4B8YA

Ferrichrome-bound fhud2
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
277
structure length
277
Chain Sequence
MKAETKSYKMDDGKTVDIPKDPKRIAVVAPTYAGGLKKLGANIVAVNQQVDQSKVLKDKFKGVTKIGDGDVEKVAKEKPDLIIVYSTDKDIKKYQKVAPTVVVDYNKHKYLEQQEMLGKIVGKEDKVKAWKKDWEETTAKDGKEIKKAIGQDATVSLFDEFDKKLYTYGDNWGRGGEVLYQAFGLKMQPEQQKLTAKAGWAEVKQEEIEKYAGDYIVSTSEGKPTPGYESTNMWKNLKATKEGHIVKVDAGTYWYNDPYTLDFMRKDLKEKLIKAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of the Staphylococcus Aureus Virulence Factor and Vaccine Candidate Fhud2.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus nctc 8325
molecule tags Transport protein/siderophore
molecule keywords FHUD2
total genus 99
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4b8yA02
4WESA 2XY4A 4K3VA 5GGYA 4B8YA 3AEQA 3BE5A 4TKUB 1G20A 2XH8A 4WNAA 4WZBA 2RG7A 3ZK9A 3PDIA 1M1YA 2R7AA 4INPA 4MX8A 1XVLA 3ZK7A 5HDQA 4OVKA 1KAEA 4TKVB 5GGXA 1K0FA 1MIOA 3G9QA 3ZK8A 1M1NB 4OXRA 2R79A 2XDQA 4GICA 4WN9A 1M34B 1L5HB 3NU1A 4G09A 4PAGA 2MINA 1ESZA 4WESB 5FLYA 4H59A 3TNYA 3MINB 4UTPA 2XDQB 4OXQA 4FKMA 1N2CB 3MWFA 1L5HA 2YNMC 3AETA 3TEFA 4LS3A 3EIWA 1G21A 4HMPA 1MIOB 2PS9A 2Q8QA 2M6KA 5M34A 3HXPA 2AFIA 1G21B 5AFSA 1M1YB 4N01A 5BVGB 2QI9F 4WZBB 4BBPA 1G20B 4WNAB 5M29A 3U7QA 1EFDN 5CR9A 5B58T 2OSVA 2WHYA 3BE6A 3HH8A 5KOJB 1QGUA 2OV1A 3PSHA 1PSZA 2OGWA 3ZKAA 4WN9B 4MLZA 5BVHB 5KOHB 1QH1B 3LI2A 4XPIB 2PRSA 1K7SN 3UJPA 2WI8A 3MD9A 4ND8B 4LJSA 3AERA 4NNOA 4M7OA 1H1LA 5JOQA 3K1AB 5JJ5A 5I4KA 1QH8B 3AESA 4IRMA 1TOAA 2ETVA 3LHSA 4MDYA 5HX7A 1H1LB 2PS3A 1QH8A 3AESB 4FILA 1PQ4A 2AFIB 4WZAB 2XUZA 3EIXA 3K1AA 4TKVA 3AEKA 4XPIA 3AETB 4ND8A 4TKUA 2XV1A 3AEKB 1KAHA 5M3BA 4DBLE 3MINA 1FP4B 4H0FA 2AFHB 5CX1B 3AEUB 2OV3A 3CX3A 1K2VN 5BVGA 3GI1A 4MO9A 3U7QB 4UTOA 1M1NA 1N4DA 4INOA 4HN9A 2PS0A 5M2QA 3HJTA 1FP4A 1K75A 5CX1A 3AERB 5JG7A 2XQVA 3PDIB 4UDNA 2Q8PA 4G07A 2O1EA 3TLKA 3ZTTA 4CL2A 1KARA 1QH1A 5KHLB 1N2CA 4HMOA 5BVHA 5KOHA 3PSAA 3MFQA 3R5TA 4FI3F 4FNAA 4UDOA 4NNPA 2X4LA 3AEQB 4PM4A 2YNMD 2PHZA 3R5SA 2M6LA 3MWGA 5JPDA 3AEUA 4WZAA 2MINB 2AFHA 4HMQA 1N4AA 1QGUB 1M34A 1N2ZA 5KOJA
chains in the Genus database with same CATH superfamily
4PZ0A 5DE3A 2Q4RA 4CTNA 3E82A 2X4GA 1CB0A 2G72A 1Z5WA 2Z2YA 2SCUA 7GPBA 2WE7A 2JHPA 2FPMA 2WYOA 1NLMA 2EYUA 4FE3A 1P0IA 3L93A 3PDIA 3WLFA 1QHNA 2DT5A 3IVMA 1W36D 1YI0A 2JFPA 3AONB 3RRNA 3WGMA 1XOIA 4P4SA 3K6SB 4FFPA 1MAAA 2YRXA 1E4EB 1R5BA 3BORA 5FBZA 3Q8LA 2PU7A 2VP6A 3B6IA 3U4AA 3LWBA 3ADPA 1V1RA 2HTEA 3HGMA 1NV9A 3FFXA 1NQXA 1S2IA 4RGVA 3ZHTA 4UNPA 4IZOA 1A2BA 1D5WA 2CL7X 3B6ZA 3KTAA 4PSVA 2P4HX 2R4QA 3A1VA 4ABYA 1FIUA 2C5BA 4MMXB 2YYSA 3NUGA 5J2TA 1N1EA 1O94C 1PJ4A 2NO7A 3VNUA 4ZMBA 1H8EA 4F3RA 4AWAA 5A9SB 2KPOA 3R41A 4R98A 2WHPA 5DLDA 5HA5A 3L6EA 4PGFA 4S1VA 4HZUB 5CU7A 1Q1GA 1K7FB 1OHHA 3K0FA 5G1NA 3ANXA 2Q8QA 4RY9A 4U7FA 2C7VA 3PG5A 4OLBA 2XXBA 3WWOA 3KQYA 1M1XB 3FNEA 1XZDA 1EG7A 6Q21A 4P2GA 5JALA 3O9ZA 5EJEA 4IQ0A 5C52B 1ZNYA 5FI5A 1O96B 3BEDA 2M6RA 3M4NA 3O75A 2W22A 1NM5A 1FYWA 1SCUB 4QT0A 4DA0A 3HR4A 3U3XA 1HFEL 1UP6A 1A72A 4GM4A 1U7UA 2OG1A 2I22A 4KDFA 4NECA 4L9RA 4OB8A 3K09A 5HS6A 2DUNA 4J2OA 1GEEA 1QKJA 1DCMA 1UPFA 2IP2A 2W4MA 2XHZA 4XWYA 4F11A 4X54A 4GP9A 4WECA 1XZPA 4K6GA 1B00A 4BGDA 3FMGA 4BNZA 1PEAA 1II8B 4I4CA 4CUJA 1HUQA 2VJPA 2ZUUA 3A3YA 3G9TA 3R3ZA 4N7JA 10MHA 4I5DA 3FI0A 4RSRA 1JJAA 1CF2O 4JOSA 3JARA 4W5QA 3M83A 3TG2A 3T0GA 2OZKA 4JBWA 5K3OA 5KU1A 1U3GA 2RE8A 1O95D 2AI2A 4OLFA 2AFIB 2ZR7A 2GOYA 3GH3A 4FQ8A 2G36A 4RXUA 2C7PA 2DP4E 5I9BA 4PG4A 1BRTA 1ZNQO 1FSFA 1U7ZA 4MVJG 4YONB 3EBOA 3IFSA 2E9SA 3JZDA 1QFZA 2VYVA 2CUNA 3BIFA 1QGOA 2PWPA 1SIWA 3CKKA 3O1LA 2R8BA 4RLFA 5D7NA 2NO0A 2WTUA 4YUVA 4AO7A 3S70A 2Y0PA 2IW3A 2UZIR 5HK9A 4FOTA 3WO1A 4YMLA 3H2JA 1RXSA 1DQPA 2BKUA 2AC4A 1CIPA 2J6CA 3MWKA 2DQZA 5CX4A 2A1UA 1UR5A 3AKDA 5ADWA 3GRUA 1J2RA 2OOKA 1R6XA 2R8RA 1Y3IA 1GL9B 1M0TA 2VP2A 2XQVA 3JZMA 2D2EA 2CYAA 3AU9A 1D6MA 4LCEA 3T7SA 1R0YA 1WABA 3C7KA 1X19A 1EJ6A 4ITUA 1N2CA 2HA4A 2A6PA 2QYHA 3CE6A 1RI5A 2EJVA 3FRJA 3MFQA 1FDIA 2IEZA 4HOYA 3EEYA 1J8QA 3BG5A 1ZRSA 2H7CA 2VDPB 3FGNA 4MRNA 4IMRA 4LF7B 2BHNA 3KZNA 4OGGA 5GONF 1R3DA 3GT0A 5ALGA 5CDFE 4EG5A 2W2LA 4FZJA 2R5WA 3UK2A 3UKOA 4C7XA 5CTJA 3OLZA 4NI5A 5HG0A 2QRUA 2XHEA 3EYAA 2BE7A 2BFPA 1M54A 2XUDA 5GM1A 5L95A 1VIVA 1X1DA 4R0NA 3UC5A 5F3DA 1A27A 3EZNA 3HCNA 5K0LA 4RGQA 5GP1A 2IBSA 1XJWA 1LJUA 3C0KA 3KIPA 4FT2A 1IDN1 2A8YA 1XF1A 3EDCA 3OZEA 3UB3A 2AV6A 3O31A 4R71A 3M33A 2FMXA 5EMJA 1J6UA 2G9NA 5SY6A 1KRHA 3NOOA 8LDHA 3QY9A 2YICA 5J4HA 3G0OA 3AKYA 4NESA 1A8UA 2WF7A 3WMFA 3GROA 4LN1A 5JXHA 2FN4A 2C1ZA 2HLDD 2IYVA 3OF2A 1RC0A 4KRXA 1YR7A 2H85A 4O4HF 2JFQA 4RIGA 2W5UA 3LG2A 3GXOA 2JFBA 1FLNA 3OCXA 4D3YA 4FDTA 4TN1A 2NN3C 5BOSB 4MEAA 1GGNA 1UXHA 4KWTA 1X8XA 3OZWA 4NWIA 1LW7A 1D6NA 4LNHA 1TM4E 4NMLA 2ZJYA 4YCJA 3HUEA 4LZZA 1PT6A 3T7RA 3GJ8A 4IQ8A 1R3UA 4HD8A 4MAAA 5I5GA 1KI6B 3KZXA 4J1SA 5DW0A 3WDMA 1VB3A 4P7JA 1KI7A 4OI1A 2I99A 3I3OA 2X0DA 3UYLA 4C0HA 4P3PA 3LC0A 5AHXA 2NM0A 3MS7A 2I29A 3NYRA 4HYQA 4E2XA 2O07A 4UFPA 5KNCD 4E30A 3L49A 2VDUE 2MR5A 3JQ8A 