4B96A

Family 3b carbohydrate-binding module from the biomass sensoring system of clostridium clariflavum
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
151
structure length
151
Chain Sequence
SHMILKLKHYNEQQSLYSKAIRWDFVIENTGNSYIDLRNVKVRYYFKDDYKNINFAVYFYSLGDEKNDVKGKVYNIRQSDSSHKYLEVTFEKGSIPPGDAAWVFGAITRDDWTEFNQEDDWSFLQGNSTFSYWDKMTVYISDKLVWGIEPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULOSE BINDING DOMAIN-CONTAINING PROTEIN
publication title Structure of Cbm3B from the Biomass Sensoring System of Clostridium Clarifalvum
rcsb
source organism Clostridium clariflavum
molecule tags Sugar binding protein
total genus 39
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2012-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 4b96A00
4B9CA 4B96A 1GA2A 4JO5A 2XBTA 2WNXA 1JS4A 1G87A 4B9FA 1KFGA 2XFGB 1NBCA 4B97A 2YLKA 2WO4A 4C8XA 1TF4A 3TF4A 3ZUCA 4TF4A 3ZQXA 1G43A 2L8AA 1K72A 3ZU8A 4B9PA 3ZQWA 2WOBA
chains in the Genus database with same CATH superfamily
2QQKL 1TJHL 4WHYH 2VZVA 4N2HA 4JRXA 3T3PB 4LXFA 4Q4IA 5A43C 1S7QA 2J2ZA 4PMFA 3GXMA 3O2DH 4E0RA 4TLSA 3EJSA 2XXCB 1EEZA 5ALBL 3F8UB 1N10A 1M05A 4GAGL 3OTTA 4RDQG 3CFBA 3GSNA 2I85A 4WNQA 4XXWC 5INDB 1NGZA 4JM0A 4KUCF 3LS5H 4MYWB 5L2JA 1CICC 2Z8WC 4HK0B 1I7RB 1RUKH 4L4VE 2VDML 4LIQE 4A2GA 4MAYA 3HUJF 2C4FT 3KPSA 5F3HA 1ZDSA 3KG5A 4K4KA 3F6JA 2G2RB 4BSWB 1TVBA 4L4TB 3ZSSA 4JKMA 2D4FA 4ATWA 2F8IA 3BVDB 1KYOJ 4O02A 1NMAH 3WGVB 3I9PA 2AJXH 2O5YH 1A1MA 3C60C 4HPYL 5T3XH 4AOFA 5FECA 1W9XA 3KGRA 3O3EA 3OWEA 3NP3A 2BM3A 1XAKA 1QRNB 2Y5TA 3FQRA 3PWLB 5AKSA 1Q1JL 5LG6A 3TTYA 4CU7A 1SLUA 3HBGA 1YJDC 3W9DB 3WJLA 4YUEH 2UZXB 1R3JA 5HGBB 4R7DA 4FG0A 2FVNA 5EIIA 2DJ4A 4GFTB 3QWRA 2EDXA 1PZUB 1A6ZA 1TSRA 3VB8A 3HJ0A 4BK5A 5I6OA 4YDZA 4BFFA 3V4PL 1DUZA 1IEBB 1OTUD 4OUUA 2OTPA 1Q0XL 3TA4D 2FNBA 4B97A 2V17H 1N64H 3CHSA 3ABMB 3AWGA 2AJSH 1SLXA 3B9DA 2W8CA 2FSDA 4PHXA 4R7VA 3LB6D 3LZFL 1U93B 1BAFH 1XMWA 5DUPH 4AH2A 5CFHA 3HHSA 3N3EA 2KZBA 4LCWD 3INUH 2GTZA 2NTFB 1FNGA 3DX6B 2R9HC 4ONOA 5JOPD 5CUSL 3LH2L 4TNFA 2XI9A 3OAWA 4B50A 1J5CA 4Q2ZB 3WBDA 1E6JL 4N0RA 3UTTD 3UC0H 3BYYA 3RWDA 3ZTNL 2H0JA 2PNDA 1RZIA 3AQYA 1PFCA 2BHZA 4M5YH 1EAJA 4EI0A 4N87A 4YNYA 4UOJA 2KT6A 1P4IH 1AZVA 3Q2CA 3ZU8A 1MXGA 4QWWD 2IAMB 3VI3F 1Q72H 1TO5A 3OGCA 2UWEF 1AMXA 3OKDA 3Q8FA 1PG7H 4N22A 1XEDA 3HE6D 3BZ4A 5CJ8A 1NPUA 2QQLL 3DTUB 3T0XA 3DYOA 1CDJA 1A7RH 3PP3K 4R0LA 3GEWB 5JXEA 2DQDL 3WNNA 2VSDA 3H9YA 5B4MD 3X12A 4HJ0D 1G0DA 3TFKD 3UPRA 4AE0A 1GGYA 2X9YA 5HDQH 4NQED 4YDIL 1E27A 1LO3L 3HAEB 3RILA 3LIZA 5KYUA 5MERA 4KNTA 4TUKL 1ZV2A 2JLPA 3U36A 4XN2A 2VDPB 4A2FA 4DSYA 3RNKA 1YSOA 4NRZB 3LZPA 4PJXF 3VSVA 3DECA 1G6RB 2OKMA 3L1GA 2N1KA 1AGCA 4F37F 3GMPB 4RMQA 3ZKNC 1AC0A 4BV1A 4BCXA 3PWNA 2YPVL 1TYRA 3RX9A 5ITFB 3QXWA 3T1FB 1T22A 1AR1D 3PDDA 5GRZA 1L0QA 4OJYA 5LGJB 2DWTA 4TL4A 4C4UA 2E46A 4UMGA 1K9TA 5GS0D 4A63A 3GXIA 3TVMC 5JW3L 3OJVC 4RVBA 4NHUA 5DA0B 3O3AA 4JKPH 1MCWW 4IHOB 4O2CB 1QLFA 4RSVA 1QHOA 4UILL 1EAQA 4V1DA 2VXTH 1TTUA 4HXAL 1MQ8A 3S37H 3VFNB 3S5LA 1KIQA 4AYFB 1Z5HA 4OZIA 4XWGH 1JGVH 1FNEA 1LEKB 5J6SA 4JKKA 5IVXE 1OB1A 1MHEB 1FCCA 5L88H 4HOZA 5E8OB 2WKLA 4HGWB 2Y2TA 2A38A 2QSCL 3QNXB 2HKFL 3EOYG 2F53A 3DUSB 2VITA 3HG0A 2DMCA 4G6FB 1JK8B 4NZTH 3RP1A 3WMQA 1SDAB 2DLFL 3NDYE 3CFJB 4R4ND 1MW0A 4CVZA 5IROD 1OLLA 4JY6B 1ROCA 3N43B 3X1NA 2YSSA 2CO3A 3VXTB 1GIGH 1IAKA 1C9SA 4Y5YA 2X70B 4BDVB 1NCTA 1ML0A 4DEPC 3FQYA 4ADJA 2BVTA 4P4KB 1U8PB 4XGZB 4Y19D 5E1IA 2ITCB 4UCFA 4YL4A 2EVFA 4G8GB 4LASL 3VXME 1AFVL 4XNYL 4GP8B 4LK4A 3FB7A 4BXVA 2F68X 3EIFA 3PG2A 4XVJH 1DYZA 2WXKA 2EIZA 4K7PL 5JHDB 5I17B 1O0VA 4RMTA 3LD8C 3TO4D 3W57A 4HIIB 3FUIA 4BSJA 1W8NA 4Z1PA 3T2QA 2Q7NA 4BM7A 3V4UH 1JWSB 4WO4C 5DO2C 4Y2OB 3TN0B 1JGEB 4PTTB 1X3DA 4ODSL 5EZJA 3QUYA 2X2JA 4PWHA 4H20H 5IW3A 5IOKA 1J12A 3SZ6A 2C8NA 4KHTL 3DV6B 3WFEH 2DEXX 3QE5A 4UIMB 1XCQA 3WLBB 3MNZA 3QISA 2IOMA 3MTRA 4PGBA 5FHAL 3AZUA 4PGDB 4PJDA 5IGXL 4P5TB 2ZX6A 4ES9A 3D07A 3B34A 3BWAA 5I82A 3CMGA 3QIBB 2W0PA 3WE6B 4XCEA 4BE6A 2QMKA 4JRXD 5D4IA 2AEQL 3EO9H 2EE3A 5EBMA 4HX1A 3NEEA 4QHMB 4KKAC 4BFBD 3PHQB 5IVZB 3D39B 1WBZB 5DURD 4OD3H 4W9HC 4FL4B 1IM3A 5CP3A 1X9UA 2NX5E 4P04A 4GMTL 4YEFA 5AW0B 3QT2A 1JYNA 3HZKA 4MAYD 3FCSB 2X4SB 3I6GA 4NZFA 3MRKB 3KPSD 5T1MA 4MWFB 2W9LA 1ZJBA 5DGQA 3SY0A 3NIDE 2P46B 1SXSA 1TJGL 2XQYK 1JPST 3SE3A 2I69A 2FYYA 1D5BB 2P7TA 2GITA 3OAZH 1C08A 1DLFL 2F61A 4OZHF 6PCYA 2W81C 4F92B 3RPKA 5GS2H 3MBXL 4A2LA 1FZMB 4PCSA 3A6OA 1NGXB 2FATH 2X2YA 3H42L 2A74B 1YEWA 2VAJA 4N8UA 5T1JA 3SYOA 5DVPA 3QWRD 2KPNA 3MOBL 3SE4C 3ARQA 3JV6A 4ELME 3U46A 1XHHA 3D33A 2VLJB 4CN6A 1R3IL 4M6OL 1MHPL 2FD6H 3QO1B 2EIJB 4MA3A 3HNVL 5A16B 4N2MA 4R8WL 1RD6A 1MAML 2EYSB 4R6UA 3VWJA 5BS0E 4N2EA 1UZ6F 5F7YC 3GBML 2CO7B 4Z7QF 5AW5B 4KJWD 3AXLB 5LBSA 5B8CC 3O4LE 3WJMB 3VXNA 2XXFA 1EXHA 1WBXA 1K8DA 5I26A 4O00A 4GXUM 2FUQA 3ZTEA 5CBAB 3P69A 2O72A 1Q38A 2BH0A 3ZJAA 2C4FU 5KYYB 3DXAA 1HEZA 2CJTA 1CDCA 3PE9A 1INDL 3D69B 3QNYB 3BSHA 4UNUA 1IEHA 4P8QA 4BQ9A 3IDYB 2E7HA 5ELIA 2CSPA 3KWWA 5A6LA 4GY4A 3EF7A 5GGUA 5DFTA 3SPJA 3QUMH 