4B95C

Pvhl-elob-elob-eloc complex_(2s,4r)-1-(2-chlorophenyl)carbonyl-n-[(4-chlorophenyl)methyl]-4-oxidanyl-pyrrolidine-2-carboxamide bound
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
134
Chain Sequence
b'VLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Small-Molecule Inhibitors of the Interaction between the E3 Ligase Vhl and Hif1Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 31
structure length 134
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4b95C02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4b95C01
4W9GC 4W9HC 4AJYV 4WQOA 4W9JC 5LLIC 4W9LC 4W9EC 4B95C 1VCBC 3ZTCC 4W9FC 1LM8V 4W9DC 4B9KC 3ZRFC 4BKTC 4BKSC 3ZUNC 1LQBC 3ZRCC 4W9IC 3ZTDC 4W9CC 4AWJC 4W9KC
chains in the Genus database with same CATH superfamily
1PKOA 5DTFB 1DZBA 3E6HB 3ILPB 1FFOA 4HGKC 5E1GA 1THCA 5CHNA 4PJGF 3D18A 4KXZI 3H9SE 3VXSD 3V0WL 4PRHA 1QLRA 2MHAB 5C2BL 1X5XA 5C0IB 3GM0A 1FLRH 3AT9A 4ZFOA 5H94B 4K9EL 1CUOA 4JFQA 3ZYIA 1AE6L 1A9VA 3T4YA 4JFFD 4A7GA 5ISZA 4AMKH 4CC0A 3V8OA 4UTBA 3BSGA 1HKFA 4JHWH 5EULV 2DMBA 2WQWA 4LEBA 5AALA 3TA3C 2BP3A 2YWZA 3HPLB 4HIQA 4AGOA 1AO7E 5IEKA 4IIQA 2WQSA 4IJ3C 5EOCH 3V6FB 4UUJB 4QDGA 3VW3H 3ZZQA 3ABGA 1U8IA 1BOGB 2FX7H 4L2LA 2EO7A 5T5NF 3QISA 1KIUB 1XF3B 1CR9H 3G5XA 2XVBA 5BZDB 1Q9KB 2Q76A 3WD5L 2LFEA 4CBPA 3H9HB 4BRVA 3BVXA 1QFWI 4QRRE 5AAMA 5CM1A 2IH8A 4X0KB 3GZKA 2FYYB 3B9DA 5DRWA 2V3DA 4Z76B 4AENB 3FT2A 2HFEA 3ARDC 1S4IA 1TCRA 5C0FB 2AQ1A 1CGTA 1ZA3A 4MKMA 3IGAA 1MCKA 1PX8A 2FX8H 4KKCC 5F7FA 4BINA 1RHHB 5KSAC 2XTJB 3O6LL 3ARGB 3BVDB 5BV7C 4XWOC 4AIXA 1BYNA 5KSBB 3O2DL 4XE0A 1FP5A 1I3UA 2CRYA 3OLIA 4H8WH 25C8L 2MMXA 4BD4A 4BJLA 3UZQA 4ODXB 5AVSB 5E08L 5FFGA 1RCYA 1RXLA 4UT6A 2HKFL 1KJ3H 5E9DD 5TDOB 2VCOA 5D7KD 2M1KA 5KVFL 1E27A 5HHNA 3ZKND 2WXMA 1URLA 5CGMA 4PRIA 5EN3A 5C3LD 3HZ3A 1ES0B 5C0AE 1MJJA 5CAYB 5CMAA 2ITFA 4XNZC 4WWKA 2YK1H 2X70B 1DJWA 2YPKA 3BGMB 5DR5H 2Y23A 3PUUA 1BA9A 1JZ4A 2YQBA 3RFZB 3MUJA 1J5HA 2AXJA 4ZXBA 4L4TB 1Q0YL 1KXHA 2EINB 3IU3B 5LGJA 4H0GA 2QKIC 3CJJA 2Y9RT 5MEOA 3S7GA 4DTGH 2YS4A 3VWJB 4FXGB 1GTFA 5JQIB 1KB3A 1G43A 3H9YA 3V4LA 4P5RA 1SJEB 3LKOA 3QFDB 2F54D 3ARTA 2BJMH 2VLJD 2V5MA 5CCHE 2CGRL 1CFQB 2OYPA 3UCQA 3WAJA 1BBDL 1NDGB 5I8CB 4HALA 2UYLA 3U0WL 1AC0A 4KHTL 1JSYA 3P40A 5BQ7A 1KBVA 3F7KA 1ZV2A 1DBKH 2P5WD 1RPUA 2V5RA 3ECVA 2GTQA 3INUL 1C1EH 4K8RC 4JJHA 3STZB 3DURA 1USZA 2MWCA 3MRGA 3Q44A 4MJ4A 4PJCB 4YLQT 1GS8A 4QO1A 3ZRSA 4WJG3 1EGJH 3I74A 4GO8A 4ABQA 5F7HA 4HW6A 3ETTA 2J20A 2NY7L 2IWEA 2DQHL 1MFAL 1V05A 1JTTA 1SNRA 2IPKA 2QSVA 4K5NA 1B88A 2J3SA 4F27A 2GHWB 4GW4B 2OSYA 3FTZA 3M6DA 4HBCL 3O3AA 4O9HL 2A6IA 4WZ9A 3D39B 2PCPB 4XAKE 3TF7C 4A2HA 5GS2D 1ZANH 4L18A 1NMAL 2HZHA 2OI9B 5I24A 4OSUL 1QHOA 2H41A 4ONFH 3SN6N 5GGRY 2OKMA 4RVBA 5D1QB 5L6YL 4EI5B 5GGVY 3RTQA 2B8OT 4JO3L 4LCYB 1IC1A 2YA1A 2VDRB 3PFUA 2X7LB 4NO3A 1FO0L 3G6AA 2X6BA 4NI6A 5DQ9A 4YBLC 3VWKC 3C8HA 1QLFA 3QAZC 2VDPL 4GBXC 5BXFA 1AQHA 3MV8E 1AGBA 3RB7A 2D3JA 3DYOA 1DE4A 3A4FA 3WKQA 4YDKH 1P7QA 3MUHL 4L1BA 2QVMA 5JTWA 4P5MA 5F9JB 2Y7QA 5A2CA 3D9AH 4BCZA 4IGBD 5EPMB 2QPUA 2EDRA 3QXDB 4MNGB 4ZW3A 4HJGA 4X5QA 4PJ8A 1WFUA 1QA9B 2HTLD 3CBKB 5E5MB 3UYPA 2E7BA 2UZPA 4ZO9A 3NN8B 1ADQA 3AY2A 2QVIA 2WBJB 4LCIL 5T3ZE 1JTOA 1RK7A 1X5KA 1ZVSA 4JO1H 4PJGA 2WBKA 4D0CB 2H32H 3K72B 1FPTL 3KPQB 4NKIL 4XPTH 1ZS8B 5IF0B 5HHQB 2J5LC 3OR7A 5GRJL 4A2MA 2FATH 2YAOA 2ZUQB 4KRPC 4NGHL 4X4ZA 2L3BA 1DQMH 5IVXF 3MTRA 3FT9A 2NW3A 1MJUH 5ENWB 2BS9A 2WWMD 1MNUH 3BPCA 3FO9B 4L1SA 2FR4A 5E4EC 4JPKH 4XN1A 1JXDA 3KPSB 3S3DB 1ZT4A 3ZT6A 3L3JA 4A68A 8FABB 3JTSB 1ILUA 1ONQA 4ZRGA 2B4CL 2C9AA 5EBLA 4Z7OB 4AQ1B 1Y07A 3ARED 4JHZA 5LNEA 1HCFX 4KOBA 5IQ9A 3RGHA 1QFUL 2NY1D 4U1NA 1A6TA 3HE7B 4ORZC 3V5HA 2H45A 3OMNB 2Z35A 3FQWA 3QSKB 2VN3A 4F2EA 4NZRL 2QADD 1VFBA 2EEXA 3CFBA 4MHHI 3B2DC 1EQWA 1E9QB 2ED9A 5E8PA 5LG6A 3DOIA 3QC5X 1S9KC 4APXB 3QPXH 4GJTB 4KO9A 5LXGH 1OM9A 1ETJA 3QUYA 4ZS6D 2OL3H 3DSFL 1QR1A 3V9CA 3WTYA 4GIPD 3SY0A 4I88A 4FFVD 1WWWX 1EFXA 1L9NA 3AU0A 4BXSV 2R0LH 2XJLA 2ICWI 2P8MA 4JFVA 2D7QA 1JN6A 1I7TA 3AUWB 4YDIH 5B1BB 1ETZA 3MAWA 1JZEA 2OJEA 4GSXA 4LSPL 4RRPA 3VTTA 2A4ZA 1I1AC 4K73A 4R4ND 3PP4L 4J2QA 1PLBA 4X6DF 3GSRB 2J73A 1FH5L 1FYHB 4HU8A 3ZDZE 4N2OA 3EOTL 1E7VA 1PJ9A 3LN9A 1JPFA 3QHFL 1A6ZB 1EEZA 4RAUB 3ZE0F 5I19L 3GS0A 3CK0L 3GK8L 2VUOA 5DK2A 4RMUA 1N5YL 3H42H 1KCLA 1N0XL 3NIDF 5ABAA 1EGJA 2CA4A 2EXYD 4LPCA 1U95B 1ASPA 2OMNA 2XWEA 1IC4L 2NY0B 4NKMA 2Y7SA 4Y5YC 1IE4A 1JHLL 1KCKA 1NGXB 2DICA 3L6FA 4GAJH 2B9AA 2LHAA 3K6FA 3NZHH 1BAFL 2BMKA 3OR6B 5CWSA 3A0OA 4PG9A 2BX5A 1SM3H 3O3EA 3QYNA 5D71H 1ZSDB 2ZKHH 2HT3C 4FP8L 5E94A 4ZTOH 5FUZH 4AEFA 2OMVB 3J8F7 3UTSB 4W9LC 1A7PL 3M7FB 3MA9H 1B3JA 1NDMA 2DYRB 3DJRA 4L1DA 5C09A 2N3JA 3WFBH 1P0SE 4KXCA 1HTYA 1XGTA 2IADB 2LVEA 4JFDB 4KXBA 5IMOA 2Q5BA 4Z1PA 4H26B 3EXLA 1F1AA 5DRNB 3ILQD 5ETUB 4EVNA 3X11A 1JZ8A 3M1BB 3S3BB 5AOLA 1AHKA 1JPSH 4MQTB 2JFCA 2QSCH 4HUCA 4AOFA 1FUNA 3ULUL 3RNKA 5TQ2L 3UTTE 5IB2A 2FX9H 2LT9A 2ADIA 4JUTA 3EYVB 4HKBB 3TC9A 5F3FA 2CLVA 2M8XA 3QZWA 4XCNA 2GBVA 4HG4K 