4B8WA

Crystal structure of human gdp-l-fucose synthase with bound nadp and gdp, tetragonal crystal form
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
319
structure length
319
Chain Sequence
NLYFQSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Gdp-L-Fucose Synthase with Bound Nadp and Gdp, Tetragonal Crystal Form
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords GDP-L-FUCOSE SYNTHASE
total genus 103
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4b8wA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 4b8wA02
4CUJA 1HDOA 4J43A 4YAEA 1ML3A 1D7OA 4LRSB 4J1NA 4QFDA 5FYDA 1WP4A 4GSLA 3Q1LA 4IZHA 4FD3A 3RUCA 3H2SA 2D0IA 5ENVA 1AE1A 1IHXA 3ULKA 1NXQA 5B4VA 3LU1A 4MO2A 1JWAB 3BMNA 3WYEA 1LC0A 3JSAA 3D1LA 3ETEA 3TZKA 4DPLA 1VKNA 2VTEA 1MV8A 1PZFA 4I8XA 1E1KA 2GDZA 3NUGA 4KUGA 4MP8A 1GTMA 1ENZA 3GZNA 4E21A 4K6CA 1ZEJA 2EJWA 2NVWA 3HDHA 3HDQA 1DRUA 5JFOA 4XD2A 4P22A 2VWPA 4GGOA 1F17A 3WBFA 3DHNA 4CODB 3OECA 3PDJA 2OO5A 4GWKA 4AJOA 1NFRA 1PWXA 1C1XA 4J1TA 5FWNA 4DUPA 4JP2A 4YVFA 4IQ8A 1F14A 4BNWA 5I7VA 4ND2A 3DC2A 4PIVA 4IJUA 5BR7A 3GDOA 1K6JA 4F46A 1BMDA 5T8KC 5G2OA 5THKA 4AFNA 3H5NA 1U4SA 4UVGA 4ID9A 3W4IA 1GEEA 2O50A 2J5RA 3GHHA 4K9DA 1V3UA 4R4JA 1HKUA 5FI3A 1SMKA 3BZUA 4JGBA 1UP4A 3ZWWA 3F6YA 4S3MA 1SNYA 1E7YA 1W73A 3MZ0A 2FPIA 3WNVA 4RQUA 5TX7A 3TSCA 3WGIA 1V9LA 5JMPA 4B4WA 1XHLA 3GGOA 3WG9A 5B12A 3K92A 1B15A 1HT0A 2YDYA 5DT9A 4E30A 5AOVA 3OJOA 3ZWBA 3F4LA 1SC6A 4JJIA 1T2EA 4MVJI 5GY7A 2C07A 2DU8A 3SLKA 1CF2O 3DMTA 3DOJA 5CP8A 4A73A 4GMFA 3PK0A 1K2WA 4O59O 4CR8A 1F0YA 4TVBA 5JC1A 2Y1CA 2JCYA 5ENDA 2DTXA 2HAEA 2R00A 4GKVA 3CH6A 3DBVO 3V2HA 4L75A 4FOOA 1B7GO 4L74A 4OSOA 4M55A 2VT3A 3DWFA 4FDAA 5L7TA 5IDXA 2HK9A 3HQ4O 4EGFA 4XGIA 3BHMA 3WBBA 2IRWA 1MG5A 3QWHA 3FBTA 2FZWA 3OQBA 5L45A 1Y1PA 1H0KA 2Y67A 3TZ6A 1Q1NA 2DFVA 1A4UA 5G4KB 3PRJA 4TSKA 3FPLA 1UDAA 2A35A 3KEOA 2C29D 4W9NA 5FF9A 1KS9A 1WAMA 2WMDA 3UH1A 4HV4A 4YXFA 3I6IA 3QA9A 2LDBA 2BLLA 3ANLA 4D46A 1BSVA 1ZK2A 4G2NA 1EFKA 3VZQA 1HF3A 2OFPA 4XZ3A 5JDCA 3FSRA 3SLGA 3MWEB 1GUYA 3ETGA 1PL7A 1P1RA 1SAYA 1WVGA 4FJ1A 4YAGA 4YT2A 5JMWA 2NV6A 2V65A 3C7AA 3HN2A 4ND5A 3C3XA 3AOEA 4L0QA 4RPHA 3S2FA 2O3RA 5FEUA 1I32A 3Q2IA 1GCUA 2BF7A 1G0NA 3AU8A 4ND4A 4CQLB 1BXGB 3GVXA 3U4DA 4J2OA 3TNLA 2CVZA 5CG2A 3DFUA 4J7XA 3RFVA 2JCXA 3DZHA 5U4QA 4L4RA 2GN6A 2CMDA 4RPGA 2GSDA 1ZK0A 2H63A 4BGUA 1TB4A 1GADO 4JJFA 2B4QA 3C1OA 1H6BA 1NFQA 4NPCA 4JX8A 3TFQA 1HE3A 4PG6A 2VHYA 1IL0A 2J3KA 3DZKA 2OP1A 5CDYA 4E5KA 3DBHB 3EW7A 2HK7A 4Z3KA 3TJRA 2J3HA 3NTOA 2SCUA 3U62A 2LDXA 4LVCA 5C7IO 4F6CA 1TT5B 5EMHA 3SC4A 4CQMD 5AXAA 4EUHA 4FOSA 4NJMB 2WE8A 1ADBA 4D0SA 2YZ7A 1ZXLA 2I65A 3GZ4A 4RZIA 3ZHYA 5LCXA 1CJCA 2CVOA 4A7PA 4KDEA 3PIDA 3T7EA 3D64A 4BNIA 5HS4A 3HWRA 1DJNA 5JCJD 3QE3A 1E5QA 1ENYA 3NAQA 1NQ5A 3HUDA 3FWNA 1U1IA 3FTNA 4RGBA 1EBUA 1K5HA 1U7TA 1O95A 1U7HA 1B26A 3WLFA 4D0RA 1XG5A 4FCCA 5DBGA 2F1KA 5HTOA 4MVJM 5IZ4A 2B83A 3JQGA 4TWRA 3KYCA 4M89A 3A28A 5F5NA 4AICA 4OIMA 3U09A 3PWKA 1A9ZA 3VPSA 5L51A 4QT0A 5JDCC 4U5QA 3TL2A 1XR3A 1Y5RA 1PIWA 4B4VA 5G4LA 4DBVO 2RHRA 4AL4A 2HDHA 4RCVA 4M8SA 1SPXA 2OHXA 4IIVA 2VZ0A 3RUEA 1HDCA 3CEAA 3WYBA 1X7GA 4D3SA 3RD5A 4BB5A 4I1IA 4K1LA 3SX2A 3OEYA 3LF2A 1A72A 1ONPA 4L9RA 1T1SA 3UCFA 4DMMA 3E18A 4BQRA 3ADPA 4BNVA 1V6AA 3LSYA 2EF1A 4CMKA 2O2SA 3DB2A 4RVDA 4DQVA 4CUKA 4W7IA 1I2BA 1MXHA 4NNJA 4CMCA 4OHUA 1J49A 4HXYA 3I4FA 1HL3A 3AFMA 2ZKLA 5A9SB 1LRLA 1Y8QA 3DBRA 4EUFA 2A94A 3ANMA 1LDGA 3F47A 4IJWA 1N1GA 1UJMA 3P5SA 1MX3A 4J7CA 4R01A 3ZW8A 4DXHA 4XR9A 5U9CA 4TZTA 4PG8A 5BSEA 1MLDA 1BXZA 1E0DA 4GVLA 5COBA 1DJQA 1RM4A 4WK6A 1R4NA 1HSZA 2V6BA 1UZMA 3JQ9A 1E3WB 2HMWA 1U3UA 4RLSA 4RV9A 1ADGA 1QG6A 1Y9AA 5DDIP 1E3SA 1W6UA 2DVMA 5EESA 2HMVA 2PKQO 2C0CA 4Q3EA 1QLHA 1ZW1A 3RVDA 3VPXA 1I3LA 3ZWXA 4IIUA 5CG1A 4M86A 3ZU5A 3KSDO 4YA6A 1JN0A 3A1NA 1IYZA 4XB1A 5B37A 3ENKA 2ZJ0A 4OKNA 2EP7A 4PGFA 3RFXA 2DLDA 1HZZA 3DBRB 3L0DA 3N7UA 3K2EA 4W99A 3DAPA 2C2XA 2FPPA 4BO1A 4GBJA 5CEJA 5KCZA 3ZN2A 1KVTA 4URFA 2WYUA 3DZBA 3NDIA 1TT7A 2VNAA 4C7KA 1BG6A 1MFPA 4Z0TA 5ILGA 3IOYA 3QWAA 3ASVA 4QECA 3ZCXA 1MUUA 3AY3A 1I2ZA 2X23A 2FSVA 1SB9A 1NAIA 4CM4A 1VPDA 5TNXA 3BMQB 4OL9A 4U8GA 1X1TA 3JQBC 3M6IA 1YOVB 2PFGA 2IZ1A 2PA3A 3H65A 3JQFA 3OA2A 4NBRA 4PLTA 2I67A 3DFZA 4WCFB 3RFTA 3ETDA 2ZCUA 1DIHA 5CDGA 1U5CA 2YFQA 5KWEA 1X7DA 2B69A 2YQ5A 3RUIA 4OQZA 4GPD1 3RROA 4NJMA 3ZDFA 4YT4A 4FFOA 1PQWA 3ZWNA 3AUAA 3FBGA 3KOUA 5B1YA 1NYTA 4Z3DA 5THQA 3GN1A 3DBLA 2P9GA 4CLXA 1NVMB 2DBZA 4EITA 2ZQZA 3TOZA 3LLVA 4IGFA 1GZ4A 1G0OA 1NR7A 4RPKA 3JD3A 3JQBA 4CLDA 2DBVO 3OIGA 1WNTA 4ALKA 3UVEA 2BGMA 1GQ2A 5I7FA 1ZSYA 1JA9A 4IMPA 3X2FA 1I24A 1KEPA 3WJ7A 3DZFA 1UZNA 4CLOB 2CDCA 4AG3A 2F00A 2EEZA 4FFNA 4KWIA 4MVJF 4ZRNA 2PZLA 3PZRA 3K6JA 3QWBA 4FIZA 3GNQA 2FN7A 3OIFA 4HFNA 4NBTA 3LC2O 4LW8A 1JKJA 1PEDA 2PNFA 4P4NA 3ZI0A 1OFGA 2FR1A 1JLLA 2W2KA 2GZ1A 2FMUA 2Q3EA 3AUSA 4CQMA 4DBZA 2GN8A 4Y6PA 2PTGA 3CSDA 1FJHA 3JQEA 3GVIA 4BO9A 2FPGA 1KERA 3K73O 2C59A 3BA1A 3ZWOA 2CZCA 1YGYA 5A05A 5TF4A 4PLZA 2RBEA 3LF1A 1W0CA 1H5QA 