4B8WA

Crystal structure of human gdp-l-fucose synthase with bound nadp and gdp, tetragonal crystal form
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
319
structure length
319
Chain Sequence
NLYFQSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Gdp-L-Fucose Synthase with Bound Nadp and Gdp, Tetragonal Crystal Form
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords GDP-L-FUCOSE SYNTHASE
total genus 103
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4b8wA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 4b8wA02
3B1FA 4QO7A 3GGGA 3OA0A 3ONFA 1LSOA 1N8KA 3QWAA 4DIBA 5JDIA 3ZWPA 1C0KA 1MC5A 4CLHA 1IUKA 1O6ZA 3JQGB 4XQ9A 5IDWA 1I3KA 5EPOA 2X0NA 2ZYDA 3FTNA 3PHHA 2AEJA 3GRKA 2IEBA 3OJOA 3JQAA 4IPTA 3I9MA 2GF2A 1TEHA 4J1NA 3GA0A 1WDLA 4DMMA 2J3HA 2NU7A 3U09A 1GQ2A 2GLXA 1SZJG 2VRBA 4WJZA 4BL5A 3EC7A 3V2UA 5FI3A 3GFBA 4TVBA 1B0AA 1PQWA 2HMUA 4JBIA 4R01A 1AHIA 4AG3A 3MJCA 1U8XX 4MPDA 2O3RA 4IXWA 4CM6A 3IC5A 5F1PA 3PXXA 5IN5A 3RASA 4OL9A 4D46A 2DT5A 1A27A 3O4RA 3RWBA 3NEPX 5ICSA 1Z75A 4R41A 4JX8A 3OETA 1YQGA 3PJGA 4WGGA 3SJ7A 4A26A 4WKGA 1PS9A 3ZWAA 1IZ0A 5JO9A 5K0ZA 4L4XA 1YXMA 4U7WA 3C7DB 1HDYA 2ILTA 3DZKA 3HADA 5L7YA 4PLVA 3Q9NA 2BGMA 2PD3A 3UFXA 3UW3A 1V3UA 1VJ1A 5U4QA 1Y7TA 3L4BC 1P0CA 7MDHA 3I9NA 3QVOA 3WFIA 2HMSA 1KVRA 5EL0A 3BIOA 3L77A 3D3EA 4BV8A 3BMCA 3CEAA 2CY0A 2NV6A 1KEUA 2ZQYA 3OFSA 2I9PA 4YT4A 1YL5A 3JQ7A 2YV1A 3OA2A 4FJ1A 4HFJA 4TRMA 2O2SA 1R66A 2ZYGA 2G82A 1KVQA 3W1VA 1E3EA 4J7UA 4J1QA 1Z74A 4Q3AA 1I5RA 1WZIA 2EJVA 1IPEA 4BHTA 2GNAA 2CDAA 3VC7A 5B4TA 3QWBA 5DZSA 2AEMA 4J90A 4XJSA 3MZ0A 1EK6A 1RM0A 2BRUA 1WNTA 3ORFA 1HLDA 1H93A 1Y8RB 4CUKA 1VC2A 3GC6A 3ITKA 3WSVA 3OICA 4H7PA 2HSDA 3BHIA 4BNWA 4LCJA 4CL3A 4J4HA 3NYWA 4R5MA 2JKVA 3DZGA 3CH6A 3DR3A 1UJMA 1Y8QB 1IE3A 1X1EA 2VQ3A 3GVPA 4MO2A 4RQUA 4E2ZA 4PLYA 3UKOA 1D7OA 4BO1A 3STHA 4JXKA 3IAHA 2X86A 4CM8B 1BXKA 1NM5A 4ALNA 4GVLA 3TL2A 4J91A 1P1RA 3HSKA 2OFPA 3C85A 2GD1O 1XQ1A 2G17A 3L9WA 3FNGA 2NWQA 2JCYA 3PDUA 5F5LA 3KYCA 3PEFA 3NT2A 1UZMA 3M1LA 4ND4A 4W4TA 3TZ6A 4PIVA 4W7IA 1LA2A 4GH5A 2FPGA 4Y98A 3I4CA 1QYCA 1B15A 2D3TA 4TKLA 1D8AA 1QLJA 4CM4B 3WGGA 2RHRA 2BI7A 3NDJA 4QFCA 2IXBA 1AN9A 3MWDB 2B5VA 3HDYA 5FFFA 1ISIA 2EKQA 4CQLA 1B3RA 2C29D 2O3SA 4INAA 1SOWA 1Q7GA 3C1AA 1X7HA 2GSDA 4JGBA 1HSZA 3A9WA 1DC4A 3I3OA 4DBVO 1Y5MA 1ZBQA 2BELA 3DONA 3UOGA 4CV0A 5H81A 4CUZA 2Y0CA 3RUFA 2C54A 1C0LA 1JKFA 5KOIA 3V5NA 4YQYA 2X0JA 4BNFA 3WXBA 1DDOA 5HS4A 3NDIA 4IDFA 1NAIA 3CE6A 1FK8A 4GSKA 1B8PA 1ADFA 1IZ9A 1TT5A 4JLWA 2NU8A 3U4IA 3ZV3A 5HRUA 3JQGA 3HNPA 4CV2A 1BMDA 2JJYA 2P4HX 3UAGA 1Z7BA 4D3SA 3DBHA 1IHYA 4G81A 2CF6A 3P2YA 4YR9A 2CVOA 2X22A 2PA3A 1NFRA 4PN3A 1PJTA 1J6UA 1XDWA 1YWGO 5A02A 5THQA 3OM9A 2PD4A 1LLQA 3FBTA 4NBRA 2JAPA 1E77A 2GN4A 3LK7A 2PK3A 2DVMA 3AUSA 3DZJA 5T6BA 3ANMA 4IQGA 3HHPA 4NBTA 2D8AA 3FR8A 3CKYA 2VTEA 3S2EA 1WP4A 3VZSA 2BFMA 4AJLA 2JCVA 1HZZA 1I30A 3D4NA 1R16A 2NNLD 4J4TA 1P45A 5B12A 1AGNA 4BS9A 3VDQA 3B20A 4IJUA 3T7CA 4DQVA 1GZ3A 1MG0A 4Z0TA 5L9AA 3JYOA 4GWKA 2QIOA 1QV6A 4DWVA 3PVZA 1MFPA 4PLTA 1TXGA 4WE3A 1YL7A 1DJNA 2A9FA 2G0TA 2P9GA 3GR6A 1ISGA 1Y1PA 3AW9A 2I6TA 4WUVA 5ES3A 3HZZA 5JYEA 1QR6A 3V8BA 1VE9A 4BGIA 4C7KA 2OHXA 4J2OA 1C1XB 1MXHA 4D79A 4UEOA 3JQBA 3MCVA 2WD7B 4OMUA 4PCVA 3FNHA 3RUCA 1HZJA 1ENZA 4KQWA 4DBZA 2I66A 3LQFA 3ZNOA 1SOVA 2C5AA 3CZRA 4B8WA 2VNSA 2V6GA 3GN1A 4Z9YA 5TX7A 4NJMA 1PR3A 4WOKA 4IINA 3RU7A 4Y67A 4RF5A 3A4VA 4B8ZA 4LISA 5JY6A 3GZNA 3GNTA 2Y93A 4ZQGA 1EE9A 2W2LA 1QYVA 1JVSA 3QIVA 4DPMA 4XD2A 1YBAA 4K1LA 3OJEA 4ZA2A 1C3VA 3VKVA 1X15A 2A92A 4N5LA 1YRLA 4M8SA 3NTRA 2PWZA 1NVGA 1R0KA 2CUKA 3ZHBA 1V6AA 3K5PA 3ZV6A 1DLIA 4QFDA 4TROA 5B4VA 5I9NA 1WVGA 3OEYA 4GX0A 2VHXA 4PGFA 1Y8QA 4W82A 1FDUA 1HE5A 3LT0A 2QHXA 5CDUA 1JLLA 4EUFA 5L40A 4CM8A 2OUIA 4OOFA 4CR6A 1SO8A 1NVMB 3ZW8A 3UVEA 2NQTA 2OO5A 3C7AA 1U7HA 3X2EA 4ZRNA 3RU9A 3AFMA 2BH9A 1AUPA 3PK0A 1N7GA 2WYWA 3ANLA 3MWEB 1JVBA 4BGEA 9LDTA 3I23A 3Q2KA 3KEQA 3U62A 4CM4A 2DBZA 5LDGA 1LDNA 3U49A 2GRAA 1E7WA 2A35A 1U4SA 2DFDA 1GADO 4HWKA 3VVCA 4PG7A 1DB3A 4OIMA 3VPFA 4TKMA 4D3FA 2HRBA 2QRKA 3VH1A 5IAAA 3TFQA 1T25A 3M1AA 1JW9B 5G2OA 1ADGA 3JQCA 3ZW9A 4FIZA 1YB5A 3G1TA 4CQMA 4G2NA 5HWSA 1N5DA 2VZ0A 1TB4A 1I36A 1O95A 1PS8A 2Y67A 2AG8A 2BFAA 1KVSA 1NXQA 1KY4A 1U7TA 4GQAA 4HXYA 1JQBA 1RYDA 4YXFA 1WMBA 4J4BA 4BNIA 3H9QA 5JYDA 3C1TA 4H16A 2O3TA 1R0LA 4CR7A 4UVGA 4DC0A 4B4VA 2NVUA 3ONDA 5JMWA 2ET6A 2V6MA 3FWZA 5F1OA 4IDGA 4D3DA 2NVWA 1U2DA 2JL1A 4NZ9A 5JS6A 4HADA 4GX1A 2HJRA 2VHYA 1JAXA 1HWYA 1XEAA 4FW8A 2R00C 4W9NC 1HDOA 4WCFB 4RF2A 4DUPA 4S1VA 1DLJA 4Z3KA 3VAZA 3LLVA 2X5OA 3QVXA 5C37A 2VT3A 4RPLA 1XELA 3WNVA 1X7GA 1YH3A 2EG9A 3E5RA 3BXXA 4U6SA 4XDYA 4AVYA 5T64A 3WMXA 1H94A 5C7IO 1E3WA 4LGVA 3D4OA 2VZ8A 4YT2A 3HDHA 3R0IA 4PLWA 4U5QA 4YAKA 5JC1A 3ZWCA 4MVJF 1NVTA 3JQ8A 2ZB7A 3IL2A 1U1IA 2C07A 3K96A 4D0RA 3CIFA 3H8VA 4WOJA 4DXHA 3WSWA 2Y1GA 1MLDA 2AQKA 2I3AA 1ZJYA 5DT9A 3H3JA 3QWIA 1HDXA 1I3LA 4I5FA 1R4MA 3UICA 4DYVA 1K0UA 2W8ZA 3S2IA 4EUEA 3GMDA 4ND3A 1NHWA 4WK6A 5BSHA 1A4IA 3FRJA 