3N06B 1FYTD 1UOVA 1GS7A 1TFHA 4NBYB 1MW1A 4OQTL 3UIZA 2DLFL 4OLYH 5DZNA 3U0TB 1VFAA 1CFNA 3AITA 2NT1A 4OZIE 2V7HB 3MRCB 4MAYC 2X4TA 2AV1A 2BY0A 4WLCA 2VE6A 1LL1A 3D8MA 1J8HD 3LRSA 3WU1A 2VRAA 2YD7A 2CPCA 3UMNA 5GISH 3FB6B 2B0SL 3HG4A 3BP6A 4KTYA 5KVFE 3SD2A 4NRYA 4H40A 4P0DA 5FECA 2H32A 2YEVB 5JA8B 1TQUA 3QS3A 4HIXL 3PJLA 4HFUH 5IQNA 4IS6A 3GJFK 5AVZB 1GYWA 5FK9B 3N1FC 2BHYA 3TN0B 3SO3C 2DMKA 2IG2L 3LZNA 4RDBA 2Q3AA 4BA8A 5C0GB 4OJFH 1T0MB 1H5BC 5CBAB 1GJWA 1NGWA 1OD7A 2HFGL 3FT4A 4JREC 2D2CC 3GLEA 4UQEA 2ITCB 2QV2A 1K5NB 2UX7A 3NJNA 4X4XA 2NQ3A 4LOUD 2X9WA 4UAOB 4EUPB 4Q6KA 3QEHB 3NJIA 2EZ0D 3T6QC 4FLOA 3GSUA 4OKVB 1UCTA 5IMKA 5JXED 3APNA 3WMQA 5KYYB 3UEQA 1QG3A 4QCIA 4U1SA 1ZLUK 2RBLA 3KPNA 5IHZA 1TJXA 4AGPA 2W0PA 3UZVA 4KFMA 2ZXEB 5LQBL 1JV2B 1SJHA 1TQWA 1QEXA 1GHFL 2AJZB 2L4OA 3HAEB 2VOTA 3MLYH 3MBEA 2OL3A 5D2NA 3MZTA 3RVTD 5FOBA 3MRQB 4I1RA 5L2KA 1TLMA 4GAYA 1G1YA 3FCUB 5FO9A 1EHXA 1E4WH 3PJSA 2I60H 5D2LB 3QZNA 5IVXA 4GUOA 2XQYK 4W9GC 2VDLH 1YPZF 4OF7A 2ATAA 1BD2A 4LLMA 2X4NA 2LQRA 2ZP9A 3X12B 1W0VB 1A4BA 4F57L 5GSRB 4NUMA 4PJDE 4OCSL 4E42B 2ZX6A 4OLWH 2JJSC 5K9QI 4KKRA 1GRWA 4OM1H 1LEIB 3WD5H 2CA3A 3N85H 1MOEA 4PUBH 4WEBL 1WA1X 3N04A 5FHBH 3N42B 4IRSD 2CHWA 4UNIA 3SSGA 3ARUA 4KTEL 3BW9B 2JCCF 3CFJA 5INCB 2ROXA 1UM5L 2VXQH 4AM0Q 2X88A 1DVFD 4W9CC 2CDEB 2FT8A 4IOFC 4I0PD 1RZ8B 3KL0A 4GRLD 4JM4H 3SDDC 1Z9OA 2VGLM 1HKLL 4PCYA 4AIZA 1FFTB 5AOIA 5KUKA 4PP2A 2BNQE 1RP8A 2DMGA 3H4FA 3SE6A 1T20A 1N0LB 5FDWB 1SRDA 3O2DH 5KBDA 1KCRL 1G0DA 3CZSA 4PS4H 4Z3TA 5DYOA 1SDDA 3W9EA 4L4VB 3BWAA 3K2KA 5FB8A 1E6JH 4W93A 5IV2B 3O2WL 4QYOA 4GW5A 5I15H 3BEVB 2LE9A 4J4PA 4MDIB 2VAJA 2XUWA 1IGML 1HCZA 2DW5A 1F4YH 2NY3B 3QZBA 3HNVH 2YMXH 3P1VA 1PDKA 4LPVA 1FJ1A 4X6DA 3H9SD 1HDMA 2QQLL 1AI1H 5IFHL 3DIFB 3QWOB 1KFGA 1KNOB 1YY9D 2X9XA 1QQDB 3ZTNH 4Y2DB 3RB5A 4UQ9A 1M05A 2CR6A 2ADGB 2D7PA 4QRUB 4HIPA 5DMGC 4ZAKC 4NC0B 4NQDB 2VUKA 1YJDC 4U1HA 3QQ9D 3EYQD 3QUKB 4JO2L 4XO8A 3VXTB 1L5GA 1GW6A 4WIQA 4EI0A 5IQLA 5JW3L 4L8BB 2VLLA 2WXQA 1N59A 3KL5A 1KOAA 4FADA 4NUJB 2G3ZA 2JWYA 2ZZUT 1XMWA 4J3OC 2F8OA 1AO7D 2ZWYA 3QQ3B 4OJDH 1TZIA 4ODUB 3MRDA 2AJ3A 2MNWA 2YXWA 1BBDH 3ECBA 4PJEE 5ILTL 2WVVA 1R47A 4HUWB 1D2OA 3C60C 1CBVL 4CN1A 5AENA 5CUSH 5B38G 3LQZB 4G8GE 3T1FA 5F97E 3U9PH 4QRRD 1HHKB 1WG3A 1BEXA 2HMID 2OXHA 4LIQL 4HBQA 5TGBB 1I8AA 3L95A 3RZCB 2J1ZA 4DP5X 3J27A 3LPGA 1MWAH 3MCKA 5GZOA 4P3WA 1AHMA 3MRPA 3VI3E 2HPTA 3LDBB 2C3XA 3TBVB 5E8EB 2C9RA 1U8KA 2DQHH 5C0CE 3U1SL 4UZGA 1F6AB 2W07A 1X9UA 2DJMA 1E2WA 1XH1A 3C6LA 3ESVF 2OPCA 2ZSVB 3LS4L 4LQFL 3T4AB 2YSSB 1PD6A 3FXIC 4TNVF 3ZVVA 2HN7B 4RGNC 2V17H 4MX7A 2W94A 4M61A 4KJWC 5D96C 1L9TA 3CZJA 2GW5A 5JIPA 5DQDL 1P1ZA 5K69A 2YD1A 4B97A 5DHYB 4Z7VB 2WV3A 2BY3A 2WINB 4JO3H 2Y4SA 3OMIB 5I2IA 2VR4A 4XB7A 5DRZB 3RDTB 1Z66A 3SCMC 4G42B 5C0AD 3E3QC 2F5AL 3I6LE 4S2SA 3TCLB 4G9DB 5I74C 3QAQA 3O6FD 4J7RA 1GMEA 5AVQB 3KZ8A 2HVKB 1U3JA 2FJGA 2Z31B 2WXJA 1AQKL 3EYUL 5HJGA 3NRFA 3ZPDA 1MQKL 3MNWB 3O0LA 5DJ6B 2HA1A 3MYJA 4JZJA 2B9BA 3NTCL 5GZNA 1D5BA 3CZNA 5F9OL 2Y5TB 2PPFA 3K46A 4ZFQA 4I18B 1GGUA 5L8LB 3WTTA 1RUPL 3P0GB 4X98A 2VDMB 1WCBB 3FU7A 4KZ0A 3VFOB 3RPKA 8PAZA 2QVKA 3GHPA 4QTFA 1S7VA 1FPTH 5G4MA 4KROB 2VXQA 1SVBA 3JWDC 2MJWA 3BKCL 4XX1E 4R97C 1MQ8A 2N1KA 1NCCL 3CC1A 3DGCR 1T3FA 4KVPA 1RZ7L 1ZLVH 3PHAA 1RJYB 2M26A 1ZOXA 1WAAE 1KPRB 5IB5A 2EYTA 1IGYA 2V9QA 3M07A 4C8XA 2ESVE 1OCWL 3LPPA 3NIFE 3O2DA 3EFFB 5CJOL 3WAKA 5KAQF 3CZFA 3T2PA 5IR1A 1ZEAH 2ZXGA 3QG6A 5GGVL 1HL4A 1QFUH 4JJOA 1QWNA 1YMMA 3OC5A 3DVNA 4MNQA 1YPZA 4XAKD 4E5XG 4BKLA 1SOKA 4HIIA 1AKJD 1I8KA 4K15A 2DQTH 3V5DB 3ILPA 2X10A 2VMEA 1NEPA 2OZNA 2R0KL 4ZZKA 3HZKB 1F41A 1KC5H 3GDCA 2XZQH 2F5BL 4PWJA 2FO4B 1HEZB 2MHAA 4MB5A 3ZKMD 1AXSA 2WW8A 5C0IA 3P3UA 4I87A 3BFWA 3CFUA 1DLHA 3NAAH 5DT1H 2JCCA 1K9TA 1V10A 3DRTA 3KLKA 5T1LB 3MV9E 2A7BA 5E23A 2G75A 2B16A 3UMTA 1N68A 3GPEA 3SDXF 4Q7DA 3MV8D 4DFIA 3N0AA 1LE9B 2V3FA 2XXFA 3LVTA 4Z7OF 4FF9A 1PZDA 1ZLSH 5FCSH 2KZWA 3RVWD 1VB9A 5LO7A 4XE5B 3EOTH 3FUHA 3TEXA 3D2UD 3PDGA 3ULUF 1QBLL 1YVLA 3Q6FA 5EO0A 4EDWH 3E9TA 3P73B 3V0EA 4TLTA 5I19H 1E65A 4KUZH 2HLFC 4OAWB 1X4XA 4OD3H 4P8QA 1NCIA 4JR9L 5EIVA 3P3SA 3SDCD 3UX9B 1Q9KA 1HL9A 1D9KD 1IM3B 4FNSA 5T3ZD 3L08A 4KKBD 5JDSB 1MWAA 2OTUB 1A4CA 3AXIA 4IIQC 1CL7I 4Z76A 2BVPB 1NZRA 3GS4A 2FO1A 1WSST 2CKNA 2RB8A 4J3TA 4MDJB 2J57A 1BLNA 1JHLH 5EEVA 1M71B 5IW6B 2E6JA 5AW6B 2J2ZB 4OT1L 1BAFH 2J25A 4IBQA 5D1ZB 5BOPA 3TU6A 3H6AA 2I9LB 1KACB 1JF1B 5AAMC 2D7OA 3BQUB 3QIUD 4AQZA 5ABDE 1RUAL 4O00A 2R1WB 2TAAA 4RLDA 4QOKA 5IIEB 1A7PH 2ADJB 3HPJA 3NCJL 1JUFB 1OP3H 4IBSA 1TUPA 3RWJA 4ODXA 5BRZB 5I66A 4FFTA 3N40F 3MUGA 5DJZB 4YH6A 4LLUA 2YAPA 2YQ3A 2ZUSA 1KG0A 2BRRH 5GRUH 3ULUH 1U3HB 1OOAA 3X3FH 1IM9D 2R2EB 4TUKH 4C47A 4ZUSB 5EIQA 3D09A 2VJ0A 3L13A 1U8OB 3AU1B 4KRLB 3BGMA 1IGFL 2OQJA 3DYMA 3BZEA 2WXLA 2J88L 4K3EL 4U3HA 2BP5M 4L4TA 4CVXA 2FWOB 2PXYB 2X4UA 4YZFE 4K94H 2B5IB 2K6WA 3B2VH 1C16A 5L7XL 4GUQA 1NPJA 2DQUH 4NQTA 1DVTA 4FXGA 5B22A 4X4ME 1AG6A 5KYXA 3DSNB 4IEFB 4WWKC 1KB5B 3QWRD 3G5WA 1J8SA 3QFDA 