4B95C

Pvhl-elob-elob-eloc complex_(2s,4r)-1-(2-chlorophenyl)carbonyl-n-[(4-chlorophenyl)methyl]-4-oxidanyl-pyrrolidine-2-carboxamide bound
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
134
Chain Sequence
VLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Small-Molecule Inhibitors of the Interaction between the E3 Ligase Vhl and Hif1Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 31
structure length 134
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4b95C02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4b95C01
4W9FC 4W9GC 4W9DC 4AWJC 4B9KC 3ZRFC 4B95C 3ZUNC 3ZRCC 4AJYV 4W9KC 4W9JC 5LLIC 1VCBC 1LM8V 4BKTC 4BKSC 4W9HC 4WQOA 4W9EC 1LQBC 4W9IC 3ZTDC 4W9LC 4W9CC 3ZTCC
chains in the Genus database with same CATH superfamily
4URKA 2DYRB 3DJRA 2ZUQB 3L1FA 3OKDA 1ET5A 1EZVX 3POHA 4G7VL 3KYMA 4JKKA 5B4MD 3S34H 5FUOH 3CVIH 2BVOB 2EXWC 3I84A 5I8EB 3W81A 1BW8A 2UWEF 2FHBA 4FFTA 4E5XB 5FYJE 4K4KA 5C2UB 3UPRA 1Q9KB 4LSRH 5AW2B 4M29A 4HGWA 1NPUA 4GXUM 4K9JA 4YSOA 1RUQH 1JZIA 1S3RA 2VC2L 2Z92A 1NMBL 2AK1L 1V7ML 5L8LB 4Y1AB 5SWZB 2NTFB 4LLWB 2MHAB 5EFIB 1T5XB 4XMLL 4IBVA 3MRLB 4BQ9A 5HHOE 2YJLA 3F6JA 4Y88A 3UABA 4JK0D 2ENPA 2QZQA 4X83A 1MCCA 5BRZE 2XKNB 3VXRD 4WEEA 2DL2A 3T77A 2AJUH 2FATH 4WFHE 1XMEB 3GBNH 3CZUB 3HG1B 4X5QA 4ONFH 3T8VA 3S8GB 3CFJA 3SOBH 3V4VL 4FQLH 1ZSHA 5CBEB 2NUPB 4ENZA 3FULA 5KSBA 3QPQC 4QYAA 5IOKA 1CLZH 1QKZL 2AAAA 3GI9H 4RCAA 2VZVA 4BK5A 2FRGP 3Q1SL 3FQUB 3QJOA 2R51A 4FQJL 2MTAA 2OMXA 5CXPA 2CR0A 2WTOA 4POUB 5LNEA 2HG5A 4PFEA 5EU6A 2H8PA 2VSCA 4A2LA 3TBTA 5IVXE 5B1JC 4RGNB 1JGLH 1YZZA 4DETA 5JO5A 5FFOA 3N2JA 4OZGB 4XZ4A 1M42A 3LD8B 3BO8B 1S7WA 4Z18A 2NXYD 2X5PA 3SEPA 2Y7OA 5F1OB 3ZQ9A 4X6FB 1KIRB 1UWFA 2BMKB 3M7FB 3QDME 3NGBB 1LP9F 3HC4L 1H6UA 2Q1EA 3LZFL 4LLVA 5DMGD 2G9HB 2O6EA 4BWWA 3BCFA 3TV8A 3LIZH 1KXHA 1L9MA 4OH2A 4MNQD 2WIMA 2ZKWA 4OCRL 1F13A 5MEPB 3UO1L 3UCRA 4ERSH 4E36A 3HPLA 1SLVA 2DBLL 3KG5A 4MJ6A 4FFYL 5CF3A 4OZ4B 3PDOA 4DK6A 4GI9A 1E3XA 1GYVA 2Q7YA 3D85D 1V7NL 3KPRB 1A9BB 3FT1A 1QVOA 3M6DA 1C08B 3UP1A 3WN6A 3OQRA 1BJ1H 2CO7A 1V5JA 2X3CA 3C6LD 4X6EA 4ZTOH 1KYOK 2DQGH 2BK8A 5FOJA 4UV4L 3BWAB 3QUXD 5SWSA 4NBYB 1HU8A 1OK8A 2P5EB 4YDIH 2J3SA 4XXDB 3VD5A 3NA9H 3FQNA 1I8LA 3REVB 3AWEA 3MV9D 2HT4D 3GSQB 1FFRA 2PPFA 3ZKQD 2EUVA 3T8XA 3B7RL 2IJ0C 4L8SA 3V6FA 5IGXL 4LCUA 4HHGA 4P3CH 3AG4B 3OZKA 2ODHA 3Q1EA 3L5HA 4K8RL 5GS0L 5HHMB 4MAZA 1M9WA 1BQHB 2BCKA 1NTDA 1HXMA 2WZAA 5FM5M 3HRZC 3P4OA 4K94H 4L1BA 1JXJA 2DI9A 3ZKSD 4EI5D 3LEVH 2FECL 2ADIB 2AJXH 3L3GB 5JQIB 3N41F 3FB7A 4XO9A 3BP4B 3F05A 1DZ0A 3ARBD 1J7VR 4A63A 3KH4A 5IMKB 3FT2B 4NZTH 2J2ZB 4KX7A 1KWKA 5D7IE 4E0RB 2FJGB 4YBLB 5FO9B 3FRPG 1R5VA 2E47A 2D3NA 4IRZH 4CW1A 2E8YA 1P9MC 2I69A 5E1QA 1IGCH 4KDWA 2F7PA 4PJAB 4KDTC 4L3EE 1IQWL 4GKNA 1L9QA 4JY6A 4YSDA 4ZFFA 3IMBA 3QRGH 4RMWA 4U6HB 5DEZA 4WVRA 2DWEA 4HK3J 4NCC2 1KJ2L 2WN3A 4XI5D 4DEUA 1DBKL 3DRTA 2SODB 4LSTH 3GMNB 1WYJA 3UOAB 4EDWL 2R1XB 1F45A 5D5MB 2OX5A 5JDJA 2R2EB 1IO4C 3ATFA 4LAQH 1IT9H 3EF7A 4BSVA 2W0FA 1M4KA 1UOVA 1LE5A 2VR5A 4FQPA 2J71A 1WQVT 4M6ML 1QEWA 4MZIA 3K3QA 3MJ9A 5ACZA 5E2WL 5DK3A 5ANME 4BQ8A 2VN3A 1J1PL 1C5DA 4FRWA 4MNHA 2O1AA 3RU8H 4AOFA 4YNYB 1G9NC 3RTQD 1UOLA 2IAAC 1LEKA 3TA3B 1E6OL 1FNEA 3RFZC 1IEHA 5J6HB 5A43C 2WGNB 4DT2A 5GSVB 1OV8A 2DRUA 3VB9A 5DJXB 5SV4A 4TQHA 2HWZH 5JPMB 4CC4A 2B59A 3OJVC 4WEBL 3RDTD 3TIEB 2E7HA 4MJ5A 4MHHG 5JLZA 3IETB 1LDPL 4NNYA 3S3PA 2EXSA 5CCKH 2BX5A 5JOFB 4HULB 1NGXA 5J12C 1FO0L 5EORH 5IEHB 4L3FA 4AYGA 2X4PB 1ASPA 4ZDHB 4K2UH 3MV7E 3ZOAA 2FBRA 3L48A 1P4IL 2CJUH 5BCAA 2ZKMX 2G3NA 5HTSA 3ZL4H 3L7FA 3LYRA 3OTTA 4M6NH 1OCCB 5DQJA 3GSOB 3MGAA 2UUDK 2PF6A 3MFGB 2A77H 1CQYA 3PG2A 1DJIA 1YEFL 2Y24A 1NFDE 4R8WL 2UXFA 4NP9A 4R97B 4NHCL 4JGUA 5AW0B 3IS1X 2KZWA 4OM0L 5E6IC 4LCYA 2PN5A 4JFWA 3VUAA 5F7DB 5FXCH 1VA9A 1YC8A 4HUVB 5CZXC 4DP7X 3NDZE 4CGTA 2GJ6A 1ZANL 5SWSB 1A7NH 1JRHH 1SJXA 3DHUA 3K72B 2JKRM 3D12B 5FWRA 5HGBB 4NQQA 2O6DA 5HVFB 2C9RA 1MHPL 1WAAE 1QHOA 2GHWB 3LEYL 2WMPB 2WQRA 4LBEA 2A9CA 3MA7A 1ZWIA 4FQQA 1A6TA 4G7YL 1HYSC 2AJYH 3N44B 4PRNA 3O9WB 4V1DB 1QG3A 3GSWA 1RUKL 2XQYA 2BWQA 3W3BA 1GGTA 1HQ4B 2X9WA 3L3IA 2YD9A 2FZ3B 3CK0L 4ZT1A 3STLB 2YXWA 4GAYA 2PP8A 5DFWH 5H4ZA 3PNWA 1KEGL 1JPGA 3ZT7A 3KXFD 5EZLB 1ICTA 4IBYA 2YC1A 1SN2A 4FL4B 3QRBA 1UKTA 4AVJA 3U6RB 4RVBA 1HCVA 4G6ML 3WEOA 5L9DH 1RIUH 2I07B 3ZL2A 4BZ2A 2MPAL 2VXUH 2ICES 3O11B 3S2AA 3KLHC 4YUEH 5C0IB 3TCXA 5FA3B 1BX2A 2PW2A 2X4UA 1UD6A 3FOLA 2BSSA 2CKBB 3FQ1A 1MCOL 2V17H 1CXIA 1ZV2A 2RQ8A 1D5MA 1SEBB 2ZE0A 3I3EA 4NWTL 3VFGH 4MQXC 4KRPD 2D7QA 5JHDE 3ZMEA 3G5WA 3HNVH 2D2CC 3UP6A 5CU9A 5HHOB 1LO5B 3HI5L 3RYMA 3UMTA 2UZIL 2J6EH 1T5WB 4ZTPH 2XA8H 5FK9B 4BQBA 5BRZB 3HC3L 3PRZA 3GBEA 3ARFC 3FUNA 4J3UA 5J3HC 3U46B 1KB3A 1MF2H 1CG9A 1EVTC 3BAIA 3BQUB 5BV7B 3L1GA 3CSFA 1HHJA 3MRPB 4AQAA 4HS6A 5AYUH 1HI6A 2NRDA 2QGEA 1FVCB 4UT7H 1OAXL 2FIKB 4EO5A 4MD0B 4J6RL 2K1MA 4S10A 1IFHL 3ALWA 5ISZE 3CN4A 2KS0A 4E9TA 5J56B 1DVTA 4JN2A 5IVXB 2G5RA 4QXTB 2OI9B 4FULA 4U31A 5FFGA 1FGNH 3OX8A 4GQ9H 1XIWA 3HAEG 