4B95C

Pvhl-elob-elob-eloc complex_(2s,4r)-1-(2-chlorophenyl)carbonyl-n-[(4-chlorophenyl)methyl]-4-oxidanyl-pyrrolidine-2-carboxamide bound
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
134
Chain Sequence
VLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small-Molecule Inhibitors of the Interaction between the E3 Ligase Vhl and Hif1Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
total genus 31
structure length 134
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4b95C02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4b95C01
5LLIC 4W9HC 4W9EC 4W9GC 4BKTC 4AWJC 3ZRFC 4B95C 3ZTCC 4BKSC 1LQBC 1VCBC 4W9IC 4W9LC 3ZRCC 4WQOA 4AJYV 1LM8V 4W9FC 4W9DC 4W9JC 3ZUNC 3ZTDC 4B9KC 4W9CC 4W9KC
chains in the Genus database with same CATH superfamily
4YE0A 5IR1B 1T5WA 3CTTA 5I8KL 3S8FB 4JVPA 2VLRA 4UT9A 4APXA 2LLNA 2X10A 1T7WA 2WXGA 2PWFA 1HXMB 2VMEA 5D1QB 3IDGA 5DHYA 2W9EL 3LRKA 4M8VA 1CURA 3ARRA 3KYKL 3BAEL 1X4YA 4M00A 3LV3A 4LKXB 1UUSA 3P3RA 4RMRA 5I19L 3J8F7 3BI9X 4JFFA 2ZPKL 4NIYE 3C08H 3CFBA 1BAFH 3QC6X 1NBZB 1TCRA 1UADC 1IBGL 2WWKT 3FSOA 2X4RA 5CR8A 1F4AA 3S88H 1GYVA 1F4XH 3GTNA 3MRRA 2QPFA 3W0WE 3FUHA 4W4NA 3LX9A 4BZ2A 1A22B 2A77L 2GUOA 3GBML 5EU6A 1A66A 2WNGA 1WLHA 1WIUA 5MEQA 5DVKA 1J5CA 3DJ9A 5FM4A 3E6HB 3HBZA 4M29A 3GMOA 4Y88A 2BNRE 1OV8A 4P4KB 1FVDB 3H0TA 3L3KB 3LNEA 1LWHA 3LRLA 2VZUA 2XTJD 1FQ9C 1LNUB 3HPLA 1UT1A 4YDJA 4L5FL 3D7PA 5I9QB 2WXPA 4E41B 3BP6B 4I48B 3MYZA 3D0VA 1MF2H 6PAZA 2FEDC 5I73C 4C4UA 3QXWA 3KPSD 3WFDH 1AS6A 3RFRA 2WZPA 3S4SG 3D39B 2AKRB 4LP4A 4P0DA 1K3IA 2E46A 2QQLL 2PYFA 1CYWA 3MRGB 4OF0A 4LSUL 3W11C 1J9RA 5CJ8A 1M57B 1RURL 1RUPL 1XHHA 1EFQA 1YYMH 1XH3A 1TDQA 3QUKA 3FRPB 2HN7B 4QWWC 1SHXA 4O51A 3DTXA 4BCXA 1FFQA 3GO1L 4N2AA 4WKZB 2Q2LA 1AGDA 2XWBB 2X4NB 2P1YA 4JG1L 4YEFA 4PJEA 2XWRA 4ODWA 2O61B 2R9HD 3FT3B 1TFPA 1EJOL 3QWOA 1NEUA 5D8JH 1OAQH 1GIGL 1TQBC 4Q6YA 4FKHA 5BV7B 3FTVA 3KYMA 5BMFH 1XGUB 2NNFA 4X6CA 3BUYA 3EHBB 3KPLA 4ACTA 1A6TB 2A0LD 4U0RC 4XHJD 5SWZE 2HLAA 2Q76B 3HRZC 5AYUL 3FQNB 4IBZA 5FV2A 4CC1A 4PJFB 4D0CB 3JUYA 3P2BA 4WKXA 3DX6A 5BV7H 2ZAGA 2NY6C 3EZJB 1KJVA 3GLAA 4MZIA 3G6DL 3HI1B 5JW3L 2OZ4H 4YXLH 4OZIE 2VCOA 4ZO8A 1MCOL 3CDCA 2BNQE 4YDKL 4G82A 3VWKC 2CHWA 3JWDH 5IKCA 4ZODA 4PJXB 1R75A 4U1IA 1SVZA 2GABA 5KYXB 3KYMB 4JR9L 3FTUA 4KH9A 3J27A 1T6VN 3FTGA 1M7XA 4HKJB 3RAJL 4I8DA 5IJKA 3FFCD 1IU1A 2G5BB 1FG2A 2XWCA 4XHJC 2BVTA 4MS6A 1EGJH 1O6SA 3NEXA 3LTVA 4F2MB 2Y7NA 4ABVA 1HH9A 2AK1H 4ELMF 3X13A 3FB5B 4W9EC 2JKTM 5LGYA 2CSPA 4DQOL 2NZ9C 2Y2TA 5CSBA 3RTQA 3FQ4A 4LSVH 4ABUA 4PJDE 3MRIB 4LLMB 1HX0A 3RURA 2FO8A 2W60A 3OR7B 2WXJA 3P9WB 4BIKA 3MBEB 2WLHA 3MV7D 4LAQH 2F0CA 4YSPA 5DZAA 5JTWA 1KLGA 2NLJA 4LGRB 1HHHA 3OX8B 5CD3A 4LASL 1AR1B 4JK0D 1HSBA 2Q8AH 3CSBA 4XMWA 4Y5XC 4QAWA 3MREB 4GBXC 1OXYA 3G6JA 3C08L 1HE7A 3FCSB 1KCSH 3L54A 4FQCH 3KPRE 4OKVB 5DC9B 3VGGA 2ZUXA 5MERB 3W11D 5EORL 3TJEL 2YSSA 1WYJA 4W9GC 5C07B 5L88H 1RJZA 2YA1A 3BUPA 2VIRA 1NBYB 4L1HA 4FNQA 3JTBA 3WTYA 5AZEH 2PCPA 4I5BB 4JO8A 4GS7C 2WQVA 3GS4A 2YMTA 3ZDYB 2F53B 4AG4H 3SOBL 4IBTA 3V6OA 1QX1A 4H7VA 1BGXL 1MW1A 1K5WA 3PWPE 1XCQB 4YL4A 1RHFA 3HG1E 3NJNA 2VTFA 4IBWA 3FO0H 1F90L 3IDJB 3T6QC 4OZGB 4UAHA 1ZLUK 2DWYA 2W38A 1JPFB 1WP6A 3EOAA 2BJMH 3EFOA 5HGAA 1F18A 1PZAA 4GQRA 2VERA 3CFBB 2ZAIA 3LZRA 4JFFB 4LPYA 4O02B 1J0HA 4GKSA 4NT6A 5C7ZA 1FYTE 4I2XB 2JCCB 4UCFA 3OVUB 3NK3A 4HUXB 4IBYA 4JFOA 4XPGH 2Y1VA 4M43L 4LNVA 2FO4B 2HG5A 2CGRL 3EH3B 4EO5A 4FABL 3N43F 2Z0BA 1MOEA 2VLRB 3PP3K 3WKMH 3WY1A 2BZDA 3OMZA 4PJ9D 4TSCL 5FO9B 1SJHA 5FYLH 3OKNA 1BAFL 2C9PA 1IC5L 5DD5L 1UOVA 4X7SH 3OG6B 4BFOA 4UINL 4HWEL 3GSNA 4Y4KB 2Z64C 2Z31D 2CDFB 4CILA 3PQYE 3VM7A 3WL9A 4HOWA 3L4WA 1EHLH 3FJTA 5TQ0H 3DIVA 3ZL2A 4KUCD 5I8KH 3QUZB 2ZKXA 5HYSA 4PWHA 1A6VL 1QR1A 3ARYA 3MV11 1CLCA 1S7WA 2XTJB 1M42A 3LB6C 3DHMA 4NGHH 2DEWX 4JO3H 3T8MA 5HDBB 1SY6A 3KPNA 4QXTB 1ULVA 1R4XA 5HYJA 3BSGA 2ED9A 1I8IA 3NFSL 3RYMA 1U8MA 2H8PA 3EOBA 2J88L 3INOA 2WM0A 4HS6A 3ZTCC 1LP9B 5EO1A 2BXZA 1U41A 2VSDA 2DJ4A 1A7RL 2YRZA 4XO3A 5DSCB 2OX5A 1GMIA 1T1XB 5IM7B 4HUVA 4Z8FL 5MEPB 3VUAA 2WQAA 1BVNP 2XA8L 4DQAA 1IKNA 4K55A 2E8YA 2DQCH 1SJHB 4Y2DC 4JBSA 4PRHD 1RIHL 4LVNB 3H3PH 1JNHA 5EEXA 3QQ9C 3SKUD 4H8VA 1FC2D 3SN6N 5AWNL 2J73A 3QJOA 5EIIG 2NW2B 3I84A 1A7OH 2LFEA 2C3XA 4FL4C 4MAUH 5D2LA 3UBXA 2X40A 2ZSWB 3QFGA 4W6WB 4G6KH 1DBBH 2IF7A 1NGZA 1WD8A 1NAMA 3TXAA 3Q7JA 4HEPA 3KLSA 3B83A 3B3IB 2A7BA 3MV7B 4CMMA 5SWZB 1G6RB 3D0LA 4ZW5A 4PJ9B 3N9GL 3Q8FA 1UWXK 5DVMA 4PRBB 2BSRB 4YQXH 1I8KB 1F00I 3K6NA 2IAMC 5C7XH 1MXDA 4FQ2H 4RCAA 2R1YA 2ZOOA 1F3DJ 3NTCH 3DHUA 2CRMA 1XGZA 3DVFA 1N67A 1DVXA 2Q86A 3CZNA 3KWUA 3ZZSA 3I75A 2EUZA 1BLIA 3MLRH 2P80A 1INEH 4ELME 3FFDB 4LE8A 2VM3A 1ZTXE 4ZG1A 2UZXB 4GIPD 3CX2A 3DX8A 2Y07L 1S7VB 3SBWC 2YRBA 3ZN6A 4NZ8A 3OB0H 3TNMA 4OLYL 1F4WL 3JV4B 1JD9A 3EYQC 5AAWA 5CN1A 1H3TA 2JB5H 4PJFA 1KJMB 2M2DA 2WLLA 4PWIA 2Y5QA 5JOPD 3RZWA 4P05A 4M4RB 3U9UB 1A0QL 4HGKC 1MNNA 2EH7L 4L1BA 1XH1A 4Z3JA 4XCYA 3V5DB 2XZAL 4UB0L 2K6WA 5CILH 1IGMH 3CZEA 1CD8A 4A7TA 1E8YA 