2QE7A 5IKMA 4Q16A 2PZJA 4OQNA 2V4MA 1ODIA 3NM5A 3VR3D 3VPCA 1JG2A 2KLBA 9ATCA 5IYZB 3KQTA 2OQRA 3O1IC 3GGPA 4AN1A 2JFXA 3ISTA 5IJZA 1QHHA 1SXIA 3B12A 4XFJA 4XUEA 1ZGCA 3OO0A 2F1IA 4QGGA 2C2XA 2FSIA 2V7UA 3LYHA 5GY7A 4DIKA 1P9LA 4A82A 1T5OA 5TF4A 4IMPA 4KV9A 4CMIB 3K2QA 3E84A 1QRSA 1EI9A 5BPFA 1CDZA 2H17A 3K1AA 3HDYA 4HDQB 2A0YA 2PZFA 2O2YA 2Z57A 3SDSA 1TF2A 5F3WB 2I4RA 2FEXA 2MYUA 5BQOA 5MGBA 2JH3A 4O4IF 1TC2A 4MK4A 4NXMB 1A9QA 1QGYA 1GPMA 1LCIA 1AF7A 1TAHA 2FW9A 2J5QA 2Q62A 2WF8A 1XROA 4ENQA 2A5DA 3EIEA 1V8PA 3QX7A 2L69A 3ZXSA 4Z4GA 1RJDA 3AJ8A 1TYEB 1USKA 1Z35A 2A0FA 2PH3A 1N5LA 2Z2XA 3BQ9A 4YQEA 3K20A 3U13A 1KI6A 1DWUA 3HZHA 4ZTUB 4MJXA 2GEDA 1X39A 4DDTA 1J0DA 1YULA 1FP4A 1YR6A 3N05A 4CMEC 3V55A 1PX0A 2ON6A 3R0ZA 5EFZA 1VYUA 5FIUA 2R4UA 4D8XA 2ECFA 3I53A 3QNMA 1IUPA 1Z5VA 3B60A 4BFXA 3UWMA 4K9LA 4JENA 1SCDA 4NHEA 4ZT6A 2ZQ5A 2YRWA 4REQA 1RABA 3V2IA 2IZ5A 4CUKA 1IY2A 2Q4EA 3AHHA 2HWYA 2ODQA 1MABB 2ZIEA 3LPAA 4MV4A 4K7JA 1MFZA 2KS6A 4IYRA 4PYNA 4Q82A 1K5PA 2H57A 1UMCB 1UKCA 2J08A 3TZLA 3DLBA 2GYUA 3U7IA 1X74A 3K5IA 4V0NA 4BB9A 4KACA 4JS0A 3P4UA 4NOJA 2YIJA 3AEQA 3BE5A 4LYEA 5HF6A 3GCZA 1WF3A 2V7QD 3TVDA 4FIDA 5DHRA 4CQLA 5CPFA 1JWLA 4PLPA 2B78A 1Y3HA 2PX5A 5KYGA 1XWIA 4M21A 1WDWB 1YMUA 3W34A 4EKYA 1NW9B 3DV2A 1SXJC 4C6TB 1P1HA 1SM4A 5LKRA 3TLJA 3R9KA 3BTUA 4JSTA 2ZIAA 4YJ2F 3UMCA 4DWVA 3EVZA 3RQSA 1UWKA 3EQ2A 3RKSA 2HBZA 3WYNA 1IJBA 1W8DA 1A7JA 2C00A 2V7BA 4QQ8A 4CU2A 2FUKA 5CNKA 1ACJA 1KOLA 4F3TA 2QTMA 4XD7A 3D6UA 3QH4A 3U3KA 1XVTA 3EVTA 2I4IA 4DG8A 1QP0A 2E4WA 1Q14A 3TNDA 4Y18A 2GXSA 4F9EA 3NR2A 1G4HA 4QFMA 1XL0A 3OZSA 2GZDA 5AO9A 2XNSA 4O2AA 2OHFA 4EEXA 1FBNA 1K8QA 2RHGB 3EUEA 4MHOA 3SC6A 4Z1MD 2MSWA 2H3HA 2I33A 3DMNA 3ZEAA 3G8AA 5K6TA 2I2AA 5E4YA 3LHIA 2XSZA 2DLNA 3ESAA 5F5LA 4LX0A 2IPLA 4MIEA 3ESCA 3IBSA 2QR2A 1IBCA 3JVIA 4RSGA 5B1DA 3WO0A 3ZHSA 3TLYA 2XMSA 5K4GA 1T2VA 3W1WA 5C5IA 7MDHA 1XXHE 4ZCSA 2G9ZA 1OY1A 4WZBE 1E2MA 5BSUA 1PZEA 4AX4A 1XVUA 5I5EA 5JSFA 5EZYF 1UMBA 3FSRA 2BF7A 4HNUA 4ZOEA 3KQMA 3RIMA 3WG9A 3SC3A 2L18A 4TYYA 1QLHA 3BZUA 3OCJA 3TB6A 1KC1A 2DWUA 4IFBA 4M0MA 4JLUA 4EOGA 3MAJA 1DRUA 4LHSA 4U0KA 5IANA 4LECA 3EXAA 1UM8A 2BRUC 3PD1A 1LK7A 3WYDA 4R1QA 1ZGGA 2XVXA 3I45A 1BRMA 1Y48E 3I9MA 1OXSC 2BEUA 1KF0A 2PO7A 3IILA 4GQAA 4RQTA 2VNJA 3E3OA 3QELA 4BLQA 3AETB 2VSYA 1DBVO 3SZUA 5KDOA 1MB4A 1KS9A 2FWJA 2ZYRA 3QYFA 2YXBA 1EHYA 2WUDA 2XA1A 2CVZA 1BN7A 2B82A 2W2NA 2PCJA 1JU3A 2ZU0C 2EF1A 4TOIA 4TYPA 5IDYA 3BWBA 3USES 2HJSA 5I7RA 2FA9A 3EPLA 1CQIB 1W4CA 1YJQA 3ZDQA 5TMPA 5KS2A 2PXHA 4LNUA 4UU0A 2C57A 1QHFA 4ZVTA 3LRXA 1TKBA 4RK5A 4PZEA 1N7JA 1I2CA 1L4GA 1YL5A 4B3XA 4C88A 4UM9B 2VBFA 2BJVA 4MV7A 3RT7A 5KEIA 1TM7E 2JJMA 2P3LA 4MH0R 3VTAA 3KBBA 5L7YA 2C95A 1QPGA 3GP5A 3S1SA 4IDEA 3DKKA 3A0RB 3VISA 4R69A 4IOKA 4CF6A 5KX5F 4EZIA 5ESWA 3TBFA 2B61A 4D2IA 2B20A 4JOBA 3TNFA 1XA3A 4BCBA 1LX6A 1A9OA 2JLCA 3B48A 3I8XA 4FIZA 3QW2A 5DV9A 1PJTA 5JE8A 4BFLA 3MT8A 3ZZ1A 4H6WA 1JKIA 1N5DA 1R0SA 3FKJA 1XXHB 3ZE9A 4BDTA 3JQFC 2D5BA 4RZSA 3HSSA 1WEKA 1R27A 2GZRA 2Y76A 4NOMA 2M2IA 1XQ9A 4C05A 3A7DA 4KR2A 1EFHA 5ETJA 3WMEA 4AL4A 3TDMA 2P9FA 1R16A 5FI3A 5FR2A 4GD3Q 5AI9A 3HCWA 3WJ2A 1AT1A 2WFAA 1MX3A 3M2TA 2CJWB 3NAGA 3JARB 4CIBA 1IUNA 2D6FA 3DSRA 1B8UA 2FPGB 3LOUA 3IT1A 3PWZA 4ENWA 3GRRA 4RESA 1PL0A 4AJIA 4AF7A 1S89A 2E89A 3STXA 3UIEA 1P80A 1JHRA 2VRNA 3BXEA 3QLJA 3ILSA 4ALIA 1ZAKA 2C9BA 2CWDA 4H1TA 2RGUA 4TT8A 4O0LA 5EE0A 1L5HA 4EZBA 5BWBA 5HUHA 1G9TA 3TR6A 4F71A 2OO5A 5EZSA 3C8DA 4PX3A 5B2FA 1U8YA 3H6HA 3JQGB 4BFZA 1JH8A 2VAPA 1BTOA 2QU7A 4I0WB 3VR4H 4A03A 2EHDA 2HRRA 2OHOA 1YVEI 3PJGA 3TOVA 1ZCJA 2R6CA 3IVXA 3SE0A 2DOKA 4BGVA 1T2AA 4C5AA 2PE5A 3FVRA 4INJA 4Y0NA 3BXHA 3LNCA 3ZZ0A 3UXYA 2I4TA 3I6YA 1DCFA 4RVDA 1NTRA 2TMGA 4CG0A 3EGCA 1U81A 3A9TA 2WRZA 3HYRA 3OZDA 4TS9A 3U3MA 2JFWA 1TAQA 3V97A 2E3JA 2LDXA 4K9MA 3Q6NA 4HNVA 5H9WA 4DQDA 2QEQA 5A0TA 3D5QA 2QUJA 3JSAA 1NBOA 4PZUA 1O87A 1E62A 3KPUA 3R1IA 1V2GA 2UYCA 4G4GA 4HQNA 2AHRA 4TV9F 1C4XA 3EZ9A 4KXFB 2FWMX 3RYFB 3AQIA 4P08A 2FEMA 4X9XA 4TWIA 3FLAA 2C7GA 3LLSA 1JBQA 2QP9X 4G8JA 4JC4A 4BV2A 2GN1A 2WMDA 3TQCA 5IT9A 4FW8A 5SZKB 3MNFA 3ZVKA 4C7KA 2YBEA 4GVXA 3ZVRA 4QEDA 5AK0A 1QLWA 2A33A 2PV7A 4I9HA 1CDOA 4MUFA 4NVRA 1X87A 2X2OA 1VBKA 1DDOA 1KJJA 3DAFA 4XI9A 4B4KA 5EEGA 1IXRC 1Q1NA 2YJ5A 3WLKX 2WAYA 3PZBA 4YRJA 1E5XA 4KN9S 4MO9A 4Z2YA 3JWIA 3RTBA 3AR3A 3KEMA 4DIEA 5ED4A 2IHNA 3LZ6A 2QV0A 4EX6A 1ODCA 4QBKA 1LI4A 5HFNA 5T41A 3ZDRA 4LXIA 4JWTA 2C8LA 2Q5CA 3AERB 4Q4HA 4D4HA 1U8FO 3AVQA 4WBNA 1FXUA 2X1HA 4D9CA 4MQEA 2A3NA 2ADMA 2H1HA 3O3CA 4J07A 1E9RA 1SD5A 7YASA 2PUJA 1SIUA 3CIOA 4HMOA 4QWWA 5KX5B 3VI3B 4L0CA 1IIBA 3VH4A 5B4VA 3DT9A 4BL5A 4HNQA 1DX6A 4GOJA 4BLRA 1EK2A 1GSIA 4F91B 3U3RA 3GLTA 3H0EA 3P9RA 1J5XA 2R62A 1UOQA 2XMRA 1U80A 4FXPA 5B7PA 3BIOA 2AGVA 3AFMA 4GKKB 3QJGA 4EEKA 4UATA 4P54A 2QD1A 1IVSA 1J09A 1JI0A 2D54A 3OQIA 4MWCA 1WMSA 3C5WP 3HN7A 1KQNA 1YE5A 1LKZA 1Y4DE 4DHEA 4ZALA 3VAZA 5L6LB 2ZITA 4A8JB 3V1MA 1KBZA 3ANSA 3ZHRA 2SKEA 3ILYA 4JWKA 5IH7A 3I39X 4JC5A 1EBBA 4DSUA 1ODFA 2VS1A 1G7TA 1E8MA 2E85A 3ULKA 5KYYA 3ISVA 