3U30B 4N8VB 1A64A 5I15L 2R1WB 3QDGE 5EULV 5A2FA 3HI1A 3L3HB 2ENPA 4GOSA 5JIHA 1FE8H 4GRMA 4AVKA 2W9EL 1N6UA 3H3PL 2JIXD 4IRSB 3OZ9H 5F0JB 2CO4A 1UWEH 3FH5A 4WFFD 5HGDB 4DPAX 1R3KA 2EDMA 1S3RA 2GI7A 5LO7A 2Y7OA 2JCCF 4U1KA 2H1LM 1P69B 3D25A 3CSYA 4XXWA 3CQPA 5BRZE 4XNMA 1M6OA 4TUJA 5AB0A 1KB5A 4R4BB 4KJPC 5HHME 3QCVL 2NY3B 3GRWL 3TBSB 4X80L 4YHIB 1RZFL 2KKQA 4HU8A 5J5EA 2OR9L 1ICTA 4H4NA 1BBDH 3B9KD 3KCPA 1YECL 1NA8A 1KCVH 3FU9A 2AJYH 1QW9A 3W5MA 1ADQH 2VDKH 4FQXA 3C6SB 3D50A 2FIKB 1G7IB 4M7KL 4ALAH 5KVGL 2XA8H 4B96A 3SDAB 2PXYD 4WIQA 4JHWH 3B6SA 2X2UA 1UKQA 3IDMB 2QR0A 1UCBL 3BO8A 4JG0H 1CF8L 1QFUL 2CK2A 4HIJB 1UJ3C 5T3XD 3T4AC 2OL3L 5DU7A 2MOVA 4DO6A 3ABLB 1N12A 3SPVB 4QLWA 4OZFH 4ZNCD 2E6PA 3HG1B 3NVQA 4V1DD 5K9JL 4M3KB 2CBMA 3IAQA 4L37B 1LDPH 3PWPE 4FMVA 4HS3A 1K5NA 5F89B 3RIAK 3VFSB 4TXVB 4R3SA 5B3SB 5JYLA 1JZ7A 4MX7A 4YXKH 3VXOA 3PPEA 1LEGA 4JPKH 4M7LH 2J21A 4W81A 2OA9A 32C2B 2P8MB 1U8LA 3JYCA 4Y9BA 1MHHB 1D7CA 1RULH 3RFZB 3TBYB 3REVA 3G6JA 2YQBA 2D7NA 1A5FL 1JZHA 2F53D 5FYLH 2B0SH 4KZ0A 4N68A 2YAOA 3A4EA 2O61A 1MFMA 1KT2B 5FUOL 1R5VA 1KCSL 1DVFB 2JF1A 3O3DA 3JYBA 4I77H 5D1QB 3S4SB 4ZW8A 1E4WH 2UX6A 1P84J 2JJTA 4OQTH 1BG9A 4PD4K 2UY7A 4KKNA 4MD5A 3N91A 2A73A 3RU8L 5D7SH 4LDEB 1KJVB 3I3BA 5D70H 1J1PL 1HINL 3ILEA 1YEEH 4IBSA 1NEZA 1CE1H 1E28B 3BN9D 4FQIH 2OZ4H 3LS4H 4YHZL 1DUYB 2XFGB 1XGUA 4LSTH 1CLOH 3FSVA 3EH3B 1E90A 4PJHA 1O75A 3RVUC 4GRLB 1FVCA 4M1DH 5DS2A 1EJ8A 3LSOB 4JGMA 4I4WB 3V5KB 1D5XA 2VN6A 5HYJD 1OE3A 4B9JA 3HUJB 3I85A 3LPWA 3KL0A 2HA1A 4M4RA 3SCMC 4PTUA 3QUYD 4GI9A 2AW2A 4C83A 1A6VH 3PGFL 4B9CA 1FO0H 2PW1B 2QZQA 3LQZB 1AS8A 1IKNA 4WK0B 3ZO0A 4LIQH 4JFOB 4KX9A 2D7TL 1JGLL 3FCTB 5HDBF 3C09B 4MNHB 1NMCC 2PUQT 3QS3A 2OMZB 3F2LA 4RGOH 1DSFH 3WEXA 2GC7C 3CSBA 3DJ9A 3FTZA 4J3OH 4G83A 5DQDL 1DN2A 4QRRE 2IBBA 4PJIF 2BNQA 2MCPH 3PP3H 5L2KA 1H0DB 3SPHA 4BWWA 3BD5A 4WI2A 2EILB 3P3YA 4M61B 3BZFA 4CC4C 4LHUG 4MBRA 4YFLI 1MIEH 5AOMA 5EBLB 3RYMA 5C0DA 2NYZA 3ULUF 3OMIB 4AGLA 3UTQB 3TX4A 1FAIL 1D9KC 1WS8A 3T6WA 1ES0B 4XC3H 1MG3C 4APQB 5E6SB 4I9WE 5C09A 2EDFA 4GNKB 1JV2A 4ERSL 5CN2A 5EU5B 3V6OC 4MZIA 4K3JH 5I75C 1FGNH 4BXSV 1WC7A 3DJRA 1P7QB 3T8MA 5GGTH 4CRPA 3Q5TA 4O4YH 5JDJA 2X28A 3FTYA 1ULVA 3EH5B 1ZJAA 4XN7A 2QDVA 3QDMD 1EDYA 2JKRM 3JWDC 4ZNEA 3BEWB 5E6UB 4X6CE 1CC3A 2A4CA 2H3KA 3ATEA 5ID0B 1NGQL 2W91A 4NN5B 4Y5VB 5EIQA 4TVPD 1IBGH 5G2NA 2H7WA 3QJFA 1TCRA 2YD0A 2PR4H 3DGCR 3DBXB 1EFXA 1VLXA 1J18A 1D6EA 4PY7A 3TIDB 1PKOA 3VI3B 1J0YA 4OQTA 4RA3A 5FGCE 3EAKA 3VMPA 4KKPA 3F6LA 3RA7L 1AXSA 2OMXA 4K5PA 5DHYA 3KLHC 5D72H 3QUZA 4N0UE 2GI0A 3A6CH 2ZOKB 3AM8C 1S8DA 4EMZA 5TQ0H 4B0MM 3ECBA 3FO2B 4CVXB 1ZGLB 1F00I 4YDJA 4G82A 2FJFB 4J3TA 4LSDA 4BEIA 1Z1WA 4PG9B 5D7JC 5E7FA 1SMDA 5E6ID 4Z5RB 3GSVA 2IIJA 5JNYA 3MRLA 3CBJB 3L3GA 3RVTD 4NPYA 3GMOA 1A47A 1W72H 4KU1A 4P2RE 2P44B 4PJXB 5FA4B 2WCPA 4WO4A 1XGPB 3KPRE 4C57C 1DQLL 3LXUX 1AP2A 1KEML 1XD0A 2YMTA 3DJZA 4WI8A 1BVKB 2FQDA 1PZBA 5F9WB 1E4JA 2VXSL 3F58H 3CFDA 4AZ8A 1NAKH 5HVWA 3QEQB 4LP5A 1NMBL 4GW4A 5I76B 4OIIL 1LO5A 1KFGA 2APSA 2IWKA 5J89A 2XKNA 1R5IA 3L4VA 4GMSL 3UROR 3ZGIA 4K7PY 5JORB 3HFML 1MAJA 3OKLA 4PJ7B 2GBAA 4DZ8B 4YBQD 3W2DH 5ECGA 5SWZA 4GQ9H 4JJHA 4BWTA 4U1GB 3ZRSA 3PV6A 4OJEH 3RY4A 3MROB 4G80A 4M02A 2J88L 5F1NA 5JXAH 3TCXA 1QSZA 2IGFH 2ED8A 4XPBL 2XUWA 1S9YA 5BOPA 3O11A 4DGYL 1KBGL 3ECWA 4L1BA 1FNHA 3I6SA 1QX1A 3N55A 4RFNB 2R0ZH 1FORL 3H7LA 3QUXC 2ZWSA 1NOLA 3UYPA 4XNAA 1KYAA 4D0DA 4FQXD 2FCBA 3FT0A 3FQUB 1I9RH 3IDXL 5I8CA 4LCYB 2D9QB 1SOSA 4Y2DB 4MA7H 2F8VA 3H9HA 1HCFX 5EZIH 3NCFB 2ZUWA 4JFFA 1EH9A 3EGDA 2MH4A 2VOTA 1OAQL 4RX4A 4DKDC 4G8FA 2VTFA 1NCBL 1QKZL 3SDDB 3WIAA 2WB7A 1NH6A 4U6VL 1V55B 1CGSL 2APBA 2XN1A 4X99A 3WKML 3MX0B 1WZLA 2IG2H 1N5YH 1OGTA 3NJLA 3SE4A 2OV0A 1KXHA 2WAQA 3WN6A 3VFOB 1A1OA 5CHNB 5DGRA 5J8OA 5FO9B 1MFBL 4PB9H 1UXSA 4I89A 4Y4KC 3KPMA 3ZYZA 5A40E 1TKWB 5J12B 3M88A 1ZS8A 3FO1B 1P9MC 4G9DB 5CEXA 4FZ8L 4JUSA 2HJLB 5HYQA 2RHEA 5C0ND 1URZA 1SN5A 4E36A 4GAAA 5F1SA 4YDLB 3IRPX 3T8XB 5I5JA 1GSKA 1MREH 5B8CA 2JI1A 5T1DH 2OK0L 3GI8L 3MQIA 3VD5A 3V5DA 4DEUA 1A3LH 1F4WL 5ICXB 1X9QA 1JL8A 2VJ0A 2XX1A 1UACH 1ZT4A 4OGXL 4KVNL 3NACH 1IAII 5TE7L 5J3HD 4PSPA 5DFAA 3EOBA 4U1NA 5ID1B 3C8KA 3MLWH 3VXQB 1CXIA 2NQ3A 4AQAA 3FPXA 3C2AL 3NFNA 2HTLC 4I18B 1LP9A 3W39A 3DO7A 2DICA 1L7IH 1AQKH 2YOAA 4NSKB 5IQ7L 3WYRA 3C5ZB 4X8JB 3LRMA 3HHRB 3VFUB 1QYGH 4AT6A 2F54E 4NJ9L 1P4BL 3Q06A 4HLZH 2E9JA 1I7TB 4NQSA 4YHKH 4ZD3H 1XGYH 1P5UC 4JQVC 4JVWA 3SBRA 4ES8A 4QTHB 1WICA 4FFYA 4EXPX 4AGMA 5ENWA 3L1EA 5DMGD 4B7IA 4X4XB 1B0WA 1YHPA 3NSDA 3RL1B 1UYWL 4KKBC 3S2AA 1BFOB 5TF0A 1IC5L 2J44A 3HFFA 1AKJA 2HRPL 1FL6A 3ZE0F 1BZ8A 2L7JA 1TVHA 3KJ6H 3MA9H 3GXDA 3WXVH 1YRKA 4DP7X 2UV3A 1FUNA 5IM7B 2BNQD 4OFDA 5L2KD 5GS1B 2Z31B 3CVHH 3VD3A 2IH3B 1IJ9A 4I0KA 2BSCA 2FBRA 3L3IA 4XRCA 2EE2A 2R2EA 5AFAA 2IDCA 2BLFA 1P7KA 1ZWIB 2VDQH 2IPKB 1QHPA 3IRZA 3QWNA 2APVA 4FD0A 3UG4A 3TEYA 3MJ9L 2VAAA 2XKSA 1FG2B 1ZSHA 2CDFA 3QEGL 1BWMA 3T4AA 1A8ZA 4OLVH 4G1EB 1D5MA 2WVSA 3S3PA 2VLRA 2H9GA 4TULH 1TZHB 4G7SB 3MXWH 2C3WA 2E4TA 1T03H 3PUCA 3R0NA 3CFEA 