4B95C

Pvhl-elob-elob-eloc complex_(2s,4r)-1-(2-chlorophenyl)carbonyl-n-[(4-chlorophenyl)methyl]-4-oxidanyl-pyrrolidine-2-carboxamide bound
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
134
Chain Sequence
VLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small-Molecule Inhibitors of the Interaction between the E3 Ligase Vhl and Hif1Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
total genus 31
structure length 134
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4b95C02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4b95C01
1VCBC 4W9FC 4AWJC 4W9CC 4W9EC 4W9GC 4B9KC 5LLIC 4W9KC 4BKTC 4WQOA 3ZUNC 3ZTDC 3ZRFC 4BKSC 3ZTCC 1LM8V 1LQBC 4AJYV 4W9LC 4W9DC 4W9HC 4W9JC 3ZRCC 4B95C 4W9IC
chains in the Genus database with same CATH superfamily
3EFFA 2BERA 4KQ3H 4KNQA 2V37A 4Z0BH 1T5WA 2L7UA 3CLEL 5ESVB 1I7ZA 1IAOB 5DMKB 3EOBA 1HYSC 1N8OE 4MAUL 1IKFL 2VNCA 3O41B 4PWHA 1TVHB 1INQA 3K6IA 5B38G 4KKPA 4RIRB 4EIBA 5E1AA 4YDJB 1GAFH 4AQZA 5A2FA 1C5BH 1BQSA 2BX5A 5CJXA 3MREB 4CC1A 3MODL 1K3ZA 4FC3E 3GHEL 4L8DA 3NABL 5EO9B 3THML 1OANA 1N4XH 1A1NA 5EZLB 1F2QA 1YDPA 4TLTA 5DZ9A 1WS8A 2WXMA 3M8OL 1C5DA 3IYLW 4XPBL 4YDMA 3LKNA 5K9OA 3W5NA 3GSUA 1DBKL 2XWTA 3IDNA 5DRNB 2PW1B 3EOAA 1HHHA 4K23H 2R2HB 2YUVA 4U7KA 4J7RA 3V10A 2WCSA 4EIGB 4GS7C 2EDXA 3PDGA 5F3BB 2B9AA 5MI0B 3MLRH 4HG4J 4QXWA 2H8PB 4MSWA 1U8PB 4F8TA 1U8PA 4OZIE 1GC1L 1NANH 3FYIB 1E2VA 2XV3A 4NQTA 1P4UA 3GJEB 4TKWA 3MRHB 4JZOA 3FQNB 3QDGE 4AEEA 1IE5A 5J1AA 1LEKA 4GQRA 2GJRA 4NUPA 2G9HB 1PVHA 5FA4B 4HGWA 3BSGA 4PWKA 2EZ0C 4NHUB 1ZT4B 4AIOA 2WO3B 5C0BD 1TVBB 5B3SB 3NEEA 5DZVA 4PYHA 5JPNA 4IK6A 4MAYB 5E6YA 4ZG1A 3KG5A 1HJCA 5AB0A 1V7NL 1WT5A 2CU9A 3IJYB 5I1DA 3PWPA 3GI8H 4G7RB 4N0UA 4Y1SA 4H25A 1KN4H 2YS4A 3T0EA 2ZUQC 2C26A 1F3JA 2HSIA 3QVAA 4WHTB 4L18A 1R34A 2WBWB 3IFLH 4I18A 2Y1VA 2VUYA 4NXSA 5C08B 4I87A 1MH5B 4N9OB 3SY0B 5FHBH 3JWNE 1SOXA 2OULB 5T3XH 1AQDB 1NBVL 1CE1H 2CCVA 3WAKA 1JV5B 4N4YB 2WQAA 4NOBA 3UTQA 5IROA 5DJ8B 1BF5A 1OOAA 5I0WA 2JSFA 2WXGA 2VERA 2ZAIA 2Q8AL 2BHFA 3SGKA 3RZCA 1F00I 1EZVX 1FNEB 1JRHH 3N41F 4X4KA 3JVFC 4NNPH 1KZYA 4S0HA 3U2IA 3HZVA 2VM9A 4BZYA 2CJ3A 3BW9B 3QNXA 2DQTL 3WEMA 2YBRB 1DVFD 2DD8L 1HL4A 4GXFA 4XPTH 2QPSA 1RZIB 4U3HA 5I0DA 2JXMB 3NAAH 3FO2B 5DF0A 2WO4A 4FFYL 1CDBA 2VZ3A 5EU5A 2UZIL 3VXMD 1AD9A 1Y07A 3GSNL 1GYAA 4QRSB 2R1XB 1EHNA 3ULUL 4K8RD 1VLXA 4L3EE 5BZWB 3IVKB 4PRID 2OCCB 1D5BA 4W9HC 1G6RL 5I1GL 4TLUA 1O75A 5ID1B 4ILDA 1QRNA 3DX1A 3MRNA 3L7FB 4W9CC 3F7KA 3N91A 2GUYA 5CSGA 2X4RB 4MJHA 2GCYB 2C5DC 3UZEC 5D1XB 5LKNA 2A5UA 3CFMA 2D3JA 5BZDA 3RGBA 1T6BX 5HJ3A 4M6NL 4N8UA 5ICXB 3NSYA 4HCGA 3NSDA 2GHWB 3QDJD 3SE9L 1AR1B 3T04D 2E4FA 4ZUWA 5LDSA 4A1RA 4K3JL 4F2MB 1ODUA 1OP5H 2EC9U 4NSKA 3FK3A 4QO1A 2OX5A 4NZRL 1YRKA 1TZHB 4OJCA 1GY1A 2YUZA 1LP9B 3P9LA 5D1XE 3NBNA 3B8SA 5IEKB 2IWFA 4XCYA 5TH2A 5I1IL 3N0AA 2YXMA 3CC1A 3D0LB 4YBLC 5EIVA 2G60H 1TMQA 2WNKA 4RX4D 5C0AE 1X7QB 1THCA 1MQKH 12E8H 3BPOB 1IM3B 3SBPA 3BUYA 4CGTA 5KBMA 4IOFD 1A0QH 1P9MA 1KBGL 5GQBA 2F53E 3HG0A 2A0LD 1YN7B 4FXGB 1BCIA 4R9HA 4AJ0A 4N28A 3ML8A 4KTEH 3F05A 3AUWB 4MYWB 4QTIL 3GMPA 4KXCA 4OT1L 4PLKC 4X8GA 5C09E 1U3YA 2FX7L 4LSRH 1N6QH 5AKRA 3VH8B 3S5YA 3KLSA 5CUSL 1CGVA 2AP2A 3PV6A 4PRHB 3SYPA 1WIPA 1J9TA 1R5VB 2JB6A 3K8KA 1PMYA 4RGND 3U83A 3UO1H 1A4JB 3P0VL 4P3DA 5HHVL 2Q7AA 3EGDB 4GLRI 5C09B 2VQ1B 4Z76A 3B37A 4XO3A 4JFHD 1LD9A 1P4IH 4H0GA 3LDBC 1E4HA 4DUXA 3ZDXF 2EDKA 1II4E 1QNZH 4P3WA 4R7XA 3W9DB 1U6AH 5CBEB 1LK2B 5I0VA 1NIBA 4G9FD 1QSED 3Q2LA 4P5KB 1PG7X 1FRGH 1MNUH 3T4YA 3SQOH 1NSNH 1KTCA 4KX9A 4MMYB 4NDMA 2BVOA 2EDFA 1SEQL 3G9AB 2G5RA 4YQXH 5IJDC 3A5VA 3VFSA 2ITFA 2AXFB 1VGKA 3HG2A 3MGAA 1AI1H 3P30H 2P8PA 3O3DB 4KRPD 1JMZA 2NY0C 4YBHA 1S3KH 3S88H 5GS0L 1DDHA 1IL1B 2SEBA 4H8QA 3U30B 4AJVA 1AKPA 4QKTA 3V4PL 1KCVH 1EXGA 5C0BA 4LSQL 2WXRA 3L8QA 3FU8A 3WY4A 2BCMA 1EAPA 2ZPKL 1FFTB 1KXHA 2MOVA 1KXVC 5KSBF 2RACA 1OD7A 1ED3B 4PJBB 4U1NB 3ZIMA 1I1FB 3GPEA 3U7AA 3WCYA 2XIBA 1OHZA 3HBZA 1ACXA 2IWKA 5AALA 2QSTA 5HDRA 1OGAA 5DS2A 3O3BB 5JIKA 4F9LC 2Z7WA 4QCIB 4LLDB 3HG1D 3A24A 2IDQA 4N25A 1XX9C 4TULH 4RMSA 4NCC1 1NJ9B 3V6ZA 2WBJB 4N8VG 3KWWA 4JPKL 1GOFA 1N64H 1CXIA 3KYKH 1JHTA 5ERWB 2AVFA 3RVUD 4GBXD 2DWEA 3ULVF 2XI9A 1F45A 3MHZA 4JFOA 4MJ4A 1QTYT 3LNEA 1X5ZA 3MRBA 4LIQH 3VXUD 2VIRB 1PGRB 3R06A 1UD5A 4M5ZL 1M71B 1NC4B 1PG7H 4Q9BA 5DQ9B 1RHHA 4LEOB 3EYQC 4DP4X 4Q9CA 1OO2A 1QNZL 2ADJB 4C56D 4OF0A 3P3SA 3O11A 1J8SA 3LD8B 1WBZA 4JKKA 2WAHA 3VI3E 1IQWL 4G9FE 1RIHL 2X42A 3CLFH 3OXSB 4K5OA 1C8QA 3F64A 3FO0H 3N1FC 2O72A 4X80H 4QJ5B 1PYWB 3QIBB 4W9FC 5HDBB 3CQFA 2JJVA 3L3IA 4X8CA 1RFDH 2MOQA 4QNPE 5GRYA 3NCBB 3MLZL 1VPOL 1Y6MR 4HHAA 2NYYD 4MA3A 5KYXB 2MCG1 3VA2C 5FYJE 3PL6C 4I0CC 3QIUA 1U8IA 4U31A 4KZEL 1MY7A 3VVVA 4LRIC 4RGNE 3RNKB 4X83A 5E2VH 1L9NA 4HETA 3QFGA 3ULSA 2X3AA 4XPGL 3UYPA 3VG9B 2EDYA 1QA9A 3JV6A 1ZTXH 4Z7QB 2HN7A 5L0QB 4ZUUB 2BC4B 1S7RA 4DGIH 1HAWA 3CBJB 5KBNC 3B2UD 2I27N 4C4KT 1EXHA 3SDAB 1NFKA 1BFSA 1MCNA 1FO0A 4GIPD 4FJYA 1NCBL 1N26A 4I48B 4KPHH 3SDAC 4BQ9A 3O2WL 1IIIA 