2D1QA 2BTQA 3OEEA 2EKQA 1UDRA 3QVOA 4XE5A 4UTPA 1J2YA 4FEAA 3UJ7A 2GA9A 3UV7A 3BIXA 1GDTA 1GPBA 4A6XA 2J5XA 3BWEA 2ERYA 4IZHA 5UKDA 3OWOA 2B1RA 1F6BA 3HCBA 3DT8A 3W78A 3I3SR 4IIVA 3H5TA 1KMQA 3ET4A 4L9AA 3S2UA 4DT1A 2UAGA 1LPAB 3LTEA 5BSGA 5CFPA 3QUAA 4AIRA 3A6PC 2BBTA 1O5TA 4I5GA 4E15A 2VRCD 1EUDA 2BKAA 3FGOA 1SK8A 3L4SO 4OXKA 5EKTA 3QP9A 4X00A 3PJDA 5CXQA 2CK3D 1M1YE 1BQ3A 2NO1A 3LZCA 3KL2A 1CV2A 1EDBA 3QEMA 1H94A 3V48A 4K26A 1YDMA 2G7ZA 1DAOA 3ON5A 3DMFA 1R18A 4NDZA 4B4DA 2QRNA 4HR7A 4YMTA 4R8RA 1B8NA 1D1TA 1VCIA 5LPNA 1R1DA 2BMFA 3FFTA 4M8SA 2WJ3A 2FN9A 2LRHA 3FVQA 5SYNA 4AO8A 5IXSA 2GCGA 2F8MA 3U3ZA 2PUCA 1DIGA 2A5JA 2UU9B 4KXNA 2OKCA 3KUXA 4UE6A 1N5OX 5DYGA 4BB0A 1UZNA 2VDRB 4I6JA 2YJ3A 3M4JA 5ER9A 2GEVA 3ZV5A 3C5VA 4OQZA 5DHAA 2F8LA 1F2VA 4GRAA 5EIAA 6LDHA 2GDJA 1X92A 3GW8A 1NDQA 1SC1A 4NS1A 1DQNA 3BSWA 3CNHA 3MRVA 5LVAA 4DIOA 2WSBA 2BFWA 1TFUA 2M98A 4PO3X 3D3KA 5AM0A 3T41A 3W2GA 1SXPA 1L1EA 1Q92A 1XDSA 4P32A 4MYCA 1V1MA 2BEVB 2PBRA 1JLRA 2Q1SA 1QZTA 2VK4A 5EKXA 2IS6A 2EW1A 4OJKA 2AZTA 5KYXA 2BW0A 3Q8WA 4AKIA 2QN3A 1EGHA 3ECSA 3U7JA 3ZQ4A 1I14A 2HBRA 2QPLA 3G0BA 4Q6BA 5A7GA 4Q9JA 1PR4A 5KREA 3O91A 4H7DA 1HFWA 2ARKA 4Y30A 1FFGA 3R6TA 4HWKA 5G0WA 5J2UA 3U9TA 3DYIA 2QSZA 4UW9A 5WRFA 1XV5A 2W98A 2DJ5A 2FK7A 2O2GA 3KQHA 2ZTSA 4L5JA 1KDYA 1D2HA 2FUG6 1JAIA 2BD0A 2ASEA 3TLKA 2AJDA 4TYMA 4J1TA 3U7GA 4RH0A 2H2GA 3HO1A 4Q24A 1VPLA 3SR0A 2B7BA 2VLBA 3HCRA 2FOIA 1JG7A 2CDBA 1NP7A 1PK8A 1HYGA 1Z7WA 2PNFA 3ROEA 1MO4A 1T9HA 5CLHA 5L4SA 3LL4A 3DNPA 2JK1A 4CF7A 1DKLA 1YASA 1I1OA 1XB2A 3UVEA 3WYFA 1VGVA 4OHYA 3BWMA 3I5XA 4QVGA 1JDZA 3RLFA 2GTHA 1FRZA 4ZK6A 2Z9DA 1ZD2P 3BB4A 2BIFA 3HLKA 1WXFA 2SKDA 3IKLA 1VE7A 2XY4A 3F78A 3L7MA 2LXNA 4NDNE 5K7SA 1AGYA 1V8DA 2YZ7A 1WUHS 4L6AA 3H2SA 5EWMA 3R74A 2JARA 4HRXA 2XZOA 4V0QA 3UAGA 6REQB 2OR3A 1ENZA 2CNDA 3C3CA 3NIBA 1EJBA 3ICOA 3LFTA 3N1UA 4NOKA 4DADA 2PKEA 1I94B 5COQA 3GLKA 4Z51A 3TTVA 2BHRA 3DHNA 3F67A 3I30X 3M6AA 5BRNA 1UKZA 1GZDA 4IIHA 2C2ZA 5IVHA 3F7OA 2XOKA 3BM5A 1Z3IX 4I2VA 5IHPA 2C3YA 2J85A 5KPJA 1OBOA 3FLEA 1J2JA 2JATA 2OTCA 1RQPA 3L0IB 1C8BA 5GIPE 4U5XA 1EE2A 2IUYA 1EK1A 1E8DA 3SY8A 1PFKA 3PHJA 3OPXA 5CYPA 5KI6A 4IJUA 3V4ZA 5E38A 5BR1A 5LQKA 2A1IA 3KT8A 4NZNA 4R9NA 2QU8A 3MRXA 5CB4A 3H9BA 5I51A 3RROA 4F9GA 3ECAA 4ZN6A 3RC7A 1GRNA 3RW9A 1JHAA 2WJ4A 4E31A 5KQMA 1C4KA 4E1AA 4GOMD 5JCOC 1I3LA 2IIBA 2VBIA 2VHXA 5ECGC 5IYZF 1RKUA 3TB4A 3I2GA 1F1BA 1XTTA 3B3JA 4OFWA 3SZMA 2AN4A 3AIMA 3ZXUB 4D25A 2V0CA 1XZEA 4LDNA 2LWIA 1QYVA 5AKJA 4LJKA 3T0IA 3WZLA 2X42A 5FH9A 2CUKA 1EG2A 4GVLA 2J3DA 1IHOA 1PRYA 2NZXA 3LI2A 4L22A 1E3WA 3U1TA 3WLEA 4CBVA 2LCFA 3PS9A 4XWOA 2P3OA 3DL7A 2WJAA 2HHHB 1WW2A 2FH5B 2V0NA 3OUTA 4ZK2A 1MAWA 4IJ5A 3EIQA 1V1JA 1JSZA 2Q07A 3WBFA 5J40A 4MW7A 3RIYA 2G5TA 1ZQ9A 3E27A 4A3SA 1N2GA 1WXIA 4G86A 3VDRA 1PZXA 3KT3A 1ZL0A 3CR3C 4YJGA 1HX7A 2BTOA 3MMXA 4KO1S 1P2TA 2D7DA 4YHBA 1XWWA 1QNFA 3PNBA 2XUZA 3T3DA 4KXLA 2AXPA 2XNJA 3OOJA 4MYDA 4OJQA 4PSCA 4XD2A 4MP3A 5AVKA 2D4AA 3Q72A 4Q1FA 2WHPB 5JXIA 4F4CA 4GZMA 3KVOA 3RARA 3BGIA 1Z28A 1Y1PA 4GKAA 1RE0A 2LDBA 4P3XA 2AQ8A 5D84A 3RS5A 1KYIA 3MB8A 4K9KA 4XDHA 2WM8A 3M5PA 3QE3A 1NA5A 2Z5FA 1U8CB 4MKZA 1VJRA 2VSQA 2O2HA 3TCXB 4EO4A 2PEZA 4Q3KA 1E79D 2VHUA 4FB5A 4Z7JA 1X0XA 3HHPA 5BSMA 1YRBA 1G6HA 2PKYX 3PA6A 2GZ3A 4HSEA 2ODWA 4ITRC 1J7KA 5JD6A 1K75A 1KQPA 4R2MA 4V39A 1SG6A 1WXGA 1C30B 1Z12A 5F1PA 4I1UA 3ND5A 1G8AA 1QK4A 1EAYA 4IQGA 4UEQA 3RVKA 3TLZA 1KL7A 2CMDA 3AJAA 2FLWA 4OOFA 4BX8A 4WADA 4EJ6A 3QWBA 4OH7A 1I4TD 1KGDA 2H6EA 1NFRA 2QN1A 1RIIA 3ZLJA 3AJDA 3SSNA 2NO9A 3PUYA 4E22A 1THMA 1KRWA 1VJTA 4GYWA 1ZK2A 3N6RA 2F3PA 1UPCA 3VOTA 2QIPA 5J63A 3GCGA 1DIHA 4FW9A 3IJEB 3O74A 4TKUB 4DV3B 1KO4A 4RDIA 4ZT2A 2ONJA 1ABEA 4R0MA 1M76A 3RT1A 2ZE7A 5JBQA 5KC9A 1E32A 4KGDA 4MQ5A 1Y6QA 5IMBA 3V4RA 1DNPA 1G8PA 1S2GA 1SMKA 4CCYA 4BWGA 3B5IA 2H07A 1JFLA 3WRXC 1ZMBA 3DAGA 1QVVA 2OO3A 2ZJ0A 5ULLA 2Z3VA 4YMUA 4Y6PA 4PRZA 5DHQA 2ATCA 4A92A 1MQ9A 4J4TA 1U1CA 3O8QB 2ID7A 1GYQA 1FU4A 3MINB 1BCSA 4BO8A 5TS3A 2GPAA 2WNSA 3UGTA 1AO3A 5GIOE 2A92A 4AM8A 1ITZA 4Z2AA 1SKYE 3H84A 3CF6R 2NLOA 3DW1X 3T5CA 2ZUEA 3FCCA 1Z0UA 3CZQA 1YA6A 2H59A 2OC4A 4RCVA 2P90A 2NZWA 1XA0A 2N46A 4JB3A 4AJKA 4EHIA 2AKYA 3OFSA 1Y8CA 2VIIA 3IESA 1K5DA 4J91A 1TEVA 3TRIA 2B30A 4ENTA 3V46A 1IEWA 1HT0A 1HKUA 1KO1A 1QHGA 1Y5IA 2VSFA 1QANA 3RFUA 1CS0A 2MR6A 1J07A 3K1TA 1R6BX 1S8OA 2FPPB 5L3QB 4NLLA 3RHTA 2ZREA 1J8YF 3NC0C 4MW1A 1WKVA 3UKDA 4ENRA 5AVTA 4XGQA 2FKAA 4L4SA 4A15A 4FNGA 1GZSA 1NKSA 4REMA 4I1OA 4MCAA 1NJ8A 4G9EA 3VM6A 4KR3A 1XHEA 3O90A 3TEJA 2YJ4A 3AIOA 3EXIA 4PNPA 2V5AA 1K7SN 2J9FB 3JQ9A 2HMTA 3G1UA 2WI8A 3M3DA 2Y4OA 3DOCA 1X13A 2J3LA 5BXQC 1O0SA 5EYPB 3VZBA 4KR7A 2CNWD 2W6CX 3D54D 1H9CA 1GSOA 1R8YA 3AF4A 3BH7A 5EUCA 3KXPA 4RF4A 3CSDA 4S1TA 1U2GC 5AKLA 4QODA 1JQ5A 4KVAA 4OEHA 5FTMA 5I8PA 1G2OA 4I4LA 5LMNB 4G8DA 3S1AA 1SOMA 2QZZA 1AMNA 3LPLA 2A4MA 3ZCXA 3FTPA 5LYJB 3WDKA 1JAZA 2WTBA 4YP5A 3PC6A 4ADSG 1TCCA 3EE6A 4LQDA 1GSHA 1TM3E 2R7LA 4EA8A 4C78A 4JEMA 3FTNA 4K88A 1ID1A 1UBSB 5DTIA 4HDRB 5IK2A 3ZWMA 2FG5A 1TI7A 3WC4A 1TJNA 