4FS0A 5EOCJ 1A6WH 3N2JA 4OLYL 4D3CH 1E2VA 1Q9KA 4NYLA 1BYOA 1NIBA 2VDRL 5HI5D 3AQZA 3WI9A 4AYEC 2XQYA 3L3OA 1I8IA 1SBSH 3N9GH 3DX7B 1NINA 3F5WB 4P23C 3BI9X 3EYVA 5FOBA 2YMOA 1N0LA 5SX5K 2BS8A 3R7QA 4GS7B 2CLZB 4RETB 3VNZA 2DL9A 3ARDB 2RFXB 1I4FA 5FYLD 1BYNA 1EGJH 2BNUA 1UJTA 2WWMC 2NY2D 3LVEA 1E9OA 3MCKA 5GISL 3V7MA 3GEFA 4M7ZB 1NFKA 4JFDE 1ACXA 3PLYA 3QUZD 4IRJC 5BZWA 3UYOD 2VH5L 3HLKA 3QNZA 4DK3A 3E3QC 2DYPA 3VFMA 1BZOA 2XZCL 2VZOA 2WBJC 3MFFA 3WIIH 2JCCB 4KTEL 4RGMC 3Q01A 4JPIA 5C0EB 1KCLA 3BGFB 2F1EA 3BIKB 1DQDL 3W11D 1CURA 1E4XI 2ZOTA 5H37G 3N40P 4Z6AT 3AMKA 1MJ8H 1NUGA 5B38A 4JO1L 1D3CA 3SCMA 1K6QH 4U2YA 4B7LA 4LKCB 4AQ1C 5EPMB 1JWUA 2WOYA 4G5ZL 5CLXA 4RGNB 1AD9A 1O7DC 3STZA 4EN3C 1BVNT 1XXDC 4KZDH 1DO6A 5DR5H 4AQOA 5F6HI 1G7PB 3GSXB 5IW1B 5IHBA 3UBXB 2MPAH 4L4VD 1FDLL 1DBJH 5CGYD 5C07B 4L3FA 4XOBA 5HDRA 4YDVB 2P8LB 1OM3H 1IGFH 3SYAA 4OLZH 3LRHA 1WYJA 4PJAE 4QXWA 1Q9OA 4YO0A 1JF1A 2ZWLT 1A9EB 5IY5B 3P4LA 4HJJH 5D1ZC 1ZLWK 2OX5A 3HZMB 4O58H 2NY0C 3VTMA 4OF7A 4JL2A 2DQEH 4ZFQA 3DIDA 2HVKA 3CH1B 1Z66A 4CC4A 2E9GA 4UQBA 4Z7NF 3NTCL 4HFUL 2C3XA 3CFKA 1FC2D 3VQ1C 3RURA 1MF2H 6FABL 5C08E 1F6AB 2X5PA 1I9JH 2HTKD 4L9DA 3NSCA 1D9KA 1U3YA 1OM9A 1VFBA 1Z9OA 5I9QB 3EBHA 1I1FB 1MJ7H 4X5WB 5DC9B 4AQEA 3ILQD 5T5FA 1A66A 1IARB 5BUAA 5JO5A 3HC3L 4AYBA 1HNYA 2WXRA 3H7BA 3QRGL 4FQ2H 1UB5A 3X14A 1QEWB 1CDHA 4F7PA 4QJ5B 2CK0H 4J3BA 3WIHL 4EVNA 2Y36L 4K7FA 2FWUA 1ETB1 1U3HC 1IGYA 1ZLSL 3ZOAA 1RU9L 1G9ML 1AMYA 2WOBA 3DC0A 3B5TA 3MLZL 1MNUH 4B5ZA 5KOMC 2ID5A 2R56H 4GIAA 1T1XA 5H94A 2JELL 5HYSG 5CSZB 3I6KB 2TAAA 4OCWL 5C0CE 1SQ2N 2Q10A 1YYCA 3DETC 4MDIB 5EN2B 5F1KC 3MV9A 4YVNA 3KGTA 1HEJC 4NQDA 4P2QE 5DWPA 4JHAL 3SPCA 1CI5A 3R7RA 1B0RA 3KLLA 3MA7B 4RIRA 3FUMA 1J5HA 1I9IL 3AG3B 1QVOB 2IWGA 2OBGA 4O9HL 1FF5A 4ZPVB 4LOFA 5D7EA 2FJHA 2AQ3A 4URTB 3F85A 5AZUA 3GRGA 5EC1B 3ARBB 2F5AH 3ML8A 3WN5B 2XICA 1SM3L 2R15A 3ARSA 3UL4A 5CMAB 2AVFA 5EU6A 2YWZA 3HE7C 5GHWL 4K15A 4MA1B 5D7JA 5DO8A 4AMKH 4LRNH 1IBDA 1RZKL 3FFDA 2K4WA 3O45A 4HUCA 4BQ6A 4S2SB 4M8QA 5CO1A 1ECZA 5J1TC 1VEPA 2JKJA 4IU2B 4LT7A 2F08A 1PQZA 5HDBB 4L5FH 3V0EA 4WDIB 4B3VA 2WWKT 1WV7T 5DLLA 4XCNA 3VA6A 4YXHL 3HNTL 1SYSA 4PRHA 2FWOA 4Z7UF 2COVD 4PJIB 1T7YA 1G84A 2HRLA 3NJNA 4XPGL 2L4OA 3O8XC 4OR1A 3E0GA 5BOZG 3VFGH 4LKXB 5T3ZD 4BBWA 1SVCP 1V05A 3MXVH 5E4EB 3ZKQD 3D4CA 4MNGB 5HHOA 2HFFA 2JH2A 2XT1B 1P1VA 2D7QA 3EFFA 3KLKA 3MV8E 1OD9A 4UQCA 5HPMB 3MZTA 5J6GA 2EZ0D 1M71B 1L0YA 1S5HA 4L29A 1I1AD 2ESVB 5L4FA 4G6AD 1M53A 1QR4A 4OGAD 4AW7A 2AV7B 3SY6A 4EXKA 2BC4A 4MMZC 3CX2A 1CGVA 2BY2A 4KY1H 1HOCA 1C12B 2J57A 4HG4J 1TSHA 4YMPA 1OPOA 3NJIA 4PU2A 3ULVF 2W0FB 5DJZB 5C86A 5I6XC 1AKJD 3T3MB 4ZFGL 1NSNH 4L8SC 2AJUL 1BG1A 1NCDL 2F7QA 2LLLA 1DCEA 4YHNA 5C6TH 2DBLH 3DPBA 2ZTBA 2O4EA 2Q76B 4FJ6A 4LCIL 1M57B 2BVEA 2WO4A 1U58B 3K1KC 3MREA 4ANXA 4DP4X 4BGLA 2GPZA 4UDTB 5D7IE 5KVEL 4TSAH 1AO7E 3WD5L 4P9HC 1ET7A 5B1JC 4QIRA 2R4RH 3SN6N 4XO3A 1D5IL 1Z0MA 2VLKB 2W88A 3QULA 4FFZL 2Z7WA 4ZFOL 2X4UA 4EI5C 2VW7A 2J5LC 4OCXH 4QRQB 2FAUA 2VLRD 2FGWH 1PG7X 4LBAA 5DJCB 4Z3GA 3LDBB 5CIPH 5IOPA 4YSQA 5C0BB 5DXWA 3HA0A 3APFA 3TPKA 4G9FB 3S35L 2FR4B 1IAIL 3KXFE 2W94A 1S5IH 5HJBA 5I5RA 5IKCA 4C56A 1DQMH 5FV2A 4WEEA 4PJ6A 1S7SA 1GGCH 3VXMD 2BVQA 1QMUA 4K71B 3DX0A 4HIHA 1MOEA 3EYUH 2OXHB 1T2XA 1H8OA 3BVUA 2EYTB 1NAMB 2EE9A 3U4EB 1MVUA 5JHMA 1INEH 1ROWA 2BHYA 3QI9C 4CMHC 5GSVA 2V2WA 4NXSA 4YE4H 4HISA 3P30L 1JPEA 5BV7C 4FQJL 3ZPDA 2NLJA 1B2YA 4WHCA 5ICZA 1BLIA 3MYJB 3F64A 2YEVB 3Q3GB 4YIQB 5E00A 4XTRC 3BN3B 3Q6GL 4Q9RH 2SEBA 2VDNL 3G5YB 3TONA 1EERB 3AREC 2WLIB 1S9VA 5CZXD 4J6RH 3GSNL 1OY3B 4BZ2A 2V2XA 3KL5A 4AUUA 3WNLA 4A38A 1NFDF 3S37X 2Y7NA 2GHWB 1XIWC 1WZMA 2GEEA 3KPLA 3EOTH 3SE8L 5AW3B 2HAZA 5IIEB 2A6IB 2ZUSA 1QD0A 1CYWA 4ODXA 4DP0X 1J5DA 1GOHA 2HVJB 4FNRA 4DN3L 4O02L 4XMVA 3QHZL 3EDJA 1X9RA 2I27N 3MACL 3ZYOA 4O2EA 3AQXA 2Y0SA 4AL8H 2NX5D 2QHLA 3IF1A 4PUBL 1KFAL 3HN5A 1XF2B 2YQ2A 1G9HA 3QW9A 3MO1B 3SBQA 2DQHH 2YBRA 3QQ9C 2JMRA 3HI6L 1RZJH 3S4SG 1HZLA 3QDJB 2NYYC 5J7CC 4OM1L 5A6IA 1DQJB 4EF3A 5ESVB 4F7CB 1UKSA 2HLAA 4IBWA 3SDXB 5F93C 5CKGA 1RZPA 4AEHL 2Q20A 3EYOA 1KBWA 3BKJL 4OI9A 1MCJA 2Q86A 4K9EH 4OFVA 5C0RL 5I8EA 2G4GA 1JXJA 5LGYA 5DZPA 4Y4FA 2WVVA 5PCYA 3KR3H 1CT8B 4GUPB 7CGTA 3N41F 4N2AA 1GPOH 4ZI8A 4MB3A 1NL0H 4UNIA 1MFNA 1TQWA 2FB4H 4A6YH 1ODUA 2QPUA 2YAHA 1TZAA 4KPHL 3ARGB 3T0BA 1BPVA 4UUJB 1WHPA 3TBCA 4QHPA 4OQ1A 1F4YH 1F8TH 4W9CC 5KAQF 2DQIL 2Y5EA 4J8QA 3DUUA 4QRTA 3UX9B 1BDYA 4EQ3A 4KK6D 3FSZA 1LWRA 3BMVA 4KI5C 3TYGL 2Q8AH 1QTPA 2BNRE 1S78C 3ZQ9A 3QQDB 4AXWB 2N7AA 5L7XH 1NUFA 4FHJA 3MRQA 3BW9B 4Z0BL 5BS0D 4GP5B 4CMMB 5AUMA 3B7SA 4X8XA 1E4XL 3O4LD 4E9XA 3MRJA 2JB5L 1BA9A 3FB6A 1FFQA 3NJXA 2OMYA 2WCGA 1PYWB 4U6XB 3NBNA 2NY5C 1C16B 5EZOH 4F58H 4NO0B 3BAJA 5TPWL 1E8YA 4OLEA 3QFJE 4WFHE 1KELH 4OFKA 1OTSD 4H0IA 5LDUA 1U8IA 2X0WA 4N28A 1AACA 2D31A 3FSAA 3FULA 1X5IA 1ND0B 2P80A 4HK3J 1BJ8A 1DQVA 2BOCA 2RH0A 3KYMB 5DHVB 1J5OH 5HHXH 4IRJA 4K8RL 1XGRA 1OP3H 1G43A 1SHMA 3DROA 1GY2A 4HUXB 4XN4A 5SX5H 4QXGH 3QR1A 1I3RB 1U92A 3L2MA 5T1KB 1JRHH 3LIZL 3DV4A 4I13B 4J8RA 