4B96A

Family 3b carbohydrate-binding module from the biomass sensoring system of clostridium clariflavum
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
151
structure length
151
Chain Sequence
SHMILKLKHYNEQQSLYSKAIRWDFVIENTGNSYIDLRNVKVRYYFKDDYKNINFAVYFYSLGDEKNDVKGKVYNIRQSDSSHKYLEVTFEKGSIPPGDAAWVFGAITRDDWTEFNQEDDWSFLQGNSTFSYWDKMTVYISDKLVWGIEPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Cbm3B from the Biomass Sensoring System of Clostridium Clarifalvum
rcsb
source organism Clostridium clariflavum
molecule tags Sugar binding protein
molecule keywords CELLULOSE BINDING DOMAIN-CONTAINING PROTEIN
total genus 39
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2012-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 4b96A00
3ZUCA 4B97A 1KFGA 1JS4A 2XFGB 2XBTA 2WOBA 3ZQWA 3ZU8A 4B9CA 1GA2A 3ZQXA 3TF4A 1TF4A 1NBCA 1K72A 2YLKA 2WNXA 1G87A 4B9PA 4C8XA 4JO5A 2L8AA 4TF4A 4B96A 1G43A 4B9FA 2WO4A
chains in the Genus database with same CATH superfamily
2H26A 1JNLH 1E40A 1T3FB 4LVEA 1AYOA 1OP3H 2CKBL 1J8HE 4EF3A 1MY5A 3K7UA 2CHDA 2WZ0A 3ULUL 4PMEA 1S2EA 3GSNB 2X9YA 1CFVH 1CC3A 2CR0A 3FJTA 2W0LA 5I23A 2AJZB 4ZQKB 4HSCX 5TD4A 3T08A 3MRMA 2P52A 3PL6D 4RFEA 4FQHB 4HIPA 3ZO9A 3GFUA 2OM5A 8PAZA 1EZVX 5E8EA 2EH7L 3A6OA 5E56A 5A7EA 2XXMB 2W9EH 5H4ZA 1BD2E 1RIUL 3WEXB 3AW5A 1KYOK 3HOGA 4J3OF 3BP6B 1SYVA 1UYWL 4Q14A 4QRUB 1QA9A 4UB0L 5A7BA 3N1MC 2J1KA 3QO0A 5C0IB 4WHCA 3EBHA 4UT9A 2FQGA 3FUMA 5AVUB 2R0WL 3FSWA 4BKTC 1MWOA 3ARDC 1V55B 3QORA 3W5MA 4I18B 2AEPL 5TF0A 4NDMB 2KYIA 3EADA 5J56B 5KEZA 1RUPL 3QUXC 4U7SA 1A2YA 4HULB 4X5XA 3UC0H 2CGRH 3CBRA 5GGQH 4MKTA 2XC8A 4E41D 1CTNA 3VW3H 1FL3A 1UWXK 2E6QA 1PCSA 1JMZA 1VFAB 3G5YA 4PR5B 4H7VA 2ZE0A 2YBRB 1NCTA 2VB5A 1EZLA 3G04A 3U82B 4ABWA 3EOYG 4FI6A 1IARB 3OLGA 3T0BA 2IC2A 3ARED 3UJIL 4YSQA 2J1XA 4BA0A 2BNRD 3VJ6A 3AY4C 1AQHA 3CTTA 3IJEB 1K4DA 3ZDYF 1GKOA 2X40A 2VC2H 3GBLA 3SPJA 1UWEH 3EGDA 4PJDE 3QC5X 2HT4C 3EYFA 2G60H 1WAAE 5MENB 1AHMA 4RSVA 3GIZH 3QZLA 1DSFH 3DPBB 3T2QA 2LV4A 1NCJA 2BCKA 3ARGA 4G83A 4U1MB 5AOLA 1F41A 4IRJD 5EORH 4RFNB 3CHPA 4AEIL 5CJXA 2ROXA 3GPSA 5IJKA 5C0EA 4L9DA 3DX7A 1F8TH 3SGEI 3FBQA 3LKNB 5FECB 4PBVC 4XPTH 3SKNB 1MFBL 3QORC 3ZUNC 4L29A 5EF0A 2F7QA 1NIEA 4OM0L 3Q9PA 3O4OB 3Q8EA 4LBEA 4TL5A 3DVIA 4RISH 2GUOA 2UY6A 3IDJB 2E4FA 3P3SA 5BS0A 3VXME 4A68A 2QKIA 4N0FA 1S8DA 4IGBA 3L7FA 2GI0A 1ORSA 1ZK5A 2ZSWA 1QWHA 1U8OB 3AU0A 4XNBA 3T8MA 4ZPVA 2HN7B 1OPGH 4D2NA 3PUUA 2GFBA 4A7TA 4MD0B 3BZDA 2QGCA 5EUOB 2CR6A 4OLUH 2DQIH 1BZ7B 3DBSA 3MRBA 4F57L 2VRAA 1YEGH 4JQIH 1N64H 1G94A 3EYQD 1Y6MR 3NJNA 2YD7A 4N1CA 1M6OB 3SJVB 2C7UB 4BZYA 1T21B 3T65A 3BXNB 3Q48A 3IDIB 3F84A 5B4MD 2P5EA 5DQ9B 3BAWA 2FVNA 5FO7B 1AD9B 1QSEB 3KVPA 1D5XA 2WZ6A 3AM8C 1OAQH 3QIBD 1MCHA 2FT7A 3J8F7 1J8HA 4Z7WB 3VJ6B 1SEBA 4TUJB 4NKMA 2FNWA 4NAQA 1BZ8A 3QC6X 2HJLA 5IMKB 4ZFZA 3VFTA 2XQYK 1Z5LA 1P5UA 4JR9L 3UJTH 3OWRA 2EVIA 5FR3A 3VFGH 4ETQB 2DQ6A 2QPDB 3F3HA 4PU2A 4XGZA 4Z76B 3N6YA 3FSZA 4M4RB 2A83A 2VT0A 4BIKA 1K5WA 2BX5A 3N42B 2D3JA 3BSHA 5ID1B 2F74B 3MGOA 1J05A 3IU4H 3ARSA 1A7NH 2APFA 5DZAA 1DLHB 2XN9A 5EUKA 2GITA 3PWLB 5K9JH 3OM3B 2CD0A 4OLXH 5IROA 5I71C 1ZS8B 1Q4NX 1K5NA 2QQKL 3D2TA 4G8GE 4YSCA 3BWUF 3QDMA 4ONHA 4R4ND 5EWIL 5FM4A 2OMNA 3P0VL 1CICC 1ZE3H 4NKOB 2DDQL 2E27L 1WBZA 2NTFA 2OZ4H 3FKUS 1U8QB 4L8CA 1JGLL 5C0CB 4XBPA 1K6QH 4JY5L 1TZHB 4D0DB 1LO2H 3I3DA 4OI7A 4CJ0A 1RK1A 3LQZB 2NXZC 4K94C 5FFOA 2Z0BA 5IHZA 4G42A 2DS4A 4OIIH 2VL5B 4Q9CA 1A4JA 2MPAL 3D4GA 1GR7A 4G43A 2BZDA 5E8OA 2G3NA 3LEXB 4OFYA 3GMOA 4U1MA 2CO3A 3L9YA 2NY6B 5FUZL 1SY6L 3SKMB 1BVLB 3ILPB 1BECA 3JV6B 5DVLA 5LXVA 2RAMA 3IPBA 3BYTA 4M43H 1QR4A 1P6AB 2P24A 2IANA 4XNZB 3VI3A 5BZZA 2P8MB 4OLYH 4QOKA 1MXDA 4U3HA 1JGIA 5I19H 1G9HA 1NTDA 3FFDA 4B96A 4G9DB 2VZTA 4P99A 4LT7A 1QSVA 4UBDC 5C08B 4Q2ZA 1CXIA 3ZYJA 2HRPH 5DF0A 4NFCA 3P02A 4KI5F 5I28A 3FULA 1R19A 5KVGH 3IDNA 3EGSB 4U1SA 5EUOE 3D39B 2A5UA 5JHLH 1IILE 1MRCH 2VZ3A 2YQ2A 3HB3B 1S7SB 5CLWA 