3O8QA 2W2TA 4A6EA 2D13A 3SYRA 1PUIA 1AVTA 5BVGA 4Z9BA 4YIHA 1H3EA 3H87A 2QUBA 5AI6A 3E0XA 3AWDA 2UUOA 1R4MA 2X0RA 1N6RA 2C84A 2CNKA 2IW1A 2XEXA 1WHTB 4IZ6A 2JFZA 2C5GA 1GCGA 2ZSKA 3CWCA 7MHTA 3EXEA 3NT2A 4YFYA 1DKNA 1DQYA 2QG6A 3EARA 3I6MA 3P26A 2R1ZA 3ZTTA 4B9AA 4QXAA 5AOBA 2ZYWX 1FVXA 1GNQA 1TVEA 3GGGA 3L4BC 4FGWA 4HATA 4MV1A 1KEUA 1SUWA 1T0JB 3PWSA 8GPBA 3SVZA 4CCSA 7AT1A 2IGBA 4P83A 1T9BA 1JDBC 5CVEA 4HNAA 3DC7A 4GBMA 4GPBA 1P9OA 1N4AA 2JASA 1E4OA 1X70A 2ZDQA 4DJDC 2XGJA 4WOJA 5I9MA 2VQDA 1FP1D 1DAFA 1G41A 1YF3A 4I2NA 1TYCA 4C0BA 1M6YA 1DOZA 3A58B 5IXJA 1UK8A 4JU8A 5CK4A 2EFEB 2FYTA 1I5RA 2VH2A 3L40A 4NFHA 3C4VA 4BWVA 3GQBA 2A9JA 1GNSA 1K0FA 3IVRA 1EIZA 5CJ2A 1F4PA 3ONFA 3RTAA 3TLMA 1M1NB 3QKUA 3DQQA 4U2BA 2OM6A 1K9SA 4DARA 4GICA 2WOJA 2YDXA 3F49S 4G1VA 4GMKA 4GOKA 3ROPA 1SO8A 5EPUA 3VKFA 5D1NA 3ZD6A 4B3GA 1AXGA 1Q6YA 1Z5UA 4G81A 1B7GO 5ESXA 1W5BA 3MOIA 5BWNA 2CKDA 1NE7A 2OHGA 3R8CA 4OQMA 5L51A 3BFPA 4J3FA 3A6DA 5IAKA 2O23A 3SSOA 1C50A 3BF8A 5IBQA 2I9KA 3RB8A 2PX6A 4NEQA 1I4LD 3HCOA 4R1NA 5D3QA 4ZICA 2X8BA 3ZJTA 4MGIR 1G3MA 1L4HA 4MV5A 2ZYVX 3I8SA 5EE1A 1A97A 2HT1A 3M82A 1FDRA 2HIAA 1ULZA 4I4IA 1JMKC 3FOZA 2FU5C 3C1AA 1CF4A 1G19A 1IRIA 2HPHA 5A71A 2OFFA 4D9KA 1W85B 2QTNA 1W49A 4HFNA 4XB2A 1AKYA 1OX5A 4PNHA 5COAA 1YB2A 1W7AA 3BVPA 2PN1A 3FDIA 2XTZA 1O54A 5HQJA 3PSHA 3VR6D 5HYVA 4OY3A 2PM8A 1Y34E 3O4HA 3PR1A 5B3KA 2OFPA 1P2SA 3F3MA 4ZVRA 3LX6A 4LXQA 4EG4A 4JLMA 5IN4A 4ID3A 3OU2A 4L3VA 3K5HA 3N0RA 3MMSA 2F6RA 5L40A 4DC1A 3UUWA 5ALJA 2EAUA 2WZCA 5JJIA 3EIFA 1LPOA 2FFAA 4YJDA 1NUSA 3MTBA 2GPJA 1LLUA 3DL2A 5GZ3A 4BGUA 3UQYS 3CBQA 2RJ3A 3TR5A 3NASA 4BV8A 1WB6A 4DM4A 4YV7A 2RGNC 3PFNA 5GVRA 2X6RA 3D1JA 3EFOB 4GI7A 1CZOA 2FPIB 4MUJA 5C8YA 3AHIA 5FXMA 1YJBA 2ZRAA 2CLKB 3RVDA 4US1R 4MWTA 4F38A 5CFMA 3D6NB 1KFCB 1NI3A 1RZ3A 4LBVA 1C7ZA 2QQ0A 2R6FA 4PE5B 4CTJA 1NVWQ 1KIFA 3E03A 1GNLA 1LRJA 3MWEB 4XTCS 3TQSA 4EFKA 1YXMA 3G82C 1MZVA 3OA0A 3ADBA 2GDZA 1YBHA 4BZQA 5BSFA 2EF0A 3LQQA 2YRFA 3LX5A 4L08A 5IP5A 3WQRA 1W59A 1Y98A 4CMJA 1YFKA 3UK1A 3EGIA 2VOJA 3GZ4A 1T10A 3AUAA 3AI1A 1ESDA 1M2OA 2YMPA 3L5OA 5DXJA 4HDMA 3T35A 3VU0A 5BMVB 4G5RA 1NDHA 2OGUA 4TUYB 2C4TA 1O6ZA 2H7YA 4PANA 4X6LA 4BEJA 1TMYA 1J90A 3MWDB 4G6ZA 4ER6A 3UCFA 2ZZMA 3GJTA 1JPJA 3DULA 4R1SA 5IT5A 4ONEA 3B3FA 1R9MA 2F7SA 4C4AA 5IVPA 2HSJA 1DJMA 4UPEA 3PTAA 4XX0B 1DX4A 5E7IA 3KQQA 4REQB 4DA6A 3DB1A 5BUQA 4XWKA 5CITA 1UP4A 4QHSA 4Q4DA 4QXOA 1GCUA 1OREA 1M2WA 1PT8A 1GR0A 1CR0A 2G71A 2ZATA 2QLNA 1Q21A 2ZYDA 3FM9A 3HCCA 1M2GA 4TWJA 5H9VA 5IJ9A 2IGTA 5DH9A 3CRNA 1EZZA 3RGGA 3CF2A 3MYYA 4E7PA 1C1YA 3KEOA 2F9LA 2XQKA 3EF3A 1PT9A 3FIUA 3QVSA 4WN9A 2W6PA 4JA2A 3A3OA 4PO9A 2I4LA 2WIDA 4H59A 2L42A 1VL5A 4KBFA 3K30A 2QD3A 4LFCB 4AB1A 3AC0A 2EV9A 5MN4A 3I52A 1SUIA 1N5JA 4YALA 4AS3A 4LJ5A 5LZ5A 3U3JA 7REQB 1DEOA 1NBME 1A2OA 2I6FA 4A8JA 2IS2A 3P0JA 1NMXA 2WJVA 4JROA 3SQOA 4DDHA 1NQOA 2O0HA 3PNYA 3EXEB 4IIGA 3ROXA 4MUKA 1PYGA 1CJCA 1N2BA 4ZANA 4R4JA 4BC1A 1ECBA 1FFDA 3DVSX 1U8XX 4ZODA 1H5NA 1PJ8A 1W85A 5IT4A 2ANBA 3NKLA 5EJ5A 1W73A 2Z8YM 5CA0F 1IM8A 1NWHA 1YB6A 4CKZA 2I2FA 4L8WB 2L0XA 2EKZA 4QFCA 1DKQA 1AK9A 4KQ2A 4I5FA 1AZTA 1A2KC 1H05A 3DTTA 4NYMR 3NBUA 2IHTA 4IDNA 3PHBE 1S1CA 2HADA 1N6PA 4IGFA 2X0KA 3CW8X 4I6GA 3VA7A 4N7RA 1CUWA 1GIAA 2GK3A 3KJEA 4H6XA 3N2KB 4BAZA 2Q4OA 3U7FB 3P9SA 5TGZA 4CEJB 3TSYA 1TO1E 2JJ2D 1R9GA 2AH5A 3MJVA 4IJ6A 4YNBA 3DKVA 1BVRA 1WHSB 3AERA 3LXXA 1SAYA 3QX8A 2RSLA 4M8NE 1FDOA 3HP7A 2KYRA 4NAHA 3ZDYB 2CT8A 1YKSA 2WWGA 4UFOA 5FTNA 1P3Y1 3CH4B 5MDHA 3TXAA 5G40A 3QKRA 3COJA 1JP7A 2EGUA 5LLSA 4DV0B 3VR4D 2OVBA 4TKVA 5E8JA 3UMFA 1BVYF 3H3JA 5LQUA 5EJFA 2EW8A 4IF4A 4UBJA 5HQTA 3PQFA 4DWOA 3I0ZA 1CNEA 2IC5A 2J4DA 2P69A 1VDMA 3EOZA 3FFWA 3MXTA 4GYYA 4OJNA 5EIWA 5ELMA 2E2WA 2ISSD 3FRIA 1P91A 1YZGA 1SC4A 3W3AD 4DF3A 2ZXUA 2YIDA 2G4LA 3LF1A 4QOGA 4W99A 4F7DA 5DNUA 2A84A 2NTJA 4IIJF 3ZY5A 3CSSA 2SECE 2C7QA 2IYPA 4DR1B 4BVJA 2PRJA 4UQLA 4AF6A 5E2IA 5FEUA 5JS8A 5LR6A 4HPJB 1PNOA 3FUXA 1IJFA 1PG0A 4DCNA 3DFFA 3UGJA 4TLLB 4UVIA 3NCTA 2YN2A 2Q2NA 1QP7A 3ESXA 4FCWA 4B33A 1E1CA 4FOPA 2GI4A 2PS1A 5IT0A 1GUDA 2AE1A 2AX4A 3C98A 1YGYA 3JWPA 4RPJA 3BAZA 5CM8B 3R75A 3HU3A 5FNVB 1E0KA 1E4VA 2ZR8A 2QZJA 3QX9A 2FJ0A 1K9VF 3OT1B 1EB8A 1ADCA 1I7NA 4W5OA 3MWJA 3BA1A 3RSLA 3L6OO 1SJ9A 1JJVA 2DULA 4NH4A 4EI7A 5JDCA 1N0UA 4C30A 1JGTA 3D0KA 5IAJA 4OMCA 3P2YA 4FZ5A 4FB4A 2H65A 4HH4A 3UV6A 2W6ID 4JB8A 3JQGA 2J9YB 4MQEB 2DECA 3G7NA 3KWJA 1KEVA 2AUMA 3D5TA 5EHIA 4JI3B 1II9A 3BS4A 3RPEA 3NWBA 4BRSA 5JXGA 3CG0A 3EUWA 2QRVB 2G9RA 2ZB3A 4E0BA 2R79A 4AQYB 1U2EA 3ZBQA 1ZYUA 3O84A 2DTXA 4QU0A 2P2GA 2WKWA 3DCYA 1C4WA 3C5HA 2OHHA 2HF8A 1S2DA 1I7PA 2BBOA 2QAGB 1N5MA 2OP0A 4JX8A 3AQ4A 4L75A 4EQ6B 2OG2A 4C01A 1M7HA 1SZPA 1QDEA 2VP3A 4OJYA 1V7QA 1WUIS 3E8SA 5FOTA 5EHQA 3EXIB 1CC1S 3QF4B 1FY2A 1YHYA 1FFBA 2JBAA 1OB2A 2OHXA 4NPAA 5EJ8A 1W0KA 2O8VA 3TQIA 1RP1A 2JFOA 1X8KA 3H13A 1I3OA 1I10A 3THRA 4ESVA 2DKNA 2WP8J 1IVNA 2HA0A 3KZMA 3NHLA 4K03A 2E1PA 5D6NA 3W6NA 1UZAA 1IZ9A 3EHDA 2NQ8A 3IOBA 1HG0A 3GARA 5LP6B 1G16A 1WUKS 4PYKA 1G7CA 3W9BA 3Q3HA 1J8MF 