I1AA 3FUHA 2NXPA 5HRYA 3NOGD 3RK6A 5G04C 3KSQA 4OYSA 3V2XA 3S7FA 4JC8A 1N52A 2UY1A 4IRUA 3HVEA 3L17A 3FP3A 4LUNU 2Y69E 2Y0BG 5BV0A 3CHPA 2J4DA 2OEWA 2MYOA 5C1DA 3MZLB 4AOFA 4OAUC 1SQMA 4TXQA 1JUQA 1UW4B 2GRRB 1OCZE 3CVLA 3MV3B 3LJNA 4EBAG 4FLBA 4GTRA 5ENSD 2C2LA 1H6KA 3RRNB 1MZCA 4DX5D 3B7SA 3PZ4A 3RKVA 1EPUA 4UQYA 2BF0X 2WXLA 3CK7A 5A7DB 4NIKA 3FU0A 4KT6B 1VDYA 2IQCA 1ELWA 2CHXA 2KXPC 1NI1A 2BTDA 3B95A 2WXKA 3LVRE 4HRMB 1LTXA 3OAWA 3PH0C 4OAVB 2JLBA 3AS5A 5KJNA 3V30A 5D2MC 3TWXA 4N3AA 2VSYA 1TJCA 4ATGA 1D8EA 4EBAA 2OCCE 3BG0B 2XPYA 4ACKA 3ASHA 4HORA 1IQUA 2F8XK 4Q96A 2F0YA 1N4RA 4G25A 2L6BA 4BY6A 4LNBA 4JXTA 3CEQA 3SY2A 3ULEG 4E85A 3MA5A 3TXMA 3J5PA 3ZFWA 4BTAA 2EIKE 3E33A 3Q7FA 2XS1A 3UM3A 3FUIA 3ZYLA 1JCQA 3ZEFA 5B1BE 3KEAA 2A5EA 3ABKE 2MHKA 2LAHA 4GTOA 3PZ1A 4I17A 2R2LA 3LY9A 1YA0A 3D9MA 2IOSA 4AIFA 3DPDA 1O1SA 3R7RA 4F7AA 2J07A 3JXIA 5FJYA 3S2AA 5LCWC 5IY5E 2WXMA 4TV3A 3S7DA 1N94A 1K1BA 4GMJA 4RG9A 5EYPF 2VYIA 4FHKA 1BI8B 3FWVA 3HG0D 3B7TA 1LD8A 4DLQA 1E90A 4YVOA 4Y6CA 4EZKA 1LD7A 4IN3B 3SNXA 1P5QA 3D9LA 3ZYKA 4EECA 4PH4B 1OWMA 5AARA 4K03A 4BSZB 4BEPA 4U0ZA 4ME2A 4MS6A 4U0SA 4GYWA 4CGVA 5KJMA 3ISMC 2WQHA 3E30A 2V8SE 3GZ2A 3CQCB 4L7TA 4I6GA 3BUAA 3LS8A 2XGOA 3Q9NC 4PS8A 3QDNA 1UN8A 4DK5A 4HRLA 1DCQA 2YQ8A 3CV0A 3DSWA 4EPZA 3SO8A 4AM9A 3DBSA 4HS2A 1ZBPA 3CHSA 3NZSA 4PUCA 1HZ4A 4GTSA 3DSSA 3J5QB 3T5XA 4GZ5A 3LPZA 4XKCA 3ZRHA 4UI9C 1MX4A 4N5QA 1O5MA 1WY6A 3ZKJA 4K0RA 3OXFA 3AS4A 1OT8A 5J90A 3U4TA 5T4YA 5HKPA 1H2UA 3JCKC 4PS3A 3L54A 2FEZA 3B13A 3PE3A 3NBNB 3ESLA 3HDXA 4ANVA 3FTSA 5AQ7A 3DXMG 3ML9A 3SFXA 4RLYA 3FU6A 3QB2A 3R9AB 4HFGA 3FTXA 1MJ0A 2IY0C 4DX2A 4J8EA 4C0EA 1HO8A 4HLLA 1N95A 1OWNA 3HXFA 5ENOD 3DSUA 2C0MA 5LFAA 1SW6A 4GPMA 5FZSA 4F53A 4O60A 4G23A 4WNFA 2J09A 2PZIA 3U66A 4UI9K 3DXKG 2IFUA 2RD0A 3U9WA 2Y1LE 1KT0A 4NRHB 5JHBA 2DVWA 3HXBA 4FP7A 4A3TA 3CVXA 3ZW3A 4AXHA 3UM1A 4RG6A 1X5BA 3SD5A 3NF1A 1Z3XA 3TWRA 3PRZA 4L2LA 1H19A 2AWIA 2MRIA 4NURA 2P9KG 5ANLA 1U2VG 1KZOA 2XEVA 3D9IA 3FU3A 2MOWA 3FH5A 5BXOA 2X6IA 4F1SA 4LERA 2JEKA 3CHOA 4BTBA 1S0PA 2DCPA 4W9RA 4ANWA 4ILGA 4ATZD 4U0UA 4U96D 4FLHA 5EIBE 3T9KA 3TWWA 3DEPA 2VSNA 3MJWA 2GW1A 2WM9A 1XNFA 2Q7FA 4I2WA 2GROB 3EHRA 1WG0A 3Q49B 1TJFA 3D9NA 2LAIA 3FH8A 3Q78A 4YNDA 3EU5A 4DI4A 1S64A 3Q15A 1TNUA 4DX7D 4QQIA 3FFLA 4FHJA 4JZYA 5AIJA 3G2VA 4I6EA 5HQ8A 4HOUA 3LXUX 4HOTA 4APFA 2GRLA 3PVLA 4JD2G 1TNBA 4XI9A 2J8SD 3FUEA 2IEJA 2XGMA 4YDEA 4XIFA 3MKQA 2WXGA 2FO1E 1A5EA 3UPVA 4J6IA 4EHMA 3L16A 2B0OE 4GAAA 2X6JA 4HLEA 3L08A 2BEDA 3ZIMA 3MCXA 3APCA 2M63A 3UTMA 1HS6A 3FY4A 3L82A 1B89A 1D8DA 3KSLA 4A55A 2H6IA 2R05A 4N5CA 1SZAA 2XZTG 1H6OA 1HXIA 4UWKA 2IU1A 2XHEA 3RIBA 3ULYA 3UKRG 2OV8A 5ARFA 2LUHA 3E37A 1O1TA 4CGWA 1ZU2A 3RU0A 2ZIRA 3S7JA 4G8KA 3FDHA 4A1GA 4CRWA 4FJYA 3OXGA 2UY1B 4RQIA 3PZDA 4KMOA 1H2VC 3R9MA 2V5FA 2EIJE 2AW6A 1SA5A 3ZN3A 4WWNA 3ESKA 1QYMA 2I1KA 3FH7A 3QKYA 2F37A 3QJZA 1BPOA 5EILA 3SGHA 3FUNA 4MRUA 3O48A 3VTYA 4H7YA 3SF4A 1NP7A 5G05C 4I1OB 3ASNE 2XENA 3C3OA 5HS0A 4J8FA 1RW2A 4QFVA 5D0OD 5AQ9A 2XZDG 3AU5A 4UWHA 2J49A 1NA0A 4HI8A 5JJ6A 2YHCA 3UIPC 4J0UA 2XRZA 3ZXPA 3FUKA 4GTMA 2P58C 4CDRA 4Z68A 3GYZA 3T8MA 3QARA 3QWVA 1IHGA 2KATA 5JMND 2I9CA 3LY8A 5FT9A 4H7XA 4TXRA 1H6PA 2I6HA 5FQ4A 2WXQA 3PZ2A 4ANXA 2VQ2A 4KVMA 3TWQA 2EINE 2QFCA 2VSOE 1PC2A 1TNOA 4FULA 2DYSE 2EIME 3MYVA 2FI7A 4G11A 3TG4A 3RSEG 5FZRA 3R7QA 3UM0A 2H6GA 4U8HA 3UIOC 1UN9A 5J08A 3PEUB 4UWLA 3UKUG 4AJWA 3P2BA 4JHRA 5CMWA 4IYPA 4JW1A 2ETBA 3W9GA 4WNDA 4F3VA 1E7UA 2P2CP 2VGEA 2LSVA 3RAUA 2LO6A 4HB5A 5ENNA 4I43A 5B1AE 2P9SG 5H7PA 3P1UA 3AAAC 3BQOA 4HVBA 1AWCB 3CHQA 4FC8A 1S70B 3HHMA 4O1OA 2QZAA 1OWPA 3LKUA 3IEGA 2KCLA 2E0IA 5AJLA 4OVVA 2L9BA 1JPLA 1UJKA 2PL2A 1OXJA 3EDTB 3Q79A 2Y4TA 1JWGA 3HRAA 3JQ0A 2I2OA 4R7LA 1JCRA 3L22A 2WXOA 3QWPA 2WXNA 3GZ1A 4A1SA 3ASFA 3PUKA 2IONA 4CZ2D 4B8AA 3HIZA 4XE0A 4FJZA 1OWLA 2BKKB 2RFMA 3DSTA 1DNPA 2XQ0A 1OUVA 3FTVA 3UUXA 4JHKA 2R03A 4RVBA 3E32A 3EIQC 3TWUA 4J8DA 3MX3A 1JCSA 5BUZA 2XRYA 5D0QD 2PQNA 3TL5A 3EU9A 3ONKA 3Q73A 5LOZA 5G2NA 3GZSA 4LSZE 4B93B 4AV7A 3UX4A 3AU4A 1YCSB 2V5QC 3ZHEA 5ITZF 3EUVA 4F1PA 1RZ4A 2XPIA 1Y6IA 4YVQC 5BXUA 1BD8A 4U63A 3ZGQA 2NYJA 5T8IA 1BLXB 2KM4A 2VGYA 3MKRA 2P9LG 3NAWA 1UJJA 2XEEA 4BSXA 1JWFA 5KBAA 4MKTA 1KT1A 5D66A 2I1JA 2PM7A 5CECB 3IV0A 1Z6TA 2ONDA 3Q4AB 4BX8A 5BNWA 4N39A 4LNUD 2HM8A 3QOUA 1N54A 2ZISA 4G2VA 4LEUA 2P9IG 4DLOA 3WXXA 1MQSA 2WB2A 3UINC 3ABLE 3BEEA 2WXIA 4FA6A 1XGWA 3PE4A 3B7RL 3BU8A 3K9IA 4D10C 3KAEA 5FQ8A 3G2SA 4B0ZA 4KZCA 3ZNGA 1N0QA 1FCHA 4ILHB 4U07A 2E2EA 1LF8A 5EKQD 3Q9UC 2X6HA 1KLXA 2WXJA 3AG1E 3RJVA 2WMNA 1HX8A 4AY6A 1YMPA 3ZXSA 