3GPDG 1P3DA 4XKJA 4LSWA 3V1TC 4B4UA 1HETA 1I2CA 4FFLA 1Z7BA 1YL7A 4FC6A 3ZV5A 2PK3A 3T7CA 1E5LA 4WEQA 9LDTA 1YB1A 2I5PO 4R51A 3JQDA 1T25A 5IF3A 1UP7A 3CTMA 4P38A 2IZ0A 1IY8A 2UAGA 1AHIA 5CPBA 4ZVVA 3CKYA 3EC7A 3GZNB 5T5QA 1MC5A 1G1AA 3LT1A 1E7MA 2O3QA 1FDVA 4QX6A 2AMFA 3GMSA 4YJFA 5F1OA 4INAA 2QG4A 3PQDA 3FF4A 5BNFA 5EQDA 1BVUA 1C1XB 4MKZA 4EW6A 4DIOA 1U3WA 2NADA 2HJRA 2Y93A 1TI7A 4HBGA 3L07A 3V2GA 4BO7A 3MJCA 3PFFA 3UUWA 1GEGA 1B3BA 2GNAA 4A5OA 4N18A 5C37A 4OAQA 3PJGA 2GD1O 1EVYA 2QQ5A 3FNFA 2O4UX 4FGWA 2Z1MA 2NTNA 2H6EA 1YDWA 2G5CA 2GRAA 4WECA 5DN9A 4D44A 2WYWA 1C0LA 2ZB8A 1PZHA 1KYQA 3JD1A 3LT0A 4P4LA 3PGXA 3DZIA 4WE3A 1Q2XA 4UAGA 5JLAA 2BGLA 2OUIA 4UREA 3GQVA 2PH5A 1BDBA 1F12A 3NJ4A 4KOAA 2A9FA 5BQFA 2H9IA 1KETA 2I9PA 5EN4A 2UV8A 4Y6RA 1PJQA 1LLCA 3TQHA 3VKVA 3VPFA 3WFIA 8ADHA 4UEJA 3GRPA 3OA0A 2Y99A 3FNEA 4XRRA 4YR9A 1BWSA 4NR0A 4FFRA 3H5RA 4QXMA 1UXHA 2YUTA 4UUNA 1J0XO 1P33A 4II2A 3WTBA 4FFPA 3LDHA 3D0OA 4YJHB 3QJ5A 4IDDA 3VZSA 1OOEA 3I4CA 4BNYA 2ZYAA 3HZZA 3PLNA 5TT1A 3ZWAA 4CMAA 1HYEA 1TT5A 3OMLA 4D42A 1W8DA 2I99A 1NM5A 3EVNA 3TZQA 3OJEA 3CMCO 1C1DA 1PR3A 5IXYA 5IXSA 4NQZA 2VZ8A 1EEHA 2GLXA 2EKPA 4MIOA 1SOWA 4RPJA 3VDRA 3PYXA 4TRJA 4O1MA 3WTCA 3ZWVA 3GUYA 4II3A 4W4TA 4CUZA 4BL5A 3TN7A 4IMRA 1YQXA 4ND1A 3S2EA 1XELA 4BNGA 1B2LA 2QRKA 4LMRA 3V1UA 1T1RA 4Z9XA 1NQTA 2YFHA 1DSSG 1LDEA 1PGQA 3MJEA 2Y66A 4I5FA 1X0XA 2D5CA 1NTOA 1DAPA 2EERA 3OH8A 4CMIA 2FR8A 3WB9A 4Q3NA 1PS9A 2AA3A 2VNSA 3HJAA 3GVCA 1DFHA 1ZK3A 1ZNQO 1ZVMA 3G79A 1LJ8A 3KLPX 4IDCA 1YQGA 2XXJA 1N5DA 2VT2A 4BS9A 3BMCB 1KEWA 4OO3A 1Q0QA 1BHSA 2HSDA 3HG7A 1EVZA 3H9JA 3B1FA 3D5TA 4GAEA 4XDYA 3IC5A 3JYQA 1VKOA 2NU9A 3H9GA 1LU9A 1DC4A 2DTEA 3M1AA 3DMYA 3EHEA 3JQFC 3NYWA 3HNPA 3NGLA 5IZCA 1LXCA 5JCJA 2J3JA 3E03A 4R1UA 1T26A 1LDNA 1DAOA 2BKAA 1HDXA 3UXYA 4NBVA 4R3WA 2GO1A 1K6IA 1XQ1A 4J9VA 5IN4A 3RC1A 2UUPA 3F1LA 4L73A 4K6FA 5JS6A 5HM8A 2PWZA 1D8AA 7ADHA 3BMNB 1H9BA 1JAXA 3L4BA 4IJVA 1U8XX 3E8XA 5JE8A 4MIEA 4Y67A 1QSGA 4BOYA 4J6FA 3FR8A 1EUDA 4PVCA 1BXKA 1A71A 4YT8A 1LNQA 1P1JA 2NACA 4HP8A 1XU7A 4F3YA 4YPOA 4YJGA 3V8BA 3X2EA 3H4VA 2NUAA 1MG0A 3IJPA 4I9HA 2QX7A 3ZHZA 3N58A 3WGTA 3WMXA 3HDJA 2E37A 1HXHA 3LZ6A 3WGQA 4NFHA 2VHWA 3DL2A 4U0KA 4EZBA 1N9GA 1HE5A 4PLGA 4QSMA 5JY1A 1LUAA 2O23A 4J9UE 1PJLA 1R6DA 1VL0A 3BYZA 3C8MA 1RM5A 3ANNA 4NI5A 2VUSA 2ZYGA 2NU7A 5JDIA 5DOZA 4E33A 2J8ZA 1MP0A 4DLBA 1ENPA 2PKQP 2Q99A 2X22A 1GYQA 3GG2A 2NWQA 3HFSA 4DQXA 5KNLA 4OH1A 4GLLA 3D5QA 1P74A 5EPOA 5K0ZA 2J3IA 1UZLA 3W8FA 4AJHA 2ZB3A 1QRRA 5TSDA 2IEBA 2QIOA 1EFLA 1O0SA 3ZWMA 4C4OA 2OZPA 1BRMA 1PZGA 4FN4A 5JAMA 4H3VA 4GGPA 4J1SA 4EDFA 5DULA 2I3AA 3H2ZA 3M2TA 3I1JA 3I9MA 4BNJA 3NDRA 4U6SA 3BMOA 4ZQHA 3VH3A 2QZZA 4H7PA 3C85A 3KZVA 4JBHA 3GK3A 2JD2A 5EERA 2DUWA 5BSGA 1WDLA 3OEWA 5L3ZA 2HK8A 1FXSA 4W9NC 4YJDA 1PJBA 5TIIA 1PGNA 4YJFB 1E3IA 5KJ6A 1A7AA 2GZ3A 2GGSA 1UAYA 3KB6A 4BNTA 1ZMOA 2EHDA 2HO5A 1VSUA 5JAIA 3I6QA 4WNCA 2WD8A 1R0KA 4WPGA 4CMBA 2HU2A 4N5LA 3JYOA 2AQIA 4E31A 3OSUA 5JAQA 3ZWCA 5KVSA 3K96A 4MKXA 3GN2A 4RVGA 4Z9YA 3W1VA 4IY1A 1GUFA 4ZICA 5GZ3A 4I5EA 4L8VA 1QORA 3F4BA 3MTJA 5A02A 1CDOA 1VC2A 4CLRB 4M49A 3JQAB 4RO0A 3QQPA 4G5HA 2CFCA 5ICSA 2V6MA 2JHFA 5AXCA 4B3IA 1C0IA 3F9IA 4N7RA 3E9MA 4R5HA 4BO3A 5L95A 4AJKA 3D4PA 3WSWA 2D59A 3ST7A 2NQTA 1HYHA 4XEHA 4MVJH 1K3TA 5A9TA 2XAAA 4B7XA 3TL3A 2CDAA 4D43A 1Z73A 4MOWA 1K89A 3AW9A 1PL6A 1P1KA 2DQ4A 4PLWA 4Z0HO 1RM0A 4RF3A 3BIOA 4A26A 1SOVA 1YB5A 2HLPA 2NM0A 4YDRA 2C20A 3VC7A 4RVFA 3DOCA 4AJNA 1LRJA 1A7KA 1R15A 3BTVA 1BTOA 2BH9A 2NLOA 1QYCA 3Q0EA 2V6FA 2CNBA 4ONEA 5KJFA 5KVQA 5L7WA 1E3EA 3IKTA 4DIBA 3WR5A 4CL3A 3FR7A 5G0WA 2D3TA 4LMPA 4BNFA 3DBHA 3RAJA 3JQAD 5DCWA 4FPXA 2TMDA 3DZGA 2VCYA 3K9QO 2IYPA 4ZQEA 4MJLA 1R12A 1PJCA 3B20A 4KDFA 1T24A 2ZYDA 4IDGA 4NK4A 4GH5A 1Z45A 4E2YA 4CV1A 1LA2A 1Q0HA 4CM4B 4EEZA 3KO8A 2W2LD 4B4OA 2WTBA 2EXXA 3MWDB 2Y1DA 3H8VA 3E9NA 5A3VA 4HY3A 3DAFA 2QW8A 2PY6A 2I76A 2QZ9A 1ZJZA 1ZIDA 1I3KA 2EGHA 2Q4EA 2VZ9A 2OORA 4I08A 4E3ZA 1HE2A 4HFJA 4HNHA 1GV1A 3A4VA 5F5LA 1HLPA 4JBGA 4J16A 5FI5A 1DLJA 1LBEA 1ZH8A 3MTGA 4B3HA 5JO0A 1DFGA 4LK3A 3I52A 2ILTA 4R69A 4WCDA 2OOSA 1DB3A 4F45A 3S2IA 3U5TA 2XOXA 4XYMA 1WLYA 4W7HA 4DYDA 3ON5A 3PFWO 3E5RA 5F3RA 3UW3A 2W2LA 2CF5A 5T67A 3V1YA 5G0UA 1NNUA 2ZTMA 4WKGA 2IZZA 4RVUA 3GGPA 2AG5A 5ER9A 4YAIA 4E0BA 4DPMA 2I66A 5CEEA 2FRDA 4DMLA 3G17A 1T4BA 2Q1TA 4Q39A 5F1PA 1UXJA 1C3VA 3O03A 5EJ2A 3B70A 3NT4A 5KVVA 3JQAA 2CVQA 3GAFA 4R9RA 4BUCA 3CMMA 4PLFA 4CMGA 3IMFA 1U9JA 2B36A 2PGDA 3UKOA 4DREA 4U7WA 4BV8A 5I7EA 5COQA 1AUPA 1DFIA 3P2YA 1I36A 5DCYA 2O3UA 2EKLA 5GZ6A 2NTJA 3U4HA 2WYVA 4CM3A 3RJ9A 4WCFA 3SEFA 5F21A 1FDWA 4YAJA 4CMEC 2I6TA 5GZ1A 4BNMA 2W98A 2A4KA 1DIAA 2WEKA 2GPTA 4MKRA 1WPQA 3ROPA 2VQ3A 1K6XA 4UUPA 2RH4A 3VKUA 3FCOA 3NEPX 2DFDA 3MJVA 2VHVA 2FY8A 2O48X 4OM8A 4OOEA 2WSBA 3L77A 3JYNA 3DTYA 4Y9DA 5KVCA 1WZEA 2WE7A 3AM4A 3OP4A 4HNGA 3L9XA 5G4KA 1LC3A 3UAGA 4BIIA 1NVGA 4ZRMA 2NVBA 5KJEA 4GQAA 3C1TA 3I9OA 1EUCA 5CDSA 3SJUA 4A03A 9LDBA 1E7SA 5AXDA 4AJJA 3JD4A 1Y7TA 3GY0A 2Q45A 3DONA 4PLCA 