2IDKA 2VG8A 5D5QA 1HV8A 4AZ0A 2Z1DA 4WV3A 2X41A 4QBFA 4OAPA 3OWHA 5ITZA 2EZTA 2IDJA 3H8WA 2ZWAA 3KJQA 2VNSA 5BNIA 1KQGA 5DXAA 2QN8A 4MGZR 3ONNA 1A5AB 1G8MA 5BVHB 4XR9A 4M7PA 3ZCVA 2QUZA 5HF9A 1U9JA 4XPIB 4HGZA 3BTSA 4ZAYA 3O2QB 1C29B 1F14A 5H4GA 2NW6A 2QNRA 4BVHA 3QU9A 3DUWA 2Q5JA 4ALMA 1X7ZB 1JNXX 1L0BA 3LAWA 3ZI0A 3C97A 2H4FA 4K9RA 2PZ8A 3K05A 1GVNB 5ADUS 1SOUA 1GV0A 1NVDA 1WAMA 2FWBA 2P9CA 3H1BA 1N7HA 2BGNA 2Q49A 3KQSA 4N1AA 1NG9A 3AESB 1PR3A 5A9TA 5LKAA 1L5FA 2RGCA 3EGEA 4Z4IA 4AMGA 4JD5A 1A4XA 1D6JA 1E3WB 1I32A 2BEKA 2BKVA 3D0RA 3EEBA 3PXXA 2PH7A 3N6XA 4WKCA 4ND8A 1V8ZA 4OQLA 2DH5A 4PYRA 2XOXA 4NS4A 2IEBA 1P44A 1KDRA 1F2DA 2G3YA 3F9CA 4TKUA 5EHGA 3EIHA 2IE8A 1XI2A 4WN3A 1HMYA 4UHDA 5HS4A 3PI6A 4B6GA 3B6EA 1CD5A 3KJGA 2OCLA 5JD3A 2HMVA 3KJHA 1BVUA 5HFJA 3E81A 5IX8A 4YJ3F 1EVLA 4N5NA 1NVEA 1JHXA 3O4RA 2NVUB 1CEQA 1R0XA 1BU8A 4DRYA 1UDAA 3CTMA 4EB3A 2ZSUA 5IWAB 3T1YB 3MTDA 4LRTB 3KXDA 3QVVA 3UGKA 4G5SA 2JIZA 3PDIB 3GMIA 4E32A 2WHXA 3IPCA 4HFMA 4C7MA 2KSQA 3Q85A 2BM8A 2QD5A 4OQEA 1AZSC 4XZ3A 3RTDA 3UJBA 1CIVA 2HRBA 4Q3BA 3BWDD 1EM6A 2YCBA 3O7WA 1WSWA 4LMAA 3OKFA 3FR7A 2BFBA 2PYZA 3NNNA 4NY1A 1E7WA 4DLRA 4M8KA 3P2MA 1WNTA 2WZBA 5I3ZA 3N07A 3A6GA 3RSZA 4KH0A 3KALA 4M1QA 3BN3A 3D7NA 4D43A 3KZVA 4XM1A 1SQ6A 4LZWA 1KEPA 5BXYA 4EG8A 1L5KA 3F97A 1KMHA 4GEKA 5IULC 5FLXA 3AP2A 4COKA 4LI0A 4UVEA 1Q84A 821PA 3AVTA 5FUQA 1G20E 1USIA 3MLBA 1E9VA 1T3SA 3D43A 1E6LA 5SV2A 2EZ4A 1ZD8A 4RMGA 2DQ4A 2PUGA 1KXZA 4ZCIA 1YD7A 1JEYA 1RQ7A 2I1WA 2OPBA 2GCEA 1YS9A 3O3NB 4PAMA 4Q47A 3WWCA 5JBIA 2VDVE 4MA5A 5JSUA 3MMPA 3O8OA 3W0LB 2YMQA 4L9WA 1SKUA 1ZESA 1H2ZA 4M0EA 1L7NA 2ODTX 2NU9B 2R85A 3DDSA 4F92B 4YP6A 4DYDA 3AB8A 3CUTA 3V7FA 4CG1A 3GYBA 1G1AA 1SQFA 3ROZA 4ECAA 3KJNA 3TOXA 4CV0A 5B3AA 3E7FA 4GW3A 1QF6A 1CY8A 1F17A 4MI6A 4XJSA 4EKDA 1IPEA 5JT1A 2X1VA 1UOPA 4X1YA 4EGFA 1BMFA 1TLLA 2AHOA 2IOYA 3OP1A 1AN0A 1GZ6A 4L7QA 3PQCA 1SVWA 2XCIA 4G8CA 3F0TA 5J2UB 4C6SA 2JJQA 1T4DA 3MSCA 2ZRNA 4YLEA 3NOXA 3F7NA 2PGAA 2VHJA 1EM8B 3LA6A 3P9IA 1SC9A 2AG6A 3REFA 5CPBA 3UHPA 3GP8A 2FGKA 4WOBA 1AU9A 2JBAB 2UVPB 3HUFA 3K09C 3AUXA 3IJ5A 4RCZA 5FHQA 2EP5A 3STUA 1H2XA 3QEKA 2UZ3A 1A4RA 4P0TA 4MCJA 4R2KA 1WIWA 3LQRA 4TSFA 4X94A 5JZSA 3QKRB 1PNVA 4DSZA 2R68A 3V00A 3VC2A 4QIHA 1ZC3A 3C43A 4N6GA 1V37A 4RNCA 3ONDA 3HKBB 1IAQA 1IY1A 3ZCSA 1O58A 1ZSNA 3WVNA 1U2GA 3FYSA 4XA8A 1V7PC 2PS3A 1FVFA 1YL6A 2JANA 2RKBA 2XCSB 1HNZB 3F2VA 3FW1A 1QYRA 3KWFA 3SLGA 1VHWA 3EN0A 3W2FA 1MV5A 4EF5A 5EZ6B 2HNBA 4C0JA 3WNCA 3LFHA 3EDYA 4PHGA 4ZTZB 3DMHA 3K7EA 2QP4A 13PKA 1YZHA 2KI5A 4J0HA 5EGNA 3D5EA 3V6LA 3H4VA 3KXKA 3QIVA 2GN2A 1U7DA 3DZFA 4XXHA 1TLFA 5U4QA 3IQZA 1PNTA 1Z5GA 3M3PA 5FULA 1ST3A 3DZ8A 4EH1A 4DA8A 3CZAA 4F06A 3SR4A 2H2DA 1UBLS 1I30A 3ETGA 1BS9A 4PRLA 4UASA 5FYQA 3UW1A 5JCXA 1QHHB 2EZ9A 1GGMA 1X3LA 2OPHA 2X3FA 1L9KA 4DXHA 2ZRGA 4G07A 2B25A 1PTKA 1SNYA 2BKLA 2W2PA 3KZOA 1IRXA 1PV2A 3W06A 1XFDA 1PW5A 2VXBA 4NRDA 4YI5A 4L28A 3LUHA 2A5FA 3CV3A 3FR8A 4ED9A 3WNVA 1C3VA 1OUMA 2RH8A 2C5HA 3HMKA 1ZZGA 2YZKA 5FBHA 1CEXA 1Z6ZA 2I6SA 3BH0A 5IAGA 1JEQA 1AV7A 2M6LA 5HCNA 3O8BA 1E2UA 3JZFA 3AY6A 3T8YA 5KYYB 4Q02A 1KAOA 1H5QA 1X9IA 3GUCA 3OIGA 4U7JA 3MW8A 1MW8X 3NI2A 2H5IA 4B8YA 3ICCA 5T6BA 1KO8A 5TJ9A 1U0GA 4H3KB 4RW0A 1W88A 4C1NA 5LYYA 3BZBA 5CDSA 2X5KO 3HACA 4N3NA 5DFAA 4R1MA 2V96A 3BJRA 4DDWA 5ITWA 5ALFA 4GFDA 3P20A 1Q57A 1IHYA 4M2LA 2WC1A 2VLIA 3ZCTA 1FYDA 2WVAA 3T9CA 1NVKA 2D8MA 4AG3A 1EUYA 2RKOA 4S0ZA 3A28A 1UZUA 4V1CB 4PWYA 2Q7DA 3LV8A 1H2FA 4ZCTA 3VJKA 4UOZA 2OAQ1 3ZDXB 4Q3CA 2Q41A 2W58A 1Q77A 5FPQA 1J9GA 2GZSA 1ZR2A 1POWA 2NYVA 4QM6A 4CR8A 3U4QA 2IY8A 1QFXA 1NNI1 1VJDA 3E18A 3F74A 5DZSA 1C9DB 4IMIB 1KZHA 4QKQA 4D8YA 3TD2A 1SGWA 1K7CA 4KGZA 4GYJA 2M6KA 1EGQA 3I2IA 4KE8A 1SRQA 2YQ4A 4WKPA 2ZTMA 3NHUA 3VR6A 5JRZA 1GQQA 3KDPA 2CC2A 3P4YA 3R7NA 1RM3A 3JYPA 1M1YB 5JNLA 2NWQA 1GU1A 1TA0A 4FN4A 4X71A 1WCYA 2OHVA 5EMNA 2QYOA 3HBFA 4B0OA 1CRLA 2I2CA 3ED1A 2O1XA 1NYLA 3RS0A 2HWWA 1N3IA 2E87A 2M6SA 1BA2A 1UXOA 1YQQA 2OD2A 4CM9D 3JRNA 2GX6A 3EXFB 3UXMA 5JDIC 2EC5A 3CB4A 4KFCA 3O1JC 3RKRA 4HGYA 4YJFB 3W77A 4DV4B 1GRQA 2NADA 3NS7A 2CCGA 4YT8A 1YHZA 4ZOCA 4NICA 2BV3A 4M7WA 2V98A 1LDYA 1DFIA 2A9RA 4BVEA 5LQRA 5ALPA 1FNSA 1NC3A 1U28A 1GV1A 5AVWA 2OB2A 4YHHB 4C04A 3EH2A 2KB0A 1ZH2A 2LR0A 1JHYA 2VT7A 3KKPA 2BBWA 2XMQA 1E3LA 3FUTA 2V1XA 4HBZA 4HDOB 2CXHA 3IAFA 4XGRA 3DZCA 1LDBA 4XWWA 5T5QA 1LVHA 5ADHA 2OZVA 3RYCB 4FMDF 3G5AA 4RKYA 3AL0C 1U2QA 2WUEA 1JALA 5LP6C 2Q45A 4BQQA 4K46A 2QUIA 4KOEC 4GSLA 5TEVA 2JJ1D 4JASB 1R6VA 3IBGA 4UEOA 3QUCA 2XCQA 4ZT5A 4AJ2A 2ZTVA 4MAMA 1RI2A 2OYRA 3V80A 3L04A 2X8WA 1SU4A 2KBFA 1W5FA 3GPIA 5LQJA 3E22B 5EJAA 5I7VA 1DFGA 3L92A 3LUBA 4MVJF 5DGDA 4TXLA 3LFUA 4ZU6X 4C3ZA 2B4RO 5AVZA 2PIAA 2Q21A 2BGJA 4HXEB 1C0LA 1K4KA 1L7QA 3WFZA 1Q12A 2YX1A 3Q15C 2DC1A 3WK8A 5KX5A 1MLDA 1FQOA 3HVJA 2WF9A 1X15A 2HI0A 4TUYA 2AC7A 4WBSA 5CFNA 3VKGA 1XYVA 2J6BA 3OQPA 4DJEC 4DWJA 1Y80A 2BUCA 3SYLA 1Z15A 1OLUB 4IHJB 1P2DA 2P7HA 3RS7A 4D42A 4JLDA 4K6HA 1THGA 1HKHA 2MJLA 4BBAA 2OAEA 1YB4A 3UICA 3WIUA 5LC1A 3WS7A 1LSSA 2W2KA 2Y6UA 4H0NA 3IUYA 