4M3JA 1TCRB 4M5ZH 3V4VL 2D7PA 1IQDA 5GS1A 3W0WA 2Y1YA 2QQKL 2XWEA 3QIBD 3AS0A 3DNKA 2OW6A 3IKCA 2F08A 4YH6A 2Z91B 2W5PA 4FNTA 1CXEA 5D2LA 4MS8D 4RESB 4ZUUA 1BVLA 3O3UN 4AGNA 5E9DA 3QIWA 4OM0L 1MW2A 2YGNA 5DVNA 5B4MD 4AQEA 3GLZA 4BH7B 1A47A 1F2XK 2VXVH 3DVNB 3N85L 1XF2A 3GS7A 4WCYH 4UQ2B 5KN5B 1FBIH 5ILTH 2Z93A 3NJGA 3F6JA 4OZHE 1KLFA 4OZHA 1FNFA 4JQXC 3SQBB 3SQBA 3ULVC 3PL6B 4CKQA 1UGKA 3QR1A 1DQML 2IAND 4WV1B 4ZNEA 3QUMH 3CDYA 2J1XA 5ACZB 2HT2D 35C8L 5DJ2A 4L9DA 4LCVA 4QRPD 4H20L 3WFHA 2YEQA 5B3JF 3Q8AA 5EZOL 1BA9A 4XO9A 1WUZA 2Y24A 3KLAB 1QBML 5SWQA 4EF3A 2IBZY 3DETD 2FDBP 2CJUL 1UH4A 1X6NA 3WUWA 4AI7A 2VDPL 1UXWB 4HIHB 1AHKA 1OF2A 4XPHL 3S8WA 3WEAA 2AJVH 3ARFB 5IB2A 3TFKC 4BFJA 1IGCH 1A1OB 1LE5B 2HUEA 4NM4H 5CILL 3BI9X 4PJ8B 1FCCA 3OKOB 5DVKA 1JFQH 3QFJA 4JKPL 4OVVA 5I74C 2VW7A 1S9YB 1PZUB 3VRLE 5GISL 2GC4C 4KVCH 5GZNC 1J1XH 1E6JH 1O9ZA 2CHXA 2P42B 2Z8SA 3DXAD 3ZKXC 3UAAA 3MCKB 1MOEA 4TNEA 4S1QL 4TSAH 3DECA 1LE5A 5BQ7B 3QT2A 1GGCH 3D18A 4ZQKB 1DO5A 3MVSA 4KDVA 1T6VN 4XBMA 1YYCA 2R2BA 1MCCA 1QRKA 2K6YA 3C09B 3R19A 4KK8D 4POUB 4J6RH 3JWDH 3UTPD 4BK5C 3KBEA 3HNSH 2VZOA 3H3BC 1VCBC 1M2VA 3IMVA 1KCVL 1KPVB 3SE3A 4XBEH 1D2OA 3PWVA 5DA4A 3MLSH 3GKWH 1GMEA 2MPAH 3H56A 4NKIH 4LPVA 5B1BB 5T1DH 4F9PA 5KVEL 3WTXA 1QPPA 1YMHA 1S7UA 1HL5A 4IBZA 1DQMH 4KBPA 4DEUA 5C09D 3UZQB 4OLXH 5F3HB 4F5CA 2HFTA 5JW5B 4G5ZH 1GYUA 3ZDYF 5FYKL 3OV6A 2XFGB 3BP4A 1UOWA 3F65A 3MBED 4LLYA 1X3DA 1J1OL 5DUML 1NL0L 5SWSD 3WENA 3BMWA 4OCYH 4Z7AA 4NNYA 3MXWH 4XAWH 1TU2A 2NW3A 1DQTA 4U05A 5HGBB 2J71A 2QSCH 3FB8A 1RHHB 3EYUL 3TH4T 3PWUB 3H2PA 4NKDB 1AQMA 3IFLL 3K5RA 3ARFC 1NGYA 1ULVA 4KQ3L 5I6PA 2F54E 1UXLA 2CDFA 2CDFB 3KGTA 3I02B 5B8CA 4B7LA 3MRLB 3ABKB 4PWJA 1F1DA 2VQ4A 4KVCL 4V1DD 1KPRB 3QUGA 3BKMH 3VXSA 4QR7A 2DTSA 4H26A 4QRRE 1RLWA 1BQHG 4MKTA 2QTVA 2ENYA 3MI6A 1RIVL 4X4ME 5LLIC 4PJ9C 3NSCA 3E6HB 2UZXA 4MJ6A 4L4TA 1FVDB 2VM3A 2W65A 2BSCA 1A6PA 4HS8H 4UTBH 2XTJE 5F6IB 5EN2B 1DTUA 3WY3A 3KYAA 4PMFA 3G6JE 3ZKND 4IBYA 1DFBH 1U8HB 4AYSA 1U8HA 2HLAB 2KUTA 5CSZA 1QA9B 5E2VL 3DV6B 4ZAKC 1X9UA 2GTWB 2BNRE 2WAQA 1SHXA 2JELL 2VLRB 1EDHA 2OR9H 4ONOA 3KLQA 4NQCD 1U8IB 5JIIA 4YHZH 4I1PA 2X4UA 3RWIA 1IC5H 4WWKA 1ORQB 2AV1A 1UACL 1BD2E 5E51A 5IGXL 4OZ4B 1Q4NX 4XN7A 2BW5A 2EXWC 4I3RL 1RHFA 1HHIB 3D69B 3NPSC 5IMOB 4HBQA 4XAWL 3RVTC 4HEMA 2FECI 1PDKB 1DJIA 1XB8A 4F7EA 2Y7SA 3AY4A 2VDNL 4G3YH 1A3LL 2VLKD 2X53A 2ZCKH 3QJQB 3NCYS 3UJTH 5DD1L 5BO0D 4XTRD 3UP6A 1DVSA 1UKQA 2IDTA 4WO0A 4QHUA 2MQCA 2AFNA 5HGBA 7CGTA 2BIIA 1N12A 1QFHA 4YLBA 2HX7A 3LPFA 2DMGA 4BDVA 1QPXA 2R2EA 3ZDYB 4JM2A 4RDBA 1NCJA 5T3XL 2W81C 3AM8A 1NUNB 4U1SB 2C9SA 4DNLA 1U8MA 5GZNA 3NP3A 3HVDA 2NY5L 3EGXB 5FO7B 3ZQ9A 5B3JE 5K1VA 1KXTB 4P9HC 1UQSA 2X9YA 1W8OA 1F8TH 2HTLC 4PS7A 3PGCB 3S36X 3CFKA 4NIYE 2CDEB 4PG2C 4MB1A 2VB5A 3TJHD 2AZUA 1IBDA 4ABWA 1BDYA 1XSKA 2ED6A 2F7QA 2AJSL 4IOSD 3T9WA 3TV3H 5CAYB 4PIRF 5JHAA 3VD1A 3OKMB 3N06B 2PXYB 3WIFB 4H20H 4JFDD 3H9SE 4DFIA 1V3LA 4RMTA 2QQLL 2YWYA 3VI4F 3OXRB 4R2GC 2MNUA 4JO2L 2NLJA 4K5NA 2CO6B 1LO2H 3AADB 1S7QA 2XG4A 4APQC 5IVZB 1C16B 1QLRB 1DVYA 1AO7B 2UZIH 3FU7A 4YHMH 2AK4A 3C6SA 3MA7B 1U58B 1Q9LA 3QZNA 1CB4A 3BKJH 3WTWA 5FKAA 4OLUH 1MIMH 2AJZA 2GTQA 4PTTB 2FZ3A 4E42B 1OLZA 1L9MA 2OS7A 1BQ5A 4LLAA 4E5XB 4ZDHB 2BFVL 4J8RA 3TO4C 1VKXB 5AZUA 2BJML 2XPGA 1PPIA 2HJLB 4RRPM 4XGZA 3SJVA 1RIUL 4NT6B 4HKZB 4GAAA 1SDDB 1VACA 4H0IA 3A0OA 4UAOC 4XPFH 3SKMB 4X4XB 1MAKA 3IDUA 3G7TA 4A6YA 4MLSA 3V0WH 4A68A 5L4IA 2GKIA 4OIAA 5JHBA 4XO5A 3BXNB 4PJDA 4E9QA 4OI9A 1E27A 1TJXA 4Z7WE 5BRZE 2WZ5A 1S4IA 3PP3H 1M7XA 1QX1A 5GGVL 5K39A 3RILA 1T2JA 3SEPA 1CGTA 5F9AC 2KKQA 4GI9A 4G6JH 1YEDB 3QO0B 1PS3A 1JK9A 4IU3B 1NCTA 3ZT6A 3RI5F 1CDGA 1IFGA 3B4NA 2E9IA 2NNCA 4YDIL 2LGNA 4N5ED 4DQOH 2DN7A 3BVNA 3GXMA 1NFIA 1HHHB 3VFVA 3SOBL 4JM0A 1XF2B 5ELIA 4JQVA 3G6DH 4NRXA 3PIQA 2TAAA 2CR3A 1X5YA 5DFVC 3MRGA 5IOKA 3LNGA 5J56B 5JOFB 3KW8A 5SX5K 3UAJA 3WMPA 1GL4B 4N0RA 3MXWL 4ENED 1BQLL 2YN5A 2QZQA 3L7EB 3PAVA 4FQPA 1R3LA 5I15L 3D0LA 3K5SA 3MGTA 4NWUH 5CBAB 4MRCA 1SJHB 4YDJA 4DKTA 2B08A 2AABH 3GMLB 4D0CA 3ROOB 1TZHA 1V10A 2ROXA 1AVAA 2YAMA 1MHEB 3FONB 3QEQD 1AAJA 1LO5A 3TNMA 3Q7JA 4ZUVA 2IGFL 4ZS7L 5HD8D 1B2WL 1IQWH 4MNGB 4MNQD 1RZ8A 3GK8L 5KYYA 5BZZA 1IB5A 5BVJB 2E3VA 1N5AB 3WS3A 1O7SA 3TVMD 4XN4A 3TA3C 1SXCA 5KYNA 3SDYL 3S35H 1CR9L 3ZDXB 5DHYA 5HD8C 3V8CA 1G7JB 4P5TD 5C0RL 1RFDL 4YHLL 1SJVA 2YMOA 5AAPA 5CGYC 2PYFB 4OZIA 3NRPA 1ACYL 4UM8B 4QT5B 2O1AA 4XVJL 4WKXA 2WQRA 1A6AB 4DVBB 1CGYA 4LQFH 4ONGH 4JM2C 5MENA 4EBQH 4ZUSA 5AW3B 3BZEA 1OE2A 2BSTA 1JUFA 3VXRB 2HJFA 3M86A 3OD3A 1UD8A 3E1ZA 3H8NA 3VXQA 4KNUA 3D6GA 3W39B 4Y4HA 4BFNA 3KPMA 5EEWA 5E8NB 3Q13A 3DDGA 2PCYA 2NNRA 2A77H 3V6OC 2N4IA 4DN4L 2EEAA 2F2HA 4HKBA 2FEDD 1CZ8L 4B9IA 2VR7A 3QK0A 4HYTB 1MCOH 2G4EA 3CVIH 4NDMB 4DP6X 4F24A 4OIBA 2VC2H 3P9LB 6PCYA 5IB4B 5LXGL 3KWVA 5E9DB 1J86A 4ZTPL 4LMQI 4Y4HC 2X4TB 1CLOH 2ZX7A 5I8CB 4BQCA 1D5MA 4B53A 1K4DA 4XNBA 4DK3A 4G8GD 3R06B 4KAQL 1V7NH 3TYGH 4WDIB 1FHGA 3O2DL 3AQYA 4MXVE 1LP9F 4GW4B 4O51A 5CCHE 3VUAA 1JF6A 1UTDA 1IIKA 