4OOEA 1KC1A 4IUYA 2EHDA 2VT2A 2WD7A 4UREA 4ND2A 4RF4A 1JKIA 3Q11A 2VN8A 4GX2A 3WYBA 4CLOB 3ZWVA 2GZ3A 3ABIA 4IM7A 1DEHA 3ANNA 5CPBA 5JC8A 2FN7A 4E0BA 1VJTA 4BO8A 4R1TA 1V9LA 4NJMB 5I8WA 2E82A 2X5JO 2FR8A 1ZK1A 1N1EA 5L51A 4NH4A 3GZNB 3VH3A 2VHWA 4HFRA 5GZ1A 2X1HA 1QP8A 2RH8A 2PKQP 5AXCA 3UXYA 1Q7BA 4EJ6A 4UAGA 2GCGA 3ZI0A 2XXJA 2Z95A 3KEOA 5TIIA 3ZNQA 4G65A 5DF1A 3WGHA 2B4QA 2D4AA 2UUPA 1D4FA 3DZHA 3L9XA 2YHUA 3CINA 3VVBA 3OQ6A 4BO3A 4RJTA 5C7LO 3HUDA 4N5NA 4HNGA 2WE7A 4PG6A 4TVOA 3QHAA 3BYZA 1I0ZA 3UCEA 2HK8A 5EESA 3E9NA 5L3ZA 2O3UA 4XRGA 2V6BA 3QQPA 1EE2A 1K6JA 4KWIA 1RWBA 3I9LA 3RVDA 1BVUA 3HN7A 1DPGA 1BW9B 5BNFA 3AU9A 3PLNA 3JQ9A 4NU5A 3PYXA 1GYRA 4H3VA 4XWYA 1O89A 3TZHA 3ZU5A 1LDMA 1PZFA 2HAEA 2E49A 3VPSA 1ZJZA 2PH5A 3OIGA 5F3RA 2VOEA 3S2GA 2EKPA 5G0VA 3KZVA 1P9LA 1SNYA 2E37A 2NADA 4A0SA 3RKUA 3GPIA 2ZATA 4CMEC 3ROQA 2Q46A 1OAAA 3D3WA 4LMRA 2PH3A 1LDYA 3INTA 3D64A 4FCCA 2X7HA 5JCJD 1GPJA 3LC1O 1P3DA 1YS4A 1PJBA 2E6UX 2VYVD 1SCUA 4E5MA 4EJ0A 5AOVA 4AFNA 3D5QA 2Q4EA 3TJRA 4ALJA 5CAEA 4IGFA 5BR7A 2YDXA 5DBIA 6ADHA 2Y1FA 5A06A 1K3TA 1DFGA 1E3SA 1GUFA 1TT7A 4HBGA 1FDVA 3EY4A 1UXHA 4FFMA 5IN4A 3TNLA 2IYOA 4BMVA 3WNQA 1DJQA 5K6AA 2NVUB 1E6WA 4MVJM 3AWDA 3BTSA 4GI2A 5KVCA 3SVTA 4PLHA 3ON5A 1T1SA 3KYDB 4W99A 5FEUA 5KIAA 3E6AA 5KJEA 4PLGA 4E5YA 5CDGA 3FSRA 1EBUA 1JA9A 1ADCA 3W6UA 2B4RO 4YB8A 1HDZA 4RCVA 3E1KA 3EDMA 4XJTA 1A4UA 5KVVA 4PG4A 5TT1A 1A72A 1PGQA 4DMLA 3MJ4A 4E13A 2DTXA 1XSEA 4OQZA 2RIRA 4N5MA 3OJFA 5DCUA 4EJMA 5DNAA 3F46A 4Q3BA 1ID1A 2J3JA 3JQBC 1HE4A 1SC6A 4Q3NA 1EUDA 4XZ3A 2I65A 1BDMA 3E5MA 4RDHA 4RPKA 4N18A 1KOLA 3U3XA 4D44A 1LC3A 1ZXBA 4JP3A 1HT0A 5LDHA 2GUGA 5T5QA 4BV9A 5L4NA 1GEEA 1Q7CA 4OGWA 5JAQA 1J4AA 1LBEA 1Y81A 5ENDA 1EK5A 5J23A 4IJKA 1GDHA 1PJQA 1QLHA 4BNGA 4WLFA 1NQTA 4NFSA 5DP2A 3RC1A 4LRSB 1PGJA 5A3VA 4LMPA 4BIIA 3R3JA 2I76A 2NVBA 2CMDA 3DZBA 3JTMA 4DL9A 2UDPA 5TQVA 3PJFA 1FDWA 2JFFA 4NDNE 4E30A 3KTDA 4YTEA 1TLTA 1UXJA 3AY7A 4JJIA 1KEWA 2P68A 2VHVA 5MGBA 4YJHB 1XYGA 5B1YA 1JTVA 2GO1A 2Q2VA 4KQXA 4ALLA 2VYND 1PQPA 5DOVA 2P5UA 5KKAA 2RHCA 4GSLA 1LLCA 5I9MA 2EF1A 3BMCB 2JHGA 3BMNB 1U5AA 1XHLA 2FPIA 2OMEA 4IJWA 5ADHA 2PGJA 3PYMA 3L6EA 1MXFA 4CPDA 1LRLA 5DBGA 1NNUA 4HX5A 5AXDA 1DIAA 4FN4A 2EW2A 1YDWA 5KVQA 1T24A 5LC1A 3WMWA 1ENPA 3ZNPA 1YBVA 3JD0A 4O5OA 5KJFA 1VPDA 4IZHA 5TSDA 1ARZA 2YV2A 3UUWA 1Q0HA 4F3YA 1W8DA 1LC0A 5T8KC 4BGVA 3OEWA 4DYDA 2ZTLA 3ADPA 2G5CA 1V3VA 3WJ7A 1ISMA 2FWMX 3HFGA 1EBFA 2PLAA 4A5OA 1B3BA 1WW8A 1FF9A 3JQAB 3RBXA 3V2HA 3UCFA 1E3LA 1WDMA 4GGPA 2HKIA 3JQAD 4YVFA 1LLDA 4MIEA 5A04A 2QZ9A 1DIHA 2JD1A 1GTMA 3MJVA 4CM3A 5CG1A 1KYQA 4W7HA 2B5WA 4KUHA 3GAFA 4L76A 4ROSA 3RJ9A 5K6AC 1P1KA 3RI3A 2P9CA 4GKVA 1Q0LA 1NQOA 3KETA 3EZLA 3WQSB 3V1YA 5MDHA 2ZB3A 4RLHA 1SBYA 2DLDA 3NJ8A 1G6KA 4TSKA 1X13A 1HYHA 2IZZA 4FS3A 4YEDA 1UP6A 1VI2A 1XR3A 2C5EA 4YBZA 1R37A 4ZQFA 5BQFA 4UEKA 1U3VA 1RJWA 1ZSYA 2CNBA 1D3AA 1UZNA 4AJ1A 1PEDA 1FDTA 4R1NA 4BB5A 2HK7A 3IJPA 3WQRA 4CLRB 2PR2A 3HDJA 3H7AA 4PLFA 1V3TA 3Q0EA 1M67A 1GU7A 3RIHA 4QTZA 3WGTA 1U3TA 3E18A 3CSDA 2YJZA 2ZK7A 1GQQA 1WLYA 5C5IA 3WIDA 5JSFA 4XIJA 3PFFA 2DAPA 1M66A 4JBHA 4DIFA 5EMHA 4BKOA 4WLVA 2D0IA 5HTOA 5L53A 2D2IA 5CFZA 2Y1EA 4L0QA 4FR5A 4NIMA 3WYEA 2OP1A 1VL8A 1SAYA 2ZB4A 3AUAA 2BHLA 3EVTA 4O1MA 3Q9UA 1YQDA 3FHLA 4IQ0A 4JROA 1YOVB 3PYLA 1T1RA 3D4PA 1YJ8A 4Z3DA 5DBFA 1WPQA 2RH4A 4GBJA 4DREA 1T2FA 4EUHA 3IQDB 3RUIA 4E6PA 1CQJA 3AOEC 4WPGA 1KEPA 4UUMA 1EVZA 1U9JA 1E92A 5LCXA 5A9SB 1ZO8A 1MX3A 4MDHA 5B4UA 3B70A 3C8MA 2FMUA 3LVFO 1P1HA 3FCOA 4QEDA 3OSUA 4PRLA 1EQ2A 2PFGA 4MKZA 4BO2A 1OFGA 4PFJA 4NBUA 2X58A 4A10A 1LLUA 4JIGA 2HRZA 4LCEA 2OXIA 3AUTA 1CYDA 1PJ4A 1AXEA 2W2LD 4YRAA 3L4BA 1LQUA 1LUAA 3QVTA 4WLUA 3VOSA 3U5TA 4NG5A 2P9EA 3D7LA 2NTJA 3DC2A 1HETA 4KZPA 4E12A 1AE1A 1KERA 2W90A 1EDZA 1QYXA 3KRTA 3CXRA 2FR0A 2VOJA 1VLLA 3ZDFA 4GPD1 4QX6A 5H82A 2EEZA 2DC1A 4Q39A 5T8KA 3NDRA 3E9MA 3HE3A 4WASA 1BHSA 3NX4A 4QUKA 4S3MA 1M2WA 2VHZA 4XGIA 5TGDA 4ZGWA 4B3IA 1C1XA 1NAHA 1ZH8A 1L7EA 4R5HA 4TZKA 3VPHA 4E5KA 5CPFA 1PJSA 3IDSA 5HM8A 2GYYA 2W4QA 1U5CA 5I8ZA 4WNCA 3PZBA 2LDBA 2Y05A 1ONOA 1EVIA 4DPLA 1HDGO 4XEHA 2J6IA 4AJEA 2J8ZA 1Z73A 1Z45A 5KKCA 2DQ4A 4RLSA 5EN4A 3NGXA 4KDEA 3K8ZA 4O63O 4Z9XA 4F46A 2HMWA 1GL3A 2P4QA 3WGYA 3G79A 3DHNA 4QECA 1GPDG 2OP0A 4YWJA 1TT5B 2YHIB 3QA9A 3WTBA 1YGYA 3X2FA 4MINA 1DHRA 2O7SA 1HL3A 3DB2A 3PHGA 4XDZA 5H83A 1CF2O 3ZU3A 5G4KA 4Z0PA 3W8EA 1CEQA 1EVYA 4YRBA 3JQ9C 4B4OA 2NUAA 3JQDA 3KSUA 4IMRA 2YYYA 1B7GO 3GVCA 4R9RA 3FNEA 4D0SA 4GLOA 3SEFA 4FOOA 1PL8A 4GVXA 4XYBA 3QV1A 5EERA 3IIEA 4B3HA 5BNIA 1SEPA 4NFHA 4RVSA 4NR0A 3F5SA 5DN9A 2IRWA 3BMOB 3RJ5A 1E7RA 3KXDA 4GMGA 4L74A 3AM4A 1H2HA 3EYWA 4YT5A 1UUFA 1O9BA 4B4WA 5FWNA 1EZ4A 3QVSA 1UXKA 1HXHA 4IY1A 2YFQA 1ZIDA 2HO5A 4MVJE 2WM3A 3PHJA 4BNMA 4DGSA 4DVJA 3JYPA 1QV7A 3OH8A 5BT9A 1ZFNA 4ALMA 5A03A 1Q0QA 4BO0A 4TRRA 4CLRA 2CFCA 3M2PA 1HSOA 1YDEA 4CUJA 1PWXA 2I67A 1YQXA 1E6UA 5DCWA 2ZJ0A 5AVOA 3C3XA 2ZYAA 4ILKA 2JD2A 3R1IA 3SLGA 3C24A 5L4SA 4GGOA 2A4KA 5DDIP 3VH2A 2AQIA 1HEUA 4M54A 2D1YA 1BTOA 