1KZQA 4PS3A 3NZ8A 4U7KA 1YN6A 4ZXBC 2AHIA 1Y6NR 5LCVL 4U1IB 3BP4A 3O0RL 5B1CA 4F20A 1MNNA 3JTBA 2P44B 1WFIA 3VFPB 2G4EA 5F3BB 5I1DA 4Z7NE 4LP8A 1QTYT 3REWB 3QEQE 2F58H 3M8OH 2IG2H 1NC2B 1ORQA 4XCFH 3I75A 3KGTA 3LNGA 1W2KT 2DD8H 1J0ZA 1HOCA 1TQTA 2KLRA 4MD5B 3U4EA 1CT8A 2EIEA 3B9KA 4DEWA 3EOYG 1JRHL 3M46A 2CGZA 1V3MA 4XBMA 4JN1H 1HHGB 2V5SA 4NDMB 4XPGH 1T0PB 4XPFL 1LO2H 3D0AA 1GC1C 1WEJL 3DXAB 4M48H 5IFJB 3IYLW 4FERA 4KH2A 5F1NA 4AEEA 5LQBH 4GB9A 5E00B 1YEGH 4H88L 5AW7B 1NL0H 3II2A 1KXQA 4EI5A 2QMJA 1KYDA 3DETC 4K07A 2AZUA 3T0VA 1JZDC 2X7LA 3UTTD 5AW8B 1GZPA 2LU5A 1M7IB 3QEUB 1CVRA 4AUYA 5DC9B 7PAZA 1DQQB 4IDJL 4JKNA 1FRGL 2E59A 2IBZY 4XBEL 2VKXA 2IANB 4FULA 5F9JA 3RTQC 3PGCB 2AC0A 4O5LL 3PWLA 2GSIB 3IDMA 1E4XI 2DDQL 1IO4C 4KJPD 3K6NA 4ANKA 3GRWL 1TQVA 2X4QB 2YUVA 3CXDH 3EHBD 3GXIA 2Z8SA 4WEBH 1R4XA 4KKLC 3OMAB 1RUML 2AVGA 2Q7NA 4JRFA 5E6SB 4CC1A 1C12A 1F13A 2DYPA 1UM5H 4JL2A 2WZPD 3LZLA 5I8OL 3X1FA 3ULSA 3IEAA 3PCYA 3E3QE 3UFIA 2VM4A 3MZGB 2UWEF 4WHTB 2VAAA 3KPQA 5HHQA 3W37A 1ZS8A 3DBSA 4K23H 4WTZG 2Z7YA 3NUKA 1SVCP 2JJWA 4M1DL 1UZGA 4PJ8C 4TVSa 3RIFK 2ICWB 2Y3NA 1ERNA 3NQKA 5IBLC 3PJNA 4E9QA 5CD5D 4HHAA 1KCRH 4FJ6A 5DHVB 5CGYC 5CILH 5J12B 1I7RB 2N0KA 5H35B 1OB0A 2B2XL 4P3DB 5DMKB 2OA9A 3SDXA 3KPRB 1GYAA 2AK4E 1A3QA 3IXTB 2VYRE 1YO4A 3EJRA 4AQ1A 4DUXA 5JQ6L 3TFKC 4BGLA 4NPKA 4Y4HB 4P3CL 3BO8B 2H0JA 1T0OA 2I25N 5D7JD 4ZPVB 3VH8B 3ZNGA 3VGHA 4CDHA 1JPEA 1U8MA 1XZ0B 1HH6B 3N0PB 3QDHA 4AL8L 3BUIA 4PJHF 4TNGA 1TQCC 1SZNA 2YD4A 5E5UB 1YNTB 4H8WC 4LHUG 3HAEH 4JO2H 2R2CA 1G7MB 4HKXB 4U6XA 3QUML 2IQAB 5K9JH 5I1JL 1E7UA 4LBAA 3GS7A 2MPAL 4P5TA 3KNBB 2A38A 5CZVH 4FYSA 2Q1EA 3O9WB 4N8CH 5T1JA 3GB7A 1NA8A 4UT7H 4KAQL 3PF2A 2HB0A 3QUYC 4F80A 5BS0A 3LH8A 1Z1WA 3ME0B 4P4KC 5B4MC 4LSUL 1JYVA 2OMYA 2ERJC 4FGMA 4NAQA 4C59B 5L4JA 2HRHA 4LIQH 4M56A 4JO4H 2VDQH 5HYJA 1MVUB 4JY5L 2X2UA 1KLFA 1TVBA 1A14H 6FABL 4MLIA 2JIXA 5AZ2H 3FPXA 3IGUA 1JV5B 4A04A 1G5GA 4BHUI 2Q7YB 4BQCA 2MEJB 1XEUA 3U1SH 3Q06A 3TIEA 5L8KB 3ARWA 2WPGA 4NIKB 3VFTB 4OGXH 1NKRA 2CCWA 1KEML 1XCXA 5IK3B 2BNQD 1GGBL 3CD4A 2E5EA 1NGXA 1TTBA 3AG4B 1D5ZA 4M7LL 4ZOBA 3X3GL 5I5MA 2XKSA 4BWUA 4KQ3L 2M83A 3TEYA 3B43A 4X5WB 1OCCB 5KS9F 3A6OA 3EGSB 1ZSDA 3PGFH 4B9PA 5I6XC 3UTSA 3PNRB 3OJ2C 4XZUB 4PREB 1HWGB 3KLHC 2EDFA 2KT6A 3DRQA 1XR9A 1JGVH 5DRNA 2W1NA 5EUKB 4OZHB 2VLKA 4N5ED 4HS3A 2UX6A 3MJ9H 4DW2H 2CO2A 2AJVL 4MRBA 4N26A 1R17A 1Z5YD 2NY6D 1CXFA 4HS8L 4GG8B 4UV4H 2DWDA 4HSQA 4ZMNA 3SJVA 3F7PC 1MI5B 1MQKH 3LMJL 3M7OA 4MJIB 4F7CA 4C83B 4P23D 5KVEH 1CICA 4H2AA 5IVNA 3UGXA 4XCEB 3VXUB 4WNQB 5AW3B 5AW5B 1KJVA 2F53E 2OM5A 3F83A 4XVUC 1RUPH 4PB9L 3B9KD 2O61B 2J6WA 5SWZA 1EAQA 1K8DA 2AXWA 1AD0A 4IDLA 5DZVA 3G04B 4ZW8A 1JZ5A 1LP9B 3WMSA 3BUTA 3BP7A 1NEZB 3HFML 5JHAA 2ZKXA 5LLIC 2JVUA 4XI5C 1FL6B 4LLWA 3V79C 1QSFA 4G8GD 2QBWA 5DRXB 4MSWB 3BSZL 4NQEB 3MR9B 3FZUC 2ZUWA 1E40A 3IDYB 3MRNB 2B1AL 4U1MB 2OYKA 43CAB 4F93B 5GXBB 2O5XL 3UYRL 4FKEA 5G2NA 1IAII 2XA8H 1IC5H 5JHDE 4C56B 4FABL 5CJOH 3HI5L 4FEMA 4DQOH 4L3AA 1CLOH 1OGSA 1JAEA 1FGNH 1OSEA 3EDFA 3RIAF 1N5AA 5C0CD 5CBAA 2IGFH 3SB3A 2KL6A 1I1AD 3VA2C 3B7RL 4PJXE 5F7MC 2PO6A 4QXGL 4MB1A 2PMZA 4FYTA 3ALPA 1GGCL 5E4AA 4X4YB 4UQ3B 2NT0A 5FWRA 3ARBB 4OKVA 1YDPB 2WSDA 2GC7C 2VXTL 4J8RB 2F5BH 4LAQL 4P2QA 1QTPA 4H25A 4IIZA 3BXNA 3R06A 4FCAA 3VD5A 3O6MH 4UYPA 3IU4H 3FQNB 3V0FA 5AFAA 5HHOB 1TPXC 5KSVA 4PJ9B 1OGPA 1RHFA 3C5ZA 5C07B 2OMXA 2IQ9L 3QJVB 4Z0XA 4CMHC 5BO1H 3K6OA 2VZTA 3CFEA 3HAEA 2R69L 5ANMB 3TIDA 4DKEL 1PF3A 4OCWL 3US0A 1T1YA 3HRPA 3I6LD 1KTCA 4PRDB 2OFQA 2UWEA 3VMNA 5EU3B 1NGYB 5SX5H 4Z7WB 2ZPKH 4ABWA 3BCDA 1MFMA 1F4XH 3UC0L 2FWLB 2N7BA 1E6OH 3WIAA 4D9LL 4BFNA 5LN4A 4J39A 1U9KA 5GGQH 2WQ8A 3MBEC 1LNUA 2B1HH 3EUDA 5HVHB 2C4XA 3FTSA 3KCPA 4LEOB 5GSRA 3ALWA 3WE6A 5D2NC 2K8QA 3CG8A 3QS2A 5EFIA 4MQ7B 4E42A 3D85D 3RILA 3K4ZA 1HK6A 3W11D 3RUGE 3ARPA 1VEOA 3K2UH 5F96H 5F89B 4FCHA 4UU9B 4LBEA 3A67H 1RZJL 1I75A 1I8IB 4PJHA 3CQFA 3N9GL 4NOFA 4YHYB 3KXFA 1W6WA 4GLRI 4ICXA 1D6EB 3VXMA 2VXVH 3QZPA 5GGUA 3WUWA 3KVPA 5C9JA 2ESVD 3DROA 5EBWB 5A40E 4M1CD 1N0LA 3FO2A 3KLDA 1JGUL 1TEYA 1M7XA 2AVFA 3JWOL 4F7EB 12E8H 4WWOA 3SE4A 1B6DA 2K6YA 3BYYA 3S3SA 4YFLI 1EAPB 4EE2A 4KY2A 3QI9B 2E7LA 2PWGA 5ESQB 1QFWH 2APBA 1ZTXL 2VR5A 2Z64C 4QEGA 5EZJA 3ETBF 5AVVB 4LARH 3VXRE 2AZAA 4LNRA 3KW7A 1MREH 1UVQB 4YHPB 1LQBC 4GYBA 3IKCA 4J4PC 3LHPH 1FNEA 4Y4KB 3MRKB 3MV9D 3RVUC 3NSYA 3RNQB 2XIIA 4DZBA 2NYKA 3VXTA 1UHVA 2R2HB 1UGNA 3EGDB 3LN4B 2MNJB 1P7KA 3PS6A 4L8BA 1U93A 3O6KH 1A3ZA 5ADOL 1G7LB 1PYWA 4N1CA 3ZHNA 4DAGL 1KPVA 4X7FC 3QQ3A 3NFSL 4XC3H 1OM3H 4YL9A 3QUXB 3TT1L 2VLRA 4ODUA 4F3FA 5LCVH 2ZUXA 1XCQB 3HA0A 1J1PL 2H6PA 1C5DA 5KS9A 4ZYKB 2BSEA 5IFAH 1I85A 1CGWA 3WNNA 3OG4B 4AIOA 2DQEL 3WO4C 1CG9A 1QI5A 5BMFH 3MRBA 3L4UA 2GJZA 3CHXA 3IXAA 4UM9A 3MOBH 4DN3L 5GGRA 2L7JA 1ZK9A 5AYUH 4NHCL 4PB0L 1IIIA 3PL6D 2YZ8A 5HYQA 5AB1A 4YR6A 1JRHH 3L3HB 3UTZB 4KK5C 3P02A 1F6AA 1WD8A 2Y36H 1DVQA 3CU7A 5AOKA 5HI4C 4BFBD 2ZSVA 3GTVA 3SDAA 5GZOC 3O3DB 5T3XL 1OSZB 5JPMA 1GCFA 1BFOA 1HEJC 4HWZB 5HHVH 3Q2CA 