4B8WA

Crystal structure of human gdp-l-fucose synthase with bound nadp and gdp, tetragonal crystal form
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
319
structure length
319
Chain Sequence
b'NLYFQSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-L-FUCOSE SYNTHASE
publication title Crystal Structure of Human Gdp-L-Fucose Synthase with Bound Nadp and Gdp, Tetragonal Crystal Form
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4b8wA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 4b8wA02
4M89A 1EEHA 5G0WA 5H81A 3DZGA 1FXSA 3I9MA 3AOEC 5L7YA 5TT1A 3RIHA 4IS3A 2P4QA 3DMTC 2EKQA 3DO5A 3C7AA 1E7YA 2FSSA 5A1TA 2W2KA 3QV1A 1R37A 4LSWA 1WDMA 4D79A 1D7OA 2B5VA 5IDXA 1X1EA 3IJRA 2Y1GA 3I9KA 4I9NA 4WLEA 1WAMA 1YBMA 1ENOA 2BFOA 3ZNQA 4TWRA 1EZ4A 4NG5A 3JQBC 1RWBA 4NH4A 4WJZA 5THQA 4DLAA 1ADBA 4GQAA 3KVOA 3JQAA 3DHNA 3DC2A 4WECA 4PRLA 3S1LA 1JA9A 1C14A 4OKNA 2VYNA 4ALMA 4KTTE 3TL3A 3KYCB 4ZD6A 1G0OA 3DZIA 5BSFA 2DLDA 4CLDA 2NQTA 4M55A 3GNSA 5DBGA 4GX5A 4OAQA 1E6EA 3CEAA 4U8GA 3PHJA 2JD1A 4FCCA 4DIOA 4DXHA 2QQ5A 1I32A 1AUPA 1A72A 4Q3AA 1NAIA 4RPGA 3HB4X 2HU2A 2B4QA 1K6XA 4ONEA 1QYCA 3W4JA 4E32A 1K6IA 3COSA 1J49A 2YV3A 1CETA 2X23A 3L4BA 5U1PA 2G17A 1DIGA 1L7DA 1QRRA 2AEMA 1KERA 1KETA 3WNVA 5GY7A 4R1TA 4ZQBA 4E3ZA 3H9JA 2R00C 1VJ0A 1LU9A 3QSGA 1ARZA 2PZKA 2ZTUA 5ADHA 3MWEB 3RUIA 3VPFA 5JDIC 5IG2A 1U7TA 5LC1A 3C1TA 2RH8A 4J2HA 3R3SA 1TEHA 2VRCD 3NDJA 2FHSA 4KUGA 2X58A 3AW9A 4DQUA 2EV9A 1G1AA 4BNHA 3E8XA 4LRTB 5I7VA 4BGIA 4Q3EA 2EXXA 4IDAA 3VH4A 1BRMA 1MP0A 1I2ZA 1UDBA 5K9ZA 3MTJA 2EKLA 4GMFA 2Z1MA 1UZNA 3LT0A 2WDZA 1KY5A 2WM3A 4FBGA 5HS6A 4B7XA 5A05A 3QW2A 4XB1A 4GAEA 2X9VA 4J0EA 4I08A 1H6DA 1B14A 3DFZA 1LEHA 3RAJA 1RPNA 4MVJA 3W4KA 4EZBA 3W8FA 2X0IA 3FNHA 3JYQA 3D7LA 4PFJA 2EP7A 3GK3A 4AJEA 3Q2KA 5FWNA 4DBVO 2BHLA 3K2BA 2FP4A 4RPHA 4M49A 2JJYA 1YOVA 1E3EA 4O1MA 2OFPA 3AM3A 2Q46A 3WGHA 3OSUA 3BTOA 2JAPA 3VTFA 3RUCA 2HCTA 1B15A 4DVJA 3JQFC 3RC9A 1GQYA 3WGTA 1PJQA 1XDWA 4A2CA 2G76A 4MVJM 1C0LA 1YBAA 4CMEA 4D3DA 2HO5A 4O63O 1Y1PA 1KC3A 3FRJA 4DRYA 2OBNA 3GFBA 2EJVA 1YXMA 1LSUA 1E1MA 1KEVA 1QLJA 4JJFA 4IS2A 1B3RA 4BNWA 4BKOA 1U3WA 2JFGA 3DQPA 1PJ3A 1T26A 4R54A 2QIOA 2C07A 2Q1TA 5CHEA 1MG5A 2Y66A 2GD1O 5DBIA 3U0BA 2I65A 1Y5RA 3HDQA 4XB2A 2B37A 1HT0A 1SMKA 2EJWA 3N7UA 2JFFA 2AMFA 3BYZA 2GLXA 4FC7A 1PR3A 3D4OA 4JBIA 4AL4A 3G0OA 3ABIA 1YB1A 3K73O 2AXQA 2J3KA 2O3RA 5IZCC 4CLOA 2TMDA 1X7HA 1E7QA 1G6KA 4L74A 5JCJA 1UXKA 4KMSA 4QXMA 3G1UA 3IAHA 1BDMA 3RU7A 2AQKA 3QWFA 1U8XX 2IEBA 2X5KO 3WB9A 4A7PA 4EITA 5CAEA 4D0SA 4FJ2A 3GDGA 2VHWA 4R51A 2OGUA 4ZJUA 3VAZA 3ZZNA 2GN6A 2TMGA 3EUWA 2I3AA 4IDBA 1YQXA 4GPD1 4PCVA 4G65A 1GR0A 3U09A 4XQCA 2J3JA 4W6ZA 4BNZA 2W8ZA 3PHHA 3PIIA 4AJHA 4YJHA 3S2FA 1E7MA 2FPPA 1P1HA 2QRKA 1LLDA 5CPFA 5KNLA 2HLPA 3AJRA 3K31A 4RL6A 4OOEA 3KHUA 4P4GA 4TRNA 4UVEA 5COQA 4B3HA 4M1QA 4NPCA 4LRSB 4JP2A 3OQBA 3VPXA 2V65A 2HK7A 3BMNB 3Q1LA 4MDHA 4E5NA 3E82A 3ZWCA 4I5GA 3UCEA 2OHXA 1U1IA 4PVDA 3LZ6A 1YL7A 3IKTA 3A4VA 1NQTA 4PLVA 3W4IA 3DBVO 1Y8QB 1HEUA 2R2GA 1YGYA 1JVSA 3D4NA 3C24A 4K9DA 3JQAD 3QRWA 4NR0A 1Z6ZA 3GUYA 2FRDA 2FN7A 8LDHA 2AQ8A 1Y8RB 3FSRA 3WGYA 1PJTA 4MKXA 3HG7A 5COAA 1PZGA 4MOWA 2O3QA 3GQVA 5HWSA 1FDTA 2GR9A 2P68A 3ASVA 4I9HA 2HJRA 2ZB7A 3QWIA 4BS9A 4XYEA 3BTSA 1E77A 1X7DA 1R4MB 4CMJA 3HSKA 1ADGA 4XZ3A 3UH1A 4Q3NA 4UVHA 4YTEA 2VT2A 5FF9A 3HB5X 3KETA 1UUFA 3HN7A 2J3IA 2JCYA 2X22A 2DPHA 2BFPA 1A4IA 4AJIA 1W0CA 5HA5A 4HP8A 4BMSA 1CDOA 4RQTA 1PGPA 4ITUA 3WG9A 4XR9A 1V35A 4FC6A 3H5RA 5CEEA 1NXQA 3GZ4A 3F9IA 4CMIA 4GX2A 4WLOA 3EZLA 4GX1A 5F21A 1DB3A 4CMGA 2GF2A 2H6EA 4NBRA 4YBZA 1YKFA 4K1LA 3BHJA 4D46A 3F1LA 3BMNA 3DTYA 1UP7A 3K8ZA 3VZSA 1KVUA 3QA9A 1BDBA 2W90A 3PWZA 4WASA 1X7GA 3EVNA 4FD3A 4JX8A 4A73A 2SCUA 1U7HA 1PGJA 1GTMA 1V6AA 3ANMA 4DIBA 5A9SA 2D2IA 3ULKA 4A26A 4R3WA 2B5WA 5ER6A 1WNTA 3MZ0A 3JYLA 1QORA 5B4TA 1N7GA 2HRZA 3EW7A 4PRKA 1MLDA 1EFLA 3JQ6A 3I5MA 1U3TA 4PIVA 4CR6A 3GVHA 4AJNA 3C8MA 3LC1O 5H82A 3OICA 1GFSA 4PG6A 2YHUA 1T1SA 4J6FA 4BGUA 4CMAA 1PX0A 3HZZA 3ST7A 3ZU3A 3UHAA 4L76A 4BNYA 1C1DA 2A92A 4CV1A 1GV1A 4NBWA 2X4GA 3H9UA 4O6VA 2IYOA 1ZXLA 3QWAA 1E3SA 3NEPX 4E33A 3QWBA 1RM4A 3RASA 5EPOA 3E03A 4DPLA 5JC1A 2CVOA 2IZ1A 3IMFA 1I01A 3VPSA 3RI3A 1F0YA 2DM6A 2CUKA 3WYEA 2YV2A 3RFXA 4OJNA 5ILOA 4M86A 3VPHA 4F46A 4ROSA 4Y98A 2V6GA 5A3VA 3NJ4A 4ESOA 5FEUA 2E37A 4BO5A 5KTKA 1M67A 2RHCA 5HBRA 4FB5A 4IQ0A 3MOIA 3F5SA 3Q3CA 4IDFA 4A03A 3HNPA 4W82A 1HSOA 2PD4A 1ENPA 2VHXA 3ZWMA 5A02A 4MIYA 3SC6A 3TPCA 3GEMA 4RJTA 4TZKA 5CDUA 3W6UA 3WTBA 2G1UA 4RZHA 2PZJA 5JYEA 1MB4A 1PQUA 3QVSA 1ZMTA 1NVMB 1VE9A 4WOKA 5T57A 3Q0EA 1E0DA 4NFHA 3RC1A 4GI2A 4HUJA 3JCZA 3PHGA 5L7TA 2QW8A 4LW8A 1YB4A 4TRMA 2VQ3A 4IY1A 1LLCA 4GKVA 1NWCA 4N5NA 3FNFA 5JCJD 4XYLA 4YYZA 1ISFA 1Y7TA 4K6FA 1O5IA 1DJQA 5B37A 3BMCB 4J4BA 3TFQA 4B79A 1TLTA 3K30A 3RJ9A 3WS7A 1YL6A 1F17A 3KEQA 3GOHA 3RD5A 3D5TA 4YAGA 2I5PO 4XGKA 5DN9A 3U3XA 4EEZA 3NYWA 2YFHA 3IIEA 4RPLA 4J16A 4YRAA 3QVTA 4R4JA 3GUCA 4P22A 4EI2A 1I24A 1PJSA 2D8AA 2HAEA 3MOGA 4WEOA 5JNLA 4WLVA 