4FTVA 1ZT7A 3KVDD 4PBWD 1KN2H 5IJDC 4PI2A 2R2EB 4UANA 3US1A 3U9WA 1E3FA 3H8NA 4YN3A 4P2YA 2D7TH 5C6TH 2WO4A 4MJID 1H3WM 3WFDH 4QI3A 3C5ZC 5KANG 1UQSA 4HX1B 2ZPKH 1UA7A 1LJMA 4FLRA 2QLYA 1UHVA 3PWPE 4P06A 5K69A 1BEXA 4GW5A 3SDAA 3RTQC 2WCGA 2VXQH 5AD0B 2UXGA 4R3SB 2IFFH 4RLDA 2XWJB 3V0GA 3ZGIA 2JTDA 3CDYA 2P47B 4AL8H 2MPAH 4X6BB 3FO0L 2FEDC 1NGQH 4P3CL 5AW4B 2F53D 4IYKA 5JIMA 4HUUA 4MQSB 5T3ZH 2C3VA 3CX5J 2Z1KA 4IW4C 3WMSA 5KSUB 3SCMB 2CZNA 2EXYD 5FO9A 3KAAA 2YAEA 1UCTA 1NCCL 2UZIH 2KI6A 4NN6C 4ZPVB 4DO6A 4QGYA 5ADOL 5CCKH 1YMHA 4U1NB 3FC8A 3S98A 4M6ML 2LE9A 2HP4A 2BY2A 5AZEL 1HHGA 4G8GB 3CG8A 4DN3H 4QCIA 3KPOA 3V0IA 2OTUA 1LMIA 3GC3A 3CC5A 4NQDE 5E1AA 2YC1A 5I1JH 2K9UA 1JYVA 4EI5A 1JRHL 2EEFA 1BM3H 2NY6D 3TO4A 2H2PD 2DQHL 2VM3A 3ULVD 4EZLA 3CQFA 4NC1C 5B7EA 3QDAA 3VB9A 4AQAA 4OGQC 2AS5M 4L1BA 4KDTC 1U8CB 4N1EA 5D1ZA 2G3MA 3DWTA 1KXVA 5JHDE 4AYEC 3BDYH 4LSVL 1S9WA 1Q72H 4GMSL 1FZKA 5M95B 4W4NA 4OV5A 3O2DA 4PRBA 2VLJA 3N06B 4OCYH 2CNZA 4GRMA 4EE2A 3Q6FB 2XU9A 3RNKB 2I07B 1X5GA 1AR1B 3KPLB 1WBXB 4JFWA 4M03A 4PRIB 4YFLI 4N2LA 3GM0A 5KOMC 5D71H 2ZUTA 1E6JH 4B9PA 3RTQB 3HB3D 5GGVL 4JFYB 4I87A 5DUMH 2BVPA 5G55A 3UC2A 3U30B 1XGYL 2J6EH 4GLRH 3CPUA 5I8KH 5DZVA 1CF1A 2XKUA 5ITBL 4BSJA 2VDLB 4LFHG 3IT8D 4GRLC 1CLZH 1MJ7L 3WOVA 1SXZA 4PY8J 3L7EB 3NCWA 2V5SA 4OGXL 5EN3A 4IRJB 3L9EA 4LARL 1IL1B 4Z77A 2A77L 4LGRB 3APDA 1T0NA 3HS0B 1OD7A 3BGMB 4Q4IA 1E5BA 3Q2LA 1CI3M 43CAA 5EU6A 3LV3B 2CJSA 4LGSB 1KV7A 3PAZA 3I75B 4NKDA 4Q56A 4OF6A 1N6QL 2C9UA 4GMTH 2XN9D 5CMAA 2NNAA 3FQWB 2EAEA 1RVFL 2X1PA 1XWVA 3BO8B 5BO1H 3MLPA 3TONA 4XO8A 3II3A 1G7MB 4BHUA 1YJDC 4QRUA 2QHRL 2IMMA 3UGEA 2HT3D 1AC6A 1XR9B 3OAUL 4BSVB 1YUHB 2EEBA 5KSBF 4O5LL 1CCZA 3UO8B 4F93B 4PJ9C 3SYAA 2J12B 3U6RA 2KT6A 3HW7A 2ZKMX 4PJAB 3LEVL 4OLVL 4WGWB 5GHWH 2EDQA 4GP5B 4KXBA 3O81A 4HC1A 1ILSA 4W9DC 1FNFA 3FQ1A 3OKOB 3ARRA 3MUGB 3AG1B 4XP9L 4ZOAA 5I1EL 1KCUL 1JV2B 2VXSL 1NC2D 2CHWA 4KJWC 1T03H 2D3LA 1PFCA 4HP5A 4HZLA 4UV4L 2WXMA 3QRLA 1E4XI 1NAMH 4NQDA 3WELA 4XNMA 1NLDH 1U9KA 5FYJL 3RB7A 1CO1A 2VZOA 4NUMA 2GC4C 5FA3A 2B0SH 4A66A 1DJSA 2GITB 3FUJA 4XB8A 5I6OA 2ADIA 5DQJA 5J6GA 4HBCH 3VUAA 1GPOH 4V2BA 2EO7A 4I2XE 5AAWA 3ARFC 3HG1A 3FU5A 2PYFA 5H2BA 3IDIA 3W38A 1IC4L 3ZDXE 5IMLB 1WWCA 2XPZA 4PRHB 3V6FB 4I9WE 3G5WA 3OMAB 4FRWA 1PX3A 3MLVL 3MLTB 2DQIL 3NZ8B 1NGYA 3FQRB 4G6JH 5DURD 2FIKB 2Y06H 4QO1A 1CFBA 4C47A 2J43A 1BD2B 5G4MA 2BP5M 2HRHA 3A23A 2CNYA 4WCYH 2ARJB 1IIIA 3WS6C 2X6MA 1S8DB 4LRNL 3W11C 1N5AA 1RD6A 3UO1L 3MRRB 1CICB 1A4AA 5GZND 3BDBA 4LOFA 4RZCB 5I5JA 3F85A 1I31A 2WN2A 5IM7B 2H1PH 4R5TA 1CGSH 4QXUH 1KIRA 3JV6A 2NZ9D 1BZ7A 1CDGA 5D1QE 2VAAA 2VW7A 3H42H 4LVHB 5B39A 2I60L 3L5WB 2OXGB 5G4OA 3ZT7A 4F7TA 2GUYA 4PWHA 4HXAH 2ZWZA 4JW3A 2WAHA 2MEJB 4GQ9H 4Y88A 1MHCA 3HAEB 3VMPA 3VFOB 1GCFA 2MTPA 3T0XA 3JV4B 3QPKA 2BP0A 5ENWA 3GIZL 3VXMD 3B5TA 1F0LA 5BV7B 4KHTH 3OC8A 3PAUA 2E5EA 1Z0NA 2JI3A 3FTSA 5EBWB 3UG5A 4HZLB 1EO7A 4OLZL 3WIIH 1JNHA 3GGWA 3IK2A 1OZTG 1WC7B 5EC2B 5IQLA 4A1RA 5IW6A 2I9LB 4QHMA 5EEVA 2VC2B 2JJSC 3LY6A 4ODSL 3O45A 2PTTB 3TNMB 5JPMB 3T8XB 4ZXBA 3ARFB 5KS9F 2NY0C 4ZFOA 2R2HA 2FO8A 4HGWB 5F89A 4JRFA 4OI8A 1XX9C 1PY0A 5BRZE 3THMH 2VXVL 2QSCH 1A7PH 1AQ8A 4HQQL 3MLRH 3QXDB 5I8EA 2B7DT 2GY7B 3OHXB 3RVUC 3GPEA 4PW3A 1EVTC 2WZAA 3K72A 1OAXH 4ADGA 4AYFB 4AWJC 2Y6SD 1R9FA 4M7JH 1Q9OB 5TDNA 5FO8A 1F3JA 4YFDB 3U4KA 1Q9WB 4FYTA 4JM2A 5FYKE 5CEYA 4FULA 4X6EA 4PTUA 3VVVA 4JFEA 5DEGA 5BS0E 1JWUB 2WTRA 3DVFA 2J72A 2JI1A 2Y7QB 3QRGL 4UQDA 2OR9L 1MVUA 2V2XB 4K07A 5EU3A 3ARDD 2FEEL 3P77B 3Q8FA 3IFPB 1QZ1A 2WXQA 4X6FB 5EC1B 3RX7A 1W16A 4HPHA 2NNXA 4AZ8A 4JUTA 1JSYA 5F9WB 2YC1B 4GLRI 4NZTL 5HI5C 1IAII 3RJOA 4KRPB 1XGRA 1EX0A 4WW1B 2GCYA 3QA3B 1HAWA 3GSQA 1U8OA 3QI9B 4Y9BA 5DRNB 4LLUA 3UYOD 4HLZG 4A67A 3ZXAC 3MX0A 4LDLB 4YDIL 4PJAF 4TQEH 1LNUA 3HG0A 2WXIA 1B0RA 1WFUA 3TU6A 3DO7A 5I1DA 3FTUA 3CIAA 4HT1H 4NQQA 1NGZB 2PYEB 1TKWA 5C0BE 1K2DA 5GIRA 4PRBB 1AOHA 1ET8A 4M62L 5ANMB 4W9FC 2FH8A 1GKEA 1RQ5A 1PX8A 