4ILKA 3RKRA 2Q46A 2JHGA 5AYVA 3BAZA 3GVPA 3HHPA 1VRWA 4NFYA 4ND3A 2B5WA 4J91A 4CM8B 2C7VA 1L7DA 3KYDA 3VHRA 1WWKA 3P19A 2Z1NA 3KEQA 3KETA 5C3MA 3G49A 4QUKA 2JFGA 2JL1A 4ALJA 5K9ZA 2Z5LA 1JDJA 1YH3A 3AM5A 4KZPA 2BRUA 5A1TA 1ULUA 4RORA 1MXFA 1N7GA 1OBFO 4KMSA 3WIEA 1YJ8A 1P45A 3LC7O 3D3WA 2X0JA 1LEHA 2ZJ1A 2E4AA 3WGOA 5KOIA 2AQ8A 4L76A 3TZCA 5U1PA 4DIFA 3ZV3A 3A9WA 2YJZA 4MINA 2J6IA 3PPIA 3WWZA 1I3NA 3EZLA 4R68A 3CUKA 1N8KA 2G0TA 2YHIA 1P9LA 1DRWA 2X6TA 3OIDA 3QVSA 1SB8A 3AJRA 4PZCA 4WLFA 4BMVA 4ZN6A 5CAEA 1DIBA 3VH2A 5KKAA 2AQHA 1U3TA 2BMAA 4QQRA 4IDFA 1HE4A 3E6AA 3S2GA 4XQEA 1T2FA 5ICMA 1V35A 4HUJA 3B1KA 1Z6ZA 1M2WA 2RHCA 4CM9D 4KQXA 5LDGA 1P1FA 2PZKA 1LDYA 4TZKA 1D4FA 1O89A 1PS0A 4YT5A 1N7HA 4DQUA 5TJ9A 4NHEA 1NWCA 1RYDA 2C5EA 2YV1A 4IINA 3VZPA 5TT0A 2O7SA 1RKXA 5HBRA 3PQEA 1IE3A 4D79A 1SEPA 1AN9A 1NPDA 4UVIA 3RUAA 1P0FA 2X9GA 2FHSA 3Q9UA 5AVOA 4ZD6A 4YB8A 3JQ9C 4RPLA 1YBMA 1JU9A 1E6UA 1HDYA 3C7DB 5A9RA 3OICA 2P5YA 1PSDA 4DL9A 3ROKA 3ZU3A 1EVJA 3FHLA 3AOGA 1G6KA 4FR5A 2HRBA 4DRYA 4YCAA 1ZFNA 4W82A 4JNKA 4OGWA 2BHLA 1JVSA 3PEFA 1R37A 1LDMA 3STHA 2VWQA 3ZWPA 3O8QB 3AI1A 5DBIA 2E6UX 5TGDA 1GYRA 1VM6A 1A9YA 1JW9B 3I3OA 1DDOA 3G3EA 3FNGA 1JVBA 1O8CA 1GY8A 1ORRA 1H6AA 3H5AA 3QVTA 2R2GA 3DEYX 5A5FA 3QP9A 3NV9A 4TMFA 2P4HX 2WM3A 3LVFO 1A27A 1ZSVA 4YRAA 2Q4BA 1KIFA 3GFGA 1V0JA 4AJIA 2EW2A 4BHTA 4KUHA 3WFJA 3FN4A 3G1UA 4IDBA 1X1EA 1XKQA 1Y6JA 1WDKA 4IJKA 4IQ0A 4WCFC 2PR2A 1NFFA 3C1AA 4NU5A 3ZV6A 4CV3A 1FK8A 1DC5A 1S6YA 4CR7A 3S8MA 3KV3O 2DPHA 3PIIA 4J0EA 1JTVA 4LCJA 1J6UA 4YBZA 3LC1O 4BNUA 3K5PA 3TWOA 4DTIA 1PJSA 5A4DA 5J23A 3CINA 3E1KA 1SCUA 1T2AA 2JD1A 4R1NA 4RDHA 1LQTA 4E6PA 1CRWG 3HE3A 4U6QA 4XR4A 4BB6A 1E6EA 2GUGA 2ZATA 1RPNA 3AM3A 2PKRA 1SBYA 4GVXA 1EBFA 2O3TA 1PJTA 4E5NA 1YVEI 5IJZA 1OMOA 5JXWA 3D4NA 2Q2WA 3U9LA 2DUUA 2VYND 1XEAA 2GZ2A 4HFMA 1R0SA 4AVYA 2HKIA 3QHAA 3VPGA 1H9AA 1O9BA 4PN3A 1L7EA 3GT0A 1DHTA 4BO0A 6ADHA 1KBZA 1H6DA 3BTOA 3PYMA 4XYGA 5JO9A 5FFFA 1CIVA 2CUKA 2W8ZA 4WUVA 3PGJA 3JD0A 1YWGO 1ZBQA 2CF6A 2AQKA 5H83A 4YJGB 1VJ0A 1ZK1A 1KEVA 3ORFA 4PLVA 4R1SA 1E1NA 3MJTA 3QW2A 2X5JO 1OI7A 4BNNA 2HQ1A 2X0NA 3F5QA 5DF1A 1N2SA 1AGNA 3NTQA 4MVJE 1Q7GA 3QVWA 4GL4A 1P1HA 2WD7A 1TEHA 1TLTA 1LLUA 3HADA 2B4TO 3TPCA 3OBBA 1HDGO 3QWIA 2IE0A 3INGA 4D3DA 1IZ9A 4H16A 1PL8A 4XIJA 1LSOA 3O4RA 1JAYA 4WOJA 5EINA 1PX0A 2YV2A 4IS2A 4IGEA 1XYGA 2W4QA 1XGKA 1CEQA 4CV0A 5DCUA 4DWVA 2TMGA 4MVJG 4UVEA 1VI2A 5ER6A 3FNHA 4K26A 2GYYA 5BT9A 1A4IA 2JKVA 2VUTA 5JY6A 1QYXA 1T4DA 1Q0LA 5L7YA 3GA0A 1WMBA 4WJZA 3HB5X 3KSZO 2O4CA 3UICA 3JYPA 3L4SO 4JJGA 4CMJA 5JC8A 4CR6A 3MOGA 5A04A 2GN9A 3HN7A 1LQUA 2X5OA 2YW9A 2IXBA 2P4QA 3FI9A 4JIGA 1IULA 3AWDA 3WX0A 5L40A 2VHZA 5C7OO 1NASA 4J3FA 3HSKA 4MP6A 4XGNA 1SO8A 4PG7A 4Z0PA 3GH3A 4NIMA 2AHRA 1R4MA 5TRTA 5B4UA 1PWZA 5A3JA 1M66A 3PDUA 1GAEO 1XSEA 3E48A 3R3JA 5CPFA 3GUCA 4QO7A 2DAPA 5L4LA 4KQWA 4JROA 1U28A 4LISA 3WGYA 1EQUA 3UOGA 1ZCJA 4A27A 2DPGA 1B0AA 3MJSA 3AUTA 3GGGA 3PVZA 1P31A 2UVDA 4MP3A 4UUMA 4R16A 5BNIA 3PLRA 4OYRA 3WXBA 5ADHA 2B35A 1RJWA 3W8EA 5BSHA 4B8WA 5L53A 1I30A 1LLDA 1ULSA 2HCTA 3M1LA 2ZCVA 4UULA 1RWBA 3AY7A 5K6AC 2Y1EA 4ZA2A 4KTTE 1XLTA 2JAPA 1CWUA 2VYNA 4PCVA 4D7AA 2ZK7A 4BO2A 1ZKMA 5I9MA 3INRA 1X7HA 4EEXA 1XDWA 1Z75A 4Z9FA 4E2XA 2VN8A 1GYPA 1DOHA 4ALLA 2NU8A 2VHXA 2IYOA 5HA5A 2RIRA 1DO8A 2PZJA 1RM3A 4EBFA 3DXFA 5LDHA 3TDKA 3IS3A 2W2KB 4CQMB 1HSOA 1B16A 4MVJP 1VE9A 1LSUA 1GFSA 4TRMA 4CJXA 2AE2A 1LRKA 2ZTVA 1E1MA 1OAAA 3ABIA 1ADCA 2VRCD 5JYEA 5DBFA 5AXBA 4PRLA 2HMTA 4WEOA 3IIEA 4PG5A 1TVEA 1JWBB 1GV0A 1Y8QB 3IDSA 3OF2A 4YTEA 4FJ2A 1YOVA 2FSSA 2X5KO 1CERA 3UFXA 1E7QA 3ADOA 5JYDA 2FP4A 4WLOA 2PD4A 3D3EA 4R5MA 3F3SA 1YQDA 2G17A 4HADA 1YBVA 4KTVE 3DBLB 3QVXA 3G0OA 3GC6A 3ZV4A 1U3VA 1DLIA 2OGUA 1IHYA 1KVSA 2C2YA 3DDNA 4EJMA 5JAZA 3UCXA 1U5AA 2VOJA 1AXGA 3L6OO 4EI2A 3K30A 1ZMTA 2EWMA 5IG2A 2RH8A 4EJ0A 1B8UA 4J2HA 4I5DA 5T8KA 5JSFA 4BKQA 4FQ8A 1D1SA 2Y05A 1ADFA 1QV6A 5CHEA 5HS6A 3JQ7B 2D1YA 3EGOA 4AJPA 2CDBA 4DLLA 5A06A 3W6ZA 3W8DA 4D41A 3L4BC 1NBOA 4UUOA 1CQIA 2X1HA 2YV3A 3SBOA 3CZRA 3COSA 1P77A 3LT2A 4LSMA 3OJFA 4IM7A 4BO5A 2POQX 5CDUA 1WW8A 1DRVA 4HFRA 3EYWA 3PHJA 3RSHA 3DQPA 4KP7A 1SEVA 5JPIA 1O6ZA 1VLLA 3T4EA 1QYWA 5AQ1A 1J5PA 3L6EA 3CPSA 1YJQA 2P91A 4NBUA 3JV7A 5L4NA 1BVRA 4HKTA 2BFAA 3V5NA 1NX6A 2X9NA 1AXEA 4XDZA 4ITUA 3KRTA 4ALIA 4CMIB 1BW9A 1YO6A 3OQ6A 3KHUA 3QSGA 4WLUA 4CLOA 2X86A 4ROSA 5JCXA 2ZB4A 1LX6A 3P7MA 3AFNA 3H7AA 1Y5MA 3GMDA 4MVJD 1P44A 3E5MA 4BNZA 1WXDA 2Q2VA 4XB2A 1N1EA 4ESOA 3PWZA 1J4AA 3IP3A 4CPDA 1L1FA 4XJSA 1EK6A 4E5MA 3GDGA 4G65A 2XXBA 4E5YA 5I9LA 3E82A 4IDEA 1C1DB 4BNXA 2XPCA 4J49A 1OC2A 5JBIA 4P4GA 1ONOA 1X15A 1EE2A 4IZIA 5T6BA 1I33A 4CMHA 3WS7A 3FD8A 3RIHA 4UEOA 4XA8A 3U4CA 3GG9A 3NT2A 1F8GA 1YE3A 4FFMA 4CM7A 1HLDA 2WDZA 3IP1A 5A9SA 2DC1A 3DHYA 3VH1A 3QIVA 3U49A 2C82A 1KY5A 4DVJA 3SJ7A 3KYCB 1GUZA 3MOIA 3WGZA 3WDSA 1JKIA 3ASUA 3P2OA 2GR9A 1HZJA 3AOEC 4I5GA 4R54A 3EZYA 1ISGA 4TROA 1ISFA 4RF4A 3GEGA 1I5RA 3INTA 3RI3A 1LLQA 1PR9A 1PZEA 4DYVA 4FB5A 3GHYA 3PI7A 1EK5A 4XJTA 4WLNA 2QYTA 