1IHYA 4RLSA 1CIVA 1DPGA 2D4AA 4NDNE 5TT0A 4OXNA 4UVIA 4LMRA 1OZAA 2ZTLA 4EJ6A 3LC2O 1E7SA 5G2OA 3ETDA 5EJ2A 1QYXA 4OM8A 3TNLA 3AK4A 4RGBA 2GASA 2FMUA 2C2XA 1U5CA 5GZ1A 1Q0LA 1GU7A 3U4IA 4BKRA 2DTDA 3EAGA 4MVJI 5ENVA 3PYLA 2O48X 1C3VA 1JAXA 1N92A 4E5YA 4DUPA 2A35A 1WVGA 2C0CA 4I5EA 1I30A 2BGLA 2YDXA 3TWOA 3PWKA 1ZCJA 4YA6A 4BMNA 3AOEA 5JBIA 3DMTA 3Q6IA 1H93A 1XU7A 4U6SA 1U28A 1FDWA 3PHLA 3M2PA 4Z9XA 1KVQA 3GLQA 1XU9A 1JLLA 1XYGA 4XYMA 3G17A 4CQLA 1LI4A 4YDRA 3JQBA 1V9LA 4IGFA 1QKIA 4LK3A 3JD2A 4PLYA 3WJ7A 1JKIA 1PJLA 3H9GA 2CY0A 1HDYA 4IBOA 3B6ZA 2JFHA 3OEYA 2VRCA 2ZTMA 3PVZA 3NJ8A 2Z5LA 1R4NB 3WGIA 1KOLA 1LDYA 1E92A 2WD7B 4XIYA 1Q0HA 3ROMA 5ENDA 3TL2A 1JVBA 3U4DA 4NJMA 1DIAA 1Z45A 3GT0A 3S2EA 3KSDO 4PLHA 1CQIA 2Q49A 4MKZA 3FI9A 2AQIA 4RLHA 4E0BA 4QT0A 4CV2A 1P77A 5I9LA 4XRGA 2ILTA 2WYVA 1NVGA 1U2GA 1P1FA 3D4PA 3LT2A 4AJLA 1ZMOA 4JJGA 3EY4A 3GY0A 3I4FA 4TRJA 4KP7A 3UCXA 3WWYA 2X0RA 4CPDA 4CM8A 3C3XA 2YHIB 4J1SA 5IXSA 1E6UA 3DOJA 4Y6RA 3GAFA 4RORA 3AFMA 3GN2A 1NQ5A 3T7CA 4RVFA 3OIGA 2JKVA 2PGDA 1N9GB 2R00A 2FR8A 2NACA 4NU6A 2VRBA 3OJLA 4DQXA 1LRJA 2PH3A 5DOVA 3HN2A 4GLLA 3RU9A 4CV3A 4NBTA 2VYVD 1MX3A 2CF5A 2VUSA 3JQEA 1EMDA 4GMGA 5GMOA 1PEDA 3B70A 3HFGA 4LCEA 2X9GA 2DUWA 1NASA 4R1NA 4E4YA 1LDBA 4TVBA 1E3IA 1HE4A 3RVDA 1IPFA 5F5NA 3WBFA 1B8VA 3FWNA 3S55A 5CG2A 4J90A 3DBHB 5F1KA 1GYRA 2D0IA 2XPCA 2NVUB 3AFNA 3TFOA 2VHVA 3JD0A 1LBEA 4IJKA 2WD7A 3OH8A 4FW8A 1YO6A 1I8TA 4R5MA 3ZHYA 1TT5A 2AE1A 2Y1DA 3DOCA 4NZ9A 3LK7A 1T4BA 2EIHA 3O8QA 5JDCC 1E1KA 1JN0A 2BFMA 2O3JA 3MJEA 3UFXA 4CJXA 2QG4A 3CXRA 3NTRA 5DOZA 5T8KC 2DBZA 4PG4A 3ZW8A 4KUHA 3NGLA 4Z0HO 1ENZA 1GUZA 2JCXA 4AG3A 3ZHBA 5C5IA 3UCFA 2Q4BA 1JKJA 2JD2A 2X86A 3D1LA 2P91A 1L1FA 3H3FA 4CQMA 3TRIA 4EUEA 3DDNA 1B2LA 1B8PA 2D5AA 4WLNA 1V8BA 3E1KA 2PZLA 3ASUA 4Z9YA 3DAPA 4Q3BA 5L95A 3JQFA 2NSDA 2DVMA 2HSDA 3KBOA 5CDTA 2Y68A 5ITWA 2GPTA 3B20A 3WLFA 4I5DA 4CM4B 3DWFA 3I9OA 1XSEA 4N5LA 5H83A 3JTMA 4UUMA 4TMFA 4KWHA 5JMWA 3ZU5A 5KVVA 5DT9A 3O38A 1SBYA 5BNTA 4AJJA 1GPDG 3KYDA 4BNVA 4XYGA 3FR8A 5TSDA 1O94A 3C85A 1E5QA 3KLPX 1NVTA 4MVJG 4B7UA 3LVFO 4TKLA 3ZWBA 1Q2XA 1Z7EA 3WQSB 1DHTA 1UAYA 3RKRA 3ZWWA 2VOJA 2CD9A 1ID1A 1NX6A 3GHYA 4ZHSA 5I7EA 3D0OA 2UUOA 4ND1A 4R41A 1RM0A 2E49A 1UH5A 1KY4A 3RBXA 4IMPA 1GQQA 3H6KA 3GVIA 4E6PA 1B8UA 2YW9A 1DHRA 2E6UX 4D7AA 5IZCA 5LDHA 2VT3A 4NNJA 5KVSA 2B83A 3G49A 3PK0A 4JROA 5IN5A 3F4LA 3RFTA 5ICMA 2O3SA 1J0XO 3FTNA 3VPGA 2H5LA 3QVXA 3LF2A 3RUHA 5CDSA 1H9BA 1XHLA 1YB5A 4PLFA 4QEDA 4ZQGA 5A03A 3JD4A 5TNXA 3WTCA 2AHRA 5I7FA 5HM8A 3TZCA 2EWMA 1ZUD1 2ZJ1A 4PLZA 3ZWAA 1I3MA 2XOXA 3WGZA 1E6WA 4Y6PA 1EQUA 4DQVA 5IDQA 3GDFA 4BNMA 1KS9A 5ER9A 1D4FA 3CPSA 3V2HA 5B12A 1H6BA 2EGGA 1HSZA 3WGQA 2RAFA 1WMAA 5G4KB 1LX6A 4KUEA 2GUGA 1OMOA 2DC1A 5F1OA 1YQGA 3A1NA 4U6QA 4NQZA 1T1RA 2WEKA 3KRTA 5C7IO 1ZVMA 3PGXA 4C7JA 2Q2VA 5TF4A 4NK4A 3HDJA 4QUKA 3C7CB 5AXBA 3ZWNA 5EIOA 5JPIA 3KSUA 4XJSA 1A71A 1SCUA 2QZZA 4UUOA 4ND3A 5TLSA 3NV9A 1NWHA 5L3ZA 1DJNA 3LC7O 4OQYA 2B35A 4ZU3A 4YPOA 3ICPA 1IOLA 1ZK3A 4L9RA 3KTDA 1H0KA 3ONEA 1IHXA 3U9LA 4DC0A 4XRRA 3ZNOA 1Q7GA 3A14A 4JP3A 3JQ8B 2ZB3A 1GL3A 2P5YA 2BF7A 3FTPA 3IL2A 4J0FA 4XWYA 2BGKA 4BO4A 2NU9A 3HWRA 5AXCA 1DFHA 2V6MA 1SB9A 1AHHA 3HADA 1XIVA 1HE3A 4J1QA 1Q7BA 3GH3A 3CTMA 1ZK1A 3L0DA 5CEJA 4J3FA 3KYCA 4OHUA 4QQRA 2HUNA 3S2GA 2HMWA 1DO8A 4QFDA 4BVAA 2V6FA 2UAGA 3UF0A 3X2FA 4NFSA 5IAAA 4TRRA 1PZFA 3OIDA 2B4RO 1FDUA 1K2WA 1VJ1A 4D43A 4AVYA 1Y9AA 1IULA 4FJ0A 4GGOA 1E7RA 3BXXA 1VM6A 2YQ4A 3WBBA 4QFCA 3TOZA 2NM0A 1EBFA 1JAYA 3CE6A 3I9LA 1K0UA 3IOYA 4WNCA 5FI5A 4EBFA 2HJSA 2X8LA 3TZ6A 3ETGA 6ADHA 3OJOA 2Q1UA 3DZKA 3SLGA 4KDFA 3ITDA 4IDGA 2QX7A 3GMDA 4YJFB 4CMCA 5A06A 2NWQA 2FPGA 4J7UA 4B3JA 3HDYA 2P9GA 4J1NA 3LDHA 4YRBA 3ZV5A 1D1TA 4CM6A 4YACA 4D42A 5JY1A 3JQ7B 2JL1A 4IDCA 1ISHA 5COBA 4ND5A 3ZWYA 1B3BA 3ZGYA 2NTNA 3OMLA 2ZCVA 1XKQA 5G4LA 3ZNPA 5A9TA 4XEHA 3QQPA 3PLRA 4YJDA 4ZQHA 1HXHA 1NHWA 1RJWA 4JNKA 1DBVO 3E18A 2NVBA 1LSOA 1PL7A 4YT8A 4ID9A 3O26A 4MINA 2X0JA 5G0SA 3AOGA 2C2YA 4BO0A 4JBHA 4CMHA 4E12A 1Z75A 3IQDB 2I66A 1QYWA 2NU7A 3UW3A 2EHDA 1EE9A 3TZQA 1U2DA 3WSVA 3SBOA 1FK8A 4QX6A 4MIEA 3RUFA 4DYVA 1QYVA 2VHZA 4BKQA 2WYUA 2VNAA 5C37A 3IC5A 1KBZA 3W8DA 4CQMD 3QVWA 1ULUA 3PLNA 5F5LA 4D41A 4G2NA 4YVFA 4BNGA 3BMOB 1ZJYA 1YE3A 4BMVA 1XWFA 2A9FA 3GGPA 1R6DA 1U3VA 2ZYGA 1UDCA 2B4TO 1N1EA 3VKUA 1YS4A 1C0IA 5CP8A 2C5AA 3GMSA 2IXAA 4L8VA 3PZRA 5EQFA 5ITVA 2GN9A 2Z95A 3PRJA 2FSVA 3GGOA 3M6IA 4UEKA 2O2YA 1F8GA 1PS9A 4RDHA 4ZRNA 4WLUA 4OSPA 2AW5A 2ZKLA 4R1SA 2GRAA 2FR0A 5AYVA 3SLKA 4DA9A 3CZRA 3AI2A 3MJSA 4GGPA 2J6IA 3P2YA 2D59A 4MP3A 1HYGA 3I9NA 4GBJA 4U0JA 4QSMA 1DFIA 1K5HA 3L6DA 3S8MA 4BKUA 3ZCXA 3N74A 3HE3A 4MKRA 2P4HX 5CPBA 3BHMA 5CDGA 4MP6A 3PI7A 4PLPA 1Q1NA 1EVYA 4LSMA 4J49A 2OBYA 4A27A 3W6ZA 3U4HA 5FI3A 2YV1A 5ES3A 2PA3A 4QO8A 2OZPA 3WNQA 3D3WB 2CDCA 4DLBA 4P38A 3D3EA 1XCBA 4RDIA 3MTGA 2J8ZA 4GLOA 1UZLA 1ISJA 2DUUA 3AY3A 3E9NA 4TSKA 4FOOA 4EW6A 1QR6A 4M87A 5DP2A 1EVJA 3L77A 2PGLA 3AUTA 1CQJA 3NT4A 4N5MA 4JN6B 1O9BA 2EERA 4W4TA 1E3WB 3FBGA 3I4CA 