3ZL1A 4DKTA 3MDJA 4WI7A 4H88H 3E2HC 1WBZA 5J06A 4KPHH 4ODTH 3RKPA 4ZT1A 4AZ8B 5ICYA 3C6LC 2R27A 2X1QA 2E7DA 1ZT7B 4N87A 3SQOL 3FT1A 4Q89A 3KJ6H 4IDJH 4PY7A 1N64L 4G9DA 1NWPA 3B1UA 3GSNB 4KO5A 1OWRM 2EUWA 4EMZA 4KMTL 4IYKA 3BP5A 2FQEA 5DC2A 3MRFA 4AQ8A 3JVFC 2UY6B 2XWRA 1K4CB 2W9EL 4O5LH 3V0VB 1HYSC 3MNWA 1XVSA 3FU9A 3JQOB 2DDQH 5DJ6A 4CU8A 3IKKA 1CTMA 4Z9KB 5H8DA 4F8OA 5HYSA 2CMRH 1LEKA 2YEQA 2GUOA 1JXFA 4ADJA 1MLCA 5BZWA 4DK5A 1FAIH 4JPVL 4F58L 1KB5H 4PRPB 1MZZA 1UATA 1L7IL 3MV7D 1X4YA 4P5SA 1FZKA 2W0KA 1R5WB 3TVMD 4JZJC 1E43A 3DX7A 4NZTH 2QVFB 2BDNH 5GZNC 3D2TA 4KV5F 1J0HA 4M1DH 3T6XA 3C2AL 4NC1C 2BINA 3QEQD 4Y4FA 4YK4B 1A1NB 2B59B 3TO4B 1KIQA 3BN3B 3PHOB 1KPRA 3BAXA 4YQXH 1WICA 2IBGA 3VNYA 1KT2B 4XTRD 2ILLA 1CK0L 1OGAA 4BWTA 4QF1B 1DVZA 1NFDB 1UT2A 1E9OA 2HJFA 2Z7WA 4ES9A 4I4WA 4U4BA 4DO5A 3KEHA 5JW4R 2C3VA 4LGSB 2YRLA 2AEQH 3B4NA 2XY1A 2J4WH 4WWNA 4J3UA 4XMXA 1FC1A 3B2MA 3WS6A 5GPRA 1GZQB 4YSDA 4JFZL 2LOEA 4TXVB 3HRZA 4Q9RL 2CRMA 1JGLH 4V2CB 3H0TB 1XB8A 3K71A 2VZ3A 1KLGB 4JKMA 1PEWA 1S9XB 2HRLA 4DGWC 3CMGA 3QUMH 1JHKH 4P06A 4QHLA 5I1JH 3RI5F 2XYCA 2MPAH 2NW2B 2X4OB 3UJTL 3GUFA 3WY4A 2EVHA 3GEWB 5KSUB 2V2TB 1BVZA 4EN3B 2Y7LA 4Q9CA 5J89A 3S8FB 1NBZB 3MC0A 1A3RL 3UH8A 3VFGL 4DPRA 2Y1VA 5LCVA 5B8CB 4LSUH 1BQSA 2MQGA 3F6LA 2D31B 4OCLC 5DZPA 4H5SA 4HETA 2MCG1 4LT7A 1YMHA 1KGCD 3KLLA 3ZIYA 5I16B 3L5WA 6FABH 3T04D 4XOEA 3LD8B 5DHEA 3APFA 2EXTA 4DN4H 1EBPA 5HGHA 4J3SA 3NA9L 1V55B 1ZT1A 5E95B 2PYEA 4F8TA 1FFQA 4AMXA 2ZAHA 3L3DB 2QHRH 2NX5E 4DT2A 1OP9A 1B0IA 1H3GA 4Y0GA 4N2MA 4L0ZA 3TZVB 4I2XA 4N0CC 2JI3A 1TJIL 4KQ3H 2BVEA 2FD6L 2WVUA 4X5XB 2ZWNA 4B9YA 5DHVH 1IBBA 1JF1A 1PZ5A 3BEWB 3BQUA 2WK2A 1PY9A 2JQZA 2RFXA 3CFIC 1EZUA 3BWZA 1FFPB 2ADJA 2TRYA 5DJDB 4X0NA 2BM3A 2AK4D 1F90L 1I1YB 1N4XH 3C12A 1F0LA 4LLQB 3SYPA 5HTSA 3HG2A 4M3JA 1BD2E 3PDDA 1QFHA 5B21A 4OCXH 4KGLA 2C3GA 3MJWA 4N68A 1J0YA 2YKKA 4R96B 1YUKB 1JK8A 2HJLA 3UAEA 3E6FA 4N28A 4AVHA 2E8ZA 2CR3A 5CD3B 3GMNB 5GS1A 3LMJH 3QJSB 4JG1L 2DAVA 1PQZA 3D7PA 2QQKL 4KI1A 2DQJL 4OD1H 5C92A 2R9HC 5B3JE 2KUTA 5IJVB 3UPAA 2FQDA 2V37A 4FS0A 3GRWA 1CFMA 5DVLA 1XIWA 2APXA 4PB9H 3PQYB 3S2CA 1RQ5A 4M5YH 3WI9A 2W92A 1PG7H 4HEMA 1XL6A 3AWEA 3VQ2C 2PN5A 4DP7X 4IEFA 4TRPL 4Q56A 4E41E 1KB5A 4MA3A 1LO4L 2G3XA 4XXCA 3UG5A 5I71B 5LGHH 4IKKA 4XMWA 2FHBA 3LNEA 3BAJA 4JM2D 3HS9A 4G9FA 4HUXB 4U1IA 1SFDA 2DQ6A 4P9HH 5TQ0H 5JYMA 1ZTXE 3HN3A 4H13C 3UYRH 3H7LA 1J0IA 3HMXH 3OB0H 4FXGC 3ARQA 3MNZA 4BH8A 2DJSA 3GIZH 2DIJA 3KR3H 3MXVH 1VGKA 3VXPB 5I1LA 1QUNA 1NC2A 1WZ1H 5FLVA 2Y7MA 1BVLB 3B5TA 4MD5A 3RZWA 2X3BA 4AV5A 4NN6B 2NR6A 5JR1L 3FCBA 1CLZH 2XHNA 2VSKB 3OX8B 4HKJB 2V8MA 1AR1D 4R84A 3GBML 4FN0A 5CR8A 1A4KB 4H7VA 3QCUL 4LPTA 4NDMA 4L5FL 5CP7A 1NOLA 2C9VA 1CF8H 4RMWA 5D93C 3VE0B 5J11B 4G5ZH 5A7BA 4FKHA 5IFJA 2BO0A 2VJ8A 2YD3A 2OYLA 3C2SA 3IJYA 4D8PA 3R7QA 1DFBH 3ZOAA 1P6FA 4PJ7E 5L4IA 2R69H 3D05A 2AEPH 4LL9A 1UZ8B 3X1GA 4EKJA 4OD2A 3QUMA 2C9WA 3ZDXF 2YD9A 3SD5A 4NZFA 3M17A 5I0VA 1TVHB 2A6JA 4TPRL 3BVUA 4NUGH 2BFVL 1FV1A 3LKSA 3WDJA 4RX4D 2QPEB 3RRQA 3AGVA 3O4LB 5DVOA 3QEUA 3UC0H 4N2DA 3NH7L 1VADB 1DQQA 1W72L 1HHHB 5EU6E 2D3VA 2B15A 1BGXH 1U4EA 2VO5A 1O5PA 3RU8L 5AD0A 2H1PL 4IRJA 2EKJA 2VDRL 4EI5C 2X6VA 2BC4B 3CLEL 2JK5A 4FNPA 5F7EH 5FKPB 2F53D 4Y9FA 5T3XE 4TL5A 1G7PB 5CJQL 5FYJH 3WSQL 1TR7A 1F6LL 5J1SC 3FQTA 5GHWL 1INQA 5JMRA 1LK3L 1AS6A 1WWBX 4QTIL 3IDXL 4HP5A 1G6VK 3ZK0A 1AG0A 2P28B 1Y18A 3RL2A 3EO0A 1XWVA 1WV7T 5E1HB 1T03L 3N3EA 3U7WL 4MHHG 3K2MC 5FW7A 1KYUA 3NIGB 4APQA 5E2WH 5KBNC 1OSPL 3BZ4A 1OZUA 5JHDD 3BH8B 4QRPD 4TQEH 2ICWA 3RJOA 5LHDA 2H2PD 3HKFA 4JLRA 2BK8A 2OULB 3GGWB 1I7RA 1Q94B 4NCDA 3PWNA 1Z9PA 3BLKA 4BZ1H 3O4OB 4NYLA 5DUPL 4BUQA 3B6SB 1QRNA 1VPOL 2HG5A 4HOXA 4ATTA 2P24B 1AHWA 1MDTA 3IXTA 4HPYH 5D1XB 5HGDA 1MELA 1A7RL 2Z1KA 1F8TL 1PW3A 3QIBD 2WSKA 4GUPA 5A43C 1QATA 3AAZB 4JFYB 2CH8A 2IPTH 1G94A 4NC1E 4K4KA 4PR5A 5DA0B 1HHIA 3MLWL 5T1DL 3RWIB 1WFTA 2FTAA 3T8VA 4AQ1C 3MBWB 5E6IA 2BVQB 2ZCHL 1B9ZA 1KN4L 3Q5YA 2IQAA 4KK6C 2J43A 2NY5L 4Z7UE 3A3YB 2Z7UA 3EO1B 3ULUC 2EIKB 2EXSA 4Y16A 3PGDB 4GINA 2J6EL 3NFSH 1P5VA 1K2DB 3MBXH 4PJBB 4ERSH 3IJEB 3QJOA 1EMTH 4ORGA 2G2RB 3QDGA 4PYGA 3ASWA 5FLUA 2RD0A 3ZKJA 3BSZA 3BT2H 3NCFB 2ZXDA 4PLJC 1P53A 1U30A 4YHKH 1L4IA 4K94C 2WLZA 3RJQB 1P4IL 1CLYH 4JJ5A 5D70L 1WO2A 3HMXA 2NRDA 1YMME 4LLYB 1LJMA 4P5TC 5F71A 4XN2A 1P5UB 3K74B 5A16B 2E9JA 3E80A 4WGWB 1DUYA 3BHBB 3SPJA 4FNLH 5EC2A 3GKWH 4P57B 4PB0H 5DURB 5I8EA 1IC7H 1U4FA 2Q7YA 3KDPB 5C2UB 1ED3A 1RD6A 1LO5B 1L9OA 2FECL 4WHDA 4E9VA 2IGLA 3U46B 2OMBA 3VDBA 5A3IC 4WO4B 1QO3A 4JRXB 5IK3A 5BVPH 3D3VE 4WW2F 1PFCA 5FO2A 2W9DL 2IEPA 3LV3A 3QCVL 3SGDH 4YSPA 1ZSHA 4JKLA 2B3RA 3FBQA 5C3TA 1AY1L 4X8JA 5DD3H 1N3NA 1M1XB 2AJYH 3K1KC 2H4EA 3F12B 5HHXH 4NJ9H 1WFMA 1FVEA 3ABLB 3BFOA 1BPVA 2EDJA 4J23A 2QR0A 4HWBH 4OLUL 4X7TB 2H5UA 2R69A 1MH5B 3IDNB 4Q2ZB 4PREA 4JX0A 4MMZA 1TITA 3AUVA 1WBXB 5EUKA 1NSNL 4JRYA 5ELIA 1OP3K 2WLIA 3QE5A 1RZPA 4KMTH 4UILH 3VXRD 4MWFB 2Z8VC 1UWEH 5FFOA 4KO6A 2EYSA 3N1GC 1L9SA 3L3GA 3SBWA 4J3BA 1JVOA 3QUZA 4HUVA 4FQJL 