2W9LA 3GRWL 5CBAA 3CFNA 3DVGB 2QHRL 3O8XC 4EBQH 1NDMB 2FUTA 4OVVA 4KO6A 2QSVA 1T83A 2C26A 3H9ZA 4HK0B 2K0RA 3GSOB 5CWSB 3WMPA 4P2OC 4ZPVB 1JF1B 2XVLA 3MLWL 1A6WH 2ZKHH 4O2CA 2OJEA 5EEUA 5DO2C 1T3FB 1HIML 4ZFZB 4KQ3H 3X13B 1PFCA 3SDDC 1OALA 2ZD0A 1FIEA 1MCKA 1PZ5A 1YNLH 5EA0L 1D9KC 4BINA 1G9NL 3P0YL 1FIGL 1FN4A 1OE2A 5DEGB 1SXCA 4OLWH 1WAAA 1RZKL 2MQ3A 2PWHA 3BVNB 2AI0H 5JXED 5IG7B 2NQ3A 3O41B 4HIJB 1D9KB 2Q6WB 1YEGL 2F68X 3B43A 2AK4B 3C8HA 2NXZC 2PXYC 1LO2L 1UWFA 1AR2A 4ZMAT 1CT8B 4I9WE 1XBRA 1JTTA 3ZE1E 3EJUA 4NENA 5E70A 4XNAA 3HI1A 3ZU8A 2JQAA 4HJEA 4NIKB 4BH7B 1DQTA 5B4MC 1K5NB 1PL3A 4R90L 5FUOL 3C60B 5EMYA 2E4TA 1TXKA 2N7SA 1WC7B 4I1RA 4QYOA 3PU7A 3EJCA 4JY4B 5HGBB 5DZVA 1SN5A 4ATWA 1ORSA 1GZPB 1XIWB 4NZRL 2BMKA 3CPLB 4KUZH 4F33B 5CZVL 4LFHD 1H3XA 5LB1A 3RIAF 1TZIA 1HI6A 1VSCA 1L0QA 4W81A 4UF7C 4HZLA 1U9KA 1W72L 4IU3A 1JPST 4WFHD 3VDAA 3QIWC 4BUGA 1GJIA 1NUFA 2DLGA 1OTTD 5CGBA 4K07A 3UO1L 3FUJA 4PRIA 5ACMA 3UFIA 3RX8A 1JUFA 4LCWE 5IOPA 5E8EA 5AVTB 4BRVA 1CVSC 5CP7B 3RWFA 4A2DA 4DGIL 4ZMYA 3GIVA 2V8MA 4IOIA 1K72A 4GAJL 4H8WH 3UAJC 2VXSH 1DQQA 4GSDL 5LAPA 2VLKD 4RGNC 3AU1B 4IMKA 3B2MA 4A6YB 1FPTL 2X4SA 1I9RH 4G6ML 1E5CA 1URZA 1JV5B 2IADB 1M71A 2PO6C 4P3DB 1LO4H 1VZHA 4U1LB 5FV1L 4LGPB 2YK1H 1AC6A 3KD4A 3VXNB 4YLCA 3IN0A 1W72H 2CO7B 3W9EA 4JS7A 4YHKH 4JVWA 3EJSA 5L0QB 2EYTA 1H3GA 2X3CA 4XN5A 4PLNC 3HIZA 1Q0YH 4QYAA 4X0KA 1NANI 1NICA 3IU3B 4B9PA 1UB6A 3E8UL 3C9NA 5LQBL 5CAYB 2O5YL 2PCYA 1R0AH 1KMGA 3B3IA 2ZP0T 2WXIA 2RALA 1BREA 5LAXA 2JJSC 4OGYL 3IVKA 1T7YA 3ATFA 3MX0A 1THCA 3BOVA 5T5NG 3QJHA 1UENA 4MDJB 4DEUA 1VACA 4YHNB 3QO1A 2VDRL 4F7CB 4F9PA 1KIQA 4ODXB 5GGRB 4QRPA 1CDBA 1JNHB 1ZS2A 4W9CC 2EIBA 2EDKA 4AQ1B 5JW4N 2H6PB 3GTTA 1AXTL 2GUOB 4KUCF 5EU6B 3O0RH 4PGZA 5KBMA 1AO7A 1IZKA 1ORSB 2AQNA 2VDNH 5EH1A 4G1MA 3OR6A 3QUZD 3F7PC 3D4YA 4XOEA 1FF5A 4PR5A 5GRVL 3TVMA 3K0YA 1MEXH 1JP5A 3P54A 4BWTA 1QSFB 2YR3A 1E43A 4L48A 1G9NH 3U6RB 5BO4A 4NENB 2V5RA 4NQVB 1XWVA 2IH1A 4HX1A 2BSSB 1MW2A 3ZSTA 1N5YL 2X4PB 2IDFA 3FT4B 5G5DB 1E8XA 4U7KA 3GINA 4F7TA 2HZHA 2YA0A 4TQ8A 1PQZB 4Y4FD 4HJSA 4DZBA 3BGAA 5C1MB 3TNNA 2IJ0C 2VRQA 3TT1H 2BHFA 4KROB 4UT7L 5F3BB 2BFVH 3LZLA 2FIKB 1P9MA 1EDHA 4QXGL 2XZAH 5EBMA 5IJBC 1YQVH 1SPDA 2GG1A 3QG6B 1FH2A 4OD2A 5JHAA 2AP2A 1E5AA 4FTVD 3KEHA 4WEUD 3FQRB 2YGQA 2YN3A 4F37F 3BAWA 2W88A 4TLKA 2JCWA 4S0TD 5T1DL 5KS9A 2WUBH 1NDMA 3EYUL 2EXWC 2P9RA 1E3FA 4CN6A 5HBBA 3UTQB 4KRPB 4YWGL 5C9JB 4DAGL 4NKOB 4LRIC 3VA6A 2W1NA 2XHNA 5BJTB 5E2TH 4JAMB 2QSQA 1HCFX 3MJ9A 5J56B 3HC2A 3VFWA 4KNQA 3IM1A 1CFNB 4HCGA 1ZEAH 9CGTA 3GXDA 3IBEA 3V0AC 3VXMB 5LBVA 4FERA 5J11B 1AZRA 1R5VB 1B2YA 5EV7A 2C4FU 4IRSB 3TO4A 4R7DA 4CNIB 4BK4A 3NJLA 1FWXA 4MQTB 1QOKA 3OGCA 5DMJB 5ERWA 4KKQA 2PETA 3FMGH 5AYUH 1LDSA 2XA3A 2EDHA 2Z6FA 1KUMA 3BH8A 4OZFG 1CFBA 3BFQG 3MR9A 2YMXH 4C83B 2NW3A 4AXWA 4J6RL 3BZ5A 5JW4Q 5EUOB 2I9TB 1C5BH 4QI3A 1FNHA 1OGAB 5EPMA 2C9SA 3ABGA 3MGAA 1RULL 3OHXB 4OLZH 4UZSA 4XXCC 1W2KT 4ERSH 3MREA 5IVXB 3ZQWA 1K3ZA 2Q7AA 1HL4A 4FQLH 4R4ND 1DN2A 2VLLA 4U1HA 4YR6B 3OLDA 1C08A 3ALWA 3GBDA 3RI5F 1TO5A 3R4RA 5HYJE 1XSIA 4KWUA 3GSNH 2NUPB 4U1JB 1EEZB 3HUJB 1H19A 4B7IA 4NCC2 3NUKA 4Q9RH 3CLFL 1MN4A 4EIUA 3DI2B 2J8UB 5DVOA 1LE5B 1SXZA 1AH1A 2YPLD 2CWRA 3X1BA 1QO3A 4IMLA 1IIIA 1UTDA 4X6FB 5IVXF 2IBZY 2IH8A 3PWVA 1NIDA 3NSJA 5LBGA 2ZX5A 3B1TA 1MWAA 5JR1H 5I82A 4PRIB 5D7JD 4Z3EA 1NKRA 3D4GA 4JANA 5E6IA 5JPMC 3DLQR 4H1LA 2KYIA 2V33A 1WF5A 3MROB 1NFIA 5FM5O 3O4LE 1G7LA 5HXMA 1B0RA 4Y5XA 2BWDA 1MCIA 3MR9B 3TN0C 5BUAA 4XWOD 2XN9B 4G80B 3GTVA 3CZGA 5I74B 4ODSH 3CPLA 3CDGB 4X7SL 4ODSL 3QXAB 4PJHB 5CO1A 3N0AA 5EF3A 4IRZH 3NABH 3T6VA 2AFNA 1YAZA 1OM9A 5K9KB 2ZXQA 1KPUA 4QJ4B 5JOEA 1GTFA 5ICZB 1ZLVK 3U0PB 4K71C 4PP1C 2I9LA 1FFTB 2OJZH 1IGYB 1PDKA 1U6AH 4JKPH 3SODB 2WXQA 1A1MA 4DH2A 4TKWA 2CLRA 4JRFA 5EOCL 3KHQA 2VDOH 4YFLI 3RIKA 3MJ7A 4ZQKA 4ZO6A 2JXMA 3OKKA 3UCRA 2BNUB 1R3HB 2HX9A 5T33L 4AM0B 1OE3A 2I24N 1PIFA 1TZGL 3HZYA 3QIBA 5IW6B 2GSMB 1AO7E 5KVEL 1W8OA 2Z8VC 1XD1A 2XU9A 4FTVB 2VWEE 2H1XA 4A2LA 3B2UD 3S6CA 1RULH 1PZCA 4OLZL 3D50A 4FXGC 3LEVH 3QUKB 4N2BA 1I3RA 4ZAKD 5F3BA 3S98A 1BXAA 2GY5A 4N6RA 4S11A 4OM1L 2R0LL 3SBPA 4P2RB 4AX3A 4MX7A 1JPFA 1VFBB 1LK2B 1N5AA 3X1FA 5L88L 3WTWA 5KVFL 2FO1A 3WJMA 3H56A 3TF7C 2BP8A 1C7SA 4HC1H 1ZV9A 3MNZB 3RWJB 4R4BA 4L8BB 1JWMB 3C8DA 3O3DA 3NGBC 1SHSA 2WQRA 3L5HA 4HX1B 2D9CA 3QCUL 4KTYA 2FJFB 2J57A 3HNSH 32C2A 4OCWH 3LQZA 5E2VH 5JHLL 1JHTB 2FEJA 1J87A 4HK3N 1OCWL 5E5MB 1HOEA 1JYNA 1QSFA 2JF1A 3ZTEA 1CG9A 5JIKA 4LOEA 1A8ZA 3U46B 5J8OA 5EIQA 1UXSA 4MA8H 4W9LC 4P57B 5F7DA 4IOSA 3JWOL 5IBTH 4M62H 1MFDH 1TVDA 2IGFL 3HE6C 3PL6B 3G04A 4XTRC 3TBSB 5F1NA 4R2GD 1CUOA 5I1KH 3MRJB 2VLJE 1CFSA 4PV1C 3TV3H 3ZGIA 3SKMB 4YBLC 2FBJH 1O6TA 2WV3A 3D4CA 4Z7UA 2PWEA 2YZ8A 5BRZE 4PJ5E 3HBQA 5AVVB 3NEEA 3ILPA 4NKIH 4I13B 3ARQA 1DDHB 3ISRA 2K78A 4Z7QE 3PV6A 5FECB 4YSCA 2LGNA 1L7TL 1CGYA 3Q6GL 4ZOCA 4G59C 3T2QA 2OTPA 3P4OA 3ELQA 3MOAH 4N2MA 5CNHA 4ZNEE 1SHMA 4ZAKB 5D4JA 2CQVA 2Z93B 2PXYB 3TYFB 4Y4KD 4FG0A 2EDQA 2V3EA 1T0NA 3UYOD 2BHZA 4NUJA 