1DVFA 3QDAA 4PD4K 4R8WH 5FYLH 4P2OB 1CFMA 2J8HA 3MLXL 3QNZA 3ZE1B 1AC6A 1UCBH 2R23A 4LPUA 4PJCA 3L2LA 2VDLB 4RGOL 5EU4B 3PJNA 3DGCR 1IGYA 2XXMB 4I48A 1LEIA 3TP4A 4F92B 4FFYA 1FZKB 4Y88A 5K93A 3VH8A 3NUKA 4A38A 3MRMB 4CW1B 1XGZA 4KFZC 2WGNB 1PL3A 4PB9H 4R0LC 3IVKA 3ROLA 3UDWC 3UGXA 1ES0B 5MP6L 4HGWB 4OLYH 3MBEB 4ZX5A 1G6RA 3RX8A 3HAEG 1BZOA 4HOZA 4R4BB 2JIXA 3D51A 5GSVA 5HHOD 5AVWB 3S34L 3NJLA 3F7VB 4LF3A 2GBAA 3ME0B 2NY4C 4YHPA 5D7JB 2FR4A 3ZKXB 4H8HA 4I0PC 4OB5H 5BVPH 5F3BA 4NUMA 3G6JB 2ZP9A 4WSJA 3RZCB 2WINA 2ZG3A 3CDZB 1WEJL 3BWZA 3CVCA 4FNLH 2NXYD 4XNZC 4YGVA 5GGUA 3W0WD 5HYQA 3GSNH 3PNRB 3UPRA 4Y1AD 5H37G 4NM8L 4ZSOA 3ULVH 1PYWA 2FWUA 3DRQA 2Z4QB 4M7ZC 1WCBA 1X5FA 4L23A 1MDTA 4WENB 5MEND 1YC8A 1WP6A 3K4AA 1L9PA 1DEEA 3UAJC 3TYGL 1GJWA 4OUOA 3PS6A 5F3FA 3PQYE 3QJUB 3T0DA 3NZHH 1LO4L 1ZV2A 4LCWD 2K4AA 2C3XA 3NTCL 4X7EC 1MCEA 2WLZA 3VI4B 5CN3A 1INQB 5T5FL 4YSQA 4Y9EA 1WF5A 1PIFA 4XOCA 4OUUB 5IK3B 5DQDH 2B3RA 2WQWA 3ESPA 2RFXB 1DP0A 2OCJA 3DROA 3V55A 3FO9B 2UXGA 1OKEA 2Y06L 3MNZB 4DKDC 3KJ6L 1MW1A 2C9VA 4PRIA 4Z5RB 1L3NA 4GRMA 3TEZA 4G11A 4OR1A 2WHVA 4XVJH 1V5JA 1F4XH 4M00A 1KB9K 4FQLH 1K8IB 2G9HA 1NJ9A 2ATPB 3F7PC 2PF6A 2WKOF 3VCLA 3EH2A 3S97C 5AYQA 3PWJA 2YPLB 3GSWA 2DKUA 2AQPA 2QLYA 2VDMH 2NY2D 2E7MA 3EOTH 3K4DA 4PY7A 2UWEA 5E0FA 1OP3H 3AXIA 2WP3T 1HE8A 1J8HB 4HZLA 4MSWB 3REVA 3S34H 2PTTB 5AUMA 1T20B 4LSDA 3PL6D 2NY4B 3BAJA 3GBLA 5LAXB 1CXLA 1EAPB 3QS3A 1KJ2B 5D71H 1T3FB 4KO6A 5IW6B 4S1DC 2GIYA 3UACA 3GXPA 2VJ8A 4HFUL 5F0MB 3KPTA 4GH7B 5D4HA 4LRNH 3P0YL 4C83A 2QSVA 1QUPA 4FQ2H 3DROB 1E4WH 2MTPA 4JN1H 4PCYA 1E3ZA 1IVLA 2AXFA 5EO9A 2RQ8A 4BELD 1MH5A 3V0HA 4BFRA 1Z9MA 3WIHL 3JWOH 2D73A 2MWCA 4DERA 1MFBH 4NQDD 5HHQA 5DQJB 5KVFH 2DQEL 1F3JB 1GXEA 4R7LA 1AGDB 1BZ7B 4K9EH 3IDMB 5DVPA 1TNNA 1RK1B 5E6UB 3WELA 1XGQA 3MRBB 4IHOB 5TF0A 1RIVH 2FYYA 1YYML 5AOZA 1XVSA 2FO8A 2WW8A 3ZR6A 5LAPA 1MY5A 3TJHC 4YE4H 5KBPA 5LJYH 3BFWA 5G5DB 3V6BR 3DVIA 4JZOB 3SDCB 1X4XA 1FWXA 3AG4B 1F4XL 1C12B 1OSEA 3D25B 4DT2A 4IKKA 1MCSA 2VSDA 1IC4L 3GO1H 2EICA 2R4SH 3GRWA 3TJPA 2AVGA 3W39A 1U92B 4JJHA 4V33A 2Z7UA 4OF8A 2WLJA 2A6JB 2BOBB 4JHZA 4BZ2L 4U6VH 2JKTM 5JHDD 4L5FH 4OV6F 1REIA 5C8JA 2L4OA 1XF3B 3NCEB 2OR9L 3UDWA 3ULAB 1DQLL 1SEBB 2J6EH 1PFOA 2P9RA 3IFOB 4IRZL 2B1AL 3HJ0A 5GGTH 1FJ1A 4ZW8A 3FQUA 2DLTA 1DDHB 2R8SH 2FNWA 2QKSA 2E9WA 1BOGB 5E6RB 3IB4A 1MFAL 2N0MA 2HKHH 1ZPLA 1DL7L 4X5WB 2CALA 3UJTL 5IHUH 4J27A 2A74C 3V5KA 3N2JA 5EIIG 2FB4L 1AZUA 1FGVH 4KMQA 4TVPL 2NZ9D 4Y19B 5IHHA 4S0SD 2ZX5A 4F2MA 4UINL 2X89A 1DEEB 3ZN6A 1BAFH 2OL3A 2JJTC 2H32H 2WWKT 3N1PC 2GC7C 1F11A 1F11B 1RURL 3G5ZB 4IIQC 4ZFQA 4X6EB 5K9KB 3VRLF 1RL1A 4UOZA 5TPWH 4YBQC 3OB0H 2J4WH 1QSFE 1G9NL 5ID0A 1C5BL 3Q5TA 3NGBB 2WVTA 3HLAB 4ZW3A 4PRNB 3MRPA 4LP8A 4WI5A 5I1IH 2GT9A 4HJGB 2EACA 1BQHB 1E4XH 3QQ9C 1DJXA 4PRHA 1GH7A 2UY6B 4KJWD 5GSRB 1SF5A 1UOVA 3RAJH 1TOXA 4WJKB 4L1HA 1E6OH 5L9DH 1G7LB 5D55A 1XH3A 3SODB 3GUFA 3TBYA 5KJRL 3J27A 3G5XB 1ZS8B 4LLQB 1YN7A 4FXGA 4PCKA 3VX1A 2B1OA 4HIEB 1CPUA 2Q10A 2IANA 3LEXB 5IHLB 1ES0A 2WYIA 4G7SB 3WG7B 1F3RB 3DC0A 5IMKB 5DHVH 3PWJB 4HUCA 1FZKA 3DXAE 1H8OA 5E2UH 1LO3H 3D34A 3WN6A 4XMPH 3U1QA 3HLAA 4MDIA 4KVPA 1A14L 1AOHA 5EOQH 4IKJA 1M53A 1W91A 1D5ZA 2CZNA 4YHYC 4HS3A 5KVFL 3FTYA 2ZXWB 1W72B 1DBBL 2QFPA 1HFUA 3I6KA 1XF1A 3KPOA 2N59A 4OFIA 1R75A 1ORSB 3NTCH 2X1PA 1NMBH 1R9FA 1KIRB 1U6AL 4APQB 1TIUA 1Z3RA 4HWEL 3R4DA 4LE8A 1QSFD 2YQ3A 3PNWB 4F7MB 3K91A 2P8LB 1U58A 2CO1A 4EZKA 3PGFH 5EBWA 5HGHB 1MFDH 3ULUF 4PJIF 4BA0A 1SVZA 3U2SA 3IDIA 2ED9A 4MJJA 3C60D 2NY7H 4GQ9L 1DQDL 4IGBB 3MR9B 1YPZF 2ZOUA 2O93L 1CVRA 3GB7A 3DSFL 5DRZA 4GBXA 2VAJA 4YMPA 5CEZE 3F5WB 4MASA 5K1JA 5TQ0H 5E5MA 2O5ZL 3CXFA 2W9EH 3FQXB 3V6FA 5B7FA 2EILB 3GGWB 2QFRA 3Q6FB 4NJAL 3W9EA 2CQVA 2ZWZA 2NY5H 2CO7A 3HMXL 4TN9A 3S5LA 5GGVY 3OWEA 2AMGA 2ZUXA 3DUUA 1A5FL 1H3WM 4LCWA 4WTZA 3X11B 1XCTB 3RVUC 2ZD0A 4LF3B 4Z18A 4XN8A 3L4VA 4QIRA 3POCA 5GRUH 4E41A 3SDCD 5F44A 2MKWA 3CH1B 3DX6B 4EI5D 1ADQA 1CI3M 2UWEE 2DDQL 3IDXL 4GI8A 3MRRA 4GI6A 3P4MA 4GOSA 5CINL 3V4VB 1H19A 3O8XC 2PETA 3GMOA 4DKAA 5C0CA 1FYHB 3STZA 4Q9RL 4DGUA 1QFOA 2OMUB 3JVGA 3O6LL 1GJUA 2Y23A 4PU2A 4FNSA 4U1HA 5ISZD 5AVXB 1WFJA 1UD2A 2JI3A 3FH5A 5LUMA 2ESVE 1FV1B 2BWIA 4PJIA 3SE6A 1U8NB 3MV9B 4A55A 2FWOA 1AG0A 3BC9A 3KBPA 2HVKA 3E6FA 3ZPDA 1M3IA 2HVKB 2WIMA 3GXFA 5BW7A 5FCUL 3MBXH 4HKJA 4HJ1A 1HINH 5I71B 3WXWL 4QRUB 5CZVH 5LGHH 2E7HA 4LKCA 1CE1L 4A37A 4AZ8B 1O7DC 4X0KA 2GJZA 3M7FB 4N0UB 1N59B 4WTXA 3HR5B 4LSTH 5C0RH 4P3CL 1OD9A 3MLTB 2V17H 3C6LB 1QEXA 1NGZB 2FT7A 2CO6A 1UJ3C 4X9IA 2EABA 3SGDH 5EWIL 1AS6A 2CGRH 4IIQA 2I9LA 2VQUA 4TNVF 2OZ4A 5AVVB 2A74B 2AJYL 1QFWM 2HRGA 5JHLL 2PW2A 3L08A 4WU5B 3BIAX 3VM7A 5C9JB 5K1NA 2H3KA 4RAVA 3DIFA 3M07A 1QI4A 4D94A 3N85H 5FGBC 4FG2A 5CJ5A 1QYGH 1VFBA 3GKZA 1XR8B 4JG5A 1WIOA 3NAAL 2D7MA 3VQ1C 3WTSA 2XQYA 3SGKC 1XEUA 4XBPB 1G0XA 2D31B 1QSEE 3IAGC 4D0DA 2L04A 3EDDA 2ATPA 3BPCA 4OLVL 3O4LA 1EZVY 4LBEB 3VFGH 3UTZB 4WTZG 5D7KE 1G7LA 5TE7L 4PJGA 3GFUA 2EDQA 3SKMA 2DB8A 1UWXK 4PHZA 5DRZB 2VWEC 4TNWF 3AUVA 