3V2GA 3ZWOA 3ITDA 3PZRA 4TZTA 3JQFC 2ZCVA 1DFHA 4BUCA 3IUSA 3TFOA 3WGZA 3WG9A 1P31A 5U9CA 1GAEO 4YAEA 3SC4A 4KDFA 5JCJA 4PLPA 3K30A 1QYWA 4ITUA 5ER9A 2NSDA 2I5PO 3BMQA 4RZIA 3B6ZA 5JAMA 1E3JA 3MOIA 3HWRA 2B37A 4PG8A 1K2WA 2ZCUA 1LU9A 4UVHA 3VZRA 1U3UA 2WWRA 1DC6A 1U4OA 1C1DA 5A9SA 1F8GA 4DTIA 1VL6A 2DPGA 4J0FA 3LYLA 3CTMA 3PGXA 4L9RA 3G49A 2B36A 4CMEA 2WJPA 3JQFA 3C7CB 3IP3A 3M6IA 4XA8A 5JW6A 3GAZA 1ZNQO 1O8CA 3JD3A 4I9NA 1IB6A 1EQUA 4BNTA 2YFHA 3TRIA 5JMPA 1VKOA 2V65A 1DHTA 2Q2WA 3FR7A 1IPFA 5IG2A 4CLXA 2CD9A 3DBRB 4CJXA 4L8VA 4P8RA 4LW8A 4WCFA 1F17A 4KMSA 1LSJA 4Y6SA 4R1UA 3DEYX 4MVJH 5L4LA 3JQ8B 4RVUA 3CMMA 2OGUA 3PLRA 1OMOA 2FHSA 1RYEA 1SB9A 1NBOA 1UXIA 3GNSA 4XR9A 4CMHA 1ZKMA 2PTGA 1R4MB 5JY1A 3UGKA 5JDIC 3QVWA 2YQ5A 1YB1A 2Q4BA 1JU9A 1LJ8A 1DOHA 1NPYA 1NP3A 3GPDG 3K6JA 5JDCC 3WWZA 4ZD6A 4IGEA 5T67A 3UHAA 5K9ZA 5ILOA 4MP3A 1X7DA 1EDOA 3E8XA 3NAQA 3DMTC 3GZ4A 2P91A 3VKUA 2PV7A 1O94A 4QXMA 1I32A 1Y9AA 2X4GA 3EHEA 3I9KA 3KV3O 1DFIA 4Z0HO 3NKLA 4BNHA 1LRKA 3DO5A 5ICMA 1HE2A 3MOGA 1E0DA 3GDOA 4OXKA 3EW7A 4K9DA 1D1SA 1IL0A 1R15A 4P22A 5JLAA 2BFPA 4MKXA 2O23A 3AI2A 3RFXA 1AXGA 2FZWA 4CV3A 1SB8A 3MJSA 2QYTA 3AJRA 1WMAA 3K2EA 2H5LA 1K5HA 4EGFA 4BO9A 5CG2A 2IODA 3I6IA 3GOHA 3FD8A 5JXWA 4YT8A 3I9JA 3G0OA 3OP4A 3JD4A 2TMDA 3DQPA 5GZ6A 4BKPA 5IJZA 1HDCA 3F9IA 4RGBA 5F1KA 3KB6A 2HJSA 3WTCA 1WZEA 4XX0A 3JYQA 4HY3A 2IZ1A 3PP8A 4LSMA 3LC7O 1ENYA 5TS3A 5L95A 1X0VA 4JBGA 1MG5A 4N7RA 1Y6JA 4YYZA 4PZEA 2FP4A 1UAYA 4AL4A 4BVAA 2WEKA 4JK3A 4E3ZA 4EZBA 5DULA 1E7SA 1LSUA 4XB1A 4TQGA 1DRUA 2R2GA 1YJQA 5EQDA 1JN0A 1HTBA 2C59A 2AW5A 4ZU3A 4YJGB 1T4BA 3RFVA 5CEJA 1E3WB 4QQRA 2E48A 2D59A 3AK4A 1ISJA 2AQHA 1UP4A 5DOZA 1XG5A 3H3FA 2GERA 1Z6ZA 4NNJA 3U4CA 4R54A 4GLLA 1XU9A 3WR5A 1IOLA 1PJLA 4CMGA 3O38A 3B1JA 2IDZA 1IHXA 4J7CA 3GEDA 1I01A 5CDYA 4BMSA 2ZTVA 3ASUA 3VTZA 5DCYA 1LDEA 2DPHA 3LC2O 4YJFB 5TT0A 5IXSA 2DBVO 5A9TA 3D3WB 2VWQA 4OXNA 4L73A 1ZMOA 2YW9A 1C0IA 2E4AA 2X9GA 3RQSA 3ZU2A 3WB9A 4J49A 1NHGA 2P2SA 1NWHA 1UZLA 4BO4A 4CLOA 1R4NB 4OKIA 1IYZA 2RAFA 4J9VA 4YJDA 2DM6A 3I9OA 5C7OO 1P33A 5IDXA 4HV4A 3UF0A 3GG2A 2B4TO 2XF8A 1HKUA 3DBLB 3QW2A 4CMCA 2CDCA 1GUZA 3DMTA 4J1SA 3W4IA 2Z5LA 2DBQA 2X8LA 3QSGA 2FY8A 1NPDA 3NV9A 5TNXA 3ROMA 4J1TA 3VH4A 3PDJA 1I2ZA 2C7GA 3W4JA 2Y0DA 4CM7A 3PGJA 4IBOA 1EUCA 3L6OO 4LVUA 1YL6A 2NTVA 2DBRA 5G4LA 3T4EA 3DWFA 3KYDA 4JP2A 1DBVO 4ZQBA 2OL4A 3AM3A 4GWGA 3TDKA 1F12A 3GLQA 2BKAA 3HJAA 5GY7A 2YUTA 1HF3A 3BZUA 1TA4A 5KNLA 1GZ4A 1MP0A 3KLPX 5CP8A 5BSEA 1KC3A 4BNXA 4EEXA 3VZPA 3ETGA 2J5KA 1QG6A 4J9UE 4YAIA 3A14A 3TQHA 5KTKA 1M75A 3LF1A 3DFZA 3Q3CA 1GD1O 4E5NA 4BNYA 3AY6A 3DBRA 3HQ4O 2J5RA 3K9QO 4B7CA 3DAGA 4LN1A 1ISHA 4ZQHA 3ETEA 3ZHXA 2G76A 3KSZO 4FFLA 4HUJA 4KTVE 1PX0A 2EIHA 3QWFA 4UUOA 4CMIA 2EKLA 4NBVA 1LTHR 4RZHA 1Q1NA 2X5KO 2Q1SA 1CWUA 5EJ2A 4D7AA 3BHJA 4J2HA 3H9GA 5A9RA 3AU8A 1KVUA 4OH1A 4BKUA 2BGLA 3WYCA 1DAPA 3GH3A 3ZGYA 2FSSA 1O5IA 4YDRA 2UAGA 3RKRA 3PPIA 1N9GB 4M49A 2V6FA 2I3GA 3ROPA 1QRRA 4FC7A 5JE8A 4E2WA 5JPIA 3WIEA 2EGGA 3VTFA 3LT4A 2WDZA 1XLTA 2X9VA 3ENNA 3BMNA 3RC9A 4C7JA 3H5NA 1GFSA 4X54A 3QE3A 2GN6A 4XIYA 2DFVA 1F0YA 2WYUA 1FXSA 3ZWNA 4IS2A 1BGVA 2ZTMA 4YJHA 5IFLA 3GG9A 2Q1WA 3K92A 2XAAA 4BNVA 1OC4A 2RCYA 5G0UA 4XRRA 5ITVA 4ID9A 3FWNA 2GN9A 5EINA 1IULA 3EAGA 1K6XA 4NJOA 4R69A 4ZN6A 1ADBA 1T2DA 3HDQA 1RM4A 4ONEA 4UUNA 4CR8A 1PSDA 3PHIA 4E32A 1SEVA 1RM5A 4P38A 4M1QA 1A7KA 2W2KB 2TMGA 1G0NA 4E31A 5JNLA 4R51A 5T57A 1BXGB 3TZCA 2B83A 1CERA 2HU2A 1F8FA 4RL6A 1DRVA 1ZK4A 1GYQA 3E9QA 3PWZA 5IDYA 1Y5RA 3WQQA 1PGOA 2XPCA 4F45A 2YDYA 3RUHA 3GMSA 3OIFA 4YJGA 1BG6A 1NQ5A 3H65A 2HMTA 3LU1A 3LZ6A 1L1FA 3WDSA 1RM3A 4XQGA 1A9YA 2X23A 4I8XA 3FBGA 4AJHA 3DHYA 5BSGA 2DU8A 3WWYA 4WLNA 4Y8VA 4D42A 2D5AA 1EMDA 2PZMA 3O26A 2O4CA 1BVRA 3AI1A 4R3WA 4H15A 5IXYA 4KOAA 1E7YA 4RPJA 4ND5A 1WWKA 2X0RA 3JYNA 5I7FA 1KVTA 1LNQA 5KWEA 3ZCXA 4E2YA 1SPXA 4IDCA 4DLAA 5A5EA 4MKRA 3RSHA 3PJEA 4OO3A 3IUPA 2DTDA 3F4BA 5U1PA 3KOUA 5CEFA 1KS9A 3RC7A 4KUEA 5FYDA 1MC4A 3OIDA 2PGLA 3HFSA 4UVEA 4EYEA 3ZWWA 3LF2A 2A94A 1UH5A 4P4GA 5KVSA 3WOHA 4CMJA 1E3IA 5F5NA 4NFYA 2BF7A 4XYLA 3DFUA 2W98A 1BRMA 4CM9D 2X0IA 3NUGA 4TWRA 4OSOA 2I99A 4XGNA 3GVXA 4IDAA 5JO0A 2PGDA 4P4LA 1YOVA 4FSHA 5ITWA 1ZK2A 4BOYA 2YY7A 1E7QA 1XU7A 4RO0A 1GYPA 3ZWBA 1H6CA 1P0FA 3PQDA 1N1GA 1VKNA 1ZSNA 1PJCA 4FFPA 2DKNA 1UDBA 4EBFA 1V8BA 3I52A 4U8GA 1ZCJA 5IZ4A 2BMAA 2EERA 2GR9A 4DQUA 4XQEA 4GL4A 2HLPA 1XKQA 2VWPA 3OQBA 4YRDA 1DRWA 5I7SA 3DTYA 2WMDA 3S1LA 1E1LA 3S8MA 3GUCA 4ZHSA 5A4DA 3E82A 1PL7A 3GGPA 1NTOA 2Z1MA 3ZWMA 2PNFA 2G1UA 2B0JA 1YVEI 1OZAA 1I2CA 2CVQA 2GN8A 3JV7A 3E48A 1EEHA 4BNZA 1KETA 1W6UA 4CM9A 3DDNA 3IP1A 2CVZA 2HDHA 1LI4A 1T26A 4KWHA 5F21A 1QSGA 2VUUA 8LDHA 2B35A 3I4FA 4PVCA 4E5PA 2GZ1A 2WE8A 3DOCA 4DA9A 2HCTA 2X6TA 4TMFA 2O4UX 2PZKA 1X14A 3G1UA 3JD1A 1DC5A 2Q45A 2VNAA 3H6KA 4UEJA 4B3JA 3FTPA 4XGKA 4ND1A 2H9IA 1GZ6A 1B26A 1U2GA 1DIRA 3WLEA 5JBIA 1E6EA 1LDBA 3FN4A 4JJFA 3O8QB 1U3WA 4ESOA 3WGOA 3GY0A 1CRWG 3IMFA 1LEHA 2P5YA 3OMLA 5BSFA 4YA6A 1EFKA 1ZW1A 3WBBA 4JN6B 1JWAB 1DSSG 1VJ0A 