2ESVA 1RSFA 1T4KA 3QO0B 5A16B 4TQPA 2KZ1B 5DHMC 5L4IA 5BMFL 4RRPA 5CIPH 2O6PA 4WCYL 1PS3A 2VXTH 3D87B 4IJTA 1KTRL 1BF2A 1JV2B 5DK2B 1FFNB 2BP0A 2FHFA 3MRBA 4OB5L 1F2QA 1U92B 4UOJA 5D7KE 1AG6A 5IEKB 5IZ7A 2JMRA 1IILE 1XQ4A 1QA9B 2G9HB 2VSKB 3L9RB 1JZ7A 1TNMA 2VMDA 3V0EA 4ILDA 3HBPA 2DKUA 3ROLB 1E4WH 1ONQB 1FNEA 3NJFA 5AL0A 2V7NB 1T4WA 3SE4A 1NFDB 2DMCA 2VXUL 2KKQA 5D6DA 4L4VE 1RXLA 5IHWA 4RGMC 2O61A 2E7MA 2UX7A 3LKPB 1GGCL 5I8EA 2W8CA 5JHBA 4H1LG 3WFDL 2AGJL 5AUMA 4M1DL 2PABA 4U3SB 3AY4C 4UTBA 3KLAB 3O4LA 4L5FH 4KPHL 2E3VA 1A9EB 3VFPB 2ICWB 5I1HL 2DQGL 3UTSD 3F62A 3OZKA 5T1DH 4CL7A 4UBDC 3AQZA 1D9KA 1RZGA 4RGNE 4DN3L 3U1SH 4D9RE 1LO5A 3RJDA 2Y7QA 4DPBX 4JCLA 4P57A 1Z9NA 4X9HA 1PF3A 1MVUA 4MD5A 5CEYA 4APQC 3OF6D 3STLA 1SN0A 1YQVL 2E6JA 5AKSA 3PHQA 4MJ6B 4KOBA 1Z3GL 3ZDZB 1WJ3A 2J71A 3F2LA 1L9QA 3GJEA 3NGBB 1KYFA 3IJSB 1EXUA 2EIEA 1EXHA 1S7TB 1RZ8A 2YPKA 2G3XA 4NSKA 4OZIF 5KVMC 1UZ6F 2QR0B 4HLEA 1EEUA 4I3GA 5G4OA 1X5AA 2NZ1A 2ICEA 3IFLH 4KI5E 3MAWA 3T8XA 4CMHB 4DKEL 3IJYB 2Y36H 3DYPA 4FOMA 1RJZB 1BPVA 4GKZA 1HCYA 5ALCL 3MZGB 2ATPB 5EIVA 5IQOA 3AM8C 1AZVA 4ZD3L 4I0KA 2Y7LA 4P2CG 3C6LA 4LOVA 4OCYL 4GW5B 1I3RB 3C6EA 2VLRE 3HN8A 4U6VL 2EEDA 1QI4A 5EDXA 1GS8A 4WLCA 2YQBA 1DVFC 3H2WA 2NYZA 3PXHA 4NJ9L 4XP1H 1KXHA 4LEOB 3OSVA 3S8WA 4XBGB 3OKYA 1RJLA 1TVBB 3V4VB 5I18H 1F6FB 1WA0X 3D85D 4KC3B 3F7VA 5E95B 1R3HA 1OP9A 2Q8BL 3VRJA 1TJIH 1TLMA 2XPGA 4BZ1L 2NNAA 4JO1L 2ZF8A 1FIGH 4LBAA 1NGYA 3PNWA 4Z3HA 1T22B 3QR2A 5EA0H 1NMCC 4NQEE 3BVNA 4BUQA 4HIHB 2J55A 4DPRA 5HI5C 1E4KA 3D8MA 1BECA 1U3JA 3B3BA 1T03L 5BZXA 1NDTA 4HZAA 4OLVL 4AYFA 5TDPA 4IBQA 4HKJA 3GXTA 4G3YL 3WEAA 7PAZA 4R6UA 4MD0A 5CIPB 2HKFH 2NYKA 1NC4B 4FZ8H 3QRLA 3PREA 4KKBD 1NLDL 5F72S 1SJXA 5KVFE 1GTNA 5AOIA 3BVWA 4PV8B 3X11B 1TKWB 1TO4A 1S9KC 3P02A 3GM8A 4KRPC 4BSWA 5E2WH 4LEOA 3JV6B 5IFAH 1P84K 3SQOL 3DXAB 3G6AB 4HOZA 1YRKA 1ETZB 1FNAA 1GGUA 3FFCE 4LPUA 4JRXD 4HHWA 1NJ9A 2ROYA 2VLJB 3W57A 3WIFB 1CTMA 3QPXL 1OTTC 3KR3H 5C70A 4OW6A 2JKLA 4MA7H 1QPPA 5J11C 2AXGB 1TQUA 5BJTA 4S1RL 4MNHA 3BRGC 4GKZB 2Y07H 1RZJL 1E9PA 4LF3B 2ITDB 3IGAA 4QTHA 3BEWA 4Q9QH 4K3EL 3KPNB 3JZYA 4H26A 1L9RA 2HXAA 5IHLB 3MV7E 2Y2WA 4JFZH 2R15A 4FQJL 4KJPD 1ITBB 4YUEH 3FN0H 3QXTA 1TKWA 4PSRA 4FQQB 1HWGB 3S36L 4JO4H 3UPCA 1BX2A 4R4FL 5DHDA 5IWLA 5SWZD 1B3IA 1NC4A 4FL4B 4W9KC 1LMIA 2B39A 5JUEH 1OSYA 3AXLB 4JM4H 4M7KH 1VRSA 3L4XA 2OTWA 3ULUE 4ZFOA 5DT1H 4Z5RB 4JFED 1BXXA 1FHNA 4XNUL 5AOZA 2JTYA 2PXYD 4MD5B 5T5NF 4E9TA 4RGOH 5EO9A 3RWDB 1MFCL 5IMMB 1YDPA 5KOVC 5IQ7H 3EH4B 4FLHA 1Q72H 3UG4A 3WY4A 2DWDA 1ZIBA 1A3QA 3SBQA 4L3EA 3ET9F 2MOVA 1ZWIB 5A40E 4L3AA 1TFHA 3WIHL 4OCSH 4UYPA 2DD8L 4PWGA 1F3JB 1UZGA 3GS7A 4R4FH 4Z0BL 3ULAB 4YC2C 1GGCH 1EUTA 3ECWA 3BGMB 1LNUA 3ZRSA 3QEUA 3M17B 4LT7A 4MXVE 4LCCB 4MLIA 2BVYA 3RZCD 3MCKB 4BRJA 4P2OD 5C0FA 2VAAA 2YXMA 1AGCA 2OL3B 4KI1A 4AQEB 4X5WA 4CKQA 4Q9QL 5C0JB 1U8QB 4Y2DA 5HGAB 2BDNH 1IMHC 4EKXA 2BSDA 1DUZB 2HRPH 4OCLC 1MJJB 2FX8H 2WY3B 2ZXAA 2XZCH 2QSTA 1OSZA 2BVPA 4Z3IA 3NJHA 4KY1H 1F6AB 1OIOA 1IEBA 3QAQA 3C6SA 2P47B 1KIQB 3BGFC 3RGVA 5BVJA 2F53A 2KMWA 2CLVA 3DX9A 3GPSA 3TO4C 2W65A 4OCXL 1AIFB 5CJXC 4H0IA 4KDVA 1HL8A 2NY6B 5F7NC 5MERA 4TS6A 5CJQH 1UG9A 2EEAA 3FUKA 5DO8A 1YO4A 4ZMVA 1XZ0A 4ZW3A 1MPAH 1XGTA 1KENL 1OF0A 1HS6A 3O9WB 4JFYA 5GGSY 4IGBD 3ARGD 4MXWH 4ZFOB 3ZE1B 4U1NA 3SDCB 4F92B 1I9JH 4XXCA 3HEIB 1N8ZA 4N4YB 1MH5B 2DL2A 3SBWA 2EDMA 4NKIL 3VXSA 2MHAB 1J88A 5EU4B 2PPAA 1CFVL 4JFSA 3QAZB 3TCXA 2ZOLB 1Z66A 3SY0B 3OMAB 4YDLC 3BPLB 2IDUA 3Q2VA 5IOPB 4N0UE 5E1AA 4F5CE 4PVLA 3QYCA 5DCCA 2OR7A 1QR4A 3ARZA 1TCMA 5GGTH 2H41A 2LAAA 3UC2A 2CLVB 5J1TC 1L0PA 1CFSB 2BSTB 3QHZH 4F57L 4OZGA 3V4PH 3QRFM 3Q44A 4GRWB 3MBEC 1J0JA 1EFXD 1I8LC 4QCIB 4BDVB 4E5XG 5KYXA 1K8IA 3F3HA 2C3VA 4JQXA 4Y2DD 4FFZL 5DUJA 5ECGA 4YZFF 3TZVD 3U4EA 2V17H 5GZNA 1E4XH 1OCCB 4O2EB 1MJJA 3IDNB 2Y36L 3K6SB 1J5DA 2QVIA 3DGGA 3QEGL 3C60A 2PYEE 2AXJA 1RK1B 2AJSH 4IIQB 4TUKL 5ABZA 1JXGA 4PCYA 5LAXB 3ZGHA 4A38A 4LSPL 4OF3A 3PQYD 4KITB 3SDXE 5TDPB 1I3VA 4IEFB 3V52L 3AREC 3LB6D 3BN9D 3MYJB 4AE1A 1R24B 3DMMA 4DEPB 2XXFA 3GPEA 4FCAA 3FAXA 1G43A 1RZPA 3BAKA 2P24A 4L9DA 2YAHA 3ILQD 3QIUA 5JDJA 2HFFA 1G7IB 1W15A 4X8XA 4NN7B 4ODTL 1IVTA 2ERJB 3O2WL 2ADGA 2CUMA 3O6ML 4JFEA 4PJAB 4YHZL 2KC0A 2VB5A 1CFTA 4JFYB 2CA4A 3CZFB 4RZCB 3MRFA 5FGCB 3E8VA 1I8AA 4MJIA 5DEGA 2X87A 3FT9A 1NC4D 2EIZB 2VQ4A 4BE6A 2UYLB 3QUXD 5T1KD 3FFCB 3PE9A 3U4AA 1B2WL 1DVSA 3D39E 1WT5A 3QEQD 2W65B 3CVHA 1WFOA 3L17A 1BP3B 4OJFH 1ZA6B 3N1MC 1NIBA 15C8L 1MCHA 4FABH 2YLKA 1GS7A 1HEZA 3LD8C 3OWRA 5A1AA 4WW2A 4LCYB 5LCVL 1Z9PA 3A22A 2VM4A 2X2UA 2GJZB 3IU4H 1BZ9A 2APTA 5BZZA 1LP9F 1JL8A 4NSKB 4P5SA 4UI2A 3QFDB 1BEYH 3QCTH 5E9AA 1UACL 3VD1A 4IRZL 1DBKL 4PRNA 2FD6H 3E1F1 4JJHA 3VDCA 1S7UB 1ZS8A 1UWEL 1C16A 2X41A 1EMTH 1E42A 4DO5A 3MCLH 4J8RB 1MHEB 1GOHA 3FCGA 4FYTA 4L2LA 4WVRA 1MVUB 3HTLX 3KPLB 5CEYB 5SWSB 3T4AC 5BRPA 3ML9A 1KBGH 2NNCA 2EE2A 2BP3A 3L7EA 4JHVA 3RX5A 4A7SA 4AEIH 1EJOH 2EABA 1ETA1 2Q5BA 3QJFA 5D6CB 1PYWB 3MLSH 2XXMB 3PIQA 4N90D 4LNRA 3I2CH 2Z4QA 1SEBB 