4Y19B 2D7NA 1FNHA 2YD5A 5DZAA 4PTUB 1EUUA 2CLZA 3LIUA 3MCYA 5HVWA 5BOJA 2C7UB 5D7LB 4WNQA 2ED7A 3O8XB 5EU5B 1R9FA 1UJ3A 4JPVH 5JW5B 1P4BL 3LRLA 3RJDA 3ZKSD 2QPFA 4O2EB 3S9DB 4G1EA 3UO1H 5IESL 3VD9A 1LDPH 3JT2A 4NP9A 3OAZH 2MTPA 1YZZA 2XTJE 1KJ2B 4TNWF 2QFPA 4YE4H 1CICC 4PM1A 2OCCB 3U7AA 5KSBE 3ARZA 3F7YA 4L1LA 4F2MA 4UT9L 4ZMZA 4G7YH 5C08B 3S0PA 4FFYH 4NQCB 2EDWA 4NQEA 1R5VB 1CGUA 3PNWB 2A9NH 2X2IA 3NACL 1W0WA 1T04A 1RK1B 2VDNB 3ZYJA 3KH3A 3HI1B 2AITA 4M8QA 4OB5H 3DKHA 2ED6A 1CK0H 5FXCH 1DR9A 5CEXA 2OV0A 1FFNB 1Q1JL 5E99L 1FN4A 4F37F 3UG3A 2GCYA 5BPPA 4ODSH 2C4FT 3OGCB 3QH3A 4JGJA 4GEJA 4BZ1A 4M5TA 3T0EA 3QJFB 1Z3GL 3ELAT 1DVSA 3CVIH 3FYEB 5DJYB 3RKDD 3QXUA 4P4KD 2WMPA 3CZUB 1A2YB 4HU2A 3VG0L 2DWYA 1KIPB 4OFYA 5JZ7D 4GKLA 2G30A 3TBSB 4XH2B 3S8WA 3QJQB 2EP6A 2DL9A 2MSPA 4HLJA 3JZYA 3QYMA 1ML0A 4GG6F 1THAA 1H3WM 1IBZA 3IDIA 3MFFB 4XN5A 4M6OH 1KBPA 1VRSA 3T0BA 3B8SA 4P4RB 2PO6C 1MAML 1XF5B 4XAWL 1MCSA 1UASA 5ACZA 3BAWA 1ZE3H 2PR4H 2JELH 4NO5A 3UJTH 3LKPB 2YPLB 2OR8A 3OKNB 1PG7W 1T7VA 1NFDF 4U33A 3RVVD 3U36B 3AW5A 4CGUB 3C5ZC 2X40A 4BZ2H 4GIAA 3RWFB 3TT3H 3QULB 4L5FE 4JQXA 3I6GB 2C5DC 4K55A 4PJCE 1YEFL 4BSWA 4ABUA 4MJ5B 2COVD 3OAYH 2Z34A 3BPNC 4PWEA 5HYIA 3PWVB 3UOAB 3OKYA 1BQ5A 1BIHA 3S88L 4X9FA 1REIA 3HE6D 1Q72H 2C9QA 3IDJB 1T7ZA 2R4SH 1I8MB 1FAKT 3NA9H 4PTTA 5SWSE 3D39E 1PD0A 2OSLA 3EFOB 1QWHA 2PP8A 4XT1C 1BAGA 1BXAA 4UU9A 3UACA 2I9TB 3ECQA 1BX2B 4YXHL 3BLBA 5HGAA 1JIBA 2ATKB 5FA4B 5TDNB 5D1QE 3FMGH 3HBGA 2VITB 5FOJA 1AZVA 5EORL 3DX8A 2WO2B 3Q48A 1G6RB 1LK2B 2MIZA 1I4FA 4ADIA 4GI8A 3EBAA 1CZ8H 1HHJB 5DQJB 4BWWA 5PAZA 1Z9MA 3SYAA 2JJUA 3KPPA 4Q0XH 4F7EA 4HWBA 2Y1AA 5CLYA 5E7FA 3S4SG 1Y1UA 1WAEA 3ROLB 2R7EB 3RAJH 3DTUB 4C4KT 3S98A 1NMBL 3QA3A 4GW1A 1RZIB 5MENE 5KVDE 4C4KO 1TVDA 3PWPB 4KTDL 5E1AA 1C7TA 3IS0X 4HMDA 4MNGE 4U1JB 4NO0A 2GT9B 3DNKA 3ESPA 1JNHA 1U8QB 4KDWA 2QQKH 1UVQA 4GKNB 2X05A 4LP5A 4MNHA 2DQJH 4P46A 1ZJAA 3F7RA 3SE4C 1BQHB 2VDOB 2GI0A 2KQNA 2VN5A 3O11B 1NICA 3QO1B 4V1DA 3PAUA 1DBML 3VGDA 3RGVD 1PZCA 4WHYH 1S8DA 4ZMLA 1RULL 4PJIB 1OSYA 3LN4A 5F7NC 2E7LC 4YHNB 2YAEA 2EKSB 2O6EA 2JB5H 3PP3K 2FEDC 2BP8A 4I5BB 2GTZB 3MHZA 3DX6B 3LB6C 3GFUA 1G7LA 2BIOA 3VD1A 1GYCA 2YO3A 4WW2A 2FB4L 5EIIG 1WZMA 1NCHA 4IJ3B 3DV4B 3Q2LA 1SEBB 4CC4A 3FHEA 1S9YB 3P9LB 3QEGL 4KMLB 3KPSE 1ROCA 4GPVA 4KK9C 5EOTA 3IVKB 5J1AB 1JGDA 1AR2A 3QB7C 4HOMA 4UV7L 1MEXL 4GI9A 3CVHH 4AQEA 1EHNA 1GMIA 1L7TL 4NFDA 4NENB 5IW1B 4WI0A 4NNPH 4FJZA 1N19A 1RIHH 1WBYA 3G5ZB 1ZA6B 1DJZA 1NCJA 2NX5D 3VGEA 4P9MH 5F7DA 5EU7E 1I85C 2ZX5A 4LCUB 1JNNH 2Z0UA 2ED8A 4YWGH 3RA7H 2AAVA 1Q8MA 2W65B 1A1MB 3ZDYF 4KI5E 2ZOLB 4TUOB 5KSAB 3QCUH 2YFNA 5BV7B 3RPIA 3RVXC 1D5IL 3GMMB 1FZJA 1MW0A 5KW9L 4CW1B 1OTTD 2ZYRA 3AWFA 1QNIA 2J8UF 1FIGL 4K5MA 4E0RA 3CXFA 4LRIA 3T3PB 3FT3B 3HZMB 4I0KA 3G6DL 3UIYA 4HXBL 3VTMA 5C0JB 3QXAA 3HHMA 3ESMA 3ISWA 4IQHA 3UP1A 3SDAC 3T0AA 3ZE1B 4TOYH 3FB8B 3QFJB 5JPMC 2WIIA 4ZD3L 4XNZB 3MLSL 5DLLA 2DQIL 4P59H 1IAKB 1MRCH 4G3YL 4TS6A 3W1ZA 1R3KA 4F5CE 4WEEA 4Q6IB 5JXAL 1PG7X 2QKIB 3HG1B 3TF4A 1HH9A 4BZ2A 4CAGA 4PRNA 1YYML 3BPOB 3D4ZA 5DZ9A 1A21A 2EVIA 5MP6H 1A9BA 4G43B 5EF1A 2F74A 4JO8A 4TLKA 2OMUA 4E41D 4OFKA 1JNLL 2WNKA 2MOVA 2NNAB 3BD4A 3T8XB 2YA0A 4AQ8C 5DHXB 2K4WA 3Q01A 3GWJA 4GQ9L 3U7WH 4LVNC 4R26L 4R4FH 4TSBH 3ZL4L 4S11A 4GG6A 1YEHH 4N9GB 4TVPL 3UTSE 1E3XA 3VFWA 4KJQD 2Y7NA 4ETQB 1KCUH 2DMHA 4JFDE 4L29B 4LFHG 3ETBJ 2QQNH 4FC3E 1HEHC 4XWGL 3SQBB 1BQLL 5DMIH 4UOW1 2R0WL 2ADFH 1OE1A 4TTGA 2R0ZH 3OXSB 2WLYA 1NQBA 1UM6H 4QF1A 3DMMB 1CO1A 1NFDA 1VPOH 4LCVA 3L9BA 4G1MA 2Z91B 1E4XH 2YJQA 4OJCA 1T6VN 2BHUA 4Y4FC 3I02B 2BNRB 4LEEA 4CA4A 1OPGH 1FZMA 1KFAH 1QLEB 2ZXBA 4MZRA 4O58H 1HESA 4IU3B 1DYZA 3HS8A 4WTQA 2CO7B 3VJ6B 1MIEH 3EJJX 2E7MA 4EDXB 3MLWH 1AZUA 3HCVA 3IFOA 5TTRA 3R1GH 5ID1A 3Q8CA 4L3CB 5F7KC 3IMRA 2H3NA 3KYMB 3CX5J 2IF7A 1KZYA 4RMVA 4B9FA 2DTML 4FG0A 4L1TA 1KCVH 1SLUA 2DEYX 1CFSA 4OGAC 4YBLB 3VWKB 3O41B 3EF4A 3AG1B 3FFCB 1HSAA 3QAZB 4I8DA 4GBXB 2ZWKA 4JG0L 1FBIL 1I8UA 2FK9A 3MJ8B 5KSUA 1S7SB 3HRZC 1BQKA 3ELQA 5EU6D 4EN3A 1UD3A 2W60B 1VIWA 3QPQD 4PCKA 1VZHA 4WUUB 5HP5A 3FT0A 3H3PL 3U4BL 1NBZA 3NEOA 3WIIH 1DJGA 4ZX6A 1EAJA 5DLML 2Y1YA 1R3LA 4KGJA 5T3XD 1SMDA 5SX5K 1QNZL 3GIVB 1ACYH 3HB3C 3IDUA 1B4JL 5CO1A 2D31A 1ZGLB 4N3UA 1R0AH 3OF6A 3RX5A 3CVHA 4MD0A 3AS3A 4XMPH 1IARB 2A2QT 4WJ5B 5HDRA 1IGCH 5HJ3B 4N3TA 3FU5A 3WEOA 1JVKA 3PHQA 1ET5A 2R51A 4YHOH 1MJ8L 1N9PA 2NXYC 3RIAK 4ZUUB 1NUFA 4PSRA 4WRLA 1AP2A 3ZY7A 4NHUB 4FKKA 3D1MC 5HI3D 3TESA 4LSVL 3ZKQD 2W9DH 3P11H 35C8H 3QCVH 4G8IB 4ZFFA 5HI5C 2RH0A 2K6ZA 4DIXA 4JVWA 3U4AA 1TJHL 2E3VA 4G6AC 5E4EB 3SPVA 1AY1H 4D3CH 5J3HD 2DZEA 3B5GA 4YSSA 1NBYB 4R4BB 2WXHA 3QPKA 4NN7C 3EJYD 3MRIA 2ALAA 1WA0X 1FFPA 4OLUH 4S1DD 4PBDA 5DJDA 1I1YA 5G4NA 5D2LE 4JB9L 3CDFA 4WCYH 3ES6A 1SJMA 3GNML 4DGVL 3BAEL 1H8LA 1RI8A 3FO1A 3GSQB 4GXUM 1E8ZA 4P99A 1NIFA 1VF5C 3BQUC 4G71B 4TUJA 3S36L 1SN0A 1JPTH 1U3NA 4G72B 1I9IH 4OFPA 4WENB 3WDHA 3HHSA 2XPYA 1BJ1H 4P5KB 2E9GA 3D6GA 3V10A 5D55A 4WKXA 2YOAA 5ITBL 5K39B 3NDZE 1J0JA 1CDHA 2ZOOA 3DUSB 