1I8MB 1U2HA 2X70A 5EUKB 4N8CH 1HZHH 4KAQH 1U93B 4EI6B 1NLDH 4NP4H 4OBSA 1U3HA 3PP4H 5FOBB 5HDOA 1Q1JH 3ECWA 3QQXA 3APFA 4UBDC 1WFTA 4DIXA 4F9LA 1ROCA 5K59F 1ND0A 1ZLEA 4TOYH 1OQXA 3IGUA 2ZXGA 4XPHH 4ODSL 4FG0A 1RZ8B 4KK5D 2KPWA 5FGCB 1NDGB 2CKBL 3NK3A 4D9QD 1JI1A 2W07A 2BY2A 4BK5A 2R0ZH 3KWXA 5AEAA 3E8VA 5TPWL 4U3SA 4MNHB 3GEFA 2EE6A 2XICA 4OF3A 4ZNCD 1M1XA 1K4DB 3T6XA 4RGMB 3MRJA 1J9QA 3SQOL 2Q3ZA 2AQQA 4YGVB 5I1AB 3L81A 3NIGF 2UWEF 4OW6A 5D7SH 4ZD3L 4B3EA 4GSXA 1PCSA 3CFJB 4FCAA 5C07D 3CVHA 4EI5B 4JZNA 4XX5A 5IWLA 4YSUA 5KOVC 5KVMC 4N6QA 2X3CA 4S1DD 2A6DA 3BVDB 5B1JC 1TQCB 5JOFA 5HXMA 2W38A 2Y72A 3O6KL 1H0DB 2C34A 4OJAA 2D7TL 2LU3A 1RUAL 4WFGD 5CEZH 3D39D 5D2NB 3ILDA 1OW0C 4K8RC 2X6AA 4HPYH 4M4RB 5GGRB 3VXUA 4BFGA 5FCSH 1BIHA 4HIXH 3PAUA 1CBVH 4PSPA 5IB5A 3C6EA 4EO5A 4XC1L 3O4LE 2EYRB 3DARA 2AJUH 4UZGA 1KY7A 3ZL4L 2H6PB 3CSBA 1YMMB 1L9OA 3W38A 3ISYA 5KZCD 4Z7OE 1F4WH 2X88A 3ECBA 3DOSA 1MCOL 4XB8A 5F7KC 1YQ2A 3VGEA 4ZMWA 2NY1B 4JGJA 4KKLC 5E6SB 3ULUD 3COOA 4G43B 2VITA 3ASNB 3RY5A 4AVKA 2D2OA 4GW4A 4NQQA 4O51B 1NH6A 2EO9A 3HB3B 3RWCB 4DKFH 1TQWA 4P2RD 4DPAX 1ZT7B 3BQVA 3IT8D 2H47C 4NHCL 5HDBF 1PJ9A 4W1TA 4QAWA 2TSBA 4WK0B 3EG9B 4HSQA 3FT0A 3GMMA 4OZ4A 3AG3B 4JY6B 2ESVB 4HJEA 1SJHA 2RALA 1ZHBB 1F13A 3H4HA 3UBXG 3UERA 1FORH 3VQ2C 5BW7C 5GRWA 5I74B 3CFNA 3V4PA 3WNOA 1T80A 3MCLH 4NO2A 5J3HD 1NCWL 3MROB 5H94A 5EIIA 2YD0A 3DGDA 3L3OB 4WWOA 5AW4B 5F7BA 1Q1PA 1PSKH 3WKNA 3K46A 1I9JL 3BH9B 1JZEA 4MJID 5CKGA 4AMWA 3MYZA 4FA6A 2FEDC 1KJ2H 1IAIH 3NCWA 1ACZA 4A39A 2G9KA 4L4TE 2EDDA 4YWGH 4UDTB 4OI7A 2XY2A 1SHWA 2OSYA 3FCUB 3EJRA 1RD6A 4GEIA 2VXTH 5FGBA 3TT1L 3VFTA 2ARWA 2F19H 2XX1A 4O2EA 1FVEA 4DW2L 2DQDH 3B9KC 4P5TB 1J12A 5T1LD 3KNBA 4UYPA 3DHPA 5DC2A 3MOBH 4X5XA 4HUMB 3MRCA 4PP1D 4UM9A 3HS0C 5CR1A 5LGKA 1ZVHA 4B41A 4NT6A 5FYLD 3SJVB 3DI3B 2VH5L 4MNQB 3VD4A 4NQDA 4CN4A 4K8RH 1VFAB 4ZMZA 1P7HL 1AC0A 3OHXC 3RY6A 2F54A 1D6VH 5EBLB 3TEXA 1PG7L 1UT2A 3HBPA 3KL5A 2XZZA 1DHKA 1XL6A 4XVUC 2SODB 3O2WH 4N6RA 4RWYL 1FNGA 4D0CB 3C5ZD 1PX8A 2R0LL 4XOBA 2H1XA 4RH4A 2OCFD 3NQKA 1BZQK 2NSQA 2WTPA 4X9BA 1F1AA 3FTUA 3NIDE 5LQBL 4OCWH 4CN6A 2MH4A 5INCA 3U0PA 1GW6A 1XSIA 4NC0B 5I73B 1HDMB 1ZT1B 2OMNA 2UX6A 3S4SB 4ZMLA 5LBSL 1MHCB 4ZMOA 1JXDA 3A4DA 1Z9SA 1JTTA 2NYKA 1T20A 4XPGH 1YPZA 4MCYA 1J11A 2B20A 2HLFC 1EAQA 1BZEA 4DN3H 3ARGB 3QORB 1ZAGA 1WFMA 1YEIL 3EUDA 4I2XE 3WV0A 3MUZ1 3US9A 5DJAB 1YAIA 4PJHF 5B1JA 3H9SA 3O6FD 3PGCA 1N0XH 1ZE3C 4P2OC 4WY7L 1OTTC 4NQEB 1NKGA 4X42A 4NN7C 4U7SA 2E75C 2P24A 3HKZA 5ALCH 1LEGA 3QZPA 1TZIA 2ZCLL 1S7WA 3IBEA 2I24N 2VDNH 3TO4A 3AT9A 5ANHA 1A7NL 1S9YA 3DVGB 3I84A 3VD2A 1SJXA 1RJLB 3QQDB 4JFED 2XXFA 4NQEE 3FUFA 3QIUD 4Y4FB 1ZTMA 2ROYA 4TMPA 32C2B 3SGEI 2HYMA 1BJ1H 1I8IB 3L5IA 2RHEA 2UV3A 5GZOC 4HU2A 3EIFA 4NQDB 2ZOWA 4GAYA 4I0PB 1NGYB 3FUEA 2PP8A 1MFUA 1SFDA 1EHKB 3TT3L 2VRAA 4ESKA 4OM1L 3QDJA 4K7PX 1BEYL 4KK6C 4ORGB 5B8CC 2VXVL 3LKPB 4K3HA 3UPRB 1VGEH 1CF8L 3P3TA 5IB4A 4M6MH 2BSRA 4MS6A 2PXYD 4N0YH 4JQVC 2WYTA 1RUAH 3ULSB 1AQ8A 3DJSA 2ZX9A 4L1SA 4JM4H 2B4CL 4A7QA 4IKIA 3DV6A 4KK8C 2Z6FA 4N24A 2R2CA 4KDWA 5DRWB 3MNDA 3PHQB 4OU3A 3NIFB 3DVNA 1KIUB 2H26A 4YDIH 3MLUL 3HG1A 2DQ6A 2CLRB 5ETUB 3P2BA 1EEYB 4ODXB 4AH2A 1AHWA 1GKEA 5I1KH 3ERXA 4E9XA 4E68A 2W59A 4M62L 4MQ7A 3T0WA 5E8PB 5F7DA 3BD3A 3G6AA 1WBZB 3REWB 5DR5H 5FM5O 4QXUL 5ADOH 4U1IA 1UKSA 2CXGA 3HS0B 2NY4D 4ZOEA 3TBSA 1NCUA 3ZMRA 3KLDA 2WKGA 3QUHA 5ICZA 2GIXA 1ZHNA 3T4AC 4G42A 4NGHL 4YC2B 4R90L 5JMRA 5J1SC 3QISA 1RZJC 1TENA 2A38A 4MJ5B 3IPFA 2Q3XA 2ZT9C 3RP1A 4H13C 1OP9A 1N3NA 2FYVA 3S3BB 4TSBL 1NDMA 3DTXB 3FSVA 5IFHH 2E7LA 2BZ7A 2JB5L 4L37A 3X3GH 5ICZB 3BAWA 3QZOA 4DAGL 4JMXA 1JWMA 3LD8C 5J06A 3BAIA 1XH2A 1ZTXE 1QEWA 2X0UA 4IRJA 2BIMA 2KZBA 4BSWA 5FDWA 4GRLC 2AQSA 3QIWD 1SJEB 3LDBB 2FEEL 1FYTA 2G2RB 3ILQC 3TL5A 3H3KA 4HIJB 1CD9B 2VLKE 3NFNB 3RJDA 1UYWL 4ZS6C 5IJCC 4IEFB 3SKUD 5M94B 4LASH 2DZEA 4U1JA 2PWDA 4DWHA 4W9EC 1PX4A 2V3DA 3T65B 1WZ1L 3T65A 4X5RA 2HUHA 5D1QA 3BVNB 2VDLL 3CFIC 3MV9D 2BDNL 3QCVH 4JW3A 4LLWB 5F7EH 3TCLB 3SYOA 4XZUB 4IEFA 5F7YC 2EKSA 4PJ7B 3CHSA 4QKXB 5FECB 3PWVB 2MNJB 2H1LM 4NQVB 3TFKD 3SCMB 4CC4A 2QDVA 1EFQA 5GRJH 4G6KL 4XCYB 2NXYB 4M62H 4NZJA 5IEKA 1AANA 3OKLA 3BH4A 4AKPA 2PR4H 1G7JA 5HGGS 4QTHB 2BZDA 3MTRA 4B97A 2W0KA 1UM5L 2WUBL 2N56A 5BRQA 4Q89A 3LVEA 1WAAE 5MEQB 4ELDA 2WLIA 3O3AB 2QL1A 4YBLB 3J07A 4XXDB 3QFJB 1MCPL 3N0PB 3BO8B 4XE5B 3O0LA 5LCVL 3NA9H 3U6XA 1CGSL 1ZWIA 4V1DE 2IH3A 1D9KA 4UQAA 5F89B 5TK4A 5CCKL 3O4OB 4OM1H 1QHPA 1VA9A 4PJHB 4QF1A 3WFEH 1J5OL 3SDYH 3B2DC 4K94L 3X3GL 4X6CE 3BP7B 4YC2C 1A7PL 4OLWH 4LMQE 3REWA 5E9DD 2WY3B 3OZKA 1JGUH 1RMFL 3ZTNH 5ADPL 5GS0H 3FW6A 2XZCH 3ABLB 3ZYJA 3C60B 4MHHI 1BQRA 5IR1B 2ITEA 1CK0L 1I85A 4CU8A 1QZ1A 4Z3JA 4XP9H 3ZK0A 1TLKA 2KC0A 3HE6D 5JUEL 1KJVA 3SZKC 2W9LA 4TUKL 4GMTH 5HSFA 4AENB 2N7BA 1IM3A 4YHIA 2BVQB 5SWZA 4M7LH 5D4IA 5EIIB 3KYNA 2B5IB 2WANA 3LJ3A 3MOQA 4P0DA 3I85A 1CMOA 3BOVA 2Z3FA 1J18A 2QVIA 1Z9SB 4POZD 3QP3A 5I6MA 2WLLA 1I9IL 1HZHL 3F58L 3NP4A 2GI0A 4NZUH 1KGCD 5DR5L 3INOA 4ZNEE 2ETWA 5GRUL 4P9ML 