2GBAA 3MXVL 3OC8A 5BPPA 1FDLL 1DVYA 4QY8B 4MRBA 3X3FH 4GBXD 1JFQH 3A4AA 4YGAB 2XPYA 3LNIA 4TVPH 4Q2ZB 2PKDA 5C0BE 3L08A 1X7SA 1KCSL 5IUSA 4KV5E 2ZOLA 3D3VD 3SY0A 5AUMB 2VXVH 4FA6A 2LVCA 3X3GL 3KLLA 4LOUD 4M7LT 5KG9A 5JHDD 4Y5VC 1WEJL 2YD7A 2APSA 3V0VA 1YEDB 3BQVA 4NRYB 3MFFB 2K8QA 2DWEB 2VDOB 3EFFB 5G2NA 4HXBH 2RCSH 4KBPA 1T0MB 2DM4A 4MNHB 5D7IF 4B50A 1IGJA 5I16B 2L0DA 2G60H 1XEUA 3VG9B 2H0JA 2ADJA 2BP0B 4X5RA 5I6PA 2A2QT 5C09A 3U30C 3V0IA 4XO9A 4Z7UE 3P1VA 1A25A 1RZFL 4Q6IA 4X5XB 2RQ8A 4Y2OB 4LEEA 1HOCB 4MLSA 1JCKA 2V2TB 4O9HL 1INDH 3AXIA 5ILTL 4DW2H 1N12A 5C07E 1OGAD 1TSHA 3CVDA 3U4EB 2OULB 2NY6D 3QQ4A 4J1UA 3QDMA 3IDMA 4YO0A 5EWIL 2AVFA 3OXSA 3ASWA 2QBWA 3ZKQD 5DC4B 2WLKA 3HE7D 4F24A 3ULSA 4HF5H 3L4TA 4KU1A 3DO7B 1Z1WA 1P4LB 3ZSSA 3EF7A 2HCZX 3IPBA 2OR8A 4BKTC 5I26A 4B9GA 2K9FB 3QJUB 5ESQA 1AXSB 3FQWB 1AZCA 3KWTA 4ESKA 1KY6A 1MFAL 3HFFA 1CFMA 2IQ9H 4P4KD 3FN3A 3ZTJH 4OZGE 3PWLA 2NX5D 2VDPH 1MIEH 1XGQA 1U8IB 2BS8A 4KGLA 4M6AA 4GPVA 1SLUA 2IPUG 4KHTL 2EXYC 2VJXA 4WHTA 6FABL 1HQRA 4QXGH 4X6CE 5HHOD 2A9MH 4JFFE 1L9MA 1G9ML 1T20A 4NX0A 3O4LB 2XOTA 3GEWB 4M93C 1QHPA 3QG6A 4OD2B 3MBXH 2VXQH 1UT9A 4PG9B 7PCYA 1ESOA 5I8OL 2BY1A 4QOKB 2YEZB 2DTML 4OQTA 4KXBA 3MRKB 3S34H 5T1LB 2OX5B 4IOSD 4F7TB 5D1QC 3NP4A 4Z7WB 1PG7X 4APQA 4PJXE 4K0OA 4PTTA 1AZUA 4TN9A 1F97A 4Y9EA 1HHKB 2FEDD 3SKOA 1G7QB 4HOMA 3OAUL 3Q8EA 1IGCH 3VD0A 3AACA 4UDUB 2O26U 3UEQA 3C12A 4PQXA 4Q6IB 4RMSA 4HEPG 4EI0A 3GJEB 2R0WH 2XTJC 3DVNB 5BW7C 5FC9A 1IBZA 3RVWD 4PUBL 5I1AA 4JM2B 2XY1A 4ORGB 4XOAA 3ME0B 2DJSA 2WMPA 4JHAL 3VWJD 1BZ8A 2VITA 7FABL 4P59H 4MMZA 1CR9H 3O0LA 1QRND 4Q58C 4P2QB 2APVA 4PLJC 3NMEA 4ZAKA 4OY9A 1FFRA 2HMID 3GM0A 3ZMRA 5H94A 4DP2X 3FQRA 3O81A 5AZ2H 2YRLA 4PV8A 5EEYA 2BIHA 4U6HB 2R83A 1R47A 3S88L 4KKAC 5CGMA 1E27B 4PG2A 2ARJB 2WTRB 1HTYA 2CCVA 5A2FA 1RUAH 3HHMA 1S7RB 4LHUD 2GSIA 2ZPKH 1KIUB 2UZIH 3QG7H 3DUHA 4Z7OB 3D69A 3M8OL 3PP4L 1A02N 1K8DB 3UGXA 3V6ZA 2O93L 3OMNB 2VUYA 3HNVL 2EVHA 1ZGLA 1EAOA 3MRLA 2Y25A 3PWPB 3B9DA 1KCRH 2QHLA 4JZOB 5HHPB 3U2JA 2IH1B 4XMVA 3V0WH 2F58H 2FH8A 5AL8A 4TUKH 4QPEA 2RTTA 3CX5K 2Y5EA 1G4MA 2OSLA 4JPSA 1TYEB 4YDIL 1D3CA 2WZ0A 2XN9A 3FQUB 3UXFA 2HTLD 3QBTB 1A9BB 1DLHA 1QFUH 1BZOA 4HD5A 4KQ4L 1LM8V 4LCUA 4J5VA 5E94A 4LSPH 1U2YA 1E7UA 1D5BB 2NUTB 3DX9B 2DQEH 3HLAB 4KUZL 1RK0A 4Y16C 5KJRH 5F88A 1CXFA 3H7LA 4GB9A 1L9TA 2X9YA 2J7LA 4KK6D 5FM5M 1RZJC 3BGFB 4FNLL 2BRQA 2B1AL 3CZJA 4PJ5B 3D33A 4HS3B 2V17L 4NQSB 1YCSA 2LU7A 1D6VL 2JIXA 1GOGA 1AZBA 1X4XA 2AQ1A 3NZ8B 1FRGL 3SQBB 5J1AB 2BFGA 3HB3B 4P2QD 3KS0J 4JFHD 4BFKA 1F86A 1KCVH 5E1GA 3T4AB 4NO2A 2NY1B 4KK5D 4YBLB 3C5SB 1S9VB 2R7EB 1DFBL 2WXLA 4PB9H 5C6TL 2OS7A 3KXFA 1OCRB 2DQJH 3A67L 3S4SA 2A1WH 5DMIH 3F05A 4GLRH 3BSZA 1Z5HA 1U3ZA 1VLXA 1QBLH 1RZKH 3MRJA 3EGSB 3RFZA 1NIEA 2YJLA 3PAZA 2WSPA 4G72B 1XGPA 3RVXD 2NCMA 3CHQA 5ITFB 5I6OA 4TXVB 4ZMZA 4LFHG 4GUQA 4D2NA 3ZE0B 3GHEL 3CXHJ 3WI9A 1S78D 2NQCA 1NCWH 1LL1A 2YKLH 4X83A 3ETSA 4NPJA 5D7SL 5BRQA 4Y1SA 1JUFB 4NO2B 1A9VA 2O5NA 2SEBA 4D3CH 4CJ1A 2B59B 3KYOA 3NYKA 1Q9WA 3P30H 2EECA 3PYCA 1YPZA 2J5LC 4K7PX 4WUKL 4BSVA 3CFUA 4A7GA 2FJFA 4ES9A 4KJYB 2GJZA 4MASA 4OCXH 3UTPE 4UM9B 1DQDH 5AKRA 2ZUQC 3N44F 4H8UA 1HI6B 1MY5A 2EH7H 2XV3A 3Q3GB 2Y72A 3RWIA 2F19L 3I6SA 4LHUG 4WGKA 2AMUA 4JMXA 4R7LA 2VM9A 1P0SE 5D1XD 1K2DB 4OUUA 3V4UL 3O6FC 3RL1A 2P8PB 4MKMA 2CIKB 4WO4B 4OLYH 3HMXL 4FXTA 1S5HB 4UQEA 3IXAA 1U8OA 4O02H 3GLZA 1TG8A 5AKTA 5HGDA 3RGVC 1GOFA 4WO4C 2QEJA 1OTSC 4H5SA 5SX4I 1YECL 2V7HB 4XVUC 4L9LA 4ELMB 3HUJF 5IQ7L 1MFBH 2X89D 4RFEB 4MS8D 4FG4A 3V10A 1J8KA 1O9WA 5TFSL 2E7LA 1KT2B 3A24A 4U4IA 5HYQB 3ZTDC 3RFZB 1RPUA 1ASPA 4FG2A 4D0BA 3HZMA 4TLUA 5AAMC 2H32H 4JUSA 2MH4A 4MNGA 4N3TA 2HJKA 5A6LA 2HT3D 1HILB 3PWUA 1JNNH 1RZKC 2XZZA 3QJFB 5DT1L 3GZKA 4XB3A 4K5OA 5DMKA 3N06B 2FSEB 6CGTA 4AI7A 1RIHH 2NR6D 5GXBB 3WTTA 3B5TA 1RJLB 3VB8A 2X4QA 3KLKA 3MLZL 5FUCE 1JZ6A 5D70H 3E9TA 4CNIA 3LZFL 4P2QA 3TL5A 1ZS8B 3EDDA 4MXQC 1C12A 4HIEA 4E0RB 3FTSA 1QSEE 1UZ8B 1IAOA 3IGLA 3NQKA 4GLRI 3C5JA 3OLIA 1URLA 2P5WB 4R5TA 5BRZD 4R5VA 4UANA 1BIHA 1YNTA 1N2RA 1LP9A 2D7MA 5EO1B 3IEAA 4AV5A 2IEPA 4ORZC 2QKIB 2L7EA 2OSXA 2YUWA 1N0LB 2PWGA 1KLFA 3EBHA 1WBZA 4G11A 1UKSA 2W59A 4OZ4A 3GI9H 4P04A 4DZ8A 2JJWA 2IBGA 4WIQA 1G4RA 5CEZD 1X5IA 3LN4B 3IDGB 4X9IA 3L3HA 2NY1D 4V1DE 1ZAGA 2HFEB 2J8UA 4G8EA 3WD5H 1I1CA 4M03A 1ZK9A 5JPNA 5ICYA 2F7PA 5B3JE 1AACA 2LT9A 2APXA 3BUDA 4JZOA 1AHWB 3QXDA 1U4EA 4NRZB 2VYRE 1NWOA 4L8SC 2BVUA 1N8OE 2EP6A 5DFWH 2EAEA 3FU3A 3FUEA 4ZUTA 5C0GB 1HKFA 3GRWA 2QKSA 4FNUA 8FABA 1BQ5A 2FX9L 1AHMA 1JK8B 3SD2A 4UNVA 4QHLB 3OHXA 2JKSA 4CADB 4GFXA 1B4JH 4XP9L 2N4IA 1IT9L 1ML0A 1KGXA 2ADGB 4PJAA 2OP4H 4LCIH 4WFFD 3P9LB 1BVOA 5E9DA 4DTGH 2GCYB 4K8RD 3MV01 1M05B 3BCFA 4PIRF 4ABQA 3E7JA 3HA0A 4PP2A 4Z7VA 4OR1A 2NW2A 3BH4A 2CRIA 2FO4A 2HG5B 4EQ3A 1TJIL 2LU3A 1UA3A 3NZHH 4JFXB 5DK3A 3TBSA 5GISL 4X42A 5DZJA 1FO0A 2B4CH 1BEXA 4HMEA 1QLRB 2CKBA 4LCWB 3QYNA 2WD0A 4F33A 1Z0MA 2WMPB 1JRHI 3ESOA 4Q7DA 1VZIA 1HXYA 1FV1A 2A6JB 2QELA 4FQXA 4UV4H 5TGBB 4G1EA 4Z9KB 3IDNA 1AGCB 2OL3A 