2A5UA 3FTUA 2L0TB 2R5SA 4JEUA 4M3OA 5BPPA 3FEYA 4WUYA 2GRMA 5CHEE 3VTXA 3HXDA 4OVUA 3E4BA 4K5CA 2GGFA 3OXLA 3JUIA 4GPKA 4BX9A 4PS7A 3L9TA 2CG3A 3IKOB 4BETA 3F6QA 3V79K 1N4SA 2XEHA 3CQGB 2Y3AA 3SFYA 4GTTA 3LCAA 1OY3D 1NZNA 2DZNA 2VGXA 3NQPA 2OVFA 1K8KG 5CCMA 4WNEA 4FADA 3CVUA 4GYOA 2LXLA 1S63A 3CVWA 5EX3A 5FINA 3UM2A 1HG5A 3T5VA 3IHVA 2C0LA 2OOEA 4BESA 2WMOA 4UWFA 5M72A 3FEXA 2VGXB 4JHJA 4HBDA 4UQXA 2HO1A 5EN5D 3CHMA 4UI9J 1N11A 3PREA 5CRUA 4CYMD 4YDOA 3PNTB 4L2YA 3X2QE 3DSVA 1E8ZA 2CHWA 1UG3A 5ENTD 1BI7B 2JABA 4U95D 3LEWA 1G3NB 1HG2A 4I9CA 3OTNA 3CVNA 3QC1A 3IBEA 4DX6D 5AN8A 4Q69A 5EDSA 1Y8MA 3CK9A 5G04J 1FPPA 4UWGA 2BUGA 1K1AA 3D9HA 1IKND 2EILE 3KD7A 1N0RA 2IF4A 1ELRA 4N3BA 4HXIA 2F8YA 4U8VD 4JVSA 2L0IA 3ZYQA 3NOCD 3G2TA 3B7BA 3HYMB 2X38A 1MX2A 5A6CA 2R02A 3NB2A 1V55E 1D9SA 3CGHA 4A63B 4NQ0A 3ONLA 3Q5MA 3FTZA 4WAFA 5C2YA 5ARGA 4CDMA 4G24A 5CMYA 4FU3A 3MGBA 2UWJG 4AY5A 1HU3A 3AJIA 3DWLG 1E8YA 3EHQA 3VLFA 4WWPA 3D9OA 4APOA 4B8CB 3ZPJA 3PS6A 1UOHA 3RRUA 3VLDA 2LSUA 2R59A 3CIAA 3AG3E 5LP0A 2GRPB 3DRAA 4I6JA 5JJ7A 3IHYA 1TEZA 5FZQA 2AXZA 4DX1A 4G8LA 1Z5SC 2OEVA 3CSTA 3QNKA 1TN7A 4GMRA 4G1TA 4DUIA 2KCVA 4GA2A 3EIJA 1HF8A 3ASGA 2WPVA 5CRVA 3T8KA 5JA4D 3JXJA 1NA3A 1ZB1A 4ANUA 1NFIE 1IXVA 2AJAA 5BV1A 1QNFA 5FQ7A 3TAXA 4P29A 2IO2C 3KEZA 3D3MA 2HE0A 5LX8A 1IQRA 3G2WA 4O6FA 4J8SA 2WXFA 4J7WA 4HNAD 5KCMA 3L13A 4IULA 3ML8A 1FT1A 1WAO1 4GZDA 2LNIA 4C48B 4HI9A 4V3IA 3CKCA 5DBKA 1PAQA 3UXGA 1KZPA 4XKBA 4DRXE 4GMLA 2J9QA 4KZ0A 4GA1A 4DJAA 3HVEB 1OCRE 1Q2ZA 4CT4A 3I4GA 2YHEA 4TXPA 4WNGA 4TRQA 4I2ZA 1QQEA 5AAOA 1PY1A 2CFZA 4M7CA 2FBNA 1SZ9A 1FT2A 4L1BA 1W3BA 4K5BA 3EHNA 3ABME 4JA9A 2FULA 3CSFA 4GZ6A 3CK8A 4BT9A 4HQDA 1X81A 1TNYA 3U64A 3UQ3A 2AXUA 3UT7A 1E8WA 3JYSA 3QWWA 3E34A 2GRQB 3O4ZA 2CFUA 2P9PG 2BKGA 3D9KA 5CEDB 3QK0A 3CR3A 1H2TC 2KBXA 2R17C 4K5AB 4XI0A 4EQFA 3ZU7B 4GTVA 4AVXA 3SZ7A 3LVQE 2DYRE 4Y6WA 5FWQA 2AXVA 4PDXA 2DWZA 5G05J 2P9NG 2KC7A 2P9UG 2IJGX 3TWVA 3LJ3A 1MHQA 1WDYA 4X8QA 3ASDA 5B3SE 3C98A 3ZVVA 3VLEA 2RFAA 1IYGA 4NACA 2VTBB 1HE8A 3PEVB 3W9FA 4TUUA 2KZTA 2OVBA 3SHFA 1E7VA 2NSZA 3D9JA 3CKBA 4EZLA 1A17A 4F6RD 2HR2A 5CBNA 1N4PA 2FO7A 4L23A 2J4BA 2CG2A 5KJLA 4JA7A 2ZGGA 3V2OA 1N9AA 3BG1B 1TR4A 3RO2A 5G55A 3RO3A 3ASOE 4BWRA 1YYHA 4WWOA 3CVPA 3DPYA 4ACLA 2WQ6A 2ETAA 3FU5A 4ABNA 4UQZA 5ENPD 4CEMA 2XPZA 4BERA 1O1RA 3N71A 5EIDA 1HH8A 5A23A 4ILIA 2QY7A 3ZYMA 3CVVA 3TJPA 2ZGDA 1E8XA 4LCTA 2FF4A 2X6FA 5FQ6A 1TYQG 1HFAA 2RG8A 4LG6A 4AP2A 1FVHA 2RKKA 5CCLA 4N3CA 2PNNA 1IHBA 3FUJA 5T3RA 3MEKA 4GA0A 4ZHBA 3ULQA 3ZUVB 4DPRA 2XS8A 5KNHD 5EX0A 1L5JA 3SFZA 4E6HA 2QYUA 3IXEA 2WXRA 1DC2A 4JB8P 3L6AA 1AP7A 1SVXA 1TN8A 4LNGA 3CLJA 1MX6A 3EJNA 4GCNA 1WM5A 2IOLA 4A3VA 2X3MA 3HXCA 4I1MA 4GZCA 2H6HA 3RRMB 3APDA 3AG4E 3PDNA 1TNZA 4LRZA 4L9PA 3D9PA 2LXMA 2GRNB 2DBAA 4JEHA 4CCAA 2H6FA 1QBQA 1EF1C 3CVQA 3DEOA 3DSXA 4I9EA 3FUDA 1OCOE 4G26A 5AJDA 1OWOA 3PUJA 3V31A 3TXNA 2A4ZA 3I3NA 2DZOA 1U3CA 3Q7AA 5AYWD 1EDUA 4JL0A 3AS8A 2WQ7A 3NZUA 4HRNA 2XCBA 3QAQA 3C3QA 4MBGA 3CHRA 3PNLB 3URZA 5FTPA 5ENQD 1E96B 1K3ZD 4KBQA 5HI7A 1QZ2A 3SBSA 5KJKA 3G2UA 4B94A 2PQRA 1SA4A 5KWDA 3ZHEB 3C3RA 3WG7E 1TN6A 3FTWA 2WVIA 4GYYA 4HOQA 2ZU6B 2B6CA 1Z3YA 5AENA 3JUEA 2IO3C 3KS2A 4GU5A 3TWSA 3U3WA 3ENEA 3SBTB 2Y4UA 1FVFA 4U04A 1V54E 4KVOA 3JQ1A 2QC9A 2WXHA 5DIZA 2KCKA 2HYZA 5JJTA 4KXKB 2ZXWE 5E76A 2V0PA 5FIOA 4GB9A 2VTBA 5LCWJ 2QYJA 4CDNA 3S7BA 1N4QA 4YDYA 5JHAA 2WXPA 4Q94A 5BW8C 1DVPA 4J8YA 3UT4A 3TG5A 5AQBA 3AG2E 3PZ3A 4C0MA 4JPSA 2V4HC 4O1PA 2PM6A 2DIWA 4BT8A 3MV2B 3TWTA 1MYOA 3SI5A 4HOSA 2YNQA 3SQVA 4BFRA 2ETCA 3I5PA 4GTPA 1EYHA 3C72A 2XCCA 5BT1A 5CERB 3CVYA 2X6KA 3Q47B 1INZA 5CBOA 2VSXE 3Q75A 3UT8A 5AQAA 4RSYA 5EYLA 2J08A 2ILRA 4KYOB 5CEAA 3UMVA 1ELKA 4YDWA 4C9BB 4MLPA 5ENRD 3GW4A 3I4RB 3FUMA 1BU9A 2NC9A 4DI3A 4XX5A 3EHMA 3FHEA 4ZFHA 2V4LA
chains in the Genus database with same CATH topology
1E8WA 3FULA 3TGOA 5BUZA 2XRYA 4FP7A 4GZ3A 4A3TA 3CVXA 3ZW3A 3JYSA 3QWWA 4N2QA 5D0QD 3O4ZA 2PQNA 3TL5A 2XGSA 3FUFA 4AEZC 4AXHA 3ONKA 5G2NA 2CFUA 4RG6A 1X5BA 5LOZA 4CT0A 3GZSA 4AV7A 3D9KA 2EQXA 3SD5A 3UX4A 4N2SA 3QK0A 2YINA 3MKQB 3NF1A 1Z3XA 3B7UX 3CR3A 3AU4A 1H2TC 3PRZA 4XZ4A 2R17C 3ZHEA 4URKA 4L2LA 1H19A 2AWIA 2L6JA 3APFA 2MRIA 4NURA 2XPIA 4XI0A 1Y6IA 4EQFA 5E75A 5ANLA 4AVXA 3SZ7A 4YVQC 2XEVA 3D9IA 3FU3A 4U63A 1U3DA 2VJ8A 3ZGQA 2KZTB 2MOWA 3LVQE 3FH5A 2X6IA 4F1SA 4LERA 5T8IA 2JEKA 3CHOA 3LYAA 4GCOA 4Y6WA 2CHZA 1H0AA 2AXVA 4PDXA 5FWQA 1S0PA 4BTBA 3LDZA 5G05J 2KM4A 2VGYA 4B89A 3LY7A 2DCPA 2KC7A 3MKRA 4W9RA 4ANWA 5ANRA 4EZJA 1UJJA 4ILGA 1GW6A 2IJGX 4BSXA 4U0UA 1JWFA 3FTYA 3LJ3A 1MHQA 2AVPA 4FLHA 4I1AA 