4XN5A 4XPHL 4ANVA 5D1ZA 3ARDD 4HSAC 2F1EA 5DVPA 2F8VA 4OZFA 2P43B 1RIHH 1D6EB 3ZE1F 1E9PB 3QDMB 4AE0A 4JVWA 5I1KL 2HVJA 3KAAA 3NESA 3MKGA 2QELA 4A67A 5IG7B 3Q2VA 1J8SA 1VEMA 5FYLL 5LDUA 5EC1A 2WXFA 1A2YA 2H2SD 1KC5L 2E7LC 3QIUC 5AB9A 1EWHA 3UEQA 5DD5L 4AW4A 4BFIB 2ALAA 2B2XH 1C5BL 3P1VA 5EBLB 4V33A 4AIEA 2BSRB 4LOFA 5ESVB 1DQMH 1TVBB 2AXWA 3OLIA 5DZ9A 2DMBA 4JPVH 1OTTC 4FTVA 3O2DL 3CBKB 4JPSA 3E6FA 5ICZA 4N1CA 2IG2H 3PXJA 4PHXA 2ZX7A 2E6JA 4PMFA 4LFHD 1SHSA 3MRNA 4FQHB 5IM7A 3AU1A 3K6DA 1U8QB 3EFFB 4Y1TA 2G2NA 4Q58C 4PREB 4E9XA 4PLNC 4Z7NF 2R4SL 4OF3A 5AUMB 1DQDH 4Z7UF 1UM6L 3RY6C 1SY6L 1KCKA 3WIIL 1SFDA 4JCWA 1F3JA 5E9NA 4OFDA 4ES9A 4UQ2A 2GIXA 2EINB 3DIFA 4FNRA 1EGJH 1M6OB 1MZYA 3D2UD 3OLEA 1RXLA 1P7KA 1YMMD 4TSAL 5EB9A 2ALWA 1FZOB 4LMQE 4DOHE 1UQSA 3NZHH 4GSDL 2J57A 1BLNB 3U0WH 1C5CL 3EFDH 1L6PA 2FCBA 1KCRL 4YHNA 1S9YA 1MVUB 4XVTH 5IB5A 1BQLH 5G2NA 5LBSA 3F12A 2A3TA 2DTML 4YDKL 5D7IB 2V5RA 3QJHB 4PJEF 4EN3B 5GS1A 1UH3A 4S2SA 1E9QB 3S5ZA 3GZQA 3TF7C 3OZLA 4L2YA 1KB5H 1XTMA 1YY8B 4HIXL 4UM8B 3PQYD 2YQBA 4L3EB 4BGDA 1IGYB 1KCUH 2VL5B 3C5ZB 2EDMA 4J28A 5AYTA 4H20H 2WZPD 3LQAL 5LCVH 3PL6B 3NEOA 4UILH 3UTQB 3RPKA 3NJIA 1XGPB 2W95A 5D1QC 3T3MF 5MEQA 4BH7A 3FUJA 2VDQL 2EUXA 3LDBB 3O3AB 5TE4H 3DYPA 1GSMA 5GGSA 1GGBH 2E59A 2AQQA 3HMWL 4JQVC 4JFOB 5TF0A 5I6XC 1ITCA 3OHXA 3U1PA 1O6SA 1T1YA 2W07A 1ETJA 1EFXD 1J9CT 4JFPB 4N87A 5F9JA 1ZJBA 5ANMB 4TNFA 4ZFZB 3TO2B 2FX9L 1TZGH 3X1NA 3WN5C 3DVIA 3GBML 4FA8A 2Y69B 3CZLA 5GIRA 1TSHA 3Q06A 4IGBA 4YHPA 3BMVA 2EDWA 2EXWD 2OYKA 4OU3A 5E8OA 5F6HJ 5C09E 3X3FH 3UYPA 5K1NA 1DN0A 3DGGB 4O4YH 4YDJB 4TULL 2Z8RA 3BSZA 4ZX4A 3OSVA 3O6FB 2MCMA 1JNNH 1A5FH 4GBXC 3VFNB 5INCA 4ILDA 3H9ZA 5EA0L 4KVNL 1YYMH 3VQLA 2WXRA 1OCRB 3BLKA 2OZ4L 2EADA 3LVTA 1PL3A 2COQA 2F53E 2QBWA 3QORA 4FZEL 4JFEA 4QTIH 3WTWA 4NUQA 4W93A 1HXYA 4AW7A 4F7CB 5T3XE 2DQHL 1N64H 2V37A 4MNGE 2QR0A 4HV8A 4IU2A 3SKOB 1DJZA 2IPUG 3MV7B 4JO2H 2WKGA 4FX5A 4G9FD 2YEZB 4ENEC 3PAYA 2DLEA 4RA3A 3CCHA 4IMKA 1J0HA 4HQQH 4NN6B 3FQTB 4NUPA 3NACH 3WIHL 4JZJC 5DD0L 2E0PA 1U95B 3MLYL 3WEBA 4LE8A 4F7EA 3FUIA 3V10A 2J5LB 4HUUA 3TTYA 1NFDB 3BP6A 5IMMA 4C58B 4XP4H 4YK4C 1SXZA 3ORJA 5GRYA 2IEPA 1UT1A 2J7LA 1TJHH 5DJYA 5JIHA 1CFNB 3EBIA 4ODXB 1MLCB 2ZXWB 2VDLH 4TQIA 1SDAB 2R69H 3EDJA 2OR9L 4ORGA 4LRIC 4EZKA 4LKXA 1NOLA 3QXTA 1GJWA 3LTVA 5HHNB 1YUHA 4MB5A 5CU5A 4XZUA 1M7IA 2O6PA 3T4YB 4QOKA 4QRPA 4Z7OE 5IW6B 1KDJA 5C6TH 3OF6D 4X4XA 1L7IL 2ESVA 1DE4A 5DZVA 5DDHA 4X8XA 5DZOA 3V6BR 4KUZH 5E8PA 2Y7MA 2BSEA 5D1XD 5LJYH 5CM1A 1SM3H 5E23A 1G5AA 1FC1A 1F3RB 5FA4B 1MAML 3W38A 3GZPA 5I1HH 3VWJC 3I2CL 3GD1C 4D0DA 2G5UA 4QHLB 4AC2A 4Z95L 5ITBH 3EOAA 3TTSA 4G8GD 3EOBA 4OM1L 1T1ZA 5CUSH 4BE6A 2E7DA 5FCUL 2BSDA 1B6UA 5E1AA 4IIZA 3RGHA 4P9HC 4AQOA 1Z9SB 3MBEC 3Q6FA 4WTWA 2YPKA 4HUWB 3B7SA 4L4VA 3BH9A 4PJIA 3T5WA 4ISVB 5BQ7B 4GLRH 4PM1A 4PBWD 1ADQL 2O5YH 4L37B 2A9NH 5CEXB 1G0XA 1F6LL 1PQZB 2XWCA 4E5XG 3GXTA 2BIQA 4KKPA 3ROLA 5JA8B 1U3HA 1MXDA 2WLHA 5D2LA 2Y5TA 2EIZA 5DWUH 4HU8A 1SXNA 5I28A 4GRMB 5EN2B 4ZPVB 1MFEH 3REWA 5T1MB 2A0LC 3ZRCC 3KYKL 1A1NA 1XH1A 2BHUA 2G5BB 4K55A 4YL9A 5T3XH 4ODUB 2XPZA 3ETSA 1RQ5A 1FCCA 4V2BA 4W6XB 4KKLD 3HG2A 1R24B 1QSEA 1BVOA 5DUPH 1SDYA 4EIGB 4JRWA 1Q9LB 2IPKB 3WO3B 1CD0A 1JZHA 2CA4A 3IAPA 2VAAA 4C56D 4BKTC 2Y6TE 5CMAA 3T0EA 5MERA 3K81A 4ADIA 1CXLA 4HKJB 4WUUA 3FO2B 3DX2A 1L7TH 4JUTA 5JTWA 3BCDA 3H9SE 3TIDB 3TV3H 5ISZB 4Z7WF 2C7FA 1AD9A 1D5IH 1G6RH 1X7SA 4TLSA 7PAZA 3IDNB 1I8KA 3MBXL 3O41A 3VMPA 5C0BE 3UAAA 4AV0A 3DNKA 4ANKA 4HH9B 2MKWA 4NDMB 4PJ5D 3VD3A 1E2WA 1RZGA 4P2QD 3QDGD 3ESNA 2VRAA 5KSAA 1K4CB 1BZQK 1UT9A 3DOSB 1HWWA 1EDHA 4PJGA 1CN4A 1YPZF 2YEVB 1FG2A 4PSRA 1F4XH 1UH4A 2BDNL 4B41A 2A9DA 5LAXA 5DEFA 5LGHH 4UB0H 1E8WA 3BVTA 3RWDA 2MTPA 1NBVL 1LTXA 2Z31A 2YD0A 3LNFA 4FNPA 4M9PA 4TUKL 4EI6A 4FQXA 4N6QA 3GPEA 2JB5H 2P7TB 2C3GA 3K8KA 3J2PA 1RSFA 4HWBA 3F5WB 1CFQB 3HE7B 3TPKA 1L9OA 1R3JA 4CMHC 3ZDWA 4FYSA 2WBWB 3L4VA 4LLMB 3BP7B 2HLFC 5K93A 4BJLA 5KTEH 1NCDL 3ZHNA 4P4RB 3SY0B 4HC1A 3OMZA 5EEUA 3IDUA 4YR6B 3O8XA 4NAQA 1BQKA 4R7LA 5AB2A 4CVWA 2PWEA 4XHJC 1CXFA 4XC3L 2MQGA 4CVXA 1MPAL 1X44A 4RFNC 3L54A 2B5IB 4DOHB 3EH5B 4XRCA 4QKTA 4UMSA 4NKOB 1AOZA 3NA4A 4HK0B 3TNNA 1DL7L 3O4OC 4JDEA 4X6CA 4YBQD 5KUKA 1RJYB 2VLJE 3PPEA 4LU5L 1ZVYA 3R0MA 3U4KA 5JNYA 2VLRE 3LMJH 1QLFA 3I6GB 4TOYH 1YNTB 4P3DA 5FDYA 3QFDA 1H3WM 1PF3A 2OULB 2DL9A 3JSSA 4U3SA 4Y19B 2IGFH 3OR7B 3FCSB 3QI9B 1IC7L 5EZOL 4NUMA 1FN4A 1MFAH 3H4FA 4M00A 3UGXA 1L9PA 1GCYA 2VDLB 3I6LD 2OJZH 4GW5A 2ZX9A 1QQDB 1R3IL 2JCCE 2CK0H 2CDGB 4I2XA 4PQXA 4PV9B 2NNAA 5CIPA 5DJAA 4GG6A 5E6ID 4GO9A 4PJDA 2VH5L 5CZXD 3VYOA 1MEXH 2DTSA 5CGYD 4ZPTA 5EBMA 1A3LL 5HGAB 1MCEA 4QCIB 4JL1A 2XWTB 4JG0L 3TVMC 1XXFC 1CF8L 5CGBA 2BCMA 4M43L 3LCYA 3QXAA 4KRMB 1X5IA 4G7SB 1CLOL 1ZTMA 1TEYA 4HSQA 4JY4B 3RY4A 5I9QB 3SBWA 1D5BB 5F0LB 2ZUUA 3SD5A 2MNUA 3X17A 3K71B 1HYSD 4KK9D 2C3HA 4KMLB 1VZHA 2F18A 5JW3L 5HPMB 3CVDA 3KLQA 3UXFA 2IMNA 4PRBA 3BUBA 1H8SA 3SDXA 3VJ6A 5BRPA 5ID1A 1KTRL 4LOEA 3LPGA 1U3JA 2QKIB 3CFMA 3AREB 4AZ8A 4ZOCA 