4DLLA 5CDSA 3DOOA 4IMPA 1BSVA 3DMYA 5DP1A 4UUPA 1LSSA 1P1IA 3O9ZA 3NGLA 1W73A 5G0WA 3IKTA 2W2KA 4IJVA 1GEGA 1C14A 1P1JA 3INRA 3LLSA 4II2A 3R3SA 1K6IA 1F14A 4YPOA 2YHIA 3HB5X 2VZ9A 3KVOA 4FB5A 3Q2IA 1GR0A 5KJCA 4Z9FA 3TZQA 2C2YA 5G4KB 5TLSA 1B2LA 1Y8RA 2FR1A 5C3MA 2AG5A 2SCUA 5ER6A 2ZKLA 3O03A 3OQ1A 1S7CA 4FBGA 3B1KA 3RCBA 3VPXA 4BB6A 4JNKA 2OBYA 1KEVA 1QYDA 2O48X 4LSWA 3FPCA 3GEMA 4D41A 1FMCA 4TRJA 4E21A 1WDKA 1NPTO 2D5CA 4M86A 3FNFA 5TRTA 3DTTA 1YKFA 2ZTUA 3N7UA 3ICPA 1W0CA 2HQ1A 4HFNA 5TJ9A 3NT5A 1GV0A 1OOEA 4UULA 5JFOA 2ZB8A 4NBWA 4ZQEA 3RUAA 1U8FO 1PZHA 4XYEA 2J3KA 3ZH2A 4BKRA 1GUYA 5KJ1A 4XYMA 4ZRMA 4K6CA 2VWHA 3GK3A 2AA3A 1GV1A 3HB4X 3BTOA 3KYCB 1I33A 1VM6A 3P19A 1XQ6A 3AM5A 4Y6PA 4QO8A 3ZWYA 1V0JA 1ML3A 1P77A 4UVIA 3L4SO 3RC2A 1DXYA 3HN2A 1GCUA 3FI9A 2O2YA 3U4HA 1E5LA 2QRJA 3F1KA 3GFGA 4OM8A 4WCDA 2F00A 1G0OA 4CQMD 4R3NA 1ZEJA 1A7AA 4RVDA 1CQIA 3S2FA 4IXTA 5L7TA 1PGPA 3MTJA 3PIDA 2O7QA 2PKQO 5AXAA 4FFNA 2ZJ1A 1PR9A 1Z7EA 3MJEA 3P2OA 4I1IA 1LQTA 4DLBA 1CJCA 3KYBA 3P7MA 3JSAA 3GVIA 2EV9A 3KBOA 2GASA 2XXBA 1MB4A 1E5QA 1ISFA 1A5ZA 2OBNA 1UDAA 4XQCA 5KCZA 1PJ3A 3JQ7B 1DIGA 3N74A 4J0EA 1T2AA 1PL6A 3L0DA 4A03A 4IDEA 1DAOA 3PI7A 2AHRA 3TPCA 1UR5A 3SC6A 1L7DA 4GKBA 6LDHA 4OQYA 3TSCA 4WCFC 2POQX 1NQAO 4NPCA 3KM0A 2FRDA 1B16A 3DHEA 4GX5A 1HRDA 5JAZA 3K2BA 3GN2A 4JJGA 2EP7A 4IIUA 1M6WA 3DZFA 3BMOA 3EVNA 2FOIA 1DC3A 2QZZA 4PRKA 5AXBA 5HS6A 3RFTA 3W6ZA 4BQRA 2EJWA 4J3FA 3AOGA 1ZK3A 4D43A 4MOWA 3H9UA 3QP9A 1KY5A 3H9EO 2GZ2A 4KP7A 4BNUA 1V35A 1U28A 2WYVA 1T2CA 2PKRA 3KLMX 4FFOA 3ZHZA 5IF3A 3GHHA 4I9HA 2VTDA 4ZJUA 1HYEA 2AQ8A 4Q3DA 2QQ5A 1P44A 1X0XA 4CQLB 4PVDA 2B69A 4IIVA 4PLZA 2YZ7A 4OSPA 4R4JA 3W8FA 4B7UA 5GZ3A 4BNJA 3CZMA 4K6FA 2R00A 3JQEA 1H6AA 3WJAA 4OAQA 2Y66A 4U0KA 4RV9A 4UVDA 4E33A 2C82A 3MEQA 5G0SA 1NFQA 1XA0A 5EIOA 2EXXA 2EP5A 2WD8A 5JCXA 3OJ0A 1R6DA 5COQA 2JD0A 2CSUA 4E4YA 3DXFA 3PQEA 4MVJI 2BI8A 3GDFA 4FPXA 5A05A 2VYNA 4FGSA 1F06A 1AHHA 1T2EA 1X1TA 4CM1A 3BMQB 2OZPA 1DIBA 4RPHA 3Q6IA 3DBHB 1VL0A 1R0SA 2YQ4A 3F6YA 4D45A 5JDCA 4DC1A 3PTZA 3AFNA 4FOSA 4ALIA 4CMAA 4CM5A 4F6CA 1C1DB 1XWFA 3INGA 3G17A 1ZXLA 3VPGA 3PIIA 1TI7A 4C4OA 4QSMA 2Y1CA 1I24A 4ZICA 4MP8A 3UCXA 4EITA 1K89A 1I2BA 2AE2A 4U0JA 1BXZA 3V1TC 4Y9DA 5BNTA 4BNLA 4WECA 4K26A 1FJHA 4JQCA 1P74A 4RDIA 4TRNA 3P5SA 3UH1A 1Z82A 2IEDA 4IDDA 4PZDA 4MIOA 1NYTA 4MIYA 1I3MA 2BGKA 4J43A 1HDRA 4AJIA 2Y99A 5IZCA 2FSVA 4Q3EA 2UUOA 3DAPA 2BLLA 5A3JA 2Q1UA 5KJ6A 3RD5A 3V1UA 2J5QA 3LT2A 2PY6A 1YE3A 4J7XA 2UYYA 1EVJA 3JQ6A 4URFA 2H1SA 3ZHYA 4B4UA 2FZEA 4XCVA 1NASA 2C0CA 3EUWA 4PG5A 3QWHA 1BWSA 4XR4A 3EMKA 4U6QA 5COAA 1MUUA 5FF9A 3CPSA 1PWZA 1GY8A 2X9NA 3H2ZA 3JCZA 4KTTE 1J49A 4YJFA 4EEZA 3PWSA 2DUWA 4OYRA 2JCXA 4A73A 2EWMA 5L45A 3RAJA 2JHFA 3DOJA 3K31A 4LK3A 4DQXA 3GF4A 3F4LA 1SMKA 3NRCA 3OHSX 3AI3A 2NU6A 2VRCD 4MVJA 4KUGA 3A1NA 1R12A 2DUUA 3W8DA 1R4NA 2NU9A 4YCAA 4FC6A 4FD3A 3SX2A 4II3A 1ONPA 3TN7A 4AJKA 3PJDA 2VYVA 2PD6A 2WSBA 3TL3A 2HK9A 1MFZA 3SLKA 3ADOA 3WICA 3RROA 1N92A 2Y1OA 3GVHA 1UXGA 1XIVA 3WBFA 5AYVA 1W4ZA 1E7MA 3H4VA 4F6LA 4I5EA 2NTNA 3WGIA 1UAGA 4FQ8A 1PGNA 4DPKA 4HNHA 3VDRA 4B7XA 3GDGA 5I7VA 4RVGA 3DBLA 1VSVA 1Y9EA 2LDXA 1A9ZA 1HE3A 2Y68A 3BTUA 2Q99A 3NT4A 1UDCA 2OORA 2V7PA 4BKQA 1NR1A 5CEEA 1YB4A 4FGWA 1PTJA 1CETA 4BO6A 2C7VA 2AXQA 3CUKA 4I5GA 3ULKA 4BGUA 2Y1DA 4CL8A 1ULUA 3IOYA 4L4SA 4XYGA 1RKXA 4RPGA 2CDBA 3L07A 4BQPA 3WGQA 4R68A 5JAIA 3GGOA 3DAFA 5IDQA 1ENOA 3D1LA 2VUTA 1QKIA 1ZVMA 4OJNA 4WLOA 1I10A 2C2XA 3EZYA 1J5PA 1N7HA 3GRPA 4ZVVA 4WNIA 1JWBB 4RVFA 1Q2XA 1HLPA 4GMFA 3SBOA 3VZQA 3ZWXA 3EK2A 3RUEA 1OC2A 4AICA 2Z1NA 4AJOA 5A5FA 2WTBA 3OF2A 4EDFA 3H5RA 4NI5A 3EGOA 3WFJA 3F1LA 3DL2A 5IZCC 3FPLA 4FJ2A 2J3IA 3ZN2A 2QRLA 3T4XA 3NTOA 4NK4A 3ETDA 4OHUA 4CLEA 1J0XO 4CMIB 3GQVA 1LX6A 3T7EA 4I9UA 3LDHA 1WAMA 1YBMA 3NJ4A 1ZK0A 3LSYA 4I5DA 2YV3A 3AOEA 3E03A 2IE0A 3IKVA 4A2CA 2IYPA 4M89A 1G1AA 2C20A 4CODB 4HKTA 2RBEA 4M55A 1T4DA 4W6ZA 3OJLA 4MVJP 4YQZA 1NWCA 4HFMA 4ALKA 4OKNA 1A71A 1KBZA 1JDJA 4Q3CA 4A27A 2R6JA 4NK5A 5TJHA 1ZZEA 1EFLA 1C0PA 3F3SA 3PHLA 2VUSA 3GUYA 1QMGA 4RVHA 2Q50A 9LDBA 4CQMB 2Y0EA 1PU2A 3G3EA 1O0SA 4NQZA 3D5TA 4YACA 3U0BA 4G5HA 5I9LA 2EGHA 2PZLA 5ENVA 8ADHA 2UV8A 1H2BA 3CMCO 2QX7A 5ILGA 3AUUA 2VCYA 3RBVA 3RBZA 2O3QA 1KIFA 4IDBA 5L7WA 2AMFA 3I1JA 4IS3A 1ONNA 1MV8A 4PZCA 1NFFA 1HYGA 4AJ2A 4WLEA 4P4NA 3QJ5A 4IQ8A 2Q1TA 3ST7A 3DBVO 4K28A 3NTQA 1YO6A 2NM0A 5AQ1A 3KO8A 1P1FA 4QT0A 1BXGA 3SXPA 3L6DA 1D1TA 2IXAA 4J16A 3H5AA 4MJLA 1GQYA 1S6YA 3U4DA 3MJTA 1N2SA 4MVJG 4DIOA 3SJUA 1H6DA 3ASVA 2HMVA 4RF3A 4CMBA 3ZU4A 3C1OA 1PIWA 5TF4A 3TOXA 4BMNA 4BNKA 1MA0A 1OBFO 1I3NA 2JAHA 1CIVA 2PZJA 3LT1A 4M87A 3PRJA 2AEFA 3A28A 4AJJA 1H5QA 1N9GA 1BW9A 4MP6A 2VRCA 3DZIA 3QY9A 4MVJD 4O59O 2NQ8A 3ROKA 1ZUD1 3BTVA 4Y6RA 1B14A 1QXSA 3TOZA 4CV1A 1FDSA 3TZKA 4N54A 2VWGA 5GMOA 3UN1A 4RORA 1PZGA 1I8TA 4J6FA 5CHEA 4AJPA 1OI7A 3VHRA 1H9BA 3RUDA 2HUNA 4O0LA 5HBRA 4B79A 2ZQZA 2O50A 1JKJA 3R6DA 4I08A 2QW8A 1E1KA 1VRWA 4R16A 4FJ0A 4FDAA 4XKJA 1XCBA 1JAYA 2QYSA 3F47A 3ICCA 4WEOA 4OXYA 3BHMA 4CMKA 