4MKTA 3FUHA 2NXPA 1KT1A 3ASDA 2VSNA 3MJWA 3C98A 2GW1A 2I1JA 2PM7A 2WM9A 3ZVVA 3IV0A 3VLEA 1XNFA 1Z6TA 2ONDA 3RK6A 3Q4AB 4BX8A 2Q7FA 4I2WA 5G04C 5BNWA 4N39A 1IYGA 4NACA 2VTBB 1HE8A 4OYSA 3PEVB 2HM8A 3Q49B 3QOUA 1N54A 1TJFA 4G2VA 4TUUA 3D9NA 2LAIA 2KZTA 4JC8A 4LEUA 3S7FA 4DLOA 1N52A 3WXXA 1MQSA 3FH8A 2OVBA 3SHFA 2WB2A 2UY1A 1E7VA 4YNDA 4IRUA 2NSZA 3HVEA 3L17A 4DI4A 3BEEA 3FP3A 2WXIA 4FA6A 4LUNU 3D9JA 3CKBA 1XGWA 3B7RL 3K9IA 3PE4A 4D10C 5BV0A 4EZLA 3CHPA 1A17A 3KAEA 2HR2A 3Q15A 5FQ8A 2J4DA 3G2SA 4B0ZA 2FO7A 5C1DA 3MZLB 4AOFA 1SQMA 3FFLA 4KZCA 4L23A 2J4BA 4FHJA 4JZYA 2CG2A 5AIJA 3G2VA 5KJLA 1FCHA 4ILHB 4U07A 2E2EA 4JA7A 1LF8A 5EKQD 1JUQA 4I6EA 5HQ8A 4HOUA 1UW4B 3LXUX 2X6HA 4HOTA 1KLXA 4APFA 3CVLA 3MV3B 2WXJA 3BG1B 2GRLA 3RJVA 3RO2A 2WMNA 5G55A 3RO3A 3PVLA 4BWRA 4EBAG 4XI9A 1HX8A 3FUEA 4WWOA 4AY6A 3ZXSA 3CVPA 2XGMA 4ACLA 4FLBA 2A5UA 2WQ6A 3FTUA 3FU5A 3MKQA 4XIFA 4UQZA 2C2LA 4ABNA 2L0TB 1H6KA 2R5SA 3RRNB 4CEMA 4JEUA 2XPZA 3B7SA 2WXGA 3RKVA 4M3OA 3N71A 5BPPA 1EPUA 3UPVA 4J6IA 4UQYA 2BF0X 1HH8A 2WXLA 3FEYA 3CK7A 4WUYA 2GRMA 3L16A 5A7DB 5A23A 4ILIA 5CHEE 3FU0A 4KT6B 1VDYA 2IQCA 2QY7A 3VTXA 3ZYMA 4GAAA 3TJPA 3CVVA 4OVUA 1E8XA 4LCTA 2FF4A 1ELWA 2X6JA 3E4BA 3L08A 2GGFA 4HLEA 2CHXA 3OXLA 3ZIMA 3MCXA 3APCA 3JUIA 2M63A 4GPKA 2X6FA 5FQ6A 4PS7A 4BX9A 1HFAA 1HS6A 2RG8A 3FY4A 2BTDA 1B89A 2CG3A 3IKOB 4AP2A 1FVHA 2WXKA 3LVRE 5CCLA 4A55A 4N3CA 4N5CA 1SZAA 3CQGB 2Y3AA 3FUJA 3LCAA 4UWKA 1HXIA 2IU1A 2XHEA 5T3RA 1NZNA 3OAWA 2VGXA 3PH0C 3NQPA 3MEKA 4GA0A 3RIBA 2JLBA 2OVFA 3AS5A 3ULQA 5KJNA 5CCMA 4WNEA 4FADA 2OV8A 5ARFA 4DPRA 4N3AA 2VSYA 5EX0A 3CVUA 1TJCA 1L5JA 4GYOA 3SFZA 4E6HA 2WXRA 4CGWA 1ZU2A 3RU0A 3CVWA 5EX3A 3S7JA 3L6AA 1HG5A 4ATGA 3T5VA 3IHVA 2C0LA 2OOEA 3FDHA 4EBAA 2WMOA 2XPYA 3BG0B 3CLJA 4UWFA 4A1GA 4ACKA 5M72A 3FEXA 3ASHA 3EJNA 4GCNA 1WM5A 4CRWA 2IOLA 4FJYA 4A3VA 3OXGA 4HORA 2X3MA 4I1MA 2VGXB 4GZCA 2UY1B 1IQUA 4JHJA 3RRMB 3APDA 4UQXA 3PZDA 4Q96A 4KMOA 2HO1A 3PDNA 1H2VC 3CHMA 4UI9J 2V5FA 4G25A 3PREA 2AW6A 4BY6A 3ZN3A 4LRZA 4WWNA 3ESKA 2I1KA 3PNTB 3D9PA 3FH7A 3QKYA 4JXTA 4L2YA 3CEQA 3QJZA 1BPOA 1E8ZA 4E85A 2DBAA 3SGHA 2CHWA 3MA5A 1UG3A 3FUNA 3LEWA 4MRUA 1HG2A 3O48A 4I9CA 4JEHA 3TXMA 3VTYA 4CCAA 4H7YA 3CVQA 1EF1C 3OTNA 3SF4A 1NP7A 3CVNA 5G05C 3ZFWA 4BTAA 4I1OB 4I9EA 3QC1A 3IBEA 3FUDA 3FUIA 4G26A 3ZYLA 5AJDA 1OWOA 3PUJA 3ZEFA 4Q69A 5EDSA 1Y8MA 4J8FA 3TXNA 2A4ZA 3I3NA 4QFVA 5D0OD 1U3CA 3CK9A 5G04J 2MHKA 3AU5A 2LAHA 4UWHA 2J49A 4UWGA 1NA0A 4I17A 2BUGA 5AYWD 1EDUA 4JL0A 3AS8A 3LY9A 5JJ6A 1YA0A 3D9MA 2YHCA 2WQ7A 2IOSA 4AIFA 3NZUA 3DPDA 3KD7A 3R7RA 2XCBA 4F7AA 2J07A 2IF4A 3QAQA 5FJYA 1ELRA 4N3BA 4J0UA 4HXIA 3S2AA 4JVSA 2XRZA 3CHRA 3PNLB 5LCWC 3URZA 2L0IA 2WXMA 3ZYQA 5FTPA 1E96B 4TV3A 3S7DA 3G2TA 3FUKA 3HYMB 2X38A 4KBQA 5HI7A 1QZ2A 5A6CA 2P58C 3SBSA 4CDRA 5KJKA 3G2UA 3CGHA 4GMJA 4NQ0A 3ONLA 4RG9A 4B94A 3Q5MA 2PQRA 2VYIA 3GYZA 4FHKA 3T8MA 3QARA 3FTZA 3QWVA 4WAFA 3FWVA 3ZHEB 1IHGA 5C2YA 2KATA 5ARGA 3FTWA 4CDMA 3B7TA 4G24A 5CMYA 4FU3A 2I9CA 3LY8A 5FT9A 4DLQA 1E90A 4YVOA 4Y6CA 4EZKA 3MGBA 2UWJG 2WVIA 4GYYA 4H7XA 4HOQA 4IN3B 1HU3A 3SNXA 2ZU6B 4AY5A 2I6HA 5FQ4A 1P5QA 1E8YA 3D9LA 3VLFA 3ZYKA 1Z3YA 4WWPA 3D9OA 5AENA 4APOA 4B8CB 3ZPJA 2WXQA 3KS2A 3PS6A 1OWMA 4PH4B 4EECA 4ANXA 2VQ2A 4GU5A 4K03A 4KVMA 3RRUA 3VLDA 3U3WA 2LSUA 4U0ZA 3ENEA 2R59A 3CIAA 3SBTB 4ME2A 2QFCA 4MS6A 4U0SA 2VSOE 2Y4UA 5LP0A 1FVFA 3IHYA 4GYWA 4I6JA 4U04A 4KVOA 4CGVA 5JJ7A 2WQHA 5KJMA 1TEZA 3JQ1A 1PC2A 5FZQA 4FULA 2V8SE 2WXHA 5DIZA 2AXZA 2KCKA 2HYZA 5JJTA 3GZ2A 3CQCB 3CSTA 4L7TA 3QNKA 4I6GA 4KXKB 5E76A 2V0PA 3MYVA 2FI7A 4G11A 4GB9A 3LS8A 4G1TA 3TG4A 5LCWJ 2VTBA 5FZRA 2XGOA 4CDNA 3S7BA 4PS8A 3R7QA 2KCVA 5JHAA 2WXPA 3QDNA 1UN8A 4DK5A 4GA2A 3EIJA 4U8HA 4Q94A 1HF8A 1DVPA 1UN9A 2YQ8A 5BW8C 3CV0A 3UT4A 3TG5A 3ASGA 5J08A 4EPZA 4C0MA 3PEUB 4JPSA 4UWLA 2WPVA 4AM9A 4AJWA 3P2BA 1NA3A 3DBSA 4JHRA 4HS2A 5CMWA 1ZBPA 3CHSA 4IYPA 4JW1A 3NZSA 4PUCA 4ANUA 1HZ4A 3T5XA 4GZ5A 5BV1A 3LPZA 4XKCA 1QNFA 3ZRHA 2PM6A 5FQ7A 3TAXA 4P29A 4UI9C 4WNDA 4F3VA 2DIWA 1E7UA 4BT8A 3KEZA 3D3MA 1WY6A 4K0RA 2LSVA 2LO6A 5LX8A 1IQRA 3G2WA 3OXFA 4I43A 5ENNA 4O6FA 3AS4A 4J8SA 2WXFA 3MV2B 3SI5A 5J90A 3U4TA 5T4YA 3P1UA 5KCMA 1H2UA 3JCKC 4PS3A 3L13A 4HVBA 3CHQA 3L54A 4FC8A 3HHMA 4IULA 3ML8A 4HOSA 2YNQA 2FEZA 1OWPA 3B13A 3PE3A 1WAO1 4BFRA 3I5PA 3IEGA 3LKUA 2KCLA 2E0IA 4GZDA 2LNIA 5AJLA 1EYHA 4OVVA 2L9BA 3ESLA 3HDXA 2XCCA 4ANVA 5BT1A 3FTSA 4V3IA 1JPLA 3CKCA 5DBKA 1UJKA 2PL2A 3CVYA 1PAQA 2X6KA 3EDTB 3Q47B 2Y4TA 1JWGA 3ML9A 3JQ0A 2I2OA 4R7LA 4XKBA 4GMLA 2J9QA 3FU6A 3QB2A 1INZA 3R9AB 4KZ0A 4HFGA 4GA1A 3FTXA 3L22A 2WXOA 4DJAA 3QWPA 2WXNA 3HVEB 2VSXE 