4C56D 3AQDA 5C0AD 1WWWX 5F71A 4EE2A 1EZVX 3OXSB 1EO8H 3S5LG 1IC7H 4J28A 2VZVA 1ETZA 4RAVB 5IBUB 3Q6FA 1B0WA 1E8WA 3LY6A 1KGCD 1OAXH 1MJ7L 3VQLA 1QR1B 1DANU 4XPTH 4EI6B 4D9RD 4WDIA 2Q10A 1UM4H 4JJ5B 3BLBA 3UP1A 4DGVH 2Y06L 4JG0H 4QRFA 5CZXD 2YSSB 3DI3B 4DFHA 3FK3A 2UZPA 1JZFA 4P2RA 2OXHB 1X9RA 3ZE0E 1PZUB 4G6JL 43C9B 2YGOA 4N0YH 4JANB 4M9PA 5JXEA 2OYLA 2DIBA 4G6FB 5JOPE 3HRPA 4Y8AA 4PG9A 6FABH 3F00A 1RU9H 4K7PH 2PW2B 4ZPTA 4Y7OC 2I27N 1SJMA 2VL4A 4MHHG 4Z95H 2EH8L 2EIDA 4MDRA 4AK2A 1AZZC 3B34A 1RUQH 5A43C 1CD1A 3KHOA 2WBXA 3VMNA 4B41A 4J7RA 2FJGA 4PJGF 5LBSL 3BEWB 3QQDB 1HFUA 2VLLB 4HEMA 3HUJE 4O58L 2D3VA 2YLHA 4JFDB 4AKQA 5DD3L 1CGUA 1WQVT 4QHMB 3FXIC 1CB4A 5D1ZB 5FYKD 1L0XA 3U4BH 1CBVL 1SJEB 1T1WA 5C9KA 4TQIA 1JYXA 2YD1A 1TZHA 4POZD 5BUGA 4LLDB 3H9YA 1PZBA 3OKDB 1OKEA 3V4UH 1GYAA 2VAJA 1JCVA 1GVIA 2B2XL 4OUOA 3C5ZC 1LQBC 4AMKH 5IHBA 4JDVB 3F83A 5HDRA 2DH3A 1PEZA 2R4SH 4I9WD 2ZOKA 4ZUVB 1YY9D 2R2EA 1RUKH 1ZT7A 3FTYA 3CDZB 4EDWL 4HIXL 4N6QA 1J8RA 2FQDA 2WWNA 2N01B 1F41A 2H26A 3U2IA 4ZW6A 4JFDA 3KDMB 4PFEA 3BPOC 5MEOB 4HDIB 4P5KA 1M7DB 4LGSB 2FJGB 3T0EA 3TO2B 4X6FA 3JWNG 3D2TA 2X1QA 3ARFB 1GZHA 3E6FA 4PI0A 1KXTB 4AGLA 3SDAA 2D7TH 1TVBA 1PY9A 2NY4D 4GT0A 5D71L 5FA4A 3V4VA 2MKLC 4Q9BA 2VMCA 3K74B 3WKML 4JPIB 2Q7YA 3INUL 5DMGC 2N1TE 2X2HA 5CBEA 1RZ7H 2CNYA 2PP8A 3NA4A 2VDLL 4K23H 1HKLL 2QQLH 5IQLA 3A67H 4QRPE 4MVBC 5E23A 1A6UH 2YXWA 2ADYA 1ACZA 1MFDL 2IGFH 4UDTB 1E28B 4XHQA 2OCJA 4MA8L 5F21B 1BVZA 4TULL 2VR6A 3ZKSD 1K9TA 1TZIB 3LPPA 1I8IB 2FRGP 2LU5A 4P99A 3TV3L 4I3RL 1OE1A 3LQAC 5CGYC 5EUOE 1IBDA 3QFJA 5KSBE 1KB3A 1O5PA 3LKOA 2VDKB 3MGTA 4M62L 4X4KA 4XI5D 4X8GA 1ADQL 5FAAA 2P5ED 3OJMB 1NAMH 3O3BA 2ATAA 3P4NA 2KLSA 3RG1C 4GEJA 5J3HD 3H54A 4GRLC 5D2NB 4PSPA 4HCRA 3G5ZB 4ZXBD 3P77B 4RDQG 2PTUA 2EO1A 3RPKA 1E6OL 3U4KA 3KPPA 4PJ5D 3CWGA 4FQIH 5FYJU 5EHFA 3MMEB 2GEQA 3HKFA 1NH6A 3MU3A 4N5UA 2O6EA 5GGUB 3G5WA 1XGRA 4UT9H 1UJTA 3WXVH 4JGHA 1T04B 3HB3D 3VXRD 3FO9B 3ARPA 1PX4A 1A8JH 5AVZB 3MUJA 1ZHBA 5FWQA 4PJ9A 2JLPA 2XICA 2LTQC 1DZBA 2UY7B 4MWFA 4CSSA 1A5FH 2WXFA 1T3FA 4E36A 2FT6A 5ES4B 4JPVL 1MWAH 4UTAL 1YEEH 5GSRB 1DCLA 4TUOB 2WQXA 4ZDHB 2ENPA 3BJ91 4N5EC 4NP4H 4C57C 3VYPA 1PBYA 5FK9A 3BPNB 4ETQA 1KJ3L 1CF1A 2WLNA 1Z3RA 3FT4A 5G5DA 2A74A 5LXGL 3QQNA 3V52H 2VABB 1CL7H 5GHWL 4I0PC 2WNKA 1TTFA 3O2DA 4NUPA 4OVUA 3BSHA 3CSYA 3IFOB 1QNZH 4M4RA 4IEFA 2BNRA 3B8YA 1S9YB 2EDLA 4BXVA 2WKLA 5CLTA 4BQ6A 5DLMH 1U6AL 4JKPL 5SWSE 5IMLB 2NW3B 3MRBB 1ZVSB 4AXWB 5FFOA 4KKNA 1AKJA 4OV5A 3IMBA 3CBRA 3H7BB 5DEZA 5F1SA 3F6JA 4NN5C 4ZSOE 4HQQH 4H25A 3SDXF 5HY9A 5I5IA 1KB5H 4FEIA 2HVKA 2X2JA 1T0NB 5AVRB 1KB5B 2Z31A 1CO1A 2OSWA 1AO7B 1QFHA 2ZG3A 2WBJD 3SGKC 2CJUL 1SZNA 3ECUA 1X5MA 1JJUA 4HHGA 5CCKH 3BRDA 5K9JL 5AALA 5FYKL 4Z0XB 1D5RA 4X80H 4I9XA 4KRMB 5JR1L 1P7QB 5L2JB 3TV8A 5INDB 5FYJE 5HJDA 2AEQL 1J0ZA 4GSXA 1RHHA 2XKUA 3NCWA 1WZLA 3OKNB 4RFNC 1E9QA 1T83C 3CVHH 3BZ4B 1DSWA 1P69B 3O11A 1KBBA 1K4CA 4K9JA 3GSXA 1NGPL 4XPBH 5ADOH 1SHWA 3ESVF 1BF5A 3FB6A 2X0VA 1BFTA 4QHUA 1AGFB 4RESB 3WIAA 1XF4B 4HIPA 1NGQL 5AQ0A 3A47A 1MJ8H 4JRWA 1A2YB 2IOMA 4FXKC 2IPUK 3QT2A 1ORQA 1GCFA 1JXFA 2X0UA 4J6RH 4WUUA 1IFGA 1G9MC 1P4LA 3AWFA 3QDMD 2HPOA 2K70A 4IGBA 4N8CL 2NY5H 2HFTA 3TM6A 3VSQA 5DI8A 1BFVH 4G42B 4AGNA 3TEZA 1CMOA 1QP1A 1NFDA 2PW1B 3QXDB 4NRZA 2KL6A 4EVNB 5GSVA 1BZ7B 3RWCB 4EI6A 2AMGA 4HK0A 4QMEA 3F12B 3MJWA 4XZ4A 3ZDZE 4GKOA 4JPWL 2ICES 2WIIA 2ZAHA 4Q14A 4JY5L 4YSAA 1U2CA 5IF0A 3FHAA 3S35L 4A7UA 3JWNH 3BAYA 1OP4A 4GW1B 4OQTH 4AQ1C 3D39D 3QEQE 2XNAB 3OB0K 1EVTC 5C8JB 4KO7A 5GRWA 5I1CL 5F8RC 2VSCA 2XIBA 1JPEA 2ZWSA 3EFFA 3IGFA 2XCMC 1C5CL 4OJAA 2D0GA 4F93B 1J1PL 1KLGB 3BAJA 4J3VA 4QRPB 5CKGA 1QKZL 5DR5H 3K6IA 3O8XB 3RB5A 1TEGA 4HSAC 4DAGH 3BX7C 5IESL 3TN0A 1VFOA 4GW4B 4U1MA 5GGVL 2G0KA 1MCNA 4N68A 4H8QA 1EHXA 2BZ7A 1TYJA 2VLMD 2Q86B 5DA4A 1IZJA 1U8HA 3BPOB 4ZOBA 3VI4A 1BQSA 5E9DB 4LESA 1KEGL 4YLQT 2ZXEB 3AY2A 4DP4X 4G6JH 3BH9B 3X3GH 4AIZA 1GSMA 3DOHA 3Q05A 4KTEL 1A6PA 2MCPH 3TPKA 1SEBA 4KKZA 1SMAA 3MVSA 1CD9B 1MJ7H 3VXNA 4DKAA 3DGCR 4JFZL 3QDMB 1Q9OB 3QRGH 4WTZG 3MXVH 4AENB 2QTEA 1OP3H 5I1EL 5FA3B 3BHBB 2FYVA 3MV8B 1TJHL 1UXWA 2LVEA 5F6IC 1MCEA 1GC1H 4BGLA 3DBSA 1PCXA 2B7DT 3DVGA 35C8H 4N90E 4XX5A 4BKLA 2WVVB 4PLOB 3NDYE 4KKCD 3MUHL 4BZ2H 2XBDA 3AJ7A 1G7LB 1IC7L 3FRPG 1EBAA 3UBGA 2P5WA 2FDBP 5KYYA 1MCPH 5A2CA 3MJ9L 4G9FA 1FNFA 3BJLA 3N40P 5JZ7C 4DUWA 5IB1A 5DJXB 3VG0H 5C97A 1A6ZA 2NSMA 4WV1C 1L3WA 1LVEA 2FL5A 1WC7A 3VYOA 3WIIL 5KG9B 3MV8A 2NY0C 4KZDH 4KK9C 4IBLT 3GK8H 3MRIA 1M7IA 2VDRH 5A3IC 1JTPA 4MJID 5F0JB 1J5OH 5IFJB 1WISA 3W1ZA 4HKXB 1VPOH 1I7UB 2F54A 2IMMA 5CINL 3VXTA 1SBBA 4PV9A 4GQ9H 4L8SA 1R0AL 3MRGA 5D1QE 3RY6C 1QFPA 4OFIA 3DMMD 4FXLA 4Y5YC 1T22A 3QUML 3OKEB 1BQHB 2AAVA 2H3NB 5DEFB 4GAJH 5E00B 3VSTA 1PIGA 2G4EA 2Z9TA 4N2CA 5C07D 2XQYA 3DRQB 1FHGA 4ODTH 2VZ1A 1YSOA 3ARBB 2V8LA 3FSVA 2GJJA 1G7HA 3HN5A 4N26A 3LKNB 2P3YA 2EJ1A 2X6AA 3W2DL 4BUHA 3DPDA 1QTYT 3MV8D 1LDPL 5I5MA 1ZVHA 3ZXAC 2OJEB 1R5VA 4NBXB 1MELA 3ROOA 3FONB 4N0CD 1RHHB 4X7TA 3QPKA 4K94H 5D7EA 5FDYA 