3CH1A 4K9JA 2VNCA 1UYWL 3QW9A 4M5ZL 1T7WA 4WI8A 3X14A 3QDAA 1RL1A 2XKNA 4JN2A 4LCWA 1HXYB 1Z5LA 1FVDB 3HZYB 4ZMPA 5CSZB 2YRZA 4AXWA 5GS1C 3V2AR 9PCYA 2I24N 3IRCA 1CURA 2A3TA 3BD5A 3IT8D 1SYVA 4UT9H 4HKZB 5CP3H 2BIQA 3QJHB 3MUZ1 1JXJA 3BKMH 4NO2A 4L4VE 5IMLB 1XIWC 4B96A 3NCXA 3X2QB 1T5WB 4I1PA 2ZKMX 5DJ2A 1FNSH 1Z9SA 3INOA 2J8UA 4UIMB 4WTZA 3BCFA 4WTXA 5EEXA 4BSVA 1MVFA 2RACA 4QRSA 4AT6B 3VXPA 3N41B 4FX5A 4XXCC 2E75C 1XGRA 4M6MH 3AFLA 5F8QC 4X80L 2YXMA 4HV8B 2D7TL 2PW2A 1IT9H 1BVLA 1OAUL 3WGVB 1XAKA 4MS6A 4Y5YB 3THMH 4B95C 3KBPA 3D3VD 3CFDB 1TKWA 4HKJA 4H8HA 1YNKL 3JV4A 4EPSA 4TL4A 5AW1B 3UERA 2HSIA 4NQDE 1A4KA 1MCPL 5KVEE 2WOBA 3EAKA 3ZQXA 3GF8A 4JPSA 4PLKC 2GUYA 3RTLA 1N10A 2JTYA 5DJXB 1YQVL 2R8SL 2NR6C 2QKSA 1I3RB 1RJZB 3L1FA 3MODH 4XAWH 4JFTA 3ET9F 1GOGA 2DH2A 1UZ8A 4LRNL 5AZUA 5M95B 5AOMA 2VUYA 4EOWL 2WJ5A 3FUJA 4YBQD 4ENED 5CCKH 2BWQA 3GEFA 1IAIH 1MFCH 3MREA 3WFDH 3WY3A 5KYNA 4MAUL 5MEQB 4XMTA 4UI2A 1AANA 1TIUA 2J6EA 3I9GL 5FO8A 5A2FA 2IXQA 1BYOA 3CHOA 4AG4H 1O6SB 2XV6B 5AUMB 3NJJA 4U6VL 4JRWA 4LKXB 4YSTA 4E9SA 3EUUA 4L9LA 5FKPA 5FW8A 2FBRA 1UXMA 1WCQA 3QDJB 4F33A 1DEDA 1NUNB 4MAYB 1MFEL 3U6RA 5E8NA 5B7EA 4M6NH 4OIFA 5JIMA 1Y6MR 3EJCA 1FL5A 2V2XA 2XTJD 2HFFA 3ARGD 1EPFA 2ITDA 3BJLA 3RIKA 3C5JB 4FHBD 1KJ2H 3FK3A 1HCYA 1UFGA 4IRJC 2PP9A 5ADPL 1BZOA 3DV6A 4HJTA 4U6HB 3BDBA 3KAAA 1CDIA 5IM7B 1DLFH 4HK0A 5KG9B 1OT1A 4YJZL 1OAJA 3LXUX 4U1KA 4Z7VE 4F24A 2ITEA 1A6AB 1RMFH 2YKLH 3EJPA 4O2FB 2QMKA 2ENSA 3BH8A 4Z7AA 1UB5A 1QEWA 2WGXA 5TD4A 1B2WL 5GGSB 1GKEA 1P84K 2YRPA 2Y0SA 1H5BB 3KS0J 1KJMB 2WO4A 1MXDA 5FUCE 5BVJA 4JREB 2P3YA 4MA7H 5JPNA 4JANB 3FU8A 3UBHA 2K7PA 2X4SB 4NWUH 4N2HA 2IBZX 3CN1A 4APQC 3X1BA 4J27A 5D1XA 2J8OA 3UJIH 2A77L 4K3HA 3TCXA 4N25A 1UA7A 5DC4B 2ZCLL 3V5KA 1F86A 1YN7B 3Q6GL 3AQYA 3VWJD 4FQPA 4MJJA 5AW0B 1UH3A 1A6VH 5J12C 4XNUL 3BC9A 1XHHA 2P8PB 3GLAA 3ETSA 4JFYA 3P9MA 1NPNA 3NJVA 4GMSL 4N1EA 1HWHB 1Y6KR 4U1LA 1AHWC 1DQJB 2FSDA 2WTRA 1F3RB 1GPOL 2BVQA 4OZ4B 3RWDA 3OKEA 4QXTA 4XP5H 4NNYB 1X5AA 3HUJB 3CSFA 3MLZH 2ZWZA 3UDWA 3SKUD 4PGEB 3HVNA 5MI0C 4Z5RB 3IJEA 3BVVA 4BDVB 3FUNA 1EO7A 3QORA 4YDMA 1J05B 5E6IC 4Y5XA 4NRXB 4Z8FL 4UT9A 2V9TA 5CP3A 3HC3L 3Q0HA 3WENA 4UV7H 3U9UA 3FSAA 4Y16C 4HJ0D 2GJ6A 4MZ2A 3OSVA 2VISB 1DJYA 3HG0A 1FIEA 3LAFA 5FDYA 4NAJA 1TZOA 5SWSD 4F15C 3HLKA 3X1NA 2UZYA 4JRLA 4ZFZA 3UL4A 3VXSB 2XN9B 3EJQA 2DKSA 4H8QA 4PJ5A 4UQDA 5ESVA 4ZX3A 3VD4A 4L8CA 3WLBA 3SDDB 1GIGH 4GRWB 1TXKA 4FYRA 2DM2A 3B2XA 5D1QD 3NFNB 2FEEI 4YNYA 4JDZA 3U46A 3AXHA 2N0MA 4YHMH 4BUGA 1YUHB 1FFRA 4WO4A 4ZNEE 1KTRL 1E28A 1D5IH 2X87A 1G6RH 3LKQB 4ZSOA 3OKDA 4K7PY 2XCMC 1QFOA 2O6DA 3FB7B 1M1XA 1ZRUA 3F12A 1LVEA 4JGUA 1A7OL 1DDHB 5HGBB 3CCHA 4AI7A 3VGGA 5MEND 4ODHH 3FU6A 3RHWF 4DKFL 4YUEH 5A6MA 2ZICA 2G60L 3ARFA 4ZD3H 3MLSH 1WBXA 2DQIH 1EBAA 2CUMA 3P77B 1BW8A 3WS3B 1PZSA 2DRUA 4FTDA 3PDOB 1UQSA 1OQOA 4ZAKB 3RPBA 5D5MF 1SLWA 2WBJD 2VC2L 3LPOA 1R75A 2F8IA 2PCFB 4MMZC 4WFED 3G6JF 1MCFA 1CGVA 2DEWX 5AZEH 3C8DA 4DK6A 3T9WA 1E4JA 3WJMB 4AGLA 4YPGA 2MCMA 1EHKB 4OKDA 5C0BB 3A5VA 1RURL 1U8JA 3FFDB 3HNSL 3KLSA 5JW5A 4N5UA 4PJFF 3VGAB 5I76B 2XLLA 1B0WA 1HZHL 1VACB 4GQ9H 4IRZH 4JPWH 3U79A 4ELMF 3BYTA 4L3EA 3KPSD 3SBWC 3WY2A 3QUZC 5I30H 1RZGA 5JORA 3IJSA 3O3UN 1CXHA 2ORBH 4I3GA 3ZE1F 5A6IA 4DO4A 2WZ6A 4K3DL 4QR7A 3WN6A 3NCYP 1CMOA 2GITA 3AACA 3L4TA 4NQCA 3DX4A 3TBYB 5LJYH 3FTWA 5BRZE 4XWGH 1GS6X 3GHEH 3HE7D 2Q2LA 2XZAH 1G1KA 3TBTB 2WQAA 4QYAA 2IFFH 2OMZB 5FYKL 1RU9L 4LHUD 3GXTA 3KYNA 1FE8H 1U6AL 3KPOB 3WN5A 3OB0K 3AABA 4Z3IA 2DB8A 3OGCA 2W8CA 4KI5D 1CU4L 2XQBL 1EJOH 3VMPA 3IDYC 5DJAB 3WFHA 1QSVA 5DJYA 4I3RL 3VFSA 5DD0H 4HWEH 1LO3H 2EVJA 1HILA 4RGNB 4Z3HA 1KIPA 3IFNH 4HH9B 1HZKA 3TBSA 3NSFA 5D96B 3KLAA 1HXMB 3O3BA 5JOFA 3W0WE 1NGQH 4O02L 1QBML 4XOCA 4YHIB 3SOTA 3MFFA 3JWOC 3VFMB 4L8SA 5HPMA 4KRNA 3T0EC 4LGPB 2V2WA 2VR7A 3SZ6A 4AYGA 3JUYA 2R1YA 4R7DB 1ZHLA 5ITFB 3TV8A 1O9VA 1VEPA 1F11A 2VW4A 3DVGA 4ESKA 5C0ND 5IHUH 2BSSA 5I74B 3EW3B 3VVWA 4N0FA 2VM3A 2WXNA 5KJ4A 4IMLB 1BFTA 3DOSB 4F8NA 3H3PH 3AQZA 5G5DA 2GI7A 4XXWA 2ZOKB 4WFGE 2X89A 1KWKA 3FRPB 3EYOB 3L7EB 5DLMH 2IALB 4L4JA 3HR5A 2NPLX 2E76C 2F9BT 1BF5A 1I7UA 1RPQA 4A2GA 4JFEB 1B4JH 3VB8A 5F0PB 3I6GA 3OAWA 1G9NL 4O4YH 2L8AA 4OM0L 1A7BA 2NY0D 1C5CL 3NP3A 1Z0MA 1RIUH 1EJFA 3Q5OA 5HDOA 4QNPE 3T2QA 1TZHB 3B1TA 3HC4L 1CLCA 2GHZA 2A1WL 1BZ9A 3K2IA 3S37L 4RBPH 3DXAE 4R97B 3OAUH 1K4DB 3PU7A 4A2LA 4UDTA 4JQXC 4CNIB 4P2RD 2UY7B 5HVHC 3VFUA 2FSEA 4GRMB 2E9BA 1P6WA 3H85A 4R2GB 4JFDD 2ATKA 3EIFA 1I1FB 3GMRB 3SYOA 3LSOA 2ARWA 4OLZL 1G6RA 2RAMA 1SOQA 5KYUB 4MXQC 3WHE1 2DI9A 4KVNL 5I6PA 4XCCL 2QT6A 1RIVL 2HX9A 4HA1A 1SF5A 2YC1B 4O2CA 3N43F 3DOHA 1F1DA 3QNYB 4U49A 2WP3T 5FCUL 4YHYC 2OK0H 3P4NB 3GMQA 3FO0H 4AQOA 4OLVH 1Q9LB 4FJYA 2DLGA 2F1EA 2IANE 4X5LA 1UURA 2FZ3A 4X7DC 3ROLA 3RY5A 2F7OA 2BSTA 2JTDA 3CXHJ 1H19A 4LVOC 2F7QA 2HWZH 2X3CA 3EDEA 3DWTA 1WC7B 2G9HB 1MJ7L 1A7QH 4YXLL 1G9MH 4R5TA 1S7WA 1FFOB 3QHZH 2ZCKH 4EZKA 5CHNB 3D18B 4RA3A 4M03A 5E2UH 1N70A 3DHMA 4PRHB 2YPVL 3BWUF 4JPIA 1QLRB 5HY9A 3Q8FA 4ZFOB 5TH2A 