3GZ1A 4J8EA 4A1SA 3ASFA 4CT4A 3I4GA 2YHEA 3UT8A 4WNGA 4C0EA 1HO8A 3PUKA 4TRQA 4I2ZA 4RSYA 1QQEA 2IONA 1PY1A 1OWNA 2CFZA 2FBNA 2J08A 1SZ9A 4L1BA 2ILRA 4B8AA 1W3BA 4KYOB 3HIZA 2C0MA 5LFAA 3EHNA 4XE0A 4JA9A 4FJZA 2FULA 3CSFA 3UMVA 1OWLA 1ELKA 5FZSA 4GZ6A 4F53A 4C9BB 4MLPA 1DNPA 2XQ0A 1OUVA 3CK8A 3FTVA 4G23A 4JHKA 3UUXA 4WNFA 4BT9A 3U64A 2J09A 3GW4A 3I4RB 4RVBA 3EIQC 3FUMA 2PZIA 3U66A 3UQ3A 4UI9K 2IFUA 2NC9A 2RD0A 3U9WA 4XX5A 4DI3A 3EHMA 4J8DA 1KT0A 3FHEA 2AXUA 3UT7A 4NRHB 2V4LA 5JHBA 3MX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D3M A;  4JHJ A;  2GGF A;  4B8A A;  1PAQ A;  2VSO E;  3JUI A;  1H2V C;  3RK6 A;  2RG8 A;  2FUL A;  2KZT B;  2I2O A;  1H2U A;  1H6K A;  4GML A;  4CEM A;  2HM8 A;  4C9B B;  4JHK A;  3L6A A;  4IUL A;  1N54 A;  1HU3 A;  2KZT A;  2ZU6 B;  1N52 A;  2VSX E;  3EIQ C;  4B89 A;  2IU1 A;  1UG3 A;  5ANR A;  1UW4 B;  1H2T C;  4CT4 A;  3FEX A;  3FEY A;  4B8C B;  2NSZ A;  4GMJ A;  4CRW A;  3EIJ A;  2IOL A;  2IOS A;  2ION A;  4LUN U; 
#chains in the Genus database with same CATH topology
 3FUL A;  3TGO A;  4GZ3 A;  4N2Q A;  4TUM A;  2XGS A;  3FUF A;  4AEZ C;  4CT0 A;  1NL4 A;  2EQX A;  4N2S A;  4XEI G;  2YIN A;  3MKQ B;  3B7U X;  4U8Y D;  4XZ4 A;  3C5R A;  4URK A;  3HXE A;  2L6J A;  3UI2 A;  3APF A;  1OCC E;  5E75 A;  1KPS B;  4UUC A;  1U3D A;  2VJ8 A;  2KZT B;  4GTQ A;  5KNG A;  3LYA A;  4GCO A;  2CHZ A;  1H0A A;  1DCE A;  3LDZ A;  4B89 A;  3LY7 A;  5ANR A;  4EZJ A;  1GW6 A;  3FTY A;  4U7E B;  2AVP A;  4I1A A;  3FUH A;  2NXP A;  5HRY A;  3NOG D;  3RK6 A;  5G04 C;  3KSQ A;  4OYS A;  3V2X A;  3S7F A;  4JC8 A;  1N52 A;  2UY1 A;  4IRU A;  3HVE A;  3L17 A;  3FP3 A;  4LUN U;  2Y69 E;  2Y0B G;  5BV0 A;  3CHP A;  2J4D A;  2OEW A;  2MYO A;  5C1D A;  3MZL B;  4AOF A;  4OAU C;  1SQM A;  4TXQ A;  1JUQ A;  1UW4 B;  2GRR B;  1OCZ E;  3CVL A;  3MV3 B;  3LJN A;  4EBA G;  4FLB A;  4GTR A;  5ENS D;  2C2L A;  1H6K A;  3RRN B;  1MZC A;  4DX5 D;  3B7S A;  3PZ4 A;  3RKV A;  1EPU A;  4UQY A;  2BF0 X;  2WXL A;  3CK7 A;  5A7D B;  4NIK A;  3FU0 A;  4KT6 B;  1VDY A;  2IQC A;  1ELW A;  2CHX A;  2KXP C;  1NI1 A;  2BTD A;  3B95 A;  2WXK A;  3LVR E;  4HRM B;  1LTX A;  3OAW A;  3PH0 C;  4OAV B;  2JLB A;  3AS5 A;  5KJN A;  3V30 A;  5D2M C;  3TWX A;  4N3A A;  2VSY A;  1TJC A;  4ATG A;  1D8E A;  4EBA A;  2OCC E;  3BG0 B;  2XPY A;  4ACK A;  3ASH A;  4HOR A;  1IQU A;  2F8X K;  4Q96 A;  2F0Y A;  1N4R A;  4G25 A;  2L6B A;  4BY6 A;  4LNB A;  4JXT A;  3CEQ A;  3SY2 A;  3ULE G;  4E85 A;  3MA5 A;  3TXM A;  3J5P A;  3ZFW A;  4BTA A;  2EIK E;  3E33 A;  3Q7F A;  2XS1 A;  3UM3 A;  3FUI A;  3ZYL A;  1JCQ A;  3ZEF A;  5B1B E;  3KEA A;  2A5E A;  3ABK E;  2MHK A;  2LAH A;  4GTO A;  3PZ1 A;  4I17 A;  2R2L A;  3LY9 A;  1YA0 A;  3D9M A;  2IOS A;  4AIF A;  3DPD A;  1O1S A;  3R7R A;  4F7A A;  2J07 A;  3JXI A;  5FJY A;  3S2A A;  5LCW C;  5IY5 E;  2WXM A;  4TV3 A;  3S7D A;  1N94 A;  1K1B A;  4GMJ A;  4RG9 A;  5EYP F;  2VYI A;  4FHK A;  1BI8 B;  3FWV A;  3HG0 D;  3B7T A;  1LD8 A;  4DLQ A;  1E90 A;  4YVO A;  4Y6C A;  4EZK A;  1LD7 A;  4IN3 B;  3SNX A;  1P5Q A;  3D9L A;  3ZYK A;  4EEC A;  4PH4 B;  1OWM A;  5AAR A;  4K03 A;  4BSZ B;  4BEP A;  4U0Z A;  4ME2 A;  4MS6 A;  4U0S A;  4GYW A;  4CGV A;  5KJM A;  3ISM C;  2WQH A;  3E30 A;  2V8S E;  3GZ2 A;  3CQC B;  4L7T A;  4I6G A;  3BUA A;  3LS8 A;  2XGO A;  3Q9N C;  4PS8 A;  3QDN A;  1UN8 A;  4DK5 A;  4HRL A;  1DCQ A;  2YQ8 A;  3CV0 A;  3DSW A;  4EPZ A;  3SO8 A;  4AM9 A;  3DBS A;  4HS2 A;  1ZBP A;  3CHS A;  3NZS A;  4PUC A;  1HZ4 A;  4GTS A;  3DSS A;  3J5Q B;  3T5X A;  4GZ5 A;  3LPZ A;  4XKC A;  3ZRH A;  4UI9 C;  1MX4 A;  4N5Q A;  1O5M A;  1WY6 A;  3ZKJ A;  4K0R A;  3OXF A;  3AS4 A;  1OT8 A;  5J90 A;  3U4T A;  5T4Y A;  5HKP A;  1H2U A;  3JCK C;  4PS3 A;  3L54 A;  2FEZ A;  3B13 A;  3PE3 A;  3NBN B;  3ESL A;  3HDX A;  4ANV A;  3FTS A;  5AQ7 A;  3DXM G;  3ML9 A;  3SFX A;  4RLY A;  3FU6 A;  3QB2 A;  3R9A B;  4HFG A;  3FTX A;  1MJ0 A;  2IY0 C;  4DX2 A;  4J8E A;  4C0E A;  1HO8 A;  4HLL A;  1N95 A;  1OWN A;  3HXF A;  5ENO D;  3DSU A;  2C0M A;  5LFA A;  1SW6 A;  4GPM A;  5FZS A;  4F53 A;  4O60 A;  4G23 A;  4WNF A;  2J09 A;  2PZI A;  3U66 A;  4UI9 K;  3DXK G;  2IFU A;  2RD0 A;  3U9W A;  2Y1L E;  1KT0 A;  4NRH B;  5JHB A;  2DVW A;  3HXB A;  4FP7 A;  4A3T A;  3CVX A;  3ZW3 A;  4AXH A;  3UM1 A;  4RG6 A;  1X5B A;  3SD5 A;  3NF1 A;  1Z3X A;  3TWR A;  3PRZ A;  4L2L A;  1H19 A;  2AWI A;  2MRI A;  4NUR A;  2P9K G;  5ANL A;  1U2V G;  1KZO A;  2XEV A;  3D9I A;  3FU3 A;  2MOW A;  3FH5 A;  5BXO A;  2X6I A;  4F1S A;  4LER A;  2JEK A;  3CHO A;  4BTB A;  