3S1LA 1UAGA 4RLHA 3QLJA 4QTZA 4ZQGA 3KSUA 1NWHA 2I3GA 4N5NA 3RBZA 4DLAA 3ZZNA 1DHRA 3OETA 2O3JA 4BNKA 1CQJA 5TC4A 3VAZA 1UUFA 3F1KA 3WQSB 1H94A 4XYLA 5KJCA 3EAGA 4DC1A 1H2HA 3JTMA 2FWMX 3RUFA 1KOLA 1HDZA 1HEUA 2OXIA 3BHJA 2YY7A 4YRDA 3OJ0A 4LRTB 4GX0A 3KTDA 3VZRA 3ROMA 2Q1WA 4DGSA 3ZNPA 3ONEA 2D5AA 3PXXA 4M1QA 2B4RO 3NRCA 3TRIA 3LT4A 1PU2A 3QY9A 4E12A 2X0IA 1ZK4A 2EGGA 1ZUD1 4BO4A 4UEKA 5CDTA 3IKVA 3PHIA 3S55A 3RU7A 4JLWA 4YWJA 2G76A 1E6WA 2BD0A 3NDJA 1LTHR 4XQGA 1W4ZA 1ISJA 3AI2A 3WOHA 2R00C 5KIAA 1R4MB 2C5AA 1U8FO 2NVUB 4AJEA 3ZHXA 4IBOA 4BO6A 3IUSA 2O2YA 1KC1A 1UXGA 3NTRA 4QEDA 4ALNA 1KY4A 3NJ8A 4L4XA 3ONFA 3RU9A 1M67A 2Y1GA 3F46A 1ONNA 4AJLA 4BVAA 5ITWA 3O8QA 4WNIA 2HJSA 3GDFA 3RC9A 2DBRA 4BGVA 3BMCA 2O7QA 2E49A 1YDEA 4B7UA 5BNTA 4CV2A 2HMUA 3EK2A 1D1TA 2ZTUA 1PGPA 2NTVA 4Q3BA 3JCZA 4TKMA 4JN6B 5EIOA 5IFLA 1Y8RA 2J5KA 1EDZA 3FPCA 4NK5A 3EY4A 4PLHA 4RJTA 3ZW9A 3MJ4A 3KVOA 2OL4A 1IOLA 1WZIA 3Q9NA 4GMGA 3RUDA 1NHWA 5G0TA 3U3XA 2QYSA 4TQGA 4BO8A 4XCVA 2B0JA 4IXWA 3N74A 3ZNQA 1FDSA 4YRBA 6LDHA 2DM6A 2X4GA 3PYLA 1V3TA 4KWHA 2ZIZA 1TXGA 4OQYA 4U0JA 5TS3A 5B4TA 4XQCA 4JP3A 2AW5A 1E7WA 4FJ0A 3UHAA 2PZMA 1VSVA 2G82A 4LCEA 3W4KA 2JFHA 3PJEA 4CQLA 4UVHA 5K6AA 5DZSA 4BNHA 1WDMA 3BHIA 2NQ8A 3H9QA 2DBQA 1NPTO 2P5UA 3WIDA 3EUWA 4ZQBA 2AEJA 3GOHA 1GU7A 2V7PA 4NFSA 4GKBA 2YHUA 1A5ZA 2GCGA 2NSDA 3JQ6A 4ZGWA 1GPJA 2VYVA 3TZHA 5EL0A 4Q3AA 4CMEA 4E5PA 4CM5A 3SXPA 2X9VA 2XF8A 1PGOA 1VL8A 2X7HA 3KBOA 3GFBA 5I8ZA 4Y8VA 5JDIC 3GR6A 1LI4A 1DEHA 2CY0A 1M6HA 1GQQA 3ICCA 1RYEA 5CFZA 2WD7B 3CE6A 4YAKA 4IUYA 1NVTA 5A5EA 1YB4A 2Q1UA 1NP3A 3WGHA 4A10A 1E3JA 4GX5A 4JBIA 3R6DA 1YONA 4CM9A 2EW8A 2VTDA 5MDHA 4DC0A 4PRKA 1R16A 4KUEA 1PJ3A 3WQRA 1IB6A 4G81A 2Q50A 4AJ2A 1H6CA 1B14A 4WASA 3IAHA 4BKOA 2AXQA 3HFGA 3NGXA 4OXYA 4WOKA 1XWFA 3BTSA 3KUXA 1E7RA 4ZHSA 1YKFA 3D7LA 2FR0A 3DAGA 3K31A 1I10A 3Q11A 4IPTA 4GWGA 1XU9A 3ITKA 2VRCA 5DP1A 4PZEA 1EUZA 3TFOA 4Z6KA 4E13A 4BQPA 1HYGA 1Y9EA 4RF2A 2PLAA 4N5MA 3V2UA 1H2BA 1VJTA 3I9NA 1Y8RB 3H9UA 2VUUA 2BFMA 2Q1SA 3ITDA 2A92A 3AY6A 4UVDA 1DIGA 1M6WA 1QYVA 3RBVA 3ZGYA 4ALMA 1QKIA 4BMSA 5IZCC 1DXYA 3H3FA 2E82A 1GD1O 4BGEA 3EDMA 3IJRA 4NG5A 5IDYA 2AE1A 3OFSA 4JXKA 3W4JA 2ZQYA 3WLEA 2Q49A 3RASA 4RDIA 1C14A 3KXDA 3SC6A 5IDWA 3OQ1A 5KKCA 3VVBA 1LSSA 1Q7CA 3MEQA 4BKPA 1I3MA 3GLQA 3QVOA 4XQ9A 1ISIA 4OKIA 4P8RA 5COAA 3DHEA 3U0BA 1B8VA 3VH4A 1P0CA 4J4HA 4Y98A 4M87A 1NAHA 2WJPA 4ZJUA 2FOIA 2GN4A 3RC7A 2EKQA 4LN1A 1V8BA 1ZEMA 3M2PA 3DOOA 3DR3A 1U2GA 3ZU4A 3GEMA 4W6ZA 2H5LA 4O0LA 4PFJA 2IEDA 4K28A 3WMWA 5EQFA 4E2ZA 3IQDB 3ZNNA 3JQ8B 4IS3A 1XQ6A 1O5IA 5HRUA 1YS4A 3RJ5A 3ZNOA 4NJOA 3TF5A 1PJ2A 1GDHA 3IUPA 1PJ4A 1N92A 1I01A 1NHGA 3K8ZA 3AU9A 3U4IA 4J4BA 4XGKA 2Y0EA 2YQ4A 3DTTA 3W6UA 1UR5A 2P2SA 1UDBA 3E9QA 4MIYA 4D45A 4MVJA 3JYLA 5F1KA 5LC1A 3QWFA 2X58A 1F8FA 1SZJG 3FTPA 4XX0A 5I7SA 2NU6A 2WWRA 2BFPA 2EG9A 2VWHA 1B8PA 3QV1A 1R4NB 1BGVA 1GCOA 1PGJA 3GPIA 4PVDA 4EYEA 4OOFA 2CSUA 3F5SA 1MA0A 1Z74A 2YHIB 2ZTLA 4A2CA 4NDNE 2VYVD 3OJLA 5KJ1A 3WICA 2E48A 2IXAA 2D8AA 1GL3A 1GZ6A 2Y1OA 3I9LA 4YACA 3UN1A 3BMQA 1R66A 1YL5A 2HRZA 5TLSA 4O6VA 4PLPA 2RCYA 4RF5A 3LLSA 1UDCA 2B37A 4EJ6A 3HB4X 3TOXA 4OSPA 7MDHA 5IAAA 4OXKA 3WSVA 2UUOA 3VTFA 5DOVA 4EUEA 4IQGA 2GERA 1Z7EA 4JQCA 2P68A 1IZ0A 3I9KA 4FGSA 2GF2A 2Z95A 2AEFA 2JFFA 4WGGA 3WQQA 3A06A 4MPDA 2P9CA 4E32A 3KYDB 2BFOA 5H82A 3JQ7A 2VOEA 1BDMA 4HX5A 1I8TA 2W90A 3QRWA 3WNQA 5JW6A 4GLOA 4CM6A 1ZJYA 3GNSA 1C0PA 3I5MA 1ZO8A 2HMSA 2ET6A 4XYEA 2H1SA 4J7UA 4PLYA 2PD3A 1NR1A 4NBWA 3PHLA 4R1TA 1BXGA 1GZ3A 1EQ2A 3AI3A 3HDYA 3R1IA 2OBNA 1UP6A 1XCBA 5G0VA 1HRDA 3ZHBA 3NX4A 4F6LA 1UXKA 1B3RA 1NPYA 2EIHA 1VL6A 1DBVO 2YYYA 1EE9A 1ZXBA 5C5IA 1N9GB 3R3SA 4J0FA 3FWZA 2C7GA 3PZBA 5T57A 2DTDA 2C54A 3KLMX 1S7CA 1TA4A 3OM9A 1P1IA 4BMNA 1X13A 1HWYA 4E2WA 1QYDA 4FBGA 1HDRA 4H15A 3ROQA 4B79A 5TJHA 1O94A 1U4OA 3VDQA 4OXNA 5L4SA 2UYYA 5L9AA 1MGOA 2GASA 1M75A 1Z82A 2AEMA 4BNLA 3MCVA 2BI8A 1EDOA 3ZH2A 1EVIA 1UH5A 3ENNA 1K0UA 4XRGA 4GX1A 5IDQA 2JCVA 1KVQA 5DNAA 1MB4A 3CZMA 5C7LO 4R9SA 1JKFA 3O26A 2IDZA 1YL6A 1MFZA 3LYLA 3RUHA 2PGLA 2NVUA 4XIYA 4A0SA 3GEDA 1NQAO 1CETA 2D2IA 2HUNA 3ICPA 1BW9B 2PH3A 3WWYA 2CD9A 2YDXA 4TRNA 4N54A 1R0LA 2BI7A 3LK7A 1IPFA 3D3WB 3O9ZA 4FW8A 3GRKA 5I9NA 3JQGB 3B6ZA 4RVHA 3GAZA 4TRRA 3JD2A 3RCBA 4ZQFA 3RQSA 2D4AA 3RWBA 4GX2A 2BELA 5ITVA 1GR0A 4FSHA 3VOSA 2R6JA 1E3WA 3EMKA 4TKLA 5CEFA 1QXSA 4O5OA 2VRBA 1FDUA 2FZEA 1H93A 3DMTC 5BSFA 1ISHA 3D4OA 3C24A 1ENOA 3A14A 4Y6SA 3JQ8A 3VPHA 5G0SA 3WYCA 3O38A 4IDAA 4BV9A 3G1TA 1AHHA 1IUKA 2VWGA 5ILOA 4R41A 5HWSA 4NH4A 4DPKA 1FMCA 3NKLA 3VTZA 1V3VA 8LDHA 1GPDG 1LDBA 2OBYA 3H3JA 3OHSX 4IXTA 1QR6A 3AUUA 4YYZA 1E1LA 3KYBA 2P9EA 1XA0A 3AK4A 1QMGA 1X0VA 3H6KA 4RQTA 1EZ4A 4ZU3A 2QRJA 2V6GA 1MC4A 3VVCA 2BGKA 4YJHA 2OMEA 4L4SA 3RC2A 3EVTA 4NMHA 1DC6A 4X54A 3DZJA 3WGGA 3C7CB 3PP8A 4NU6A 4HWKA 3ZWYA 2RAFA 4RZHA 3UGKA 1WMAA 1KEUA 1VJ1A 5GMOA 2UDPA 2PV7A 2Q2QA 3R0IA 4RVSA 4CLHA 4BKRA 2J5QA 1NQOA 1FDTA 1HTBA 1ISMA 1EMDA 3B1JA 2ZB7A 1OC4A 1LSJA 2NNLD 1YBAA 4BGIA 3PHHA 1ZSNA 1E92A 3IL2A 