2GTZA 1CE1H 5C0DA 3DX6A 3TN0D 4MRCA 1E2VA 4JFQB 1FSKC 3REVB 3CSGA 3L5IA 4FZ8L 3T4YB 5ISZB 4IRZA 1G7JA 4P46C 3DV4A 2UVEA 3FAXA 1S9YA 3CIQA 5KTEL 1RUKH 5KN5B 1AJ7L 2NZIA 1GYVA 1S9VB 4RFEA 2A9BA 4TNFA 1D3CA 3BMWA 3AREB 1DVXA 3KPRE 1I7ZB 1LXMA 4M1GH 2J71A 3APMA 4FQCH 4XP6H 1WVZA 1AGDA 3P0VH 4WW2C 4IIQB 4CC4C 4HJEA 2VTFA 4ZDHA 1U8IB 1OPOA 3S34H 4AVKA 2PW1A 4WEMB 4PV9A 3V4VH 4R5XA 4QXUL 4X9HA 5BRQA 3G5XB 1S5IH 2Q76B 5D5MA 2YUZA 3ULVL 1MCPH 1D5RA 3SE9H 3BE1L 1KEGH 3RBSA 4NZUL 5HDBB 5DRWB 3L2NA 3G6JA 3U1QA 2YD0A 4PVBA 4QWWD 3P69A 1B90A 1YQVH 1D7BA 1TCRB 3VO0A 1ZA3B 3IGAB 1JGEA 2H9GA 1J1OH 3C09C 3Q13A 4PJFA 4QRQA 5I1GL 1F3JA 4ELMA 1TQBC 3GXMA 4HGMA 4NM4H 3Q1EA 3L9RA 5C0JA 3N41F 5GS0H 5GGTL 3WLWC 2OTPA 2KLSA 1A7NL 1UOKA 3P0YH 4EIZC 2XWJA 2ZYHA 3UZQB 4FQXA 1PSKL 3MLUL 3RL1A 3I50H 2KS0A 4K7FB 4LRIC 5L88L 4BH7A 1BFVH 1E27B 4N6RA 1T66C 4HAKA 5F21B 5D72H 1ZE3C 2FBOJ 3QDMD 3SKJL 4PRIB 1WFJA 2DQGH 5DUML 4JFSA 1MJJB 2VMCA 3GSNL 1O7VA 4E9TA 4LEXH 2EC9U 5CMAB 4WWKB 2YPKB 3B2UC 3TTSA 1JL8A 1G7QA 1FC2D 4GSRA 1A3LL 3Q43A 5LGJB 2WTOA 5MEOB 2QZ5A 1M9SA 2X2HA 4L4VD 2Y3AA 2XG5A 4YL4A 3RX8A 2GBUA 1E5CA 5GRXG 4XVSL 4HX1A 3OAZK 2DLTA 3OKMA 4LOVA 3LKOB 3MRRB 4U2ZA 2NY3D 2X2JA 4L29A 5KJRH 5E51A 3V4PH 3SQBA 1AZZC 4UNVA 3S35H 4OZHE 4WAFA 4GXVH 1RPKA 1EXUB 3LIZH 3STLA 4M4RA 3SEPA 2AJSH 2UYLB 4IK7A 4Y2DD 3DMMA 1A0QL 5HDLA 2BFGA 5EA0H 2R4RH 5C0EA 3LQMA 1NGZA 1MI5E 1UGKA 1MUJA 2HPOA 2HTKC 3QQ4B 4NQDD 5L4MA 1FYTB 1HC1A 4YK4C 5BUGA 4N0UB 5SV4A 4MJIE 1KCSL 3DURB 3MRGB 1CYGA 2QEJA 3X13A 4S1SH 4LDEB 4QO1B 5BOZG 3F62A 3K5SA 2R1XB 1FHNA 1XCTB 3ARVA 2CO7A 3VJ6A 3VXUE 5D6DA 1K6QH 5FYJE 5TE4H 4DEPB 1JYNA 3ZGIA 5EV7A 2QLVB 4WEUD 5F8RC 2BSRA 1J8HB 1M53A 2IPKB 3TGXA 1UD8A 5DC0A 3O3AB 3O45B 2I07A 1LP9E 2VL4A 1S6NA 2GK2A 4A7SA 4W9HC 3FW6A 5FYKE 1KBBA 1DTUA 4DP2X 2X12A 1YAZA 4NQEE 2FAUA 2VXSL 3C6EA 5BQDA 4TNWK 2G5RA 3RZCD 5LN8A 1XB6A 4HS6B 2PWFA 2W60A 4Q52A 4JG9A 1NC4A 3RTQB 3ZQ9A 4C56E 4DKAA 3GI9H 3PXLA 4JHAH 4OZGF 4NO3B 1S3KH 2XOTA 3G6AB 5DQ9B 4H20L 4ONGL 3UABA 1KB9J 1YEEH 4MD4A 2W38A 5EU4A 1KN2L 1QLFB 2E7HA 1TMQA 5E6ZA 1DBBL 2CJUH 4UZSA 1AGBB 3MROB 1DE4B 4CBZA 4RMBA 1P7QB 4EN3C 4WJ5A 4P5MB 4F37K 2Y7QB 4AQAA 5EEYA 4X8CA 3WTVA 3OAYK 5DZLA 4M9OA 3T77A 3LEYL 1A4AA 4UB0L 2NZ9C 1FDLL 3V4VA 4BFRA 1H6UA 1YEIH 1A6WH 3QGVA 4XO3A 3UYPB 2FJUB 3NESA 5HHOE 2BNUB 4LASL 3N1PC 3MNDA 4L3FA 5C07E 3RDTD 2J5WA 2VR3A 3R19A 3ZE2F 4TQPA 5ANME 2XZCL 4JQIH 5FYLH 1OY3B 3LD8C 5FS5A 4PJGB 1NINA 4FFZH 3OR7B 1EJ8A 2JKLA 2WNXA 2V6HA 1WZAA 1OP5H 4RA0C 5K9KA 4Z7WE 1PKQA 2O6FA 2Z31D 4MQXD 5LAPA 4I3SH 5CKAA 2NW3B 3AMKA 3BPCB 2FR4B 4X8GA 1Y1DA 3T3MF 4ZMYA 4UM8A 3DO7A 3GXFA 3QT2A 1KELH 3L3JB 3PPSA 4TVPD 3V0AC 1LEGB 1HCVA 1TQCB 3S96A 2B1OA 3IDGB 4GRWF 4HCFA 1CQKA 5EBLB 2VC2H 5E8DL 4E9LA 3UYOD 5IQ9B 3FOLA 4A6YH 1L3NA 5EZPA 2O5ZL 4U1NB 1A6TB 3SPIA 1J88A 3V5HB 4MS8C 4KROD 2ENJA 4QMEA 3TNNA 4J1UA 2Z35B 3LZRA 3VDCA 3FQWB 1UD4A 4RISH 5DZJA 1VFBB 3HNSH 4NC2B 1HIML 2ZAIA 3BN9D 3CFBB 4PMEA 4XVJH 4OH2A 2EAEA 1FVDA 3HZYA 5E8PB 3IB4A 3HI6H 3KYKH 1XGQA 3QUYB 3UJJH 3H53A 3SY0B 2EDEA 1CFVH 1EFXB 4RMTA 4YPJA 2P8MB 4GAGL 4G6JL 1OAKL 1JN6B 2ADYA 1ETZB 4PJAF 2OJEB 3NABL 4QHMA 1GR7A 3CMOL 3GMOA 1QPXA 4ODVH 4Z3GA 3V4PA 3CIAA 4XVTH 3MRHB 2CRZA 4FG6D 3TA4D 4Z7QE 5K59F 4JHBA 3CDGA 4HMCA 2XQBH 4QHNA 4FQ1H 2WQRA 4GRWH 1EEZB 4FMVA 3GBDA 5DK2B 4EEEA 4YC2C 2CK0L 3GINA 1J9RA 3W2DL 5T1LD 2AK1H 2Y22A 4O02H 5I6XB 1QBMH 4GSDH 4H8VA 2BSDA 3F8UB 1J18A 5E2TL 4NKMB 2QJDA 2WKLA 3D0VA 4WFHD 3IE4A 4NN6C 1I3RA 1YRKA 1UZ6F 2NYYD 4L48A 4LSRH 1U0QA 1NAKL 2BMKB 5CWSB 3IJ7A 5D7IE 4PG9B 1H3PL 4J3XA 1BJ1J 3AWGA 4DETA 1NCDL 2XRAL 3WE1A 4OLEA 2J56A 4GFXA 1L0XA 1NDMB 1XD0A 2H8PA 5C09B 1JDDA 3IPBA 4RDQG 1IM3D 4MXWH 1YJDH 3ULVE 1YEJH 2OR9H 3G3LA 4J12A 1V3KA 4NWTH 2W0LA 4R0LB 5AUMA 3X11B 4CRPA 1VSCA 1NLBH 1UTDA 2HH0L 1OLZA 3DGGA 3DO4A 5IB2B 2ADIB 1V7NL 4JKPH 1I9JL 1IVLA 2CLVB 1DN0A 3QZWB 2DQCH 4XCNB 5D1ZD 1D5XA 2H2SC 1IEAA 1G1CA 1S7QA 2YHGA 2A1WH 1F58L 5IBUG 2MOQA 4DJMA 1ZLEA 1BP3B 3UAAA 1KUMA 1VFAB 4XPBL 1CFNB 2XBZA 3FOMA 3T2NH 4ILDA 4HHWA 4L9LC 3LPFA 3AXLA 5TPWH 5BRZD 2F18A 4OU3A 2X4TB 1KB9K 1XF1A 2VE6B 1FL3A 2BXYA 5T33L 3LRSB 1IJ9A 2NDGA 3GJEA 3PXJA 4JQIA 5GGSA 3GM8A 1U3HD 4NRYB 4UOQA 4JDTL 2H32B 4KU1A 4FFZA 4PGZA 3I3BA 3H1ZA 5DMJB 4WF7A 2IC2A 1D6VH 3WEXA 3HJ0A 1OTSD 2X4SA 4IS6B 4OJAA 5TF0A 3NJMA 4R7NA 3ERXA 1VKXA 1J5OL 2YN5A 1B4RA 2P7TB 2PXYD 4EIGB 1EVUA 3F5WA 4OZGA 3W0WD 2BERA 2NCMA 2Q8BH 5A2IH 1NGWB 5JW4Q 1SEQL 2LGNA 3FT4B 2EVFA 1TPXB 2P8PA 1PEZA 2QSTA 5ESAA 5JPNC 4CMHB 3VGBA 4X4XB 1DL7H 4PRPE 1AFVL 5IHBA 2A99A 4FTVA 4A6YA 3C08H 2EIZB 1MRFL 5D1XC 1DQJA 2EUZA 15C8H 5DJCA 2GY7B 4QCIB 4U1SB 3KPNB 5IHZB 1MHPL 4QGTA 3FH8A 3UZVB 5I1HL 4HDIA 1TLKA 4WFGD 4HC1L 2EH7L 3L3OB 3LKNB 5D4HA 2WXFA 5E2VL 2UZIH 2XWTA 2Z93A 3JYCA 3KPMA 3MMEA 3D4CA 3MBEB 2O26U 2OL3B 4BDVA 1AJ7H 3PYCA 1J05A 5D2NB 4NRXA 4HVBA 1J0KA 1IGJA 5FOBB 5L2KB 4GAYB 3HHRB 2Q87A 5FO9B 3BKJH 3PJSB 2O1AA 2LU3A 2VQ4A 5HXMA 2WVTA 2NY4C 1KBGH 5IVXB 1UCBL 3LXBA 3TV3L 3UDWC 5C86A 1VHPA 4NQVA 1X3DA 4LLMB 5E5LA 2X4NB 5KVGL 