1OA0A 3LPDA 1B23P 4WDRA 2P91A 4CEIA 2JFVA 4PU0A 3W6OA 1UBGA 2CHVA 2V4UA 5K20A 1TTHA 2WE8A 4IKPA 2HMWA 1YT5A 4FYIA 5NULA 2GCIA 4FUQA 1H2HA 4IDAA 5TGDA 1OX6A 1XZCA 4M55A 1XJ5A 2FZ4A 1C81A 3GLRA 2BMWA 2GPWA 1WTAA 2QMEA 4FTWA 3TTUA 4C08A 4XVRA 2JGRA 3OM1A 1ZQ1A 5BN1A 5K03A 1I2BA 2AXEA 1E2KA 3CINA 4TMVA 4UARA 4XOUA 3AGPA 1Q7GA 1YRAA 4JHXA 1LX7A 5L9AA 1JFSA 4DLUA 4MIOA 5IKOA 1YFJA 1X1SA 4JGGA 1ZIYA 3EMBA 4W8OA 3HJRA 1HQDA 2C4UA 1E9CA 1ZU4A 4HNAB 4PGAA 2QRKA 3LJKA 2VP0A 1IWPB 1FS6A 1MEJA 1PJAA 1T3LA 1DEHA 2ODAA 3T3IA 1ETHA 5BT8A 2PZBA 3JQBA 3OZCA 5TRTA 1C1HA 1OFTA 5KQPA 1NURA 2J0EA 3LSYA 5K0NA 1ILWA 3NHSA 2AG0A 4NENA 4KV7A 5JLAA 3GC6A 3UJNA 3E0QA 4J76A 5FL7A 4XVUA 4HB3A 4RV5A 2FKNA 1OI7A 1KNXA 1THZA 3QXCA 4GGOA 2D8AA 3ONEA 4H0CA 1N6IA 1RRCA 1EDZA 4YS6A 4X8LA 5B37A 1G21B 1VCOA 1T3TA 2ZBFA 2QE6A 1YQWA 3Q88A 3FMIA 1Z8NA 3HB1A 4GSYA 2D3WA 2JL1A 1G4UR 2QI9F 2XE6A 1WV0A 4WZBB 3QEBZ 4DPMA 2XB2A 1MT0A 3AOEC 4ZGGA 1VLVA 2I03A 4TVOA 1ZI6A 4PFQA 5T6MA 1BS1A 5MGNA 1T2UA 1KZ4A 3EZ6A 3R3JA 4B09A 1E92A 1NU6A 2AC2A 2WAXA 3OFNA 3D3NA 4J4HA 5FA8A 2C5SA 4D46A 4J0DA 1QH1B 2RGWA 4EG0A 2CDRA 3DEIA 4IXNA 4L27A 3EDQA 3AUKA 4RD1A 1XP8A 5A5VA 4QYSA 1U28C 2FUNB 3ZS8A 1JHOA 1XZAA 2PJZA 1WZUA 3I1IA 3KFLA 4P3YA 1HXHA 4ER3A 2C2KA 4L15A 4BKRA 4W9NC 3PE4A 2ZRPA 3PFFA 3U09A 2AW5A 1H2BA 1OXVA 1X6VA 5EYPA 5K5EA 1BJKA 1IEQA 1P73A 3EIXA 3JWEA 4JLNA 1GKYA 4IFIA 1FUIA 4L0QA 1YIOA 2CLFB 2XWPA 1ZWKA 2IHZA 4PICA 2QSUA 4Q0MA 3W5DA 4MV8A 2J09A 3UATA 3R7BA 3MBOA 2Q5LA 3DCNA 3ESZA 4TMYA 1GDHA 3M5CA 1KERA 4GS5A 2QAIA 1U3TA 2QLMA 2QMQA 3K0HA 3FYUA 3GUUA 3RU2A 3GUVA 4M3NA 2PUWA 1OFUX 4D96A 1Z6QA 4I4TF 1O6BA 2W2QA 5A6SB 2GKOA 2AOUA 3B3GA 3COPA 5H3CA 1NR1A 1C7JA 4O8ZA 4BWFB 5CCEA 4P33A 4N41A 1VSUA 1PUJA 2SKCA 3F8WA 4AY6A 5JG7A 1YTLA 3NRCA 2DFTA 1BFUA 2OVFA 4LOIA 4LYAA 2L2QA 1A7UA 1EA5A 1LNSA 2BFMA 3ABSB 3NVDA 1H0SA 2ZUBA 4PF1A 3WWZA 1PW7A 2D7CA 3SQDA 1B43A 1WE2A 3DDNA 1NY5A 2BI8A 3QYJA 4LXGA 5E1OA 5FAXA 3L2OB 1EZ1A 1YIDA 1C0PA 4ETNA 2OFXA 3BJMA 2V74B 3ZR4B 3Q8MA 3DBLA 3TQHA 4QPCA 3VYSB 4D44A 4ZCMA 3U61B 2GA8A 2X19A 4NOLA 1CWUA 1VA4A 1HSZA 1ZNZA 3T4PA 4CCYB 2IZ1A 3RIGA 5I9NA 3EZXA 1QYCA 5L3RA 1WHSA 3BXZA 3PRYA 1ZCZA 4EGQA 5AVUA 1NXWA 2BEUB 3NDRA 1A7AA 2J59A 3I04A 2YHUA 2ZI6A 3A05A 1VECA 3OIWA 4BNFA 1KPHA 2ICAA 1F2UA 5CK5A 3DE5X 3NYQA 4MJ3A 4C0XA 3O8LA 1T34A 2OZLB 4X8OA 3PK0A 1LS1A 4HGRA 4PFKA 5AK4A 4UM5A 1MIHA 4QO7A 2QGFA 1N8KA 4MWSA 4JYCA 4YJHB 4BB5A 1H1DA 1W52X 1UINA 3FCAA 3G9XA 3ZE6A 5LZ2A 4W5HA 2JIRA 4L76A 4HMPA 1ZMXA 3VYTB 1QOPB 4R8MA 4X5OA 3PGMA 3OIYA 4PAOA 1CTQA 1E58A 1WMFA 3EBLA 4XFDA 3ZU6A 4CM9A 5A2QA 4NYJR 3PQ8A 4ZYTA 1L7AA 1JDVA 2XB6A 2QLTA 4EJSB 3A1SA 5IEBA 3JAWA 4TTIA 2FY8A 2P6OA 1D4AA 2WYHA 3ZBUA 1ORTA 3OA2A 1ZW6A 1P7YA 1SCKA 4ICIA 4OJMX 5G0UA 4BVFA 4GX1A 2Y0DA 2OLJA 3D2AA 3I42A 4JBXA 4WJKB 3MFYA 3RI3A 1E6MA 4CL3A 3HU5A 3QWHA 2NUTA 2CVHA 2HQBA 4NBLA 2IYFA 3H2KA 1XLTA 4WZAE 2XWSA 5FLEX 4QQRA 4UTVA 4F3KA 3UWDA 3W3AH 3OQNA 1YFLA 4C4TA 1HSOA 3AM1A 1IOLA 1SUEA 5J1SB 4AD8A 4CMIA 1ZUIA 2XWQA 4YAWA 4WERA 2YWRA 3GEIA 5D51S 4PYOA 2P3QA 2Q1TA 4JR0A 5AI4A 2IV7A 1VG9B 2EIHA 1TOAA 4JLOA 4KN6A 4X60A 2ZQYA 1P0FA 4ZCPA 1SCAA 2XOKD 2P5UA 4OU4A 4V0SA 3IL2A 3EY9A 1BXGB 3WMWA 4F84A 4D4LA 3RSCA 1P62B 2C1EA 2Y99A 3KKEA 3LDGA 3NVKI 4BB6A 3WGTA 3IMFA 5HQ3B 2VT3A 4GC5A 4RDXA 4DUGD 1BXRB 2IZ7A 5B53A 2F48A 4J7XA 3MIIA 1MEEA 2GMWA 4QZVA 4S04A 1ZCFA 1LK0A 2UZAA 4LEIA 3KHKA 3K5WA 4LDPA 2O8CA 1UIMA 4A26A 1S8FA 2HMAA 2DCUA 1UPTA 4QL3A 1PFQA 1QUEA 1YB1A 3W8EA 4LMPA 3JASA 4D9IA 4WXEA 2X2PA 5HMLA 1NMQA 4L51A 1XZGA 4LJYA 4ZWNA 3QEJA 3RTEA 1R8JA 4EBBA 3OJEA 4N76A 2X5JO 3ZWQA 3GV0A 3ZGXA 1B3BA 4A8TA 1GZ4A 5FA6A 3I72A 5CURA 1C3EA 5B1IA 3HDQA 1BWRA 3K2EA 1DXHA 3R7FA 2A7XA 3PKJA 1ZMTA 1UKAA 3HYSA 4MRRA 4EKGA 1ECCA 5C35A 2DVMA 2FWRA 1CDEA 4DJFC 4CI0B 3UXEA 2RAFA 3TK1A 5A9RA 3HJFA 1V26A 1MRZA 1USVA 2GUWA 4AZVA 2IRWA 3VR2D 4YB8A 4LBYA 1OLSB 1W6RA 4RMIA 2JAXA 1J00A 1KU6A 5JADA 1CY6A 1M8KA 1AUVA 1YCHA 1U8AA 3W8NA 1PG2A 2A35A 5TSDA 4KR9A 3IUEA 5HJ2A 1ZAYA 4LFAB 3PUHA 3KLMX 1U8EA 1WXDA 3QTBA 3KB6A 5EMHA 4CR7A 5HM6A 3G59A 2I3DA 3GG9A 3NOQA 1QHXA 3EY4A 3OPNA 3BERA 3VMFA 4A6PA 2YYYA 1GCOA 3NHKA 3HYLA 4M0FA 4NV3A 5JH7B 1U2TA 4J16A 2H11A 4C07A 3OG9A 4JI5B 4HWSA 5DU2A 2ZRQA 3I6QA 3JQCA 5C46F 2V9ZA 1OCEA 4CRWB 4KXQA 1Z6GA 3TIIA 5JH7A 1NQVA 2H4WA 1IBRA 1N2CB 5BT9A 2CNLA 4NFYA 3HDVA 5I8WA 3C6XA 5BN3B 4YR7A 1GG9A 1H42A 2XMZA 3ZIUA 4AECA 2HA5A 5IW8A 3K70D 1JKXA 1ZJYA 3UA3A 3TUJC 3HYTA 4ZQCB 4C20A 3C3EA 1T9CA 1AXEA 1T36B 3TGLA 2I2XB 5C5DA 2PUBA 2WUVA 4TYWA 1PV4A 3HKBA 1UPBA 2JGLA 5EXXA 3TWOA 2ZVPX 5DM60 2D1YA 1PD1A 3V1NA 2RGEA 1DDIA 3FNBA 3A6HA 1V5FA 1VI5A 4YCLA 5TPWB 3L1JA 2CUZA 2GEUA 4XLLA 1GPYA 3K70C 4BNGA 2HPZA 5EIOA 1X7YA 4Z4FA 3DLTA 3ZUGA 2FPIA 4K6OA 4UQOA 2UVPA 3KETA 2N75A 5D86A 3ONWA 4D56A 3Q8KA 3G5UA 3KCQA 3M1AA 5ADVA 2G04A 3ZJYA 3FTDA 2XDWA 3KUCA 5F7JA 5JVDA 3DE6X 4GM1A 2EKBA 2PH1A 2Q9CA 4OFZA 4W4TA 2QMHA 2HSDA 4X7MA 4NC9A 3AX6A 3NTVA 3IKTA 2XUAA 4URYR 1W0JD 1RT9A 2P9YA 3WBJA 5CB8A 5JW6A 1YRLA 3SYTA 1DRKA 3MUEA 3R5JA 4A0SA 5LFAA 1QM5A 1BKSB 5ISMA 