2Y1FA 4UUPA 3WQRA 2EW8A 2P5UA 1OC2A 1PGNA 3FWZA 5DP1A 3ZWPA 1GQ2A 4FFOA 1I3NA 3GHHA 1A9ZA 4ZVVA 2P2SA 2I99A 2WE7A 2XXBA 3WQQA 3ZN2A 3ZU2A 2LDXA 1HLDA 5CDYA 1N7HA 2C59A 4Z0PA 3STHA 1LA2A 3I52A 4IM7A 4YT4A 4DIFA 1PL6A 3TJRA 1MUUA 4BGEA 4B3IA 5EINA 4UUNA 3SX2A 3QE3A 4NK5A 2CDBA 5GZ3A 2IZ0A 2QRLA 1D3AA 4RF3A 4J7XA 3ZWVA 3MJCA 4JIGA 1K3TA 4IUYA 1U4SA 2AQHA 1JKFA 1KC1A 3VOSA 1YBVA 1V0JA 1K6JA 3UOGA 4RVSA 1NBOA 3GZNB 3UN1A 1RM3A 3PYXA 2PKRA 1HDZA 1EDZA 1BSVA 4PVCA 1KIFA 2PTGA 5BSGA 1T2AA 1SEVA 1UP6A 3AY7A 4OSOA 2LDBA 1HKUA 3PQFA 4R68A 2NU6A 4O5OA 3GG9A 3VKVA 1Y8QA 1VKNA 3KB6A 3FPCA 5A5FA 4D44A 5AXAA 1BW9B 1GD1O 2OXIA 2VYVA 1AXEA 1NP3A 4UVGA 1IE3A 2HMTA 3OECA 1QV7A 1Y8RA 4ALLA 4BHTA 1R0KA 3X2EA 4FSHA 2WYWA 3GGGA 3JV7A 4P4LA 5T64A 5HTOA 1DC5A 2DKNA 4NU5A 1YJQA 1HE2A 4BNIA 4HNGA 2IE0A 4DWVA 4YT2A 3QWHA 1Y81A 1MFPA 2HK8A 1GYPA 4B8WA 4HX5A 3AI3A 5L7WA 1VJTA 1R4MA 4CUZA 2BI7A 5DBFA 2BH9A 2ZATA 1P74A 1WMBA 1J4AA 4IPTA 4ALIA 3VH1A 5JSFA 2QRJA 1QV6A 3JYPA 2B0JA 2ZQZA 1ZK0A 2RCYA 3B1KA 3AUAA 3KUXA 3BZUA 4K26A 1GCOA 3ENKA 5CFZA 2X1HA 3MJ4A 2OP1A 2YQ5A 3PZBA 2O4CA 3F1KA 3H2SA 9LDTA 3H3JA 3TF5A 3KV3O 3RKUA 1HZJA 2PR2A 4F3YA 5L45A 3WGGA 3LLSA 2O23A 4WEQA 1E3JA 3LU1A 3NAQA 3IKVA 4IGEA 1LUAA 4WK6A 1GUYA 1VRWA 3CIFA 4D45A 4U5QA 2GZ3A 1T2EA 3ROKA 2RH4A 1X14A 5G0UA 3PJFA 3WJAA 1PS0A 3VH3A 2X0NA 3GNTA 3R0IA 3TZKA 5G0VA 5IFLA 1LRKA 4HXYA 3IJPA 4BNKA 4CR7A 1B7GO 1ENYA 3CUKA 3AY6A 1KVRA 2VTDA 2NADA 1VL0A 1IPEA 3PGJA 3RUAA 1VC2A 1KEUA 3ZHXA 1WW8A 1U3UA 2ZYAA 3I9JA 2ZJ0A 1BW9A 3ITKA 1SB8A 4YCAA 2V6BA 1XQ6A 1I0ZA 3ETEA 1Y6JA 1S7CA 3EMKA 4I1IA 5DULA 4NBVA 1PWXA 3F3SA 3OA2A 3SC4A 4R3NA 3DB2A 4IQGA 3AM4A 4CL8A 1HTBA 4QECA 5ICSA 5DNAA 4L4RA 5JDCA 2X6TA 1EUDA 4CM7A 3EZYA 5T8KA 4NHEA 4IQ8A 4BO8A 3JD1A 5L4NA 3ZHZA 3IUPA 4YWJA 1ISGA 2GCGA 4XGIA 3PHIA 3DBLB 4J9VA 4DMLA 1DXYA 4CMBA 5JE8A 4OXKA 1AHIA 5I7SA 1T2CA 2ET6A 1DLJA 3DL2A 1PGQA 2EKPA 3D64A 4OOFA 5DZSA 2Y0CA 2E4AA 3ICCA 3M2TA 4PGFA 1HDGO 2BD0A 3E6AA 4CUJA 3L9WA 4R16A 1M6HA 4GSKA 4IIVA 2NTVA 3KO8A 4WLFA 4ZA2A 3ZH2A 4XR4A 1U9JA 4DC1A 1SNYA 2AE2A 1XELA 3JSAA 4RO0A 5U4QA 4CR8A 2EW2A 1NYTA 2PV7A 3BMQB 3I1JA 3WR5A 1CWUA 5C7OO 1LLUA 4CL3A 5A4DA 2PNFA 4WCFB 4E2WA 4NI5A 4EUFA 2WD8A 1UXJA 5KJFA 3K6JA 3H5NA 3QLJA 4CLRB 1LC3A 2Y05A 5IDYA 2CMDA 3ZI0A 2Y0EA 1FJHA 2PLAA 3FNGA 1SZJG 3E5RA 3F47A 1A27A 1T2FA 2YDYA 1R16A 3ORFA 4PZCA 3GPDG 3GVXA 1C0KA 1HL3A 5L40A 2CDAA 1KVSA 1TI7A 1B0AA 3QY9A 4W9NC 1H2HA 3ADPA 3GG2A 3BMCA 2AEJA 2OP0A 3RC7A 1XGKA 2YYYA 3Q11A 4BNUA 2AEFA 4JK3A 1ML3A 1YDEA 1P0CA 3CKYA 3EHEA 1TT7A 1Y5MA 3G3EA 1I2CA 4L4SA 2Y1EA 1WP4A 1I3KA 2Q99A 4EJ0A 1FDVA 2ZYDA 1VKOA 4RPKA 4E5MA 3I6QA 3P19A 1H2BA 1EBUA 4LGVA 4ALKA 4MP8A 3BHIA 3H4VA 2O7QA 4TKMA 3V1TC 4XQGA 4H16A 4E2ZA 2I9PA 2AG8A 1WXDA 1VL8A 2DBVO 1SC6A 1U8FO 3BMQA 3DZHA 1T4DA 2C82A 5B4VA 4KTVE 4GL4A 4CM3A 4YQZA 3AU9A 3DBRB 1KEPA 4YAIA 2B69A 3VC7A 1HWYA 3U49A 2Q3EA 1PIWA 2BMAA 4N7RA 4BQRA 2DAPA 3V8BA 2BKAA 1DC6A 5KJ6A 1FMCA 1CJCA 1LDGA 4EJMA 2PGJA 4GWKA 2CNBA 4ND4A 3NX4A 3QJ5A 3T7EA 3P5SA 5JO0A 1BXGB 3JQGB 1WDKA 1A7AA 3FHLA 2E48A 3KLMX 1N2SA 3F5QA 1OAAA 1HDRA 1NFFA 2VZ9A 3F6YA 3JQCA 1QXSA 4OKIA 1LSJA 1A9YA 3NDRA 4YJGB 3UUWA 2H63A 3NDIA 4MJLA 1ADFA 2CF6A 5EL0A 3HFSA 1NTOA 2OO5A 1MGOA 2Y93A 4AJ1A 2W2LA 3PJEA 4DREA 1R4NA 1PZHA 5BQFA 3UAGA 4A10A 1C1XB 3NTQA 3N58A 4H7PA 1HE5A 3OHSX 1O89A 4HV4A 5T67A 5IN4A 4KZPA 2DTEA 3NGXA 1L7EA 4XX0A 3AI1A 3WWZA 3RROA 3L6EA 1GUFA 4Q9NA 2PKQP 1PS8A 1C0PA 1IZ9A 3PWSA 4XA8A 1E5LA 4CM9D 1DAPA 1UAGA 3AWDA 2YHIA 1GCUA 1X15A 4MPDA 4II3A 1HDOA 2XAAA 4G81A 3VZQA 4TROA 3B1FA 3VVCA 1M76A 4W99A 1SEPA 1HRDA 2BELA 4DL9A 3G79A 4ND2A 1N9GA 1NPYA 2Q1WA 2GERA 4I5FA 4XIJA 4A5OA 4BUCA 2PY6A 3KM0A 2IYPA 4HBGA 1V3TA 3JQAB 4FJ1A 5CG1A 1IUKA 3FR7A 4W7IA 4EYEA 2JHFA 5JAIA 1F14A 4JLWA 2D5CA 3JYOA 5DF1A 1ONOA 5T6BA 4FFPA 5BR7A 4HNHA 1ZEMA 3EYWA 4EEXA 4J43A 4UVDA 3TQHA 4YJGA 1K89A 3MJVA 4P4NA 3DBHA 4URFA 4ALNA 2ZQYA 2NVUA 1SPXA 3DMYA 1EDOA 1KEWA 1MG0A 1X0VA 2VZ0A 4AJ2A 3ROPA 4E30A 3WFJA 4AJKA 1HDXA 1ZXBA 2PD6A 2VWHA 1IL0A 1ORRA 3LQFA 4DYDA 1P1KA 3ZV6A 1WWKA 1MA0A 4UREA 4CLEA 3I6IA 2GYYA 2POQX 2RBEA 3RJ5A 5MGBA 3BIOA 1BXZA 3INTA 3K5PA 1LSSA 3VZRA 4RVDA 4AFNA 4NFYA 4R1UA 4BV8A 3GF4A 1OI7A 3V2UA 4WUVA 4J2OA 5AXDA 5IF3A 4MO2A 3FD8A 3DOOA 3BTUA 3INRA 5JLAA 3OM9A 2VUUA 4CLXA 3RWBA 5MDHA 2OUIA 4E2XA 1UJMA 1Q0QA 2GSDA 1GPJA 3WXBA 2ZB8A 4MVJP 4CM4A 1PU2A 4IINA 1OC4A 1F06A 3OP4A 5B1YA 2NV6A 3PJDA 5JFOA 4WE3A 1QLHA 5A9RA 2IDZA 3TSCA 1GZ3A 4J9UE 2GZ1A 4N18A 1UXHA 4R5HA 4WCFC 4I9UA 1VSUA 1A7KA 4GVXA 3JQ9C 5EESA 3FPLA 3BAZA 2ZB4A 3SXPA 2Q1SA 1O95A 1CRWG 5L4SA 1PJ4A 4QTZA 1BTOA 1EUCA 4Y9DA 2PFGA 3ONDA 5IZ4A 3GAZA 4WOJA 4Z6KA 2DFDA 3GA0A 3FN4A 2VNSA 4NIMA 1WPQA 2Q45A 4AJ4A 1GV0A 2IEDA 2PD3A 2Q2QA 4HFJA 4BQPA 1YOVB 2DQ4A 5BSHA 1P44A 2X5JO 1FDSA 4IJWA 3WFIA 1JW9B 1H6CA 1Y9EA 3KEOA 1NM5A 3E9MA 2Y67A 2WTBA 3A28A 3ENNA 1RYDA 3E48A 5KJCA 2P9CA 2V7PA 3PDUA 5TS3A 3P7MA 1OOEA 4JBGA 3U4CA 2J5RA 4BL5A 2J5KA 3KZVA 4DPMA 1PSDA 2ZCUA 4JQCA 3PDJA 3WYBA 1NPDA 1N5DA 1UZMA 1LNQA 1V3UA 2F1KA 2GNAA 