3WFBH 3PHAA 3QDGD 1DDTA 4QHNA 4XHQA 3SO5A 3ZE0B 1MWOA 1ZTXL 3UTSA 2BVYA 5LGHL 2I25N 2NXZD 1REIA 4PRHD 5ISZA 5GGRY 3VDBA 4ONHA 3GGWB 1XR8B 1IM9B 4NZRL 4AQ1A 3ES6B 3TS8A 4XNZB 1RJZA 2X4TA 2ATPB 5LG1A 4P07A 3IGLA 2KQMA 5BRZD 4ZS6C 1RK0A 5F1IB 3AC0A 1X5JA 1MCQA 3OKYA 2O5YL 5HHOD 2EH7H 2V33A 4NGHH 1WRFA 3COOA 3IJEB 2Y23A 1BEXA 1Y6NR 3PJSA 5EUKB 1A3ZA 2VLMD 3EJZC 3G9VA 1HX0A 3E6HB 4WWOA 1SVZA 3SJVB 4U1MB 5FO7A 4GBXD 2DM2A 2C7UA 5D1ZA 4XP5H 1JZIA 3CQQA 4ANKA 2X09A 1FZKB 1N8ZB 1BOYA 2DDQH 3B9AA 3VGDA 2VLJE 2EXWD 3WKYA 4W1TA 4IRZA 4NNPH 5HGAA 4JO4H 3VFTB 3H2QA 4HCRA 4LCUB 2V17L 1E5UI 4U4IA 1HIMH 3GBDA 4MQXC 4TL5A 1ACYL 5JTWA 1SLVA 2AJSL 3IFNL 1MFEH 1OP9A 4X9BA 3MLTA 8FABB 5EOQH 1AJ7L 2J1XA 1ZLWH 1BXAA 4FNSA 4NENA 3HMXA 4MS8C 4Y1AA 3E38A 1RLBA 4A04A 4QOKA 4FFVC 5DS1A 3D1MC 2X89A 3VH8B 3ZIMA 4BELD 3INUL 1UD4A 3GS0A 3FRUA 3GDCA 5IBUB 4RRPM 1JXGA 5A7BA 2JTDA 2UZIH 2AKRB 2XZAH 3NPSB 5FA3B 4XNUL 2WMPA 4PB0L 1AGFA 4JFPA 3OAYK 4OLUL 4YZFF 2CMRH 1WZAA 4GUOA 1BYPA 5FKAA 1VFUA 1MCWM 4IBTA 2F18A 2RAMA 2ZD0A 1GGIL 1P4IL 1HXKA 1UVQA 1JS4A 2HJFB 1FIGH 5DEGA 2EVHA 3QXAA 4HUVB 4Q9BA 1Q72L 4E2OA 2KS0A 3QEHB 2X4RA 1JI1A 2BOBA 1C7SA 3IPBA 1FNSH 2GIYA 1TTBA 3HE7A 4OF3A 4Q52A 1UC6A 1BMGA 4FNLL 2A9NL 3FMGL 5JA9A 3DHMA 3TM6A 2UZPA 4F8NA 4F7TB 3SD5A 1EO5A 2X7LB 4HQQL 4JRYA 3LKNB 3IJHB 3D0LA 4H8UA 3WFZA 2GUOB 2HCZX 5IF0B 5I16A 4ANUA 3FYEB 3V2AR 4HLEA 3FN3A 2EIDA 3WS3B 1SHXA 3O8XA 4ODVL 4WAFA 4Z7NB 1OAUL 4FQHA 4MHHI 1X44A 3TCTA 3NIFE 3H2PA 2W60A 3EOAA 5KANG 2F2HA 2X4NA 1KY6A 4QHUB 4MZRA 3L5HA 4GUCA 3AGWA 4OJDH 2V2TA 1IGCH 2Q87A 4HEMA 2Z6FA 4WK2B 4DTGL 4ODTH 5SWQA 3UTPD 3LH9A 4NN7B 4QRRD 5ABDE 1XH3A 2Y1YA 5JQ6H 2E7LC 1L9TA 5ACMA 1DQTA 2P5EB 1L9MA 2VGLM 4NO5B 5AAMA 3X1BA 1XB8A 5K39A 1J0JA 2ZUYA 4UQ3A 2VLLA 5T33H 1QABA 3G6DH 1KXVC 2OR8A 1TTCA 1MG2C 1QQDA 2DWDA 2G3NA 2J8UF 2ZXEB 3LVTA 3M46A 4P57B 4PLKC 3TF4A 5KSBE 2Q6WA 5L88L 5ESQA 1K4CB 3RNQA 2VL5A 4BKLA 5EF2A 5BXFA 1IC4H 4OBRA 3LNEA 3KPPA 4L8SA 4F1SA 4TVPL 4I9WD 4UINH 1D6VH 4ODWB 4WCYL 3A22A 2DD8H 3ZE2E 4QUOA 1NC2D 2N0MA 5HI3D 1KTDB 2NY1D 4XE0A 1S7TA 4BUGA 1LVEA 5HPOA 3RUGE 4Y4FD 5AL0A 3CFMA 2VC2L 3L3KA 4E9TA 4QO1A 5E8NB 3X17A 4F3FA 4X6DE 3WFHA 2YRZA 3TN0C 5B1JA 3LN5A 3CSTA 1VGKA 3WCYA 3HVDA 3O41A 2BSDA 4PRNA 2V9RA 5F7FA 1YC8A 3RB7A 5IWLA 1L6PA 4XVUC 5J1SC 2EC8A 5HHQA 4XVJL 5LBSL 1MFCH 2DQJH 4CADB 3GMMB 1CD8A 4K5OA 1QI3A 1A14H 4JY5L 4Z77A 4X7SL 3ULVC 1KENL 3OHXC 1JZ4A 4LF3B 5CWSA 1TTFA 4U33A 1Q0EA 2NXYB 1KYOK 3QIBC 4MJ5A 1NICA 4L8CA 3GHPA 1RZ8A 1AXTH 4P05A 4Z7UB 3UO1L 1S3KH 1JI2A 4X4ME 2NW3A 2GY7B 3VXUA 3C2SA 1A7PL 5CXPA 2ED7A 5FYJU 3QI9A 3CV5A 4KGLA 1Z6JT 4MASA 2YPLA 3TV8A 3OJDB 4NT6B 2EECA 1KCWA 1I8LC 2Q0ZX 1AR1B 4ZSOE 4HUWA 4UIKH 3QORC 5FFGA 4HF5H 1XDTT 3LRLA 2H2SD 4HXBH 4ZOCA 4N5EC 2BSSA 2CXKA 2EE6A 5HJ3A 2AVGA 3IMWA 3L3JA 5JA8B 1B88A 3FO0H 4FXKB 5EEWA 1M9SA 1KXQA 1KB5L 2O93L 1CR9H 4XPAL 2V7HA 3ZL4H 1SHWA 2XWTB 3CDGB 3KDMB 2BWIA 4PJ8D 3BPNB 3PYCA 4UDUB 4Y1TA 1KBKA 4NQCB 1M1XA 2E7BA 3OMZA 1RUAL 3F01A 2NQCA 2JKLA 4DWHA 1X6NA 4KK5D 4YAQA 5I6MA 1GYVA 5ISZD 2BY1A 2HT2D 3KYAA 3ROOB 4J3WA 4QRAA 4TRPL 4ZTOH 3ZDYF 4D9QE 4PJCF 2WXMA 3KMDA 4NO2A 3I6LD 4P0DA 5AW8B 1SFDA 4OJCA 4S1SH 3T77B 5IQOA 2A99A 2OTUA 2ROXA 2WIMA 1WT5A 3OMAB 3F7VA 1KNOB 2VIRA 5EO0A 5KBKA 5DVKA 4BFNA 3QAQA 2AXGB 5C71A 3PXHA 5C0GA 1II4E 1A4JB 2M8XA 4PIRF 4HD9A 2FATL 2FO8A 2F19L 1QLEL 3TNMA 2YEQA 3AU1B 2GW5A 1IIIA 1JWMB 1MVYA 1BOGB 2NY0D 4D94A 1J11A 1GR7A 1N8OE 3DRTB 4Y16B 1MJUL 2W65A 3LV3A 2QKIB 3VVVA 1IAIM 2E8ZA 1ZE3H 2M2DA 4PJBA 4XMZA 4BFRA 4QHKI 1U8KB 2IFGA 2UWEE 4ODHL 2B1OA 5IG7A 4PP2A 1Q0YH 5FO8B 2WPGA 2FTAA 2WNWA 5LJYH 3VYPA 4IJ3C 2VDOB 5DD5L 4F33B 1SEQL 4QXUH 3RTQB 1QPPA 3IDYC 3MNWB 4N4YB 2BSRB 2OXGA 5EO1B 3VXSA 3S88H 3VRJB 4H8WH 3I02B 3V6OE 4WW1B 3GSUA 4Y1AD 2EICA 3AXHA 1KLUB 2WBWB 3QFGA 1KTBA 4K3HA 4QOKD 2JKIS 2X89D 1DQQB 1FLRH 3B2MA 4G59C 5AVWB 4EOWH 3TCLB 1M7DB 2YD4A 4GB9A 2YXWA 3CHQA 1AHKA 3FRPB 5E2TL 2WUBH 1THCA 1QASA 3AT8A 2A9BA 4IRSC 4HIQA 3U6XA 5E51A 3JV4B 1EEYB 1ILSA 4K3EL 1X4YA 1B6DA 1HQ4B 2WTPA 4JFEE 4PJGF 1PZDA 4XP9H 4HC1H 5FK9B 1FGVH 5INDA 1NFDB 4UM8B 4WUUB 4DVBA 2NY3C 4LSRH 2R7EA 2ICEB 2RD0A 1JERA 3DARA 4NWTL 2UVEA 1ZHNB 2IPUK 4X4YB 1RIHL 1VGEL 2ERJC 2O5ZL 2OSXA 1KB3A 4JM2F 3WFDL 3MBEC 2G2RA 4UZGA 3OXSB 2WUCL 1MIMH 1EHLH 1NCHA 1XO8A 4HMCA 4L4TA 4FQCL 1J0ZA 1JZFA 3GXUB 2A77L 1Z9MA 4XBEL 3M7FB 2E4FA 3HEIB 3PWJB 4KJQD 1JN6B 2F54D 3K7UA 3NA4A 2VXVH 4N2GA 5KTEL 3ZUNC 1QRNA 2EO9A 3PWLA 4UV7L 3BD4A 4NB7A 4H25B 3B2PA 1DFBL 5TK2A 1BBDL 2UZXA 5D2LE 5C0AA 4ZQTA 5I73B 5H37H 5HGBA 3WO4B 3P3RA 2P45B 3V9CA 5FGSA 2ZOUA 4JVUA 1U91B 2VDKL 3O8XD 3I9AA 5I1JL 2H1PL 4Y5XB 2W1NA 3ZHNA 1JNLL 2E7CA 2EDEA 1R3HB 3D0VB 3N41B 5AW1B 5CGBA 1IEBA 1WFUA 3BSZH 3P2DA 3TA3C 3WY1A 3RFZC 4G6MH 1HJBC 3SZKC 4W9DC 1RUQH 2H8PB 2HWZH 3NEOA 3ME0B 4JQIA 1ZANH 1JGUH 5JHLH 1NGPL 5AG8A 4C4KO 1U93A 3RWHB 5DVLA 4CVUA 2X3BA 4IIZA 1DANT 4M7LL 4IW4C 4F37K 3KWUA 4KK9D 2NTFA 3LPOA 5AW9B 2IDUA 4JFTA 2F5BH 5KSVB 3TEZA 3DX6A 2MHAB 2HG5B 3S36H 3OXRB 4GKNB 4FNTA 4LHUD 1FVDB 3MLSH 3CDZA 2B0SL 4WTZG 2Z7ZA 3LEVH 1UM5H 1A7OL 