3OSUA 3OT4A 4WCFC 3Q7QA 3EPHA 1OLXB 1PDOA 3IRUA 4BCDA 4E13A 3B6MA 3RJ9A 4F5ZA 2H9YA 2VDKB 4G2NA 1PNRA 2XYPA 2MYTA 4J9VA 2B1IA 1IQUA 1N6HA 3OHSX 4F5WA 9MHTA 3I6IA 3KWLA 3RREA 2GO7A 2O1WA 2R8PA 5JQGB 3PC8A 2BR4A 2PMCA 4UUPA 2OFOA 4WJZA 4D3DA 5I47A 3R6WA 2OYCA 4Q15A 2R8XA 3G85A 3JY6A 3T7IA 4KREA 5JSHA 3THWB 2PS0A 5J58A 3PXAA 3DMDA 2AUNA 2JLAA 4A7PA 4PAQA 3GDWA 5K0TA 3ZDCA 2PZAA 4YMVA 2TYSB 4QXQA 1Y9AA 2JIZD 2ENWA 4J6FA 4QJBA 1IC6A 3NPAA 1JPNA 1Z34A 2JKVA 5CLIA 2VCHA 3EJ6A 2X40A 3Q7TA 2QL6A 4GP6A 4ATNA 3W7AA 2ZJFA 1YK0A 2O7NA 1XP5A 2AMFA 4F6RA 3ZE2B 2YS7A 1FTSA 1RWXA 3G8DA 5I9TA 5SZHB 1H4QA 3HRKA 1E4EA 1W1IA 2XLCA 2XVYA 4HRVA 5ALYA 2JCXA 4K1XA 5JXJA 4FP9A 3G0DA 3KOWA 3II6X 2E4VA 2X58A 4G0WA 1ZKDA 1A76A 5HWSA 5D3MB 1SEPA 4EPVA 3FCYA 4WLEA 2BKEA 3NBKA 4Y6QA 1MRSA 2PA0A 3TSWA 1GL7A 1RYFA 4PBRA 2OSBA 3A10A 4P81A 3WXMA 5FX2A 1G2IA 4ZCLA 3GVCA 4F4JA 3PE3A 4YWJA 1GU7A 4G9GA 4PFJA 1DBPA 3Q41A 1N7GA 5REQB 5LB4A 1Z4NA 3ZNQA 3LECA 3V34A 4F8EA 2C92A 2LIPA 2VJMA 1AQYA 2G88A 4BQPA 1FTQA 2JAOA 1DIRA 1EP1B 3CRZA 3IMCA 4MYRA 1IUOA 4G5YA 4V0MA 5JSKA 3DBHB 2OD9A 1XBTA 4BBPA 2GLTA 5J1TB 4M9QA 5KTKA 5M04A 1V48A 1N6LA 2IZ6A 3F4BA 2J9FA 1YNOA 1T4GA 2AMJA 2EU8A 1D9XA 2YHAA 4Y7DA 2GHTA 2QN9A 4LJLA 3S5JA 2W4QA 3ID6C 4MS3B 4RANA 5LM3A 3IAS6 4QYWA 1G6KA 1S3SA 4ZKDA 3GXBA 3JPYA 2BCJQ 2AD5A 4WOCA 2ONYA 1IN8A 5BNZA 4S2UA 4YRZA 5ICMA 5LSAA 1H1TA 1L4MA 3H2IA 3G0IA 3D59A 1GPJA 3JVVA 3DTNA 4H77A 5T57A 4JV5B 1AKVA 1OE0A 3W5IA 1ZRNA 5EHXA 5JJ5A 1RNLA 3EW7A 3WI7A 3CHYA 1VSBA 2Y1OA 2IODA 4QUHA 8ABPA 1QRTA 4RVFA 2BHTA 1JDBB 5FBKA 4B6PA 1FFWA 1N0HA 1E1MA 2VDWB 3OMLA 3KJZA 4GWLA 5BP7A 1NXXA 4M86A 4BQIA 4MLDA 3RRBA 2OCKA 1YR8A 1Z3CA 2J3IA 2EKPA 4CW7A 1NI5A 1FTGA 3AEKB 5FDFA 4EHHA 3GLIB 1NVUQ 1T6NA 3E5HA 1B73A 1GCAA 1IY0A 4LDRA 2IHUA 3I2HA 1LLCA 3PHIA 5ICFA 2AN3A 2AMLA 4A0FA 2CHQA 2R65A 2Q6LA 3PGXA 4URXR 3C3PA 4D82A 2NAFA 3NTRA 3RYTC 2I80A 2J6HA 1QB7A 1N4DA 1Z2NX 2OC9A 1D2NA 5CT8A 3VTZA 1FDSA 1G4AE 3QHAA 1NW8A 4L4UA 1AGNA 2QY6A 3D0OA 3CRRA 2OWDA 4X6XA 4S05A 4RD4A 5A0VA 2JJ8A 3X2SA 1V39A 2GF9A 2Z43A 4RTPA 5CDYA 2CXQA 4U1RA 3MRTA 2X5OA 1WWKA 3D8HA 3ZXXA 2WM2A 3GLHA 5IH3A 1NFQA 2BHSA 5TEWA 3VX4A 5GVSA 5KSZA 3OQ1A 3OZXA 1N3BA 1LA2A 2ANCA 1KYZA 3I1FA 5K0BA 1U7HA 4I1SA 3AOEA 3NBQA 3Q2OA 3I01A 3NCHA 2Q6TA 3W3AA 2FUG1 3TL3A 1RW4A 3C70A 3Q9UA 3RD5A 1MAHA 1T0PA 3R40A 2LUOA 2BMJA 4OU5A 4FPXA 1DHTA 3O6VA 1DADA 4TMXA 2WU1A 4L3WA 4X65B 3ERCA 4LJAA 1VCNA 3DE1X 2Z8XA 5MHTA 4JI6B 1HY3A 3O3OB 2JLQA 2JG3A 1MGOA 4DNPA 1M72A 3THYA 1EDOA 5IASA 2ZP1A 2NOAA 1T43A 4R6XA 3V7WA 5C8DA 1Q6ZA 5REQA 5FLYA 4X8HA 1NJ5A 1TIKA 3GGCA 3WDLA 4CDNA 1Q7EA 1EBUA 1H4VB 4ZI2A 3AF3A 1FQWA 1QVAA 3UJ8A 3IQIX 4D6YA 3WGIA 4RIIA 3H42B 3F5MA 1K2WA 3B7GA 1XQ1A 3C8HA 2A59A 3L84A 1DJNA 5A1JA 2VTBA 4A27A 4RIEA 5D3MA 1VJ0A 4CM1A 4EMTA 2ALJA 1V3QE 2DSNA 4M1SA 4QE3A 3R3UA 2PRKA 4U9IS 2QT1A 3ZGVA 1QFMA 4D0GA 4UNRA 3FJYA 5AFSA 4XIJA 1G5PA 3IA7A 2QRMA 2I8AA 4XEUA 1Z45A 4EVIA 5DTQA 2AK2A 1T8YA 2PWBA 1YAHA 1MMFB 4QTZA 4ZHQF 4PN3A 1M5UA 1W76A 4ZYUA 4Q7MB 4S0XA 1VQ1A 1OZHA 3NETA 1HE8B 3ZY3A 5B6IA 4I1VA 3THSA 4CLHA 1VCHA 1ULTA 4TV9A 3SR3A 1CQJA 1G9SA 1PQPA 3ICPA 3OCYA 3DZGA 2AEMA 4LDQA 1GAWA 1DC7A 4LDJA 4MRVA 1QE5A 4V3BA 2NIPA 1EEHA 1U0LA 2FFRA 3AJ9A 4KQ1A 4NPHA 4JSRA 3RYHB 3MD0A 1Z0SA 3U62A 5LWHA 3DCIA 3LHSA 3MTJA 1PEYA 1DTEA 4RF3A 1HDIA 4IH1A 2OORC 4URUR 1RWVA 4FGKA 2G1KA 3F7MA 4XUDA 3SF8B 1E3DA 1QJCA 1OAOC 4PY2A 5TQVA 3L18A 2F1HA 2OGSA 4F46A 4HEA1 2I76A 2IEIA 1J0EA 1UOEA 2YHSA 3EZ2A 1B0PA 3PJFA 4PZ9A 2R7KA 2PWYA 4K8OA 5KMGB 4MUEA 4N3BA 4OB6A 1FZTA 1ZWLA 4Y2GA 2FQWA 4PSAA 1XWFA 1KBQA 3UMJA 1MAUA 4E03A 4ENPA 2WTEA 1HLDA 2X8AA 3BFKA 2GF2A 2ZSEA 1PV1A 1T2FA 3AGQA 2HZ7A 2O3UA 3JQDA 3MXOA 4WPGA 5B64A 3GI1A 5FF9A 5JASA 1E3MA 1WZCA 4CM4B 4ID9A 3IXQA 5U9CA 1E7QA 2I6GA 4UUMA 2YHIA 2UYYA 3PEWA 1SKYB 2D2VA 3HK2A 3T1TA 5GQSA 4ZO6A 4BIIA 2D0OB 5ALWA 1JFTA 3I04M 6REQA 4OQYA 3PFKA 5IFLA 3VNBA 3WKEA 2ZUTA 3ABRB 4MSUA 5IARA 1XNGA 2PQ2A 1NAIA 3T3OA 1LTQA 3AM5A 3JPWA 4X0EA 4YWHA 1KOJA 4FHGA 4X95A 2KQUA 2B9VA 3L0YA 4I50A 4QUDA 4XLZA 4Y67A 5CH3A 1SCBA 4WUVA 3K0SA 1CQIA 3BH6A 3OZGA 1XPOA 3K9GA 1GUZA 2ZIZA 3IPLA 3DB2A 2BTEA 1E2FA 3CB2A 3G2NA 4L73A 2CJYA 2DHCA 4LWZA 2JC3A 4QSHA 4Y2RA 1YK1A 4UNNA 2EZUA 1TGYA 1R74A 3BHMA 3LPNA 5K3FB 3LLCA 2I71A 2XH8A 2NTNA 3IAS1 4GMGA 3IKJA 3U44B 1G7RA 2IL1A 1JS1X 1QGZA 3DCJA 3ET5A 3ASYA 1JDSA 5JWOA 1EB9A 1QHSA 4MYSA 4UC0A 5AD1A 4DQ0A 1JX6A 3D6AA 1TO6A 2GN8A 3PNLA 2YY7A 4JBNA 5DGCA 4O4JF 4F2DA 2BRUA 3KLPX 2R00A 3BWVA 1XRQA 4B80A 3HCDA 2WHEA 3L05A 3RG8A 4EJFA 3DTYA 1NRWA 3MGGA 1T8RA 2QLBA 4I50B 4KE6A 4MGEA 1UBCA 3E9CA 1J1ZA 1P2BA 4TRRA 1BFDA 1TQ4A 2WIGA 1FMTA 2LZ0A 2RGNA 2YV5A 3C24A 1NJ1A 3DEFA 3DNMA 2C83A 3GQBB 4P80A 2EEZA 3AKEA 3VR3A 5CT9A 2CYBA 4N5HX 3OQJA 3HBAA 1XELA 4QDUA 4G1FA 2WU3A 1VPEA 3BRSA 3HXPA 2EBFX 5BWLA 1TU0A 4OHVA 3BDAA 1TA9A 5KNCA 4XPZA 4D3XA 4WVLA 2JD2A 2G07A 4R7ZA 5K01A 1MAVA 4O2AB 5DBGA 5JDCC 4D3ZA 1TZBA 4DQUA 4HN2A 4OXIA 5DM2A 2OBXA 1GU0A 3BD7A 4NBVA 2HRCA 1NVMB 3IH5A 4QU5A 1ELOA 4MLZA 4JBHA 2OXTA 2SNIE 3V5NA 2GPBA 2IJGX 4BCCA 2GM5A 