3AU8A 1H94A 1PGOA 1LQUA 3L9XA 1P45A 4XKJA 1LLQA 1YQDA 1O8CA 1XQ1A 4RVUA 2GN4A 2XXJA 5I8ZA 5G4KA 2PKQO 3HDHA 4Y8VA 3GVPA 2Y1OA 4J7CA 2X7HA 4JJIA 5KKAA 1UP4A 4BV9A 3OETA 4OQZA 5EMHA 5BT9A 2C7GA 1NNUA 4RVHA 1IB6A 2VHYA 3RUEA 1UXIA 2OL4A 7MDHA 5K6AC 2RIRA 5KIAA 1EVZA 1JWBB 2C7VA 5AVOA 4AICA 1J6UA 2CZCA 4YAKA 5TX7A 4CLOB 1YONA 1TB4A 4IMRA 4E31A 2HRBA 1M6WA 2NUAA 1YL5A 3CH6A 4DLLA 2NLOA 3NT5A 2O3TA 3H7AA 4BB6A 5L4LA 2GO1A 4GWGA 4ILKA 3GRKA 2W2LD 3JQ8A 4RZIA 2FZEA 1WZEA 2VN8A 1PZEA 4FFNA 4JXKA 4MVJE 1DDOA 4IDDA 4TVOA 2EGHA 1DIRA 1AGNA 4OO3A 1PJBA 5T5QA 4FFMA 4F45A 3RCBA 3UICA 4YJHB 1PL8A 1GY8A 3JQDA 3MWDB 2WWRA 4LN1A 1XEAA 3LSYA 4INAA 3H5AA 4PG5A 1IYZA 4L73A 1QP8A 3EK2A 4CLHA 2PZMA 4M8SA 3PFWO 5KVQA 3GEDA 2X9NA 3RUDA 5DCWA 4KQXA 1E3LA 1I5RA 3QIVA 1MXHA 2IRWA 1RM5A 3WMWA 3DZFA 1I3LA 5ILGA 3FBTA 2QYSA 4XDYA 3UXYA 4BO7A 3OQ1A 1R15A 4B4VA 3WYCA 1ONPA 1ZKMA 1BWSA 4M54A 3SJ7A 4WKGA 3DXFA 4BIIA 4EDFA 3LT4A 1M66A 2H9IA 4IXWA 5J23A 2VOEA 2B36A 1E7WA 4YJFA 5K0ZA 4J4TA 1N8KA 3L6OO 3JD3A 5KJEA 3GNQA 4XJTA 1VSVA 4XGNA 4LCJA 1BMDA 3C7DB 3JQ7A 2W98A 2NNLD 4OH1A 3V2GA 3MCVA 3U5TA 4B4OA 1TVEA 5L9AA 2BGMA 2QYTA 3C1OA 3ZWXA 1CEQA 5A04A 3UKOA 4OIMA 5U9CA 1W73A 2DPGA 3QVOA 5HRUA 4FQ8A 1EQ2A 4Q3CA 1IZ0A 4BO3A 3OF2A 1IY8A 1O6ZA 1PTJA 1JDJA 3BTVA 1AXGA 1ZFNA 3V1UA 1NFQA 3T4EA 4O0LA 4LMPA 5BNIA 4HY3A 1P1RA 4HFNA 3U62A 4YEDA 1TXGA 4YQYA 4BB5A 3FF4A 5KOIA 2NQ8A 4B8ZA 2BLLA 3DAGA 3SEFA 4IXTA 5KWEA 2JD0A 2HDHA 4IZIA 2A4KA 3OA0A 4ZGWA 1CERA 2GN8A 4LVCA 1LQTA 4CMIB 4KDEA 3ROQA 4WPGA 1D1SA 4J1TA 1T24A 1DRVA 2EG9A 4U7WA 3GDOA 4FDAA 2XF8A 4H15A 2I67A 3WGOA 1BG6A 1ULSA 3L4BC 1G0NA 4IIUA 1YWGO 2OMEA 4PLTA 2OORA 2O4UX 2DU8A 4PZEA 3BMOA 3LLVA 2ZK7A 2C5EA 2YZ7A 2FZWA 2AA3A 2W4QA 3DFUA 5A9SB 3PIDA 3HJAA 1LDEA 1DRUA 1T25A 2X5OA 1MXFA 1XA0A 3GR6A 4UULA 4BGVA 3H9QA 1U4OA 4FR5A 1DEHA 1O0SA 3NT2A 4UAGA 3TN7A 4E13A 4CV0A 2VYND 3WDSA 1PQPA 1QMGA 3EVTA 4F6LA 3PXXA 5EERA 3A06A 4NBUA 3WIEA 4HFMA 4BNXA 1DIHA 1P31A 2E82A 5KVCA 1CF2O 1DC4A 2WJPA 3Q9UA 3IS3A 4EUHA 3SVTA 1C1DB 1FF9A 4ZQEA 3D5QA 2YUTA 4DTIA 4D3FA 2IXBA 4PLWA 4R69A 4TZTA 3PTZA 3ZW9A 1YJ8A 3DZBA 4OYRA 1MV8A 4HKTA 4DMMA 2FOIA 2O3UA 4PG8A 4C4OA 5IJZA 4EGFA 1B16A 3L4SO 4PZDA 4ZN6A 4BNTA 4L0QA 1EK6A 1KVTA 1UDAA 2C20A 3H2ZA 1A5ZA 3ZV3A 1H9AA 4W9NA 3VH2A 4IDEA 2GZ2A 4FN4A 4P8RA 3D3WA 4GX0A 4E5PA 1MFZA 3GVCA 4GKBA 1DOHA 4D0RA 3FNEA 1LRLA 4IJUA 1F8FA 4BKPA 3GEGA 5DDIP 3IDSA 4B4WA 4YR9A 1B26A 2DFVA 1R0LA 3L07A 3NRCA 3OBBA 3NKLA 4RF5A 1E3WA 1BVRA 1VPDA 2I3GA 3WOHA 4OMUA 4B7CA 3DTTA 4JGBA 4CM5A 4Y67A 3RFVA 4DPKA 1P3DA 4X54A 1P1IA 2YJZA 3NTOA 1VI2A 4BNJA 4CMEC 3TZHA 2UV8A 4RQUA 1A4UA 5JAZA 4IJVA 1ZH8A 4L4XA 4FPXA 4RVGA 1I2BA 2HKIA 1DRWA 3HHPA 5BSEA 4DBZA 1LDNA 3OIFA 5TQVA 1W4ZA 4CM1A 4J4HA 3CMMA 1TA4A 1LJ8A 1E1LA 3A9WA 5DCYA 5B4UA 4HWKA 4UEOA 3GFGA 4MVJD 3V1YA 4XDZA 2HQ1A 3K96A 4CM9A 3ZU4A 3GZNA 5LDGA 1WDLA 5TIIA 2HMVA 5DCUA 2BI8A 1ZBQA 1UXGA 2FWMX 2QZ9A 1PJCA 2EP5A 3H65A 4AJOA 3DZJA 1YVEI 1ZK4A 1ZK2A 4RF2A 1P1JA 5JAMA 1QSGA 3W1VA 1AN9A 4H3VA 1ZNQO 2I6TA 2Q50A 1GADO 3DEYX 3OFSA 1DSSG 2BRUA 1QYDA 3RC2A 4IZHA 2YFQA 3DONA 2HMUA 8ADHA 3NUGA 5JC8A 4I8XA 3OJFA 3EC7A 2WSBA 1ISIA 1EE2A 4W7HA 3PEFA 1X1TA 4L75A 1JWAB 5TC4A 3KSZO 1RYEA 1EVIA 2D3TA 2JHGA 2PWZA 3LF1A 4BO9A 3W8EA 2G0TA 3WSWA 4YAEA 1PR9A 1RKXA 1ZZEA 2DBRA 2OOSA 5TJ9A 5JAQA 4ZICA 2HMSA 3GPIA 1MC5A 1ZSVA 3ADOA 5CEFA 2J5QA 1NHGA 2IZZA 5A3JA 5L51A 4BNFA 2DT5A 4MVJH 4FS3A 4ZQFA 1PQWA 2RHRA 1NR1A 1VL6A 2DTXA 3KYBA 4UEJA 7ADHA 2UYYA 4Q3DA 3RBZA 3DHYA 1JQBA 1LC0A 5F3RA 3TDKA 2CVQA 2JAHA 1Z7BA 5JMPA 2HK9A 1F12A 3E9QA 3OEWA 3G1TA 3VDRA 2I76A 1Z82A 1OBFO 4XQ9A 4S1VA 1VLLA 4CQLB 3PP8A 1XLTA 2DBQA 3C1AA 3ZDFA 3EDMA 3INGA 3O03A 3S2IA 3ZNNA 1ZEJA 5HS4A 3QHAA 5JXWA 2VCYA 1DFGA 1YH3A 1N1GA 1GAEO 3CMCO 5KCZA 3I83A 1YDWA 2Q2WA 4R9RA 4B4UA 4E2YA 4RPJA 3R3JA 4AJPA 3O4RA 3VTZA 3F4BA 4PG7A 4FIZA 1ZIDA 4S3MA 3P2OA 1J5PA 3ONFA 4E21A 4XCVA 5A5EA 4GVLA 2GGSA 4NJMB 3UGKA 4RCVA 1Z74A 3WMXA 3VHRA 4C7KA 5TJHA 3KXDA 2BFAA 2NVWA 4FFLA 1T2DA 3MEQA 1P9LA 4KOAA 2F00A 5IXYA 1D8AA 2UDPA 1NR7A 4FGWA 5BNFA 3WICA 2A94A 3CSDA 5LCXA 1DAOA 1SOVA 4CODB 4PN3A 3VDQA 1GYQA 1M75A 1WLYA 3ANNA 2VTEA 4PLCA 1NAHA 3ZV4A 2P9EA 3PYMA 4CM8B 5KJ1A 1HYHA 1ZO8A 4K6CA 4JCOA 4U0KA 2CFCA 2NTJA 3MJTA 5JW6A 2CSUA 1PWZA 4NJOA 1BHSA 3ANLA 4CMKA 1NQOA 3ON5A 3QP9A 1X13A 5JS6A 3DBLA 3RBVA 3PQDA 3RQSA 1NFRA 2VWGA 2UUPA 3PJGA 1HZZA 2QHXA 1DIBA 1I33A 1QG6A 2CVZA 3H9EO 4MVJF 4Z3KA 1GEGA 4LISA 4TQGA 4WGGA 2C54A 3IP3A 3O9ZA 2Z1NA 4FGSA 3PFFA 5I9MA 4Z0TA 3Q9NA 1SOWA 4MIOA 4YB8A 1I10A 3FCOA 2JCVA 1AE1A 1HF3A 2EEZA 2O50A 3OJ0A 1HYEA 1GZ6A 3VVBA 2Y0DA 1W8DA 2WE8A 1NQAO 4YT5A 4BO6A 1ADCA 5JYDA 3WIDA 4BO2A 1JU9A 4WCFA 5AQ1A 4XD2A 1ISMA 1GEEA 3SJUA 3HQ4O 4QO7A 2VZ8A 3B1JA 3JQ9A 4YRDA 2Y99A 4KQWA 3RSHA 1TT5B 3I23A 2VUTA 5C7LO 4CLRA 1EUZA 2FPIA 3CINA 3O8QB 4A0SA 4ZRMA 5IDWA 3DR3A 1SAYA 3EGOA 3K9QO 4DGSA 4F6CA 3K92A 4BO1A 1DLIA 3PQEA 4R01A 1ZSYA 5THKA 1Q7CA 3AUSA 1ONNA 1ZSNA 2FY8A 4FOSA 3M1LA 3HUDA 1BGVA 2PH5A 1P0FA 2C29D 1GZ4A 1LTHR 3F46A 4ALJA 2VWQA 1LDMA 2UVDA 