4TTDD 2CPUA 3DKHA 1HXYA 1T6WA 4BUGA 5FS5A 4HOXA 1HL8A 4XO9A 3MBXL 1G7IA 3BKYH 3Q8CA 4LLQA 3QDGA 1A66A 1SOQA 3RGVB 1QR1B 3F6IA 3CX5K 1WIPA 3L3DB 2EABA 2ZF8A 5FCUH 5CHNB 1NH6A 4G1EA 3V0HA 2AQ2A 4H8PA 4L3AA 2H4EA 3FT3A 3ILQC 3HHMA 4XMKL 5AW3B 1TU2B 4UZSA 2F8OA 4KKBC 2VKWA 3VNYA 4OZHE 5GRVL 4NZFA 1EVUA 5TDNB 4DHLA 3ROOA 4Z76A 4JJ5B 2J4WL 1ZHNB 2VDPL 4MS8C 4GG6F 1AGDB 2V9QA 2H0JA 3SGDH 4XNDA 1MWAL 1CS6A 4W4OA 5IFAL 3L08A 3HRZA 2YGOA 1U95A 4CGTA 5EULV 1BIIA 4ENED 1Z9SB 1DN2A 1ETA1 4HYTB 4ZFOB 2G0LA 3RILA 1H6TA 2J2ZB 4GRLB 1MIML 4LLYA 5I5MA 2BIPA 2W60B 4IKKA 5TGBB 3RZWA 3KJ4C 1TENA 3DIVA 1EJFA 3OJVC 1OGPA 5HHMB 1J0HA 2RA1A 2WBXA 1L7IL 1WCQA 1P9MA 4DEPB 4XC1L 4YVNA 5DHYB 3T2LA 2X0VA 4HWEH 5EEWA 3J27A 4FMVA 4OZFG 3ARPA 4EOWH 5K9QG 3HZ3A 3BN9D 1F3JB 5C0IA 1GZHC 2G3ZA 1N12A 4TPRH 5CSZA 1AS6A 4NQED 5BS0B 5DVKA 3MRKA 5C08D 2VTFA 4Z7OE 3N2JA 2VN3A 3QEGH 1PQZA 1MOEA 4I0PC 4I4WB 4LPVA 1ID5I 2QVFB 4G6AD 4X4KA 1ACYH 2GTZB 2YEZA 5DD3H 2YARA 4Y8AA 3S96B 1KF9B 2B5IC 5KVGE 4P46D 4ZYKB 3K4ZA 3P77A 3FRPA 3ZVVA 3HHRB 3B2VH 1KT2B 3CFQA 2EEDA 3HC4H 5D7LE 3NZSA 4UYPA 1DBKH 4AX3A 4Y7OC 1MJUL 3SPVA 3L3IA 4ODXA 1F4XL 1GJWA 2GJRA 2W1NA 3MV8D 3A67L 2W95A 3CVCA 4LLWA 1GGBH 1AZZC 4W9JC 3GSUA 1RZKL 3MRGA 2BFVH 1MCKA 2VDOB 3OKNA 3BP4A 4DKEH 1PZ5B 1RJYA 2ICEA 4KK8D 5EO1A 4LLAA 4G5AA 1NMBH 3E1F1 4HV8A 5GSVB 4Z3JA 3C8KB 1LE5A 3QJSB 4BCYA 5ERWB 2RCSL 1MQKH 1HEZB 1UWYA 1DQLH 3S5LB 3KYKL 4HUCA 4WWPA 2IGFL 1FH5H 1KZQA 1XGYH 2J6EL 5CR1A 4UUJB 2ZOOA 3DBXB 4PVNA 1KXTA 4M9OA 5DJYA 3H9HA 3RFZA 1H8SA 2HX9A 4YHNA 5DURB 4FA8A 4YHZL 3HR5A 4QXWA 5E51A 2XXGA 3LKNA 5TE7H 4MB5A 4MAUL 4ERSL 5D4QA 1WBYA 4PJFA 3TVMC 4L1HA 4BKLB 3UTQB 4N4YB 5SWSD 2EDDA 2UVFA 4D9QD 4NO0A 1Q0XH 5AVZB 1GOHA 1JFHA 4OIBA 3VFOA 4NQSA 3VYPA 4PLKC 4TLUA 2AXHA 2HN7A 3NJMA 3MJ9L 4FYQA 1BVLA 4P07A 5DZPA 1QSED 4UTBL 3K0WA 3TJHC 3CFNA 4WI5A 4YXKL 5ICUA 2VL5A 4P59L 1OAKH 2XN0A 2EUVA 4MYPA 3BP5B 1N6UA 3QDGD 4N90D 5FUCE 1A14L 3SDXB 1JCKA 4ZUVB 4WUKH 5DVPA 4X9GA 5SX5K 3VD2A 3GXUB 2BW5A 1FVDB 3E6FB 3HMWL 2F58L 1KIUA 1BYNA 3HG1D 5T3XH 3QCUL 2F8XC 4LVHC 1JDDA 1A3QA 3QDJA 4UTAL 5KUKA 3GB7B 4LSPH 4K3EL 1UGKA 3LRLA 5DMJB 1KENH 1W0YT 2GTWA 5CLZA 1RP8A 1DJZA 2JB5L 3AM8A 3LRSA 3NSDA 3QXVA 1JWMB 3H85A 2Y4SA 3O8XD 4XVJL 4YDVA 1KB5H 4N2BA 4HCRH 1IC1A 1CL7H 2X0WA 2FATH 1P5VB 4RGOL 3BZEA 4EUPB 5DLMH 3WS3B 3GHEL 5H2BB 4N85A 1NFDF 3ARQA 4R7VA 1EO5A 4ZW6A 3MRIB 1BCIA 3EJZC 5HYSG 5BS0D 5I8CB 4JGMA 3BPLC 2EUWA 3N42F 2WIIA 3KBFA 1RZIB 1ZLSL 5F70A 2Q7NA 2JKLA 5K39A 2ZYRA 2FX7H 4LF3A 3LPOA 5DUJA 1DJWA 3D0AA 4UDTA 5DHDA 1BBDL 2WXPA 5HYIA 3HPLA 4UT6H 5I1LA 3DTXB 4XXCA 4EPSA 1RUML 5IMMB 2GC7C 5JR1L 3L4YA 2V2TA 2VISA 2QQNL 3C6SB 3QNYA 1X3DA 3SKJL 5HPOA 3NCJL 4NDMA 3VG0H 5LQBL 4I18C 4MCYA 4AGLA 3K46A 5HHME 3MCLH 4H20H 4XCCL 4DGYL 3CJJA 3DSFL 1I3GH 4P2QB 3SKUD 3UTTD 3E8UL 1PG7L 2OTUB 3TXAA 3TYGH 4H88H 4L9LC 5I19L 1LP9A 1B4RA 3MR9A 3AG4B 2W0FA 4BWTA 1BJMA 3M45A 4J12A 5KYWB 4RGNE 4TLSA 3T77B 2WQSA 5TQ2H 1DQTA 5FUZH 2NLJB 2IMNA 2V5TA 4LB8A 3QQ3A 1U8NB 4H26A 3T4YB 2C1OB 3V4VB 2FHBA 2GHWB 4N0YH 1AMXA 3ZKMC 1WE5A 5AOKA 3S35H 2P80D 1FVEA 1CXEA 1E28A 1C08B 1U8CA 5I1KH 2WKOA 4N8VA 1QBBA 1G1CA 4PJCE 3V4PH 4ZUWB 4RWHA 3RGVC 4UNTA 5SX4I 5F9OL 1ROCA 1TMCB 3BX7C 1XGPA 5EIIG 3QRBA 5FGRA 1A9EB 4ZFGL 1A1NB 4JANA 3NG5A 3QEQA 4LO9A 1FCCA 1HCVA 2C9PA 2EVGA 2P8LB 2VN6A 3HE6C 4LNVA 5I1AB 4OZHF 3GM8A 4A7GA 1GGIL 3VWKC 3DXAB 3KVQA 5H35A 1OT2A 1RK0A 3JT2A 3LZLA 4MMZC 4M6OH 4IBZA 4AM0B 3QNXB 1DBMH 4YPGB 2XV6B 4FHBD 4ONOA 2D7TL 1CZ8L 1OGAD 4WEBH 4UT7H 4XVJH 3CU7A 1WS8A 5CGMA 5AOJA 1Y07A 1E4HA 3HUJE 1N67A 1J1XH 2AFNA 5E00A 5JHLL 1U8JA 2R2BA 4M5ZH 4J6RH 3O6LH 3L4XA 1P5VA 2ZCLH 2EICA 2Z91A 2OFQA 4N22A 3IFLH 2KZBA 5F7WC 1S9XB 4EVNB 4K3JL 3EOTH 3NJFA 3WJMB 2L04A 1LTXA 5IWLA 4HCIA 4JB9H 2BXZA 5T33H 4F92B 4HS8H 4YSOA 3KPOB 4WFFD 5FOJA 4HGKC 2AXJA 4A6YA 3JUYA 5HTSA 1PW3A 2CJUL 1KTLA 4M7ZC 3UJJL 3GUFA 4JZJC 2WGNB 3IPFA 3NJXA 5KBKA 3DROA 4W68A 1IQDB 1O6VA 3MJ9H 2DOCA 5ICXA 2CRMA 4K73A 