1IY8A 5HA5A 5THKA 4L75A 1PJ2A 1NX6A 3IS3A 4BO7A 3GHYA 2OOSA 4CLDA 1YONA 2NACA 4O6VA 5EQFA 4R9SA 2DTEA 3I83A 2BFOA 4FFRA 3N58A 5CDTA 3KHUA 1MGOA 3PFWO 4WEQA 1LRJA 1VSUA 1BDBA 3U9LA 3WLFA 2GGSA 2UVDA 4NMHA 4EI2A 2ZIZA 3COSA 4NHEA 4A7PA 3ZNNA 4BNNA 1PS0A 3QLJA 1ORRA 3D0OA 1PQUA 3GT0A 1WXDA 3F5QA 5B37A 3I5MA 2O3JA 1ZSVA 3KUXA 3OECA 2CZCA 2H6EA 3IJRA 3TWOA 3BAZA 3ZZNA 1GCOA 2QG4A 5A1TA 1H0KA 7ADHA 4E2XA 5TC4A 3FF4A 3JD2A 3GEGA 3GNQA 2H63A 1TVEA 4YAGA 1UP7A 2CF5A 3TF5A 1QORA 3QRWA 1XGKA 2IZ0A 4Q9NA 1M6HA 4IZIA 3WS7A 2GDZA 4LVCA 2NLOA 1NR7A 4GAEA 2EW8A 2Q49A 3ENKA 2XOXA 3AY3A 4DRYA 3I6QA 2JFHA 2Q2QA 5FI5A 3JYLA 3K73O 3OBBA 2Q3EA 4JCOA 4R1SA 1B8VA 1CDOA 5I7EA 1ULSA 4Z6KA 1LDGA 4W9NA 1EUZA 2AE1A 4NU6A 4AJ4A 1B8UA 3O8QA 3KSDO 1H6BA 5G0TA 3HG7A 1E1NA 2GPTA 3M2TA 3ZV5A 1ZMTA 2BD0A 4YAJA 3W4KA 3MTGA 3ZV4A 3ONEA 1RPNA 3Q1LA 4LRTB 3H9JA 4EW6A 1E1MA 3BA1A 1DO8A 4PLCA 2F1KA 4HP8A 4XB2A 3H2SA 2FPPA 4AJNA 3A06A 3WX0A 4L4RA 1LXCA 3S55A 1PZEA 4RQTA 3PWKA 3PQFA 5COBA 1ZEMA 1H9AA 1M76A 2JFGA 4BO5A
chains in the Genus database with same CATH superfamily
1EIZA 4D8YA 5L7TA 4QO7A 2H1OA 3WDKA 3WAKA 1RI4A 2OUKA 3FWPA 1I7DA 2R44A 1VCHA 1LSOA 3DMDA 2W7TA 4DIBA 5K6TA 3UW1A 2C1ZA 1XT6A 3VYVA 1MC5A 4MUJA 4CLHA 1O6ZA 3JQGB 5IDWA 1ABBA 1I3KA 3O4GA 5EPOA 2A5DA 4EGCB 4EGAA 3IULA 1IBSA 4OGKA 3FTNA 2CLOB 4RXUA 5C1OA 3WLSA 4KIFA 1N34B 2HHCA 4UQPA 4TLAA 2ALJA 1WW2A 4R6XA 4J1NA 3QPVA 4CTKA 4BWFB 2B5OA 4DMMA 2NU7A 1R6AA 4IDUB 1SZJG 3WDLA 1TQDA 1ST2A 3V2UA 1VMIA 2ODNA 4A8JB 4CQJA 3QX3A 2ZTHA 4JQZA 5KOJB 3D4IA 3HLYA 4PWZA 1EHCA 5FI3A 1Q14A 4TVBA 3SHQA 1B0AA 1PQWA 1L5GB 4LKRA 3OCXA 4YR7A 2V7EA 1YK0A 4AG3A 1B76A 1U8XX 2WNHA 2O3RA 1Z39A 1SULA 3I01M 1ZD8A 3O92A 3PXXA 2Q0SA 4DUYB 1BMFA 2APJA 4JU8A 3V7NA 4RVNA 1Z75A 3A0UA 3R5XA 2Q7DA 1K63A 4DIDA 4JX8A 4MVWA 3HZOA 5E8JA 3SJ7A 5JJKA 3HRIA 5BVGB 1JX6A 3SR3A 1EVEA 1EUQA 1LPBB 1KYYA 2AZDA 4H6WA 4NC9A 1QO7A 3U6KA 4C7OB 1CHNA 1TYZA 2EBUA 3CLUC 2ZT7A 3VBCA 2XWQA 1QPZA 2D7DA 3C7DB 2VF4X 3PPYA 1R0BA 1HDYA 1DXOA 2PT7A 5L7YA 4QIHA 1Q1EA 2VDPB 4EPVA 4RTMA 2JEZA 3WL8A 1GG8A 1JBQA 4Y9SA 1M2OB 4ZCLA 3U40A 1GTL1 4D81A 1C41A 2FOLA 2RGCA 3X1KA 4Q16A 1LNZA 2EWVA 3QVOA 3H5VA 3L05A 3WFIA 1KVRA 2Z2KA 3Q9LA 3W5IA 2HD4A 4DNXA 3BIOA 1F2TB 3RS0A 1N5KA 3WB0A 5A2QA 1XTBA 3KXKA 1PT7A 2PYDA 2NV6A 1KEUA 3EHDA 4PGHA 4U7TB 3A2KA 3R3WA 4IFEA 2BMJA 3JQ7A 1KRHA 2GEFA 1P9WA 1M54A 3BXZA 3IQXA 5DJ5A 5BOSB 1JH9A 1IQPA 4PYOA 1GNVA 2XD9A 5DASA 3TVTA 2A30A 3CZCA 2R66A 3HCBA 5IDVA 2G0NA 1E3EA 4J7UA 2A9VA 1EX7A 2CYBA 4HWPA 1NLFA 1KI8A 1Z74A 4Q3AA 3VSAA 3O91A 3PC8C 4BHTA 5C53B 4HCJA 4JEMA 1KGSA 2Q4RA 4UJ5A 1N33B 2D0PB 2E1RA 5FI1B 3EIUA 4CETA 2ZRQA 1O6FA 4FNOA 3EJ6A 4LXQA 5HS6A 2AEMA 1UDXA 1NI5A 3H2GA 4HMPA 4XJSA 3ZE7A 4MDEA 3K8QA 1XN4A 3I1IA 2OHHA 4IYRA 1H65A 3ER9A 1H93A 2GDJA 3N87A 4CUKA 2J9FA 1BDHA 3BSYA 2QX8A 1UT5A 2O5RA 5A62A 5FPTA 1M1NB 1ZN2A 4H7PA 3AVTA 1P8JA 2PGNA 4ESVA 3FNQA 4ASUA 2F2TA 3NYWA 1ICEA 3IBYA 2J0VA 3DZGA 3H1BA 1QVAA 1Y8QB 4RQUA 1I1NA 5FFNA 2I2BA 1T8YA 2GSWA 1D7OA 3STHA 4XSGA 2FPKA 5AVYA 1IEWA 1DJLA 1OIVA 4PM4A 2FZVA 4DJTA 5HUJA 1BXKA 5DIFA 2RI1A 1C8BA 4ALNA 2OHVA 4ZV7A 3G6WA 2XCQA 3GLHA 5H0IA 4J91A 2CNWD 4H6PA 1P1RA 3IEKA 1AHPA 2GD1O 1FX0A 3FCEA 4CL2A 2G17A 1GLVA 3UKJA 5JMOA 3KR9A 3MSXA 4G5QA 1IN1A 1JQ5A 1UWVA 3DVLA 3PDUA 1OU4A 1O94D 3Q0IA 4K9LA 4DM3A 2JH8A 1QHHA 2D5BA 3ZU6A 3H1EA 3BCSA 3L7AA 1B15A 1TJ5A 4Z4EA 1WQ1R 3J81A 4TKLA 4MW9A 3T9FA 1FFYA 1VIDA 4W9MC 3EEBA 4YIKA 2OILA 2QR3A 2WPDD 3MWDB 2A5YB 2HC9A 4EP1A 3HDYA 2RGRA 4B2IA 2FFJA 1V6CA 8MHTA 2HM7A 1KFBB 3QKSB 1H4QA 1NM5C 1B3RA 4E5UA 3CN7A 2O3SA 5DHUA 2JFWA 1BCRB 2R9VA 3C1AA 4JGBA 1U6IA 3T06B 1W44A 5AM2A 1QX3A 4B32A 1YQQA 1RWNA 2WB4A 2ZIUB 3KXIA 4OY3A 3OEEA 1SG0A 4N0DA 5D7NA 1ODCA 5EE3A 1UFOA 4QTTB 2GO7A 2Y0CA 2K4MA 5ESRA 2C54A 1C0LA 3RUFA 1NDHA 1F8UA 3V5NA 2BKVA 4MWCA 4MTCA 5HJ7A 2G4VA 2OB2A 5CIQA 5A3SA 4IDFA 1NAIA 121PA 2PJZA 3GT4A 4A1OA 1FK8A 2IW3A 2WJVA 3AR9A 2L2QA 1ADFA 1FB5A 1Z34A 2FJ0A 1BC5A 4JLWA 3U4IA 5KYTA 3JQGA 3SHOA 5KWJA 1YQ9A 5LMCA 1A3CA 1WZUA 2JJYA 3NNDA 5E1BA 1SUSA 4CEHA 4ZVNA 4BVBA 1IHYA 5D1NA 1QH8B 2CZGA 2ZVDA 3JR7A 3GJSA 1YQEA 3B1VA 3P2YA 1EXMA 4KJZA 4IG4A 1X80A 4AROA 5CXXA 2QX4A 4PN3A 5IUKC 3F7OA 1PJTA 4L8FA 1X6VA 1XDWA 3FFAA 5ALGA 3VYWA 1YWGO 1AMNA 2CNOA 4ZAGA 5THQA 1M10A 2BONA 2PD4A 3A6FA 3HCAA 3C43A 1E77A 2GN4A 3LK7A 3OM9A 4LVOA 4NBRA 4BGPA 4D9BA 4IQGA 2C03A 3UWOA 5FBZA 1NXVA 3FR8A 4MWOA 4NDZA 4NJEB 3S2EA 1JRLA 1CQPA 3M5WA 4AJLA 1P6QA 2JCVA 3Q7TA 1I30A 3LHIA 2NNLD 5BRNA 3KU4A 2OCYC 2WAMA 3A4YA 3GPCA 4UNSA 5LIRA 2KX7A 1ODTC 2XUPA 2FW7A 3D02A 3A04A 2YJ4A 3B20A 1WD5A 2ATCA 1YQUA 2ZJYA 3F8WA 3PUKA 3T7CA 3TRKA 4BQQA 5CCBA 5CJ2A 1Z5VA 5T3YA 3LUFA 3SIRA 4ZMRA 1ORDA 3CLHA 1CNFA 1TXGA 4N0QA 5IAGA 2PXCA 2ONJA 1WSWA 4KFUA 1NE2A 2H5IA 1U8CB 1YL7A 4Q5IA 1V1JA 4DZRA 1L1QA 2A9FA 2P9GA 3GR6A 3QYFA 4B7ZA 4IIJA 1G3UA 2R48A 1U7WA 3RTGA 1NKSA 3PWTA 3HZZA 4LZOA 2I29A 4BGIA 2RB4A 4WNAA 3UOWA 3IJ5A 3U7HB 1W48A 3ZBQA 5K0TA 3N0WA 2DCMA 3T5PA 2EWWA 3MCVA 2ZAIA 3HJTA 4OMUA 2PKXA 3UWDA 3ZD9A 3FNHA 1T2NA 