1U5AA 2VWPA 4OGWA 4OXYA 4CQMB 2PK3A 2ZTVA 4XQEA 3R6DA 2G5CA 1YRLA 3R1IA 3DHEA 5G0TA 2GDZA 6LDHA 1NPTO 2O7SA 3E5MA 1WZIA 5JDIA 4K28A 4O59O 3M1AA 2ZIZA 4WCDA 4WNIA 4GSLA 2G82A 1EK5A 2O2SA 4RV9A 5EQDA 3LT1A 4Z3DA 5TRTA 3VZPA 1W6UA 3KYDB 3AUUA 3KOUA 5GZ6A 1BXKA 5I9NA 1XR3A 1HETA 4HFRA 1EFKA 4II2A 5I8WA 3GC6A 2IODA 1OFGA 4CUKA 1HDCA 4XYBA 4PLGA 1X0XA 1DC3A 4Q39A 3OQ6A 3WLEA 5L53A 3V5NA 4YXFA 5C3MA 3DBRA 1KYQA 1Z73A 1R66A 2W2KB 2J3HA 1HLPA 1R0SA 3K2EA 5FYDA 5K6AA 5JY6A 2AG5A 1XG5A 2NU8A 4N54A 2D1YA 2YY7A 3GN1A 2FR1A 2H1SA 4OL9A 4YAJA 4BNLA 1V3VA 5TGDA 5AOVA 5EN4A 1R12A 3PPIA 1M2WA 3IUSA 4D3SA 1BXGA 3AM5A 3JQGA 3Q2IA 4NMHA 2EF1A 3I3OA 1BVUA 4RF4A 5JCXA 5JO9A 3LYLA 4G5HA 3CZMA 1SO8A 4GH5A 5F1PA 5KKCA 3IP1A 5FFFA 4J91A 3GRPA 4Z9FA 4HADA 3BA1A 3JYNA 1MC4A 3ZWOA 4KWIA 4FFRA 3T4XA 1H5QA 1ZW1A 2R6JA 4E5KA 1S6YA 4R9SA 3TOXA 1ZJZA 3H8VA 1C1XA 1UR5A 2Q4EA 3DAFA 4LVUA 1JTVA 1H6AA 3UVEA 1CYDA 1LXCA 3OJEA 9LDBA 1I36A 1PJ2A 4BNNA 2Y1CA 4Y6SA 1P33A 2WMDA 4BOYA 1E1NA 1GDHA 3WX0A
chains in the Genus database with same CATH superfamily
2Q21A 3ROXA 4I46A 1EEHA 3UJDA 3ZHSA 3DZGA 3UXMA 4RH1A 4YDSA 1VBFA 2RHHA 5CB6A 2WAYA 5TT1A 4BFYA 5EIAA 4CF7A 4ENWA 1KO8A 3BXZA 3DO5A 1E5XA 4MMYB 2FSPA 2W2KA 3FCUB 1CZUA 3QV1A 4KYVA 1WP9A 4LSWA 4PNPA 1M2GA 4D79A 4NYIR 3H2IA 3NBAA 1X1EA 4Q9LA 1R9GA 3IJRA 3A9RA 1SZPA 1Y1LA 2H1CA 2Y1GA 3E5NA 3KCQA 3V33A 2F9MA 1ENOA 1NC1A 2BFOA 2QNIA 1EZ4A 1R0WA 1TUBA 1F0PA 3IFSA 2PZFA 3PRHA 3LX6A 4ZQCB 3OJCA 3QPBA 3T0IA 4WJZA 4BLPA 5BWLA 3AL0C 1WXEA 3KJZA 2INGX 5AI4A 1ADBA 4DNQA 1SOAA 2CZQA 2YICA 4EKDA 5KQGA 4GQAA 3KVOA 4WECA 3GUUA 3QK7A 4M0FA 5F7JA 2BKUA 3DOHA 4ALMA 4CKWB 1Q1QA 1P1BA 1QFSA 3KYCB 3PXBA 4ZD6A 3EPKA 1J20A 5HEKA 1R74A 2DLDA 2V7WA 1DINA 1LW6E 3LYUA 3WK6A 1IZZA 5EHXA 1P8AA 2IF0A 4FLMA 3RTGA 3GNSA 1XZBA 3T38A 5EI5A 3OD1A 4MUXA 1T36B 3PHJA 1E9VA 2JD1A 3O74A 2P6NA 2PVPA 2WF9A 2XB6A 3WGLA 1DJOA 5K0BA 4UCFA 3E7FA 1I32A 1AUPA 4WMLA 1E5DA 5E6UA 1GJRA 4NAHA 3SKXA 1NAIA 1KDYA 4AF8A 4RPGA 4KXUA 3MF4A 1GU1A 1W47A 1Z6QA 3MS2A 2B4QA 1LY1A 3U37A 1QYCA 2P0AA 4HGRA 4E08A 1G5RA 3W4JA 1K6IA 1J49A 4KQKA 3IPLA 5U1PA 1GG9A 1QB7A 1QRRA 1DV1A 2AEMA 4POAA 3REFA 1U63A 3R2JA 1FFBA 4PONA 2NXJA 1JE0A 4TT3D 4L15A 2O5CA 3G23A 3H9JA 2XZLA 1SH7A 4MV1A 1ARZA 2PZKA 4DZTA 4DEYA 3RUIA 1T1EA 5E2BA 2OYRA 3G82C 3IIKA 4HO1X 2E55A 4GP7A 5DYGA 4DNPA 3FIUA 1Z8NA 3CNQS 1TQ6A 4MS4B 1N2ZA 4F7DA 4UZSA 2K7FA 3PITA 3KDPA 3PSAA 2ZDHA 4Y2GA 4BU0A 3NDJA 1T43A 2KJQA 3JXEA 1UL1X 2VLBA 3OO1A 4KUGA 3AW9A 3T9FA 1UMCB 2EV9A 4F3TA 1DGQA 2VYFA 4NCXA 4GM4A 1J7KA 1UEIA 2EXXA 3MCWA 2I2AA 1OVMA 1N2JA 3N39C 4LUCA 3VO9A 3VH4A 3ZEAA 3RC8A 2WYOA 1FRQA 4Y2UA 5EKXA 3GGDA 5F2OA 3ROZA 1B6GA 1H2EA 2QYOA 3SGLA 5B6IA 4EMUA 2QAIA 2FJ0A 3ZPXA 3ZJYA 1B00A 2WJAA 1AH2A 1W5TA 5DHSA 1UZNA 4FBGA 2WDZA 5HS6A 2WM3A 1AHNA 4Y2VA 1DEAA 2IZOA 4TLDA 4XB1A 5A05A 4B7XA 1I0IA 4HLUA 2VXYA 4RW0A 3H17A 1MN6A 5CGQB 3F8WA 5B58T 3KLNA 2DP4E 3WLSA 1DQRA 1XA4A 3DWIA 4JJZA 4RV5A 2EWWA 5AHKA 1ULAA 5ALLA 2CJWA 1NDQA 2V6JA 5G3ZA 4X3PA 3V55A 2GEUA 3CJRA 3H11A 3IILA 3NOXA 3R5XA 4Y2SA 3Q2KA 4BX9A 2J5BA 2IF2A 3HCWA 4KN8A 3G2NA 1EWKA 2XWBF 4FWIB 1E1QA 4RPHA 2A0WA 4LYEA 4YO8A 3UWKA 4AQ7A 1XTKA 1P81A 1Q3TA 2W6IA 1AUVA 2GKGA 2YV4A 4L8GA 4LDRA 5G41A 2OFPA 3AM3A 4IX1A 1K92A 1A7JA 3WGHA 3M83A 1O54A 4MXDA 1GPBA 3ZEIA 2ZS9A 4YYEA 1DUSA 3RUCA 1AG9A 2PGOA 1B15A 1NGSA 3JQFC 3IQIX 3L82B 3WO0A 3ZXXA 3K4HA 4Q7MB 1Z68A 1AKQA 4DHWA 4PPGA 2WYIA 1V8PA 4WFJA 3W06A 1ZJWA 3HYCA 3LGXA 3O1LA 1C9KA 3JRWA 4G97A 4ARSA 1V6CA 4MVJM 4D3DA 3T9BA 1JYSA 3UW1A 3GLIB 2PSDA 3IYLW 5C53B 5KOHA 1NOKA 3FRJA 1NVWQ 1IPHA 3QBDA 2UUCB 2DJIA 4OH7A 1N0HA 3H9BA 1QGOA 3L7BA 3TMYA 1YXMA 1KEVA 4B46A 4AZWA 1B3RA 1RS0A 3AXSA 3LQ1A 2JFGA 1A0OA 2R6HA 3LBIA 1KJIA 4UNNA 1BX1A 3P9XA 5DLDA 4BE9A 5FUQA 1L5ZA 4I3GA 3DQPA 2I6GA 2XYHA 1S2GA 4GO1A 3HU3A 4P35A 2JLCA 4PFSA 2Y66A 4RU1A 2GD1O 2PU7A 4O4HA 1VG9B 3KUDA 4XB2A 4AZ0B 2A0FA 4WACA 1SMKA 4R9NA 3TXAA 2GLXA 2WUVA 4HAZA 3QJYA 4FC7A 1U99A 4TV9F 5LKRA 3O2SB 1TPZA 4J3JA 3G0OA 3RTEA 4AL4A 1AKNA 1Q3HA 1G8HA 2J3KA 1M6VA 2XTAA 2O3RA 3NORA 4I55B 3WMFA 1P9NA 2TMDA 3K5HA 1E7QA 1XTSA 4M0KA 2EW1A 4L74A 4MKGA 4UDXX 1ZLYA 3QTBA 1RJGA 1TM2A 1BDMA 1CQJB 4ZOLF 2ZU0C 4D5EA 2JA1A 1U8XX 1JIXA 1ZCBA 2IEBA 1C0EA 1E6MA 2WVGA 3DV9A 3Q87B 3WB9A 4DFDA 4KXLA 4MRPA 1J9EA 4BVJA 2W22A 3S5JA 5JASA 3GDGA 5T4FA 3IEUA 1Z7YA 4M83A 2Q6OA 5EYPA 4UMVA 1YFLA 2XT9A 2HOQA 1Z5OA 2GN6A 2OV6A 3ZZNA 3LFHA 5IKMA 3LH5A 1YR2A 2WI8A 2IV3A 1K5GA 3NR2A 4P3PA 4XQCA 3EG9B 4W6ZA 4BNZA 3PHHA 1O94D 5JBNA 2GPYA 1FLAA 3EZ6A 3FCCA 4NNOA 1FFCA 1N0WA 1P1HA 1KF0A 2FX2A 3LBNA 1E1DA 1LLDA 3SOZA 1F3OA 5CA1A 1OV4A 2HLPA 4AZVA 4HI0E 3S27A 2XUFA 3VPAA 2GTIA 5COQA 4B3HA 1OSNA 2W7TA 5JYBA 3OKPA 3IEMA 1GNTA 4CDMA 1KJQA 1JYFA 1TTTA 5J2TA 4LRSB 1GCAA 5FNVB 4HNAB 3U7HB 1GQRA 2FXVA 3K15A 3E22A 3FMOB 2QKYA 3JYHA 2VJCA 3EB9A 3Q1LA 4MDHA 2ODPA 3H86A 3IAXA 4EH1A 5BYBA 1AK2A 4OHRA 4C01A 4X92A 1A82A 4KE6A 4IP0A 4WFKA 2F17A 3OKFA 1YL7A 3IKTA 3A4VA 1TUIA 4M9SA 3KKEA 4RMHA 3B6EA 4AZ0A 1GR1A 2QRVB 4CU2A 4DMKA 1SCQA 1Y8QB 