1GSMA 2XCMC 1U4EA 4M48L 3PREA 3D85A 4PJ5B 2VLRA 4MJIA 2K70A 4R9HA 4M61A 3RJDA 5C3IA 1E50A 5DS8A 5AB0A 2XJKA 4KO7A 4PHXA 2EP6A 2GIYA 3V9CA 4FTVD 1H9DA 1BZEA 3KJ6L 1DQDH 4PLNC 3D4CA 4RH4A 4MKMA 1FZMA 4OLWL 1UD5A 1ZT4A 2JH2A 3NABH 1RZFH 1IFGA 2KUTA 3SO3B 3QZMA 3VWKB 5E2WH 1JGLH 3WFBL 2CU9A 3LKPB 4FEMA 3BKYL 1FH5L 3VGAC 4ZO9A 5J11B 1UM5L 2HG5B 3P9WB 2DQUH 3LJ3A 1YC8A 3K4DA 3QQ3B 4EIBA 1KBBA 2E9IA 4YBHA 4UOW1 3C08H 1AKJA 3MYJA 1JHKL 4PJHE 3FF7A 3V0VA 3FAXA 1U3YA 4JFFA 3OF6D 1CGVA 2Y07H 1FLTX 1YEEH 4FE9A 2ORBH 5D8JL 1AG6A 2J5LC 2H8PB 4KK6D 4Z7UA 3WKMH 5BUGA 1T1XB 2YSSA 4GQZA 2AZAA 1FO0L 5CD5C 4NS0A 3X1FA 1UEYA 3RUGA 3KHQA 4OI9A 4TSCH 3A22A 1NZRA 4YDJA 3UH8A 1TZGH 2Z4TA 4NP4L 3QI9C 4NZRH 2UVEA 5K5YA 4YVUA 5TE6H 4JFFE 5EC1A 1NCGA 5D2NB 3TA3B 1CE1H 3QO1B 4M56A 3PHSA 3RDTA 2YD9A 4E9WA 3FONB 5DJ2A 1GW6A 2JI2A 2Z93A 2YWZA 1WCBB 5CN3A 1HFUA 3MSPA 1QHQA 1Q8MA 2R23B 3U1QA 1TIUA 1N8ZB 1KELL 1S9VB 1G9MC 1FORL 3N1GC 1U8MB 4QRSB 4X80L 3W9DA 3LZPA 4M8QA 1KT2A 1DE4B 1PY4A 4R0LA 5CO1A 5D1ZD 1YEGL 4FF9A 4F7TB 4J27A 4MLIA 4XHJD 5DS8B 3T3MF 3X3GL 2GBAA 4OLUL 2BY1A 1LWRA 3CVHB 4PLJD 1JUFB 4OQ1A 1S7WB 3VDCA 4A55A 2VN7A 4PJ8A 4EOWL 1TQTA 4ZAKD 1QZNA 4LLWB 2WWMD 3BZFA 2FCBA 3HBPA 4WV1A 1JFQH 3IGAB 2PXYB 4KH9A 3WCYA 3BKCH 1CFQA 1RERA 2IWKA 5D93B 3P3TA 4ERSH 5IB4B 1OAYH 4XP4L 1EEYA 1EGJA 4XI5D 2VRKA 2VXVH 1U8KB 1R47A 1YEJL 4WJG3 4ZXBB 3I9GH 5JPNB 1T20B 3FQYA 4WSGA 3CH1A 4L3FA 4XNUL 2F19L 1BMWA 4NPYB 1CFVL 4F27A 1IEAB 3ULUD 1RY7B 3UTSA 3NZHL 3BSZA 4XNQB 5ITFB 1DQLL 3V6FA 3VD7A 1AHKA 1AKPA 1YN7B 5E6SB 3OKEB 4GW4B 4IBVA 4JDZB 2DQFB 4E9TA 5J6HA 4K8RH 3VGHA 5TPWL 2DMCA 4W9GC 4X6CE 1Z5LB 4JFEB 5DEGB 3PRZA 4WWKB 1KBGH 3WSQL 2F1BA 3H9SA 4A6YH 3TH2T 4NNXB 2AJUL 3MV9B 3TH3T 4NXSA 2D4FA 4HGMA 5KBMA 1ZDQA 2HT2C 2OXHA 5HHQA 3RG1C 3TEYA 1CGYA 3WS3A 2NY1C 1NICA 2MRYA 4Q9RL 2YD5A 2Z93B 1M7IA 1D6VH 2GJPA 3T0EB 4YSEA 1GA2A 3SJVA 3ZHLA 5CINL 2JE8A 5EBGA 3CFKA 1T89C 1CWVA 2Y3AA 1ACCA 2H1PL 4JQVA 2A6IB 4UU9B 5KYUA 4FFTA 4RGMB 1QSEE 3TNNB 3CFBB 5GGQL 3SOBL 1G6VK 2A9ML 5I0ZA 5FHBH 2NUTA 4OD1H 1YECH 1DN0B 5C0NC 3DVNB 35C8H 1NCOA 3A6BL 3MV11 4ZDHB 5A2JH 4E41B 1MHEB 2BFGA 4H26B 3V4VA 2DQJL 2I07A 1LQSR 4IOFD 3D39A 6PAZA 2FWUA 5F1SA 9CGTA 5KVMC 5MENE 1UTDA 3CZFB 1XGUB 3L2NA 1Z1WA 4UCFA 4K8RD 5E8OB 5ALCH 2F7OA 5FM8A 2AAVA 2K8MA 3FQ4A 3MJ9A 5CZVH 4IOFC 2JELL 4Z7IA 4MXQC 5AL0A 5AAMC 4LVNB 2E86A 1A2YB 1AR1C 1I53A 3CZGA 4N86A 4ZO7A 3RGBA 3WU1A 1IVTA 5C0BA 2WJ5A 1VESA 2NY5C 2EE0A 4KTDL 5LO7A 4CN4A 3GEWB 4JQIA 5KANI 2XVKA 4OFYD 3G6AB 3GI8H 3II1A 5JMRA 4KVCH 1EFXA 3PL6B 4HH9B 4BQ6A 4PGCB 5JPMC 5BRPA 5BQDA 2OMVA 3MAWA 1SQMA 4OZGA 4LEBA 1K4CB 4DK3A 5C8JA 4DP1X 5PAZA 1JGEB 1A22B 2YAHA 1T1XA 2A9NL 4MNGE 4Y1TA 1MI5D 3ZZ1A 1MNUL 1OF0A 1JPFA 1MCRA 1UD2A 2G9KA 3QPQC 3G6JB 5F0PB 1G1KA 3OPZH 3ZDXB 4F15B 3LEVH 4OLVH 4QY8A 4HXAL 3KGTA 1JGDA 4G7RB 4X7SH 2LTQC 4OY9A 5JZ7C 1H9VA 2CUAA 2Q86B 3WYRA 4UQBA 2VR7A 4PJBA 1RH8A 5IQ9A 2WUCL 1AGEA 4GI8A 4ONHB 4YBLB 5F2FA 2DWTA 4OJDH 1UD4A 1SXBA 4NO2A 3NRQA 2HUEA 3U0PB 3C2SA 1MNNA 1CBVH 4ZXBD 1OAZL 1AE6L 3U6XA 2NZ1A 4GSQA 4KTEH 3WSQH 3FPYA 4OZGE 3CZJA 1EGJH 2X9WA 2FH6A 3BE1L 3QIBA 1YEWA 1TQSA 4F2MB 2XN9E 3OQ3B 4YDLB 3DA0A 3REWA 3LZFH 2WXOA 2UY6B 3IDJA 4IBWA 3KYMA 4EIZC 3K74B 3HCVA 4HFWB 2X4OB 4ZUSB 2NXZB 2WNKA 3BFQG 3L4ZA 1UURA 3NAAH 3KLAA 3Q5TA 4XMLL 4ZW3A 4ZAKC 5F7HA 4FFVD 1XH3B 1G87A 2F54B 3TBBA 2NX5B 4K3DH 4YAQA 2NTSP 4YE0A 3H7LA 2JFCA 3QEQB 4JFVA 1TU2A 2R1YA 3L13A 5FYJH 5LCVA 4K9JA 2LVCA 5GJSL 5MENA 4AM0Q 1WP6A 3F64A 3O3EA 4ODTH 1LEKA 3VWJA 5I16A 2EDOA 1MIEH 4OZGF 1ETZA 2WLLB 4HH8A 1KCVH 1F6AA 2Q1EA 2F2HA 4YHLL 5ANME 1RZGB 2CRZA 4RMSA 2B14A 2WN3A 2AQNA 4FQCL 5DR5H 3FU7B 3JWOH 3HR5B 4J4PD 4TSAH 1J1OL 3SBQA 1OK8A 3WEBA 1NC4A 3VDBA 4F7PB 3KEDA 4QCIB 2FBOJ 3HG4A 1HIMH 2PP9A 2YGPA 4PRPD 7PCYA 1TQUA 4PN6A 5KYYB 3X1BA 3TTYA 1ETJA 2GYSA 5IHLB 1A8JH 3RHWF 3WKNA 3QUMB 4OZHA 4PJIA 4A7GF 4YEFA 1UXMA 3BPOB 4FLQA 3FFDB 4NKIH 5BV7C 2BC4A 1W6LA 1JN6A 4Q9BA 3ZRSA 3QJTB 2BY3A 3FZUC 