4YN3A 4F8OA 1ECYA 4BIKA 3L5XH 3PXJA 1E4WL 4OQTL 1ZXKA 2OJZH 2WK2A 3VGAC 3UZQA 3ZMRA 3LKOA 1KTCA 2DJUA 3WUZA 4U31A 1MN4A 2FL5B 1KIPB 2PN5A 4BZYA 4M1GL 3ABKB 2ITDA 3IXAB 3GUFA 3FONB 4ANVA 5TK4A 1H19A 4OLWH 3RAJH 1H5BC 1CE1L 2CNYA 4N2IA 3NA9L 2QVIA 3LS4L 1MCKA 1QSFB 2RQ8A 4PGCB 5E2UH 1OP5H 2WZPA 2H45A 2HFEB 3PREA 5DUJA 3MNMA 1KJ3L 3HAEA 5D96B 1IT9H 3U9WA 3KBPA 5DJAB 3BEVB 2GEQA 4M1DL 5E6RB 5IHZB 4JKNA 3EHBB 3LNIA 3B8YA 2X6UA 5AZEL 4YOKA 4Z8FH 1CLYH 1PY0A 3J07A 5IFJB 1G6RA 1F42A 1IZJA 5B3JF 2JKNA 3GMPA 3T08A 1XCWA 3QDHA 4IOIB 3B9KB 5ITFA 1Z5LB 2YQGA 4L3CB 2ZX5A 3T1FA 4DH2A 4FI7A 2CUHA 3OAYH 1ZA6B 3VGHA 5LGJA 1GZHC 2YUXA 1EBPA 2ZAIA 5AVUB 1SXBA 1FH5H 1R0AL 3OB0H 3RPIB 4OZHE 2E27L 4RGOL 3T4YB 4IHOA 1VIWA 4WZ9A 4EKJA 2VDMB 1E9PA 3ORJA 3TBBA 1FFTB 1EAPB 1TYJA 1LK2A 2R1XA 2MCPL 3VFNA 2R1YB 3T0EB 1SJEA 3S34H 4AYFA 2Z1KA 5H4ZA 3FF7A 4WKXA 3KBHE 5GGQH 4J3OF 3DO3A 1MIEL 3PFUA 4GEIA 2ZG1A 3VDCA 1MHEA 3FB8B 4MAUL 1S7WB 2NY4B 2VXQH 2IANE 3K46A 3CFNA 2ALAA 4PS4H 4X0KB 1W80A 3QNXA 5DS8B 1HZKA 3BIBX 3QUHA 4PI2A 2BXZA 4ZUWB 1YNKH 3DUSA 1NOAA 3MC0A 3KH4A 1GZPB 4NDMB 5A2CA 4JZNB 1UH4A 4I3RL 3GBLA 4QHLB 2IH1B 4F7EB 2F74A 4HJSA 2VQUA 1UZ6E 1GMIA 1JIBA 1JVLA 1VRSA 3LAFA 4JPQA 3TBTB 4Z7QE 1OB0A 5K9QI 3CC1A 1IE4A 1KXVA 2X70A 5C08D 4O4YL 2ITCA 1PZSA 3V4PB 2I26N 4G8GA 1OAJA 2DJSA 1CDGA 3SDYH 1KJMA 1LYQA 1V8HA 1TQUA 1IBGL 4IKKA 5H35A 1INQB 4IIQC 3MRMA 1JG9A 4MZ2A 3QQXA 3TJEH 2DWXA 4ENED 3CDYA 4U49A 5JHDA 1FRGL 5I17A 1AS6A 2E6JA 2WWOA 4LARL 4U6YA 4MGXA 5FFLA 4JO5A 5DZAA 3P3UA 1PKQA 2VWEE 4NNYB 3VQ2C 3ZRCC 4H40A 1EWHA 3IAGC 1HAUA 2AEWA 1JWSA 3TN0A 4K0OA 2EDJA 3B7YA 5C0JB 4PTTA 4G7RB 1LHZA 4YDKL 2UXTA 1A4BA 2ZUQB 1TQBB 1V10A 4PRIB 1IEAB 4LU5H 5C0CD 3EJYC 5L6YL 2DW5A 2B1HH 3DV6A 2NSXA 3GHBL 3SKNB 4ONFH 4L0PB 4UIMA 4P2QD 2IC2A 2JCCE 2P52A 4MMXB 5D5ME 3WLBA 3Q7JA 1B9ZA 3KAAA 3R1GL 4XOCA 3UO8B 3VQMA 4AIEA 4EBQL 3FFCB 2XNAB 3FJTA 2R2HA 3CMOL 3BT2L 3T04D 3NGBC 1L6XA 1N0XL 3QIBA 1P6AB 5KVFH 5EOTB 3SB3A 3WE6A 2OTWB 4M6NH 1GHFH 3U7YL 2YJQA 5T3ZL 3ARFB 1AQDB 4QHMA 4Q9CA 4RGNE 5IVZA 4QT5A 3D39A 1WBZA 2EXTA 2QDWA 4I3SH 5D2NB 1H6FA 1GYCA 5CJOH 5DC2A 1ZHLB 1DE4A 4LPUA 3TYFB 5JLZA 2VM4A 2O5XH 1A6TB 3DVGB 5KVDL 1F02I 2X4SA 1PX8A 3GSQB 3LEYH 4W9KC 4MWFA 4TNEA 2C9RA 4FFYL 4U1IB 3R19A 4XCFH 1GGUA 5EB9A 5EEZA 3E3QE 4L4TD 4JX0A 4GQ9L 3NCXA 5E08H 2DMGA 4E41E 1V54B 4X6FA 1JCVA 2J8UB 2CDGA 5DD1L 1QNIA 2I7SA 1PZAA 5E8PB 5A2AA 2DQGL 5J11C 5DK2B 4F2EA 1QRND 4WWKB 5B39B 1XF4B 1P84K 5KZCB 1FZMA 3RDTC 2WXOA 3CD4A 4PAZA 1NGXA 4FHKA 1CF1A 1IGTB 2AABL 4OD2B 4I0PB 1A2YA 1O7DE 2Z91B 2ZKYA 3QPQD 4QYOB 1AC6A 1HOEA 3ZHLA 5ADOL 1NLDH 1Y1DA 3VTAA 3QXVA 1NIEA 1WSST 3QO1A 2Z4TA 3GJEB 2A5UA 5EZIL 1G7HB 3QVAA 1KY7A 1BX2B 4YEEA 5A16A 1BXXA 3OX8B 5I0VA 2XPYA 5EZLB 4NEHB 5FUZL 4AWJC 2EYSA 4UMSA 3FS9A 1PJWA 2F7PA 1VZHA 1BFVH 4Z7VF 4D7BA 2CO7A 4NPKA 1HHJB 2GABA 3AXLA 2D7MA 1XB6A 3HS9A 3WJMA 5ILTH 2QSTA 4ISVB 1HTYA 1MCSA 1F58H 3UZVA 2Z92B 2KH2B 1A6UL 4JO8A 1OAYH 5KYYA 3AY2A 1BM3L 3QIWB 4K3GA 3VFRB 1EV2E 3GQFA 1IJNA 3QNYA 4HHAB 4TNVF 5D1XB 4AEIL 5EF3A 4LPYA 2IAAC 4DN4H 1U8CB 4HHGA 2VABB 3KXFD 2OYMA 4BQCA 1U41A 4MS8D 1YEGH 5T1DL 2BW4A 2IAMD 4N8VA 1MXDA 3BUYA 2R1WA 4FQLH 1A3LL 3EJJX 2DI7A 3DOSB 3L3HA 3BX7C 5JMRA 4MXQD 1MLCB 2Z8SA 5FIEA 3SSGA 4IRSA 2YN5A 5SWSA 5HGDA 1KLGA 2KDYA 3MLWL 4PJIE 5F8RC 5IP4A 4NN6C 3U0PB 2WZPD 2V5MA 2WXLA 1SRDA 2H5UA 3K0WA 3RKDD 3BWSA 1F3JB 1AQKL 4GEJA 5LLIC 1JSYA 5TFSH 5E8EB 2VJXA 3L7FB 3ULUE 2ZUVA 4NKOB 4WI6A 4Y2LA 3PQYB 4CNIB 3EF4A 2ESVE 3BH9B 3MBEA 5GS1C 3ZDZB 3P4OB 4PJCB 1OARH 4LL9A 1JFQH 1TQCB 3HG2A 3EJQA 2G3ZA 3C6SA 5D9SA 2FIKA 1G7IA 3IDNB 4GG8A 1DANU 3M1BB 2WWKO 2XG5A 3SDAA 1JPGB 1KYFA 3MJ8B 5IBLC 1CCZA 3MMEA 5FF6B 5I74C 3US9A 4HIJA 3QG7H 3MDJA 5IMMB 4GSXA 3E2HB 2C1OB 3SPVA 4V11A 1UD8A 3TH3T 4NIKB 1HQRB 4F15C 1AI1H 4F9PC 1EVUA 3HG1A 4Q9QL 4J4PA 4M7JL 5IBUG 4J1UB 1RURH 4DT2A 5F89A 1E43A 3VFSA 4DCQB 2V5RA 3IE9A 1AIZA 2IBGA 5AWNH 2Q3XA 5FR3A 4OGYL 1H15B 2ZKHL 32C2A 2YIHA 2R8SH 3Q1SL 1PZ3A 1MHHA 3DX2A 5DTFB 4QRSB 3WOVA 3RFZA 3TBYA 1TMQA 2D03L 4ZX5A 1N6QH 1G0YR 2C5DC 2VLKE 4JO3L 3UIZA 5T5FL 4G6FD 2MOGA 2YHGA 3LEXB 5JIKA 2XOTA 1DVFA 1JCKA 5IB2B 5D1QA 3GBNH 1YNLH 5D1ZI 5C0BE 4D3CL 3O81A 1J8SA 4RBPK 3SQOH 3O2VL 5HHNA 5JIDA 4G9FE 4GFXA 3LPGA 4P4KD 1HKLH 2Z35B 3MKGA 3JWDL 4LZKA 4ZXBB 4Q6KA 3IK2A 1BIIB 4S1DD 1ZLVH 4XPFH 4G8GD 5DLML 4Z78A 5DI8A 1JTOA 1E28A 3E8UL 3LYRA 4PJGB 4N9GB 1DUYA 3CPLB 3OJ2C 4G7VL 1PAMA 3FUEA 3BGFC 2WSPA 2NDFA 3E7JA 3VYNA 3K8LA 5JHDD 1A0QH 4GRLA 4FERA 1DEEB 1LO4H 4F2MA 3LSOA 3NIGF 3OKMB 3R8BB 2OQJB 4I4WA 4NC2B 4NQVA 3V5KA 2UX7A 3HUJA 2IBZX 1D7FA 3CCHB 1X6LA 3CZEA 4JM2B 3SQBA 3TN0D 4DW2L 2XBTA 4AKQA 2Y7LA 4NO3B 2VZSA 4GO9A 3QB7C 3QUMB 1X7TA 4G70B 5EH1A 2DQTH 3FFOA 4IDJL 3TJPA 3FHEA 1NCAL 1H5BA 2CJ3A 2PW1A 3LQZA 5E1AA 4JPSA 5I1KL 3QFJD 3CWGA 4JFOA 1V7NL 4WFHD 1VACB 3OLDA 4P5TD 4Q56A 3FCTA 1RXLA 4AMWA 2YGNA 4AEFA 5DJ8A 1IGIH 2OMZA 3V6ZB 1RQ5A 2XVBA 4DERA 3QIBD 3H3BC 2NY7L 2J7LA 1I1YB 1K6QL 1DZBA 2Z1PA 1JPSH 5I5IA 2J1YA 3TEXA 2OAAA 3U4BL 3D39D 4LOVA 1HHIB 3A4FA 5DR5L 2NZ9D 3K71B 5EBLA 2ZXGA 3IPEA 2EKSB 