5IEKB 2MJWA 1AD0B 2DWDB 1I8MA 2G30A 1CE1H 1IL1A 4MDJB 4XNQB 5GGRY 1IEBB 3S4SB 3VFVB 1N6UA 4EBQL 4P04A 2LW3A 2AXGB 5LG6A 3GBDA 4KPHH 5DS2A 1MFUA 1P7QD 5CP7B 1TQSA 3TWCH 4JY5L 3GUTB 3NSDA 3Q43A 4UNIA 3TN0B 1ZA3A 2EYSA 3FQXB 4IW4C 1YJDL 3JV4A 4PY7A 4XO3A 2F53B 1ASOA 1AIFA 3VXUE 3MNZA 4WUKH 4MQXD 4OD1H 4FCAA 1KZYA 3CDZA 5F97E 4MNGB 4AWJC 3VGAC 4HWZA 5DWPA 3GJEA 4R2GB 1MIEL 1JZ7A 4LCCC 5I16A 1CFTB 3MV8D 3ARFD 1Z32X 4JKLA 4I87A 5GRXG 3UTZA 3ZK0A 5IVZB 2OMTB 4KV5F 3S88L 1D5ZA 3NFNB 3D4GA 3VX1A 3VG9B 2OYLA 4MD4A 2FJFA 3NJKA 1XR9A 2FD6H 4LKCA 4X99B 1S6NA 1FFQA 1MXGA 4NRXA 5I15L 2V5MA 2KC0A 2A1WH 2DLHA 1PLAA 1G6RB 3M1OA 3PIQB 3RVTC 1FIEA 3I9GL 5FR3A 5L6YL 3UADA 2X09A 1FV1A 1NINA 2DJ4A 2OMZA 5I19H 5TD4A 1TTUA 3ARGA 4FJZA 1H19A 5IMOB 4EXKA 2X1XR 3C5JB 5IB3A 1W72H 3KYOA 1HDMA 5IR1B 3OAUH 4NBZB 4NUJA 2B4CC 5F7FA 2YWYA 4C57C 3EGXB 2JH2A 4RGOL 2ZQKA 4Z7OB 4NN7B 3WLBB 4O2CB 5EN3A 4JFHD 3I9AA 4RFEB 1Q72L 1RMFL 1VENA 1TTGA 3ULVE 3NCWA 4DPBX 2TAAA 2HJKA 3WV0A 2ZP0T 1T7YA 5DHYA 3H3KA 1EZLA 3WUWA 4UDUA 4PJ7E 5FHBH 2APSA 1QBBA 3QZLA 3BLPX 2XPYA 4DGVL 3OWEA 1CDUA 3QIUD 2Z7YA 2WAQA 2V8MA 5ESQB 5JW4R 3A67L 3H2WA 2HFGL 4E9SA 1J8HD 3AY4C 4N1EA 4QF1A 1BVNT 4FTDA 4N9GB 2ITFA 3QWRA 1JK8A 1NEZB 3QEGL 1TZIB 4Q14A 3BVWA 3H3PL 2NY5L 1J8RA 1ZDSA 2EC9U 2ENSA 2PO6B 1OM9A 1OTTD 4N4YB 4Q9QH 3S35H 2VDPH 3QT2A 1D7FA 5T3ZD 4F8TA 5FC9A 1YEDA 3S5LA 3GRWH 4DNLA 1LWHA 3HHSA 4JREC 3ARYA 5I8KH 3TFKC 2LLLA 1FFPA 1WIUA 4OGYL 5J1SC 1PMYA 2HFEB 4UMGA 1LNUB 2R29L 1OE3A 2AF2A 3FT3A 1A7QH 1BMGA 1O7DE 2D7PA 2YD8A 5TTRA 4DGYL 3QUMH 1JL8A 3C08H 2CU9A 3PP4L 1FPTL 2XVGA 3V0JA 4KQ4H 3LD8C 5I1IH 1PX8A 4NKDB 3HNSH 2UZXA 2W5PA 3QUYB 4OZHA 5IW1B 3B2UC 2NR6A 3G04B 3KGUA 3B7UX 3N91A 3NGBC 1T21A 3NTCL 4WCYH 4B97A 2BP8B 3B9KB 2WVTA 2FIRT 3ARXA 1AO7A 4P2OD 4M1GH 5BS0A 4JFXA 1MFMA 5AZ2H 5GGQL 3KM1A 4U6XA 3SGJC 3VXNB 2XV3A 1KG0B 1AYOA 3MOBH 4Q7DA 2XSKA 4OLZL 3UAFA 3DX1A 1TR7A 5TDOA 3PY9A 3P02A 1YECH 3GSUB 4HT1H 3H9SB 1VACA 4LCWA 1JTOA 5CWSB 1KFAL 2X38A 5I66A 3KL5A 2LFEA 3HZMB 5T33H 2VQTA 3BUIA 2O61B 3EBHA 3DV6A 2ZYHA 5F1IA 1ORQB 4FG6C 4LVHB 1A6UH 3SGDI 4L29B 3RUGA 5DVLA 3CFNA 1PY4A 4X8JA 4PS8A 4ZFGH 3FDWA 1XF4B 1JMXA 5KSBE 43CAA 5D1QD 5IROC 3VXSA 2GT9A 3CN2A 3CSGA 3DBSA 4HS8L 4FI6A 3L5JA 1TKWA 2APVA 1S7RB 4GXFA 1E5UI 1AHWA 5LUMA 5EU6E 1ACCA 5KUMA 4MA1B 1BYPA 2IAMA 3EYVB 3NJLA 1MJJA 4FFYA 4PW9A 2FYYA 4TSCH 2NY0B 2VUYA 4L9LA 5I2IB 1MFCL 3KPLA 4JRLA 4JHWH 1QD0A 4OT1H 4YBLC 3PWLB 3NIFE 4NUGH 4XCFL 1H3GA 4XN4A 4KTDL 1CI3M 4OCXH 5GISL 4P5TB 3UBXB 4LVOB 4HX1B 3MXVL 5EZIH 1IM9B 5DO2C 4YE4H 2UV3A 2Z93B 1MJ7H 4NRYA 4Z9KB 4MMYA 2JKXA 4PUBL 3WNPA 4UOZA 1XEUA 4FNTA 3VRIA 4ZUSA 4C4BA 3QJUB 4GBXD 4L1HA 4P23C 1OLZA 1S7XB 4ZSOE 4J8RA 3QFJD 2FR4A 2VR9A 3FUEA 2P5WA 3CHPA 4XP5L 2EUZA 2A6JB 3QCUH 4PTTB 1CK0H 3QQ9D 5SWSE 1L4IA 2VLJB 1TJXA 5F3HB 3MRFB 1EEYA 5ETUA 5F89A 1NFKA 5I0ZA 1TQWA 4ENED 1U8IB 4Y5VB 2X4RA 4ABQA 5C7XH 3IN2A 1F41A 3CVHL 5IOPB 1NWPA 2GI7A 2H26A 2VLKE 1OB1B 5A16B 3TA3C 1I1CA 3UC0L 1AXIB 3HVNA 3MMEB 1UASA 2LVCA 3K80A 5HJ3B 1SHMA 4UYQA 4R4NC 1RK7A 2JCCB 3GINA 3D51A 5D7LD 3EG9A 1ZT4B 3VXPB 1W72B 1XCQA 4MDRA 4YN3A 4X4YA 5EOCH 1MLBA 4MDIB 2GUOB 2FHFA 1DBAH 3FFDB 1HEJC 4EN2A 3D3VA 1S9XA 1KGWA 1NC4A 2G4EA 4LPCA 1KJ2A 3ZY7A 5EIIG 1PZ2A 2FEEI 3EYFB 3FW6A 1F6FB 1Q94A 1VGEL 3BAYA 2YD6A 5FYKU 3WL9B 3AB0B 3WHE1 1K8IA 3KBHE 2CDEB 1MCPH 3FU5A 3UBFA 4D8PB 3VRJB 1IV8A 5D7JA 4A66A 2XU9A 3B6SA 4LLDA 1RURH 3OAYK 2D03H 1NCWL 1OARH 3F00A 4XGZA 3V4PL 4OCYH 4Y9CA 4HOMA 4R96B 4FG2A 3VD7A 3ZHKA 2N4IA 2BHFA 1YEJL 4AEIL 4BWTA 1DDHA 3BFWA 1OGAD 5DD3L 1H15A 2VDPB 1I7TA 3D39A 4H25A 2NY2C 1JV5B 4H26A 3VWJD 2OK0L 4R97C 1M7DB 4HALA 4NJ9H 3FB8B 4XPBH 5JXEC 1AH1A 1RZIB 3DROA 2P42B 4J8QA 4G1MA 3QUMB 4Y2OB 3VYNA 2BW4A 2Z8SA 4AJWA 1JZJA 1RK1A 1TZHB 4P05A 2W65B 4OJFH 5I0DA 2WBJA 5DQDH 3MBED 4KHTH 4NQCD 1OE2A 3F7VA 1ZOXA 1N59B 3ZIMA 3NRQA 2XYBA 1WA0X 3VX0A 4BYHA 1JTTA 3H56A 2DDQL 4JFDA 3B9EA 4R7NB 5KVFH 3QDJE 3VXUB 3KS0H 2X10A 3CDFA 5GRVK 2R2HA 5GS2D 1ILUA 1IAKB 1FO0A 3MBWA 2OM5A 4YAQA 4N2DA 4QWWC 4CSTA 1AGBB 1ZK9A 3HBQA 3ET9F 3CU7A 3O9WC 1PZ3A 1JOIA 1TJGL 1WA1X 1YN6B 4N2MA 4BWUA 1HZLA 5AVRB 2A0LD 4JFFA 4JCMA 1TUPA 3BVNB 2WVUA 2KI6A 1QBAA 4FXGB 4G6JL 3VE0B 2AJVH 3DO3A 1E4XH 3SDCC 4KQ0A 3O6KH 1UWXK 4A2GA 4HWEH 1S7UB 4OUUA 5F70A 2L7UA 4HS3A 2OYPA 3NABH 1EA9C 2ZXEB 2KLSA 2X6UA 5CCHE 4JRXD 2AEPH 1ZK5A 3IMTA 1R19A 3WKPA 4PWHA 1CIUA 4X5XB 1X5ZA 4OKVB 5G5DA 4H8WL 2WQWA 3NH7L 1OSEA 3UJTH 4NQVB 1FDLL 2JXMA 1TVDA 4NCDA 3RHWF 1VZIA 2IO5A 5IKCB 4NAMA 2MOVA 2NX5D 3O0RH 5A7EA 4LSDA 1CGYA 5HDBB 1GZHA 1N19A 5GJTH 4JG1L 2GTZB 4K94C 2QZ5A 3FHAA 1BM3L 4BCXA 3Q8FA 1GPOH 1E5AA 2X12A 1H0DB 4PJ7B 2P48B 3HE6B 5F96L 3ZHLA 5KBPA 2Z6FA 5FYKE 4YHOL 5TQ2H 3LQMA 2GJ6E 2P1YA 3DURA 1VLXA 1CBJA 4E9WA 3NCYS 3FCBA 1KYOJ 3P3TA 2AEOA 1JMZA 1GC1L 1MI5A 4XX5A 1J9SA 1IEAA 1KY7A 1LO3H 1VIWA 2WO3B 2XKUA 3DJSA 3EH1A 4G8IA 4QRFA 2I60L 3VFUB 1AVAA 1SOQA 3EJYC 5DURD 3FAXA 3NAAL 1ZXKA 3S36H 1FORL 2RALA 3N85H 1RJLA 5I6OA 4KY1H 1FRGL 2QPDB 4NZRH 4PRHA 2OI9C 3NCEB 5AVWB 1JS4A 1QLEL 1YEWA 