3II2A 4Y2DC 1BGXL 2HLFC 2YWYA 3PFQA 5IG7B 3W0WD 5DK2B 1A9BA 2QTVA 5K9KA 2QR0A 4XN4A 3BUIA 5C9KA 4L37B 2GK2A 2HXAA 3CSFA 3LSOA 1ZVHA 3U30C 3UX9B 1OB1A 2ZUUA 3G6JF 4Z78B 1S7VB 1VFOA 2DQUL 5F7UA 1KXQA 3D0VB 4L05A 1KWGA 3BRDA 2D03L 1MFEL 4G42B 1CLOL 1KB9J 1D9KA 3EJQA 3U9PH 2K6ZA 1UT9A 1QSZA 1UFUA 4B9IA 2LQRA 2C1PB 3HNSL 5FDWA 2HKFL 4QTHA 5HGGS 2F0CA 5E2WL 5E1AB 3NFNB 4FC3E 3K72B 2Y25A 1YN6A 4AYFA 5GGSY 4GEJA 1JK8A 1AHWB 1HXMA 5HHVH 4F1SA 3QUZC 3A0OA 1EFXD 2WQ8A 1E6JL 5L4FA 4U0QB 4C56D 4NERA 1IEAA 3BUTA 5I9QC 2VQTA 5HP5A 2ZX6A 2CO6A 1J9QA 3DUHA 4EUPA 4CKVX 4JPVL 3L3DA 2XG4A 3HS8A 2A9BA 3FCTA 5C7XH 1RZGA 2IQAA 5EU7E 4I1PA 3NTCH 3E8VA 3GSNH 1MCWM 2V2WA 4HJGA 4X9FA 4OTXL 5EU6B 4KQ0A 3O45B 3TNMA 1GIGH 3ZTNH 2HWZH 3CFJA 4X9BA 5LNDA 5DMKA 3V5HA 3FT0A 4BH7A 4HIQA 5CBEA 2YGNA 3BUBA 4WV1B 1OAUL 2OS7A 2ADGB 5DHVH 5LNEA 3U1PA 3UAJD 5D7LB 2EE6A 4PWEA 1RJZB 1O7SA 3QNXA 1QBLL 2HUHA 3EHBD 4D9RD 1NC2A 4GRWF 4LU5L 4U0RB 3B2DC 2ADJB 3MODH 3V7MA 4DGIL 1I9JL 2BVPB 5F7EH 1NKRA 5FEBA 4JQXC 1W80A 2CR3A 1F11B 1QWUA 2G9HA 3V7AE 1EAPB 5DJXA 1I9IL 4I48B 1CG9B 5IKCA 1WAPA 1LQBC 3PGFH 1IKNC 3S37X 3CH8A 3ORJA 5LB1A 3LKOA 3QIUB 4X0KB 1SVCP 3VGGA 1UD6A 5LHDA 4P5SA 4W81A 3FT4A 5D7JB 3F8UB 4BCZA 1EA9C 1NUGA 4HKXB 3FUIA 4HS3A 4XCEB 4GQPH 5IFJA 4FG0A 4NENA 3PXLA 5T3ZD 1C8QA 2I9LA 4QHMB 4H0LC 2ARJA 4HU8A 5HVFB 5MEND 3FSAA 3OWEA 4S10A 3GDCA 1PYWB 3OZ9L 1DLFL 3D25A 3U36A 4DN3L 1I8MA 5TE4L 1E7VA 1U3JA 4PRIA 4GY4A 4LOEA 2A74A 2NQCA 4DGWC 1INEL 1NEZA 4G6KH 4AKPA 3B3IB 5FGCE 3RWHB 4GUCA 1S7XB 4NB7A 5JO5B 1UWGL 2FLMA 2C9VA 5IMLA 4I3SH 3SO3C 3IVKB 5LXGL 3ZN6A 4DAGL 3STLA 4F20A 3GWJA 1MFMA 5IB2A 5HY9B 4WI8A 2EINB 4N8VG 3R0MA 2OMWB 5JXAL 1UD8A 4EDWL 1HILB 1LP9F 4EQ2A 1DN0A 3S35L 2IVFC 1Q9KB 4DP2X 1G4MA 1G7QA 2XX1A 4B9ZA 2FZ3A 2EC9T 3T6ZA 4MJ2A 3ZMRA 3E3QC 4PP2A 5CXPA 1SJXA 2AQPA 4HJ0C 2A6KA 2DM3A 4OFPA 1GYVA 1XMWA 1EMTL 5INDA 5GS0C 5C86A 4EIGB 1TPXC 4UQ2A 1DCEA 4PRIE 3OX8B 4YSRA 5CU9A 3QWQB 4ESKA 2ENSA 1QFWM 4TRPL 4S0TD 4YWGH 2LGNA 3MRJA 4AYBA 1P0SE 5EIIB 4NNXA 4MVBD 4GT0A 4ZW8A 4CW1B 2A99A 1OWRM 3W57A 4MMYB 3L7FB 4S11A 4HK0B 4QXTB 4I4WA 4N0UB 2B59A 4AG4L 4XZ4A 3SZ6A 4DESA 1BZ9A 2GSIA 3QIBB 3ZKQD 5EZJB 1QG3A 3QO1A 4PHZA 4Y1AD 3F58L 3RKDD 4KX7A 1VGEL 4XX1G 4CMHB 4DTGL 1BJ1J 2X70B 5HYJD 2WSKA 2LT9A 1AGFA 3F7VB 1NOLA 4DW2H 3LV3A 3QORB 3A5VA 3L3IB 2XNAA 4BZ1H 3IJSA 1EUUA 4ADIA 3MOBL 3G6DH 4DWHA 4AVIA 4K7PX 3RE0A 4Y5VB 5KTEL 1KPUB 2BVOB 3GSRA 4WTZA 4JFED 4WUUE 1HHJB 3BWZA 3GRGA 3UPCA 1M6OA 4M6MH 3INOA 5MEOB 1A6UL 1JF1A 3EYOA 1C1EL 1S7WA 3JQOB 3NVQA 4RGOH 3CFTA 2VLKA 1HILA 3GXDA 4PJAA 5CCHE 4JM0A 4KDTA 1YPZB 3HRPA 4L3CB 3ZPDA 3LNHA 3PWJA 3GO1H 1H5BC 5ERWA 4RAVB 2WCSA 2LAGB 5T3ZL 1AZBA 1KPVB 4YHKL 3EFDL 4JFQA 4EEEA 2Z7YA 5CAYB 4NT6A 5D7IB 3RIAF 1J5OH 2BIOA 1T7YA 4MB1A 3O0RL 2OSXA 2UZXA 4OAWB 1RZ7H 5FYJE 2APBA 2FSEA 3RWDA 3VU1A 3WEAA 3G6AA 1JZFA 4DIXA 3CN3A 3D25B 4QT5A 1E6OL 4FAAB 4LAJH 2AKRB 3G5XB 3LN5B 2ZPKL 1QBML 3SDDD 1J1OH 4XNZC 4DOHE 3LCYA 4PY7A 2NTFB 5LGHL 4J3OH 4LLQB 4JG1H 2EKJA 1G7PA 1ILUA 2NYYD 2Z6FA 2A73A 3QG7H 4PY8I 3GMLB 4HUKB 3ZZLA 3HJ0A 1QABA 3LS5H 2R0KL 1JYNA 5BNXD 4CN1A 4A63A 4F37K 1SHXA 3EFOB 4PJHF 3L4CA 4LSTH 2XWXA 4BK4A 3GXNA 3KWWA 4ZFFB 3G5ZB 1A64A 4FYSA 4XAWH 2F5BH 3B8SA 3DOSA 1XHHA 2BERA 1ACZA 3HPLB 1QFWI 4F91B 3JZ7A 3WNIA 3D50A 3AMLA 4Z7QE 2OYKA 4RVBA 3F04A 1L6PA 1RHHA 1DZ0A 1F3DH 1G43A 2XYCA 4GS7C 1A6WL 1GJIA 3P9MB 5I17B 5BQ7A 3UBFA 3O2DL 3V4VL 4JFHE 3L3GB 3WUZA 3GS0A 3QJQB 4PG9B 3T09A 4Y2DD 4M6NH 1CXFA 1JDCA 3K6FA 4EXKA 3DI2B 3QUXB 1KTKE 1WCBA 1J9SA 1A1MA 3BC9A 3O3DB 3FHEA 2KL6A 4KUZL 1G7HB 2APTA 3I6LD 1ASOA 4CVXB 2VN5A 1YNTB 1BBJA 4JZJA 4MJIB 1EBPA 3DDGA 3I50L 4L5FL 4FXKA 2GBTA 5T5FH 3REVA 3VXSA 3AAZB 4X99A 1MF2H 4K9EC 5LAXB 4XPAL 4XP1H 2XPGB 3D18B 3AWEA 1JL8A 2VSCA 4IRZA 5FDYA 4ZMOA 1V3MA 2I25N 4L2LA 5A16B 5FHAL 5E5MB 3L9RB 2ZYHA 4IRSD 4MA7L 4NOFA 1JXFA 1HSBA 2DQTH 3BKJL 4TNWF 1VB9A 1S7TA 4FQHA 3LPWA 3CNKA 4WUUA 4MJ6A 4HVBA 2XSKA 3VW3L 5IV2B 1DBBH 1HKFA 3IU3B 