4PE5B 3LL7A 1MVOA 3HO8A 1HEUA 2PV0A 1JVSA 2C4WA 2IZ6A 4N0MA 2IDMA 4OCZA 3V42A 3GLFE 3UK6A 4M7PA 3ENVA 5D1HA 1WULS 1ZPDA 2FEKA 2AQ8A 4LYAA 4NEQA 1SVIA 4QVGA 2P9BA 3W5UA 3HG7A 2WHPB 2CVFA 1XAIA 5COAA 1QLWA 3ZBQA 8OHMA 1L5SA 3SJAA 1W29A 3GQVA 5HWSA 2GR9A 4GE0A 4AKTA 2HJRA 5CT6A 4Y9TA 5DI3B 4ZCLA 1E77A 1TO1E 3NFYA 1KO4A 3TO5A 3J81A 3EXG1 1R4MB 3UO8B 4BFSA 4BEJA 4CMJA 1FQJA 5ALIA 1QVWA 4OP1A 4DJFC 3DM9B 4YTEA 5FF9A 5F9MA 3KETA 4MS1A 4OXQA 1EKXA 2IPLA 5IT5A 2YJ5A 4FFSA 2X22A 4MLZA 2ZBGA 4FSDA 4ZEOA 3Q7RA 2ATEA 4F3RA 1E0AA 1NDUA 1ULZA 2AH5A 3C8HA 1C2YA 4HP8A 3NQ41 2PSEA 4ITUA 4RQTA 1QJCA 4AAYA 4AECA 2IH5A 4CYMA 1TIKA 1EWTA 2LP4Y 5DGHA 2AR7A 3PG5A 3SFZA 4ER7A 1U80A 2QTCA 4QASA 3OQHA 4N6GA 3NEYA 1XMOB 3QBVA 3E3OA 5F21A 1DB3A 3DDZX 3JPWA 3WRVA 4TMZA 4HNAA 4DN6A 4YBZA 1SVMA 3KT6A 4JITA 3OCUA 4H3HB 4K1LA 4LY9A 6ABPA 2H1HA 1JFVA 3DTYA 3K8ZA 4K9QA 4I8IA 1FNCA 4UTOA 2XTZA 4RMIA 2LWIA 3BGOS 2DR2A 3PWZA 3K16A 5CFPA 3UWMA 1X7GA 3EVNA 4EYOA 1J9GA 4WWHA 1W0KA 1EGMB 1NVVQ 2X8JB 2O54A 1PGJA 1GTMA 4R9UC 2R84A 2FK7A 3NNSA 2GPSA 2B5WA 1TUEA 4PICA 4Q03A 4YROA 5ER6A 5B4TA 2HRZA 1CUDA 2XMDA 3BXOA 2PNJA 5JHHB 1M1YE 2DHDA 2IY7A 4G09A 4GMHA 4J8PA 4BEWA 1EK2A 5DHRA 3T7TA 3PC7A 1YQEA 3C8MA 1RABA 3RS9A 2BEVA 3LC1O 5TPWB 4B81A 1UMBA 1XXHB 1PQ4A 5E3IA 4PFKA 4TL8A 1X1BA 1X1SA 3AINA 3F3MA 4HGZA 1T1SA 4RKYA 5DSTA 1FFYA 3WGKA 4CMAA 2WOOA 1PX0A 3KQMA 1T3GA 1E3DA 3HZZA 1YJBA 3ZU3A 4CWAA 5ELLA 4K9KA 5DYTA 3EVDA 1U2TA 2C4TA 1P72A 1XNGA 2A92A 5AW5A 3I34X 3IAS1 1OD6A 1MJGM 5BWOA 2A57A 3GEIA 1ZH4A 1D04A 4PZAA 4WESB 1CT9A 4BP3A 1JPNA 3FVQA 1QIDA 1ZXLA 2BBWA 3F7TA 5EKSA 2VJPA 4AXBA 1D2NA 1UK9A 3K0SA 2X2OA 3LRTA 2PT7A 5DIZA 2QZPA 1TFRA 2ZVJA 1BQ4A 2NXNA 4O2AA 4RK6A 3BRQA 1YHNA 1WUJS 1W0JD 3BFVA 4JA0A 4Y2QA 3VPSA 1F0YA 3CM0A 3DDCA 1R6XA 3WYEA 3G8CA 5ILOA 3VPHA 3AW8A 4ZT6A 3OU7A 1KPIA 2XBMA 4Y98A 5KTTA 4IIEA 5JV5A 4REQB 3DT8A 5BW5A 1JMVA 4MW7A 5E7MA 2E37A 2GYVA 2OKCA 2ZWVA 1Z2PX 4MGYR 4RGVA 3R9IA 2AR9A 4NOMA 3OZAA 2RK6A 4W8HA 5LU8A 1FJXA 5KNDA 1JZSA 1SUAA 4MEJA 4RCZA 3OE5A 3G7UA 3HNPA 1NXTA 2FSVC 2YQZA 4FGLA 4J0GA 1JMYA 4C87A 3K7EA 5HFNA 3VISA 3CLSC 2VHXA 3KNZA 2OQ2A 1H1LB 4MIYA 4UBJA 4B0OA 3TPCA 2QE6A 1TIPA 4TZKA 1VOTA 5C31A 1IAVA 1X7XA 2PZJA 1PUJA 4GP9A 4RNCA 3T1TA 1MB4A 3B8HA 2DGDA 4B40A 1ZMTA 4I6JA 5I9SA 2JDID 4R2XA 3CLKA 1DTWA 3NEAA 4WOKA 4YGYA 3NAGA 3DLTA 1FYFA 3OX2A 5KWVA 4QPZA 2X41A 4IR7A 2BCJQ 2YVUA 1ORDA 3ACCA 2ZYHA 4GI2A 1P0IA 3C3AA 1QQTA 1QM5A 5L7TA 1VL2A 4LW8A 1K8RA 2ETXA 4TRMA 4IY1A 3QPVA 2DQKA 1LLCA 1Y8ZA 3RF7A 4CT5A 4H3SA 1QHHA 3BEDA 1FX1A 1EDEA 2WF8A 4GBED 3UOWA 2BW0A 3WYAA 4WESA 3EIOA 3ZL9A 4D2IA 3F3YA 3IURA 4ZCIA 5CB8A 1F2TB 1KZ4A 2A1TR 2JJQA 1OWLA 2WTAA 4AX8A 3K30A 3VDXA 1ZN7A 4ZGBA 1YL6A 1ZUIA 2EU8A 2CMGA 2OXFA 1EA5A 3KEQA 4RJJA 3WLRA 1QONA 5C4MA 5LVAA 5BMOA 1J24A 4EEZA 2DEUA 1V1JA 4NWIA 2YXPX 4BN5A 5LQCA 4IYRA 1LX7A 1H5UA 1QJ4A 3H1EA 3IP5A 2PRJA 5TQ2A 3M70A 5BW6B 4DCTA 1BX0A 1NW8A 1I24A 2D8AA 4HQFA 1DJPA 3KALA 3OZDA 4MNTA 4WEOA 3QI7A 5KHAA 4WLVA 3VI4B 1U65A 4YCSA 2ZBQA 4YAFA 3JQRA 2D4AA 4NDNE 4RENA 5TT0A 2AKEA 4OXNA 1XRSB 1HA3A 3A9VA 3O1HB 3UYKA 3ZJ4A 2ZTLA 4RJ2A 1E7SA 5G2OA 4Y0VA 3ETDA 1WW3A 3TNLA 4D6YA 1FRNA 1GZ5A 3AK4A 1BVYF 5BV8A 4RGBA 4D9MA 1C9YA 1QHGA 2C8JA 2EZ4A 2YZ2A 3P9PA 1SKYB 4TKZA 4Z3KA 3DKVA 4DV7B 3ELYA 2XVMA 5PGMA 3TPZA 2O48X 5HJ2A 4QHSA 4L28A 1M2NA 2NQ2C 4G0WA 4AKSA 2A35A 5LKAA 2ZVDA 2FMXA 1ZU4A 1XK6A 4PGMA 1V16B 1M1NB 5KQLA 1UANA 3TM5A 3AOEA 3AEYA 5JBIA 1FMTA 1V43A 5FWXA 5DX1A 3DMTA 2RGUA 2CHEA 3SFVA 2J48A 2WNSA 4GP6A 3VO1A 4DLVA 4XGRA 4CI0B 5BMVB 4FUQA 1GL9B 2PLRA 4IH4A 2QL7A 2QSJA 5KYXB 4NXNB 1USVA 3PHLA 3ZDBA 4Z9XA 3GLQA 1XU9A 5IM4F 3QELA 5D6NA 1XYGA 2XXAA 3CZCA 1LI4A 1J5EB 3HSSA 5CLLA 3JQBA 4MWZA 3URMA 2MMGA 1JUDA 1QKIA 4EB6A 4UCQA 4WXYB 5FBKA 3WJ7A 5HZHA 4IDNA 2CY0A 1HDYA 1JIQA 2I8LA 1K08A 2QVCA 3OEYA 3PC2A 4P86A 1WNFA 5HUQA 4D8UA 3ZVNA 2EGUA 3I2HA 3NJ8A 3OZWA 3UJCA 1SULA 2ICAA 3KUCA 4JFRA 4WN3A 4ZAXA 4UPDA 2D06A 3RRZA 3ZUGA 5ENDA 3EGEA 1JVBA 1Z35A 3H97A 4FWBA 1QFZA 1Z45A 1WZNA 2NO0A 2Q49A 4MKZA 4WZAB 4ZT5A 2J3QA 2RB4A 5LYYA 2XUJA 3UJ3X 2W0SA 4P5PA 5IVHA 2QPAA 4GZLA 4EARA 1XZFA 4EECA 1RQGA 3DEKA 3T0FA 1NVGA 1U2GA 2WUEA 3L06A 3M1IA 4KXNA 5CNIA 1RKUA 5DNCA 1L7PA 1U0FA 3R3YA 1ZMOA 3DE5X 1KMNA 3GY0A 1XZLA 4RUKA 1ESMA 2B6HA 3CNEA 3U3RA 2PL5A 1KPHA 5DGTA 4CPDA 2IL1A 2YHIB 3PEVA 1HT2E 1E6UA 2M98A 4E22A 5IXSA 5B3AA 2O5EA 4Y6RA 1AKVA 3M6WA 3KLOA 4D9HA 1XMQB 4I6EA 1JR3A 2C2ZA 3PC8C 5AHOA 3RS4A 3T7CA 2P0EA 5HKLA 2EP8A 2R25B 1G8GA 1L9XA 3FMPB 1ZUWA 2VK2A 1GPYA 2B1RA 2NACA 5I9LA 3K71B 2G71A 1FYEA 1MOSA 3LCRA 3NWJA 5SY4A 1EXNA 4W5RA 2PH3A 3AKCA 3CZ5A 1H85A 2PZAA 3HN2A 2I2CA 3HPQA 3ETNA 4NVRA 4Q4HB 3SXUA 2O2DA 3JQEA 5BMVA 2REBA 4BMYA 5GMOA 3GDWA 1M2VB 1JT9A 2BJWA 3LUJA 1MBZA 3U7FB 4BRUA 3L4JA 3OFKA 5CJJA 5AVWA 2X9GA 2DUWA 3AJEA 2WVJA 4DDMA 1VA4A 4JYBA 4Z1OA 2GI4A 3T06B 3Q8WA 2MINA 3M9LA 4MUHA 1WEKA 1XPOA 4ZC8A 1YS6A 2BKLA 2IWHA 5B6PA 9ABPA 3IMCA 4F2GA 3HCCA 3OU6A 1B8VA 1TKRA 5BSVA 1U3DA 4RHFA 3IJEB 3BXPA 4ZEXA 3ESDA 3VI3B 4L2IB 5CG2A 1CS0A 3DBHB 