3BUYA 2EIMB 2CG9X 3OKDB 2KLTA 4FNQA 3KYMB 4DO6A 2GJRA 1B9KA 3L3OA 3ULSA 2HLFD 1A65A 1CL7L 3KNBB 2IH3A 4W1TA 3LRGA 3Q8CA 3GO1L 1ZPLA 3V5DB 1AYRA 1VFBA 2OSYA 3ZPDA 3HKZA 4CC0A 3VXTA 2Y2TA 3DJZA 3E0GA 5F7HA 15C8L 4XHJD 3DSFL 2JIXD 4DVBA 2IQAB 4M5YL 2YFOA 3FTSA 4J3VA 1S4IA 5IIEA 4BQCA 3AS2A 3SY6A 4Z23A 4HGWB 3ARSA 5DZLA 3QNZA 1JZ6A 3FZUD 2Z92B 1JDDA 1DQLH 1PZ5A 3RKDD 2EKJA 2GB2A 1ESOA 3F58L 3AFLA 4ZAKA 5DJCA 2IAND 4D9LL 1X4ZA 4KX9A 1FZMA 3QXUA 1OP5K 4ZMLA 2CE6A 4X8GA 4OW6A 3CDYA 4G8EA 4N86A 4PJHF 4W9IC 4LIQE 1BXAA 2QADC 2CO3A 1OWRM 3OKNA 2H1LM 1EAOA 1Q0XH 2DH3A 3DV4A 4APQB 3FPXA 2YAQA 1H3UA 2Y4SA 4WTXA 4XPFH 1QFWM 5LGKA 4LSSH 5B3JE 5KSBB 1JN6A 4K3HA 1DBBL 3TVMD 1I9RH 2KH2B 3W0WA 1R5IB 4XMPH 1E43A 4TSBL 2OMXB 4A7UA 1A4KB 4W9EC 1JHKH 2HG5B 2YN3A 4FP8L 2EDOA 4WWKA 4K15A 4Y2DA 5EU6B 3VM5A 3WE1A 5C0RH 3DJTA 3PS6A 5TQ0L 4GRLB 5JO5B 1FFTB 3AG3B 4DKFL 5DUJA 5FYKH 5LN4A 2RH0A 1KJVA 1IRAY 1S7WB 3QDHA 5DFTA 1CI5A 1T80A 1ULVA 2CLRA 3NIFB 3O2DA 4EN3C 1A6WL 1QFWI 4AMKL 2D4DA 3QIBA 3N1PC 1SBSH 3DC0A 5TFSL 1CFVH 1JI2A 4LLVB 1N8ZB 3U7WH 2EH7H 4GO6B 4LSPH 4U2ZA 3C5ZC 2PR4H 5TF1L 3TH2T 4FHJA 5BNXD 5DJ8A 4LNRB 2YLKA 4MJ6B 1FNSL 3PDOB 3PL6C 4KO9A 3V0VA 3VFOB 4ZSOB 4JVPA 2XZAL 3LDBC 1TF4A 1DBJL 1UENA 2CO7B 2BNRA 2M2DA 4FFZL 3KJ6L 3R4DA 1VFUA 4MXQC 2WLNA 5FECA 1WEJH 2WYTA 5JDSA 3G9VA 3ZTNH 3AT9A 5F9OH 1MJUL 1U8KA 4Y5YC 1XAUA 1QTSA 3O4LD 4LHUA 1UD2A 2ZAHA 4M5ZH 4XT1C 5KYUA 3GWJA 3SYQA 3M17A 1IGTA 3OD3A 5L2JB 1HH6A 1N0LB 4M3JA 2YKLL 5HYJA 4LSUL 1GGYA 3FQNB 1EJOL 3BESR 1A1OA 1N7ML 2VLKB 4MJID 1I7ZA 5GPRA 1F11A 2E74C 3FN3A 5DC0A 3QSKB 4L8SB 3V6FB 2ORBH 4XWGH 4LCUB 4ECNA 5INDB 1F4HA 2HG0A 5AVXB 2OR7A 3FN0H 1EAJA 4H88H 4M7LL 3RVTD 2BCKB 3MKKA 1HHGB 1HXMB 4PJXF 3O6FC 1WZLA 3DI3B 4UOJA 3SHSA 2VERA 1MQ8A 1JNHA 1AQHA 4TQ8A 3FB7B 1M56B 3JYCA 4OIAA 5GZNC 1A02N 3EGDA 1AC0A 4ICWA 5J7CC 4Y1AD 5SWZD 4OFYD 5C97A 1R5VB 2ZXDA 3EO9H 1SMAA 5FB8A 2X9ZA 3ZNGA 4JS7A 4WIQA 4GKNB 4JY6B 1N3NA 2X2YA 4NN6C 4P46A 1PD1A 2DWEB 4ZNCD 3HG1D 2K70A 4WHYH 2QPSA 3ZVVA 4PJFA 2J5LC 5GXBB 1SZNA 2C9WA 1QWNA 1B4TA 1T22B 1BFTA 3B2DC 3PNRB 3DI2B 3FU3A 5MEOA 1CZ8L 1R34A 4F7TA 4BSVB 1Y1DA 3IDJB 5IHBA 2Z64C 4U4BA 1X5YA 1A6AA 1M2VA 1QSFA 2PTTA 4CU6A 2JJWA 1QEWB 1HAWA 2O72A 3TFKD 4D94A 5ACZB 1RUMH 1A4JB 1IILE 3KGSA 4RGND 4PJ9C 1C5DB 1L5GB 4JGJA 1H3XA 3LKNA 2DWXA 3QDJB 3P3UA 5ACMA 2IPTH 4H8VA 1FNEB 2H0FA 3QPXL 4OQTL 2EEFA 1U6AH 4BKSC 3SYAA 5BVJA 3UDWA 2K9UA 2JE8A 4W9HC 1IKNA 4JNXA 3X11A 3IFOA 4FC3E 2DLIA 1UD3A 2C3XA 1NFAA 4JHZA 4K73A 1L0YA 3DMMA 2CHXA 4F93B 2TRHA 3BUDA 4OFVA 4MJ5B 3WIHA 3BC9A 4Y4KA 3OKEA 3ZU8A 1TPXB 4YHZH 5BO0D 4RX4D 2YA1A 1FVEA 3KPRD 1T3FB 3MRRA 3QJFB 4JFEE 4PMEA 1NGXB 1LD9B 2E46A 3BI9X 3EO0A 3IJEA 5CJ8A 4TV3A 1XSIA 1EO7A 5IVOA 2D9CA 3NJVA 2VXTL 1QPKA 5DGRA 1OW0C 3CH1A 3BGMA 4OIBA 4HXAH 2YPLA 4TVUA 1AI1H 2Y1AA 3NIGE 3L7FB 3BVXA 3TBBA 2OMUB 2P5ED 5C92A 4OLXL 5DQJB 2YPVL 2DB8A 5CN2A 4FG6D 5D96B 1ZVNA 4ZD3L 4QHUB 1O6VA 4FYQA 5IB1A 1E2ZA 4J1UA 1CUOA 4XAKE 3QXDA 4YSUA 3SDYL 2YSSA 5LBSH 4I0KA 3NUKA 3OBAA 5EF2A 2VR6A 1E30A 4N5EC 5KVEL 5IROD 1J1XH 1Z9OA 1WIOA 5HHMD 5MHSE 5K1JA 5ADOH 1T89A 1K3IA 2GJ6B 1Q9WA 4P06A 3AT8A 3ATEA 4YBHA 4AK1A 3ZDZE 3SBRA 2PWGA 3HNTL 4S0SD 3FF7A 4EMZA 5C07A 4HA1A 2Q2LA 1DQQA 4QRPE 3HR5A 4LBEB 4H1LH 4O00A 1E4JA 1S7TB 2DQTL 3RGVA 3S6CA 1ZWIB 4X2UA 2Y07H 1A6TB 2ICEB 2ESVE 1RZKH 1F58L 4RBPK 3CN1A 3I02A 3E6HA 3P4NA 3GSWB 2V8LA 5DLML 3TT1H 3HUJE 4FQ2H 1NEZG 2BVQA 5DO2D 1ZLUH 4IBQA 1U4FA 2BOLA 3L3IB 3QQDA 4NKQB 4A6YL 2IBGA 2A4ZA 1ADQA 1SLXA 4GAYB 2EVFA 3PNWB 1MCWW 4N2BA 3T6QC 4P23D 4BCYA 2YC1B 3SOTA 1PS3A 1MVFA 4HEPA 2BNQD 1ZLSL 2BOBA 4EVNA 4QKXB 4LOUC 2GHZA 3RBGA 3TX4A 3UTPE 5HSFA 2I5YL 2B1HH 1DBML 2P45B 2Y7QA 2X4UB 1AAJA 4L4VE 3FOLB 4MKTA 2AC0A 4I89A 1J05A 2BSSB 1K2DB 1SN0A 4JO8A 5IUSA 3AGWA 3TBCA 3CFDA 1VADB 4ETQB 1D5MB 1K5NA 1WWBX 2XN9A 3LS4L 3SGKC 1E7VA 4F58H 5D2LE 2WJ5A 3W9EA 3H53A 4Z5RB 3TA3D 1JGUH 4KKCC 4YSCA 4HJGA 1I53A 1QA9A 2WJ7A 4MA7H 2BVTA 4R4ND 1SLUA 2B8OT 1CG9B 4NI6A 2C9VA 1CJYA 2UY7A 2HB0A 1A3RL 1MNNA 1MWOA 3LPWA 3LVEA 4AQAB 2ED7A 1HI6B 2EJ1A 3QB7C 2E6QA 1QLRA 3T0EE 4O51B 4WWID 1AZVA 3GNML 4HPYL 2AQ1A 4PG2C 2IXQA 4TNVF 5EMYA 5GRUH 5HP5A 4R26L 1BPVA 1YEEH 2B5IC 2AMGA 3IXTA 4AM0A 2YA2A 3GJFH 1XH0A 3HS0A 4LMQI 4PU2A 1J86A 1BD2E 1GOFA 1GR7A 4JN2B 4XVSL 4WO4A 3OX8B 4RAVB 3VG0L 1XIWB 4RFOH 5D1ZB 1JBJA 2AITA 3QULB 4N3UA 1EHLH 4M3KB 4N24A 5IUCA 3V4UL 4FMFA 3P11H 3QI9C 1QBLH 2JJSA 3IYLW 4YQXL 2HVJB 3IGUA 1UCBH 3HLKA 1HSBA 2OCFD 2BRRH 1NL0H 4FXKB 3QZWG 5EC1B 5JXED 4GW4B 4F8NA 4PJGE 3D6GA 1DN2A 5E6ZA 1RP9A 2APXA 5GJSH 3RX9A 1TVHB 1TYJA 4Z7QE 2OS7A 3O6MH 3QCTH 1F5WA 1WCQA 1T1WB 3V0WH 1GHFH 1NUDA 2DQFA 4HCIA 1A8ZA 3S8WA 4F2FA 3UBXG 5AQ0A 1GTNA 4ODSH 4G43A 4O02L 2E56A 4D9QD 3MJ8A 4YSTA 3WXWH 3GHEH 1N5YL 4WFGD 4RWYH 3HG0A 5I9QC 3AU1B 5E8DH 4PWJA 1FZJA 2EYRB 5DT1H 5CEZL 4XB8A 3KEDA 3O9WD 1X7QA 4QJ3B 4X8CA 2NQ3A 4V1DD 4BFGA 1L3WA 1NBZB 4IRSC 3VD1A 1SBBA 1F3JB 1RIVH 2YGVA 5EC2A 5JXAH 2QKIC 2MCAA 3AREC 4UQ2B 4BE5A 4WU7A 3SE4A 1J0ZA 3UTTA 1HINH 1PIGA 1GY1A 1ROWA 1ZSDA 4JZNB 1DP0A 