5FYKD 1K2DB 1KOAA 3MCKA 2YUWA 3ARDD 4YLQT 2FSEB 2VL5B 3I9AA 4NNXB 3QO1B 2H0PA 4LPYA 4NO3A 4BFFA 3CAFA 4UB0H 4MA7L 1G1CA 4PFEA 3LKRB 3LXAA 4U3CA 2ZJSL 5D1QD 4IGBC 5DD5H 3K74B 1HHJA 2NQDA 1FE8H 1ZGLA 1BG9A 1WQVT 2XQ0A 3IPEA 3KCWA 3EDEA 4UIMA 4Z7UB 1X5KA 3WUWB 3DVGA 1FO0H 4NP9A 1E3XA 3SO5A 2IWEA 2B3IA 4LPXA 2O5XH 3O3AA 2V0AA 2JQAA 4K3GA 4MAYA 3V0AC 4G80A 2DWEB 1K8DA 5DQDL 4KTGA 1TZIB 4P23C 3VYOA 3L3DA 1ZJAA 4PRBB 1EBPA 1TR7A 3QJVB 4OKVB 2WBJA 3PFUA 2X5PA 1BVKA 2YJLA 5D5MF 3SPCA 3S3PA 3LN4A 1I75A 3MRHA 3MO1A 3T6ZA 1IC4H 5C0BE 1W72L 3GSXA 4HPYL 4TQEL 5CLWA 3WTTA 3ZO0A 5JR1H 1G7MB 2WXLA 4EMZA 5DK0B 3FSAA 4LSSH 3V0FA 1Q0YH 4NX0A 5CN1A 3QG7H 4W70A 4DOHE 5I0YA 4JR9H 2JELH 4EI5A 1FZOB 3HG1E 1TO5A 5KOMC 4XMXA 3GSXB 4WGVB 1FVCB 1KXTA 3QXUA 1GY2A 5MI0C 5I6LA 2VMJA 4AJYV 2YJQA 3FAWA 1BGXL 2P48B 4KKZA 1I53A 2JQMA 4QO1B 3APDA 2OLDA 1FAKT 3ULVD 3VGFA 1L3WA 1WBXB 4N5EC 4W9JC 4IDJL 3MV7A 4PJ7E 3BZDA 3ZY7A 3S96B 2WNGA 3QA3A 2BZCA 4LARH 3MCYA 4KHXH 3MN8A 4HJUA 3FCSA 3P4NA 4EOWH 1A6VH 5CJXC 5J3HC 4DZ8B 3NT0A 4PB0L 1KIRA 4APQA 4U1GB 5CEXA 4Z78B 1R3HA 5KSBE 1JPTH 1CQKA 1XIWB 2VLME 15C8H 1MI5A 5JHDB 3C5JB 5F9WB 5J12B 1AQKL 5ICYA 3EOBB 4CRPA 3BAEL 5IREA 3D06A 2BS8A 1TVBA 5JPNB 2H0FA 5JZ7C 5L4MA 1E8XA 3BLBA 4E36A 1NCWH 2OMVA 5IVNA 3EGDA 1D7CA 4RAUB 1F4HA 3O9WD 2QHRL 4NIKB 4GQQA 3EYFA 3P73B 1R5VA 2JXMA 4PJHE 5JHDE 1YEEL 4LCCC 2FQDA 4MD4A 5HHOE 5JZ7D 4NQDE 3DTUB 1QWNA 2VDRL 5KEZA 1P4LB 3WHE0 1U8OA 4ZJ9A 5HJGA 2A9BA 2EKSB 3GO1L 1JNLL 4GO6B 1FFOA 4WVRA 3CZGA 4OD2A 1IU1A 1NUDA 3L3HA 4RFEA 2G2PA 1W2KT 2APBA 3V8OA 2NR6A 1L9SA 4R7NB 5IBTL 2DKMA 3QIBA 2RA1A 5EZIL 3LXUX 4KDTC 4WHYG 4YEEA 1DZBA 1KB5L 1A4CA 3RJOA 1AQDA 3T2NL 1HKLH 2IDSA 4PGCB 3AQDA 4YPGA 3K71A 3CHPA 2CCWA 1I9RL 3U1SH 5H35A 3LKSA 3PNWA 3QIBC 5BRZA 1MIML 3LQAH 4HD9A 4P49A 4LFHG 1SM3L 1ZXKA 1L9QA 4AUYA 1J5HA 4C54A 2Z8WC 1NCAL 4YDVA 4W6XB 5KYUB 4XNQB 3C8KB 2G5BB 2BRQA 2Y6SD 3FULA 5EO1A 3VWKC 4OCXH 1PZCA 4PW9A 2XN9E 3WMQA 4BE5A 3BFOA 4OGXH 4MA8L 4Y19A 1GGCL 5AVZB 4KU1A 4NN7B 4HAFA 4F33B 3FSOA 4WEEA 3VSVA 1TNMA 4JHWH 2EVHA 1F5WA 1TZAA 2KQNA 3O0RH 1J48A 2X3BA 3WSQH 4P3DB 5IKCA 2QQKH 4WNQA 3VD7A 4ANUA 5HYJD 3W57A 1NBVH 3AS1A 3MV8B 4Q6YA 4XTRC 4O02B 4OJFL 1FORL 4HUKB 2RGSA 5E1IA 4IDLA 2DWDB 5F21B 3TVMC 3BP4B 3FT2B 1Z66A 4AG4H 2H6PA 4RNRA 2IPTH 3ZUCA 1P6FA 3SE4C 4WKZB 1IC7H 3G5XA 5F1NB 4R97B 5ACZA 2P28B 4KV5E 2GK0B 3LRSA 4TF4A 3QJTB 4HJIA 2LAAA 3DGGA 1N7MH 4JDTL 1S9XA 5TTRA 1U95B 3BW9A 3QUML 4XO8A 1XD0A 2A6DB 1CDIA 4J2XA 5E00A 5L2KE 1GA2A 2F53A 2AK1L 2KBGA 3OLEA 3QZLA 4P9HH 1ID5I 1MEXL 2IGLA 3LH8A 1UWGH 5I1AA 5KUKA 2R9HD 4XOAA 1HH6B 5DD3H 2JCCB 5G55A 1LE9B 2V8MA 1KGWA 1KSRA 3OL2A 4UT6A 2DI7A 3AREB 1OCWH 1AG6A 2K70A 3B56A 4HF5H 3QJOA 1X5JA 5I1GH 5D5MB 2J7LA 5GXBB 1G7IA 4NBYB 1XTMA 1J0YA 1GZQA 4L9LB 4PVMA 4WFHE 15C8L 3ZTJH 3FO1B 1HU8A 5HI5D 5TK2A 4LVOC 3DRTA 2OL3L 4I88A 3QZWG 1PLAA 1MF2H 2CHZA 2C9UA 2C3HA 5F71A 5BUAA 2EXWD 5K5YA 4AEIL 4EXKA 3FCTB 3MOAL 3GZQA 3ZKJA 4MVBD 4X8JB 3MJ7A 3W11D 3ARXA 1E5CA 3KLLA 4LSTL 1EJFA 2QVTA 3WEXA 3L4YA 1FLRH 3FF7A 3PP3K 2GBVA 2O6DA 2EP6A 2PO6B 2N01B 3DTDA 1B9KA 1CYGA 1ZOXA 4WWKD 4ZI8A 3IF1A 5FA4A 4NFBA 2OI9C 1SOKA 2QPEB 3UTZA 4JFEE 2X2UA 4QRTA 3V5HB 1XH3B 4XP4L 5EU6E 2X9ZA 4JFYA 5DJAA 4CVUA 2LQRA 4N2KA 1YHPA 3EOTL 4W9LC 1XCTA 4X50A 3BEVB 4HKXA 3BH8B 3KPSD 1IM3D 2P8MA 3AZUA 3HUJE 2CUHA 3NESA 1N70A 4YZFF 5I17A 3UBXA 1INDL 2XWRA 4FQHB 3ARPA 2CO7B 2BVPA 1FL5A 3CHOA 5FW6A 2X4QA 2W92A 4LRNL 1CLOL 3C6LA 3AG1B 3G04B 1RZFH 3MROA 3QRBA 4MNHA 4J3OH 5DZAA 2BPBA 4U2YA 1T1ZB 4LLVB 3K2UL 1MELA 4KQ4L 3MRKA 5LB1A 4NQUA 1WWAX 1HS6A 3WIHH 2VZ1A 5KYWB 5EZPA 1UB5B 1WHPA 2ICEC 1SY6L 2VN3A 2V7NA 3C6LC 3ZYZA 2JB5H 1M9SA 2J1WA 2Y5TA 2GTZB 3I75A 5K69A 3FTSA 1AJ7H 2X70B 5EUKA 3IFNH 3H6JA 4P5MA 3QYMA 4MNQA 2XWJB 1R3JA 4FQLL 4ODWB 4Q6KA 3UAFA 2R83A 4PJGB 4I18C 1NCCH 2YK1H 1F3DJ 3FO0L 1GZHC 1T5KA 2LVEA 3FT1A 1M3JA 3TVMB 3JV6B 3TWYA 5JW3H 4CVXA 2M8XA 3B9KB 1O5PA 4RVBA 4BZ2A 1DBJL 2FIKA 1WA0X 4GAGH 1P7KB 3OKNA 4ETYA 4Y1TA 3VQMA 3BD5A 1L0QA 3DI2B 3BWAB 2H8PA 2YRBA 3P4OB 4QRRD 2IANB 5GSVB 8FABB 2G75B 1JG9A 3PJSA 2C8NA 1PX3A 3LTVA 1AGCB 4KGJA 1PKOA 1ZTXL 3JSSA 1LL1A 4EN3B 3Q06A 1JGDA 4L8CA 2B1HL 2Z35A 1CJYA 2VE6B 2WTOA 1MRCH 2IPKA 4PIBA 5CD3B 3T8MA 3V0IA 5D70H 2KLTA 4QMEA 4WW2C 3KGUA 1LQSR 2J56A 3AREC 1NAKH 1NLDL 4NP4L 4YSEA 2OBGA 2OV0A 4YFEA 3I50L 1G5GA 3V95A 4HBCL 3CZEA 3D85A 2BSEA 2N7AA 2IQ9L 1S8DB 1O7VA 3UEZA 3GHPA 3WNKA 2R1YA 1D5MB 1MNUL 1NCOA 5TQ2H 3HZYA 4Y5VB 4HWZA 5FO8A 1GMIA 3MRRB 3V52L 3U0TA 2QHLA 5ACMA 2FD6L 1OT4A 5KJ4A 3DURB 2YA1A 4M43H 3T4AB 2QGCA 4KZCA 1DN2A 1KENL 3EDFA 4ODTL 4CAGA 2R29A 3PV6B 1I8MA 4KXBA 2IQAB 3MBWB 3PWNA 4HZLB 2Z9TA 1OK0A 1KCKA 1V55B 2VDKB 4Z7NE 4M5SA 2KYIA 1OPGH 2I5YL 1T0PB 2YXVA 2ED7A 3S5LB 2D7NA 2I26N 2MHAB 3O6KH 2YAHA 4G7YL 3T3PB 1OGSA 1XIWD 1KTLA 3BZEB 1IGTA 3PHSA 1IGTB 3GBML 2AXWA 1BM3L 3NIGB 3EYSL 3IF1B 2P7TB 2UXTA 3CVBA 1CBVL 2ALWA 5I5IA 3AGVA 2ZNXA 4UTCA 4MXVF 1RUKL 4GXVH 2PWGA 2OTWB 1XIWC 2WJ7A 1QBLH 1UWGL 5D96C 5IBLC 2CMRH 3LS4H 3QUXC 3VDAA 1DQJA 3CZKA 5IK3A 1N64L 