2AG8A 2X0RA 5IN5A 3PTZA 2Y1FA 3GNTA 1QV7A 1ZZEA 4FC7A 3UCEA 3BXXA 1E3LA 4QO8A 1Q7BA 1YXMA 1QP8A 1C0KA 3PJDA 3RBXA 4YQYA 1OZAA 3PJFA 5TQVA 1Y81A 4J90A 4Q3CA 4RL6A 4PG4A 2JAHA 3PHGA 4PZDA 1DPGA 4OJNA 1IPEA 2B5VA 4JK3A 4YQZA 4FS3A 4MDHA 4B7CA 2PD6A 2QHXA 2X8LA 2Y0CA 5ES3A 4M54A 4S1VA 2EV9A 3UF0A 3ONDA 2IODA 4DA9A 4CM1A 2QRLA 1PQPA 3L6DA 4TVOA 4WLVA 5DP2A 5T64A 2G1UA 1ID1A 4J4TA 4C7JA 4B8ZA 1T2CA 1PS8A 4OMUA 4LGVA 1PQUA 5KTKA 2JD0A 3DO5A 4XWYA 1T2DA 3CIFA 5A03A 4Q3DA 4CLRA 4B3JA 3K2BA 2O3SA 1X14A 3PQFA 4QFCA 4LVUA 2OP0A 5I8WA 4O63O 3BMOB 4J1QA 1UXIA 1D3AA 2JJYA 3NT5A 5MGBA 3GF4A 3LQFA 3RKUA 2EP5A 4I9NA 3ZU2A 3SVTA 3FRJA 4CLEA 2Y68A 4YEDA 3Q3CA 4BKUA 3WJAA 4Q9NA 3I83A 4I9UA 4AJ4A 2EJVA 3KM0A 3JQCA 3GVHA 4E4YA 1PTJA 3L9WA 1F06A 3I9JA 3T4XA 5H81A 1QLJA 3I23A 4WLEA 3PWSA 1JQBA 1YRLA 2Y0DA 1FF9A 3CXRA 4XYBA 5JNLA 3Q6IA 4GI2A 3H9EO 1KC3A 1M76A 2DT5A 4CL8A 4NZ9A 1E77A 4JCOA 4CM8A 4GSKA 4D3FA 1ARZA 1U2DA 1I0ZA 2PGJA 1DC3A 1GQYA 1CYDA 1XIVA 1KVUA 4R3NA 1DIRA 3Q2KA 3BTUA 2DKNA 4AJ1A 1KVRA
chains in the Genus database with same CATH superfamily
4C9BA 4QU0A 3HWSA 4DNQA 1T3HA 3HS3A 4J1NA 1VL1A 1KH3A 1CU1A 1SUAA 4A0FA 4GSLA 5ULLA 1KEZA 2ATEA 1DCMA 4ZDJA 3CYFA 3IAAA 3MGGA 2YYSA 3QY0A 1VMDA 2PSEA 2DUMA 2ZRQA 4JNCA 4BQEA 3WK7A 1WXFA 3BMNA 1MJGA 4DLNA 1LC0A 4CIXA 3D1LA 1MRZA 2WWFA 3WE7A 3ETEA 4PPYA 4DPLA 4GG1A 3FNBA 1R10A 1ND6A 4I8XA 1ZICA 1E1KA 2HMAA 3TR0A 4BU0A 4F2PA 4MP8A 4M1YA 1ENZA 4WZ6A 4BBZA 3J7TA 5SYAA 3U0VA 4I46A 4LGCA 1XMVA 2JIRA 3NNDA 4MPTA 4AN0A 1NOIA 3HDHA 3HDQA 4UPVA 2IHBA 4KLCA 2O8BB 5DTIA 2PWBA 2RGEA 4FEGA 3LECA 4P5PA 3BFXA 5DKFA 2NYRA 3NIBA 3A1UA 4XD2A 3BZWA 4A1FA 2DEUA 2WG0A 2R7NA 2YC2C 1N5MA 3GJXC 3HP7A 1AO3A 2B92A 4EQ6A 1EX9A 1W0KA 4KPGA 3U3KA 4R0MA 5C8VA 3OX4A 1JAZA 1NRIA 5I7VA 1Q17A 1GGJA 2FPLA 3C7KA 5DBHX 3UJ6A 4C01A 1ZWLA 2G70A 5EG5A 3IQGX 3PKZA 4ES6A 5IPFA 3GDOA 1DEXA 1TRKA 3QYAA 4WBNA 1Y8CA 4BIMA 5SY4A 1BMDA 2ZIAA 4TLDA 5THKA 2RGDA 1MZVA 4ZI7B 3HUTA 2CZQA 3RVLA 3ZE9A 4DLPA 1W85A 5GVSA 1GEEA 4LV8B 4PYLA 1XVAA 2NN3C 1THGA 1W35A 4KAAA 2JJ1A 1O96B 3HLYA 1U31A 3GZTB 4R4JA 4IXMA 4UHBA 5FI3A 1E2MA 3BZUA 1LB1B 4OU5A 1NT2A 1WJGA 4JGBA 3ZG6A 1L2TA 2ZVDA 3W5CA 4RC9A 4X64B 1KAMA 4OB7A 5FPHA 2RGYA 5BWNA 5JZOA 1EEXB 4RQUA 2LVBA 3IP6A 1V9LA 1YRHA 5K3FA 3G5MA 5ITZB 1MX9A 1TJ3A 3GGOA 5EIBD 3UAXA 4ER5A 3OHPA 2YRFA 3LWBA 3R8FA 1PL0A 2ODAA 5IHPA 5FUYA 4L6IA 1QOQB 1EHYA 1GUBA 5DT9A 3DTNA 4GDMA 3F4LA 2LKCA 4MVJI 2C42A 1YHNA 5LQUA 4ZAGA 3DMTA 1U2ZA 2PSSA 2F3QA 4A73A 1GCGA 4UTVA 1K8ZB 1U8YA 1VIMA 4O59O 4NEGA 4HQNA 2NZJA 1IN4A 2VAMA 2VDOB 3B12A 2YZGA 5EZQA 1JIXA 5A3SA 1SXQA 4B6QA 1BN7A 4RH3A 5LQAA 3EHDA 3P9CA 1YUMA 2W6PA 3CWZA 5K4AA 2R00A 2Z2JA 3LBYA 5FUMA 1D2CA 3CCBA 4ASUA 2H4FA 3GJ8A 3V2HA 4FOOA 1Q1BA 1OGYA 2Z4TA 3BJZA 2VT3A 3L49A 4WDQA 3ML1A 3L7DA 5BMOA 4F1JA 2JLVA 3I5XA 1BOFA 4QJ5A 1LJUA 2PXHA 3T38A 3QBTA 3HXPA 3OQBA 3E8MA 1TEZA 4BEBA 2ZUUA 3QEMB 2CKDA 3NLLA 1U8TA 2IKQA 3BB3A 2FSIA 1MO5A 3DYIA 3PRJA 4H2DA 4MS3B 1K5PA 3VR1A 4H17A 1JR3A 5K0TA 2FG5A 2VJQA 3CFYA 3C70A 4Z8XA 4LRWA 1KS9A 1DUIA 4FYPA 4B3BA 5A4KA 4JOQA 2QRHA 4PFQA 1WUIS 4HRAA 4RK7A 1ZGAA 4F2WA 4DUYB 1QYRA 2YX1A 2C58A 1BE8A 1ZK2A 1G7TA 4OHOA 3L0CA 3RRFA 3QELB 4BVEA 1C30B 4O1HA 4QUJA 1EFKA 3VZQA 2OFPA 3T54A 2F4VB 1N0WA 2NZYA 2PKCA 4O4LA 2PJRA 1XEXB 4MGHA 4DNXA 1BMFA 3RJMA 4KH1A 3ETGA 4TLCA 1P1RA 1N1DA 3W2FA 3HSSA 3HWX1 4DZRA 3C7AA 2WWGA 4ND5A 4XTCS 2PLRA 4C5AA 2CNLA 2O3RA 4ZANA 5FEUA 4BU1A 1BDIA 1I80A 2Z3WA 2M98A 2Y0BA 3Q2IA 3ID6C 4K5QA 5JNSA 4ND4A 1RE0A 1A7JA 1SUBA 1CEYA 2B6NA 4PO8A 3U4DA 3TNLA 4D57A 5KVAA 3WKAA 4CF4A 4CEHB 1O6BA 3PX3A 3TVYA 1P4HA 1RIIA 5EUMA 3AVUA 3BD7A 1W75A 2FQWA 2XNJA 3OX3A 4RPGA 4WD3A 3DE3X 4HH1A 1ZK0A 3IAUA 3TQQA 2W8BB 4JJFA 3TD2A 2B4QA 1Q0SA 4EG8A 4MW2A 3FRIA 4FNGA 3ZU6A 1KIMA 1HE3A 4PG6A 2JLUA 3H04A 3N1UA 4YJ3B 2X41A 1BEUB 3RAPR 1PUJA 1KJ8A 1IL0A 3B9PA 1NBWB 3T3HA 3LUKA 5T3YA 3FDXA 4ZI5A 2ZRCA 2FEMA 1G16A 1CR2A 2QRMA 4QIHA 4Z3KA 5TVKA 2J3HA 2BFFA 4PSAA 4BE9A 1EK0A 1L1QA 2WWIA 3TOCA 3RV4A 4X8OA 3ZVNA 1QCDA 2V7BA 1E2PA 4F6CA 1XZHA 3S2YA 5EMHA 3PC6A 4YLGA 3SC4A 1VG9B 2C97A 5AXAA 4GU5A 2NXJA 1D2EA 4TL8A 3UXMA 4BVHA 4U2FA 2I4IA 1ADBA 1XK7A 1H8HA 1LI7A 2P9YA 2QRZA 2YZ7A 4MA5A 5FPYA 2A0YA 3RDPA 1E58A 4D5EA 1CJCA 4LF7B 1W1UA 1L8LA 3VBEA 1YUBA 1EP9A 4UNNA 5CPFA 5BRNA 2DB3A 4CGZA 3F7MA 1G3QA 3HU1A 4YNBA 4FWBA 4JUDX 4WW0A 1I7LA 2ODWA 4UQLA 5LFAA 2VRNA 2C5SA 1A88A 3AF2A 4UBOA 2WJ3A 4DR3B 5U4XA 2OCYC 1OHHA 1NQ5A 2ZI4A 3HUDA 1R0WA 1J7JA 2XUGA 3AHGA 4QOIA 2TRSB 5ALHA 4ZV9A 1E3QA 4OGLA 1EBUA 5IWCA 2J0SA 2NO0A 1U7TA 1SM4A 2YOHA 1B26A 1XG5A 5FOWA 3EG9A 2O57A 3BH6A 2QGNA 3P96A 5P21A 5IZ4A 3RODA 5IX8A 2W93A 2B83A 3LP6A 3OZEA 1I7NA 1FRFS 4R31A 3D81A 3U09A 2GVNA 3RARA 4AICA 1EE1A 3VPSA 4JYZA 4QT0A 1MJNA 4HTFA 4IO0A 2PRJA 4LE0A 4BY9E 1G6HA 4IP0A 4N3CA 1J1ZA 2C4VA 3V4ZA 1KXJA 1MD9A 3RH0A 2IIQA 3B52X 4YJ3F 4QJBA 2JBAB 4BC0A 1Z5VA 5JSQA 4B3TB 3IE2A 4F9FA 1JDBB 3NBQA 2PUFA 4NHOA 2HTEA 2D06A 1XDZA 1HDCA 1JHQA 1MO2A 4FM9A 1X7GA 4HD8A 4HDMB 4N3BA 4RK4A 5DBOA 4D3SA 1TIBA 4QDXA 4HQFA 1VDZA 