3FH8A 4R83A 5B1AB 5IK3B 1DBJL 5D7LB 2JK5A 3P9WB 2B4CH 1E30A 1IBBA 2ADFH 4JFQB 1JRHI 2QPFA 1IGFL 3FH7A 1ES0A 3RY5A 4HZ1A 4D0CB 5FV1L 4APQA 3U0WH 1BF2A 3G08B 3F05A 3RQ3A 4HJJL 2B9AA 5IMLA 1MEXH 3NN8B 3MV7B 2DWSA 4JLRB 4QGYA 1CFVL 2QZ5A 5DA4A 3GO1H 1SOXA 5EU5A 4YFLF 2WYTA 4FQQB 3QZWG 5I1LA 1J88A 3NAAL 5B3NA 3LKQB 3OAUL 4OZFB 1P7QA 4XNXH 4HULB 4P2CG 1MF2L 3HC4H 4AYMC 4XO4A 5L8LB 3NMEA 4EIBA 1GYWA 3SGDH 4FTVE 2MKWA 3BEWA 4OB5L 3K6IA 3H4FA 3MKKA 1CLVA 5I6PA 5ID0A 3QQ4B 3JZ7A 3E8VA 4Y5VA 4AVIA 4IBLT 1GJIA 4AM0B 1IFHL 1NLBL 5LBGA 1IE5A 2RB8A 5B1KA 2VLJD 1YY9C 4PRPA 3R4DA 4AE1A 3TIDA 1FNFA 1ID5I 3VI3A 1H3WM 1KEGL 4QCIB 4KROC 1E7VA 3ARBC 5GRWA 2A6DA 2ARJB 3H2WA 4OJFH 2QPEB 4CU8A 4QF1B 4YQXL 1T3FB 1DJXA 2BMKB 2J4WH 2J8HA 1BQKA 3JVFC 4IIQA 4JDEA 1TJMA 4PG9A 5EWIL 1C5DA 2EXYC 3B4NA 1RUPL 2VR7A 3P0VH 3LN9A 4Z5RA 3GMNB 3HB3C 3OG4B 5DD0H 1HYSD 3Q2LA 1AE6H 5HDOA 5I1CH 1ONQB 4P3CH 3DBSA 4K9JA 4PJXA 4Y9EA 4O5LL 5FA4A 1XGPA 4P06A 4FG4A 5AVRB 4L3AA 5JIQA 3V79C 4FX5A 1YO4A 1OF0A 5A3ID 2BERA 3A23A 5CM1A 3GJFH 4FFWD 3IDIB 3QEQA 4R4FH 5GGSB 4YC2C 3QHFH 2FECI 5T5NF 1VFAB 2Y07L 4X6BB 2FO1A 1J8KA 2OMVA 1QBAA 4HIXH 5E94B 4Z3TA 1IKFH 4HWUA 1FAKT 4X7DC 5JR1H 1FO0B 2HLFD 4L5FL 2WN3A 2ZXCA 2A7BA 4HJUA 5JORA 2UUDK 4OCYL 4KMTH 1C5CL 2WKOF 3MVSA 2DQCL 4S1RL 1GC1H 3JWOC 4PJ7A 4IRSD 3TIEA 4TOYH 2GBUA 4OZGE 4BZ2L 2X1OA 3VGEA 3IXTB 1WJ3A 4XH2B 1J0IA 4TTGA 1TFPA 1RL1A 1U95B 2AQQA 3G5ZB 3MROA 2EDDA 3OHMB 1NCGA 1WBYB 1UOKA 2X4PB 2H32H 1YC7A 4XOEA 1JP5A 3L45A 3EO0B 2BOLA 3QZPA 1YEHH 3V4VH 1TNNA 1WE5A 4Z18A 5KN5B 4NRYB 2IO5A 4J7RA 1NM4A 3O2WL 4N8CH 4ZFZB 1ZVHA 4UNTA 3U9UB 1Z9NA 1BAGA 1BLNB 5AW2B 5AW4B 3FQUA 3SDAD 4LCYA 2PTUA 4TQEH 4Y2DA 1I8KA 1IL1B 3CBKB 4JREB 2DF3A 4H8HA 5CILL 3TO2B 2DTSA 3I75B 4KVPA 3O4OC 3SDDA 3RDTA 3RHWF 3HG1D 2DI9A 4J4PD 2YS4A 1AY1H 3FRPG 3UJTH 1W6WA 3MX0A 4N5UA 4NHCL 3B2DC 2FE0A 1A9VA 4K5MA 4TUOB 4KI1A 3VE0B 3JTTB 3VFOA 4Q58C 1QPKA 3QFDB 4G8IB 5CHNA 5HD8C 2JQMA 3FCBA 3H9SA 2A1WH 3HS0B 1TKWA 1JD7A 3FO1A 1QNZH 2HT3C 4ATTA 3MLRH 3TJHD 3VXRE 3O6LH 2FGWL 2HJLA 4WU5B 5I1IH 2E59A 4EUPG 1ZA3B 4FP8H 1BQHG 1T2QH 4ZMNA 5K1NA 1DVFD 3FTXA 5D1QD 2YKLH 3BCFA 3QJSB 3RWGB 3ETBJ 4MCYB 5DJ2B 4QNPF 1QSEE 2R29H 4NJAH 4ZUUA 3KS0J 3HLAB 4BSVB 1F4XH 5ICXA 1BECA 2CKBA 1OF2B 5FAAA 2ZSVB 3CTTA 3TV3L 4R97B 2HSIA 4ZUVB 3ESUF 1GRWA 5TDOA 4JJ5A 5K93A 1HSAB 3NSYA 5DRNB 5ID1A 4N3UA 1W72B 3ROLB 3VXQA 1CBVH 3WS6A 1INEL 2YLKA 3EYQC 1AIFA 4I18A 4KUCD 4BFEA 1IKOP 2GJ6B 2W9DH 4NSKA 4YE4L 4GRLD 3C5ZA 1AXIB 2WLLB 5IMOB 1URLA 5DSCB 3QK0A 3IKCB 3FC8A 2FX8L 5IFAH 4PN6A 1N4XL 2XWBB 1F41A 3ZHKA 4F5CA 4MXWL 1N3NB 3JSSA 4YJZL 4YHMH 5IT2H 3FT4B 3MRIA 1JYWA 1RAMA 4L3EB 4M43H 3A21A 4DUXA 1DBML 2JQZA 4X4XA 1Z9SA 1JGIA 2OMNA 3GTNA 4D9LH 3FTGB 4R2GC 1CE6B 1QO3B 2VMFA 3HN8A 4ONGL 3D9AH 3IU4L 4LSSL 3OR6B 5TF1L 2Y6SC 3OR7B 3H6JA 3QZNA 4L1TA 2G5UA 4PGEB 2V9UA 1C1EH 4UTBH 1WZ1H 5F9JA 4JL1A 4XNQB 1OAXH 2FNWA 5IB1B 5IM7A 3KE0A 2P5EE 4P2OC 5GS1A 2Z31A 1HWHB 4RQQA 3BLPX 3L4XA 4E9WA 2FO4B 1QBLH 2EUZA 3L9YA 4LVNC 4CKVX 3VFPB 4WEBL 3O6FC 4TNGA 5CR8A 1EHXA 2I07B 4N6RB 5F8QC 1ZWIA 3BVXA 2IPKA 5EDSA 1EZUA 1PZ5A 3BVWA 4KQ4H 4A39A 1G7JB 2WXGA 3TBVB 1FG2A 4V2BA 3WTUA 2CUIA 1MRDL 5L9DH 4P46B 1DFXA 4G1EA 4APQD 4JN2B 1ZK5A 5JUEH 4KDTA 5F7NC 4F9PA 5A2JH 4Z7VB 3EJCA 3B2UC 4N2DA 5F7EH 2VRKA 5I1HL 4K9EL 1P7QD 5A1AA 3BP7B 4IRZL 1I9EA 4N1HB 3MJ7A 1YMMA 2CIKA 1NBVH 3VTTA 1J8HE 2L3BA 3DX7A 4JHZA 4JDVB 4HCRL 5GZND 4CN1A 3F5WA 4LPVA 3A5VA 1NL0L 3NABH 1AGDB 1HESA 3VMNA 2FB4L 5IB5A 5IB3B 3X3FL 4NXKA 2YC1A 2CLZA 3A3YB 4ZMTA 3BHBB 3O0LA 3I2CL 3ARDA 5C92A 4GAYB 3HMXL 2F58H 4WQOA 3ZO9A 4GG6E 2DOCA 1GCFA 2PW2B 2DQUL 3BZDA 3D4GA 4UTCA 3POHA 3OG6B 3SDCC 1F11A 4PJFF 1W0YT 2JB6B 2ROYA 2D3VA 2WLMA 5C7ZA 1DJSA 4NCC1 4Z7UE 5LQBL 3V8OA 1KGWA 5SV3A 2BS9A 5TQ2L 3D3VA 2ZE0A 5C9KA 4RMSA 3RIFK 2LTQC 4X9GA 5C0EA 4AIZB 1P2CB 5MEOB 1TQSA 3BIKA 5LAPA 1G7LB 4XZ4A 5D93B 3VGBA 4TSBH 4RBPH 1NCUA 3ARTA 3KPOB 4KXZH 4YLCA 4DGUA 1E40A 4YSSA 1MI5E 3WXWH 1J5OL 5HHXL 5EPMA 5B1BB 3CZFB 3EJYD 1IQDB 2GBTA 2A9ML 3OKKB 3ULUH 4HAGA 1G7PA 1JRHL 4K23H 3GSXA 3WFBL 3UBXA 4WGWB 1NCNA 5C07A 5I1GL 4LLMA 3ULVE 2XWZA 1TJIH 3TH2T 3PWUB 2IDSA 4YDVA 2P8LA 1T4KA 2J12B 2BWDA 3PJNA 3RGVC 1JD9A 1JHLH 2GK0B 1A9EA 3S3CB 1U6AL 1ZTMA 5AKVA 2X3CA 4PRBB 1XZ0B 1KXTB 2OL3A 4ZDHB 2QVFB 4MDJB 5FC9A 2WM0A 4EZJA 1E67A 1MQKH 2EO1A 4JB9H 1JPTH 4CBZA 1FNLA 4JAMB 5JIIA 1F6AA 4FG6C 4HT1L 2R0WH 4HDIB 2X9ZA 5KJRH 1FYTA 4PV1C 2YXFA 2CBTA 4ZQKB 2XACC 2HX9A 1I1FA 1Y6MR 4LLAA 4X5WA 1KWKA 4MB5A 2VDQB 5DD6B 1UUSA 2KI6A 4XP5L 4QXTB 1RUMH 3S7GA 1DBAH 2EIKB 4KKRA 5AL8A 1A7QH 1QEWA 1TEFA 2AK4E 4M1CC 4AJVA 4ELMB 3T6QC 4FXGC 4E0RB 4Y2DD 2DDQL 4PYGA 2ISDA 1R34A 2YD7A 2ZOLB 3GNMH 3TZVC 5FYKU 3EDKA 3MUUA 4LLDB 1I1RA 1I7UB 3CQFA 3SDDD 5BUGA 4Z7AA 1G1OA 1JUFB 4LPTA 1MFEL 5CSZA 1Q90A 1RH8A 1X4XA 4FRWA 3I6KA 2EAEA 4MDIA 4QRPE 1MCPH 5EN2A 1U8HA 5GRUH 5ALCH 1G1CA 2CHDA 3L1OL 4OZIF 4HKXB 1JJUA 3D7PA 3MA7A 1B3JA 3ZKXB 3W0WB 4BZ1A 2WZ5A 2HH0H 1T0NB 3MJ6A 2UY6B 2KZ1B 5EC1A 3ARBA 5I18L 2LAAA 2UZIL 4MCZB 3WN5A 2XZAL 5ADPH 4U05A 2FECL 4Z7WA 4PJ5B 3PDOB 3Q05A 4MD4A 