1KDOA 4EL0A 1GYRA 2R9VA 3OAAD 1P2FA 4M1TA 2H52A 1R5OA 1UBRS 3ILHA 1NVBA 1YRHA 1U1EA 2VHVA 3NALA 4KE9A 3OH8A 3PQ5A 5CA1F 2TMYA 4D3ZA 4R5MA 4CNBA 3BDIA 1U90A 2Y1DA 4PSCA 4TTPA 3MK31 1PEKE 3VPDA 2YZGA 4PSKA 3UFXA 3MMXA 2BFMA 5J2TF 4TTVA 4QBHA 2QG4A 3OT1B 2IP1A 2SKCA 1KZGB 3CXRA 2BFEA 3DD5A 3EWAA 3A4YA 5T8KC 5C1DA 1L5MA 3OQIA 5IU6A 4ZZ2A 4BRWA 3BC1A 3M4NA 4MR7B 1EUQA 4YRZA 1MRSA 1GUZA 1HG1A 2I4RA 3SKYA 3LUHA 4C0SA 2DLNA 3NM5A 4D6XA 4B3TB 1ZGAA 5B5SA 3H04A 5TY0A 4CQMA 1DWOA 3IUYA 2VJBA 5KTNA 1B8PA 3WWOA 2G25A 1BKDR 2UYCA 3LHKA 3I5YA 1XFAA 4Q3BA 2NSDA 5CDTA 2Y68A 1L5YA 1NE7A 3B20A 1W30A 5AM5A 2ZSAA 1XSEA 1JJ7A 1W5SA 4IIJA 5H83A 1L5LA 3SFTA 4JB3A 3ZKAA 4YMLA 5BVGB 2CXOA 2YJ3A 4TMFA 4UUBA 4WXPA 1NXXA 3ZU5A 2FVYA 2GWRA 2O5VA 3LY8A 3O38A 1GUAA 5KVVA 5J3JA 1K7YA 3W6OA 1SUCA 3BWVA 3NBXX 1WEHA 5DWQA 2M6RA 1KK0A 4PPFA 4B45A 3IPRA 4BCBA 1ZGZA 4CIWA 3TUJC 4TYNA 2V7UA 2XCUA 2PXHA 4M9CA 4MS3B 2OTCA 5LZ5A 3ZWBA 1EFDN 1E4OA 4ZT7A 4ENRA 3PIRA 4QJ4A 2FFRA 4YJ2A 4HYTA 1USIA 1UT8A 2G36A 5J40A 5JZBA 5CLHA 2VJMB 2VOJA 3CRMA 3GHYA 3VU0A 3EGIA 3K09C 4ND1A 3R8XA 3TS1A 3NP7A 2E49A 2E3JA 2ONYA 3CCBA 1KY4A 4J1JA 3EW9A 1T15A 3R6WA 2X1MA 3M3HA 3FZQA 3BDVA 1GQQA 4IMPA 4FR2A 4JBWA 2MSDB 5HILA 4ZCMA 3GVIA 4TOIA 2K2WA 5FA5A 1DHRA 2VDQB 4WDRA 4M1ZA 5ADVA 1H2AS 5JXJA 5LDHA 1E98A 2WSIA 2X5XA 3OT1A 3VHXB 4CKYA 4DADA 1TZKA 5K0EA 5KVSA 5D01A 2DBYA 3E7PA 3G49A 3R7SA 3A4MA 4JROA 1P4GA 2PU5A 1IY9A 1ODKA 3HYRA 3F49S 1J0XO 5CNKA 3VPGA 3W9YA 2NN3C 2H5LA 2QNBA 3QVXA 3U2QA 1W36B 1YRAA 1XHLA 3NI2A 1YB5A 1GNVA 4QEDA 3V4RA 2GCOA 5BQPA 3N2KA 5CDFA 4ERXA 5TNXA 2PKXA 5LWQA 2CLCX 4S1TA 1CUIA 4WZBE 5BOSA 4YMGA 2RHOA 4PX9A 3AQIA 3ZV6A 4A92A 3V1NA 3O82A 1L6IA 3BVPA 2AR0A 1T5IA 1YZYA 3P0RA 1M2KA 4Y6PA 4C0JA 5HK9A 1EQUA 4LE1A 4QPDA 4OHZA 4DQVA 5IBCA 3TDMA 4O3FA 5IDQA 2DG2A 1KMMA 2XLCA 2FH5B 2X6RA 3CPSA 3HYLA 3LA6A 4XIGS 3FB1A 3BEOA 2BSAA 5B12A 1H6BA 1RAIA 5ARBA 4LWOA 2HJHA 5J1TB 1ILEA 4YV2A 2PS1A 3WGQA 1E1CB 2VAPA 3RR2A 4TSFA 4M0DA 1KJNA 1VMDA 4KUEA 4PS0A 2DC1A 3H0EA 5F77A 2H85A 2AOTB 2V4MA 5F1OA 1VKRA 3WAKA 4OK3A 1YQGA 3A1NA 2PS9A 4S04A 3HMQA 1C3LA 4AYXA 1T1RA 4LZNA 4YT8A 2EX0A 3A27A 4QHYA 4DXAA 5I3CA 3AKYA 4RABA 5AR1A 1KO1A 4EGAA 1TA0A 4C7JA 3IOCA 4Q1CA 5AKHA 5FEMA 2GJSA 5TF4A 2Z2JA 4QWWA 5KAPA 2FPGB 1N75A 1MORA 2GBIA 3KSUA 4DDVA 1A71A 3SHWA 1K75A 4M0LA 2A0YA 2IKSA 4GNRA 4JBXA 5I9TA 3QVGB 3KQPA 2ZRNA 3CCFA 3DMNA 2FW6A 5E6SA 1DJNA 4OQYA 3VSAA 2B35A 5ENZA 4B6SA 3K1ZA 4P08A 5SYAA 1Q17A 5ADUS 3C6KA 1QIKA 4Y7CA 2BFFB 3KTDA 2GN1A 1H0KA 4G0UA 2OK7A 1OTYA 2QSUA 3QMPA 1FUKA 2ZB3A 2L82A 4EWLA 3FCYA 4AN0A 3O1JC 3ZI7A 1NL3A 3ZOZA 4PS1A 2X1LA 4OD0A 2BGKA 2HNAA 3AYXB 4V0SA 2V6MA 2JAQA 3VR5D 1VYVA 2FUNB 2RHBA 1SB9A 2ZSIA 3BFPA 1BE8A 4C78A 4J1QA 1V1MA 2PWYA 4IDQA 2QI9C 2H1VA 3CTMA 1ZK1A 2OO5C 4LDNA 1G9XA 2WNHA 5HDBB 4DAOA 4YRSA 1AO0A 3RB8A 4LMAA 2QLNA 2Q5IA 1D4AA 2HUNA 1HNNA 2E0IA 1N6IA 1K4YA 3BSSA 5IMBA 1F7UA 4QNRA 2FW8A 4I8DA 1EFTA 2OHJA 2OCIA 1QH8A 4NFSA 3LM8A 3OIDA 3VYTB 2B4RO 1N77A 1K2WA 5EZSA 1G3IA 1MF7A 1E7RA 2P2NA 3E3MA 5EJ9A 1BRTA 1OJLA 2VO1A 5AJWA 5ALKA 3UAOA 1JYEA 1NLFA 1VM6A 1YB7A 2YQ4A 3M1YA 5LQSA 5AUPB 3DYIA 3I9LA 5DNUA 3E9EA 3KB2A 2GK4A 4WNCA 3UAYA 3LTNC 4G23A 4G41A 4Q7EA 4YREA 3R7NA 2FRXA 3SLGA 4EZEA 2PJUA 2XDQA 4KDFA 3L8GA 4IDGA 4MK4A 4X85A 3GMDA 2J46A 3U7QB 5LP6B 1L7MA 1SY7A 3EZ2A 2V6IA 4FYKA 5AHXA 2OA0A 5A06A 2NWQA 1G5TA 2FPGA 2ZWIA 3KV1A 3O7WA 4HF7A 5DGXA 4XI9A 2CEAA 4TYMA 1V6SA 5CX4A 5DKFA 4YRBA 2EKBA 1C5KA 3FNQA 2B1GA 2AB0A 3T7JA 1ISHA 1T6ZA 3GFTA 5COBA 1YZQA 5FB3A 1SQ0A 2NTNA 4AC9A 2ZCVA 4A36A 2P5SA 2F67A 1XKQA 1Z29A 2BFFA 3VR5H 1G3MA 3EN0A 4O4LA 2F6RA 4ENTA 3IELA 1I7PA 1RWNA 3MHTA 1T3HA 1G8AA 2GCIA 5E2AA 3K0KA 1YC5A 3PGKA 1E1YA 2YZKA 5EWLB 1U8CB 1KRXA 3E4DA 4I4TB 4MINA 2X0JA 5HKAA 4BO0A 1DKPA 2KLHA 3F6BX 1Z75A 1S2IA 4FDVA 2PL3A 4JBHA 4L5AA 5IC5A 1QYIA 3SIRA 3L0SA 3UW3A 3QKRA 2C1ZA 1VPLA 1U2DA 3GAMA 1Z0KA 1MQ8B 2J3EA 5DBEX 4MIEA 1NVAA 2VEOA 4MDYA 3HYSA 4Q00A 5NLLA 4ESVA 1ZD9A 2NUPA 1WRBA 3QOXA 2ZIEA 5EC8A 5K3BA 1CE8B 1E9CA 1BWQA 1SXJE 4ZJZA 1LD3A 2AFHB 1KBZA 5DMHA 3VHQA 1T35A 1ULUA 3PLNA 5DRTA 1U6KA 1DT3A 1BMTA 1X1QA 2WAOA 3M4XA 3OPNA 3PPYA 4C07A 1ZGBA 4B6GA 3WV5A 4G2NA 4IL5A 5HKKA 3THXA 4LI0A 4DEVA 4DT1A 1ZJYA 5EJ6A 1VJDA 4HRVA 4DSAA 3GGPA 1R6DA 3IP8A 1Z16A 1UDCA 3N7AA 4QTXA 3VKUA 3V7NA 5A4KA 5CP8A 2WDPA 3GMSA 4QYTA 3PZRA 2RDMA 5EQFA 5ITVA 3MAGA 3PXAA 2P3OA 3KQSA 1B0PA 3CZ4A 4UEKA 4DLTA 2O2YA 2C2KA 4ZYWA 4HGOA 2HV9A 1Z28A 4YV0A 1EIZA 2GHRA 4EG4A 2PT5A 2C7BA 4OSPA 3T3DA 3OZVA 1GRNA 1IHUA 1MB2A 2ZKLA 1HOXA 2YASA 2GRAA 2IBMA 3D0QA 3GJZA 3K1YA 4OAOA 5AYVA 1E20A 3RIYA 4O08A 5T3UA 2W6JA 3ORRA 4MQUA 5AJUA 4AF7A 1B8OA 3P2YA 4RY9A 1CNFA 1Y4SA 2O06A 4K9NA 4V3BA 4B3CA 2QXTA 3Q7QA 2OE2A 3QKUA 4P54A 4NMXB 4P4SB 5J43A 4UM9B 4RE6A 1IN7A 2O8NA 1PR1A 5EWLA 3MQ4A 2Z9BA 5A7GA 3N74A 2P1ZA 1R8JA 2BPOA 4CBVA 2P7IA 4XUCA 1E2HA 3OLQA 4MKRA 4PTZA 4W5HA 5A0TA 3BHMA 1J2TA 4DCPA 1EVYA 3DLIA 3ELBA 3GLIE 4YK7A 4C9BA 1XEWY 1TGYA 4AXXA 1YJCA 2YVQA 2NG1A 3PNPA 5FI3A 3OF5A 1DBIA 2AT1A 3ZS8A 3KJHA 3L7AA 3UK2A 