1PVHA 2FX7L 5F88A 5FYJD 3TEUA 4X6CE 1C16A 3TN0C 2LLGA 2P46B 1DVQA 4YHNB 5GS3A 2MCG1 5IB5B 3WKML 3F12B 3Q6GL 1BEXA 4ZFQA 4KO7A 1WZMA 2OW7A 2VR3A 4JPIB 5GS1B 5IHZA 4M7JH 1EPFA 2ZWSA 4X7SH 4N20A 4GKLA 5BRZD 4I2XE 1NIEA 1REIA 3MO1A 3O2VL 4R4BA 3I3DA 4GG6E 3VDCA 4K0OA 2WP3O 3PAZA 2WO4A 3LXUX 4AQEA 2YMXH 2YJQA 3BQUD 3VG9C 3BT0A 4PYHA 2IQ9H 3QYCA 5MEQB 1FCGA 2QJDA 2DM3A 5A2AA 2BXZA 4UAOB 2LHAA 2OP4L 3WFBH 1GOHA 4F2MA 4Z7VB 2Y5EA 1WG3A 3PWUB 2BS8A 3OHXB 1T1YB 2W07B 4RZCA 1YY9C 4RNRB 1CR9L 4OLVH 1S5IL 3CIQA 3FQ4A 2FSDA 3EYUL 3TH3T 1BJ1J 5F9JB 3L5WA 3G5XB 1HN1A 1DUYA 2JI1A 1CE6B 3L3HA 3MLUL 4F1ZA 2R0ZH 2R4RL 3SDXE 1KT2A 2WNWA 7FABL 4NN7C 2WUCH 1GJIA 3L3DB 5GIRB 3VCLA 4GAGH 2BVUA 4O58L 4R5VA 1RKRA 1AE6H 2CK2A 2X0UA 3QDMD 5KVMC 1DYZA 2L8AA 3KVDD 5EU7E 5L7XL 5HPOA 2J6WA 1DN0B 2FJHA 2B1AL 4YSAA 4K5OA 3T2LA 1EJ8A 2RACA 1LK2A 1MCDA 4HWBH 1NUFA 2AEQH 5BZDA 4IMLB 4ETYA 4NENA 5LWYH 5EO1B 3S3DB 3UEZA 4IBZA 1SRDA 2R9HD 4FADA 4L48A 4G70B 3QORB 5T3ZL 4JFEB 4B3EA 1HXYB 5K69A 1AXTH 3B5HA 5T1LB 2EVJA 4HC1H 5K39A 1G7QA 4NO2B 2QR0B 1HWGB 4IU2B 1PAMA 4JLRA 1KN4L 3ZYZA 4LCIL 3V7MA 5C0GA 4LK4A 3NIGB 4W9ZA 1DR9A 5F9WC 3CCHB 2VYRE 5I1DA 3DX8A 3MLVH 4EDXB 4F57L 4RRPG 5KG9A 1NGQL 4KX8A 4JN1H 4QJ5B 4A37A 1KJMA 1L9SA 2X1OA 1IMHC 3QUYC 3VA2C 3PUUA 3BP6B 3VXRA 4B9ZA 5IBUB 5I1CH 1OF2B 5J13B 2VT0A 1T4WA 2YGNA 1E4KA 3B9KC 3FTYA 2ZUTA 4APXA 5DJYB 4QYOA 4KAQL 4Q0XL 4HCRH 3S3JA 3OMIB 4W81A 4Y5XB 1WA2X 4C47A 5EBWA 4MB4A 5K9OA 4FKEA 4ORGB 3UBGA 1TCRA 3K46A 4Z7WA 1FNAA 3ZDZB 2FJUB 1YUHB 2H6PA 4XZUB 1PZCA 2FSEA 4QRPB 4PS4L 1RK0B 3U2SA 2YXMA 3IXAA 2ESVB 1BQRA 2I26N 2QLYA 1DE4B 1KGJA 4EN3D 5DDHB 1PAZA 4GIAA 4XOCA 4Q9RH 3BIKB 5E8PB 5FF6B 4PD4J 5IVNA 1CD8A 4ONHB 4YVUA 3HUJB 4QRBA 4L3ED 1X9LA 2X0VA 2R29A 4TNWK 3C5ZD 3BDBA 3B4NA 4LVHC 2EDKA 3K8MA 2HRHA 3WO4B 2IWKA 3Q48A 2J25A 3EDFA 3U9PH 3MUGA 4D0DB 3ZW3A 3PL6D 3GXIA 1MN4A 1KN2H 3KR3L 4KK6D 4W6WB 4PJCB 1F1AA 3EOAB 5I1GH 1ZJAA 1BM7A 1T1ZB 3P3SA 3NSCA 5T1JA 2WCPA 1KBBA 4L1TA 3MODL 5E1AB 4DKAA 3BKJL 2BY0A 5DZAA 3GRGA 4M8QA 4MXQD 3Q6FB 2QQNL 2YPKB 4L4VB 3EOTL 2EICA 4M48H 4NM4H 4W9LC 2GJZA 2NY0C 2NDGA 2E8ZA 1JFHA 1OAYL 4L8BA 2VJ0A 4BBWA 5ALBH 5I5RA 3ROLB 4K5MA 4OI7A 1U3HB 1ZA6A 2P8PB 3DVNA 5D2LB 3QUXA 4OV5A 2Y5TB 4OZHE 1YA5A 4MBOA 4DAGH 5KBKA 2EIZB 1XF2A 3I9PA 4YWGL 1NQBA 5DHVA 4LVOC 1UADC 2A9BA 5CN3A 2FLMA 2W9DL 3FUDA 1A1NB 2P80A 4FXLA 3UBXI 4F8PA 4KXZH 4OLWH 1AO7E 1XF1A 2DOCA 2P24B 1HL9A 2WO2B 4OKDA 3I50L 2VITA 2W8CA 2AEIT 3O6FD 1I1YA 2KQNA 3IJ8A 1LE9A 1WICA 4H0LC 5A2LH 5IWLC 5I0YA 3T0EB 3JVGA 5MERB 4G7RB 4RDQF 3VSVA 3ZDYF 5GZND 3FB5A 3GI8H 3PGCA 3RIAK 5IHHA 1GJUA 2UVEA 4K7PH 35C8H 4DTGH 4EI5A 4MRCA 1AD9B 1BD2B 3LV3B 4UIKL 1A21A 2GIMA 2LTQB 3MV7D 4FG4A 1I8KB 3ARBA 1BF5A 1I8IA 2Q5BA 3O41B 1DJSA 4W68A 4HIIA 1VESA 4AYMC 4Y5VC 1TIUA 4WFFE 3EZJB 3N04A 1XWVA 4JO3L 4GKSA 2WY3B 1KCSL 3KH3A 2ZKHH 4UQCA 5C9JA 3LZNA 2BXYA 1RZGB 4JAMA 3N5AA 4WW1A 1H8OA 3OWRA 4I3RH 5F1KC 1GIGH 2HLAA 3CMOH 2C7UA 4YLBA 4IEFA 2ADGB 5KSAB 4YXKL 4KOBA 2D4FA 2Y0SA 2D31A 5HVHB 1MIML 2QV2A 5B38A 1G9EA 2NY7H 4ZOEA 2XZQL 4PJGB 4B96A 5E56A 1IC4L 3AZUA 4Z7QB 2FBJL 5LAXB 3S37H 3DX3A 5DEFB 3T1FA 3C9NB 4XBEL 4S0HA 1I3GL 3WTTA 1OAZL 5DGQA 5E00A 3MLWH 1MRFH 5HI5C 5ACLA 1UGKA 4HLZH 4EI6B 4U1GB 4FQXB 2V6HA 3AB0C 4G7VH 5L8JB 4BFKA 2UY6A 2BY2A 3BIAX 4N8VA 2OSLA 5D4IA 5BOJA 5CHNA 5I71B 3OSKA 4B5EA 4P49A 1PG7L 4DGIL 3OKMA 5CJXC 2O5XL 3FU7A 1MUJA 3RTQA 3PGFL 3WKQA 1J88A 1NCOA 1RUAL 1U8MA 4PBVC 4MXVF 4J3WA 4FF9A 5FFLA 2CJ3A 3CVHA 1AQKL 1G4MA 4YZFE 5MP6H 2R7EA 4L1DA 5A2CA 2WNKA 2WLYA 1G7HB 1NMBH 3INOA 4KZEL 2P5WE 1KLGA 4LSVL 1V7MH 3RWFA 3X1GA 4CVXB 1RUPL 3CC5A 2JKSA 4P9HL 4XRCB 3RDTA 1E6JH 3TNNB 5IFHH 4XMLH 4JDEB 3UZVA 5I30L 3W39A 3IGAB 4BA0A 4GT0A 5BZWB 4UZSA 2NYZA 3QFDB 4WENB 4U3SB 1MNUH 1QHQA 5JHDD 4RRPM 3V4VH 1SHWA 3L08A 4AYBA 5KYYA 4GW5B 5EEXA 2C4XA 2HN7A 3NCBB 4OF6A 4W70A 1KV3A 4I2XB 2NNAB 3M07A 1J9RA 1QKZH 4GG6B 4N5ED 1T0PB 1DVZA 1TQBB 1DVSA 3IJYA 3RVUD 3UAJC 1OQOA 1WCBA 3Q1SH 2CUIA 4FXGC 3FBKA 4KZDH 4FQJH 5DC4B 3D3VE 4PWEA 4ZPTB 3MLTA 5EBMB 3K4DA 5CP3A 2ZX5A 2VMJA 3RVXC 4QUOA 3Q44A 4TN9A 5D2NE 4U0RC 1VEPA 1TLMA 3QXAB 4XPGL 2EC9T 2P3YA 5GGTH 3G6DL 1MWAL 4S1RH 3OXSA 1B0GA 4MQTB 4ANWA 2GQHA 5AAWA 3JTBA 3C8KA 3EDKA 2VERN 3SDXB 5ID1B 4JZOA 1XT5A 5DYOA 4YX2L 3UO1H 2YUZA 3BKMH 3L17A 2VZTA 1NGPH 1CXHA 4XNBA 5DRNA 4ODWA 4FFYH 3D39E 1NGWB 4AZ8B 5A6MA 4QPEA 1VFAA 1A4AA 2BIOA 3EO1B 4YFEA 4QLRA 4HUNB 4OZGF 1P7BA 5SWQA 1BQSA 3TJPA 1IL1B 3CFKB 3T6VA 3HE6C 4LOUD 1XB6A 4HEMA 4NNXA 2E27H 1ZA3B 2EYSB 4PVMA 5F9DC 3JV4B 4PY7B 5H35B 1B4LA 5TJWK 3WNKA 1DLHA 3O2WH 4JFDE 2W94A 3INUL 3MNZB 4NRZB 5TDPA 4F20A 3K2UH 3CDZB 4QHPA 2YGPA 5KVGL 2AXJA 2WM0A 4HWZB 5D7SL 3GJEB 4K7FA 2NLJA 5IGXH 1URLA 4KKCD 3HE7D 3FC8A 3W2DL 5BUGA 1O7DC 5I16B 5HHPA 3NSXA 2QGDA 4JFFE 5GS0H 4ODVL 5L88L 4CSSA 1JCVA 5BUPA 4MD5A 2FWUA 5FIEA 4YHYB 1D5ZB 3G6JF 1XR9B 3WGUB 4RZKA 1TDQA 3VSQA 1PLBA 3QHZL 3EYOA 2ARWA 2CJTA 2HUEA 1ZHLA 1RI8A 2X4OA 2R83A 2QQLL 5AZEL 1A0QH 3MLXL 1FV1B 3G5ZB 3ECBA 12E8L 3ARGB 1FBIH 4M4PA 5E9DD 4R9HA 4O5LL 3R1GH 