2PPEA 2VSKB 4P5MB 5KW9L 5I66B 4P9HH 1BJ1H 1OGAB 2FX9H 4OY9A 2L0DA 4MD0B 4S2SA 1NFDE 1FIGL 1MCHA 2FK9A 3BLKA 4WDIA 1CLZH 1SN2A 3FYIB 2BP3A 1KYDA 2H6UA 1KCBA 3S5YA 3VJ6B 1MFAH 4IMLB 2ZKMX 3SE9H 1EBAA 2YFNA 4QTIH 2AAAA 1P4UA 3WNJA 3KYKL 3PL6B 4LKXA 2D2CC 3FUHA 3LQMA 5F6HJ 2B1AL 3CZGA 1OT2A 4MNGA 5BV7L 1OSEA 3C5ZD 3Q8AA 1EZSA 4HWEH 1A1NA 3NCJL 5G4OA 1M71A 5HHMB 2DQMA 4XXCC 1OTUC 4W6XB 5KSAB 2G9KA 1SMOA 1RIUL 4UT9A 4DP1X 4ZT1A 2VZTA 4XZUB 4ZW6A 3BUIA 1I8MA 4JM4H 3AG2B 5DCCA 5HGHB 3NZHH 4EDWL 3LB6C 1KCRL 2DS4A 5EORL 4G3YH 3DIVA 2W0FA 1A21A 4Y4HB 3D09A 4HEPA 4XMKH 2VMDA 2XN9E 3U9PL 2X4OB 2Y2YA 3MRGB 4F93B 5TE4L 4GKOA 3L3DB 4OF0A 4PLOB 4CDGC 3QBTB 5MI0B 2Z31D 3FF8A 5G55A 3WL9A 2D0FA 3RI5F 4GUQA 4H88H 3PWPB 1U58A 4XAKE 2CGYA 1MCLA 5T33L 1RJYA 4IGBB 1ASOA 4UDTA 4ZUTA 5F2FA 3SQRA 2Z3FA 4IU3B 5L4MA 4H1LA 3L8QA 4LBEB 5IBLD 4QWWC 1HCVA 4HPOH 2QQQA 3ULSB 5CCGE 4Q6IB 5HY9B 3V6FA 3HE6C 5DJCA 4NOFA 3SKUD 3X11A 1A25A 2WV3A 2DD8L 1XMEB 3A4DA 1SZNA 5FGBA 1HL9A 2GSMB 4DOHB 3ZR5A 1X5MA 1GS7A 4JS7A 4HJ0C 3TFKC 2QELA 3KVDD 5E2WH 4OW6A 2FR4A 3BAEH 4JFUA 2N7BA 5EO9B 1HH9B 1L7TL 4N85A 1RZKC 2AI0H 2G9HB 5KG9B 4EDXA 4HV8B 1JGDA 1HI6B 1UG9A 1Y0LA 4WRLA 4MCMA 3B7RL 1FFPB 3G9AB 2EYTA 3ARDD 1NAMA 1M7IA 3CFCH 3D85B 4OLXL 1CVRA 1DJZA 2W95A 4LAQH 3W1ZA 2OMWA 5CEZL 1QSFE 1T5XB 4OBSA 3UTZB 4DKAA 3L95B 4KMLB 4AKPA 1RJLB 1AR1C 1HZHH 1KDJA 2QQNH 3EG9B 2WGNB 3GF8A 2JXMB 4GLRH 4KAQL 3MYJA 3Q3GA 4YIQA 5E03A 4AUJA 5IFHL 1VF5C 1T7WA 1VZGA 2YUVA 4HKZB 5GS0C 4X50A 2AK1H 3O3UN 2ENSA 2XWRA 3FT1A 4O2FB 4OZ4B 3G5YA 2WLIA 2IALB 3V5HA 5GJTL 4YSTA 3VCLA 1BSIA 3GYRA 4W93A 2DKUA 3BAYA 4L8DB 4F1ZA 3QJQB 4KITB 3WEAA 1BD2A 1FWXA 4LPXA 3BPCA 1M6UA 3V4LA 1HJCA 5CLTA 4E68A 5DZNA 3N40F 1Y1UA 5INCB 1KN2H 4JDZA 1L3WA 4TPRH 4WLCA 3FT2B 5IIEA 4EO5A 4K94H 5K59F 5J9PB 2HVJA 3Q2VA 4MNQA 4EN2A 1KLFB 1HILA 3FU7B 3L9RB 4RGND 5ANMB 3U7AA 5ICYA 4Q14A 4B9IA 1U33A 3MJWA 3DGGB 3FO9B 2APXA 5C0FB 2AXHA 4R4NC 1QG3A 1UEYA 1SYVB 3KGUA 1O5DT 5IROC 5C07D 3HRZB 4XE5B 3LRKA 3QDJA 1J9CT 3F00A 1DQJA 2PPAA 1CFMA 2I5YL 2YD6A 3BISA 5J57B 3P54A 4F7CA 3VWKB 4NIYE 3SDXA 1G9NL 1XAUA 1YMHB 4LLWB 4ZMZA 4GW5B 3GSOB 3RGHA 4AMXA 4L1LA 5A6MA 3SBPA 1I31A 2AANA 5LN8A 3U7WH 1HCYA 2Y06H 5TH2A 4G6KL 2A6JA 3ZQWA 4TVSa 4N3TA 3ZR6A 1CT8A 4GUPA 1ODAA 2P5WB 4ZZFA 3O6FA 1J05B 1QLRB 1ZEAL 3C08H 4JQIL 3TO4C 1Z9PA 3U82B 2IBZY 4FLRA 3RTQC 4L1DA 5MHSD 5AVVB 5I1DB 2ADYA 4F9LC 1DDHB 5DC0A 5L4IA 1KCUL 3PHSA 1FSKC 3M07A 3WEBA 2XBDA 2Q2EB 2I7OA 4YZFE 1GTNA 1SHSA 1PY4A 4PM1A 1L6ZA 2AJ3A 1HK6A 1GGBH 5CIPB 4BCYA 1XQ4A 3QQDA 3ZE1E 5D7IF 3U1SL 4AXWA 5FGCB 4C59B 5I1EL 1F90L 2FSEA 3DX8B 1SOKA 3BW9A 1ZVSB 5F9OL 1QFPA 2BCKB 1EJOH 4N0UB 4QXUL 3A6BL 4ZFOB 1PEWA 3VGGA 3EUUA 4U6XA 3QR2A 1XH2A 3VM7A 1C16A 3L5JA 4GQRA 5LUMA 1VPOL 4HWZA 2BVUA 4NO0A 4MDRA 4QY8B 4BGDA 1FC1A 1FLRL 3RL2A 1P4LB 1T1WA 2C9PA 4EOWL 1B2WH 2XN2A 1EZVY 4XBMA 1A6AB 1JOIA 3O9WB 4NFCA 1ND0A 3ARBD 4P2RB 4ZMVA 3KYMA 5DHVA 2K3HA 4ZS7L 3KPRB 4N1EA 3EH1A 3NZUA 4HUXA 4TSCH 1OHQA 3X13B 1QFWI 1XL4A 1PNDA 4N90E 1I3RA 3PXLA 2NUPB 5T1KA 1ZLUH 4XP9L 4WHTA 1UZ8B 3RWCA 4LEXH 4HJIA 4MLSA 2RCSH 2PYEE 1VFMA 2VDPL 1E2ZA 3B5HA 1J5IA 5HVHC 4GSDH 1G6RL 2UZYB 2XU9A 2IF7A 3HR5B 3ENEA 1SJXA 5TE6L 3HHMA 4XWOD 2LU5A 1TFHA 1CG9B 1XR8A 1IM9A 4PJEA 1SLWA 3LH8A 1EHLL 3WJLC 2VDNB 1EEZB 2CO1A 2DM4A 5F1IA 1M05B 2Q5BA 3ULAB 2BIIA 2E9BA 4CL7A 4WNQB 4WVRA 4EZMA 3ULUD 3LHPL 3SKJL 2NY6B 4PJHF 1J1OL 2A9CA 3IJEA 2AEPL 2BK8A 4BK5C 2DKMA 3KEDA 1RMFL 5EUKA 1R24A 2JWYA 5HHVL 2ESVD 1PSKH 3RVXD 4NFBA 3E6HA 3JV5A 3SJVA 4J5VA 4JRFA 4PSRA 5I8KH 5F3HB 3ALWA 3SIKA 5BJTA 4HWBH 5I30H 1UA3A 1TVBB 3MJ9A 1ITCA 5DHDA 4ZTPH 1I3VA 1HC1A 2O6FA 1FZKA 3FNKA 1N8ZA 1N68A 4ZW7A 4KJWC 2G4EA 4CKQA 1H3XA 5FECB 3BPLB 2CDEA 3O3EB 2X6BA 1Y6KR 4G6ML 3UBHA 3VFTA 1BMWA 2O6PA 1BBJB 3FQRB 2EE0A 4JFVA 5EHFA 4B9ZA 3AGVA 2H0EA 1E5ZA 3RWIA 5F7UA 4N2BA 4R7DB 3HBQA 3HNSH 1AZBA 4ZMAT 1W16A 3MGAA 5EIIB 3CFQA 3D4YA 3FQXA 1QA9A 1CIDA 2CGRH 3OL2A 1L5GA 2GAZB 4KRMB 2MSPA 3VH8A 4M6MH 4L0ZA 3TZVA 2VLKD 4OUUB 1WWWX 2BVOA 4PJFB 5GGRA 5M7QA 3S36L 2AKRA 1CU4L 1XF5B 4NM8H 5FA3A 4NKMB 2P42B 5F7DA 1TTAA 4NP4H 2APWA 3EZ8A 1SUJA 5C0BD 5D1XE 3X1EA 4XMWA 4JR9L 1DN0B 4R84A 4TS6A 2QTVA 3BXNB 3PP4H 4G9FD 2R0LH 2OJ1A 2CRYA 2HJFA 3MOQA 4GAFB 3B9VA 2IMNA 4LP8A 4JFWA 1AANA 2PCXA 5DHXB 4HIEB 2I9TB 1BQRA 4ZO6A 4NUPA 3S5ZA 1MFDH 1MJJA 3UEQA 3QEHA 1DR9A 5DC4B 5JPNB 1IBFA 1MWAH 4OLWL 3K6FA 3RAJL 3ZX1A 3B9KC 4XMPH 4QAWA 2BP0B 1FIEA 3LOWA 2QVKA 4IMKC 5D71H 1RZIB 5ERWB 3KJ4C 3RWFB 3D30A 5E0QA 2PXYC 2AQ1A 3DMMB 4LGSB 4F7TA 3NYKA 3EYSL 3I9GH 3LKNA 2XTJE 2WVTA 3PQYE 3BPOB 5GZOA 4NCDA 4XPTH 4BJLA 4ABVA 2PLTA 2OYPA 3WJJC 3X12B 3ZDYE 3WMPA 3AG4B 4PJCE 1HKFA 3ULVH 3IDGB 1T4WA 5FLUA 1VSCA 2J20A 1YYML 2XYBA 3ZL2A 2ZIDA 4QHUA 1XTLA 4PCKA 2AXFB 5KYUB 3L5IA 3U36B 3L13A 5AEAA 3T2PA 4LEOB 5GGVH 3SGKA 3O3BB 3RNKB 5AVSB 2RALA 2X2IA 4NO5A 2ZKWA 1VCAA 5IJCC 4J12A 3TESA 1OAKL 3PWNB 4HSQA 4J27A 1T22B 4GXVL 4G6JL 4P57A 4WV1C 3T65B 3A67H 4OT1H 4Y5YC 3KW7A 4L05A 3QDJD 1JF5A 1RZQA 3ZYIA 3X3GL 1OIOA 1YPZE 3ETSA 3O3AB 1VKXB 4ODWA 4UOW1 3AJ7A 4JO2H 4RISH 1M7UA 3L2LA 3Q2WA 