2YD9A 1S7TB 4GSUA 4L05A 5DVMA 4LIQE 3BEWA 4PBVC 1N5AA 4K15A 1PLBA 1KB9J 3OAUL 2HX9A 4UOJA 1O7DE 2PR4L 2YD8A 4HIIB 1PZSA 4ODSH 4LP4A 4JANB 2BNQD 1YEFL 4KMLB 1NC4D 1TPXB 2W07B 4AK2A 3DIVA 4OF6A 3AC0A 1ZLWK 4QRUA 1I8UA 1Z5LA 4MRBA 2BIOA 2JKWA 4FXKC 1XF4A 5DJ6B 3T3MB 4ZS6D 3L5WA 1CXHA 1MFCL 1JN6A 4OZHF 4S10A 2JJTA 3FT3B 4U6HB 3RDTA 4F20A 3K81A 1GOHA 4G8IA 1OIOA 1SPDA 4D3CH 4UTBA 4JFXB 3GMRB 1Q9WA 2R0KL 2J5LC 1Y1UA 3WIHA 4KRNA 1IMHC 1FZJB 2VZSA 1OSZA 1UWEL 2P7TA 4GO8A 1A1MB 4X6DB 4X6DA 5DJZA 3T8XA 2RCSL 3QDGD 4WI6A 2O4EA 3N44B 2X1OA 4F80A 3VFRB 1PD1A 4ZQTA 4FFYH 3GNMH 2A73A 3BQUA 3FU5A 3P4OA 1XXFC 1MCFA 4M5YH 5A7EA 1A9BA 3WIAA 3QHFH 1KTJA 5F0JB 4N2FA 4WY7H 2IH1B 4X98B 1MRCL 35C8H 4KO9A 1S78C 4C59B 1G6RH 4X6DE 2ZUSA 4FXGC 4U1MB 3KWUA 2F19L 3B9DA 3WDJA 4EOWL 1XZWA 3HRZB 2V9TA 3N43B 4R26H 4Y1AA 2VJXA 1JYXA 3ALXA 4HSCX 5KSVA 2ED8A 1SDYA 1NPJA 4MVBC 3ZLQC 3NEOA 3CDGB 4J3XA 4ZUVB 1GIGL 2B59B 2DH3A 2WO2B 4G9FB 4ZBJA 4D9LH 4X0KB 3W2DL 5I1LA 3CZUB 4J3SA 1AFVL 5INDB 2JV6A 3LNHA 2OQJB 2JCCE 1AR2A 3LN9A 2OFQA 1HYSD 5EUOB 1X5LA 5BS0E 3MGTB 5CBAA 2BP5M 2BNRD 4QRPE 4DUVA 4DTGL 3QIUC 4RGNB 1OHQA 4Y4KB 1CYXA 1I8LA 4Z7UF 4UM9D 2XWDA 3R18A 4X6DF 2DM2A 3DSNA 5CF3A 1HT6A 4JHAH 4NRXB 4KTDH 4R4FH 1OAUH 4M6ML 1IGIH 4NYLA 3K72A 3CDZA 1RSYA 4PV9A 3MV7D 2YRLA 1RK0A 1M7DB 2QGDA 2NXYC 3GIVB 3GJEA 3QUZD 1R24A 1U8JA 2VSMB 3KPSB 5E2TH 3VMNA 3U9UB 2L7EA 1M4KA 3PLYA 4PUBH 3QRFM 4C55A 4G8EA 1UH2A 3D25A 3X1BA 3QG6A 3CN3A 4FNLL 3ZBMA 5M95B 3QEUA 2C4XA 2QVMA 4J4PD 4JRYB 5CLZA 1IGJA 4NRZB 3WHXB 5E5RB 3IGAB 4X4XA 3RY4A 2HX8A 4QHKJ 3RA7H 3JTTB 4GP8B 1FP5A 1CE6A 4MNGA 4PGZA 4EDXB 2RFXA 3DO7A 3FUKA 2AJVL 3UABA 2H9GB 2KHAA 4K3EH 3VX0A 4DO4A 1XIWA 2OMYA 5SX5H 3VI4A 3KPRA 3QJRB 4JCLA 4WWPA 1LQBC 3QJHB 2X87A 3EJZC 5AVTB 1V27A 1H5BB 4ZSOE 4GG6A 2WOYA 2VDMB 4JRLA 2V7NB 4ABQA 4XX1E 5B39B 3UYRL 3LEYL 3KJ6H 4TQIA 3IK2A 2F8OA 5BJTB 5DMKA 3MJ9H 2G2NA 2Y2WA 5E56A 5HYQB 1ZT4A 5JHLH 3OB0K 4ZSOB 4WV1C 3SHSA 1J88A 5DYOB 3Q1EA 4U6YB 3APCA 3FQNA 3OJ2C 4UT6L 1H6UA 2QHRH 5DDHA 1OB0A 1AR1D 4IRSB 3BGAA 5IMLB 3AS3A 4ZYKB 3ME0A 3MUY1 4NERA 4YHPB 1F42A 1RH8A 2FEEI 2J88L 3UTPE 5DEZA 3B9KA 4GY4A 1G7HB 2LU5A 2YARA 2Q3AA 2EE2A 2JCCF 2HTKC 3FZUD 3C5XA 1HQRA 3CBKB 1OTUD 4ZOBA 1GR7A 3R1GH 2OK0L 2RQEA 2XLLA 5DRNA 4LLMB 1JK8A 5DUMH 1MCIA 4FQJL 4PRIB 2IH9A 3B8YA 3PXLA 3QZBA 1AE6L 5F9WC 5TDPA 2NX5D 3SYCA 5IZ7A 3BGFB 5C07A 5HYJB 2WZ0A 4UDUB 5EU4A 1TQBC 1SXBA 3RTQA 2XT1B 3CHQA 2IH3B 5L7XL 3ULVL 1JF1B 2BXYA 3MU3A 1DFXA 3MLYH 5FOJA 1T66C 4XBGB 3FBKA 3C2AL 1ZGLB 1XSJA 4G3YL 5C08D 4ZX6A 1DVFB 3BUBA 2UYLB 4LNRA 4IHOA 4PG9B 3OB8A 4NGHH 1RY7B 5F2FA 1JVOA 1AO7A 4TNGA 2DQFB 5I8CA 3OVUB 2V7HB 4QTHA 4XVSL 3MNWA 3SKNB 3VFMA 3OG4B 1MLBB 3BRGC 3PHOA 4JPIA 5TJWK 4OLWL 3UC0L 4OQTA 1TUPA 1TZOA 2EXYD 3K80A 4TXVB 4H1LG 2P5WE 2XZAL 3FYEB 4XP9L 4A2HA 4JFFE 1I8LC 5I5RA 5AENA 5CSZB 3Q43A 1QI5A 5C2BL 1N5YL 4I3SL 2ZE0A 1NGPL 4ODBD 4XRCB 3VFVB 4ZMAT 3FB5B 3ARSA 4PJFF 3CDFA 5ISZB 2OMBA 2FK9A 3WFBH 1OAYH 2NOYA 4BWTA 3AACA 3ROLB 4WNJA 4UMSA 3EJUA 4KJYB 3SN6N 1IBYA 4OLZH 4ZUTB 4K2UH 2PYFA 3CFCH 3X14B 3ULUC 2V2XB 3UCRA 4Z1PA 1EZSA 3ESMA 3BUDA 3KJ4C 4WNQB 1MJUL 2HP4A 3O9WB 3MV8A 3B5GA 3BVXA 1NM4A 2X2JA 1HXMA 2AI0L 4NS0A 3HCVA 4N68A 3HNTH 2IWGA 2YSSB 3Q05A 1NUFA 3BPNC 4P05A 4XPAH 3I9IA 3X1FA 4A6YL 1JFQL 4UV4H 1I7TB 4PP2A 4FQQA 2EH8L 5JORA 5D7JD 2IO5A 3QQ4A 4ZZKA 2H45A 2KLSA 2MNWA 1LVEA 4P2QD 3V5KB 5I6XC 2BY3A 2ZSVA 4G83A 3CHRA 5BRZB 1NCDH 2MEJB 2V5TA 2I32A 2OJZL 3G6AB 5F7MC 4L9LC 1KWKA 2WQVA 1KWGA 1KJ3L 4DEWA 1UT1A 4F2EA 3BGMB 3GSRA 4NWTL 1QD0A 1EMTH 2IPKB 5I26A 5CD3A 1WD8A 1CI5A 4LSUH 1S9XB 4MQTB 3MRIB 4WO4A 1IFHH 1HQ4B 1JGEA 3MX0A 1YN6A 5DZJA 4BE6A 2XZCL 4G82A 4J3OG 1SRDA 5EH1A 3GM0A 4IRSC 4URKA 2DWXA 3EO1B 3WKYA 3FL7A 5KVGH 4LVNC 1ONQA 4WWKC 2I69A 5DGRA 1NICA 4P4RA 1ZK9A 5CCGE 2WSPA 2A6JA 2BOBA 1RULH 5HHPA 3MJ9A 1T03H 4YPJA 3TC9A 2NQCA 3TJEH 4O02A 2XN9D 3B1TA 3GSNA 5ECGA 5FDWB 1B6UA 4WUUB 3NEXA 4R5TA 4DGYH 2CJUH 4M93B 4W4NA 3UTTE 3LNIA 2WBJD 1DSYA 3T4AA 2FX8H 5F70A 2IALA 1O6SB 3C12A 1U8CA 3BP6A 2PO6A 2YIHA 3FCBA 3V9FA 4ABUA 5I15H 1BW8A 3DX2A 4JRXD 3LHPL 3LV3B 1B3JA 2KZ1B 4L3EB 1NKOA 1QO3A 3D48R 3C8KA 3L45A 3EAKA 4CL7A 1LEIB 4HBCH 4A7GA 3TA3A 1OAZH 3IMWA 3M17B 4FQIH 3DOHA 2D4DA 3ZHFA 4L3AA 2OXHA 4P23A 5MEPB 4UIMB 4EN3C 3SKJH 4XP1L 4OJYA 1KN4L 3VWJA 4GRLA 3N5AA 4UV4L 3TM6A 4Q56A 2KMWA 2P5EA 4WFEE 1I1RA 4ENEC 3CSTA 4KI5C 3O3EB 2DBLH 1AQKH 1CLCA 5DK2B 3ZW3A 5DRXB 2WKOA 3RX9A 3RWGB 3S96A 4BK8A 3S2CA 4X7SL 2X6VA 1CG9A 2BCKA 4L4TD 2YD1A 1PAZA 2HZHA 3MV9E 4HLZG 3PU7A 2PYED 2Q7NA 5FF6B 5CD5C 2YO3A 2AGJH 3TO4D 5JNYB 5CR8A 3PHQA 4AGPA 3OZ9L 4GS7B 1MG2C 5AKVA 3G6JA 5D9SA 5G4NA 2J2ZB 1MRDH 4W9GC 3PREA 1SN5A 4H44C 1TJHL 4NPJA 5ECJE 1RU9H 3PUCA 4FFVC 1GTNA 4PRAA 5JO5A 5D7JA 3IU4H 1QZNA 4YHIB 4HEPG 2GTWA 2ORBH 3S3DB 4EDWL 4OLZL 1A7RH 1M7IA 4EIZC 4LAJH 4PCTA 5IVXA 4LOEA 4AW4A 4P46C 1ZVYA 3HTLX 2NNAB 2AEQH 4LVOB 4PG2A 3UH8A 4HPHA 1DE4B 4IJ3B 4YFLF 5D7JC 3P0VH 5HHVH 5C0GA 1Q9OA 1VACB 3QRGL 3ZE0E 3VFUA 1NCIA 3HC2A 4QOKE 2A6IA 3MRMA 4CW1A 4AYFA 1DSWA 4ISVA 4CMMA 