5DR5L 2OL3H 2BP3A 3WGUB 2ZJSH 4F58H 1JZ2A 32C2A 3H0TB 3TPKA 2VC2L 4GW5B 4MD5A 4L18A 4N8UA 5DYOA 1ZA3B 3GMNB 3DPDA 4W9EC 4CVZA 3TZVD 4OCSL 2ZD0A 4BZ1A 1AO7E 2ZG2A 1WF5A 5SV4A 1L9SA 2VW4A 1GW0A 1I85A 1VZGA 3IFOA 1KIPA 1Q9OA 2C34A 4GKLA 1TOXA 4NO3B 4WI0A 1KGJA 3C5XA 3M17B 3ZSTA 4BH8B 1MEXH 3L95B 4K3DL 4X6CA 1LVEA 2GY5A 2ESVB 5AW0B 4GG6A 2QPUA 4X7TB 2FT6A 4KZCA 5SWZE 3RY5A 1DZBA 3MRHA 1Q1JH 5BW7A 2R23A 4P49A 4MD4A 1G9ML 3SDYH 4QIRA 4D7BA 1XIWB 4JO8A 3FCSA 2OJEB 4MDJB 3VQMA 3CFKB 1I8KB 4IDJL 3VH8G 2X89A 5IMMA 4Y4KC 3UTQA 5IEHB 3O9WD 4UTAA 1I3VA 2E7MA 4E41A 2M1KA 3NH7L 2JCWA 3NIGB 4NJ9H 1HC1A 4JHVA 4NM8H 2CKBH 4YNYA 5EC2A 1FF5A 1R5VA 2XYBA 3V6ZB 5I18L 4Z8FL 4GT7A 4AMKH 1NGXB 2VL4A 3MHZA 2W07B 4FQJH 1MJ8L 3ULVH 1X7QB 4ODVH 5ESAA 2UUDH 3S3CB 3UPAA 4EO5A 4R7XA 4ANWA 1LNUB 4P9HH 1VLXA 4GW1B 4WGVB 5H8DA 2F54A 5FF6B 4MSWB 4AJWA 4FQLH 1A7BA 1QW9A 2XQ0A 4X9HA 3MV9D 1JXKA 1I3UA 2EIDA 3OPUA 2CKNA 4GFTB 5DJAB 2ED6A 1MI5A 1FIGL 1U4FA 1KNOA 1RL1A 1XTLA 2CWRA 2YPLD 2HMID 4E5XB 4OQTL 1OO2A 5CKGA 1ET7A 5E8PA 3OV6A 5AVTB 1TTBA 4A7VA 5GGRY 3MRDA 2OK0H 5FLUA 1QVOB 1UGNA 1EGJL 5EF1A 1OK0A 3C87A 2EZ0D 2V9RA 1W8EA 3GB7A 1D5IL 3MOAL 2X05A 1ZHBB 3KPPB 5DC0A 3OAYH 1YEHH 3C6SA 4DJMA 1R75A 2QBWA 2Y7QA 3RIFF 3MRQA 1FWXA 1IRAY 4FFWD 3QDMB 1QI4A 1O9ZA 2VABA 1PZBA 5D6DC 4PSPA 4Z7OB 1EJOH 4MXQD 2H26B 1NFIA 1KSRA 4FFWC 4XVSH 4BZ2L 4HG4J 2XWDA 3PQYA 5KJ4A 1U30A 2FZ3B 2Q86A 3HNVH 2NY4B 3LVTA 2BCMA 4BSVA 1AGBA 1M9SA 5JDSA 2AJZA 5I8CA 2OSYA 4K2UL 2F7IA 4PGDB 5T5FA 3MKKA 2VITA 2HMIC 3UYRH 2Y6SC 3V4UL 4HUWB 3CHOA 5CJBA 3LKSB 4JDEA 5SWZD 1I1FB 3U36B 3VMOA 5HYJB 4JFFD 2JCCB 2O6CA 1HWWA 5EEUA 3LQAL 1DQKA 3GMNA 2I7SA 1HE7A 4ZDHA 4GG8A 1YVLA 1F1AA 3VXRE 2X7LB 3L3KA 4AXWB 3ETTA 5TDOB 4Z1PA 4XNYL 3KL5A 3C2AH 3FO2A 5LKNA 4I85A 5GPRA 1U8IA 3CDGB 1ZE3C 3MV01 4Y4KD 3BCFA 1S7QA 2ESVA 4GG6B 3LX9A 4AUUA 3BVXA 5JHLA 3FW6A 4H1LB 1CK0L 2PYFB 1D6VL 4DP0X 4XBGA 5J1AB 3BGAA 3KPLA 3FOLB 4FNSA 5L4IA 4JKLA 3VD1A 3APFA 1TJIH 4IEFA 2GEEA 4R83A 1ONQB 2E8YA 4XPAH 4PREB 1FO0H 5CLYA 35C8L 1BFTA 4KXZH 1FH2A 2BOCA 3OXSB 1GZQA 5KS9B 1YEHL 2ORBL 5D8JH 5DWPA 5AG8A 4IBTA 4IOSD 2KHAA 4NO0B 3IMWA 5T5FL 3PAYA 5DFWH 5F0MB 5BRZB 1KJMB 4XNQA 3BT2H 5JQHC 5GZNC 4IKLA 5KVEH 5KBDA 2NW2A 3FQTB 4S0SD 3X17A 3HC3H 4QRPD 2W0KA 4W4OC 2OMTB 1HQ4A 3ZL4H 3BN3B 3FS9A 2I60H 1KN4H 3N40F 4GP4B 4TLKA 4HC1H 3SODB 4L4VB 1C12B 4I89A 4XCNB 4YHPB 2Z8VC 2UZXB 2WWMC 4OAWA 4PWKA 4F7EB 4JFEE 4WUUD 1PIGA 1FAKT 1XL4A 3FT1A 1DQJB 3FB5A 1FA4A 3DJSA 4K9EH 5D2NC 4A37A 3LKQA 3KDMB 4L1TA 2UX7A 5AB9A 3VFUB 1E8WA 2UWEA 5TPWH 3WTTA 1F18A 4CC4A 4FQXB 2QVKA 2A7BA 2VLRB 1C16A 1SOXA 3TT3H 2XFGB 5I82A 3BW9B 3H54A 1FZJA 2YN3A 4HCFA 4B3VA 2EDHA 1RZJH 4HWNA 2B3RA 2WLMA 3V2AR 5CM1A 5HYQA 5MEOA 4FMFA 1EV2E 5SWZB 1JZ4A 3QAQA 4J3OD 4M6NL 3K2MC 2CO4A 4U3SA 1S5IH 1CF8L 5D2LB 2WXGA 4JO4L 2R4SH 3AY4A 3HN3A 4IHOA 3T3PE 2AEOA 5HHNA 3QI9D 2D7OA 4KKNA 5HI3C 1HDMA 5K9KB 5B1AB 1MKFA 3ISRA 5IUSA 3MC0A 5E7BA 1QX1A 1XAUA 1ZLVK 3FQ2A 3APCA 3SDAB 3RBSA 3GSOA 4OD2B 2HRGA 2R29A 1HYRC 4NLAA 3A24A 2IWGA 2OMUA 2H9GB 3MNDA 1ZA6B 1ES0A 2FEJA 1I8LC 4Z0XB 1JPGB 3TIEA 4JFQB 1JYXA 4Q7DA 5HYJA 4PRPB 1FRGH 1ITBB 5E6IB 2HJFB 4Y0GA 4CVUA 3EFDH 4NUPA 1JUFA 3X3GH 1JPEA 3RA7L 1ZT1B 3R1GL 3LRKA 4N9GA 3DUSA 4NOBA 4BZ2A 1TZIA 2LU5A 5EUOF 5DYFA 3W9EB 4D0CB 1CDHA 1IGIH 1PNCA 4P2AA 2W8CA 3JWNH 3MLSL 2B1HH 1IU1A 1A6VH 3RWCA 4ZX5A 5L2KE 4FJYA 3AU1A 1KIPB 3EUUA 1GOGA 3FTGA 3CSYB 2JKRM 2RD0A 5IF0B 4HOZA 3O0RH 1GYAA 2QSQA 1S6NA 1OXYA 5AW9B 1E30A 4N2KA 3QEQE 3ZL2A 3E3QE 2IADA 4R84A 2OL3B 3S7GA 3MDJA 4LSRL 3GO1L 5ABDE 4KKLC 3HNTH 4NCC2 5KSAA 5IIEB 5I1CL 5IV2A 1MDAA 1QNIA 4G70B 1QQDA 4P2RB 3TCXA 4ZO8A 5K33A 2WLZA 1NFKA 4U1HB 4AG4H 4CSZA 4DZBA 1ZHLB 2NXYB 2FYYB 2WCPA 5HHMD 4PJCB 3RUGF 4NNPH 3VGAB 3QYMA 1L7TH 3VGBA 3MRKB 1XIWD 2EE2A 2JXMB 1E90A 1RURL 4TQHA 1MFDH 2XBZA 3WUWB 5KVDE 1A6WH 1UVQA 3B9AA 3D51A 4FQIH 4G5ZL 1BPLB 4P2QE 4P5TD 4YL4A 3FH8A 3S3DB 4HUVA 3AGVA 2YQBA 4LKCB 3RDTB 4IOSA 3FFCE 1EMTH 2IDUA 4LDOB 5E94A 