3I72A 3UC5A 3DL4A 1JFRA 3D3EA 1KJ9A 3GEBA 2XRYA 4F4IA 2W6NA 1NT4A 1UPBA 3UATA 1SOUA 3PWTA 5JNUA 1YZ3A 2CW5A 3E9NA 4TSKA 1BFKA 1IOVA 1ISRA 1QR6A 1EZ1A 1ZVKA 2YYZA 2P9QA 4RBNA 5DGDA 5I48A 4B44A 1AT1A 5J4LA 1RWXA 2BGGA 1NM5C 2R1TB 5BMVF 5LXTB 4WZZA 1O9BA 2EERA 2O1SA 2YN4A 4NCIA 5LBIA 1CG6A 1EWYA 4MDFA 4ZV7A 3O94A 1JT2A 1HPLA 4Y1GA 2CE7A 1I3NA 2VUHB 4CKCB 1VLJA 1A9ZA 1S9DA 3Q8KA 4Q7JB 2XMQA 4GF5A 3QYFA 4K0RA 2F1JA 4ZVVA 3UFBA 5FUBA 2I99A 2SKDA 4BFTA 4YHHB 1AF4A 2IPAB 4QVIA 3ZN2A 3RYTC 4KPUA 1H8HA 2O07A 1N7HA 2R79A 4PRYA 2AMLA 3L02A 4WXHA 4FM9A 5F76A 3M7IA 2YOHA 3C3PA 2BGIA 4C14A 4F5DA 4YT4A 4IM7A 3SEZA 1ZYUA 1TM7E 2REOA 2Q3HA 2VNIA 2DX7A 4JR1A 1ZJ6A 3TJRA 3OOYA 3HGMA 3Q7SA 3BXHA 4XFJA 1V71A 2IZ0A 5FCDA 3UB4A 3WV4A 1OA0A 3ZVRA 4WT7A 1GTSA 3RTCA 1T6BY 2ZM5A 1OH7A 3Q72A 1SKUA 4JIGA 1C9MA 1K3TA 4U9IS 1RMQA 1JKFA 1G9SA 2EARA 3ZZMA 4RTOA 1VKZA 1T8YA 3VNSA 3ZK9A 3K9LA 1K6JA 3GP3A 4G6ZA 4EATA 1NBOA 3LDFA 3DSRA 3K0FB 1RM3A 3K0AB 4DWOA 1PR6A 1R1DA 3R0QA 3GPBA 3KZMA 4ESHA 5JC1A 2ZWAA 5K3EA 2H2GA 4PVCA 2PTGA 1NBEA 4CRWB 1T2AA 1UP6A 4RH0A 3WMRA 1HKUA 2BFCB 2HHLA 4MRMA 2NU6A 1IXSB 4CTNA 4HRAA 3TG8A 5HIKA 1P73A 1R6TA 3BCUA 4QQKA 1UJCA 5CVCA 5F4BA 3PKJA 1ZM2A 1QIJA 2VA9A 9GPBA 3KB6A 1NONA 5A5FA 2MTBA 4D44A 2B9VA 4N8EA 1IE3A 3OECA 2JNWA 1Y8RA 3X2EA 3EVCA 3CLTC 2PLWA 1TM4E 1Y3FE 2WYWA 3JV7A 3OLZA 4HL6A 4KIWA 4P4LA 3U3ZA 2ATVA 4YO7A 5K0GA 5HTOA 1CEEA 3Q1KA 3V9PA 2R1TA 2R4QA 4MZDA 1Z47A 4B43A 3IRVA 2NZWA 3SKVA 1JSZA 1GYPA 2G5PA 3AI3A 4PYKA 1W581 5KNBA 5L7WA 4YUVA 3SMQA 1DUIA 4CUZA 5DBFA 1JHZA 3BL8A 4ZYTA 3DEFA 4YASA 1VCNA 1WMBA 4ND6A 2VSXA 1C81A 3G85A 4LJYA 1L5KA 3TRJA 4Z2AA 3QWFA 1QV6A 3JZDA 4PQRA 3E9RA 3ZI4A 3OFJA 3BB4A 2B0JA 4HEHA 5I01A 3WLQA 2X2EA 3AUAA 4MJXA 3ZGVA 1D1PA 2BMEA 3EIQA 3IUJA 4K26A 4JQYA 4DYHA 1CKEA 2HFJA 2P4UA 1NXPA 1P7VA 2A0UA 3ETCA 4G0QA 5J1SB 1UBMS 2JIQA 1EVEA 2ORYA 3PS9A 5IUNC 2AOWA 4LYDA 5ESRA 4B6EA 1LGYA 4JJ7A 5C7YA 5EWJA 3W5JA 3ZIAD 4BDTA 4U5QA 4F38A 4YP6A 5CITA 1XQVA 1BDHA 1X14A 3TUIC 3QFRA 2XY4A 1Y6RA 4FINA 4Z2YA 4DMRA 5DJ5A 3I62A 1O58A 1PS0A 1SG0A 2X0NA 3GNTA 1G5HA 1Q1GA 3R0IA 5IFLA 2C2MA 2O6HA 3IJPA 4HXYA 4X63A 3ER9A 2R1ZA 4KKVA 1ENYA 1ONSA 2BDTA 2XYQA 4UU7A 3UXHA 4MYTA 1XVTA 3RFUA 2AG6A 3TLCA 2BFCA 3BSYA 1FSSA 3HBAA 2ZW9A 3G6KA 5DLEA 2J9FB 5D7NA 3JAWA 4JBNA 3ZHXA 1M2HA 3ZTWA 3QVVA 4LHZA 3R41A 4LX0A 1ORIA 1R9NA 2Z56A 4MW5A 3V4VB 1IEWA 4X1YA 5EA2A 1KAMA 3GZJA 3U39A 3TMAA 2PRIA 3I12A 3L7MA 3ETEA 3O95A 1JDVA 2CLHB 3EMKA 4I1IA 1PNVA 2GZRA 2O7VA 5EVJA 1YMVA 2OAP1 4YGXB 1GGNA 4FZVA 4MI3A 3RT1A 1JLHA 1DU4A 1UBUS 2AXNA 2RHWA 2CWWA 3DB2A 1T8RA 2IGBA 5FTWA 1JDSA 4W1PA 5JLJA 4NJEA 1UCFA 2P7HA 2C57A 4IHAA 3V7WA 4AX4A 4EAAA 4GBMA 3VKFA 1XQYA 1PEYA 1R9JA 2FEMA 4N3NA 3UEOA 1Z7GA 1CUEA 1QFMA 1VJRA 2CXSA 1XXHE 3VMMA 5K0JA 1G21B 1QGDA 3HPRA 4BO8A 5L4NA 1BQEA 3ZHZA 1FUEA 3IUPA 3L6UA 4YWJA 4XGIA 2L2QA 1NUSA 1G5IA 3HY6A 3P0FA 4JJAA 4LOIA 5CM8B 5JXGA 1GPNA 1DXYA 3QPWA 1BZYA 3W2GA 3AESB 1P5JA 2R7KA 1Z63A 5JE8A 1IUOA 5DYWA 3SQOA 3G5UA 3CW2A 1MX1A 4RXTA 1NRWA 1U0SY 3OFND 3AQ4A 1JXOA 1VIDA 1PGQA 1X2EA 2AUTA 3D64A 3LOUA 4KACA 4OOFA 5DWDA 2I2FA 1U0GA 5K0FA 3LVQE 2Y0CA 3U44B 1HDGO 4CUJA 5MN4A 5CYOA 4H6XA 4HDKB 2N42A 2FE4A 1TAGA 1V95A 4WLFA 2C8LA 4ZREA 4EY3A 5JNWA 2EBFX 1N33B 1Y0BA 4DC1A 3FPAA 4QGBA 3JSAA 1XCOA 2CCGA 5EJIA 4OHFA 3I1JA 5C7OO 2J4CA 1CR6A 4B0PA 3A04A 4CKBB 1BA3A 4C6SA 1ILWA 4E2WA 4GOXA 3T7DA 1PFQA 4FHCA 4LAFA 5CW1A 1F6WA 1DBSA 4RXMA 2WD8A 3OEHA 4B80A 1UXJA 2EJCA 4I1UA 5I9BA 4ZDKA 3QLJA 1X3SA 2F3TA 1SUFA 2VK8A 2J30A 1F9EA 1BGXT 3D6UA 3SU8A 3ZI0A 2JBAB 3ESQA 4FWTA 1G7RA 3I4LA 1BYUA 1SZJG 2K4MA 1A27A 1K6EA 1P5RA 1K1EA 3D8HA 3HDVA 3TCXB 1C50A 3GPDG 2IEZA 4QYWA 2AGVA 4X1KA 5CCBA 2COEA 3A1UA 4Q01A 3T61A 1QRTA 5TPZD 3ZCVA 4OHXA 2ZSFA 5L40A 1SCIA 4GOJA 2HR1A 1XTZA 4NY1A 1BE6A 2CDAA 4B3RB 1JEEA 5GAJA 1R6UA 2HSWA 3R0JA 2QJWA 1DAEA 2FG5A 1KDTA 1V8ZA 5D8DA 1TRHA 5ED4A 3ADPA 5AW3A 1G21A 2CBZA 2AEJA 4OX9B 1MAAA 4JK3A 4KU4A 1LPBB 4KVGA 4AULA 4Q3OA 1QVZA 4OBXA 4DRXB 3H0KA 4G3XA 4BIMA 4R8LA 1SBTA 2Y3IA 1VKHA 5DXJA 5EQJB 2JK0A 2Y1EA 3NHLA 1NJ2A 2IS2A 3BCHA 2HJVA 3EQZA 1OX4A 2PX2A 2GEKA 4G63A 4E5MA 4LDPA 3VR6D 4OXRA 5FP0A 2PRYA 4O4LF 3JASA 3IHTA 2PS3A 1QDEA 5HRAA 4DXDA 4D9BA 3H4VA 1C3XA 2GLTA 2I62A 4UNPA 2R11A 2IYRA 4HAIA 2X2FA 3V1TC 1SUIA 4E2ZA 4C7OB 2I9PA 4CG2A 3D43A 2NYRA 5ITSA 1SC6A 1IN1A 2UXDB 4FBLA 1EXWA 1JIIA 1MH9A 2C82A 2R85A 3L0IB 1UBTS 5B4VA 2WUWE 4MYRA 4P7BA 5JCPA 4YQZA 3RK1A 5EXPA 1JFTA 1N8NA 3B7WA 3DBRB 2JAUA 1V5WA 5EIBC 4YAIA 3LMKA 3VC7A 3U49A 3LKVA 4Z86A 3EMDA 2XHZA 3OESA 4W1SA 2ZIXB 2DAPA 2LGJA 2ZSEA 4DM4A 2O8EA 2WILA 1Q92A 2EX4A 4PTLA 2QVGA 1FMCA 1CJCA 1LDGA 1Y34E 3P0JA 4LHVA 4PYNA 1KK3A 4JGGA 1CVRA 3SQXA 2W5UA 3QJ5A 4MH0R 5JO0A 3K1JA 2YNMA 1BXGB 2IYQA 3JQGB 2QMOA 4ILEA 1IK6A 4JDPA 3RJZA 1RJDA 4ERNA 4D57A 3GPCA 5IBQA 1XZ8A 2JW5A 1OAAA 4L6CA 1YR7A 2XH8A 3TGLA 1VE5A 3D8UA 3RHFA 3GRAA 2VZ9A 3VZCA 3NHZA 3F6YA 1AD2A 4OYHA 4WA7A 3MCUA 1TL7C 3VGPA 3JQCA 3ZLJA 1XZHA 2QVYX 1QXSA 1YS7A 1LSJA 4OKIA 3CPEA 2H63A 4R7GA 5KVAA 3HA7A 4MJLA 3VNAA 3BJMA