4BHUA 2H5UA 2PW1B 1SPDA 1U3ZA 5IB3B 1HHHA 3P54A 3KYOB 1HDMB 3CSYB 4GFXA 1N10A 2WIIA 3WCYA 3V9CA 4PW4A 9PCYA 1P5VA 4J3BA 4JBSA 4A1RA 1XSKA 2GCYA 2JJTA 2NY6B 2XWJA 4Y19D 4W4OA 3QI9D 4HUMB 1DBKH 2VDOL 2HJKB 2ITEA 5DHYB 2ADFH 4B9PA 1DHKA 3WUWB 4UDUB 1J9QA 2A74C 2E3VA 4AGPA 3US1A 3ARDA 2EIEA 2BW5A 4DUVA 3MOQA 4OCSH 5AVYB 4QIRA 2DQDH 4APQC 4ZMZA 4LL4A 4QF1B 2HKFH 1WAEA 4PJAF 4M6MH 2OTUA 1JK8B 1MI5E 4DHLA 3JV6B 5E2WH 5A6LA 3S36X 1HKLL 2EECA 1VJSA 1J1PH 3WMSA 2XQYG 4FCHA 3OMNB 4NCC1 5I6PA 4BK5C 3QK0A 1A6PA 3VRLE 1YEDB 1PJ9A 4U1LA 2HH0H 3HHSB 1FFPB 1XR8A 3APCA 2YGQA 4GRLC 1ZT7A 4PRPB 4PRHE 5D5MF 3WSQL 1SXAA 2VC2B 2FUQA 4I3SH 1WPCA 3FQYA 4R3SA 4WEBH 4OZHB 2UZXB 1E0OB 3EYQD 2VIRA 5EG6C 3ARED 4PVBA 1BP3B 4OD3H 1J11A 1GZPA 3RE0A 2DD8L 1AO7B 4JFXB 4AYID 1FO0H 1KBPA 4N90E 3QNFA 4HJ1A 3U4BL 4XO4A 3SPCA 3QHTC 3KPTA 3N9GL 4LHQB 2VDNL 3GZKA 2CIIB 3T65B 3TN0D 3L3KA 3V4VB 3WFCL 3DECA 2KZKA 2ZJSH 5TDOB 1MELA 2ZF8A 3UZQA 2BIHA 2F53D 3DX6A 3DXAD 3P77A 2NTSP 3QIWA 3FKUS 1YN7B 4BKLA 3B5TA 4G82A 5T3XD 3VYPA 1YEFH 4KY2A 5A1AA 2E4FA 5I66B 1JPFA 3UYOD 4R2GD 1XXDC 2XQBH 1Q8MA 4F80A 5I5MA 2JB6A 4OM0H 2PYEB 1I8LC 5F1IB 4BIKA 5EWIL 1X3DA 4XNUH 3RX5A 4F7PA 2DQ6A 4PG9A 6FABH 2Z9TA 1ZANH 3MREA 4X8JB 3PQYA 2XWZA 5HYIA 4WHYG 5DK0A 1WE5A 43CAB 1DZBA 2GT9B 4X5LA 5JPNA 5KBMA 1T83C 4OSUH 4N9OB 1MHPH 1TKWB 3KMDA 4PRAB 5FYLE 1ZT1A 3W0WE 4DWHA 1ITBB 2CPCA 3CXDL 2WZPA 1XFPA 4G7YH 1AHWB 2F1BA 5FW8A 4FEMA 1YY9D 1S3KL 2WW8A 4TLTA 4N0CD 4F5CA 1MJJB 2B4CL 2BVEA 1FGVL 2FYYB 3QYMA 3AADB 5D7HA 1ZLWH 4KJPC 1LO4L 4L9LB 1NCAH 2GAZA 2E9WA 3MCG1 2ZUXA 5I82A 3ZRFC 3KPOA 4KJQC 3SQBA 5I5IA 3CK0H 4PB9H 5E5LA 1EFXA 1OQXA 4MMZA 4FFZA 1A1MB 4I18B 2QVIA 3VMNA 3PWNA 3CLEL 4N25A 2VQUA 3J07A 1HX0A 1P6FA 2MPVA 2JKTM 1NJ9A 2XBTA 3L5XL 4Q9BA 4G6MH 3RWIB 1U8HB 2F19L 1BOYA 4NFDA 3VRIB 3TF4A 2MPAH 3MC0A 3ALPA 1FNFA 4ZUSB 2XX1A 4AGQA 2ZOKA 4QAWA 4F33A 3LZPA 1PSKH 4NX0A 4PP2A 1UB5A 3ABGA 2CMRL 1LEGA 2FR4B 5KZCB 1MCOH 1EEZA 3RWGB 2P5WB 3GMLB 2BNRE 3CC1A 4NWTH 4QXUL 5C0EA 1JV2A 3D08A 4DEPC 3ULUH 2PO6D 5KSVA 1XF5A 2NZ1A 2P5PA 4IOSD 4HIEA 1SJVA 1EEYB 3HI5H 3PGDA 2UZIH 4NQSB 5ETUB 5F89B 3HC3H 4U1IA 4M7ZB 5HYJE 2V5YA 2X4RB 1YO4A 3AG2B 2VRQA 2P49B 1B90A 1T7ZA 1WRFA 1ETZA 2G2RA 2H26B 3AITA 3IU3A 4X0NA 2Z7WA 4YMPA 4M03A 3PHQB 4PVNA 4G9FA 1N67A 2QGBA 3GB7A 4XXCA 2X2UA 3QUYD 5DXWA 4W4NA 4X6BB 2PWHA 4XPAH 1OAXH 2XHNA 5K9JL 3JZ7A 3B9KD 4UIMB 5AOJA 1BAFL 1V05A 4I77L 4X4YB 3I75A 4MCZA 3ZGHA 5EU3A 2F58H 3GIZH 1S9XB 1NC4B 4B9YA 1KJ2B 1TPXC 2ZYRA 5FAAA 3LKQA 3CX2A 1JAEA 5D2NB 2DQIL 3WFEL 1F56A 3UTOA 2YARA 3HI1A 1JE6A 1K8IB 2H3NA 1EQWA 3L9EA 3U79A 1BBJA 5JMOC 5KYXA 1ZLDA 3H9SD 5D7JB 3B6SB 4H1LG 4LLDB 5B1JA 1M05A 2ADJA 5FYLH 3JXAA 3GLEA 3ISWA 1UB6A 4FQCH 3WG7B 5DD5H 1DDHB 2F7IA 3EJPA 4HIQA 5D96C 3RAJL 3WJMA 1XL4A 1H15B 4PJFE 2QMKA 3D39B 1I7TB 5IVXF 1IKOP 4H25B 4NXSA 4H26B 4DZBA 3U4EA 4OQTA 1JZ3A 1FNGA 3TP4A 3ZYOA 4EF3A 2VDKL 1ZD6A 1NZRA 3ZIYA 2Q7NA 1BA9A 4M9OA 3CAFA 4OAWB 5KVDH 3WJJC 3O2DH 3BH4A 4LLQA 1DFBL 3GSNL 1RK1B 5FUZH 5E2TH 1XMWA 1G7MA 1JI1A 1NAMH 4HZAA 4RA0C 1QSFE 4LGSB 4XP6L 2WBJB 3WEXB 4WGWB 2ENJA 4FYTA 4CVZA 5EEVA 3F7VB 3ROOA 5E7FA 3BHBA 1YNKH 4JFDB 3F7QA 2NY0D 2Z8VC 4UM9A 1JYXA 4NZJA 1UM6H 1SY6H 2R2HB 2PCFA 3MN8A 2ICEC 1FO0B 3B7YA 3MBWB 3N3EA 4NAJA 4UNTA 5CLTA 3PUCA 3QO1A 5A2JH 3KGRA 2R1YB 4AEFA 1JWUB 3FT0A 3DX7A 1UVQB 4JFFB 1IM9D 2G0LA 2AABH 2DI7A 2ZUYA 5IB4B 4HG4J 1R17A 3TYGL 1TITA 3MACH 4EXPX 2QHRH 4AGNA 3FQ2A 4JR9L 5AAMC 3BQVA 3KL3A 2DWTA 3RWJA 1QASA 2P52A 4ZX3A 3LAFA 3O3BB 4AMXA 2AQRA 2DTMH 2FO4A 1CGXA 4YDKH 3A4AA 5E08H 4ELKB 1ADWA 5FUOL 4HIJA 4IHBA 4K9EL 1M57B 2JXMB 2YPLE 2VLJD 4UINH 4HIXH 4ZOBA 2VKWA 3MJ9L 4PJHA 5IBUG 3RWCA 3DHJA 4Z0XA 4WW2B 2DPKA 4GMTH 5E6YA 3OKLA 1MCHA 4R84A 5CSGA 5E8NA 3LQAH 1P9MA 1RUQL 2FQGA 4MASA 3MFFA 1YDPB 1IBZA 1RZ8A 1TJIH 2VDQH 1ED3B 4KDTA 5F7BA 3RB5A 3IDXL 4ZBJA 5I8CA 4UAHA 2AQSA 3QDAA 2MFNA 3IFNH 2VDMH 4IOIA 5AYQA 2C9UA 3LNDA 3QDGA 1J8KA 4X9YA 4A6YA 2HT3C 1OM3H 2Y36L 3SJVB 1KELH 3CQPA 1IEAB 2AJUL 4G8IB 4ODBD 1I85C 2FX9H 2FT6A 2L7QA 3MA9H 4ONFL 3SO3B 4E9LA 2VMFA 5SX4I 1GS7A 3CD4A 3L6FB 3SOBL 2R2BB 1UWEL 4NPJA 4M4RB 4U1NA 3SBPA 1IGIH 2WN2A 5GGUA 4PRHB 4M61A 2WYZA 2C5DC 2IGTA 3JTTA 3TCTA 1QO3B 2EYTA 2FEDC 2LFGA 2F15A 3PU7A 3ULSB 5D1ZI 1I7RA 3RFZA 1NPNA 1PDKB 1I1AC 2IH3B 2V7NA 4IYKA 4ZTEA 1HJBC 5EA0H 4KVNH 2XZZA 4ZO9A 5EIVA 5I8OH 1CXEA 4QTFA 3VWKB 2MQ0A 2OZ4H 4FXKC 4XNZB 3MROA 4DPRA 1QMUA 2L7EA 3AMKA 5IIEB 3OMAB 1TCMA 2W1NA 1I3RA 2GBAA 5CCGE 1JGEB 4BFRA 4F37F 1RZQA 1ZE3H 4HHWA 4JM2A 5C0CE 1PZ5B 3OKKA 4YPJA 2Q2EB 3RI5F 5IF0A 2FH8A 4ERSL 4ZAKB 5DD0H 5DJCB 3VXUD 1UM4H 3CPUA 2XIIA 3MLYH 2R0WL 5B1BB 1FZMB 2FLRT 3QGVA 4Q8BA 5ITFA 4WI4A 5FKAB 4A2HA 4G8EB 3MRKA 5DUBB 1GS6X 4QEGA 3D2TA 5HI4C 1JZDC 4ZS6C 1F1GA 2ZCZA 4ZTOL 1KLUA 2DQGL 3SCMC 2ZUVA 4PJXA 4EPSA 5EEYA 3B56A 2XICA 2EVGA 4NC1E 3US9A 4ZZFA 4OF7A 1JN6B 3RVXD 4YDIL 5E6IA 2PP9A 3HLAA 5DJ0B 2GK0A 4LPTA 3W0WB 3D0LA 1CB4A 3VQMA 4BZ2L 2XTJC 5CLWA 2NSMA 1FLTX 5TDNA 1EXGA 4M6AA 2CCLA 4AIOA 1MCWM 1WISA 1NGYA 4YH6A 2VXVH 4P3CL 4OCMC 2AHIA 3CBRA 5B1KA 2PCPA 1RL1A 4FFVC 7PCYA 1KJVB 2PYFA 5F7WC 2YRZA 3H4HA 3BZFA 4O02A 1MAMH 4K94L 2CLRB 5GS1C 1AR2A 3M45A 5GSRB 4CKVX 3LEVL 4FGMA 5L4JA 3I2CH 3V5KB 1E65A 3H9HA 1E3ZA 4DGWC 1D9KB 3T3ME 1WAAF 4Z95H 2VZ1A 4I4WA 3VXMA 1NWOA 3LKOB 5DJ8B 1CICC 1JF5A 2BFVH 2BNUB 3FSOA 3HE6D 4XP1L 5FCUH 5FDWA 3C12A 4L8DB 1CGSH 1LMIA 3JUYA 3V0VB 3PXHA 1RZKC 2QKSA 3EZ8A 2AS5M 2QHLA 3QISA 5ID0A 4UAOC 1RHHA 1BOGA 3D7PA 4GIOA 2BNRB 1TNNA 1ADQH 4WHTA 3JTSB 3PABA 4DEWA 5FECB 5JDSB 1R75A 4GEIA 5HY9A 1U8KB 5JOPE 4LHUB 1HL8A 1UJ3A 5KYUB 4LSTL 3M17B 1S9KC 2ZG2A 1F2XK 1IGTB 1HH6B 1ONQA 1CLYL 5HYJB 2AV1A 3KYKH 4XMXA 5TE6H 1E3FA 1TLKA 3CFEA 2I9TA 1IT9L 4GY4A 1A1OB 1OAKH 1FVDB 2Q86A 3IT8D 1I7ZB 5DEJA 1IVTA 2CQVA 1F11B 2HZHA 1FF5A 1FYHB 4HSCX 3RIFK 4GOSA 3FCTA 5E1IA 1KXTA 3UTTE 3BWSA 1T1XB 3ARFA 4WSKA 3RU8L 5BXFA 3MYZA 1HZKA 4DUXA 1M71A 2JKNA 2CCVA 4XVUC 4GSUA 1AG0A 3KLSA 3V0EA 4DN3L 3W9DA 3CXHK 5C08A 2HRLA 2UXTA 2GUYA 2UX6A 3EGDB 5LO7A 2VDQB 4ALAH 1GSKA 4D0BA 5ABZA 1BBDH 4G8FA 1GGIH 2ZKYA 5FGCE 1PKQA 2VDMB 4PB0L 4AIZA 5FB8B 2ED8A 3MTRA 4YEFA 4IBSA 1ZHBA 4L8CA 2K7PA 5CCKL 5I1AA 2VDRH 2CNZA 2VW4A 1BVKB 4HGKC 4P5RA 3MRGA 3OKYA 4P46B 4JPKL 1X9QA 3EBAA 5GQBA 1ZS8A 3T4AA 1RU9L 4K2UL 3BEVA 4PJFB 4N2HA 1Z5YD 5EZJB 3OJDA 4ZMWA 2OQJA 4QD2E 3WBDA 1G43A 4APQD 2OZNA 4P5SA 1OP3K 4TVSa 1NCNA 2NZIA 5J13C 1NBVH 2XZCH 4X98A 3DO4A 3KBEA 5MEOB 2E7LA 2A77L 4L0ZA 4TUKH 2W0LA 1J8HA 3QR1A 4Y5XC 2YQ2A 1A6AB 1M2VB 3QG6A 2PTTB 2C1PA 1F42A 5AW8B 2BP5M 5EU6D 1QABA 2OLDA 3FUKA 5FLUA 4GRLD 3VGHA 4N0UA 4O2FA 3BH8A 3LKNB 2WQXA 1GW6A 1I7UB 4MFHA 4QRRA 3CSTA 1VGKB 4NKMA 1EV2E 2JWYA 4HOXA 5BVJB 1A7NL 1JRHL 3T6ZA 3LEXB 2CO4A 4PR5B 3IFOB 4NWUH 2P28B 2F1AA 3DMMB 2Z34A 4XC3H 1CDBA 5HDLA 1MPAH 3RY6A 4HMCA 2OBGA 3WO4C 1DL7H 4Q6IA 3DTUB 4Y4KB 4S0TD 4LU5H 3OKEB 4HF5L 3FO1A 4E9YA 3K6OA 2Q7AA 1FVEB 3MRRB 4LRNH 5LG1A 3ISYA 4JANA 5EOCJ 1GAFH 3KLLA 4QT5A 4ZO6A 3M1CA 3EO0B 3ABMB 3IJEB 2EEAA 2V2XA 2VSKB 2F5AH 4WNJA 4Z1PA 3CH1B 5EZOH 3ZHDA 2YD7A 4LB8A 2HUHA 2YPLB 2Z7ZA 4MWFB 4PCYA 5SWSD 4Q4IA 5L9DL 5C0JB 1R3IH 2RJMA 3VGDA 5C2BH 3LX9A 2P8MA 5DJDA 2VXUL 4YUEL 2O5ZH 2XG5B 1QRND 3C6LC 2VH5H 2VLKD 4CNIA 1EDYA 2YMTA 1WZ1H 1G7LA 2LAAA 3V55A 1ORSB 1YMHA 2XBDA 43C9B 1HVXA 2N56A 1YNTF 2EIBA 1EERB 1CF8H 2V0AA 4NQTA 5DZJA 3VFGL 1G84A 2VE6A 3B2MA 4M43H 1JVLA 3BSZL 3DTXB 3X14B 4Z8FL 3HNVL 1B4JL 1NUGA 1S7SA 3TH4T 2CUHA 3GRBA 4R7XA 4Y4HC 4ZUUA 1BIIA 3T0EC 5IFJB 3FL7A 4GUQA 4P59L 1DQQB 3WUWG 1IIIA 5PAZA 3RGVB 1MF2L 4JQVA 3PXLA 3HS8A 1IFRA 2DF3A 2FWSA 3CX5K 4KJQD 3ZT6A 1AY1L 2ZAIA 2I9LA 3OB0K 3KPMA 4HLZG 4UU9A 5AYUL 2KDYA 1DO5A 2LTQC 3E6HB 3G5YA 3P4NB 4K23L 4UT7L 5FW6A 4TPRL 3WKYA 2RGSA 4CDGC 3RB7A 4KXDA 1NSNL 3KS0J 3CU1A 3VFPA 5BW7C 2BVQB 3NCJH 5AOKA 2YXFA 3QQDB 1ZLWK 3WN5A 4WNQB 1TT6A 1HK6A 4XOEA 3MDJA 3ABLB 3OM3B 4TUOA 4DP8X 5E1HB 3B5GA 3CG8A 4GKOA 1OCWL 5E70A 4LEEA 4ADJA 3RX8A 1JHLL 1YJDH 1FGNL 4UDTA 1AGFA 1PIFA 3K91A 3RG1C 2CBPA 2BOBB 4NQXA 4AIXA 4YHLH 2Y7QB 2YOAA 4GBXA 3H6AA 5J57B 1RIHL 5B39G 1TO5A 4LLUB 5ESAB 1DSFH 1J05B 4M93B 1MIEH 2J55A 5JQ6H 1NANI 5C0CB 4MCMA 3AQZA 3D25A 1KCBA 3WENA 3CH8A 4U1GC 4OGAC 3QDJD 1UJTA 3S88H 3W9EB 1A14H 5I71C 2H6UA 5LN8A 4HJGB 1KGYE 1QA9B 3HHRB 4IOFC 1DCEA 1ECYA 3H54A 4JPVL 2VXSL 1DJYA 5L6YH 2AANA 4JZJA 2CJSA 3BD3A 4I5BA 2UY7B 1KGUA 2OSXA 2EEXA 1KIUA 4GRWE 4K7PX 1QLRB 2KMWA 4KOCA 4NBXB 1X5MA 4QO1A 1KPRA 5D7LA 2IXQB 1DQDL 2KDGA 1MHHA 4DKEH 2DJMA 3IXTB 3LY6A 1KFGA 3OXRA 3HS0B 1IZJA 3JWNE 1Z9LA 3C2SA 3V95A 4LEOA 3DRQA 1FIGL 3GBLA 4LRIA 1OKEA 2E7CA 3APFA 3IVKA 3PDGA 1EGJL 1JGDB 4WO4B 5C8JA 1UD5A 3PE9A 4UT9L 5BO4A 4N0FB 4D7BA 5CD3A 1CD1A 3AVEA 1JJUA 2HX8A 4DGVH 3QRFM 2UUDH 3GIVA 1RZ7L 3NZHL 1SF5A 3ZHFA 2BRQA 3FNKA 2EDBA 3U0WL 2HFGH 3SDDA 3WNLA 4XNDA 1JNLH 3EFDL 5LKNA 3T6WA 1DANU 1SDDB 3QEGH 5D70L 1C12A 2R2CA 1E4WH 4Z7OF 3H3PH 3ATBA 4GQQA 3MXWH 4HISA 1OGAA 4OJDH 1A47A 1U92B 1WDAA 2E9JA 2V9UA 4HBQA 5TGBB 4LBAA 2NQDA 5FYKD 4RAUA 1NIFA 1KTLA 2GJ6D 3UBHA 1KB5L 3X3GL 3JT0A 1XZWA 2DQFB 3K1KC 4OGYH 5GZOC 3WXVL 3QEUA 3HAEA 1U0QA 4DGYH 3VA6A 4ZMTA 2TRYA 5EIQA 2OXGA 3PP4H 2ZG1A 2XDHA 1KBVA 3RJQB 5H8DA 4OLEA 3ME0A 2XTSA 5LCVL 1KLFA 3L3JA 3MBEA 4UILL 1YEGH 4BV1A 4XP9L 2VOTA 4AYEC 1FZJB 3SKNA 6TAAA 3RWHB 3NP4A 4QDGA 4U33A 5TE4L 3PREA 3A4EA 3D18A 4HOWA 3EYSH 1F8TH 1GGBL 4HPOH 3FQRB 1DEEA 4TUJA 2VO8A 1P5UB 4EQ3A 2X4NA 4BFFA 3RL1A 1LL1A 4WHCA 4WU7B 3UTTB 4JVUA 5DVMA 5KS9A 2FNWA 1ACYL 4ZOAA 1BYOA 1JVKA 1ZSDB 1TOXA 1TZGL 5C0FB 1JHTA 5IJDC 3V0GA 2QFPA 3ECUA 2O4EA 1C16B 1N2RB 4N5UA 3IEAA 3EFOA 3AW5A 1G9HA 4HFWA 3IKKA 4O4YL 4HIPA 5KOMC 1CIDA 2WSPA 2X70A 1AR1B 3GSVA 3BPCB 1JNNL 5IHZB 1K85A 5F1SA 1P4LB 4GRWH 5FGCB 4F9PC 3WTXA 1YYML 4FNSA 3DARA 2GTQA 2X28A 3C5SA 1MWAA 2FLBT 2X05A 3SPIA 1E8XA 2PCXA 3WELA 4IS6B 3MO1B 1JDAA 4R4BB 2E7BA 3JWNH 4YGAB 3PFUA 1FAKT 1QFUL 1M3JA 5I6LA 4YHYC 4AQEB 3IDIB 4PN6A 1BFVH 3JQOB 3O6LH 5LAPA 2HT3D 4G59C 2FK9A 3OG4B 3D4YA 1BJMA 3K5SA 1BAWA 3E9UA 4HQQL 1O0VA 1MFCH 3AS0A 3NACL 4MA3A 4AVIA 5FHAH 1U3NA 3P9LA 4A7GF 1N6QH 4XCFH 5JZ7C 1EUTA 4BK8A 1NMCB 4PCKA 4L0PB 1CU4L 4XP4L 25C8H 4Z3HA 2JQMA 2XY2A 