5EZIH 2A6JA 3US0A 2ALAA 2ATPA 4OD1H 3QZPA 5AD0A 2FJSA 2Z65C 1BJ8A 4KI5C 3N42F 5DZ9A 2VUKA 5FW8A 4M1CD 3O3AA 1G6RH 1TENA 2IDCA 4PLKC 2W0PA 4LL9A 6TAAA 5FO8B 3MRRB 1NZRA 2I7SA 4JFFD 3HC3H 4D9QE 3QWOB 3HVDA 4J3OH 1UA7A 2B0SL 4E41E 5TPWH 5F97E 3DX4A 2QMKA 1JRHL 3UBFA 5HJBA 4AVIA 3NJXA 3NIFE 3NIDF 3H4FA 1TQCB 2W0KA 1UD3A 2DYPD 3VXSD 1J05B 1DR9A 2AEWA 2O1AA 3WFCH 1OGPA 2RIKA 2X6UA 3MA9L 5G4NA 1GGTA 3VGDA 3C9NB 5EEZA 4J2XA 3B56A 4J3XA 1CE1H 3AITA 2LR4A 2WUCL 4ZZFA 3WN6A 3ZRCC 3UJIH 4HHAA 3DXAE 2DJMA 3VWKB 3LVEA 3EAKA 2EILB 4GFTB 1NGWA 2MNUA 3N3EA 2V5YA 1LXMA 2ZXGA 2PUQT 3U9PL 2G30A 1PY0A 3CFQA 4FFWC 4O00A 3BXNA 1OQXA 2X4SB 3ETBJ 1PAZA 4YN3A 4L3FA 3SE4C 4LIQL 1J1OH 5JIHA 1TZ8A 4UNTA 5D6DC 4NO5A 4NBYB 2O5ZH 3F01A 1QSEA 2JCCA 4LLUB 4NQXB 4M6OH 5PCYA 4EZLA 3G5YB 1MHPH 3LEYL 5CCJA 4X6BA 3E38A 4NC2B 1OB1A 2QKIA 4GJTB 1P1ZA 3KPOB 3QUXB 2VXUH 1CXKA 1TTRA 2YEQA 5GJTH 2CG9X 4KHXL 3DURA 4MYWB 1MRDH 3OKLB 3DHPA 3S2CA 3BD4A 3TCLB 4F91B 1E6JL 4IKKA 1VB9A 1YN6B 4CU7A 3NIGB 5FYLE 4EBQL 1JZ3A 4M5SA 4OI8A 2EZ0D 5D1ZA 1HVXA 2AJVH 1ZLUH 1HNGA 1MW3A 5C0DB 4U1KA 5F7YC 3SDDA 1I8MB 4BFGA 1KJ2A 3GXPA 1MQKL 3MODH 4IKLA 4B96A 1VCBC 1X5KA 4G7SB 1LILA 2QVFB 3GMQA 4G7QB 2C4XA 3P30L 4NAQA 3T0WA 2IMNA 3FQNA 1HL9A 1B9KA 3LKNA 4LVOC 3NA9L 4R96B 3T0DA 1MHPL 1AKJD 3NIGF 2ZNWA 1IC4H 3VNYA 1NCWL 5EU4A 3GRBA 3NTCL 4UQ3A 3VXSB 3VXUE 3OAYK 4PP2B 3B37A 3E2HC 4LEXL 2UXVA 2PXYA 4U0RB 3MRLB 3N2JA 1J1OL 4M8UA 2O6CA 2CJ3A 1YYCA 4IGBB 3WUZA 3FSZA 4TUUA 4Y4KA 1AGBA 1KY7A 4OD3L 1HH6B 3TCTA 4M6NH 1DBBL 2OV0A 4NAMA 1JZIA 3A6CH 4YHLH 3GEFA 3RDTB 4WFEE 4H88H 1YMME 4WKZA 3RWFB 2H2SC 3SDAC 1XF4A 3CMOH 1WBYB 2WN2A 1QRNE 1Z2KA 3HFMH 2BC4A 1GW6A 3U0TA 3UMTA 2R23A 3UTOA 2VZSA 3Q6FB 5E8OB 1YY8A 1ACYH 3N1GC 2FWOB 2IQAA 1MLBA 1G7JB 4OJEH 2UXFA 3RWHA 4BH8A 4CU6A 4AWJC 1XAKA 2V6HA 1VGKA 4WWNA 1IGIL 2YARA 3TVMB 2DMHA 4NQED 1MRCL 2WKOF 4KJYA 1JVLA 2EINB 4V1DB 1GMEA 1F0LA 3T77A 1B4TA 1NUNB 2R4RH 4NUGH 3HNSL 4JPWH 4XVTL 1IE5A 1J9SA 1H15B 4ZXBA 3IMUA 4JDVA 1Q8MA 1CGSL 2L4OA 4HBQA 2E9GA 4OFPA 5GGRA 1AAJA 3B7UX 1HZKA 3GMOB 4NQQA 4RQQA 3UJTH 1E65A 3BUYB 4RWHA 3L2LA 3OKDA 1PKQA 2JTDA 2DWDB 1YN7B 1XGPB 3O6FB 1FZKB 5GGQL 4S1SL 3WUWA 3FO1B 4MX7B 3GMNB 4DOHE 4FKEA 3G08B 5GRJH 5A6MA 1IBFA 5KW9H 4KX9A 4X0KB 1U3HC 2D2CC 2GITA 5DGRA 4Z7OF 1MWAB 4B9IA 1WFTA 3HI6H 3IJHA 5E6YA 3L95B 1LWJA 4NP9A 2XPZA 1JGDA 2I32A 5I1DA 1AHWA 1S6NA 2ZSWA 1TUPA 5JQ6H 2BWIA 2BY0A 2H45A 2XT1B 2DKMA 3NIFF 3OR7A 4M43H 4LLVB 3BD5A 1IO4C 1AR1D 3CCHA 4HUKB 5FGBA 1ET5A 1OD9A 1BLNA 2COQA 3AAZA 2GJPA 4DZ8B 4KJWC 4CU8A 1PD1A 1U91A 4TM9A 3AWEA 1IC0A 3MBWA 5T3ZD 3UPRB 1D5IH 1G1KA 2FJHB 3D0VB 5IWLC 3KJ4C 1NDGB 1BOGA 3PY9A 4QKTA 5ESAB 1L4IA 2OAAA 3G08A 3Q8AA 4GAGH 1XSOA 5ICZA 1NA8A 1JGEA 4YNYA 3SGDH 1KV3A 5JW5B 5EZJB 4HS6B 1N68A 2BJML 4P2YA 4MKTA 4PBDA 5KBDA 1P4BH 1QAWA 1D7DA 1SYSA 3QWQB 3QEHB 3H0TB 2F8OA 3DXAA 3G6AA 3GUTB 4QRRD 3MOBH 1MJUL 4GXVL 2X4UA 3IMWA 4X98B 5DD6A 1ED3B 1A7NH 1TZAA 3F12A 3CDGA 4AJYV 5HYSB 1WHOA 2JI2A 25C8H 5FHBL 3S34L 1ZTMA 2Z1KA 4LVOB 4LQFH 3GYRA 1P9MC 2MQGA 3VFWB 1WAAE 1NM9A 1OAUL 4H1LB 4XAWH 3HOGA 2YZ1A 1S8DB 3HC4H 5GRUL 1EDYA 3Q8BA 4UTBH 4M7LH 1X9UA 2JJVA 3BH9A 1QLRA 5H37G 3WMSA 5I0ZA 5JIIA 5DFAA 1LE5A 4HXAL 2K4WA 1MWAL 2R1XB 4XMKL 5D7HA 2ZXWB 1ET8A 3B9AA 4YDNA 5F6HJ 3BP7B 4HLJA 4J4PD 2ZCKL 2XWBA 4MNQB 2ZKMX 3CK0H 3O11B 5LWYH 2QFPA 2ZOWA 3VFRA 3HMWL 1MHCA 2XXCB 4PJ8D 1VADA 5K39B 3IN2A 1SDYA 1NCBH 3Q2WA 4I7ZC 4BK8A 4Z23A 1S5HA 2EIZA 1JG9A 5J13B 5CJXA 1IVLA 5DS8A 3WUWB 1MI5D 3Q43A 2JE8A 3L5IA 4CGUB 5DURD 3QULB 4PS7A 4XB7A 3UTTA 1MCWM 1YEKH 4I89A 5J13C 3T0EB 1RIVL 3SYQA 4O9HH 4AE0A 1S46A 3S97C 5F1KC 2MPVA 5FCSH 1L9PA 1DN0B 4EQ2A 2X4OA 4XCYB 5M94B 5BVJB 2HFEA 1PLBA 1ZEAL 4H25B 1RIUH 2JK5B 3VQ1C 4JQIA 5IMOA 2QQKL 5IB4B 5IOKA 1BZ7A 1W6WA 2R29A 3C5ZB 1YNTF 3IB4A 4BFEA 4CC4C 3TF4A 1A4JB 5B8CA 4V2BA 3VD9A 1CDGA 1HZHL 4NNXA 4UQ2A 4CBZA 2ESVB 5E8DL 1EEYB 4PRHB 4U31A 5T3ZL 4B9YA 4WFGE 5DUPL 5MEQB 3C8KA 4X6DA 1DJGA 1LO5B 4PEEA 4F1SA 2C3VB 3E0GA 2QQNH 1J9QA 2VQTA 4XMKH 4GRMA 5E8OA 3A6BL 1I31A 1TQTA 3T3PE 3F6IA 4QHMA 1EV2E 3OAZK 5IBUG 3RU8L 3ZE1F 2B8OT 1EERB 1A64A 5B38A 5FXCH 3MLVL 2XACC 1OB1B 3CUPA 5EOCJ 1S7RA 4YBHA 4K7FA 2Z7ZA 2X70A 5TF1L 1NGPH 2OMTB 4XPBL 4ZS7H 1UGKA 2UYLA 3HZKA 1S9WA 3H8NA 4N8VG 2ERJC 4AUJA 2DI8A 2FATL 1BA9A 1JNLL 4JKMA 4BQCA 4HPOL 3WE1A 4GP8B 3ISWA 3WHE1 1M1XA 4HUWA 5DZNA 4P5MB 2AEQH 3ZR5A 2Y6SC 3HC0B 4GNKB 4HT1L 4P2RD 5DRXA 3VH8B 5HD8C 1BX2B 1YJDC 4FXKB 1QUPA 5EU5B 3ROLA 5JPNB 2H4EA 1VEOA 3DYOA 3AC0A 2KS0A 3CGTA 1FAKT 1BM3H 4XO5A 4BA0A 3A4DA 2VDPB 3IF1B 1ZY9A 1HZLA 4DOHB 2VN5A 5IMLA 1U8OB 2GI0A 3IGUA 3U36B 5IMOB 1DVTA 4WI8A 2FD6L 5L4JA 1NAKH 4HJUA 3WO3B 1S7WB 2K1MA 3JYCA 4EI5D 3ZDYF 3AABA 4OAWA 3P3TA 5I0XA 3LOWA 5KJ7E 3TVMD 3LJ3A 3U1PA 2W91A 5BRZA 4OJFL 5CD3B 4KX8A 1MDTA 2A74B 3FUIA 4QJ5B 5LCVH 5CKAA 4JB9H 5DS8B 1J12A 4WF7A 3NG5A 1F3DH 3QO1B 3LYRA 3RUGA 2D0FA 3CQFA 4F7CA 3FT3A 3Q5TA 2VDKH 2VAAB 4AQEA 1MHHA 4WU5A 5ELIA 5ISZE 1FLRH 1H8NA 2VUOA 3D51A 3PDOA 3QIBD 5A2AA 4WQOA 3WBDA 4Z7WE 3OPUA 5E6ZA 3V0HA 3VFRB 5T1JA 1AP2A 