4BN0A 3HM2A 4I1IA 1NJ6A 3SX2A 1TCVA 2BH2A 3KKNA 3LF2A 3O3NB 1A72A 2IUFA 2FZVA 3A05A 3PKJA 1FYFA 3LPAA 4BQRA 5IK2D 4UFOA 3T7AA 4ZCTA 1V6AA 2BMJA 2WW8A 3PPWA 4XVRA 2O2SA 3LPNA 2P65A 4PAGA 4ZT2A 4CUKA 1TAGA 1A9RA 1GDTA 2UUAB 4CMCA 4IXDA 1T5IA 1CR0A 1WS6A 2HYDA 1FNMA 1HL3A 3JAKB 1ZMXA 1VGRA 3DFFA 2F2TA 1LRLA 5A9SB 1U0HC 3R7AA 4EUFA 5CFQA 3TGPA 2A94A 2HA2A 1UJMA 1MX3A 1G2OA 1D6SA 4XR9A 2QD2A 4TZTA 3C3PA 5KNDD 1PT6A 4QBIA 2ACVA 1V4NA 1E0DA 2FPRA 2Q5HA 3ECAA 2ZJZA 1VHQA 2PMEA 1R4NA 1HSZA 2V6BA 2X5NA 4YP1A 1UZMA 5JVDA 1JKXA 1EFHA 3CLTD 2QRVA 3JZAA 1BWRA 4RV9A 4EHIA 4DJDC 1JKMA 4KXUA 4D3ZA 4AUMA 1Y9AA 2AOXA 2VAVA 1T3TA 3ROZA 1T9BA 2DVMA 1F7UA 1CUJA 4JJ7A 2G1AA 4FINA 1OBOA 1R64A 4FUQA 4TTVA 1QLHA 3DEIA 4N0DA 4X94A 2PL9A 4QVGA 3UBTA 3N8GA 3R77A 4IIUA 5ALPA 1AB6A 2P9ZA 3DR5A 3KSDO 3A1NA 1IYZA 2QNRA 4XB1A 2QNIA 3ZY5A 3PC2A 5B1EA 4EKNB 4BFUA 1ZOIA 2RG7A 1O1YA 2ZJ0A 1KPGA 3RFXA 1MVLA 4C3OB 5C5CA 4QGSA 2HT1A 3DBRB 4Z9BA 1D2GA 3SP1A 1O08A 3WSTA 2VF7A 4BZWA 4W99A 4MI3A 3ZQUA 3KZXA 2WIJA 4H0FA 2IYLD 1W85B 3BRCA 4RXUA 3ZN2A 5TQ0B 1KVTA 4UTPA 4URVR 5KAMA 2BZ0A 2JCGA 4C7KA 1BG6A 4OI0A 1IEXA 1HY3A 3GGJA 1N6PA 5ILGA 4XVCA 3IOYA 1O5TA 2G4VA 2O6LA 4QECA 3SXJA 4WFIA 5IAEA 2ZREA 4HAXA 2BEUA 1I2ZA 2DUNA 2X23A 1IY0A 3MQFA 2FSVA 4ZOLA 3ZPXA 4DDKA 3CIOA 4F0JA 2ISCA 1TZ2A 3H05A 1QIEA 2R4UA 1A2BA 2OYSA 3M6IA 2H2WA 2QTTA 1FNSA 3H65A 1NN5A 1WQ3A 4G56A 1XTTA 2YVQA 4YRIA 4WCFB 4EX7A 1E0AA 5IC4A 2ZCUA 1PUXA 3E8SA 1U5CA 2YFQA 4FMBB 3SAJA 4EECA 1RZRA 2VNJA 4MCHA 1I4OA 2B69A 1BQ3A 2PAFA 2XB9A 4ICIA 3H1EA 4JJEA 4QWWA 3QVGB 3RROA 2C2OA 4Y7CA 3ZWNA 3HB9A 3S8EA 4R98A 1Z2DA 4QGBA 2PGNA 5GM1A 3FBGA 4MUMA 4Z1OA 5K8VA 1MCZA 1U3GA 3DEKA 3BM5A 3N6RA 3WB1A 5I5EA 1W44A 2Z09A 4CLXA 1SXPA 4K7JA 2C9BA 2KHZA 5HDBB 1LD3A 3UQZA 5L3QB 2ZQZA 3TOZA 4C5CA 1R5JA 2P0EA 1F7VA 2FWNA 3T0FA 1GZ4A 5EYPB 3UUEA 2V55B 5KOJB 1NR7A 2ZUDA 4DV0B 4JGIA 4CLDA 2D6FA 2GRJA 5JD6A 2YL2A 2BGMA 2LUOA 4D0LB 4IMPA 2CHQA 1KEPA 1HDIA 2P30A 3BJEA 4P6VF 4Y7DA 3KPVA 4FOPA 4ARIA 4HATA 4XGQA 3DVSX 1Z0UA 3JWHA 4AG3A 2OCXA 1A9TA 3RC3A 4MVJF 4UE3S 2OFFA 1F2DA 2C7RA 3PZRA 1REQA 1L4MA 2R86A 3PD1A 1JZQA 3LC2O 4L3OA 4LW8A 5AHOA 5AOBA 5D3ZA 1O94C 1JLLA 2FR1A 2GZ1A 2QG9A 3AUSA 1V43A 3MOSA 1YQEA 3OX2A 2V7WA 1HMPA 2PTGA 2MIIA 1FJHA 1FU8A 2PXAA 2QMHA 4L85A 4Y6PA 4BO9A 3NM5A 1VMAA 2XEDA 1F6BA 2YVUA 1FTQA 4FX2A 4U63A 3VR2A 5EJ9A 5DLPA 2VP6A 5FBQB 2IUUA 2ZSAA 4OK6A 2HPAA 5C80A 1Y5NA 3B9BA 2N75A 2YIMA 3BK2A 4LJRA 4PLZA 3E9YA 4AC9A 1W0CA 1ZM9A 2IDKA 3A2NA 2CCJA 1R00A 4B4UA 1HETA 1I2CA 4UCXA 3CVVA 3FWHA 1Z7BA 3ILYA 1YL7A 4FC6A 3UB4A 4N48A 2IH2A 3SZLA 3MS2A 2MSEB 4GF5A 4LBYA 2ZIGA 1YB1A 3AVXA 1Q50A 5JVDF 4R51A 2I4TA 4NC9A 5DX0A 5EFOA 2W42A 2V58A 1H2ZA 1Y34E 4R2KA 4P34A 4H1UA 2W6MA 4P38A 3HXQA 3U4QB 4F2DA 3NCHA 1NY5A 3MUEA 5LDDC 5AKGA 1PQYA 4GLJA 4GM0A 2HPHA 1L4KA 3BXOA 3PNOA 2EX1A 4QUIA 1EGQA 5ALWA 3FPFA 3I64A 1CPYA 3D6HA 3Q2OA 5K1ZA 1FDVA 3W9YA 1GTRA 1WB5A 2YCLA 2I71A 3R7WB 1MRNA 2AMFA 5KYYB 1JPVA 3H99A 4YJFA 1WOMA 3PQDA 1GT91 4GYJA 4PHFA 4F72A 3BXEA 3QEMA 1IQUA 2OPHA 1WCWA 4EW6A 4CVNA 3T5GA 1HE1C 5J40A 1U3WA 2NADA 1YR9A 1UODA 2VT7A 1M33A 2J9ZB 4IF4A 4WAUA 3TSYA 2I4LA 2GD0A 1G1MA 4HBGA 4OHKA 3E81A 5EHNA 3PFFA 2QPOA 1I9GA 4A5OA 3NPAA 3WLHA 4WXMA 1BMTA 3DPIA 2P7HA 3AKDA 1PQ4A 2QQ5A 2O4UX 3JALB 1EGAA 2ZWIA 2X1VA 1MDBA 2QM8A 3UYKA 1XXLA 1SCDA 2UXCB 1JSXA 2FZKA 1UFQA 5FCDA 2IPMA 1FBNA 5EA2A 5LUAA 2DWOA 2G5CA 4MJ3A 3GLIE 1Z5UA 3F5FA 4E5UA 3OPYA 4FWTA 2UXBB 2D3WA 2OESA 5JRJA 1JLKA 3AY0A 1TTPB 5D51S 3HTXA 3PGXA 3DZIA 2XZTA 1DKMA 4MCIA 4FKZA 4CKEA 5CFPA 1TOAA 4EK9A 4KLNA 4MWOA 2DSNA 3NJ4A 4OBXA 4GI3A 4OBWA 1VJ5A 4KOAA 3ISJA 4P4SA 5AKIA 1GQOA 4XJVA 1YFKA 4RZSA 3UW1A 4QULA 1KQGA 4V0RA 2UV8A 4UM7A 4C1NA 4Y6RA 1PJQA 1LLCA 3HP4A 3FOWA 5I9TA 3VR5A 5IKEA 4RLFA 1O3YA 3GRPA 1EP1B 1H1LB 3I6MA 3OA0A 2IWRA 2PMFA 4JMPA 2H1WA 4Q00A 1BWSA 2WFLB 4BQIA 3BSYA 1UXHA 4UUNA 4DA6A 4LF8B 5DXAA 2Q5CA 4XUEA 3T5TA 5CA0B 3WTBA 4AKGA 5EVCA 1O97C 2XRFA 1DAMA 3TTVA 3LDHA 3D0OA 3QJ5A 4D9KA 1D0VA 1DUVG 1FMLA 2HBZA 2DWCA 3VZSA 2QDXA 2GFQA 5TT1A 3ZWAA 4QOHA 3UQYS 3OMLA 1TT5A 3A1FA 3HCOA 4DYHA 2NYUA 1W8DA 2A5LA 4X66B 2I99A 3OQNA 3OJEA 2C4MA 3NHBA 3A11A 4PR3A 1PR3A 2NO5A 4S35A 3T7DA 8AT1A 5HQTA 1GLGA 3QLVA 3D2BA 3PE4A 3ZDYB 4N9WA 5IXSA 1X8XA 5IXYA 4RTPA 2AN3A 1EEHA 3DMDA 3ZOZA 2W58A 4OHRA 5E95A 4JVLA 2EBUA 1QS0A 3ZE6A 2J3EA 3VQTA 3GUYA 1HGXA 3HUUA 4W4TA 3ZGNA 5LMCA 1U0FA 1YC5A 2QLJA 3K20A 3TN7A 4Q16A 3L7AA 5HBGA 3GFPA 4BNGA 2GPNA 2X8BA 3V7YA 2WB2A 1H05A 2QRKA 4LMRA 1CUBA 3C6QA 1U2EA 2R5FA 2ZS7A 3QFTA 3UUGA 1LDEA 1PGQA 5ECDA 1KSFX 2XIJA 5CLFA 3IQXA 2OTCA 4I5FA 4Q4AA 3WO0A 2PS0A 2D5CA 2EERA 3K9CA 3OH8A 5K8JB 1E9EA 2GVDC 4BMZA 2Z8YA 2NPFA 3HJAA 3U19A 5CITA 2QN7A 3UMRA 3AO0B 5J2TF 4BTLA 3ZTTA 5AQEA 1FFEA 2MOKA 1Z3CA 1ZVMA 2OWEA 3G79A 3RVOA 1LK0A 2REOA 3DV2A 3VV2A 4E88A 4EMUA 4G5QA 4G1UC 3TRHA 1ELOA 3EARA 1SU6A 3DDCA 4PN7A 6GPBA 3MSCA 2ZAIA 2HSDA 1BHSA 3KJIA 3N0VA 4PM4A 3WMEA 4ZZ2A 1Z4KA 4CF5A 1UT8A 1F2TA 3IC5A 2HRDA 1WPRA 3GPBA 1DC4A 1DTEA 3M1AA 4MYCA 3JQFC 3SHTA 3NYWA 4BQNA 1IH8A 3G6KA 