5J8OA 3ZKSD 3QBTB 5LBVA 2H0FA 1D5ZA 4QRTB 4BELD 1TCRB 5FK9B 4AENA 5IROC 5GISL 1QRNB 2VXTH 2H2PC 1CFNA 4P46B 1BV8A 5CUSL 2ZCLL 1WD9A 2DL9A 4HIJB 4R96A 1JZGA 2EDTA 2BOCB 2ADIB 2H8PA 3OXSA 4J3BA 3TM6A 2IV8A 1BYOA 2NX5E 2ICEB 4ORGA 3CMOH 3DV4B 3B9KC 4P4KC 5KJRH 2EXWD 2BK8A 5IB3B 1QFPA 1N0XH 1O5PA 3H7BA 3TO2B 3QQ4A 5CZXC 2PP8A 1AHWC 2B4CC 2X4RB 3B7SA 3GKZA 1TTRA 1RUAH 1BM3L 1GHFH 3OX8A 1XR9A 2ADGA 3LOWA 4KMTL 1E6OH 4EZJA 1W72A 4YO0B 3FTXA 1OCWL 4PRPE 1M1XA 3MBEB 4U1LB 4CBZA 4EDXB 4XO3A 1PJ9A 4K0OA 2CPCA 3MACL 2X5PA 3N44F 3LN9A 4QOKB 3ZKMD 3WY4A 3O6LL 4M8UA 2VSKB 3L3OA 2GJZA 2E0PA 4ZS6C 1ZXQA 4G9FA 4HJ0D 1LE9B 1OF2A 1ZD6A 3N44B 5B8CA 5JUEL 5DK3A 4RSYA 4FEIA 2QZQA 4O02H 4K23L 4RMWA 3OZKA 4YGVA 5K93A 2EQDA 5M7QA 1A25A 1FSKC 1I8IB 4IGBC 2C9SA 3MBWB 3SDXF 3ZW3A 1C1EH 2WPGA 2NDFA 2BJMH 2F8VA 3B6SB 4JUSA 3KPRB 2LFGA 3B56A 4X8GA 2PW2A 3BZ5A 2UXTA 2NNAB 3FQWA 2KZWA 1BVKB 5FGBC 3VXUA 5CFHA 3LPPA 3BFOA 4Z7VB 4WUKL 4GIPD 2VMFA 3JTTB 3IDMA 4KMTH 2GVYA 2VNCA 3GKWL 1PYWA 1JZHA 4DETA 1QBLH 2AABH 3HFFA 1QUNA 5DVNA 4PVMA 4F8QA 5JW4R 6FABH 1JYWA 1KEGL 3GMQA 4UU9A 5KYUB 5JORB 4YDMA 2R69A 5JYMA 3QPXL 3TNNA 1VZHA 1T4WA 2JKIS 2CHXA 4HG4K 1H8NA 2Y0SA 5GRXG 5J12C 5D9SB 5B38G 5LQBH 3EIFA 1A6PA 5JHDA 1T22B 3EH3B 3AT9A 5I0VA 4NWUH 4XVOA 3RZCA 5JR1H 4P23D 3ULUF 3MO1B 5EIQA 2BNRB 1WZKA 3OKNB 5E8PB 1HK6A 1MN4A 3VXUE 5K1VA 3HC0A 4YMPA 3DXAA 5BO0D 4A2HA 1UASA 3MUY1 4U6YB 3FN3A 4AY0A 4DGVL 4OGYH 1NFAA 1QRND 2Q2EB 2AQTA 4G8GA 4YSAA 1QRNE 4PV8B 4WTWA 4HMDA 1ODAA 1U41A 3AXLA 3NIDB 1SY6H 2DMKA 3QUYC 2J8UE 4FQ1H 2NY5L 2NY7H 5KVEE 3KLSA 2CLVB 3UAJC 3FCBA 2ZUWA 4ODHL 1M1SA 5FM5M 3RDTD 4H40A 1BFOA 3RIAK 2I5YL 4Y16B 4AKQA 4EDWH 4A2EA 1MHPL 1OPOA 3BRFA 3CXFA 4EIUA 1UZ6E 4FQXA 4AIZA 3DYPA 1XIWC 3GGWB 2EIEA 3L5JA 3MCKB 1X5FA 2XPYA 4OKVB 4W9CC 1MJUH 2ZXAA 2CA4A 1ADQL 2FX8H 2IPTL 5GJTL 3NYKA 1MW3A 2BSDA 3DMMA 2C1PA 1CLOH 2F58H 1DQIA 1U8PB 1JZ8A 4U49A 3QUZD 1CYXA 2DQCL 4Q4EA 5CP7B 4P2RE 4HKBB 2OZNA 1U33A 2QQKH 2XFXB 3ZY7A 3S36X 2ARJQ 4ICWA 2OXGA 4KPHL 3NCMA 3C09C 5FECA 5BW7C 1WAAF 2MNJB 4LIQL 2QADD 3FQUA 3L6FA 1OF2B 3PQYD 5BZXA 5B8CB 3KPRE 3T4AB 3AB0C 3CGTA 1BLNA 1JHTA 1MCDA 1BXXA 1VENA 5AAPA 1B90A 1FRGL 5CZRA 4JR9H 3UJTL 1WWBX 3SDDB 3EOAA 2VM9A 3TIDB 4PS4L 3P11H 4KXAA 4RNRB 5DDHB 4YE4H 5E2VH 1YMMD 3FZUD 4RA0C 5D2LF 5C07D 2EE9A 5GGSB 5BUAA 4XVUC 4G72B 4WI6A 2VYRE 2CIIA 1KCRL 3ROOB 1GVIA 3RJQB 1F2XK 2WVSA 4F7PA 1AI1L 3LHPL 4OGZA 2EECA 4PRID 2FO4A 2PCXA 4KK8C 3OKYA 3QWOA 3N40P 4LPCA 1GIGL 3JWNE 1ZVSB 3DX7B 1TTCA 1KCVL 6CGTA 2XZQH 2X6BA 4MA8L 3CFDB 3V55A 4NCC1 3A4DA 5HI3D 2XG4B 5I1GH 3T3PF 3PL6A 1MUJA 4FFZA 2XX0A 4WNSA 3ME0A 1KJ2A 5DHVB 1A7QL 4K9EL 4IJTA 5KBLA 2FJFA 4BFJA 2SODB 2V7NA 2ZX8A 1IAKB 1MRFH 5CBEB 2I9TB 4PB0H 2D73A 5CJQH 5D6DA 3H2PA 2VMEA 1SF3A 4N26A 5JW3L 2OBGA 1F8TL 2Z31C 4OFVA 5I15H 4V1DD 4UT9H 4J39A 3HC3L 5JHAA 4U3CA 2YJLA 3R4DA 4N9OB 2UXVA 4F15C 2V9TA 5BOPA 1MAKA 1VFBA 3OGCB 4XBEL 3R19A 5HY9A 12E8L 1FNSH 2X4TA 1J0KA 1VFAA 4NRZA 5L88L 1H8OA 3E38A 3PGDB 2XWCA 5TF1L 3QHFH 3GBNH 1E4WH 1N7MH 2LU7A 3H2QA 3RVVC 1I7ZA 1VCAA 1YRKA 4PJ7B 5HGHA 2AEQL 1QRNA 1AANA 3SDDA 2Q2LA 3AAZA 1F4XH 3GS4A 4K71C 5JW5B 5ICZA 4H25B 4YHML 5F0JB 2P5EE 1IGML 3CUPB 1KCSL 2A2QT 4IU2B 2PO6A 4HWEL 4IK7A 4LEEA 3N43F 1A7OH 5JLZA 4D8OA 1BVZA 2JIXB 4L37A 5E0FA 4ZXBC 5DRZA 5F7KC 1L4IA 3WKQA 3UP6A 4XXDA 4Z7NF 4GSXA 3BSZL 1D2OA 1U21A 3C5JB 3RPIA 2OTPA 2JELH 3T8VA 1JZDC 1JDAA 1DDTA 4HWBA 3RVTD 2ZXCA 4N9GB 2ZOWA 5DLLA 2PWGA 5GZOA 1SLXA 2BOBA 2N59A 4IBYA 4L8DB 1B0GB 3BJLA 4N6QA 3SGJA 3CK0H 2MQCA 2QTEA 2NUPB 4Q2ZB 3ILQD 3P0GB 3UXFA 3C8HA 3CXHJ 2C3VB 4KVCL 4FHJA 3D4YA 3BHBA 3VRLE 2GUOB 4OJEH 1EFXB 1RU9L 2WGXA 3TIDA 3TVMB 1B2YA 2Q20A 2MOGA 4UB0H 4DT2A 1DDHB 1QYGL 3OZLA 4OF0A 4NJAH 2L7UA 4KKRA 1A65A 5GZNA 2B2XL 2P4AB 4MJ5B 5AWNH 1N5YL 2ZSVA 1NUDA 4PJCF 4B0MM 5I8OL 4JRXB 4PJHB 1EHLL 2WVVA 3HNVL 3KPSE 3DOHA 2VKXA 2F54E 1WAAA 1IAIL 4FA6A 4R5VA 1TEGA 2YMOA 3BVWA 4X6DA 1QLEB 2JCCA 4P57A 3H1ZA 1E27A 5AW5B 3HG1E 4G1MB 1WQVT 