4JFXA 5C0IA 1GYCA 4MNGB 4B3VA 2DJUA 5DQ9A 5C6WH 3MNVA 1IFHL 2P45B 3HAEB 4PJ8B 4XPHH 1A5FL 1RU9L 3MN8A 3BO8B 2A9NL 3DX1A 1C1EH 3GMRB 4DSYA 5AFAA 1MREL 4AJ0A 2ZCKH 5ITFA 2Q6WA 3ZHNA 1WAAF 3OKEA 3NCBB 4EIZC 3JV0A 5ALBH 4GKSB 4NT6B 3BMVA 3VWKA 3I50H 4DUVA 4UZUA 1KTDA 1U21A 3ZTNL 3ZRFC 3O2WH 3O6MH 4YHZH 4L8SB 4GMTH 1CGSH 4AGPA 1UCBH 4CW1A 3SDCC 4BV1A 5LGKA 1CYXA 2XVBA 5FGRA 1AD0A 2ETWA 3ML8A 5TF0A 5CR1A 2WXHA 3MV9B 3LMJH 5E5MA 1IB5A 2EDRA 5EU6E 2LLGA 5TE7L 1CPUA 4ECNA 5L2KE 3MUY1 4LDLB 2WKOA 2JQMA 2R2BA 2RBLA 1J86A 4LVHC 1IARB 4ETYA 3ZE2E 5I0VA 2H0FA 4AMWA 2JIXB 4LOFA 3F5WB 5H8DA 4DN4H 2NMSA 3BWAA 4QOKD 3GUTA 2IAMB 3IS1X 4PRID 4L2YA 3RTQC 2NY3B 1MFUA 1XTMA 5JHDE 4PTTB 4BFIB 4KVPA 2H32A 2MCAA 3T1FB 2P4AB 3OJDA 4C4BA 4G5ZH 3K6FA 4GP5B 1S4IA 5GGTL 5AD0B 1NFIB 5BZDA 2R8SH 3C5JB 4F1ZA 4BSVB 4JZNA 2E76C 3MRHB 2G2PA 5CFHA 1F56A 1MUJA 1J7VR 5EF1A 3JYBA 5MENB 3U0WH 4PWKA 3S0PA 1WWAX 1IGTA 4L1TA 3QZWG 1F1AA 5KVDL 1S7VA 2BH0A 4OGZA 3I3BA 3WTVA 2XY2A 5HYSG 2WYIA 1ZSHA 4HJ0C 2WWMD 5EO0A 1PLGH 1SOSA 2AK4A 2TRYA 5TE4H 3B2VH 2X6BA 1X3DA 3VTAA 5BCAA 3TASA 3TO2A 1DEEA 4PM1A 5C0RH 5I1GL 5I30L 4FI8A 2BNQB 4K3JH 4PJGB 4XP4L 3UC0L 4P23D 2A3TA 3DWTA 1LLAA 1N0XH 5BZWA 2OMZB 2X89A 5IHZB 5LG1A 2AK4D 1FAIL 4F8QA 1WS8A 5FOBA 3T3PF 5I6XB 3ASNB 5IFJA 2EEXA 2HVBA 1PG7W 3GDCA 3FUDA 4AT6A 1R17A 1SN2A 4RMVA 3GZPA 1EO5A 3SGKA 2YC1B 1TMCB 1NCDL 3BQUA 3UX9B 3K4DA 3BIBX 3X14B 4A63A 2AJZA 4ELDA 2XQYK 4WEEA 2JIXD 5IVNA 3BRFA 5EZJA 4M7JL 3T3PB 1ZVYA 5F9OL 3D18B 3UIZA 3C6LB 2JI1A 4KKPA 1TVHA 4G70B 4LMQI 3S3SA 1QD0A 1AS7A 2X6MA 4FN0A 1MCWW 2FX8L 1N3NA 2YXFA 2JB6B 1NBZA 3KXFE 3QDJD 4WY7L 5GZNC 1B88A 3IAPA 5HVWA 3RUGF 1KC5H 3BQUD 5E9DE 3TNMB 4LIQH 3AAZB 5H35A 2J5LB 3C60C 1OAZH 1ZVNA 3PWNA 3S5ZA 5D4QA 3PGDA 2G75B 5E0QA 1ZE3H 2QL1A 5D1QA 4BFNA 1C9SA 1HYSC 4OCMC 2KQNA 3VXOB 3MRCA 2ID5A 3VFNA 4EZMA 5A7BA 1CZ8L 5I2IB 3W39B 2Z91B 2XJLA 4FXKA 3AGVA 5SX4H 5DU7A 3VH8A 1MFCH 2WUBL 4FP8H 4U1JA 2FR4B 3N9GH 2L3BA 2VN4A 5EZOH 5DI8B 1MAKA 3DTXB 3NAAH 5T1MB 3BDXA 1XR9B 4MMXA 2BSRA 3AS1A 3UAFA 2YXVA 5C3IA 3SDYH 1F1DA 2W5PA 4DNLA 4WK2B 1YEJH 2WINB 4M6NL 4NXKA 3KBHE 4HJIA 1NCDH 2AQRA 2ENSA 4UWQB 2YPVA 2DMKA 1GJWA 3N55A 3UMNA 1UOKA 1U8HB 3HC3L 5FPIA 3UBXB 4FF9A 3GMRA 4LB8A 3REWA 4I1PA 5DJ6B 2BIPA 1SM3L 3F85A 2XIIA 3P4LA 4N1CA 1N5YH 1PG7H 2XDHA 2VWEC 5FOJA 4XPTL 1Z0NA 3NACL 1MLCB 5J6GB 4PRNB 2MEJB 4L4TA 4IHBA 2W07A 1TLKA 3LN5B 3DDFA 1KTJA 3ILDA 3PXLA 4G1EB 4V1DA 4XC3H 5L2JA 3E6HA 4J23A 4WW2C 4CSPA 5ID1B 5C0FB 4N2DA 3PHOA 1CXEA 2FEEI 2DIEA 2YAEA 2BIMA 5LDUA 4HVBA 4ZMOA 2WHVA 1NOLA 3J07A 1P4IH 3N0PB 1N59A 2IXQB 4C8XA 5HPMB 1FZOB 4DJMA 1OW0C 1R19A 4X5LA 5JLZA 1GL4B 2F18A 1H5BB 3GI8H 4GO8A 4AL8L 2YD6A 3RWCA 5ANHA 3MLTA 4Z77A 3EF4A 2ZUWA 4P3CL 3ZKXB 5F0PB 1CLOH 3QULA 3KNBA 5CJOH 5SWSD 3NN8A 2CO3A 2F1BA 2IFFL 1S9YA 3SPGA 3DPBB 3VXPB 2YO3A 3PL6D 3LH2L 5I0DA 4D0BB 2O5XL 2CKBH 3GIZH 2CO7A 3GIZL 5IR1A 3FSAA 3B9KD 1MCCA 5GRXG 1FVEA 1TTGA 2DWEA 2H1PH 5A3ID 3WENA 2NLJB 1DVUA 3UP6A 4Y16A 5C2BH 3MXWH 4PJ7B 4WW1B 4I88A 5J57B 1JHKH 2B16A 3AZUA 3O9WA 2X9ZA 4NJ9H 3V7AE 4O2FB 4UQ3B 5LGHL 1U8NA 5E8PA 3MYJA 3FT2A 2ITEA 3GB7A 2YN5A 3IRPX 3IKCB 3MJ7B 4ZQKB 4UZGA 3UJIL 4MZRA 2YFNA 2ZCHL 4AK1A 5J89A 5FR3A 4AL8H 3PUCA 4HWBH 3QCVH 2YAPA 3QNYB 3QUHA 3MLXL 1SMDA 5ESQB 4YPGA 4TNWK 3QHFL 4N9GB 1R3KB 2AAAA 1XD0A 1T7ZA 3U83A 3DUSB 1NEPA 1BGXH 3E3QC 4BELD 3G3LA 4I4WB 1TJMA 4ZTOH 2E4FA 5I5JA 4XC1L 1ODAA 4IU2B 1QLFA 1KCUL 4MMYB 3ULVF 1X7QA 2EYSA 1UXSB 3X14A 3TJHD 1T0PB 5A2BA 4NFBA 3I6LD 3NACH 2BIIA 2BS71 4FE9A 4JREB 1LYQA 1WITA 2IBZX 4KH2A 1SYSB 1Y6NR 4HV8A 2E56A 4W9IC 1F4YL 4DP0X 5F7MC 3UERA 1WFJA 3UACA 1QYGL 3V6BR 4PJGE 2OPCA 3LQZB 1IX2A 1NCTA 3ZTNH 4QLWA 3JXAA 1BZ9B 4LQ1A 4AKPA 4L1DA 1LDPH 2CXKA 3T6XA 1BOGB 1HNYA 4FAAB 2GIXA 2BIQA 1WCBA 2NXYC 2XJKA 3T2OA 3W9EB 1MREH 1KPRA 4PJDA 5IROA 5BO1H 1I3GH 1DO5A 4OIAA 1X5YA 1YPZF 1CICB 4XNDA 3Q01A 3VGHA 1QO3B 4IMLB 4KPHH 4E9SA 4GKNB 4E9QA 4UQAA 1HCVA 1D2PA 3LPFA 1MFEL 4BKSC 1A4KB 4CVUA 3MACH 4KTDH 3ELAT 3GIVB 3WNJA 5HHOA 4C59B 2YEVB 3CHPA 1MCDA 1JS4A 1KYAA 4OLXL 3WGVB 4POYA 3HZVA 5EBLA 3SKJH 4FNTA 3RAJH 5HHNB 1M7IB 3BP7A 1OAZL 3BPCA 3UZEA 1J5OL 1U8IA 4JO2L 2HAZA 4Y5YB 3RDJA 3BYYA 4LLAA 2JXMB 3UG5A 4C54A 1AI1H 4AMXA 1IKFL 4NB7A 2Q3ZA 2QVMA 3IDYC 4JG5A 1JFHA 5GGUA 3U82B 2J1YA 5IUCA 5KEZA 2CH8A 2O72A 2XZQH 1UD5A 4LSSL 4PMFA 4QGTA 3R8BB 2ZT9C 1I53A 4FJ6A 3ZQ9A 1G0YR 3NRPA 3U0PA 3LNDA 4PBVC 1RVFH 1XF5A 2B59A 2YJQA 1RK7A 1UVQB 1UWYA 4WCYH 3NIDE 2H2PC 2WVVA 2GJ6B 2I25N 2KQMA 3APMA 5AAMA 4XN7A 1X5LA 5DWUL 2A4ZA 4Y2NA 3X12B 5CLYA 3L3DB 5J9PA 3KPSB 4TYUA 4HCIA 3PPEA 2X0WA 3CSFA 4L3CA 4AEHL 3PWJB 3UTTD 4CW1B 3ARFD 3FU6A 2EKSB 4HPYL 3ZO9A 5IJKC 3V0DA 5LDSA 4TF4A 1MLBB 1XO8A 2I85A 4DCQA 2WVSA 3D06A 2OCFD 4HYTB 5C0RL 2WBJB 2DTMH 4N3UA 1NCCL 1LEKA 1CGTA 4O4YH 4S10A 5EUOF 1NGXB 3CVHL 3WCYA 1EWHA 1JIBA 2G5RA 1VFUA 2BSBA 2CXGA 2JKXA 4U2YA 2GTWA 5IBLC 3OMIB 5JHDA 2FBJL 2DLEA 4CDHA 4GAAA 3N44B 3D09A 4C55A 4IJ3C 2VDPL 5GZOA 2NNAB 5EC2B 5KSVA 3QJRB 1UZ6E 4W6YB 4H1LH 1I8LA 3SDAB 2JSFA 5HHVH 4R7XA 3W3BA 4S1DD 