1S0P A;  2DCP A;  4W9R A;  4ANW A;  4ILG A;  4ATZ D;  4U0U A;  4U96 D;  4FLH A;  5EIB E;  3T9K A;  3TWW A;  3DEP A;  2VSN A;  3MJW A;  2GW1 A;  2WM9 A;  1XNF A;  2Q7F A;  4I2W A;  2GRO B;  3EHR A;  1WG0 A;  3Q49 B;  1TJF A;  3D9N A;  2LAI A;  3FH8 A;  3Q78 A;  4YND A;  3EU5 A;  4DI4 A;  1S64 A;  3Q15 A;  1TNU A;  4DX7 D;  4QQI A;  3FFL A;  4FHJ A;  4JZY A;  5AIJ A;  3G2V A;  4I6E A;  5HQ8 A;  4HOU A;  3LXU X;  4HOT A;  4APF A;  2GRL A;  3PVL A;  4JD2 G;  1TNB A;  4XI9 A;  2J8S D;  3FUE A;  2IEJ A;  2XGM A;  4YDE A;  4XIF A;  3MKQ A;  2WXG A;  2FO1 E;  1A5E A;  3UPV A;  4J6I A;  4EHM A;  3L16 A;  2B0O E;  4GAA A;  2X6J A;  4HLE A;  3L08 A;  2BED A;  3ZIM A;  3MCX A;  3APC A;  2M63 A;  3UTM A;  1HS6 A;  3FY4 A;  3L82 A;  1B89 A;  1D8D A;  3KSL A;  4A55 A;  2H6I A;  2R05 A;  4N5C A;  1SZA A;  2XZT G;  1H6O A;  1HXI A;  4UWK A;  2IU1 A;  2XHE A;  3RIB A;  3ULY A;  3UKR G;  2OV8 A;  5ARF A;  2LUH A;  3E37 A;  1O1T A;  4CGW A;  1ZU2 A;  3RU0 A;  2ZIR A;  3S7J A;  4G8K A;  3FDH A;  4A1G A;  4CRW A;  4FJY A;  3OXG A;  2UY1 B;  4RQI A;  3PZD A;  4KMO A;  1H2V C;  3R9M A;  2V5F A;  2EIJ E;  2AW6 A;  1SA5 A;  3ZN3 A;  4WWN A;  3ESK A;  1QYM A;  2I1K A;  3FH7 A;  3QKY A;  2F37 A;  3QJZ A;  1BPO A;  5EIL A;  3SGH A;  3FUN A;  4MRU A;  3O48 A;  3VTY A;  4H7Y A;  3SF4 A;  1NP7 A;  5G05 C;  4I1O B;  3ASN E;  2XEN A;  3C3O A;  5HS0 A;  4J8F A;  1RW2 A;  4QFV A;  5D0O D;  5AQ9 A;  2XZD G;  3AU5 A;  4UWH A;  2J49 A;  1NA0 A;  4HI8 A;  5JJ6 A;  2YHC A;  3UIP C;  4J0U A;  2XRZ A;  3ZXP A;  3FUK A;  4GTM A;  2P58 C;  4CDR A;  4Z68 A;  3GYZ A;  3T8M A;  3QAR A;  3QWV A;  1IHG A;  2KAT A;  5JMN D;  2I9C A;  3LY8 A;  5FT9 A;  4H7X A;  4TXR A;  1H6P A;  2I6H A;  5FQ4 A;  2WXQ A;  3PZ2 A;  4ANX A;  2VQ2 A;  4KVM A;  3TWQ A;  2EIN E;  2QFC A;  2VSO E;  1PC2 A;  1TNO A;  4FUL A;  2DYS E;  2EIM E;  3MYV A;  2FI7 A;  4G11 A;  3TG4 A;  3RSE G;  5FZR A;  3R7Q A;  3UM0 A;  2H6G A;  4U8H A;  3UIO C;  1UN9 A;  5J08 A;  3PEU B;  4UWL A;  3UKU G;  4AJW A;  3P2B A;  4JHR A;  5CMW A;  4IYP A;  4JW1 A;  2ETB A;  3W9G A;  4WND A;  4F3V A;  1E7U A;  2P2C P;  2VGE A;  2LSV A;  3RAU A;  2LO6 A;  4HB5 A;  5ENN A;  4I43 A;  5B1A E;  2P9S G;  5H7P A;  3P1U A;  3AAA C;  3BQO A;  4HVB A;  1AWC B;  3CHQ A;  4FC8 A;  1S70 B;  3HHM A;  4O1O A;  2QZA A;  1OWP A;  3LKU A;  3IEG A;  2KCL A;  2E0I A;  5AJL A;  4OVV A;  2L9B A;  1JPL A;  1UJK A;  2PL2 A;  1OXJ A;  3EDT B;  3Q79 A;  2Y4T A;  1JWG A;  3HRA A;  3JQ0 A;  2I2O A;  4R7L A;  1JCR A;  3L22 A;  2WXO A;  3QWP A;  2WXN A;  3GZ1 A;  4A1S A;  3ASF A;  3PUK A;  2ION A;  4CZ2 D;  4B8A A;  3HIZ A;  4XE0 A;  4FJZ A;  1OWL A;  2BKK B;  2RFM A;  3DST A;  1DNP A;  2XQ0 A;  1OUV A;  3FTV A;  3UUX A;  4JHK A;  2R03 A;  4RVB A;  3E32 A;  3EIQ C;  3TWU A;  4J8D A;  3MX3 A;  1JCS A;  5BUZ A;  2XRY A;  5D0Q D;  2PQN A;  3TL5 A;  3EU9 A;  3ONK A;  3Q73 A;  5LOZ A;  5G2N A;  3GZS A;  4LSZ E;  4B93 B;  4AV7 A;  3UX4 A;  3AU4 A;  1YCS B;  2V5Q C;  3ZHE A;  5ITZ F;  3EUV A;  4F1P A;  1RZ4 A;  2XPI A;  1Y6I A;  4YVQ C;  5BXU A;  1BD8 A;  4U63 A;  3ZGQ A;  2NYJ A;  5T8I A;  1BLX B;  2KM4 A;  2VGY A;  3MKR A;  2P9L G;  3NAW A;  1UJJ A;  2XEE A;  4BSX A;  1JWF A;  5KBA A;  4MKT A;  1KT1 A;  5D66 A;  2I1J A;  2PM7 A;  5CEC B;  3IV0 A;  1Z6T A;  2OND A;  3Q4A B;  4BX8 A;  5BNW A;  4N39 A;  4LNU D;  2HM8 A;  3QOU A;  1N54 A;  2ZIS A;  4G2V A;  4LEU A;  2P9I G;  4DLO A;  3WXX A;  1MQS A;  2WB2 A;  3UIN C;  3ABL E;  3BEE A;  2WXI A;  4FA6 A;  1XGW A;  3PE4 A;  3B7R L;  3BU8 A;  3K9I A;  4D10 C;  3KAE A;  5FQ8 A;  3G2S A;  4B0Z A;  4KZC A;  3ZNG A;  1N0Q A;  1FCH A;  4ILH B;  4U07 A;  2E2E A;  1LF8 A;  5EKQ D;  3Q9U C;  2X6H A;  1KLX A;  2WXJ A;  3AG1 E;  3RJV A;  2WMN A;  1HX8 A;  4AY6 A;  1YMP A;  3ZXS A;  2A5U A;  3FTU A;  2L0T B;  2R5S A;  4JEU A;  4M3O A;  5BPP A;  3FEY A;  4WUY A;  2GRM A;  5CHE E;  3VTX A;  3HXD A;  4OVU A;  3E4B A;  4K5C A;  2GGF A;  3OXL A;  3JUI A;  4GPK A;  4BX9 A;  4PS7 A;  3L9T A;  2CG3 A;  3IKO B;  4BET A;  3F6Q A;  3V79 K;  1N4S A;  2XEH A;  3CQG B;  2Y3A A;  3SFY A;  4GTT A;  3LCA A;  1OY3 D;  1NZN A;  2DZN A;  2VGX A;  3NQP A;  2OVF A;  1K8K G;  5CCM A;  4WNE A;  4FAD A;  3CVU A;  4GYO A;  2LXL A;  1S63 A;  3CVW A;  5EX3 A;  5FIN A;  3UM2 A;  1HG5 A;  3T5V A;  3IHV A;  2C0L A;  2OOE A;  4BES A;  2WMO A;  4UWF A;  5M72 A;  3FEX A;  2VGX B;  4JHJ A;  4HBD A;  4UQX A;  2HO1 A;  5EN5 D;  3CHM A;  4UI9 J;  1N11 A;  3PRE A;  5CRU A;  4CYM D;  4YDO A;  3PNT B;  4L2Y A;  3X2Q E;  3DSV A;  1E8Z A;  2CHW A;  1UG3 A;  5ENT D;  1BI7 B;  