2HNAA 3NGLA 5IZCA 1QP7A 4EG1A 4AF6A 3EZ7A 1LDNA 3ORHA 2BKAA 2ONCA 1KIAA 3PENA 3VKFA 1MR3F 3H0EA 1RQPA 2VXCA 3RPEA 2QTMA 4J9VA 1K6IA 1K06A 1XQ1A 3IVRA 3GW8A 1OASA 3NBMA 4X7MA 2VF8A 3F1LA 3WB0A 4ZJPA 1XMQB 5FHQA 4Z7QB 3Q8KA 2WD9A 4D3YA 3ICOA 2VAWA 1SN7A 2XKAA 3BMNB 3BBLA 2WC1A 3J81k 4W5QA 3M6WA 3UKJA 5AVYA 4DV5B 3E8XA 4TUYB 2PX0A 2BCJQ 4J6FA 1VE6A 3NC1C 3ZR4B 1ZJWA 1XZPA 3ZCUA 2QX8A 1VHDA 4CIWA 4G0UA 1RT9A 2IPXA 2GESA 1XU7A 1ZIPA 4KHZA 1U1GA 4KACA 3WLPA 3D0KA 1QO0A 2ZJ3A 4NJEB 5F2KA 3V8BA 1VB3A 3B82A 5AKLA 3VI4B 4S1TA 3X2EA 2BGTA 5I9SA 3ZHZA 3A4IA 3WADA 1J8DA 1U6JA 3N58A 2IHJA 3JATB 3C16C 5JCOA 4AD8A 3HDJA 4MI1A 5AD1A 1K4MA 2BFDA 2C4UA 2O1SA 3CVJA 3TBFA 4B81A 2PT9A 3MHPA 5K8TA 4EZBA 2HN9A 4PLGA 3GJ5A 4EY7A 1QYIA 1CK4A 1TVKA 3LVBA 1XNHA 2BMFA 4H7DA 5CX1A 4ZODA 5HKKD 3BYZA 3MCAA 4NICA 4OPMA 5E4TA 5J3JA 4TZ0A 1Z37A 3CKLA 4MMZB 4A6EA 5P8WA 1UC8A 4R2WA 2J8ZA 5SZKB 4DLBA 4E33A 2IY8A 2PL1A 3GRCA 1KYVA 4J03A 4WY8A 3HFSA 1KI9A 5DHTA 3NWJA 4ZWNA 2R97A 4DOMA 5LZ9A 1JEEA 3E84A 3D5QA 4OH1A 5E9AA 3CNBA 1R8XA 3MWDA 2FDCA 3TLAA 2AHOA 2PBRA 4HPJB 5EJIA 5TSDA 1YRQA 2YJNA 4IVQA 2AZDA 1PZGA 4RAQA 3OOJA 3U60B 4M1KA 1WF6A 4GGPA 2P1RA 4LY6A 1II8A 1DCKA 5DULA 3FSGD 3FMIA 5KINB 3H2ZA 3TL6A 5FLKA 1Z5NA 2EX0A 4BNJA 4CKWA 4LMAA 5ARBA 4AWAA 3L1KA 2HA0A 1JIIA 4ZQHA 2OVBA 3VC1A 3D5EA 1Z5ZA 3G8AA 1HQYE 4BVGA 1MIOA 2QTVA 4R2MA 1SC1A 4JBHA 4PXSA 1TJ5A 3UK7A 5AVZA 2DUWA 3Q5GA 2HADA 3OEWA 2QVBA 2YFKA 5GGXA 621PA 4YJDA 2J0QA 2OCGA 5J1TB 4BP1A 3GV0A 1YZUA 2I80A 2J3LA 1X6VA 1G38A 2Z6AA 1PGNA 3FOCA 4YJFB 1E3IA 1SCAA 3GELA 2CLIB 2J4DA 2GGSA 1KRHA 4IQFA 3CH7A 1AIPA 4P32A 2QRQA 5JARA 2CEAA 3I92A 3GARA 2EHDA 4MKGA 4DNFA 3MYYA 3FH0A 5IKXA 2NZUG 2PQ2A 2WJIA 4Q4LA 1K6EA 1KK1A 4AO6A 3P4YA 5DK4A 2WQ6A 2AOUB 2W4MA 1RHKA 3BWEA 3NHZA 1RJ9A 2VJCA 2PH7A 2A1UB 3IAXA 3UHJA 3HLTA 4E31A 1II9A 1HO3A 4MULA 1CNFA 1Y1QA 3ROEA 2VJYA 4OMCA 4MKXA 1JFLA 5EJGA 3IHKA 3KQQA 4GE3A 4OY3A 4AN1A 4C4ZA 4EA8A 4WZBE 4IY1A 4LV5B 1SHJA 4J1TC 2ECKA 1E9BA 1KSHA 4L8VA 5GZ3A 5EKTA 1KO8A 3A7EA 4Q0MA 4M9RA 2HLHA 4P81A 1CDOA 4OM7A 3JAWA 3OZFA 1L5RA 4DMMA 4RO0A 4H59A 1PJZA 1DELA 2B8TA 4OXQA 3AP2A 4RKQA 4OX9Y 4D9CA 4B3IA 1IG0A 1ST3A 1RCFA 4BE7B 3U7FB 8ATCA 5L95A 5LM3A 4WOBA 4AJKA 3T9FA 1XDGA 1DEOA 1HYHA 1QH8A 1WW2A 2OLKA 3C98A 2H2HA 3WHPA 5A9TA 1T8PA 2XAAA 4BZPA 3TL3A 1ZXXA 4G89A 4D43A 1RWOA 1I13A 1B4DA 1OUMA 2F3SA 3PKIA 4MOWA 1PL6A 5KDOA 1PFWA 1PKXA 4JA0A 2I9KA 1P1KA 4MWCA 5HM6A 1JYFA 1T6BY 3W5BA 2JIZD 3A3PA 2CNOA 4PHGA 1ZS9A 1TTTA 2JJ1D 4QUHA 4HRXA 4AJNA 3SM9A 2ZR7A 4GZ5A 1C3EA 2OZEA 1EG2A 2CXUA 1BTOA 2VIIA 3CVXA 1T13A 4FHGA 4LK2A 4QGFA 2GETA 3PRYA 3L40A 4V0NA 2CNBA 2J07A 4ONEA 1IN6A 2V7QD 1AUOA 4RQBA 1J06A 5REQA 1XQVA 3L8ZA 1UJBA 4CL3A 4DT1B 1BE6A 5F2NA 3GLGB 1XTIA 4ZPJA 5G0WA 2D3TA 4LMPA 4JCCA 2WAXA 2XGGA 1X42A 2WHYA 3O2QB 3F6BX 2X2OA 3S8YA 5IJ9A 4AZTA 1JDVA 3OY2A 2TMDA 2IL1A 3F8WA 2P2NA 5FPQA 3K9QO 3VNQA 1A04A 4ZQEA 4ZHQA 1YR2A 4B0PA 2ZRLA 5DGCA 5IVHA 3AFGA 3WL3A 2XB2A 3EEBA 1QGUB 1EK2A 5BURA 3KTAB 4GH5A 4JOCA 2OD9A 5D3KA 2AWOA 5JAPA 2WJ4A 3S1AA 2R4QA 4CV1A 4WBSA 3TLYA 5EHZA 3KO8A 3OLQA 2IITA 2W37A 2IE8A 1H4VB 3L7IA 1F3OA 1EPUA 1NQXA 1Y3IA 1J33A 3RSZA 4HEA1 4ATNA 4LHEA 2ZJ4A 4HY3A 4KO8A 1KNQA 3CLVA 2PWPA 4X65B 1NBIA 2QW8A 4LXYA 1J25A 1ZIDA 4DDUA 3DOHA 1HE2A 2JIPA 5EHQA 5F5LA 1XRNA 4A8PA 4QODA 4A0GA 3DDSA 4JBGA 4J16A 1DLJA 1LBEA 2R8XA 3CWQA 3CRVA 2HWUA 4AZ0B 1W88A 2EG5A 1T9GS 4B3HA 1RXYA 4KYVA 4DSTA 5JO0A 5B3KA 3T3EA 3PDWA 4R69A 4F45A 4CKZA 1I6MA 4P2BA 3QMPA 4EM6A 1RCTE 2IYTA 1WLYA 3EVBA 3ON5A 3PFWO 3E5RA 1N2CA 3UW3A 4CIBA 2W2LA 2P11A 3EFOA 1LGYA 2CF5A 4QEZA 3DKPA 3G5LA 4JU9A 1NYQA 1B42A 1NNUA 2WG1A 3COWA 3R0QA 4L15A 1OLSB 5JI3E 4DS3A 4KITB 2ZS8A 2AG5A 2I66A 4EB8A 4QEKA 3I37X 4ITRC 1BMFD 1HQKA 1LBIA 4X44A 2KM1A 3L4KA 3RHZA 2ZI9A 1UPUA 3B70A 3JQAA 5FWXA 4BUCA 4CMGA 2NYVA 4PLFA 1RQLA 1D6MA 2B36A 2EP8A 2YN0A 4G4GA 4OUDA 3UKOA 4Z49A 4G07A 3BA6A 4ETMA 4P93A 4BV8A 1VGVA 3MFQA 3A1DA 1C3OA 1Z7YA 2WJVA 4Z51A 1Y3HA 3KG2A 3ZCTA 1X38A 3U4HA 1JR2A 1QRUA 3CQ9A 3CRRA 2RI0A 5GZ1A 1Y1RA 4CMEC 2I6TA 2A4KA 3EIXA 2WEKA 3ROPA 4MKRA 5DN6D 4IYJA 3HJCA 1CBUA 1K6XA 3LXUX 4O8CA 2CE2X 2DFDA 4F4DA 1UM8A 2R6R1 1U1CA 2O48X 1XZGA 3SYKA 3RT9A 3CS3A 1QF9A 3AG5A 1D5WA 2OHJA 4H7EA 1GGMA 1RXCA 3QUBA 4NMLA 1V4BA 3AM4A 3OP4A 4HNGA 4K05A 3UAGA 4BIIA 4EEKA 1S1CA 4TMWA 2BHNA 4J1GA 3M5PA 1CR6A 2NVBA 2UUCB 1RE1A 3RK1A 4BX9A 2WSLA 1JRLA 3I9OA 4EB6B 3GL9A 5CDSA 3OOSA 1QPBA 2FOXA 4QBGB 4A03A 5IABA 2D00A 4UZEA 5AXDA 3IKLA 1G5TA 1KORA 3ZQ6A 3JD4A 1W34A 2B7CA 1X7WB 3DLHA 1AJEA 1I1HA 2Q45A 3HYRA 3ZZ0A 4JU8A 1YUNA 1MHPA 1QX4A 4ILKA 3QPCA 2Q46A 4TWJA 3NBZC 3LHDA 2A84A 3P45A 5DNWA 2KQUA 5KTOA 1VRWA 2BTQA 2H2DA 1YDHA 3SZMA 3PDHA 3ILHA 3R09A 4TLAA 1JEYB 4WACA 5AKJA 1OLUA 1H69A 3UJ8A 1L6IA 3EF3A 2WFZA 1JHUA 3E3LA 4JWTA 4UE6A 2JL1A 2B30A 4LMBA 1SKMA 2ZRIA 3CUYA 3E7DA 5JNWA 1O94D 1RMQA 3ACBA 1YH3A 3OU6A 2P9TA 4PWZA 5A1TA 5HK8A 3QKSB 3BXPA 5AVKA 5EIHA 2FAXA 5FR1A 2CK3A 1MXFA 2XUOA 4PFKA 2IZ5A 2OLEA 3I53A 5ALNA 1YJ8A 1BWPA 1M0TA 1P45A 2G08A 5G40A 2ZQ5A 3WIEA 2X5XA 