3EQ2A 2AYYA 4LOLA 1U0BB 3PX3A 1CZOA 3CWQA 1HZJA 1KP2A 1R2QA 2GZHA 2DCUA 2NU6B 4LBZA 4MMZB 5J40A 4RANA 2UXDB 4DLKA 1E9FA 3I3SR 1J0AA 5CHYA 3ZNOA 1XD2B 2NYVA 1SOVA 2CNLA 4RHFA 2ZWAA 4P5PA 4NJMA 2OCIA 4F9GA 1Q50A 4KXNA 1UEXC 3OZRA 3OM0A 3QYPA 1KIAA 3U1VA 1RW4A 2WM9B 2WUDA 4Y67A 4RF5A 4BAZA 4YRGA 5HIKA 4H7EA 4H7JA 2D0OB 2FV8A 4OHKA 4EI7A 3E2IA 3GA7A 1YBAA 4XD2A 3OJEA 3P0RA 3PL1A 4OHVA 4COKA 1JTEA 1CJVC 3HBAA 2LBPA 4UAUA 4ZMSA 3AGQA 1G3RA 4ZXFA 3WHKA 1M1NA 4DB4A 2HY7A 2AB0A 1R0KA 1YDHA 3IAUA 3ZHBA 1V6AA 2QXYA 3K5PA 3O8DA 5B4VA 1GAJA 3UWPA 1Y8QA 3FYCA 1ORTA 2PL1A 4ZARA 3RAGA 2QA5A 1ZCFA 4OYYA 3CF0A 5CW1A 1GZVA 5IYZB 4OOFA 1BHQ1 2GPNA 1PN3A 2O0JA 3DXYA 3EPRA 1JQ3A 4GBMA 3ZW8A 2NQTA 4DDHA 5H3CA 2H1VA 3WIUA 5LNK6 2YWRA 2H00A 1TGVA 3A27A 3EH1A 3O3CA 3OO1A 1IQ0A 2YMPA 3DEKA 3IO3A 4RGYA 3K70B 3D8SA 1OWPA 4ZRNA 1X1QA 1XVAA 3RU9A 1VYUA 2BH9A 4G36A 1HORA 4FUQA 1EP9A 4NULA 1U98A 2J31A 3CZAA 4NCXA 3C4JA 3PNMA 5IVDA 5AVSA 2ZRMA 3K7EA 4HTFA 4W1PA 2BFCA 4X63A 3KWLA 5AKGA 4EHFA 4QNRA 1W85B 1YJAA 5KQLA 3PVCA 2TRSB 3R2JA 3I0ZA 5FV7A 3ZE9A 1DWUA 2EGUA 4IQFA 4JR2A 2C2GA 1JHOA 2CB9A 1WG8A 4M9UA 2GRAA 3SVZA 1YBFA 3AYZB 1QGUB 1U4SA 4HWKA 1GADO 4QOJA 4RDXA 1SK9A 2Q8NA 3GLFA 2JARA 3O73A 1VRVA 4PG7A 3PGKA 4R8SA 4OIMA 2YVKA 4FD2A 4Y1EA 3W8RA 5KSOA 1WCWA 1QFYA 3VNBA 3ZGZA 2WV7A 5IAAA 1T25A 2I80A 1P5RA 3I0MA 3YASA 4YRTA 3DEJA 1NULA 3I76A 1GR1A 4C04A 1KI4A 1ZVQA 3TS1A 4DXAA 1QH1A 5G2OA 3UJ8A 4UPVA 1QGYA 2BSQA 2X3YA 1GAWA 1PZNA 3G2IA 4FIZA 3UC9A 4OQDA 3JAWA 3VV2A 4OI0A 3NMUF 4OFBA 1DG9A 1FUEA 3O84A 2Q21A 3SF0A 2JPDA 3C3JA 5IEJA 2CLMB 5IM5A 4CQMA 4ZFNA 3O93A 3HKBB 3R6GA 1Q0ZA 4ZYYA 1I36A 1PS8A 2Z08A 2ZUVA 1G8MA 2AG8A 2BMVA 2I8AA 2V0NA 4OFZA 5FBKA 4RTLA 3OUZA 1NIPA 1N6OA 1U7TA 3EMDA 2BFDA 1MQ9A 3ORSA 5SZIA 4C0JA 2G3YA 4HXYA 4CEHB 5EIEA 1Y63A 3HL0A 4C22A 3GJ0A 3C1TA 4H16A 4UBNA 1C9JA 2CV2A 3WIVA 4UVGA 1FZQA 1E61A 1K5GA 5JMWA 1MEOA 2EKDA 2ET6A 2V6MA 1NVBA 2NVWA 4FGLA 3EVDA 2R8EA 2HJRA 1XEAA 1QE5A 2QZSA 3WYAA 3G02A 3E3NA 4DUPA 1Q20A 1DLJA 4S1VA 2VBGA 4LXHA 4Y2PA 2X5OA 3QVXA 4OUDA 2VPQA 5EIBD 3ZCVA 2VT3A 1Z35A 2PS0A 4RPLA 1X7GA 1O1YA 2D1TA 3PITA 1D0IA 2EU8A 3BXXA 3WNVA 4GPZA 3CM0A 5CYGA 3OKPA 4DDKA 1XZIA 2QD5A 4KNVA 5DHRA 5C7IO 2EF0A 3L0PA 1KFKB 1XALA 2C3YA 5TGZA 2G1JA 1LBSA 1RI3A 4TWZA 1MB2A 1RQGA 1VJ5A 4BE7B 1TQ4A 3Q9SA 3VQTA 3II6X 5JC1A 1QAOA 4G0UA 1MR3F 4MVJF 5FOWA 1NVTA 3JQ8A 3DYIA 1I0LA 1X3LA 3IL2A 4NXMB 3CIFA 2LWIA 3TEJA 2YJTD 2Y1GA 3CH5A 2AQKA 4NH0A 2I3AA 1BX3A 1YTLA 3HVIA 2YWXA 4ZO4A 1I3LA 2G9ZA 2I91A 3UICA 1DBIA 3VU1A 1WQ3A 2XCIA 1RXYA 3FPKA 3SBXA 3WGNA 3TM4A 3HXPA 3KPWA 5LB4A 1YR6A 2W8ZA 2CNNA 2XDWA 4I14A 1ZJ6A 3E84A 1KDRA 4ND3A 1A4IA 4OOEA 1X7ZA 2XB4A 4HDRA 1J07A 4UREA 4ND2A 3KB8A 2F9MA 3QKRB 3DO8A 1JKJB 2HMYB 3T99A 4LVNA 1KYIA 1TU4A 4IL5A 3T7RA 3KWMA 2B7LA 4QKQA 5G53C 1UC5B 1YAHA 1PE0A 4R1TA 4WINA 4NYIR 4ETMA 3R9XA 5LP6B 4D56A 5L3SA 2YJGA 5IJXA 2X5JO 3DE5X 4ZYXA 2FR8A 2ZBFA 3EC1A 1ZK1A 4WVLA 3DEIA 2D3WA 1WMEA 3EE6A 3AESA 4JENA 3VH3A 3KPYA 5K51A 2FP3A 2UYCA 4M53A 2HIAA 3HXMA 1USWA 2AZTA 2ZBDA 2WB2A 1QFJA 3G2PA 5AVJA 1LY1A 1KRWA 1T9ZA 1YR7A 1YT5A 3E9YA 5AXCA 4YXWA 3OIWA 1Z8FA 3RIMA 5ABPA 3H4TA 2Z95A 1CS0A 4GS5A 2FU5C 2POCA 3AIKA 3PTLA 2GD0A 2AI1A 2XMSA 3OESA 4UZEA 3RODA 4F72A 1T6YA 5FPKA 2DQZA 5TIIA 5JTUA 4KYIB 4BCCA 2WSYB 3IX7A 4DR7B 2ECQA 4L5CA 1O6GA 4Q12A 3D3NA 3IAS1 3WGHA 3L9XA 4HQRA 2NO6A 2OHFA 4RXMA 2F62A 3CINA 4PW0A 1VYTA 2CWWA 2EP8A 4RY9A 3OQ6A 3A6ZA 3TCKA 1VE6A 2PFSA 4ISBA 1P2SA 4BO3A 4ZMBA 1N6LA 1Y7PA 1KWGA 4BB9A 1L9XA 4WV3A 4INJA 3ZGXA 3NBMA 2XV1A 5C7LO 2CHQA 3BUSA 1Q22A 4N5NA 2NMVA 3IDQA 4MUGA 2WE7A 4FX5A 3QHAA 3ZQUA 1I0ZA 2FSFA 2QTVB 2GYWA 5EESA 3E9NA 3UCEA 2CXTA 1NBHA 2A9JA 1QE3A 2QSJA 3C98A 4C5BA 1Z9BA 2O3UA 3FUTA 1B6TA 5FOVA 4EQ6A 4F84A 4XRGA 3B9PA 1XXLA 1QAMA 1Y3HA 3E61A 3V4ZA 3B52X 4KWIA 3I05A 1DKNA 4M1KA 1JQLB 4O4JA 5T6MA 1AA6A 4I1OA 3ENQA 2HF9A 3M1IA 4NV0A 2XGGA 3SICE 1GYRA 2UYOA 4YS6A 1X7XB 1FDIA 5CVJA 2O19A 3HYSA 1EWQA 2FLVA 2J59A 3DKKA 2OOKA 3OIGA 3TINA 2IS1A 5BSWA 1P9LA 4RFSB 2E37A 4EA8A 1NXPA 2VLIA 4MR7B 4A0SA 5IWCA 1HEIA 4ND7A 1GRQA 4YRRA 2SKEA 1OAAA 5JS2A 4A0RA 1VHWA 3PL5A 4PQRA 2VAXA 4DLXA 1LDYA 1NOIA 2JATA 1DMSA 3E1SA 3EQ8A 1B4DA 3VRHA 3S8YA 3OD5A 1G2QA 3KOZA 1A98A 2WM8A 1P2BA 4FYWA 4GYKA 4RKWA 3IERA 3GD5A 3JS5A 1P3DA 5KO2A 1TC1A 2E6UX 1M2FA 3E35A 3PICA 1QHNA 4ZDJA 3UFBA 1ZOIA 4AFNA 3E8MA 2GZAA 5I9TA 3RTEA 3TKYA 3TJRA 5C8VA 4M0DA 5CAEA 4B76A 2CUTA 1KJJA 2GRUA 2QJWA 2YDXA 2BT4A 1P2VA 3H6HA 2Y1FA 3M5DA 4D80A 5A06A 1K3TA 3VMFA 1SVIA 6ADHA 2XCOA 1D0VA 1YS2X 2C5SA 4Y9TA 4ZREA 4MR8A 5IN4A 3G9UA 3BDVA 1RYHA 1E1CB 4FILA 4IGAA 1C50A 3WNQA 3IHLA 1DJQA 4NZPA 3D8TA 2RJ3A 3UK1A 5IABA 4U39A 3AWDA 5K6AA 1D03A 4PLHA 1U5BA 2QROA 5KIAA 2J9XB 4RA6A 3R7WB 1Y5LA 2FJPA 2G40A 2R6ZA 4PCLA 1WABA 3WSTA 3W5HA 4JR0A 4ZO9A 1IK6A 2B4RO 3WDMA 1WPRA 3WLIA 4XJTA 3EDMA 1A4UA 4OUDB 1A72A 1PGQA 4DMLA 4LHZA 4PHTA 1QC5B 1M9NA 2M6RA 2P11A 3DMHA 3OPYB 5HE9A 4MJ7A 4RY8A 5DNAA 5F9FA 1P4RA 1GZSA 5DM2A 5FEMA 3B3GA 4H0FA 4JJZA 1SC6A 3MIZA 4XJVA 3CKLA 2RKWA 4R9VA 4AY2A 1C3JA 