4A7GA 1KTDA 1LD9B 3DOHA 3Q9QA 3BN9C 3S5LB 4OZIB 4KK8D 1PZCA 2IPTH 2YA1A 4BK8A 5E8NA 3LIUA 3AMLA 1OAZL 4XVTL 3VW3L 3D0AA 2FWLB 2IVFC 3OF6D 2VDOH 1OL0A 2HUEA 3MRRA 4YGVB 5EU7C 4DP5X 3ARGD 3MRNB 1TQBC 2CLRB 4KZEL 4YWGH 1LM8V 2V6HA 3D2UB 2F1AA 3SDYL 3QCTH 3QUYC 2J56A 1WCBA 4M5ZL 4QGTA 1EO8H 3UBFA 1QRKA 2BFVH 1M4KA 7FABH 3BP6B 3GMMA 5AAWA 1FH2A 5DD3H 1FNAA 1HHHB 4ILDA 1NCIA 2MFNA 2D0GA 3FU0A 1IAKB 4ZYKB 4LF3A 5C7XL 4APXB 2GYSA 1NDMB 2R69H 1RPQA 3FKUS 4JFZL 5CJBA 5DMIL 4BINA 3W37A 3S6CA 2QT6A 2BJML 2YRLA 3FOLB 3HCVB 4JFDB 3FQWB 5IQLA 4AGOA 4YHPA 4ABUA 3FB7B 3MTXA 4JDTH 2H47C 1F6FB 1FZJB 4ZMQA 4PW9A 3OAZK 4F57L 4NT6A 4EUPH 2E5EA 4NO0D 3HOGA 4NBZB 4P5RA 4ZX4A 3L5WB 3CDCA 1T80A 2IMMA 4XVSL 3QIUB 2ZNWA 2ZX9A 5KVFL 3SOTA 2MCG1 1LWHA 5FCSH 1VAHA 3OPZH 4M6NL 4AYDC 2QHRL 3MBWB 4P3DA 3X1FA 2Y3NA 4WI0B 4U4BA 5JDSA 5T1KD 1MKFA 3QAZB 3D18A 2C7FA 1EEQA 5E8DL 4RMBA 3MNZB 2XWTA 5CJOL 4UDUA 5T1LB 4NQCA 4XCYB 2O5XL 3FU3A 4J3SA 1IX2A 1JXDA 3TBWB 1FVEB 3WE1A 1TUPA 3IDUA 4PJAB 5ESAA 5F7BA 2H1XA 1WFOA 1HXMB 1IM9D 3ROOA 4XCFL 1XH1A 4GSRA 5I2IA 1JYVA 2WQWA 1U8OB 2F7RA 2Y1AA 3N85L 4ZJ9A 3T77A 2J6EH 5E08L 1CGXA 4P49A 1GTFA 1AVAA 1IBHA 1LP9F 4IBUA 1IM3B 5DMYA 1BXUA 3NIFF 1IAOA 2B2XL 1OCCB 5DQ9B 2BSTA 4YHYC 4WK4B 2AXGA 5KVGE 3AB0B 1IRAY 4DKFL 3SJVD 3LCYA 5C6PB 1A4JA 2ED9A 3GZOA 4Y19A 3SGEH 3BFOA 5TDPA 1ZY9A 3HRPA 3NJKA 1E6OH 3SY0B 3AU1A 3L4ZA 4MB1A 1JWMA 2CBQA 4JPVH 1BOGA 2CO2A 2HRHA 5FDWB 4LQ1A 3DRTA 4Y16A 3HZVB 5EC2B 4F27A 3HKFA 1NLDL 1IQWH 2QKIA 1AGEB 1T5KA 2DJMA 3K74B 5E6IC 1QBMH 5EU4B 5BMFH 2V7NB 1C08B 1EJ6A 5J13B 1U8KA 2BPBA 3MRDB 4FZEH 3RVTC 5KSBF 5FO8A 3RE0A 4HFWB 3DHJA 3P2BA 4W9IC 5EBGA 3MV01 5HVFB 3RTQA 5D4HA 4AJYV 1GOGA 4Q0XL 2P1YA 3T2NH 2K7PA 1BFVL 5EO1A 4POZD 1UM6H 3VRJA 1N7MH 2Y2WA 3I02A 4KNUA 4WFGE 1RHHB 3UG5A 5J4MA 4WW1A 1D5ZB 4AGNA 1X5GA 3FN0L 1KLUA 2A0LD 1F58L 3RUGF 1DQQA 5E99H 5H2BA 3UJIL 3L7EB 3TCLA 3RVWD 1M7DA 4IM8A 1NDGB 5JZ7D 4X6DF 3MCLH 5G4MA 2WLYA 2VC2B 1EPFA 2WLNA 1QFWL 3ISWA 3JZYA 4UQDA 4XHJD 2PWHA 2I60H 4IOSA 4EE2A 3JV4A 3WHXA 1EEYA 5B3JE 1HQ4A 4AG4L 3VWJB 3KH3A 2EH8H 3JVGC 1MCOL 3QZLA 4YBQC 4RWHA 4NZ8A 2DQFB 3MUHL 4LE8A 4BUHA 4OKVA 2HT4D 3GK8H 4UM8A 4WUUA 1DZ0A 3VXNB 5JPMC 1CGWA 4OIBA 4BUQA 1MRCH 1TMCB 1ZHNA 3EFDL 3STLB 4X4YA 2YAPA 3BUBA 3DXAB 3I3DA 1TJHH 3MLUL 5MEPB 3V6BR 3TEWA 1QBBA 3FUJA 3K2IA 1AR2A 3MRPB 1T5WB 5ALBH 4GAGH 25C8L 5E9DE 4FQXC 1ZHKA 3PWJA 3DVFA 1OZUA 2C26A 4WGVB 2QFRA 1JN6A 3MV8B 4FN0A 4U0RB 5F7WC 4JMNA 5JW4R 2VDMH 5KVMC 4N24A 2B08A 3AITA 1TEGA 1OV8A 5GZOD 1H6UA 3AUWB 4GRMB 3CFTA 4JEGB 4F8QA 3RIKA 3NESA 1UXMA 1KIUA 4LQFL 1R3KB 1UFUA 1MUJB 1U91A 4YSPA 3QHTC 4Y5XA 2CHNA 5M94B 3CX5J 3D05A 3D0VA 4IBQA 5C2UB 4HPYH 3V0WL 4TUJB 1FFOB 1CICB 4Y2NA 2GK2A 3UBXI 3QEUB 3MUY1 2H8PA 1XF3A 3ME0A 4JGNA 1Q1JH 4H8PA 2P5ED 1AI1L 5FWRA 2WP3T 4FLQA 1CXLA 1KJ2A 3KCPB 1CQKA 4KO9A 1EXGA 2Q3AA 4H2AA 2BP8B 1UD2A 1LLAA 4QI3A 3QJHB 5C0NC 1SDDB 3RWHA 5MENE 3HPJB 1WA0X 2Z8VC 1OT1A 2WXPA 4TF4A 4NM4H 2J73A 5I0DA 3BDBA 2JJTC 1S4IA 4JFHE 3VA2C 4ENZA 3SOBL 3V4PH 1V3JA 3C60B 5D7IB 5KSVA 3BO8B 1AO7B 2MHAA 2WC7A 1Q0XH 2HG5A 3PNRB 5FM5M 2X88A 3OXRA 3QPXL 1ORSB 1FVDA 3K91A 4AVJA 3QWOA 4ZPTB 5J3HC 3TT1L 3ISRA 1AOZA 3LZFH 4HS3B 1B9KA 1I8UA 4PHZA 1QLEB 1HN1A 4R3SB 3VSQA 4YSAA 1XGTA 4LSUL 3SQOL 2G0KA 1EUUA 1G7MB 4K3DL 5ECJE 1UH2A 2IDQA 2RA1A 2FL5A 1KIPA 1XD1A 4QD2E 1C7TA 3KXFB 3FU6A 1W91A 4N8PA 3IXAA 5CUSH 3FONA 2ZUUA 3LH2H 5LXGL 1PVHA 1OSYA 3HBPA 5GRXG 3FQNA 3IMVA 4BE5A 2ZT9C 2O61B 2JIXA 4Q74A 3ZTNH 2C4XA 2EC9T 5DMGC 3UGEA 3TGXA 1IKNC 3O2DA 3BEVA 2GJ6E 4HZLB 3WELA 2HFTA 4MD5B 1F86A 2NXYD 2PYFB 3ARRA 3FUNA 3BKML 3FAWA 3BT0A 2QQLH 4PREB 4FABH 4K2UL 2E6QA 2DQDH 3IVKA 1NEZB 4NPJA 3B9KA 1Z5LA 1LO2H 3ML9A 4L3CA 4U1JB 4L3EE 4NZUL 3EDEA 4IMKA 1XGUB 4YDIH 1LO3H 3WHE0 2L04A 5M95B 1MH5B 1LE9B 4DO5A 5EZPA 4HHWA 4TUKH 2EUWA 4G7YL 2NCMA 2PXYA 3Q0HA 3RPIA 5H8DA 3QJUB 1O9WA 1D5XB 1DBKL 3DVNB 3T4YA 1XXFC 2I9LA 1U8QB 1NGYB 3B83A 1EAPA 4PTUB 5AW7B 2R1YA 4NBXB 5LWYL 3DSFH 4DIXA 3T0EA 3WJJA 2X4QB 2YPVH 5TGBA 1WAAE 1CZ8H 4W9ZA 5FYJD 3KVPA 4OSUL 3FB8A 1NDTA 4NQCD 2TSAA 4X0KA 5HSFA 2GKIA 1BVNP 5HI5C 2YA0A 2AXWA 5DS8A 2ADFL 1WPCA 3FUKA 5AZ2H 4ZUWA 4F7KA 3DIFB 1O9ZA 2ZCHL 3VU2A 5EBWB 1PX3A 4NDMA 1V7ML 1T2JA 4JZNA 3ZKMD 5D2LF 4HXAH 2IH1A 2XG4B 3ZZ1A 1KPRB 4Z7VE 1L9NA 5CLZA 1U4EA 3BZFB 1VEMA 1CFNA 2AFNA 1HYRC 1MCBA 3VG0L 4WV1A 5C0DB 2NY2C 1JTTA 3JV0A 3N04A 3KEHA 5T5NG 3TVMB 2HKFH 1DCLA 4N2OA 1QUNA 1BFSA 1OPGL 4W9GC 3S48A 3ARUA 4JG1H 4LEEA 3QUZC 5LDSA 2NUTB 1INQA 4M00A 5C09B 4ZMPA 1KZQA 3GS7A 4Y16D 1QHQA 4NUJA 3MNVB 2Q3ZA 5TTRA 4BD4A 3B56A 4NNYA 3KDPB 4ZAKD 2BNRB 3MODL 3K6OA 3W11C 4YPGA 4WW2B 2QV2A 3R06B 3WMSA 2JV6A 1XL6A 3OSKA 2QADD 4OJFL 5HYJA 4LASH 2YKKA 1Z3GL 1AFVH 4PRIA 4XNYH 1IEAA 5GS3A 3RTQD 4AJWA 2WNGA 2YQ3A 1B3IA 3POCA 2J4WL 4MMXA 4BYHA 1OVZA 5GJSL 4IKLA 2VE6B 4UBDD 1EFXB 5DD0L 2CKBL 3FFCA 1SY6H 2VDLB 3OZLA 5KUMA 3QFJB 4PR5B 5CGYC 2NQDA 2ZXAA 4DEPB 3FSWA 2IQ9L 1AXSB 2DYSB 4E9RA 2OTWA 4IOSD 4I2XA 5HYSB 4ODSH 2L7UA 4QAMB 4PPTA 1JE6A 4OV5B 4BFIA 3ARFA 3D6GA 3ECBB 1AQDA 4FLHA 4ICWA 4YDJB 1NTDA 2C1PA 1F13A 4KHTH