3L5XH 3JWOH 4HSCX 1BD2D 1RQ5A 3I02A 1ZHLB 1MFNA 4OF6A 3KH3A 2W94A 4D8PB 3PGFH 1OARH 1ANUA 2BERA 2QJDA 2WB7A 5AB2A 4LL1A 4HF5L 2KI6A 1QFWH 1G1CA 2IPTL 3I9GH 4PCSA 3VCLA 3WYRA 5I8CA 4ONGH 2Q3AA 5D4IA 1JZDC 3H3PL 3NJGA 5BS0D 2CK0H 1QLEH 1W0WA 3I9AA 2VL5B 4BWUA 1Y18A 3QA3B 4OQTL 1R6VA 4KNUA 3AGWA 4WZ9A 3BLKA 1KN2H 5KOMC 1BBJA 2CDEA 1ECYA 1J1XH 4TPRH 2WLIB 2K7QA 4EJ1C 1CL7I 4UTBL 1Z32X 3OAZH 2DI7A 3HC4L 1EXUB 4I0PD 2V9UA 2CMRH 3PXJA 4R0LC 5F7WC 5KUMA 1MKFA 3QCUH 4NWUL 2QV4A 3AG1B 3WL9B 5D2LE 5HDOA 1UH4A 3IJ7A 4ODXA 4QHNA 4ENED 3GXUB 4N5ED 1UEYA 3D25B 5HJ3B 4FFYL 2NXYB 3TX4A 1OLLA 1EHLL 3CK0L 2YEZA 1X6NA 3WFBH 4WJG3 2QLVB 4FLSA 2KZKA 3IDUA 5IW3A 2ORBH 3W0WB 5C0AE 4HXAH 2DQUH 2A9DA 2WAQA 5DD5H 4PGJA 3H85A 3ATBA 1NMAL 3FB6B 1F5WA 3K2UH 4Q52A 3DJRA 4KQ0A 3D3VB 4TVPD 1EO7A 4PRAA 1ROCA 2CMRL 2EEBA 1T5WB 5KVEH 5AVQB 4E41D 4ABWA 4AQ8A 3GJFA 3F04A 4FD0A 1T2XA 2CK2A 3IJHB 5I9QC 12E8L 1NOFA 3BP4A 3U7YL 2XQ0A 3A6OA 2IDTA 1EFXB 5DJYA 4ZTEA 1Y0LB 1NLBL 3QIUD 2AV7B 4FFZA 5K1VA 2X9XA 1J05A 2DMGA 2VLKE 2PTTB 5JIPA 5KTEL 3EOBB 5J3HC 3WFHB 2UWEE 4PS4H 2AF2A 5JXAH 3L4ZA 1FNEB 2ZUYA 1BIIB 1FH5H 4A37A 2OQJB 2VR8A 4G8GE 3PGFL 4IU3B 2A6KB 1NL0L 4M5ZL 5HJGA 3ZHLA 1NL0H 3IKKA 5B7EA 2PCPB 4I5BA 3VVVA 3ULUF 5DK2A 2MTAA 5F7HA 2GBVA 1QACA 3AFLA 5F9JA 3D2UD 1GZQA 4LCCC 4JHUA 4B95C 4JZJB 4S1DC 4XNYH 1IKNC 3BIAX 1Z5YD 2VDLH 4HT1H 1YMMD 2FK9A 4OZFH 3MUUA 1EFXA 1D6EA 5J7CC 5EU3A 1NJ9B 2VLJA 5EU7C 4NKOA 4F7EA 4UQBA 1NLBH 3WJLC 3BT2H 4GG6F 4HGWB 2XQBH 4EN3D 4WRLA 1FL3B 5GS1B 2CR0A 4WW2F 2Y22A 4HWZA 1NTDA 3LZOA 1H9VA 3U6XA 4NUGL 2G3ZA 3VXME 1E7VA 5D5MF 1CGXA 1U30A 5E1AB 2VZ3A 2F15A 4NUMA 4AEHH 3I9IA 3KLAA 5FUCC 1XL4A 2XFXA 1VDGA 4HIXH 1KXVA 1OZUA 1S7QB 3GSNL 4GG6B 3ARFC 4UTAH 5DWUH 4ZTPH 4XMZA 1FBIL 5DVNA 1I7UA 4MB1A 5F0MB 1AFVL 4PIBA 4RDBA 1YYLH 2R69H 3MLYH 2OTWB 4OGAD 2B77A 3UGUA 1YY9C 3VI4F 2EVGA 1EGJL 3QH3B 3HFML 1M71B 5C09E 2HKAA 1F58L 3KCWA 3KPSE 3D48R 3DTDA 2PYEA 2YMXL 2H9GA 3KWVA 3L4YA 1WD9A 3WXVL 3C5ZD 5CEZL 2E7HA 3GSRB 5AAWC 1KBKA 2JELL 1CG9B 4F2ME 1YEWA 1CBVH 1AQ8A 3K80A 4NC1E 4NHUA 4FG6C 1WBZB 4BQ8A 2QFRA 1XEDA 1MRCH 2IALB 3BT0A 2FB4H 3TEUA 2LU4A 3R8QA 4WFED 2QADC 4QD2E 4XNXL 2F54E 3SKJL 3UYPB 3L9YA 1R3JB 4XCCH 1KBPA 4MJ5A 3ESUF 4TTGA 4JW3A 3UDWC 5ADPH 1RJYB 2DEXX 4U4BA 4PJCF 2YUZA 5E08L 2APBA 1AGEB 5D2NC 4OJCA 2E75C 3L81A 4TQEL 4LLVA 5MP6H 2OR9L 3EYFA 3X1EA 5B22A 2PLTA 3GBNH 1L7IH 1FZMB 3UOAB 4PB0H 5JMOC 1DDHA 5KUKA 5GIRA 2WB1A 2P5EE 3FCTA 3HZ3A 4ZT1A 1QBBA 1C5DA 2IVFC 3WIHA 2YAOA 2J8OA 5FDWA 4FZEH 4H0GA 1G6RA 2JJTC 3UYRL 1USZA 1U58B 4PW9A 1CFTB 4M7LL 1KGWA 2VJ8A 4UOW1 5CZXC 5GRUH 3LNFA 4TRPH 1NWPA 1E50A 4LSSH 3OHXC 4PJXA 1E9OB 5FF6B 1OAJA 2BINA 3EGSA 5FFLA 2N59A 2XRAH 2HPTA 2WXKA 1PZ2A 4HBCL 3BWZA 1UJ3A 1YEFL 2DYPA 4ELMA 1T2JA 3VRIA 1CLYH 3U46A 4E41A 2HH0H 4NQDD 1OT2A 1OSEA 2F7OA 4Z5RA 3SPVA 5EFIB 5BW7A 1T6WA 2ZYIA 2BRRL 3OLGA 4FQ1L 5JHLA 1MJUH 4GXVH 4P5TB 1MUJB 3OPZL 3TIDA 2VDNL 3D6GA 3IXAB 5J5EA 4M3JA 4I18A 5EOQL 32C2B 3ARVA 1E67A 2FL5B 3ZJAA 1AG0A 5CMAA 4MBOA 1MEXL 5E1IA 4K9EL 1DCEA 5FLUA 5L0QC 2HRPL 3C6LD 3WKPA 4AZUA 4FQXC 5C0EB 2IGLA 3UTQA 4TOYL 4N2IA 4S1QL 2E7CA 2KPNA 3A23A 5DJAA 4UM9A 1AXIB 1FGVH 1WUZA 1TZOA 3VNZA 3BVVA 3WLWC 3M1BB 4DP6X 1E4XI 1FG9C 1KXQA 3JTSA 5A2KH 2YFOA 4AKOA 4NBZB 2PR4H 5IQMA 1UT2A 5DHEA 4JM2C 3B9KC 3DNKA 3DSNB 2AV7A 4NOFA 3NSXA 4PJAE 3CFIC 3P40A 3N5AA 3QUYD 1RPQA 4C4KT 1TQCC 1CICD 3DRQA 4JPKH 3ZZQA 1Q72L 1UUNA 3DV6B 3QJZA 5DVPA 1PQZA 3HS0B 4MB5A 5H4YA 3SYOA 3WJJA 2Y7QB 2GQHA 2Y6TE 2GBTA 1I1AC 3QIWB 2X6CA 4PY7A 2AEOA 5BS0A 3O41A 3OF6A 3FYIB 3T65B 1UEMA 2HLFC 1I8KA 4OIIL 1SVCP 5F0LB 2B14A 4XNZC 2EDEA 5E2UL 3VXTB 1T1ZA 3C2AH 1S3KH 1RZIB 3ZE2B 4Z7NE 1H3VA 5I66A 2PWDA 1AKPA 2XFXB 3WAKA 1PGRB 3BZ4A 2Y69B 4ZMXA 3QISA 4O02A 1UA6H 4ZPVA 5K1JA 3HLKA 5GZOD 2X2IA 1VZGA 4RBPK 1NCUA 2AJSL 3ABMB 1JF6A 2OFQA 4QTIL 1XV8A 3HMXA 4LEBA 2ZUUA 2AQQA 1YN6A 3LS5L 4M9OA 5BOPA 4AYID 4UV7H 5GS3A 4BBWA 3VXMA 43CAA 4GW5A 4JRYB 4PVMA 1ADWA 4QRTB 5FCUH 2VC2L 2XBTA 3NCYP 4JHZA 1KYDA 2CKBL 3DJTA 3R1GH 4X9BA 4OFQA 4L4TB 3AMKA 3C5ZA 2HT3C 3ARDB 5DUBB 3STBA 3NJKA 3II2A 1PD0A 4KZEL 1S7XB 2AXFB 4WWOA 1Q94A 3ZL4H 3KYNA 4OKVA 5C0CB 1N6QL 1KSRA 1JWMA 2DBJA 3BP4B 3MRMA 2F7IA 2CUAA 4OD3H 3CN1A 5C0BB 3MPCA 3K8KA 1EHAA 4YR6A 2HP4A 1YNLL 5DC2A 3NVQA 2H0PA 3NCCB 1IUZA 5D7IE 4Q56A 2R2CA 3LZQA 3D08A 2BRRH 1DJZA 4FLQA 3RPIA 3AU0A 2PR4L 4N6RB 1XSJA 1OB0A 5J12B 1HT6A 3Q2CA 4GG8B 5IVZA 1OTSD 4K8RH 2Q8BH 4BZ1H 4R26H 4MCYB 2VZOA 4K7FB 4KZCA 1R5WB 3QVAA 5I18L 1B4LA 2FVNA 2IFFH 3PHSA 4KQ3L 4X8CA 4D8OA 4L18A 3OBAA 4U1MB 5AW8B 3PGCB 2ZKHL 3T6ZA 1CDYA 1OP5K 2BVEA 4G8EB 3VMOA 3VXOA 1PKOA 2VLJD 4WGVB 4RAVA 5EU7E 1P53A 3RHWF 1NUDA 4Y1AA 5AW9B 2R51A 4TVUA 4AJVA 3FUNA 4F58H 1JWUA 4UOZA 4QR7A 1P4IL 2QPSA 1YNTB 3OPZH 4TLSA 1MCLA 4CJ0A 2IANE 2CIIB 2AEPH 4GW1A 3RIFK 1HEHC 3RVUC 1E4KC 1RUMH 3WSQH 3ZX1A 5DK0B 2AV1B 3IFLL 4GQQA 3ROOB 4L9LC 2WP3T 5DVLA 1XCQA 4BH7A 3L2NA 3QYMA 4D0CA 4AQOA 5K9KA 2VL5A 1S78C 1J1PH 3QS3A 1NC2A 4ANKA 5E08H 1LWRA 3BMWA 2VKWA 3PJLA 4NM8L 3NCJL 1CI3M 4UNIA 2EYRA 1ROWA 1IRAY