3T3DA 1V1RB 1TPYA 1A9QA 4LHSA 2VDKB 3WGOA 5JJCA 5KOIA 2WQZA 2O8EB 1RP7A 2GHQA 3BE5A 4Y0AA 5U1PA 5E2IA 2JLWA 1XROA 4NZYA 1JIQA 4R81A 3RG2A 4YMGA 1JEQB 2QUJA 3Q3JB 1HTTA 1WKCA 2A86A 3C3MA 3GBSA 4RJIA 3JRWA 4KAFA 2G0TA 3GEHA 1SB8A 2GD6A 3NWPA 1S1MA 2ZYTX 3TX2A 3VH2A 5JRZA 3FFTA 4KWTA 1Z4IA 2JK1A 1FFSA 1HEYA 1T2FA 5CM9C 2C1EA 1OVGA 4RK1A 3RIMA 3VSCA 3UT6A 1S4MA 1MJ5A 2OECA 4INPA 4D97A 4Q24A 4DEVA 2VTKA 4CL2A 2PUAA 2B9EA 3WWPA 1P1FA 2JRCA 2VHTA 4YT5A 5SY6A 3T1YB 1EYZA 2FTKE 2CL6X 1GIAA 1CUYA 4PYKA 3WK5A 1PVOA 2GF9A 4I55B 5TJ9A 3EOAI 4AUNA 3RYTC 1FNBA 4FXPA 2O2JA 4Y1RA 2AN4A 1HLFA 2YV1A 3VZPA 4Q4AB 2AF3C 2HU5A 2O7SA 3CURA 4NZZA 2ZBUA 4U2CA 4D8VA 4X3PA 4GOJA 3VGJA 5KQMA 3PQEA 1IE3A 3ELUA 3LA8A 5IF9A 3GFOA 4DA4A 2DLNA 2HCBA 2X9GA 4ANFA 3Q9UA 4RXMA 5AVOA 4ZD6A 2HV9A 3UAYA 3ZGVA 4EY5A 2P3OA 5DTQA 4YCBA 2ETXA 4W1QA 1U28C 3DMPA 3DOFA 4JB3A 4J2TA 3PTLA 3OICA 1DZIA 3L8FA 3R74A 4O2BF 1EJ0A 3RYIA 4DV7B 4DL9A 3VSEA 5F64A 5EIWA 2HRBA 1P6UA 2QYOA 4IEFB 4Q9HA 3M7IA 2NW6A 1BVHA 1SUCA 4JNKA 2JS7A 4OGWA 2BHLA 3CPJB 2KBFA 1JVSA 3PRKE 3PEFA 2ATVA 4GXRA 4TPKA 3X44A 4FYHA 1VJGA 1PV2A 2ZZKA 1LDMA 3H5LA 3HB0A 4MDYA 1SWWA 1ZM7A 4Q6WA 3STHA 5JAUA 1A77A 4MUKA 3J80A 3MM4A 1YVDA 1CJUC 4J0CA 4JI4B 3K32A 3D02A 1SG6A 3LPLA 1DWQA 1JW9B 1UZUA 3DPUA 3OKAA 5JANA 121PA 4N6NA 3UMSA 2XB8A 4O1IA 5F3DA 1ESMA 4MRMA 3UPTA 4YP0A 5A5FA 3JVVA 3LBIA 5CHYA 4G5RA 3QKRB 2FLWA 2XKJE 5HTKA 1Z0KA 1BEZA 3OOWA 4TMFA 5J2UA 2P4HX 4KRYA 2G0NA 4KE7A 3ZLBA 2Q4OA 2PJUA 4C0QC 2C77A 3EAQA 1R8YA 2Q4BA 4YRAA 3WYGA 1KIFA 2Y71A 4OUDB 1V0JA 1Z15A 2BJWA 1E4OA 2EW2A 2QVZX 5DLQC 1KMIY 3BWYA 4YP9A 3WFJA 1X1EA 1XKQA 3HJFA 1QOPB 2JK0A 1WDKA 2VNKA 4DNOA 5HKBA 5K4HA 1HLGA 2BSAA 2EKBA 3C1AA 4XSGA 4NU5A 4EBBA 1S9HA 4QPJC 2ZSBA 1V7CA 4J0HA 2EWWA 2OORC 2PMCA 4CV3A 4E08A 3HO1A 4ZKDA 4BV2A 4J0EA 2VSNA 4Q48A 3ZS9A 1KO5A 1TC1A 4DBLE 2XSZD 1K08A 3KWMA 4LCJA 3O47A 4L9WA 4AYXA 4F97A 1L5HA 1J6UA 2Z2ZA 1Q1EA 2CT8A 1ZGHA 1RRKA 3TWOA 2HPZA 4C4RA 1PJSA 1R6VA 2ZIXA 4DTIA 5CFOA 3G0CA 5JYBA 5J23A 1R9MA 1DKQA 4E6PA 5CM2Z 1CRWG 3HE3A 4U6QA 5F33A 3I04A 3UG6A 3MGKA 2OO3A 3CBGA 2JGDB 1SOMA 3A37A 1E9DA 1RPNA 3IEKA 2PKRA 2R62A 2A9PA 4FDLA 4HNAB 1YQTA 2VXYA 3D3NA 4OF4A 3KQNA 5DYWA 1K7XB 3IODA 2DY1A 4DDHA 2EBWA 3U4GA 5IAOA 4JI0B 2VAXA 1C50A 1EFTA 2OVFA 4LXUA 4D9HA 5CB0A 1XXHA 3MIZA 2HW8A 2X3YA 1CVRA 2ZJAA 4LZAA 3N6XA 2GZ2A 4ZVLA 1R0SA 2FN4A 3FDIA 2OSBA 2HKIA 5EHIA 1VE3A 3CEJA 1H9AA 4PN3A 4ENWA 1W46A 2WFAA 4HLUA 5M5BA 4G0OA 3TUJC 3UH0A 1WU8A 3JATA 3BTOA 3GFFA 5JO9A 3CUEF 3EQ6A 4KLAA 3F9RA 3KUCA 2W8ZA 3PGJA 1TF7A 1YWGO 3C43A 5H83A 2C1ZA 3LCJA 1ZI8A 4GZ6A 4E46A 1A9XA 3GYBA 2QLTA 3I9V1 3ZDDA 4CBVA 1JG3A 2X5JO 4IFEA 3TOSA 2EFHB 2X0NA 5B1IA 2HCJB 3EIWA 4RKWA 2WNHA 3GA7A 1PG0A 5CW1A 5DF1A 2XMZA 1N2SA 1DWOA 2VBCA 3ND7A 2P4EA 3K0EA 3QZUA 1QZTA 4N5HX 1UJ4A 3CNHA 2ODTX 4OFWA 3RM3A 1C81A 3UJAA 1TEHA 1TLTA 4QKQA 2B4TO 2FUG1 3VJLA 1AV7A 3GLFB 3AVTA 4UXIA 1QVZA 4H16A 1TEXA 3FVRA 1JAYA 3IGFA 3GD5A 1PX0A 4L8YA 5EINA 4IS2A 5EIAA 4U7PB 1LTKA 4JP5A 1T0HB 1XVVA 1XYGA 4MQ6A 1CEQA 1DAIA 3DLAA 4MVJG 2WKQA 2NSJA 5IVIA 1VI2A 2BFEB 1JHZA 2G6BA 2ADMA 1PHPA 2A7QA 3CUUA 3SR4A 1HOXA 2XODA 2GYYA 2Z57A 3M9LA 2PGIA 1QIJA 3T3MB 4J3JA 3DE2X 4PS1A 5E6RA 2HA7A 1T35A 2OFWA 1KRWA 1DAKA 2R84A 2FH5B 3R3YA 2YJ4A 1T4DA 1YR6A 1FY2A 1Q0LA 1XD8A 3IMCA 1AC5A 4ZGGA 5CXSA 5IT0A 3ZDAA 1T2NA 2X4DA 3HXLA 3TZLA 3KSZO 3TCNA 1VMKA 3JYPA 4JJGA 4B74A 4C78A 2ODEA 3I2YX 1UCFA 2C9OA 1N7IA 2IEGA 4OB6A 4CR6A 5JV5A 1YZNA 2GN9A 1WXHA 3HKEA 1U0LA 4MV6A 4WN3A 2GB4A 3FPAA 5FYQA 2SBTA 1P9NA 4YUZA 2P4QA 1FNDA 1SCJA 3FI9A 3WX0A 3BFJA 2IW1A 2P9QA 2YOFA 4G4SO 5L40A 2VHZA 2Y2VA 2F67A 4O2BA 1XZDA 2WFMA 5JTTA 1NASA 3OZRA 3LTNC 3HSKA 3H13A 1KFBB 2QJWA 1NP7A 2TYSB 3EH1A 1SO8A 2C98A 2H2GA 1G3IA 3KU1A 2NAPA 3EC2A 1DX6A 4L5IA 3LBNA 2Q8NA 4KXFB 4RV4A 1R4MA 1NQUA 5K45A 1PWZA 2HNKA 2JIZA 4NCKA 5C5DA 1JR6A 3LPMA 3R3JA 4QO7A 3FJOA 2PX6A 3HBFA 1TDJA 4MS1B 4RYDA 3K35A 3LI2A 4FHZA 1V2GA 5J4LA 2CLFB 1UK9A 1ISSA 1CUAA 1R6BX 3EEFA 3G8CA 4RIIA 1ZM3A 2DPGA 2PQ0A 1BCSA 3MJSA 3AUTA 1WMFA 2FMKA 1P31A 3CU5A 3PRHA 4MP3A 3KV1A 5FNVA 1G7RA 2HH9A 4R16A 4BB9A 4A2QA 1FPQA 5BNIA 3TJZA 3PLRA 1M8PA 4FTWA 4OYRA 3ZJTA 1AZWA 1DBSA 3W8EA 1PT9A 5BSHA 3H75A 2O20A 2RGNA 3I28A 5L53A 3JZMA 1I30A 3IEMA 3QX3A 1ULSA 1ZH2A 2PRKA 5AKYA 5K6AC 4U8HA 1AGRA 1OFHA 1DQZA 1KEEB 3L46A 1T2VA 4LBZA 3VHXB 2WTUA 4G41A 3ZGLA 4KTTE 1XLTA 1Z0DA 3OM0A 4KB5A 2C7OA 4PCVA 4AY3A 1L5GB 4BO2A 2CKMA 4FYYA 3HCAA 1X7HA 5BSMA 4MPJA 2WSYB 3G0DA 4E2XA 2EJTA 4ALLA 2E55A 4RTNA 3C45A 2RHMA 1RWVA 2RIRA 2ZKIA 2OQVA 1NE2A 2BKXA 4EBFA 5CFMA 1Z6XA 3LVQE 1IMOA 2W2KB 2ZANA 3MINB 1YS9A 5KTYA 3M9XA 2B1IA 2CXQA 3A4TA 3RYCB 3IPLA 1AS2A 5D6NA 2FEOA 4FN5A 4DA7A 1GFSA 2B4YA 1AKVA 1LRKA 3P2IA 3ZVMA 3D6FA 4C03A 2ZUTA 2I78A 2RDMA 3IXMA 3NOQA 2BWJA 3OY7A 5SICE 1TKBA 3KLBA 1G8KA 5DBFA 4JXXA 1R9JA 4WHMA 4ZARA 4WEOA 4N6GA 1O9GA 1DC7A 1T8RA 4D96A 3IIEA 1T91A 1DQYA 1Y8QB 1BOOA 4LSGA 5K3SA 1D1QA 5I6DA 5EIFA 4RJJA 4BMPB 2AOUA 5T6MA 3IPRA 5AJVB 5AI4A 5TMEA 4UBMA 5MF6A 4LHXA 4IJMA 5JYDA 2FP4A 2X42A 5TPWA 5KTRA