4RDHA 1OX4B 1WDTA 4N18A 3LMKA 4RPKA 3U3XA 1Z5UA 3VR4H 2YYZA 5JU6A 4R8VA 3KQUA 1T0HB 4Q4LA 5K3FA 3VYRB 4X85A 1GEEA 1JKMA 4K6KA 4C0BA 2YWBA 1J4AA 1LBEA 5K0CA 1W2HA 3MTDA 1OI4A 3S8EA 2XQVA 2IHYA 2OFOA 1GDHA 4IJKA 1R9JA 1OXSC 3K9HA 2PYZA 1NQTA 3BWEA 4WLFA 1AK9A 5DP2A 3SS7X 1GAXA 4FWTA 4ETWA 1PCXA 4LX8A 3PDIA 4JUBA 1D9ZA 4BIIA 1JEOA 3RU2A 3SS9X 1D07A 4JB8A 2E21A 3JTMA 3DZBA 3KZXA 3P9CA 2UDPA 4IH1A 2H5JA 4A0QA 4QZVA 1F0PA 1UEJA 3HP7A 1NJ5A 2NVOA 3PUHA 1VIMA 3HBNA 4G5OA 3ZQJA 3AHGA 3IXQA 3U3DA 4EHBA 5JNRA 5MGBA 1E79D 4BFSA 5B1YA 3HABA 1J2YA 1JTVA 3LC0A 4YUXA 4I1PA 3BWVA 4ALLA 1SXIA 2VYND 1DQZA 4HXEB 4X1YB 1HDIA 5CJPA 4DUGD 3PX2A 2QK4A 1BRTA 3V8NA 1BX0A 2A7QA 3VA7A 4ENRA 5K3EA 2GBLC 1XHLA 3THXB 3O90A 4IJWA 5ARDA 1JWLA 4G2TA 4IQ4A 3QM1A 1BGXT 2XUKA 3PYMA 2BEUB 2GXQA 4X8HA 1V5GA 2MINB 3NU1A 1O7JA 4ARUA 1H3FA 4HH3C 4HX5A 4LXXA 1DIAA 5KVQA 2EW2A 2F8TA 4JI0B 1T24A 3VNUA 2I4LA 2VIIA 3QLUC 1JSZA 3TTXA 3JD0A 4O5OA 5B36A 2JFZA 1AM4D 1F6BA 1ARZA 2XVAA 1WW3A 3VPDA 1V4NA 4F3YA 2MMCA 3C97A 3GEBA 1RI1A 2J9RA 1LC0A 1VIYA 3K5IA 2ZTLA 3O4FA 4B73A 3QVKA 1OWLA 1V3VA 2C9ZA 4F6RA 3NIBA 3RC8A 1EBFA 2PLAA 3H1PA 3D3QA 4J07A 5BWOA 2A0XA 3UV7A 2J4DA 1WW8A 2XLCA 4FZVA 3SS8A 3BZBA 1GGFA 3UCFA 3Q8WA 1WDMA 4GGPA 1EX6A 2HKIA 1WRBA 4F3NA 1NATA 2CT8A 2PUDA 2AUTA 2P4EA 3WLTA 4BNDA 3LYUA 2J6BA 3HXQA 1A0OA 4JASB 3NI2A 1Q5PA 3MJVA 3D43A 2KLBA 4KO1S 4KUHA 3GAFA 1VSTA 5JPIA 5U4XA 3M49A 4Q66C 1YB2A 4EYSA 1CE8A 4RQBA 2AMLA 3RI3A 3CNBA 3KS9A 2CXOA 3TYXA 5DNCA 4PNEA 4IVQA 2G5GX 2HJVA 1REQA 3EZLA 2D06A 3GIDA 4EW1A 3R3XA 2FX5A 3ET5A 4NZZA 2KE5A 3L04A 3R4VA 5D2CA 5JVDA 3NTXA 4LNAA 3W90A 4RD4A 1CS4C 1WTAA 1YR2A 4WBNA 1ES9A 4YEDA 1GITA 3DVSX 5DNVA 1A9TA 1U1FA 1VI2A 2VF2A 3AKYA 5K03A 4EG6A 1MPXA 4NABA 2ECKA 2C3PA 4ZQFA 1EFVA 3MWJA 5F33A 4UEKA 3ORRA 2CL6X 4R2LA 3RM3A 3UUFA 2WIJA 3AEXA 3WJ1A 4QU0A 2IE8A 1GA4A 4N0EA 4QULA 4RHYA 5ARCA 3T5GA 4BB5A 4AJ1A 3RT9A 4PAOA 2Z30A 3UM9A 4CLRB 3L7MA 4C9BA 3KC2A 4MXDA 5FL3A 1TCCA 4DCSA 1XTSA 1TZ2A 1V3TA 4EQZA 1FX0B 1OE0A 1VGVA 1G8KA 3MB8A 5HRAA 4DDMA 4RJKA 3RIHA 4WY8A 1ILEA 3SQWA 5J4KA 4QUBA 4E1AA 2CUNA 5DEIA 3WK9A 1F4PA 4L16A 4D97A 5CB4B 4XDGA 2NP7A 3T1OA 4OI2A 3PSAA 5CXSA 5JSFA 5CT9A 1K92A 1WPXA 4XIJA 4FSXA 1KI9A 4GEKA 5EQTA 4OQLA 1M66A 1WF3A 1ZHOA 1QHGA 2ORIA 3OTIA 2D0IA 2QTTA 4Q9DA 4WLVA 2XDQB 4DCMA 3EODA 3RTDA 2Y1EA 4L0QA 3G5MA 4TLDA 3X3HA 4B3DA 3BE8A 1TJ3A 3QUTA 2BHLA 3AF4A 2SECE 3EVTA 2DECA 3DDCA 2WT4A 3NTUA 3Q9UA 4QQNA 4U2FA 5IT0A 2ZM5A 4K0KB 1YOVB 1BHO1 5MN5A 4DMHA 2NX2A 5KTNA 3NKVA 1Q0UA 3KQVA 5DBFA 1U5BB 1RCFA 1FUIA 4JIMA 2JK0A 3TE7A 4EHNA 1XYVA 2XCSB 3L7KA 2IVZA 1WP9A 1U9JA 2ECPA 4UUMA 1IK4A 1G20B 3ZK7A 3C3YA 4YJ2F 1J2JA 5DPMA 2J9FB 2QTNA 2CBGA 3R7NA 3HLTA 4P3NA 2FG6C 4Q21A 2XWJI 3UTDA 3B70A 3C8MA 1VSBA 3LVFO 4MRVA 4AZ0B 5C5CA 1P1HA 3HJRA 5EI5A 3ZE8A 4NJEA 4RC9A 4LEIA 2R8OA 4EA7A 1M5RA 4MKZA 4MSUA 3HLKA 3HCPA 4PFJA 1Z26A 1PNQA 2NUBA 1NDUA 4GPTA 4QC2A 2HRZA 1QH9A 1RRFA 3CW8X 4GP9A 4K03A 2YXNA 5FUVA 1MOZA 1MABB 4CTJA 2WKQA 1L8LA 3ENVA 5JNSA 3W2HA 1SUEA 3U7EB 5JXJA 4K0RA 3B3FA 3WLNA 2QTRA 2HH9A 5IW8A 3PJRA 5ALNA 1OLOA 3KE8A 4I1YA 4WLUA 2AZ4A 2R8PA 4MGEA 3DC2A 1JDTA 2BEKA 3RT7A 3RVLA 3ZDDA 2I2XB 2W6IA 2P1DA 3DAHA 4BXOA 2JI6A 2VOJA 4KCGA 4GPD1 2EEZA 4JC5A 3QXGA 3CO5A 2FA9A 1TK2A 5H7XA 3OHPA 1I6MA 1UFRA 2H1LA 3HDGA 3DQZA 4DSTA 1NAHA 4OGLA 3VPHA 4TZKA 1OIXA 5CPFA 1PJSA 1K8QA 3IDSA 3Q7RA 1JB1A 4UCQA 1FPMA 2AOUA 2C95A 1U5CA 4QPPA 1Y7LA 1OH6A 1O08A 3DCNA 3PZBA 2Y05A 1ONOA 4L7QA 1EVIA 2DHEA 4H27A 3E9ZA 4RD2A 1V4VA 3IAXA 1HDGO 3WGLA 4V0QA 4ER7A 4KSCA 2O20A 3OKFA 4XQ0A 4Q4CA 4FYVA 1AV7A 4CKCB 4N3GA 1K1EA 5EN4A 3K8ZA 2EQAA 4P08A 3H4IA 4QHTA 2H1HA 2X5NA 2JAWA 1GL3A 2P2YA 2B9VA 3MELA 4S1OA 2XEXA 3HKEB 4QECA 3BE5A 1UM8A 4MV9A 3VUFA 4HQ0A 3AHIA 1YGYA 2JBAA 4MINA 4Z2YA 3WTBA 4DAOA 4FYPA 4D9EA 5I47A 3BN3A 4ZT5A 4L5JA 2CMHA 4L95C 3TIVA 2D00A 3ZV7A 1Z0UA 4MWZA 2BDEA 4Q47A 3V7FA 1X1RA 3ZU3A 5G4KA 3GJ3A 4ZO6A 4Z0PA 5T41A 4RLQA 3ZE6A 5CXQA 3NWEA 1T8SA 2P2ZA 2FSIA 3NXSA 3H99A 4UE6A 1UCFA 5IVIA 4HGQA 5I7AA 2BMDA 4DTCA 3FIUA 2AGVA 3CWZA 5JI2E 4GVXA 1X2BA 3RW9A 3ZLUA 1SM4A 3QV1A 4OA8A 2FN4A 8OHMA 4NFHA 1UQTA 5DHPA 3I92A 3SQMA 2NYAA 1PG5A 2H4WA 3F5SA 5LSAA 1UF9A 1GNQA 3HPQA 1E7RA 1S3IA 1RXUA 4JYBA 4NENB 4RM2A 2OAP1 2X1LA 3GRFA 4FGKA 4BFWA 4BBZA 2BTOA 5KNDH 4HT3B 3MM4A 4JU9A 3KALA 3Q0TA 5KYVA 1VLZA 3AEUB 1N6PA 3IOBA 5ALDA 3QVSA 2JS7A 3ZTTA 3TSAA 1P4AA 3FTFA 3OM1A 4K2AA 2X2FA 4IY1A 4EG3A 2X6RA 4DGSA 2WM3A 4DVJA 4ZVTA 5ESXA 4OBEA 3UJAA 3CRRA 1W85A 5K8CA 4ALMA 3HR8A 5BT8A 1RIFA 3PKJA 1S4MA 1Q0QA 3CFYA 3CEMA 3HB0A 3W6PA 3ADCA 2AOXA 2AFHE 4CLRA 4C6SA 3PC8A 2IY7A 4FZ5A 3MT8A 2DH5A 3HXTA 3RSQA 4Y0AA 3HUFA 4JYZA 4CUJA 4XDHA 1UT6A 1QAQA 2I67A 1ZUHA 1E6UA 3A11A 4CIDA 4XD7D 2X2OA 2YHBA 5AVOA 3C3XA 2ZYAA 3U4MA 3SLGA 5L4SA 1G291 3C24A 4BUZA 3BWDD 1N2EA 1FFDA 3AC0A 3GJZA 3OC0A 4IDHA 2PV0A 3AB7A 4HLUC 3WGUA 1ULZA 3UJBA 4CU5A 3DDHA 5CLLA 3V2GA 3ZWOA 3LHSA 2DKFA 3CLSC 3PZRA 3JQFC 4OB8A 4TZTA 5ERGB 4IXDA 3WG9A 3W79A 2IUEA 3DBIA 3U48A 4TWJA 1R18A 2IOHA 4YAEA 4N6NA 1FW8A 3OTHA 2R7AA 