1J8RA 1JSYA 1TKWB 2O5YH 3E7JA 4FADA 1SHMA 3NN8B 2P5EB 3N40P 5A2CA 4KVNH 5FUCE 1FC2D 5CEXB 1V7ML 4M1GL 1FFQA 3WXWH 3TN0C 4P5SA 5EPMA 3S8GB 2CRMA 3HZKA 3ARBA 3T2OA 2ADIB 1MFCH 2ZG1A 3FH7A 2R0WL 1U42A 4HWNA 3HZMA 1JPFA 2F0CA 3AGWA 2QSQA 1KGYE 3F85A 3QNFA 4BWUA 3IS1X 1WCBB 4FL4B 3CFEA 1PKQA 2ALAA 2DIAA 1E8WA 5GZOA 4CNIB 2X4QB 4HZAA 1GGUA 2X44D 1HE7A 1OGAB 4D8OA 4YPGB 2K45A 2JJWA 3I6GB 1OCRB 4NENB 4KMTL 5KVDL 4PJCF 5I8EB 1UYWH 3ARGA 3OHMB 3QORA 4GG8B 3S36L 4G8GE 5FA3B 4R3SA 2VLRA 5F6IC 4N1CA 3ZJAA 1I1FA 3B9EA 4BHUI 1JZ3A 4AGQA 12E8L 3EYVB 5B4MC 2YMXL 2DQMA 2J44A 3QG7L 4OLVH 1HSAB 3D39B 1YEIH 3U82B 2ZTBA 2Y07L 1CU4H 5JNYA 1QSVA 2BNQA 3ILEA 1XAKA 3IWUA 4KUZL 5ALBH 1SFHA 1WRFA 5IB1A 1ODAA 4DGWC 3KPPB 4JBSA 3AU1B 1X7TA 3DLQR 3EYSH 1BAWA 2Q9OA 2J8UE 1JWUB 2D8KA 2E86A 3HBQA 4O2FB 5K39B 3A4EA 3PPEA 3L3OC 3VU1A 4NPYA 3QRGH 3EH5B 1A7NH 2BHUA 2QSCL 3RURA 3R0NA 4P5KA 4N9GA 5HTSA 4DKEH 5I19L 2H32A 3MJ7B 5FAAA 4X8JA 1OE1A 1ZWIB 5F89A 2WM0A 4KH9A 43C9A 1J8HD 4TVSa 4MMXC 3QW9A 4CU6A 1JZDC 3UG4A 1Q72H 4M7ZB 2YAPA 3VM5A 4FZEL 1Z3GH 4N1HB 1HHGB 1HL9A 3D1MC 1NC2D 3VXPB 2EIKB 5LCVH 4MZ3A 1B3IA 3DUSB 2IG2L 3MOAH 43C9B 1LWRA 5CZVL 3WFEL 2JK5A 2Y4SA 3H9ZA 3JT2A 3X12A 5CFHA 1VADA 4NXKA 4CU7A 2YD6A 5FUZH 2YD7A 5KSUB 4ZX4A 4R97C 5J12C 1VPOH 3S35X 3MFFB 4PJEE 1KC5L 4ZXBD 4JPVH 2ENQA 1QBAA 2WLNA 4N2BA 5T3ZH 1YEKL 1OGTA 2BVQA 3F7YB 3M46A 5SWZB 2APXA 1DBKH 1QLEL 2BP0A 3QXVA 2UX7A 4F37F 3PGDB 5HHNA 2LV4A 2F9BT 3AB0C 4HALA 4IYKA 4MD0A 4NKMA 3VI3F 4FHJA 5IHZA 3BISA 5KAQG 1RJZA 3S0PA 1IC7L 1RCYA 3UAEA 3UTSA 5EDXA 4NUGL 1MJ8L 5D2LE 3ZQXA 2FJGB 4AE1A 1SF3A 5F88B 1E4XI 1OGTB 1RP9A 1PZBA 3F7YA 4ALAC 2YD4A 5B7MA 3CSPA 3KPSE 1N7ML 4FNPA 4F1ZA 3MNVA 4KH2A 1AY1H 1BZDA 5IJBC 2XRAH 1HK6A 1INEL 3X17A 2IBZX 4OZIB 1MWAA 1VSCA 4MD4B 3B7UX 2VUKA 3E2HC 1E9QA 5FO7A 1DBMH 3X12B 3VXSB 2W94A 5J6HA 2K8QA 3L2NA 1SQ2N 1A3LH 2ZCKL 3HUJF 2W60B 3MJGX 5BQ7A 4Y2OA 3LIZA 5AZEH 1MVFA 2FVNA 4I0PD 4HQQL 3DK0A 3DO4A 2FB4H 4TVPH 1YYLL 5AVUB 4IBLT 1OCWL 5AG9A 4X7TB 1MCPH 3UYRH 1MW0A 5IUCA 1MIEH 3PXJA 1XGUB 2EVGA 3LRMA 1T2QH 2X2IA 3QDHA 3ZTCC 5BUGA 5JA8B 3NK4A 2H32B 3FRPG 1AFVH 4B9GA 2DLGA 4L3CB 5EO0A 2WD0A 3MGOB 2P5ED 4Z7VA 3EXLA 4FFZL 1OF2B 4GUQA 5LGJA 1OAXH 5C08E 5L88H 1TTFA 4IRJD 3GHBL 3CV5A 4FERA 4GQZA 3D4YA 3U4EA 1H5BC 1YAZA 1EEYA 4ODXA 3U4BL 3HPLB 4AH2B 4UYQA 4NB7A 3OZ9H 3FRUB 4WFHD 5ANMB 2I9TB 1KG0B 1IAIL 3O6FB 1DZ0A 1PNDA 5IVXB 1YUHA 3FTVA 4U1JB 5HY9A 4PWFA 3L9EA 4HH8A 3VW3L 1PD0A 2Q2LA 1RJYA 3AMLA 4LO9A 3IU3A 2AJXH 3HZVB 1RI8A 2E27H 4NUJB 2FHFA 5KSAB 3GBDA 1ADQH 5EF3A 1EUTA 2A74A 3D9AL 1L6PA 3DPDA 2YC1B 2PXYC 3B6SA 3V7MA 3BKYH 3QCUH 3CC5A 4Q2ZA 5SWSA 1TPXC 1ESOA 2UXVA 4IGBD 1W0WB 1PD6A 1ZA3A 3C5ZC 5D7IF 2WQ8A 3BWSA 4DGIL 1AGEA 1DBML 1CIUA 2Z31B 4MLIA 5HGAA 3VRIB 4HWBA 4X99A 4GFTB 2D0FA 3OKEB 5JW4R 5HPOA 1JZ2A 1F4WL 4N2HA 4G6AC 5C71A 1FGNH 5BZDB 4PJAB 5CXPA 1FFPA 1NINA 4P57B 5HYJE 1G4RA 1YY8A 1QNIA 3C5ZB 4K9EL 3VXOB 1KBPA 2JJUA 5CU5A 1I8AA 3MRDB 1KB3A 4HHGA 5DJYB 5IOPA 2DF3A 2Y7MA 1TKWA 2R69L 3FQRB 4Q6IA 3NN8A 4MX7A 4P59H 4CMHB 2JE8A 3LKRA 1ZLSH 2FSDA 3WFDH 2OZ4H 4LOVA 3NABH 1NZRA 1HC1A 4O00A 3IGAA 2WXHA 3VFUB 4JPVL 3OBAA 3QI9A 2FX9L 5BO4A 1HHIA 1RZ7L 2FD6H 2C1PA 2WB1A 3D69A 3MJ9L 3R4RA 4HIQA 4JPWL 3WBDA 2IGTA 5C86A 3WIIH 1RZJH 5FS5A 2ZAGA 3C60C 3PE9A 4YSTA 5C0EA 2NSMA 1G7HA 5MHSD 5KSAA 2I07A 5E24E 3DUUB 4IHBA 1ZLWH 1IM9D 3NPSB 5ESQA 2BP8A 4AENA 4TTDC 2EDEA 5DMJB 2WBKA 4PI0A 5BRPA 1YMHB 1HDMA 1ZT1A 3MO1B 4Y19D 3S4SA 3WMSA 1MJUH 1MHCA 3AT0A 4OT1H 5KSAC 5EN2A 2CRYA 2RMNA 5C0FB 4HPOH 5GHWL 5HVFB 2X05A 4MMXB 5A16A 2WXKA 3IWVA 1ETZB 1AXTH 2FWLB 2VLKA 3HNTL 3TCTA 4M61A 4BDVB 2EIMB 3O11B 5BRZD 3QUYA 3O2DH 1EXUA 3N55A 4P2QB 3H53A 4K7FA 5TF1H 8CGTA 1ZANH 3ZE1E 1KB5B 3JWDC 4ZMPA 1UM6L 1JJUA 3QHZL 1PBYA 4GUPA 4OI8A 4XMWA 1RURH 4KROC 4XMLH 3V0DA 3ZE0B 4G71B 2CHNA 4N2IA 4Z3TA 4PWEA 4R96B 3W0WE 4N2OA 1WPCA 3VB9A 3UX9B 5CZRA 2R69H 5JXAL 2Z1PA 2B14A 1KJMB 2MQGA 4CMHC 4XNDA 5IG7A 5GRZA 4HW6A 4JUSA 3HI1A 5EA0L 2V5MA 3WHXA 4PYGA 2COQA 1DVFC 1CFNB 4O2CA 4NNYB 2DIEA 2IMNA 5E6ZA 3RAJL 3OKDB 3OR7A 2A4ZA 1YC7A 4UQDA 1XSOA 2YEZB 1E3FA 4RMWA 3KPSA 1Z7JA 4L4VD 2DQTH 2GYSA 3LPPA 1ED3A 1XZ0B 3CIQA 1N2RB 1HCZA 4M4PA 4AE0A 1DN0A 4LCCA 3QUXB 4O02L 5FPIA 2HLAA 3KL3A 4MHHG 3LNDA 3D39A 2P49B 3CFUA 4F91B 3EBHA 1IC5L 2COVD 2YGQA 7PAZA 3HPJA 2B5IC 4PJBE 1LGVA 2BP0B 4N2NA 4I77L 4AEHL 4HA1A 5HHXH 1T22A 1KPVA 1CG9B 3FN9A 6FABL 1SQMA 4XMPL 3P77B 3ZHKA 2W0LA 3FT3A 4U6HA 3Q3GA 4YUEL 4TULL 3RIKA 1B4JH 1R0AH 1A3RL 1OT1A 2DI9A 4XC3L 2W1NA 4NO0A 3SKNA 3PP4L 4WEMB 1A21A 5T1KA 4CSSA 1ZANL 1YNLL 4O9HH 4YXHL 4DO5A 3RUGE 3LPOA 4HWEH 1CD1B 2B0SH 3O9WC 1S7XA 2NY2B 2VC2B 3RGVA 1E90A 5ESVA 4HIIA 2EVFA 5EN3A 5EG6C 4F8NA 4WI3A 1G0DA 1W0VB 2PCPB 4D0BA 4GKZB 2RAMA 4JY5H 5BNXD 3QZWB 4AQOA 5DTFB 3BPNB 3O6FC 3M88A 2AHIA 2XWBA 2NX5B 3VXUE 3O9WA 1U9KA 1D3CA 2HH0H 3ETTA 8PAZA 1B9ZA 3S37L 2EXTA 3C08H 3S3CB 4QOKA 4FABH 3TA3D 1TTAA 1FZMB 2GSIB 4U0RC 2ZAHA 3WFHB 2AJYH 1RVFH 3H42L 1OB1A 3K1DA 4JRYA 3U46B 4PS4H 2VDLH 1TTUA 1NC2B 4LLWA 3BDXA 2KH2B 4JFPB 4QGYA 