1XG5A 3HEBA 3O4IA 4QASA 4NJMB 1QTNA 2E0IA 1CJUC 3C4QA 1E60A 5FWDA 2JI7A 2FF5A 2C42A 4C87A 1A5ZA 1AHHA 2V8OA 4EI8A 5I4BA 5IU6A 1J1UA 2WUWE 1OFGA 5H59A 4YT4A 1KBOA 2HJ9A 3JQRA 2ACWA 2ORWA 2ZU6A 3O03A 4NCJA 4R2XA 3AY3A 1XLUA 4WXYB 1KVQA 1JEEA 2XNKA 3BBPA 1VTKA 3C16C 3RASA 4QG3A 5JBNA 4R9UC 3WWDA 1GOTA 4LPKA 3ANLA 3GLIE 1V47A 2WU0A 5IM4F 5LQMA 4D92A 2F17A 3IALA 3FPFA 2XZDA 1DCTA 5F77A 2AR9A 3K9QO 4AUNA 4UAUA 4BFVA 4BLSA 2PUEA 4RF5A 5HCUA 4CM8B 3TZCA 3VVCA 4TN5A 3UA4A 4IVQA 1H3FA 3T7EA 3J81k 3GUZA 4KXWA 2DWOA 2C0CA 2W2LD 3CX3A 3FKQA 2PAFA 4LQCA 1YBAA 3QLVA 3X2EA 4EJSA 2JVJA 1EA7A 2H4YA 1M1NA 3BICA 3IV7A 3HJTA 1I1NA 4HB2A 4AN4A 5T3YA 1YRYE 4P8RA 4D4MA 5EVCA 3DZIA 4EEZA 4TLMB 3H1TA 1XN4A 2YQ5A 4C2UA 3GNLA 1HRDA 4ND3A 4X93A 2FSSA 3PX3A 5D3KA 1P7WA 3RABA 6GPBA 1J97A 1UBHS 2VKQA 1U4SA 2VDWA 5BNFA 1YZTA 2ATIA 1N5IA 4IDGA 2W37A 1PWXA 5I7FA 2GNOA 4YGXB 2RGYA 4EDHA 4KL8S 5BRJA 4KBGA 1EXWA 2PV0A 1MX1A 5AOAA 4F0JA 5KJCA 5LQAA 4YCSA 5LP1A 2Z6AA 2F3SA 4C06A 1XAIA 2JGKA 2J5KA 5MF6A 2B4YA 3TAHA 4IZIA 3R2JA 2OXRA 1Q1EA 1RJEA 3IXMA 3OQIB 4NATA 2IOFK 4KQGA 2XUIA 1D2GA 4BJ3A 2Y1XA 4QRHA 5JV5A 4FR2A 3I92A 4HP8A 3X1KA 3GQVA 4BNDA 1ZDMA 4FMBB 1XPUA 1YS7A 2HEGA 4Z0PA 2ZI3A 2XRZA 5CB4F 1XL1A 3LCRA 3ZX5A 2RDMA 1QG0A 4GI5A 3TFOA 2ZB8A 3AF0A 3RJMA 3NX4A 3H2GA 4M1TA 2C9OA 2Q2VA 2CNWA 2R5NA 2O5RA 3WGJA 1BMFD 1PBTA 1OTYA 1T0UA 3K0CC 5IZCA 1CFZA 1OI3A 1P5HA 3KC2A 2MTBA 2PTGA 4HL6A 4BGIA 4MR8B 2C0PA 1YU6A 2PY6A 4PQGA 3NHZA 2PUFA 2NP7A 2VHTA 4RY0A 1HT2E 3X44A 4OHRA 3WGUA 5KJEA 1N78A 3D02A 3ZLTA 2PKRA 2IOHA 4OQQA 2Q3BA 1EP9A 2VUHB 4QDZA 2GXAA 3V8BA 1C2TA 2Z1MA 5PGMA 2HCBA 4LTNA 5ALOA 1ONPA 1U1EA 2F1JA 1Y4ZA 3WB2A 2GKSA 1LRLA 1HL7A 3GGDA 1UWLA 1JHDA 2YDYA 1HDGO 2WWXA 4UCXA 5AKEA 2NVWA 2QW0X 2WJYA 3P0IA 4MW4A 2Q4TA 4YV2A 2CXNA 3VPAA 4M76B 4Q37A 3ZHYA 3NGMA 3IB6A 4LTMA 1ONOA 5LQNA 3ZWDA 1G1MA 1K3UB 3QA9A 3ZCPA 2QRGA 2HDHA 1Q50A 3BPSA 3OCVA 5TVKA 5AHRA 3SJZA 3WGKA 2HHJA 2OLKA 4KX5A 1B93A 1CFJA 1Z4IA 3OICA 3UJ9A 1FX1A 2FCRA 3QUTA 3UK7A 1MP0A 3JQFA 3O8NA 3PRKE 4IJQA 1ZKMA 2FX2A 3K8OE 4UEJA 2HM7A 3PNPA 2GJKA 1I2MA 1VE6A 1UF9A 2H3EA 3H0CA 1ZL2A 1ZOLA 4QATA 3SZOA 5B7NA 4K0KB 2DTDA 5C1OA 3MEQA 4M8LA 4R2JA 2EFDB 2FZLA 1F12A 4JB0A 4EFNA 4J0QA 3DLAA 1UXGA 3BHIA 2HDNB 5KWEA 2FR8A 1OR8A 4XLTA 4CV1A 5G4KA 3QFTA 3RVSA 1OXXK 3O8CA 3VAAA 4JZYA 2QZ4A 4CU5A 3MC1A 2DFDA 2J32A 4J43A 3HE3A 4FDVA 3OE5A 2HJHA 1FOEB 3HDGA 4C0AC 3AZQA 1U9IC 3VI4B 4TMWA 3VU1A 2V7XA 2AFRA 4L5AA 4LY6A 4EITA 3L7IA 5K9ZA 3OCUA 3CRMA 3R4VA 3HU2A 2NG1A 3OQ6A 1CR4A 5JSQA 3PGA1 3R5XA 4RMNA 3WNBA 1CJKC 2ZRKA 3DOOA 1DC6A 3TW4A 1DV2A 2X9GA 3UAYA 4EUFA 3QE2A 1H6BA 1LVGA 4ZVPA 4MR9A 3FSEA 2XIJA 3M81A 2J3HA 3LO8A 5LQDA 4D4JA 2FPGA 4DLNA 4G4IA 1P2GA 4W5JA 2ZYUX 4WLFA 1GZ3A 1KWGA 3AHGA 4JIMA 5EERA 1EUCA 5EXDA 1P7CA 3TR0A 2A5YB 1QBKC 5HGXA 4B3CA 4DLZA 3NWOA 5EJMA 5E4TA 1OPRA 4FFWA 5DBOA 2QRPA 3DOFA 5AW3A 1B14A 1OWOA 4O1MA 2WAAA 1TB4A 4RA6B 5F7XA 4JX9A 3WGLA 3VZRA 1SUBA 3I73A 1BNCA 3PQ3A 1BE8A 4G01B 3DZDA 1TCUA 1RS0A 3KDSE 4IINA 4NBNA 1XRLA 4NX2A 4Y2PA 1M2EA 5ALXA 5FTJA 1AF4A 2P6PA 3SIWA 3P2IA 1MV8A 4TYQA 4O5OA 1JSXA 1NUAA 2PQ6A 1P17A 3PF8A 3A0UA 2C58A 4JODA 1T36A 1KYXA 4QDOA 4L3OA 4GLFA 2XW6A 1M6VB 4RWZA 3ORRA 3QWIA 5AVYA 4N0QA 2YWEA 2P9BA 1NKTA 2I34A 3VX3A 4H7PA 1ZIPA 4QOFA 3IELA 1ZGBA 4UBLA 4YP1A 5GAJA 3RFTA 3RVPA 3W2HA 2GRJA 1UC8A 1U9CA 1ZGJA 3H75A 5FNVA 1RQGA 5EP1A 2I2BA 3TIVA 3FZQA 3AVPA 5HKKA 2GRAA 3NBZC 3K0FB 1CE8A 1E1CB 3JD2A 1HNWB 3M6UA 4B17A 2GJ4A 2F9FA 5DISB 1SCJA 4YRQA 4EO7A 3GPLA 2CV0A 2XAAA 2AI3A 2WEKA 1QDUA 3HO6A 1OQAA 5C5EA 3R3SA 1LNQA 4HVLA 2L82A 2D3TA 1GKKA 2YIMA 2YS6A 4OHPA 2YV2A 2BDUA 4LZLA 1AQNA 3H6KA 5E2BA 4F04A 5C1DA 1OLSA 4E5PA 3GGOA 2Z3ZA 2X23A 1JLMA 3HC7A 3TRKA 3WWEA 4ECEA 5C2JB 1Q3TA 5HM8A 5JJKA 5JHHB 3OE1A 1IFXA 3DBIA 2QVYX 4L57A 1Z74A 1ZIXA 5KYXB 1PFGA 3PYXA 2HCJB 1U2DC 1BDBA 1QG6A 2WTAA 5LA6F 3WIDA 1RBMA 1UMBB 1GTG1 4QPZA 1PYOA 5C1IA 1OPXA 4FEGA 4H08A 1UWCA 4HV4A 3FY4A 1H2WA 4MVJM 5D1HA 5EJIA 2FRVA 2ZI7A 4I55B 4KIGA 5EXPA 4KFTA 3IP6A 4DCOA 2N9UA 5JYCA 2IT1A 3C3YA 1AE1A 1XD2A 1I3MA 1LZLA 4E4YA 5DBEX 5L3SA 1TEXA 2X8LA 3AUTA 2V6FA 3JD3A 4RFSA 4YUWA 4YRPA 2GAOA 1XRPA 2G76A 3ELUA 4GLBA 4N3AA 3TKAA 4BUZA 2B5WA 1MX5A 2ONCA 5BYBA 5HK8A 2WUGA 5A05A 4OXYA 4OHUA 5JU6A 3DW3X 4ZVSA 2FX3A 4P53A 4LF8B 5IDVA 2WYIA 4DR6B 2E5WA 1PGOA 1FBTA 4Y8VA 2CHGA 4YY3B 1GAEO 1VMEA 4KZKA 1QZUA 1W0JA 2PSSA 3L7CA 3AEUA 5BUSA 1DXYA 1F0YA 1M6WA 1JXMA 1V96A 4M9ZA 3EWNA 4POAA 3L7NA 4PG8A 2ZB7A 2YXPX 4KKXB 4YCCA 2UZ1A 3C7DB 4KYTA 2J4FA 4YI3A 4E94A 2E21A 4ZYYA 1C1DA 1Q1BA 1RMTA 1VIMA 3A2KA 2RH4A 5IF3A 2JGFA 1IM2A 1M1YA 3STHA 2I1LA 2ZJ5A 2JJ2A 5DEIA 1CBUA 1I7SB 4IDCA 1NN3A 1XTZA 1CY4A 1IN7A 3AH8A 5DGHA 5I7HA 1CUIA 1P9NA 1HOXA 2Q9AA 3NMUF 2YJ6A 1C9EA 4XIIA 4OYRA 3GNSA 1L5QA 3C5EA 5CBKA 2E7ZA 2R1UA 3CNEA 4B79A 4FWTA 1ONSA 2JAQA 4WKGA 3U4QB 5CNJA 5ALVA 5C3MA 2OT3B 1W5AA 2IKSA 2VT2A 3RVNA 2QTWB 3OI7A 3FHLA 3K71B 1SCIA 1KSJA 3IQGX 5ELLA 3T7AA 2CJPA 2GM4A 2FSVA 5EE9A 2G5GX 3HEAA 1PZGA 1VPWA 3STWA 1L8LA 1FP7A 1M2HA 3MJTA 3PKIA 1L5NA 3JQ6A 1QQ6A 1KI9A 1NSYA 4RYDA 4ZC1A 2FUEA