2JAB A;  4U95 D;  3LEW A;  1G3N B;  1HG2 A;  4I9C A;  3OTN A;  3CVN A;  3QC1 A;  3IBE A;  4DX6 D;  5AN8 A;  4Q69 A;  5EDS A;  1Y8M A;  3CK9 A;  5G04 J;  1FPP A;  4UWG A;  2BUG A;  1K1A A;  3D9H A;  1IKN D;  2EIL E;  3KD7 A;  1N0R A;  2IF4 A;  1ELR A;  4N3B A;  4HXI A;  2F8Y A;  4U8V D;  4JVS A;  2L0I A;  3ZYQ A;  3NOC D;  3G2T A;  3B7B A;  3HYM B;  2X38 A;  1MX2 A;  5A6C A;  2R02 A;  3NB2 A;  1V55 E;  1D9S A;  3CGH A;  4A63 B;  4NQ0 A;  3ONL A;  3Q5M A;  3FTZ A;  4WAF A;  5C2Y A;  5ARG A;  4CDM A;  4G24 A;  5CMY A;  4FU3 A;  3MGB A;  2UWJ G;  4AY5 A;  1HU3 A;  3AJI A;  3DWL G;  1E8Y A;  3EHQ A;  3VLF A;  4WWP A;  3D9O A;  4APO A;  4B8C B;  3ZPJ A;  3PS6 A;  1UOH A;  3RRU A;  3VLD A;  2LSU A;  2R59 A;  3CIA A;  3AG3 E;  5LP0 A;  2GRP B;  3DRA A;  4I6J A;  5JJ7 A;  3IHY A;  1TEZ A;  5FZQ A;  2AXZ A;  4DX1 A;  4G8L A;  1Z5S C;  2OEV A;  3CST A;  3QNK A;  1TN7 A;  4GMR A;  4G1T A;  4DUI A;  2KCV A;  4GA2 A;  3EIJ A;  1HF8 A;  3ASG A;  2WPV A;  5CRV A;  3T8K A;  5JA4 D;  3JXJ A;  1NA3 A;  1ZB1 A;  4ANU A;  1NFI E;  1IXV A;  2AJA A;  5BV1 A;  1QNF A;  5FQ7 A;  3TAX A;  4P29 A;  2IO2 C;  3KEZ A;  3D3M A;  2HE0 A;  5LX8 A;  1IQR A;  3G2W A;  4O6F A;  4J8S A;  2WXF A;  4J7W A;  4HNA D;  5KCM A;  3L13 A;  4IUL A;  3ML8 A;  1FT1 A;  1WAO 1;  4GZD A;  2LNI A;  4C48 B;  4HI9 A;  4V3I A;  3CKC A;  5DBK A;  1PAQ A;  3UXG A;  1KZP A;  4XKB A;  4DRX E;  4GML A;  2J9Q A;  4KZ0 A;  4GA1 A;  4DJA A;  3HVE B;  1OCR E;  1Q2Z A;  4CT4 A;  3I4G A;  2YHE A;  4TXP A;  4WNG A;  4TRQ A;  4I2Z A;  1QQE A;  5AAO A;  1PY1 A;  2CFZ A;  4M7C A;  2FBN A;  1SZ9 A;  1FT2 A;  4L1B A;  1W3B A;  4K5B A;  3EHN A;  3ABM E;  4JA9 A;  2FUL A;  3CSF A;  4GZ6 A;  3CK8 A;  4BT9 A;  4HQD A;  1X81 A;  1TNY A;  3U64 A;  3UQ3 A;  2AXU A;  3UT7 A;  1E8W A;  3JYS A;  3QWW A;  3E34 A;  2GRQ B;  3O4Z A;  2CFU A;  2P9P G;  2BKG A;  3D9K A;  5CED B;  3QK0 A;  3CR3 A;  1H2T C;  2KBX A;  2R17 C;  4K5A B;  4XI0 A;  4EQF A;  3ZU7 B;  4GTV A;  4AVX A;  3SZ7 A;  3LVQ E;  2DYR E;  4Y6W A;  5FWQ A;  2AXV A;  4PDX A;  2DWZ A;  5G05 J;  2P9N G;  2KC7 A;  2P9U G;  2IJG X;  3TWV A;  3LJ3 A;  1MHQ A;  1WDY A;  4X8Q A;  3ASD A;  5B3S E;  3C98 A;  3ZVV A;  3VLE A;  2RFA A;  1IYG A;  4NAC A;  2VTB B;  1HE8 A;  3PEV B;  3W9F A;  4TUU A;  2KZT A;  2OVB A;  3SHF A;  1E7V A;  2NSZ A;  3D9J A;  3CKB A;  4EZL A;  1A17 A;  4F6R D;  2HR2 A;  5CBN A;  1N4P A;  2FO7 A;  4L23 A;  2J4B A;  2CG2 A;  5KJL A;  4JA7 A;  2ZGG A;  3V2O A;  1N9A A;  3BG1 B;  1TR4 A;  3RO2 A;  5G55 A;  3RO3 A;  3ASO E;  4BWR A;  1YYH A;  4WWO A;  3CVP A;  3DPY A;  4ACL A;  2WQ6 A;  2ETA A;  3FU5 A;  4ABN A;  4UQZ A;  5ENP D;  4CEM A;  2XPZ A;  4BER A;  1O1R A;  3N71 A;  5EID A;  1HH8 A;  5A23 A;  4ILI A;  2QY7 A;  3ZYM A;  3CVV A;  3TJP A;  2ZGD A;  1E8X A;  4LCT A;  2FF4 A;  2X6F A;  5FQ6 A;  1TYQ G;  1HFA A;  2RG8 A;  4LG6 A;  4AP2 A;  1FVH A;  2RKK A;  5CCL A;  4N3C A;  2PNN A;  1IHB A;  3FUJ A;  5T3R A;  3MEK A;  4GA0 A;  4ZHB A;  3ULQ A;  3ZUV B;  4DPR A;  2XS8 A;  5KNH D;  5EX0 A;  1L5J A;  3SFZ A;  4E6H A;  2QYU A;  3IXE A;  2WXR A;  1DC2 A;  4JB8 P;  3L6A A;  1AP7 A;  1SVX A;  1TN8 A;  4LNG A;  3CLJ A;  1MX6 A;  3EJN A;  4GCN A;  1WM5 A;  2IOL A;  4A3V A;  2X3M A;  3HXC A;  4I1M A;  4GZC A;  2H6H A;  3RRM B;  3APD A;  3AG4 E;  3PDN A;  1TNZ A;  4LRZ A;  4L9P A;  3D9P A;  2LXM A;  2GRN B;  2DBA A;  4JEH A;  4CCA A;  2H6F A;  1QBQ A;  1EF1 C;  3CVQ A;  3DEO A;  3DSX A;  4I9E A;  3FUD A;  1OCO E;  4G26 A;  5AJD A;  1OWO A;  3PUJ A;  3V31 A;  3TXN A;  2A4Z A;  3I3N A;  2DZO A;  1U3C A;  3Q7A A;  5AYW D;  1EDU A;  4JL0 A;  3AS8 A;  2WQ7 A;  3NZU A;  4HRN A;  2XCB A;  3QAQ A;  3C3Q A;  4MBG A;  3CHR A;  3PNL B;  3URZ A;  5FTP A;  5ENQ D;  1E96 B;  1K3Z D;  4KBQ A;  5HI7 A;  1QZ2 A;  3SBS A;  5KJK A;  3G2U A;  4B94 A;  2PQR A;  1SA4 A;  5KWD A;  3ZHE B;  3C3R A;  3WG7 E;  1TN6 A;  3FTW A;  2WVI A;  4GYY A;  4HOQ A;  2ZU6 B;  2B6C A;  1Z3Y A;  5AEN A;  3JUE A;  2IO3 C;  3KS2 A;  4GU5 A;  3TWS A;  3U3W A;  3ENE A;  3SBT B;  2Y4U A;  1FVF A;  4U04 A;  1V54 E;  4KVO A;  3JQ1 A;  2QC9 A;  2WXH A;  5DIZ A;  2KCK A;  2HYZ A;  5JJT A;  4KXK B;  2ZXW E;  5E76 A;  2V0P A;  5FIO A;  4GB9 A;  2VTB A;  5LCW J;  2QYJ A;  4CDN A;  3S7B A;  1N4Q A;  4YDY A;  5JHA A;  2WXP A;  4Q94 A;  5BW8 C;  1DVP A;  4J8Y A;  3UT4 A;  3TG5 A;  5AQB A;  3AG2 E;  3PZ3 A;  4C0M A;  4JPS A;  2V4H C;  4O1P A;  2PM6 A;  2DIW A;  4BT8 A;  3MV2 B;  3TWT A;  1MYO A;  3SI5 A;  4HOS A;  2YNQ A;  3SQV A;  4BFR A;  2ETC A;  3I5P A;  4GTP A;  1EYH A;  3C72 A;  2XCC A;  5BT1 A;  5CER B;  3CVY A;  2X6K A;  3Q47 B;  1INZ A;  5CBO A;  2VSX E;  3Q75 A;  3UT8 A;  5AQA A;  4RSY A;  5EYL A;  2J08 A;  2ILR A;  4KYO B;  5CEA A;  3UMV A;  1ELK A;  4YDW A;  4C9B B;  4MLP A;  5ENR D;  3GW4 A;  3I4R B;  3FUM A;  1BU9 A;  2NC9 A;  4DI3 A;  4XX5 A;  3EHM A;  3FHE A;  4ZFH A;  2V4L A; 