1DUYB 3L3HB 3N0PB 2Z3FA 1MVYA 4MAYB 3ESPA 1XIWD 4PUBH 4QY8A 1DDTA 1E90A 1KT2B 1OF0A 2X2IA 3MTXA 2FEDD 5D1ZD 3X12A 2VDLL 2R69L 5LXGL 2NY6C 1U8LA 3V9FA 2CA3A 4GB9A 3OKOB 3VD2A 1GKOA 4X7DC 1ZCRA 1U58A 2FJHB 5CEYB 3WE6A 4C54A 1G6VK 2OV0A 3FCGA 3BE1H 4QRQA 1N9PA 1LK2B 1X5GA 1WSST 3F62A 4HEME 4IKKA 1ZVSA 4N6RA 5BZDB 4YXLH 3QXVA 1A3ZA 2G60H 1YEKH 2IV9A 3KYAA 4D3CL 4DF9A 1GL4B 3HZYA 2I85A 1SM3L 2JIXA 2YAFA 3RVWC 2ARJA 3V0FA 4AQ1C 1I3VA 4P4KB 1AQ8A 1J5CA 1MDTA 2X6BA 1PYWA 5I1HL 4XBGA 4JLRB 3PAVA 4NIYE 1A25A 4F9LC 4U6TA 5ITBL 5EO9A 2F8XC 5I1DB 3DX8B 5CUSL 1BEYH 2C9QA 5KG9B 2X3AA 1AZUA 4O9HH 1KJMB 3DYOA 1VKXA 2J8UA 3SCMD 2QTEA 4EIZC 3TT3H 1W16A 5J11B 3TPUA 4OZIE 2YZ1A 4XCYA 4U2YA 3KWVA 3VI3F 2HVKA 4FZ8H 2A9NL 3N0AA 2YD2A 3FPYA 4APXB 4AY0A 3IWVA 5CLZA 2XTJD 5EBWB 3AY2A 1WF5A 1AP2A 2E76C 3HTLX 5DWUL 5EO0B 4RGMC 5K9KA 3W11C 5K9OB 2H3KA 5IBTH 5ERWA 4KNQA 1SQMA 2F5BL 2JCCF 1NCWH 2DIJA 1T7WA 2H6PB 3V4PH 3OPZL 2FSEB 1NGZB 4FFVD 1KJ3L 4G42A 4JQXC 1NPJA 1OK0A 1OT4A 3SGDH 4AEIH 4XMUA 2YAEA 4XX1E 3U2SB 3IXAB 5D4JA 2FTAA 5J6GB 4E9RA 4UZUA 4TUUA 1RZFH 3WUZA 3QARA 2VMEA 5CN1A 4YHIA 1MCJA 1AXSA 4JDVA 1KBGH 1A7PH 4XNYH 5SX5K 4AQ8C 1L7TL 2K78A 3WS6C 4G6FD 5DJZA 3TV3L 3MUGB 2ITCA 1ML0A 2AVGA 4MMXB 3OLGA 5FO2A 1MKFA 2B39A 1KENL 2X4TA 4OGXL 2H32A 5C0DA 3V7AE 2DDQH 1E67A 3BZEA 3APMA 3SYOA 3UYRL 1KV7A 3BRFA 4FI7A 1DQKA 1GKEA 2GJZB 4CU8A 4H0IA 3DOHA 4L8BB 3J27A 4WZ9A 1A7RL 4P2CG 2EDLA 1WBZA 4XE5B 1QW8A 2BIMA 1F4XL 3DVNB 1I1FA 4G6JH 1JZEA 4I18C 4L3CA 3PV7A 5DHVB 4EI0A 1FSKB 1M1SA 4LCCA 2F74A 2F8OA 3BVUA 3UO8B 5IQMA 4MJIA 3SQRA 1CURA 2JB5L 2XIBA 2YIHA 4B9FA 1SXSA 1I1YB 2O6CA 4XVUD 4X6DE 2ROXA 1LE9B 4UQEA 4GRWB 4CJ1A 2YRBA 4JEGB 4HMEA 4TQEH 1T2QL 2N1KA 5EOQL 2CIKA 3FB5B 4DO5A 3PGCB 4XMWA 1T2JA 3QORD 3QZNA 3FYEB 4JFED 4LO9A 3EJTA 5DMYA 5DEGB 4N2LA 5GS0C 5KTEL 5T1LD 4EI5B 1U8PB 4K7PY 2X7LA 4U3XA 3LN4A 4JG1H 5HD8C 1N5AA 4PP1C 4WQOA 3PPSA 1BM3H 2E9IA 1A3QA 4HIIB 3IPBA 3DVFA 5DVKA 1S2EA 1NKGA 2NTFA 2FECI 4OFYA 3NJJA 4OTXH 3LXBA 2KERA 4OVUA 4KQ3H 4ZMAT 4I9WE 3MRLA 4JAMB 3V6OC 2JI3A 4WW1B 3TBWB 4XAKD 4IEFB 3B8SA 2DV6A 1GC1H 2D31B 1IAOB 2IALA 3LMJL 5DZNA 4UOW0 5B38B 5IT2H 3EAKA 3VVVA 5HDBF 3QQXA 2FGWL 2D3VA 2I60H 5KYWA 3HG1A 2IGFL 5MHSD 3VAEA 3NAAH 2CHDA 2YA0A 5L0QB 5DSCB 3T1FB 2X88A 1FORH 1MFAL 3AY4A 3F7KA 5CBEA 4QHNA 1GGCH 3T8MA 4F5CE 4PJ7F 4H13C 1DLFL 3O3UN 5E00B 5D2NC 4L4TA 3MGTA 3C6SB 6PCYA 1XGTA 2MOQA 4B9JA 3D0VA 2XN1A 3FQUA 1SGKA 3AM8C 2UY6B 4N8VB 5AKSA 2Y06L 5CHNB 1BLIA 3P4MB 5K5YA 1Y6NR 2OMWA 4JFZH 3FTZA 3MRHA 4G6KL 4A7VA 3FU7B 4P2RA 2W38A 1MUJB 3RTQB 15C8H 4OZGA 3ZYIA 3VQ1C 4NKIL 1U8MB 4M5YH 3O3DB 5IREA 2DKUA 4F15B 2JJUA 3CVHB 2BMKA 2R7EB 4KRLB 3M1BA 1VHPA 3FFCE 5EF3A 1ZTXL 4CADA 4LASH 4KKAC 1T6VN 2NDFA 4ZMNA 1KLGB 3RWFB 1CYGA 1EUUA 4OI8A 4DZ8B 2RBLA 5D1XC 3CC5B 3KJ4B 3WEAA 3NZUA 3RDTB 3UACA 2A5UA 5EDSA 3UTPD 4D9LH 3VD9A 3SGJA 4OZ4A 3VI4F 2OMBA 3E3QE 4L4VD 1KGXA 1A9BA 3QUZB 3UPAA 1TYRA 4WKZB 3FK3A 1IVLA 3RILA 4KPHL 3IFPA 1UCTA 1EMTL 4MYWB 5IHUH 3EJCA 4GINA 1OT2A 1Z5LA 2LU5A 3TU6A 3RLSA 3UIZA 5BMFL 1G1YA 2HPOA 2YQGA 3G6JA 3LHPL 5KYYB 1HXKA 1T03H 1RULL 2P5EA 5TH2A 3GEFA 1LO0L 1H3VA 1KTJA 4XXDA 1DBBH 3IJYB 3V4PB 1F0LA 4HCFA 4ES8A 3ZKNC 1WCBB 2EH8L 5FYJH 4Z3IA 5K33A 4CU7A 4KTGA 3BPOC 2WXHA 1T5KA 1MREL 3NSYA 1UT2A 2BC4A 1B88A 1SJHA 3OV6A 4Y4HD 2CKBH 5IROA 3T0ED 4ZXBB 4DKFH 3DUUA 4TXVB 4HXBH 5BVPL 1WBYA 2A6KA 1RY7B 4KKLC 3K6SA 3LXAA 4AMKH 2FD6L 3GSNA 5SV3A 5KSBF 2DS4A 1BD2D 2ADIA 1BZDA 2H0EA 4G5ZH 5TFSH 5DC9B 1RAMA 3BP4A 3GM0A 4R0LA 3HR6A 3QHFH 4WW2C 4IDLA 4JZOB 5DYOB 5DC2A 4JE4B 3AAZA 4E0RA 4ODWB 1LEIA 5BV7H 1FNSH 3NFPA 4C4KT 4M5TA 5D93B 5SWQB 3DKHA 2AZUA 5FUCC 3F2LA 3AQXA 3GSXB 3NIFF 4U6HA 4EUPH 3C87A 4NPYA 4XE0A 4NNXB 2EACA 4P23A 4Y9FA 1U93B 4TL4A 2YFNA 3QJQB 1SXBA 2BNQA 2EDNA 4KJYA 3ZBMA 4FHKA 5FHBL 2YKLH 1EDQA 4LSUH 2W9EL 2Z91A 2WYHA 3CFCH 1V3JA 5DQ9B 2EDDA 4FQXD 1I4FA 4OGAD 1KCVH 1INEL 2YK1L 2NLJB 1YUKB 3WFZA 4IOFD 4E2OA 1HH9A 4YNYA 2VZOA 3QO0B 4RMBA 4ZNEA 4LF3B 5TK4A 3GRWL 3MUUA 3ULUC 5I8KL 3QS3A 1WZKA 3NJHA 1WLHA 4D9RE 3QYNA 3PAUA 3EYOB 1A7QL 3NZ8B 3VWKC 4OZIB 4XNZC 3V0AC 3C08L 1ZHLB 5CJQL 5DJXA 2X4OB 3CZSA 3PWPE 1RERA 3ECBB 3CN3A 4W9JC 3T2NH 1BVNP 1N68A 5KVEE 4YDVB 2VUKA 3EJSA 3QA3A 5E5UB 3SGEI 3HNSL 3TIEA 4WCYL 1FL3A 3KZ8A 1MFBH 3ZTDC 2ITDB 4PJHE 2F08A 4QNPE 3H2PA 2IBBA 4XXWC 5JOFA 5LHDA 2YXVA 4M1GL 4DVRH 2WIIB 3RRQA 2J56A 5AZ2L 4ZAKC 2WWKT 1P5VB 2X4PA 5AG8A 2CR3A 1MDAA 4ZDHA 2OA9A 1USQA 2GCYB 4AK2A 2XWJB 2X41A 3MUHL 4FD0A 4LQFH 1QEXA 4FI8A 3MOBL 4YBQC 3A6CL 4HKBA 4W9KC 3ARDB 3M46A 5D71L 1QLEB 4HDIB 5IV2B 4DGUA 2NY1B 1OAUH 2FX8H 2DQJL 1Y0LA 1TSRA 3IDYB 1ECZA 4FMKA 2OTUB 5JXEA 5GZOD 3FONB 3FMGH 3HPJB 2XACC 3A47A 3V52H 2CO6A 2DM2A 2ICCA 2AXFB 4HUVA 4M7KH 1TQCB 1QFWH 5KJRL 4U1LB 4N0YH 1PCSA 2WYIA 4ZFGL 3UL4A 5CGYC 1KIQA 1QAWA 1XR8B 3GPSA 1ZT7B 3OPUA 4GSQA 1CVRA 1FP5A 4OLUL 2M83A 3PLYA 4B0MB 1YC7A 3DBXA 4MCYB 5HGDB 5HJDA 4E41A 4R3SB 3D9AH 3O9WA 4GP8B 1TQVA 4V1DA 2C3WA 2R1WA 1D9KC 1MCLA 1GZPB 2ICWA 4JDTL 4KK9C 1CFMA 4S1QH 5L2KA 1NM9A 3EGSB 4JHWL 2ISDA 1HOEA