1SMAA 2AQ3A 2AJXL 1FNSH 3TASA 3B9KD 2ZKXA 3LKNB 4QXTB 3IJHA 3HHSB 1BFOA 2CJSA 1WZMA 1MHHA 4FMKA 4ZPTA 2OYLA 4HG4K 4IRSD 4WW2A 2OJ1A 3LOWA 4JZNB 3PRZA 4ELKA 4YNYA 5D9SB 5TDOA 3UOAB 1MAMH 2CMRL 3LS4L 3IXTB 2BVTA 1LK3H 4LOUD 4OD3L 1BPVA 4B5ZA 4NQXA 3AITA 4NQCB 3FSZA 4F8OA 3SIKA 4KK6D 4YDZA 3ARDA 4J3OD 5EV7A 4X6FB 4NLAA 3JWNC 3PWPE 4XP5H 5FUCC 4CA4A 4FE9A 5D96B 2BY0A 3NA9L 1AS8A 4UV7L 5D6CB 4I18B 2OP4H 2P5EE 4DQAA 3HC3H 3UPCA 1QFUL 4ATWA 1GPOH 2P44B 3ECBB 2FATH 3VNYA 2CKBA 1RMFH 5ADPH 4HUXB 1Z0MA 2DQCH 2FX9H 1I3GH 2V2XA 4UNTA 3NACL 1AD9B 2GY7B 4GSDH 1JNNH 1JPSH 3C8DA 3VTMA 3IFOA 1MRFL 1NIDA 2ZSWA 1RVFL 3D0VB 2WZ6A 2LLLA 4P2OD 1L5GA 4X98A 5AWNH 3ULVE 2EUZA 5I1EL 2F58L 2DY2A 4UT7H 1QHQA 3MC0A 1BMWA 4XMKH 1V54B 4GRWE 3F12B 3FOMB 1RK0B 3S3SA 1AGFB 1FF5A 3L5XL 3HHRB 5TE7H 2EYSA 4O5LH 5G5DA 2HTLD 3B7RL 4HZ1A 1E5BA 3A47A 4Q9QL 2AITA 3NZ8A 4FQ2L 3T8VA 3VFMB 3MFGB 1TMCB 5DEGA 1C5DB 1MAJA 1CCZA 2VN4A 2VL4A 5A2IH 5K9OB 3RLSA 4JDEA 2Y3AA 4APXA 3CMGA 1VHPA 4FXLA 4NO2B 5D1ZI 4JFXA 5J6GB 1YNLH 2IOIA 4E9YA 2DL9A 1CLYH 1IZKA 1QSFB 3R0MA 5D1XA 3TZVD 4J3BA 5DQJA 1SBSL 3EFDH 4P07A 3GK8H 4ERSH 4L3FA 3VXRD 4FD0A 3W9DA 3H9YA 1OQOA 1L7IH 4Y4FA 1RZGA 1TQVA 4WI0B 4JO1L 4PJDF 1JNJA 2DMBA 4ZMNA 3QEGH 1OSPL 3OPUA 1GS6X 5JIPA 4XVSH 3ZR5A 2XKSA 1SYVB 3PQYB 4X80L 1DQDH 1IGJB 4NRZA 2XN0A 3WE6A 3UC0H 2Y69B 1MCDA 4PW3A 4TLSA 3H7BA 4JN2B 5F8RC 4M93C 1XBDA 4U6VL 4XR8C 1HH9A 4HWBL 3VMPA 1OAQH 25C8H 4JFYB 3U9UA 3PAYA 5EZJA 3AT8A 4QHNB 4U1NA 3QDGB 3UROR 5IB5B 3DHMA 3OJDB 3QEQB 3ZE2E 3JT0A 3ARWA 2VT0A 4YXLH 4G7VH 3CN0A 2XWTB 3IDNB 4NZ8A 5E2UL 5FHAH 2NT0A 4OFYA 1LMIA 2H2SD 3SOBH 2FX7H 1NGWA 1F58H 4LSRL 5EUOF 4BSJA 4F7PB 3VE0A 5KBDA 5I76B 5BJTA 3OSKA 2WNXA 4HGKC 3Q8EA 4IOFC 1X7QA 3BQUC 1S5HB 1TZGL 2EDWA 3BGMA 5GS2H 3K6SA 5ITFB 3FHAA 1AE6H 1YEGH 2EIJB 3BZ4A 3WFCH 2A1WL 2JFCA 2BOLA 4L2LA 4MMZC 3U9PH 4IMKA 1CICC 4FI7A 5E1AB 4A7TA 1SJMA 1T21A 4H8PA 2X2YA 1DR9A 4N2AA 5KYWA 3B7TA 3SE9H 3NCFB 4PVBA 1Z5HA 1KGCE 4GYBA 3QB7C 3TBWA 2F54B 2YPVA 3K8LA 3P3UA 3DRQB 3AREA 3CDGA 4ZRGA 1FN4B 5JIMA 2EDOA 1C08B 4XN1A 3C9NB 4YHOL 2VYRE 4FG6D 3JTBA 4JG1H 5T33L 4DZBA 1BLNA 3S37H 5IHBA 4PH8A 4F9PC 5DS8B 1VZHA 5CEYB 1P1VA 1QRNB 1OW0A 2BVPB 3HE7D 3L1FA 3KBHE 3EH4B 2Q2EB 2WQSA 4XZ4A 1D5XB 2BS71 3BESR 4UIKH 4P04A 5DEFA 3V9CA 5HYSG 2KPNA 2R2HA 3TBYB 5ANME 3STLB 2MPAL 3STLA 2ITDB 4WGWB 3OMNB 1IKOP 4PD4J 3RWFB 3T2PA 1CYWA 4RWHA 1NA8A 2OK0H 4PGDA 1UVQA 1A9EB 2R15A 4UM8A 4K5PA 4S1RL 4OF7A 3NRQA 4XB7A 2YR3A 4PI2A 4D8PB 2H5UA 3UFIA 3MYJB 3FN0L 3O3DA 3MMEB 5E4EB 5B1CA 4Q9RH 2HVJA 2J12B 3S2AA 1CZ8H 5D7EA 4CSTA 1TDQA 3PHOB 2R1WB 4Z7IA 3UIZA 1PTZA 2J1ZA 2A9NH 2WXQA 2OQJA 1ZHKB 3FB7A 1D6VL 1NLBH 3VFOB 1LO4H 5B3NA 2DQFA 3P9MB 3HS8A 5AAWC 4HLZH 1N59A 4JKPH 3I6KB 4L9LA 4MD5A 2AS5M 3A67H 5EF0A 1P2CB 5E6IB 2N3JA 3K8MA 4GSRA 4JHVA 1AHMA 1MXGA 2QPFA 2DH2A 4Z77A 4K71B 2A9CA 5J5EA 4ADIA 5H35B 3KPRB 5EWIH 1UEYA 3WN5C 3VI4E 1WGVA 3MXVL 4LCIL 3TURA 3D05A 1JHKL 1PZ2A 3K6SB 3WDHA 2DMHA 1H15B 4ODTH 3L48A 1P5UC 4D8PA 4ZT1A 2FJFB 1U95A 1KGJA 3MYJA 3L9YA 5E8EA 3PIQB 2Y22A 1B0WA 3QC5X 4AYEC 3DX6A 4EAEA 2VN7A 3RWFA 1P1ZA 3O2VH 4XVOA 3A23A 1PY0A 1YEEH 1EFXB 3KPRE 2WBXA 2XN1A 1UJ3A 4U49A 5EC2A 3T2QA 4PJGF 3TBCA 1P5UB 4B5EA 3K6NA 1W6WA 1KY6A 2NX5E 3VXUB 4OV5A 4WJG3 5HI4D 2PO6C 4V2BA 4Q9QH 1IGFL 3W9EB 1E4WL 3MRPB 4RQQB 3QXDB 3VMOA 2P45B 3FT4A 5B38A 3D7PA 4XWOC 1KB5H 2VXUL 3CBRA 4ONFL 5AYUH 1ZEAH 1EHXA 4Z23A 2R29L 3U0TB 3IETA 1P2CA 3DYOA 3EDKA 3DO3A 5AVYB 3KHQA 3IDMA 4RMQA 4PRDB 4WI0A 4UUJA 1RK1A 4F1SA 5FFLA 1FNAA 1EHLH 4HXAH 2BINA 5JMOC 1T21B 2DYPB 1BJMA 4HK3N 4MGXA 5HHQB 2YA2A 2GI7A 3E6FB 4TUJA 2FJHA 4XODA 5CZXD 2Y1ZA 2WZAA 2XCMC 4XAKE 2PCXA 1YY9C 1EH9A 4PRDA 2LFGA 4A2LA 3PWPB 3U79A 1G7IB 3KXFE 4BZ1H 1EGJH 5K9QI 2ZYIA 2QKIB 3ATEA 3BDYH 3BZFA 4L29B 4KKCC 3V0WL 5DUBB 4C83B 2XQYK 1AGBB 5H8DA 5K9JH 1LE9A 1ZCRA 2JCCA 5DYFA 4I85A 4BFIB 1YEJL 4R7VA 5CEZL 1USQA 2Q7YA 3VFNB 5GGVH 3WO4C 2WUCH 2X40A 3BPOC 4FP8L 2J6EL 1QW9A 1N19A 4MQXC 5FGRA 3Q8FA 2J88H 4CILA 3L3KB 4RSVA 2IH8A 3L3KA 1VEOA 5DURD 3M45A 4MBOA 5L6YL 2D0GA 2IF7A 3QHFL 1CU4L 3Q44A 1ZJBA 3H7BB 4RAVB 4G8FA 1UJ3B 4J3TA 4P06A 4GKNA 3U7WL 3RBGA 4M3HA 4FLOA 2PO6D 2OMVB 4IM8A 4PJFA 4UOW0 3NSXA 4JO2H 4IU2A 1G84A 4NOFA 1D7FA 4Q6IB 4LGSB 5KS9A 1UM4L 1WAAA 2BNUB 1UATA 2BSSB 4LEBA 4LIQL 3CX2A 5J9PA 1N10A 4X6CF 3QFJD 4AZ8A 1AD0A 3ZUNC 4TVPD 5EUOA 3BKJL 3MACL 2IAMD 5SWSE 1MLCB 5TD4A 4A66A 4PJ9A 3P4NB 3MAWA 3QWOA 4B96A 1NMCC 3UMNA 3QUZB 3QYCA 5CIPH 1GHFH 3TNNB 1MQ8A 1J1XL 2V4LA 1YUKB 1PQZB 3MV7B 3WKMH 3ARED 1MJ7L 1OV8A 3VE0B 2YLKA 4WO4D 3BKCL 5EC1A 4HLJA 3V4VA 4Q2ZB 5FYKU 4JDVA 5SWSB 1WS7A 3NFSL 3SCMD 1GCFA 1XFPA 4KTDL 1EJ8A 4R4FL 5CJ8A 4BCYA 5K9JL 5EA0H 1FZOA 1U41A 1GGIH 1T0NB 2PMZA 1KV3A 3IMTA 1KC5H 2XOTA 4IBUA 4RX4A 1KCWA 2EO1A 2Y7LA 1RJYB 2V33A 5HPMA 4N8VB 5E2TL 5GRXG 1UVQB 1KTRL 3HRZC 3TO2B 4CVWA 2HT3C 5DFWH 3DGGB 4G6JL 1E5AA 1LP9E 4OGYL 4QRTB 3QULB 5CGYD 3SY6A 4EUPH 1B0GB 5E4EC 2TRHA 1KTLB 4PJEF 5FV2A 2AJUL 4XNMB 1MZZA 3JYCA 4L8BB 1H6TA 2CLVA 4Y2DC 1P1ZB 4U3XA 3QPXL 5IUSA 1AACA 2F1EA 2QT6A 3E6HA