#chains in the Genus database with same CATH homology
 1E8W A;  3FUL A;  3TGO A;  5BUZ A;  2XRY A;  4FP7 A;  4GZ3 A;  4A3T A;  3CVX A;  3ZW3 A;  3JYS A;  3QWW A;  4N2Q A;  5D0Q D;  3O4Z A;  2PQN A;  3TL5 A;  2XGS A;  3FUF A;  4AEZ C;  4AXH A;  3ONK A;  5G2N A;  2CFU A;  4RG6 A;  1X5B A;  5LOZ A;  4CT0 A;  3GZS A;  4AV7 A;  3D9K A;  2EQX A;  3SD5 A;  3UX4 A;  4N2S A;  3QK0 A;  2YIN A;  3MKQ B;  3NF1 A;  1Z3X A;  3B7U X;  3CR3 A;  3AU4 A;  1H2T C;  3PRZ A;  4XZ4 A;  2R17 C;  3ZHE A;  4URK A;  4L2L A;  1H19 A;  2AWI A;  2L6J A;  3APF A;  2MRI A;  4NUR A;  2XPI A;  4XI0 A;  1Y6I A;  4EQF A;  5E75 A;  5ANL A;  4AVX A;  3SZ7 A;  4YVQ C;  2XEV A;  3D9I A;  3FU3 A;  4U63 A;  1U3D A;  2VJ8 A;  3ZGQ A;  2KZT B;  2MOW A;  3LVQ E;  3FH5 A;  2X6I A;  4F1S A;  4LER A;  5T8I A;  2JEK A;  3CHO A;  3LYA A;  4GCO A;  4Y6W A;  2CHZ A;  1H0A A;  2AXV A;  4PDX A;  5FWQ A;  1S0P A;  4BTB A;  3LDZ A;  5G05 J;  2KM4 A;  2VGY A;  4B89 A;  3LY7 A;  2DCP A;  2KC7 A;  3MKR A;  4W9R A;  4ANW A;  5ANR A;  4EZJ A;  1UJJ A;  4ILG A;  1GW6 A;  2IJG X;  4BSX A;  4U0U A;  1JWF A;  3FTY A;  3LJ3 A;  1MHQ A;  2AVP A;  4FLH A;  4I1A A;  4MKT A;  3FUH A;  2NXP A;  1KT1 A;  3ASD A;  2VSN A;  3MJW A;  3C98 A;  2GW1 A;  2I1J A;  2PM7 A;  2WM9 A;  3ZVV A;  3IV0 A;  3VLE A;  1XNF A;  1Z6T A;  2OND A;  3RK6 A;  3Q4A B;  4BX8 A;  2Q7F A;  4I2W A;  5G04 C;  5BNW A;  4N39 A;  1IYG A;  4NAC A;  2VTB B;  1HE8 A;  4OYS A;  3PEV B;  2HM8 A;  3Q49 B;  3QOU A;  1N54 A;  1TJF A;  4G2V A;  4TUU A;  3D9N A;  2LAI A;  2KZT A;  4JC8 A;  4LEU A;  3S7F A;  4DLO A;  1N52 A;  3WXX A;  1MQS A;  3FH8 A;  2OVB A;  3SHF A;  2WB2 A;  2UY1 A;  1E7V A;  4YND A;  4IRU A;  2NSZ A;  3HVE A;  3L17 A;  4DI4 A;  3BEE A;  3FP3 A;  2WXI A;  4FA6 A;  4LUN U;  3D9J A;  3CKB A;  1XGW A;  3B7R L;  3K9I A;  3PE4 A;  4D10 C;  5BV0 A;  4EZL A;  3CHP A;  1A17 A;  3KAE A;  2HR2 A;  3Q15 A;  5FQ8 A;  2J4D A;  3G2S A;  4B0Z A;  2FO7 A;  5C1D A;  3MZL B;  4AOF A;  1SQM A;  3FFL A;  4KZC A;  4L23 A;  2J4B A;  4FHJ A;  4JZY A;  2CG2 A;  5AIJ A;  3G2V A;  5KJL A;  1FCH A;  4ILH B;  4U07 A;  2E2E A;  4JA7 A;  1LF8 A;  5EKQ D;  1JUQ A;  4I6E A;  5HQ8 A;  4HOU A;  1UW4 B;  3LXU X;  2X6H A;  4HOT A;  1KLX A;  4APF A;  3CVL A;  3MV3 B;  2WXJ A;  3BG1 B;  2GRL A;  3RJV A;  3RO2 A;  2WMN A;  5G55 A;  3RO3 A;  3PVL A;  4BWR A;  4EBA G;  4XI9 A;  1HX8 A;  3FUE A;  4WWO A;  4AY6 A;  3ZXS A;  3CVP A;  2XGM A;  4ACL A;  4FLB A;  2A5U A;  2WQ6 A;  3FTU A;  3FU5 A;  3MKQ A;  4XIF A;  4UQZ A;  2C2L A;  4ABN A;  2L0T B;  1H6K A;  2R5S A;  3RRN B;  4CEM A;  4JEU A;  2XPZ A;  3B7S A;  2WXG A;  3RKV A;  4M3O A;  3N71 A;  5BPP A;  1EPU A;  3UPV A;  4J6I A;  4UQY A;  2BF0 X;  1HH8 A;  2WXL A;  3FEY A;  3CK7 A;  4WUY A;  2GRM A;  3L16 A;  5A7D B;  5A23 A;  4ILI A;  5CHE E;  3FU0 A;  4KT6 B;  1VDY A;  2IQC A;  2QY7 A;  3VTX A;  3ZYM A;  4GAA A;  3TJP A;  3CVV A;  4OVU A;  1E8X A;  4LCT A;  2FF4 A;  1ELW A;  2X6J A;  3E4B A;  3L08 A;  2GGF A;  4HLE A;  2CHX A;  3OXL A;  3ZIM A;  3MCX A;  3APC A;  3JUI A;  2M63 A;  4GPK A;  2X6F A;  5FQ6 A;  4PS7 A;  4BX9 A;  1HFA A;  1HS6 A;  2RG8 A;  3FY4 A;  2BTD A;  1B89 A;  2CG3 A;  3IKO B;  4AP2 A;  1FVH A;  2WXK A;  3LVR E;  5CCL A;  4A55 A;  4N3C A;  4N5C A;  1SZA A;  3CQG B;  2Y3A A;  3FUJ A;  3LCA A;  4UWK A;  1HXI A;  2IU1 A;  2XHE A;  5T3R A;  1NZN A;  3OAW A;  2VGX A;  3PH0 C;  3NQP A;  3MEK A;  4GA0 A;  3RIB A;  2JLB A;  2OVF A;  3AS5 A;  3ULQ A;  5KJN A;  5CCM A;  4WNE A;  4FAD A;  2OV8 A;  5ARF A;  4DPR A;  4N3A A;  2VSY A;  5EX0 A;  3CVU A;  1TJC A;  1L5J A;  4GYO A;  3SFZ A;  4E6H A;  2WXR A;  4CGW A;  1ZU2 A;  3RU0 A;  3CVW A;  5EX3 A;  3S7J A;  3L6A A;  1HG5 A;  4ATG A;  3T5V A;  3IHV A;  2C0L A;  2OOE A;  3FDH A;  4EBA A;  2WMO A;  2XPY A;  3BG0 B;  3CLJ A;  4UWF A;  4A1G A;  4ACK A;  5M72 A;  3FEX A;  3ASH A;  3EJN A;  4GCN A;  1WM5 A;  4CRW A;  2IOL A;  4FJY A;  4A3V A;  3OXG A;  4HOR A;  2X3M A;  4I1M A;  2VGX B;  4GZC A;  2UY1 B;  1IQU A;  4JHJ A;  3RRM B;  3APD A;  4UQX A;  3PZD A;  4Q96 A;  4KMO A;  2HO1 A;  3PDN A;  1H2V C;  3CHM A;  4UI9 J;  2V5F A;  4G25 A;  3PRE A;  2AW6 A;  4BY6 A;  3ZN3 A;  4LRZ A;  4WWN A;  3ESK A;  2I1K A;  3PNT B;  3D9P A;  3FH7 A;  3QKY A;  4JXT A;  4L2Y A;  3CEQ A;  3QJZ A;  1BPO A;  1E8Z A;  4E85 A;  2DBA A;  3SGH A;  2CHW A;  3MA5 A;  1UG3 A;  3FUN A;  3LEW A;  4MRU A;  1HG2 A;  3O48 A;  4I9C A;  4JEH A;  3TXM A;  3VTY A;  4CCA A;  4H7Y A;  3CVQ A;  1EF1 C;  3OTN A;  3SF4 A;  1NP7 A;  3CVN A;  5G05 C;  3ZFW A;  4BTA A;  4I1O B;  4I9E A;  3QC1 A;  3IBE A;  3FUD A;  3FUI A;  4G26 A;  3ZYL A;  5AJD A;  1OWO A;  3PUJ A;  3ZEF A;  4Q69 A;  5EDS A;  1Y8M A;  4J8F A;  3TXN A;  2A4Z A;  3I3N A;  4QFV A;  5D0O D;  1U3C A;  3CK9 A;  5G04 J;  2MHK A;  3AU5 A;  2LAH A;  4UWH A;  2J49 A;  4UWG A;  1NA0 A;  4I17 A;  2BUG A;  5AYW D;  1EDU A;  4JL0 A;  3AS8 A;  3LY9 A;  5JJ6 A;  1YA0 A;  3D9M A;  2YHC A;  2WQ7 A;  2IOS A;  4AIF A;  3NZU A;  3DPD A;  3KD7 A;  3R7R A;  2XCB A;  4F7A A;  2J07 A;  2IF4 A;  3QAQ A;  5FJY A;  1ELR A;  4N3B A;  4J0U A;  4HXI A;  3S2A A;  4JVS A;  2XRZ A;  3CHR A;  3PNL B;  5LCW C;  3URZ A;  2L0I A;  2WXM A;  3ZYQ A;  5FTP A;  1E96 B;  4TV3 A;  3S7D A;  3G2T A;  3FUK A;  3HYM B;  2X38 A;  4KBQ A;  5HI7 A;  1QZ2 A;  5A6C A;  2P58 C;  3SBS A;  4CDR A;  5KJK A;  3G2U A;  3CGH A;  4GMJ A;  4NQ0 A;  3ONL A;  4RG9 A;  4B94 A;  3Q5M A;  2PQR A;  2VYI A;  3GYZ A;  4FHK A;  3T8M A;  3QAR A;  3FTZ A;  3QWV A;  4WAF A;  3FWV A;  3ZHE B;  1IHG A;  5C2Y A;  2KAT A;  5ARG A;  3FTW A;  4CDM A;  3B7T A;  4G24 A;  5CMY A;  4FU3 A;  2I9C A;  3LY8 A;  5FT9 A;  4DLQ A;  1E90 A;  4YVO A;  4Y6C A;  4EZK A;  3MGB A;  2UWJ G;  2WVI A;  4GYY A;  4H7X A;  4HOQ A;  4IN3 B;  1HU3 A;  3SNX A;  2ZU6 B;  4AY5 A;  2I6H A;  5FQ4 A;  1P5Q A;  1E8Y A;  3D9L A;  3VLF A;  3ZYK A;  1Z3Y A;  4WWP A;  3D9O A;  5AEN A;  4APO A;  4B8C B;  3ZPJ A;  2WXQ A;  3KS2 A;  3PS6 A;  1OWM A;  4PH4 B;  4EEC A;  4ANX A;  2VQ2 A;  4GU5 A;  4K03 A;  4KVM A;  3RRU A;  3VLD A;  3U3W A;  2LSU A;  4U0Z A;  3ENE A;  2R59 A;  3CIA A;  3SBT B;  4ME2 A;  2QFC A;  4MS6 A;  4U0S A;  2VSO E;  2Y4U A;  5LP0 A;  1FVF A;  3IHY A;  4GYW A;  4I6J A;  4U04 A;  4KVO A;  4CGV A;  5JJ7 A;  2WQH A;  5KJM A;  1TEZ A;  3JQ1 A;  1PC2 A;  5FZQ A;  4FUL A;  2V8S E;  2WXH A;  5DIZ A;  2AXZ A;  2KCK A;  2HYZ A;  5JJT A;  3GZ2 A;  3CQC B;  3CST A;  4L7T A;  3QNK A;  4I6G A;  4KXK B;  5E76 A;  2V0P A;  3MYV A;  2FI7 A;  4G11 A;  4GB9 A;  3LS8 A;  4G1T A;  3TG4 A;  5LCW J;  2VTB A;  5FZR A;  2XGO A;  4CDN A;  3S7B A;  4PS8 A;  3R7Q A;  2KCV A;  5JHA A;  2WXP A;  3QDN A;  1UN8 A;  4DK5 A;  4GA2 A;  3EIJ A;  4U8H A;  4Q94 A;  1HF8 A;  1DVP A;  1UN9 A;  2YQ8 A;  5BW8 C;  3CV0 A;  3UT4 A;  3TG5 A;  3ASG A;  5J08 A;  4EPZ A;  4C0M A;  3PEU B;  4JPS A;  4UWL A;  2WPV A;  4AM9 A;  4AJW A;  3P2B A;  1NA3 A;  3DBS A;  4JHR A;  4HS2 A;  5CMW A;  1ZBP A;  3CHS A;  4IYP A;  4JW1 A;  3NZS A;  4PUC A;  4ANU A;  1HZ4 A;  3T5X A;  4GZ5 A;  5BV1 A;  3LPZ A;  4XKC A;  1QNF A;  3ZRH A;  2PM6 A;  5FQ7 A;  3TAX A;  4P29 A;  4UI9 C;  4WND A;  4F3V A;  2DIW A;  1E7U A;  4BT8 A;  3KEZ A;  3D3M A;  1WY6 A;  4K0R A;  2LSV A;  2LO6 A;  5LX8 A;  1IQR A;  3G2W A;  3OXF A;  4I43 A;  5ENN A;  4O6F A;  3AS4 A;  4J8S A;  2WXF A;  3MV2 B;  3SI5 A;  5J90 A;  3U4T A;  5T4Y A;  3P1U A;  5KCM A;  1H2U A;  3JCK C;  4PS3 A;  3L13 A;  4HVB A;  3CHQ A;  3L54 A;  4FC8 A;  3HHM A;  4IUL A;  3ML8 A;  4HOS A;  2YNQ A;  2FEZ A;  1OWP A;  3B13 A;  3PE3 A;  1WAO 1;  4BFR A;  3I5P A;  3IEG A;  3LKU A;  2KCL A;  2E0I A;  4GZD A;  2LNI A;  5AJL A;  1EYH A;  4OVV A;  2L9B A;  3ESL A;  3HDX A;  2XCC A;  4ANV A;  5BT1 A;  3FTS A;  4V3I A;  1JPL A;  3CKC A;  5DBK A;  1UJK A;  2PL2 A;  3CVY A;  1PAQ A;  2X6K A;  3EDT B;  3Q47 B;  2Y4T A;  1JWG A;  3ML9 A;  3JQ0 A;  2I2O A;  4R7L A;  4XKB A;  4GML A;  2J9Q A;  3FU6 A;  3QB2 A;  1INZ A;  3R9A B;  4KZ0 A;  4HFG A;  4GA1 A;  3FTX A;  3L22 A;  2WXO A;  4DJA A;  3QWP A;  2WXN A;  3HVE B;  2VSX E;  3GZ1 A;  4J8E A;  4A1S A;  3ASF A;  4CT4 A;  3I4G A;  2YHE A;  3UT8 A;  4WNG A;  4C0E A;  1HO8 A;  3PUK A;  4TRQ A;  4I2Z A;  4RSY A;  1QQE A;  2ION A;  1PY1 A;  1OWN A;  2CFZ A;  2FBN A;  2J08 A;  1SZ9 A;  4L1B A;  2ILR A;  4B8A A;  1W3B A;  4KYO B;  3HIZ A;  2C0M A;  5LFA A;  3EHN A;  4XE0 A;  4JA9 A;  4FJZ A;  2FUL A;  3CSF A;  3UMV A;  1OWL A;  1ELK A;  5FZS A;  4GZ6 A;  4F53 A;  4C9B B;  4MLP A;  1DNP A;  2XQ0 A;  1OUV A;  3CK8 A;  3FTV A;  4G23 A;  4JHK A;  3UUX A;  4WNF A;  4BT9 A;  3U64 A;  2J09 A;  3GW4 A;  3I4R B;  4RVB A;  3EIQ C;  3FUM A;  2PZI A;  3U66 A;  3UQ3 A;  4UI9 K;  2IFU A;  2NC9 A;  2RD0 A;  3U9W A;  4XX5 A;  4DI3 A;  3EHM A;  4J8D A;  1KT0 A;  3FHE A;  2AXU A;  3UT7 A;  4NRH B;  2V4L A;  5JHB A;  3MX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...