3DXAD 3JWDH 4PH8A 5GS2H 3BDYH 3QORC 7PCYA 1D2PA 4Y5XC 3VRJA 4N0RA 3UBXI 3VXSA 1HFUA 2Q7AA 1T5XA 1JWMA 1NOFA 1OARH 3V6BR 1PLCA 4FNTA 1XH3A 2EUXA 4LOEA 5PCYA 1EO5A 4JFFA 1T21A 5ICXA 1A6UH 1IILE 5LBSH 3NJKA 3UGUA 1J7VR 1NAMH 1HJCA 2VWEC 2NMSA 4UTCA 4NJAL 4O02A 3CLFL 1PZBA 1OTUC 4JGNA 5B1JA 1I31A 3MV8B 4X6CB 3ZU8A 3IPEA 2ZD0A 3EYSL 4AITA 4AIZB 3MCG1 2LLNA 4PP2B 5TE6H 2OR7A 1EZVY 4W9IC 5ID0A 2IAND 1M7UA 3CH8A 4WO4C 2UXGA 3K91A 1T20B 4KY1L 5AG8A 2A5UA 1X9LA 3QG7H 2JF1A 3V52H 5C6WH 1A7NH 3NT0A 5DYOB 3W9EB 1H8SA 3BWAB 4XHJC 1HL8A 4FG2A 2X2YA 4GW5B 4QYOB 2AQSA 1WQVT 2YQGA 3SGEI 3W9DA 4PJAA 4BGDA 5AVTB 3KH4A 5J4MA 2H0EA 3OPZL 2K0RA 4WHCA 3V7MA 1PDKB 2XICA 1FJ1B 2G2NA 4X6DB 1I8LA 3SKJH 1HDMB 3FN3A 4DFHA 3GMPA 1BVNT 3ARFC 4YGVA 2OLDA 3L7FA 3FTXA 5DDHA 3UBGA 3ZE0B 1O9WA 5C6TH 1M05B 3F2LA 4X83A 3TYGL 2AABH 1H9DA 3QRBA 3EO9L 2HT4D 2WLMA 4U1HB 4LQ1A 4UTBH 3KBEA 4LSTL 2M2DA 1TTAA 4J3OG 1L5GB 3NIDB 2BIMA 4MB4A 3ZR5A 1N59B 3MJGX 3KPRD 2D0GA 3WO4B 4YZWA 1BF2A 4M4PA 4XPHL 1BLIA 3O8XC 3Q1SH 4NQUA 5F6HI 3TBYA 1NJ9A 1TZIB 4NSKA 4L37A 5E8OA 4ZMVA 3MRDB 1UB6B 4Y4HD 2AJ3B 5E9DA 2BVYA 1TJMA 1UM4L 1S3RA 4GAFB 1A5FL 3ECBB 3V9FA 4EZMA 4FMFA 4DVBA 1IL1A 2OMZA 3ZTDC 4HD9A 1DBAH 3OMZA 1A0QH 4FG4A 3T1FB 3FUMA 3BRFA 4B50A 5D4IA 2BW4A 2VDNL 3DX3A 5CN2A 2OXHB 2UUDK 3AT8A 2MFNA 3L95B 4JUSA 3FSOA 2ZXCA 5CZXD 2KERA 3S4SA 4DZ8A 3MCKB 2MTAA 4PGCA 3MRPB 4ZFGL 3S5LG 3KBFA 3WN5C 3PQYE 3JV6A 3I2CH 3QCTL 1U8KB 3E2HB 5IT2L 1UXSA 3ZRCC 1UEYA 2DJUA 2W07B 3F58H 3O9WD 2F54A 5I75C 3GO1L 1PFOA 3C6LB 2VLJA 4QLWA 2BHFA 3W3BA 1HT6A 1NCNA 2WWOA 1KTKE 4G2AA 4XCYA 5KZCD 4G6KL 1FNFA 2VXSH 4KQ4H 4MX7B 4M61B 4LXFA 4WU5A 4ZOEA 3V6OE 1X5FA 4MXVE 1P1ZB 2WY3B 4JY4A 3DOSA 2OCFD 4L8SC 2P5WA 2BSCA 1INDH 2XWXA 4CL7A 2WNGA 3EYOA 5B39G 5T3ZL 5EIIA 4J6RL 1A66A 2N59A 2FL5A 4GAAA 4S2SB 4X5RA 1KN2H 2ZT9C 3LZFH 4PY8J 4UIKH 4ODWA 2EO1A 2C1OA 3DJSA 4FLRA 2UVFA 5LBVA 3B34A 2RQEA 5IEHA 1RUQH 1H0DB 4XXWC 4NQXB 1Q0XH 1WLHA 3WFZA 3M45A 1TYEB 1P7HL 1QKZL 4JZJB 3LEYH 3D69A 3ML8A 1T89A 3MGOB 1J87A 2RCSL 2ZKWA 3WNOA 2UY7A 3F6IA 4GRMA 2VN6A 3B8YA 4QJ4B 3S35X 1EZLA 4W9DC 1PLGH 1ZGLP 1W91A 1MDAA 4X98B 2XBDA 4JAMA 3G08A 1I1FA 2X09A 5I9QB 3J07A 2ZUYA 3GMRA 1MF2H 5LBSA 4YHLL 1G4MA 1NAMA 3TJHC 2BWIA 1HZLA 2TSAA 1WS8A 5DFVC 1CLVA 3WKML 1T3FB 1N7MH 3O4LE 1MI5D 5FGCB 4EN2A 1S7TA 5C8JA 1T1ZA 5IB5B 5DGRA 2EYTB 4MJID 1R19A 3IF1A 4XNYL 5F7UA 4YE0A 4N8VG 4OI8A 4OW6A 2UXTA 1E30A 4QRBA 4IGBA 3V4UH 3VXUD 1T2QH 3BAIA 3CZFB 5IR1B 4NXKA 2EDDA 2C8NA 1IC0A 3EADA 3EHBB 4CSPA 3QG6B 5E8DH 1N6QL 1X5ZA 5DEFA 1I1RA 3L3KA 3UPRB 3DO3A 4M7KH 4NPYA 1WC7A 1DQLH 2XN1A 3DVNB 4MNQB 2A9DA 1YPZB 5I1EL 4BKLB 4KHXH 4YEEA 5FYKD 4HIIB 1I8KB 2VXUH 1AMXA 4S0HA 1HIMH 2XWBA 2YEZA 1DSFL 3NVQA 1U2HA 4A63A 4Z0BH 4ODBD 1AXSB 2MRYA 3NIGE 5IROC 1SN2A 1KSRA 1DLHB 4C56D 43C9B 6CGTA 1MRDL 2DIEA 3REVA 2VDOL 2JCCB 1GAFH 3DX2A 3DRTB 1KCWA 4BKSC 1HQRA 1J5DA 2CRIA 4QRFA 2G75B 3PV7A 1H9VA 1FG9C 4XNXL 5KN5A 3CPLB 3QUHA 4K7PH 3CDCA 3GKZA 3ESOA 1S9VA 3R8BB 2F15A 2OTWA 3GYRA 3AREA 1AQDA 3SDYH 2C1PB 1I7ZA 5TFSH 4CKQA 3ARBD 1QVOB 2X42A 1AXIB 4P2OD 5F9WB 2EXWD 2HKHH 3Q6FB 5EO0B 4KRMB 4OCRH 5HHOD 4PJ9D 4EBQL 2CCVA 5T1MB 5C07D 4H1LH 2RALA 1ADQH 4U3SA 4QT5A 4XP1L 3NEEA 2PTTB 4WU7B 1MWAB 3T0XA 4PP1D 4Z3JA 1T0NA 2FGZA 4PHZA 1YYLL 1BLNB 4DP0X 3CHQA 4NUQA 1T4WA 1JPGA 4BQ6A 5L2JB 3KPLA 4PJBE 1X4ZA 5BV7L 1KYFA 1Q9WA 2IJ0C 3BIKA 2P80D 5KVGE 1QZNA 3QR1A 4M93C 2Z3FA 2L7QA 5I82A 4J28A 4QOKB 3HPJB 3BQVA 5C6PB 1WHOA 5AKSA 3VQLA 5D6CA 3RWJB 1XBDA 1AZRA 4DGYL 5I66B 3MUGB 4FEIA 4Y5VB 5AVWB 3MLVL 4LLUB 4K7FA 1KG0B 1ZXQA 3CVDA 1A02N 2HH0H 2GAZA 1OAXL 2NXZC 3VXOA 4M8VA 2XX1A 2DQFA 4XO5A 3CDZB 5DSCA 3AB0C 3MCLL 3OKOA 1AVAA 3P4MA 4AKPA 2ARJB 4FQXC 4JRXE 1F58H 2OQJB 2IAMD 1CJYA 3BZEB 4U4IA 2CSPA 1F18A 2PWHA 4CVXB 1OZTG 3P30H 4Q6IC 2Q86A 2X4UB 4HF5L 1JRHI 2X3AA 1INEH 1C16B 1AMYA 1YECL 3BPOC 3B37A 4O51B 5F7WC 2Y6SC 2Y07L 5KYXB 3LQAH 4XP9L 5E0FA 4FQLL 4PPTA 1VEMA 4HT1H 3MRRA 3QI9D 3BH4A 4NOBA 3NZ8B 1WF5A 3LRMA 4HIHA 4JZNA 1YN6B 1CQYA 2WQUA 4DGUA 3BP4B 1BAWA 4OLXL 2VDKL 4ZMTA 1EXUA 2CR0A 3IFLL 1NIDA 5I1DB 2KZBA 5IQ7L 1E8WA 1PCXA 4A1RA 1JFQL 3RHWK 2R23B 1J5OH 2HVJA 4Y4KD 4K8RL 3SOBL 3QQ4A 5JW4M 4GP4B 1FYTA 4B9CA 4P23B 5ALBL 1ORQB 3VM7A 4N0UA 4G6ML 3I75B 4Y19E 3OHXA 3L5HA 5D93B 1SEQH 4HPOL 3U4EB 1HOCB 4RNRA 2R1XA 1CT8B 1XCTA 4MCZA 2FUTA 5D7LE 2E27L 1J11A 3B9KB 3DMMC 3QUXD 4FXKA 1RVFL 1J8HA 2DIBA 3MRMA 4N90E 4XNMB 3A4EA 3O45A 1MCCA 5JNYB 3HNTL 4AYEC 4D94A 1F4WL 1NGPH 4DGIL 3LY6A 5DVKA 2VIRA 5F1NB 5C08E 4HC1H 4MVBC 4NQCE 5D6DC 2ICCA 4DVRL 1JK9B 1IFGA 3ULVD 4JK0D 4HS6A 3QQDA 5DK3A 1G9MC 2DIAA 3OZ9L 3L1OH 4S1RH 1XGUA 3JZ7A 1GZPB 4YO0A 2BHZA 3VRLE 1UCBH 3TV3H 3JSSA 1U8HA 1GGYA 3LRGA 2LFGA 1F5WA 3MROA 1AXTL 4PI2A 5ERWB 2H3XC 3GI8L 2O5YL 3MPCA 5JXEA 3Q8BA 1C08A 2G0KA 3PWLB 2O4EA 4KVCH 3IDMB 4BYHA 1O9ZA 4Y1AD 3BLPX 3DVFA 5BRPA 1FWXA 4JFWA 3ZHLA 2IH3B 4N2CA 2BNUA 4CVZA 2NQCA 4H1LA 1C12B 2DYPB 2R56L 4RBPK 5CS7A 3FPYA 5D7SL 4FQIH 1AIFB 3ULSB 5LAXA 4NJAH 4H8PA 4FA6A 2DM7A 2VAAB 2YPLE 4GIOA 1BREA 1M7DA 4HAGA 4IK6A 1GY1A