4KDFA 1O87A 1SBHA 1IM5A 1UBEA 4UDOA 3WNDA 4IJ6A 2BGTA 2O2EA 4KR7A 1VCOA 4EY8A 2BOVA 4P58A 1E3JA 6REQA 4C3ZA 1GNRA 2ZCUA 4S24A 4AQDA 3DO6A 4AKGA 2QUIA 4PY2A 1U3UA 2RHLA 3JAWB 1E9VA 1G20A 1U4OA 2WWRA 4FEAA 4IO0A 4OHPA 3CW9A 2Q27A 1E6CA 3B13B 1E8NA 4KI0A 3R75A 4B3MB 1VL6A 2DPGA 4ZT7A 4DMFA 4YAUA 2Z6QA 2HPZA 4JFAA 5HFNA 4OBXA 4L9RA 2IH5A 4R0MA 2QYHA 4YDSA 4IUDS 1RMYA 3MTBA 4LMAA 1N75A 4NS1A 3CX7A 4WA7A 3VOTA 4LYHA 1KKLA 1AUOA 5FUYA 2ISQA 3RVSA 1L5MA 3L8ZA 3TK1A 3GAZA 3F7MA 5JW6A 5TV2A 1GTJ1 1SKYB 2Q3JA 4LZLA 5C2JB 5SY6A 3F6BX 5CYFA 4F71A 2IEZA 1P9OA 1SUFA 2YFHA 4JC0A 2JGEA 4E6EA 1KK3A 1VKOA 4LHEA 2QMYA 2C2MA 2QM0A 2J3DA 5CVDA 3FR7A 3KQHA 3DBRB 1KYXA 2YX1A 2QUBA 4MVXA 1EEXB 4P8RA 4ZVUA 4ZC8A 3MD9A 1XUOA 4R1UA 1ND6A 3DEYX 4ZTUB 1YJXA 3JQ8B 4WXHA 3DLBA 3GGJA 3GRCA 2VEOA 1E8MA 2K2WA 5JPCA 1XEWX 2BE9A 1K8YB 3UATA 2HWKA 1PZMA 1BKDR 4UAVA 1CY8A 2CFOA 3GNSA 2FF7A 4CMHA 3MFYA 4EHAA 1OV6A 2HJWA 4OHOA 1AGXA 2Y0PA 2ABWA 2JHPA 1YB1A 2RBGA 3UWMA 4P35A 1RQLA 5ICFA 5JDCC 3PIRA 4HRYA 1GZHB 3LBAA 2Y0BA 5ILOA 2IQIA 2DHDA 5B58T 3A3PA 4RMIA 1Q83A 1KJNA 2V3WA 5JZMA 1FQWA 3GZ4A 2P91A 5H70A 1L7QA 3IOCA 2YV4A 3ZGLA 4DJ5X 2ZSBA 1I32A 1XLUA 5EPUA 5JNVA 4D9HA 3EHEA 1T5IA 5LA6A 3QBJA 1W35A 3D8UA 4ARBA 2Q6LA 2EFGA 1ODFA 1Q0SA 4J16C 3H2HA 1J0BA 2VJAA 2PO7A 3EW7A 4K9DA 2B98A 3MPOA 4ZTBA 5DBOA 2C4VA 4C01A 1JFTA 4AZTA 3VNRA 2KI5A 3F5MA 4P22A 5JLAA 4PC2A 2BFPA 4OGFA 5AW5A 1NQWA 2EAUA 3CNLA 3RFXA 5IBQA 5DIZA 2GT1A 4CV3A 1RAGA 1DTWA 2YRFA 3K2EA 1W19A 2H5LA 4MICA 4X20A 4BLWA 4BO9A 5CXUA 3I6IA 3OZEA 3OQJA 3GOHA 3H16A 3ZGOA 4XWOA 2XZOA 1LTQA 1BS9A 2VPIA 2WFZA 3G0OA 4Y0VA 2R97A 5ALWA 1T9GS 4CEIB 4BKPA 5K05A 2G9UA 2QTZA 4ND8B 5F1KA 3IA7A 1SHUX 7ABPA 1XRLA 3KB6A 2W4MA 3P9RA 3LJKA 4BE9A 3C6MA 5BNZA 2XMBA 4FCWA 3PEWA 4L78A 1RWVA 3PP8A 4MVCA 3LC7O 4PCUA 4UEQA 4G1CA 4XX1A 2HIGA 3KHTA 4G6ZA 4UM7A 5D5PA 5TS3A 3IMEA 3OG9A 4ENUA 3SKVA 1NW3A 4G1VA 4PZEA 2FP4A 4KREA 4BVAA 2WEKA 1ZW6A 3HUUA 4M9SA 1NYRA 1EQAA 1KYWA 3OUUA 5BN5B 2C7PA 4DMCA 2K7ZA 4NENA 1YJQA 1JN0A 2C59A 3N0RA 1T9AA 4M6WB 3QLUA 1E3WB 1VOTA 1X77A 4B74A 1S9HA 5GTDA 3DM5A 3NS7A 5DOZA 3B89A 2NP6A 3H3FA 3K9CA 4CI9A 3I61A 1E2FA 2GERA 2RC5A 3BRSA 1I9GA 1Z6ZA 4NNJA 4O4JB 1UOPA 4J0IA 1PBTA 2YNMC 3JVIA 3WR5A 3OZIA 3ZWKA 1IOLA 4DUZB 4J7CA 1GTRA 4NOMA 4PC3A 2VRWA 1I01A 3T1QA 2C96A 3PHCA 4GYYA 4BMSA 2ZTVA 3PNQA 4S1WA 1QKJA 3A05A 2YXLA 3L8FA 2DPHA 1M6EX 1EGVB 1NXOA 1SHLA 3OZAA 4NEHB 1VA4A 3NBZC 2FEKA 3KLNA 4Q6WA 1UWKA 4YJFB 4MV3A 3ICEA 1V8PA 5A9TA 1X7ZB 2ZGVA 3D3WB 1ORWA 2YXDA 3G9TA 2ODWA 4MA0A 2EZTA 1XVLA 2V7VA 3KQQA 3MMZA 4GZ5A 5KQRA 2WF8A 4QELA 1CRZA 3ZU2A 1N1DA 1A5TA 1YBHA 3I42A 1E4EB 1IIBA 2GNPA 4Q4JA 1X7XA 4ZVLA 4UM5A 1R4NB 2XMQA 3ZDCA 4J9VA 2J9YB 3SHFA 2V0GA 2YTZA 3G8BA 5B7PA 1JGTA 3FOZA 3T7DA 2B4TO 3DBLB 3QW2A 2GKGA 3QG1A 2BTEA 1XU4A 4IFBA 3TMKA 1OYWA 3DMTA 1G59A 2ZJZA 5IKXA 3M82A 3N8GA 1NPDA 1LBIA 3NV9A 4MUYA 4J1TA 4N5DA 3BMXA 1EFPB 3OQOA 1NW6A 3KTAB 4US1R 4C88A 4CM7A 5DYGA 3IE2A 3W1WA 2QVYX 1EUCA 2IKQA 3LIPA 4RAQA 4YMSA 2XNKA 3T4EA 2DBRA 3KLBA 3M7IA 5G4LA 2WD9A 5BR8B 3KYDA 5FOQA 4JLKA 1NE7A 1XZLA 4RA6B 1DBVO 3AM3A 3K0HA 5GY7A 3TDKA 4LX0A 2GBIA 5KQPA 3BPSA 1TA4A 2PSDA 1ITZA 4CN8A 4LWZA 3A1FA 2AYXA 3KLPX 1FMLA 2XT6A 1THTA 3P2IA 3MD0A 1TKBA 4WK2B 4MR8B 1TMGE 1COWD 1JLSA 1Z08A 5EVJA 4BNXA 4EEXA 3VZPA 2PJDA 1QIHA 1Z62A 4U2GA 5ALUA 2PGIA 5CB8A 2J5KA 2Z5GA 3V3KA 2ZS7A 3L0YA 4DB2A 1J90A 4M9ZA 1IONA 3HJHA 4Z99A 4Q4DA 2JZOA 3AERA 1GD1O 2OQRA 3BEDA 3IEPA 4BNYA 3HQ4O 5PGMA 4LOHA 3QLEA 2I1LA 3EIQA 3B2QA 4A0GA 5J2TF 3AINA 3ZHXA 3ZHTA 1M1ZA 1FJ2A 1UINA 1JT2A 2VDWB 2EIHA 4UUOA 1T34A 1WPGA 1GUDA 3ANXA 4P93A 1RC1A 4AX8A 1TAGA 4F91B 4KBYA 2C5GA 1QC5A 4UCXA 4EB6B 4CU2A 3OZ7A 2F3PA 1G3QA 2YZGA 4D7AA 4GDFA 3PDCA 1KOJA 5A9RA 5BURA 1KVUA 3DVRX 5ADVA 1QRSA 1ZOLA 3LQKA 2FZ5A 2PH1A 4LV8B 5C4MA 1D2NA 3ZGYA 1E1DA 2FSSA 1A2OA 3R20A 3KT0A 2HPAA 2FQWA 2W5UA 2P27A 4N03A 1HT3A 3C5WP 3HYRA 3TKAA 2GPYA 2UAGA 3BBLA 1DKPA 1GTG1 2IU0A 5B3JC 2PT6A 2WU4A 4X7RA 5IYZF 1G7TA 2I3GA 2CHGA 3ROPA 4ZJYA 3DTVD 4FHCA 4LJKA 5JE8A 4E2WA 2WJ6A 3LT4A 1J97A 1R1DA 3FJ1A 2J07A 3LYHA 3PGVA 4LHSA 3RLFA 3RSOA 3EIXA 4AY4A 1T1EA 1GFSA 3IMKA 3QE3A 4E5DA 3KYIB 4Q3OA 3FPSA 3FCUB 2RHDA 2ZAYA 3LV8A 1FXSA 2QD4A 4MV8A 3JY6A 4OQQA 1BGVA 2DR3A 2ZTMA 3NBAA 3DFMA 3N86A 1IN6A 4G5XA 2IOFK 2Q1WA 1T1IA 2OR3A 2C4UA 3AKEA 4X1YA 3U9TA 2O9JA 3Q8XB 3T7JA 1E8DA 5ITVA 3VNAA 3NPAA 4CKXA 1R50A 3CWCA 4ID9A 3FUVA 2O8NA 3FWNA 3H2YA 4DANA 1PQ4A 3QVMA 3E3AA 3LT5A 3BEOA 5IAOA 3CLSD 4ZN6A 2HWWA 1N4DA 1T2DA 3HDQA 2ZB2A 4HJXA 4Y7CA 4FIDA 2OLJA 2HHJA 1JHMA 2IH4A 2X0KA 3WLAA 3JX9A 1PSDA 4G4GA 1HRKA 1PSWA 4QBHA 1UBKS 1T5BA 2ZJOA 1FU7A 3W7VA 1DC8A 2W2KB 1D9XA 4BNDB 5JNLA 2Z2XA 4AZWA 1YI0A 3TTTA 1KAGA 1U2GC 5DSTA 1CERA 4UD6A 1CUUA 1IJFA 4AW9A 2HU2A 3RIXA 4QU5A 4QLOA 1GPMA 1VHJA 1ZK4A 2G9VA 3K0EA 1Y5RA 5A4KA 1MRSA 2FX3A 2ADOA 3KVVA 3MT0A 1J39A 1J33A 2CLFB 4RK1A 3WMGA 5C80A 2C2OA 2KM1A 3M6XA 3OIFA 1AKUA 1BG6A 1NQ5A 3H65A 3LU1A 1B0PA 1R5BA 4LZWA 4M6WA 1IVSA 4MLPA 4KGZA 1V2GA 3H18A 5B58C 2X23A 4I8XA 1JBKA 3DHYA 1A9XB 1ZCBA 3E27A