3MR9B 2VAJA 4HUWA 4EBQH 3BE1H 4KKPA 1T5WA 1PEZA 3GBNL 1BYPA 3MX0B 4PMFA 4ZAKA 2J5LB 12E8H 4FFZL 4GQ9L 4NQXB 5D1QB 4Z23A 4J8RA 2AW2A 2E6JA 4HBQA 5FO9B 3MZGB 4YSTA 1N3NA 2YBRA 5IB1A 1BBJB 4JZJB 1A4KA 3JBG7 2HH0L 5TDOA 4LNRB 3IJYA 2NRDA 5ID1A 3NFSH 3I3BA 5L9DH 4YXHL 2PWFA 4QHKJ 1EEYB 2FWOB 1AH1A 1ZTMA 4OGAD 1QLFB 4ZMQA 1XAKA 3CLEL 2HLEB 3IJEA 3OKDB 1OARH 5E4AA 1IBYA 5EZLA 4RWYL 4CU6A 2QL1A 3RWEB 5EB9A 2Y36H 4RESB 2DLFH 2G9HB 1XSJA 5D1XB 2YO3A 4JN1H 3CN0A 1BFSA 1Z3GH 4GO9A 3ZK0A 2RALA 1IFRA 4IEFB 4JO3L 2Z8RA 4PJ7A 4R7DA 3F6LA 4KNQA 2ED9A 1ZANH 4MJHA 4LMQE 1CXKA 3UERA 3NRFA 2XWZA 5F7YC 4W6YB 1JGDB 2CMRH 4XNUH 5BZWB 1II4E 1OAXL 1YEIH 4G82A 3A4EA 3S3BB 4Q58C 4PJAE 3BMWA 3LHPH 4U6VL 4LESA 4IRSA 5B3NA 1A0QH 1PKQA 4F7EA 1KELH 1PPIA 1QPXA 5DJ2B 4LL1A 4K3HA 4QTIL 4TUOB 4I77L 3VH8A 2OR8A 2JJUA 2I69A 1WFMA 5C0AE 3CE1A 4PJFE 5CJOL 1PD1A 1T0PB 4NO0D 1HJCA 3ECVA 5D1QD 1T03L 3RL1B 4DQAA 3VXTA 2X4TB 1M9WA 1IT9L 1QSFE 4RAUA 5T8IA 4F1ZA 4N2CA 3OKOA 1GXEA 4Z7VA 4HAKA 3A6BH 3MRHB 1SBSL 2ZYSA 3WNNA 3LNFA 3TBTA 5L0QB 2NZ9C 1BVOA 4JEGB 4S0HA 1I9RL 4CRPA 1T7VA 5I1HL 1RJLA 3W1ZA 1SJHA 3X12B 3M1BB 1AD9A 2NY0B 1KZYA 3K5RA 1GY2A 4C56B 2NR6D 2HH0H 3EH4B 1V3LA 4O4YH 3BO8A 4AZUA 4X5QA 4C54A 2X4QA 5C70A 1DBJL 3QDJD 4ZG1A 3EBAA 1YUKB 2Z34A 4PB0L 4Y5VA 1EEQA 3UP1A 1N7ML 2FQDA 5KVDL 1B0WA 3NP3A 4QRRA 3I6KB 4GIOA 5AENA 4IRSC 3FYIB 4FNLL 1M7XA 4B97A 3ZHDA 2FGWL 2MSPA 1IGYA 4MA8H 3GSWA 2CRYA 1FNGB 3NPSB 3ECWA 2EVJA 2R0ZL 3HZMA 4RMUA 1MWAA 3QCVH 1EFQA 2ICWI 5E5MA 4YDKL 5DVMA 1KFAH 3IS1X 1AZNA 2JK5B 3BAIA 4QJ3B 3RL2A 5DMGD 2WYHA 3I9GL 4XMPH 1FHGA 4MWFB 4MXVE 4RNRA 5D7SL 1PDKB 2CRIA 4M5YL 4OKDA 3WNJA 5C0EB 5I8OH 2CJUH 3BLKA 3O4LD 4HBCL 3L3OB 3HA0A 2JCCF 1A7QH 3EO0B 4N3UA 3RZCD 4J8QA 1BVNP 2FJSA 4NHCH 5IESL 3IDYB 5IF0A 4WEUD 5FUOL 2F5BL 5T1DH 3LEYL 4ZTOL 4EJ1C 1FZOA 1OSEA 4ODXB 1U8JB 4G43B 1BZQK 3BDYL 1NGYB 4UAOC 1IZJA 3T2PA 2ZWNA 2JXMA 3MFGB 4PJ9D 1OTSD 2R0KH 2ISDA 5C0RH 1H0DB 2YPLB 4XCFL 5EIVA 4A2MA 1MCSA 2JLLA 1IQDA 5CSZB 5HDBE 3WD5H 1X6NA 3AFLA 1MVFA 4HFWA 4Z95L 1MI5B 3VVWA 1PQZB 4HAGA 1FL3B 1XGUA 1X5XA 1UUNA 1IM9A 2YXWA 5DD6A 3IJHA 3S36L 2JKNA 3Q6GH 4NPJA 2FR4B 2ODIA 2G0KA 3ZU8A 2JWYA 3GSOB 4OD2A 4KJQC 1PTZA 1IGMH 2NYYC 3DXAE 1T5XA 5JA9A 3U4BH 1K8DB 3HLAA 5E2UL 1LK2A 3EO9L 4ONFH 3DURA 4GMTL 2YSTA 3WTVA 3KL0A 4XP9H 3M86A 4DOHB 3CFUA 4AGPA 1F97A 1HWGB 2A77H 2JQMA 4WKXA 4N0YL 3FO0H 4R3SA 3ULUE 1OT4A 3RB5A 3AS1A 1QEWA 2ITEA 1Q9LA 4Y16D 1TJXA 4FXGC 1LWJA 4ZD3H 4GKZB 4P5RA 3QG6B 3DJTA 1HKLL 1FFNA 2FYVA 2XQYA 1HQRA 2BNUA 3AADB 4CILA 2VGLM 1FO0A 1NBYB 2HX7A 4WJ5A 3VXQA 5DU7A 1CD9B 2IG2H 1HTYA 1ANUA 5AYQA 3ETBJ 5I1KL 4AH2B 1I3GL 1CD0A 4PD4J 4HKXA 1KJVA 2X10A 2XTJE 3IJ7A 1X6LA 1G7HA 4XVTH 3MJ6A 1SLVA 1SXAA 1LHZA 2W9DL 2VZ1A 1EBAA 1DVFD 1YPZE 2P9RA 2YXMA 3RVXD 5MP6L 2GFBB 1NANI 1J8SA 3CVHL 4Y19A 3NIFE 5TQ2L 4NO5B 4AQ1C 1HYSD 3NDZE 1OAJA 4NQTA 2BSRA 4B27A 2DJ4A 4LZKA 4AMXA 4N0FB 4DGVH 2IOMA 1VDGA 4U2YA 5ANMA 2FNBA 1T2JA 4LCYA 1X44A 4KHXH 1E5UI 1IM3D 2HFTA 4P04A 2O5NA 3C60D 3BD5A 1LP9B 1FLRH 2K3HA 2E47A 3W0WB 4PJ8B 4KJYA 3L3JA 4LKXB 1HH6A 3EOBA 5E4EB 3BEVA 1CUOA 1M53A 4TKWA 4PJGF 4JMNA 4PJDB 4YUEL 2C4FU 5F9JB 1IFHH 1J0YA 2VLJB 1RMFL 4M5ZL 3F7RA 3GSRB 3TT1H 3DX3A 3WXVH 2ZKWA 3ETBF 3MFFA 2E7DA 2FTAA 2DYPA 2EDKA 4N1HB 2C5DC 1C8PA 1MZYA 2XV0A 1UJ3B 1MAJA 1N70A 4PJIF 3L9BA 1KTBA 3GLDA 4KV5E 5DFAA 2FL5B 4X6EB 2EILB 2X89D 5DC2A 3VXSE 5EOCL 3QQ4B 3ZOAA 2ZX5A 3O9WA 5KSAD 4JFDE 3ATEA 3DGCR 5HHOD 3MLUL 1PKQB 5EZPA 1YNTF 5AFAA 3RWFB 1PEWA 2ROYA 1J05B 1Z7JA 3MRIA 5CIPH 5LCVL 2Q8AH 1TFPA 1IBFA 3B8YA 4TVPL 4JDZA 3BAEL 5J57B 5F96H 2GBVA 3GXIA 2DWYA 4P23B 4K23H 2QMKA 1UH2A 3AVEA 1BMZA 3M1CA 4FQXC 2GIMA 3WTUA 2ESVE 1I7RB 1FV1A 3L4VA 4PGJA 1Z5HA 4NBZB 4AIZB 2JJVA 2XTLA 3PWPD 3V0WL 2GSGB 4OZIA 4K3EH 4DZ8A 2YPVA 1DJYA 2WBWB 3MACH 5HHOE 4FQ1L 4L3ED 1X5IA 4Z3IA 1CTOA 3QHZH 1E4KA 1UOVA 3V52H 1P7KB 1U92B 2PTUA 3HN8A 2W65A 3U0WH 2IGLA 4GXVH 3BP6A 3BVNA 3Q5YA 4NI6A 3X1GA 4EKXA 4GXUN 2R4SL 4WSJA 3QJUB 4PPTA 1N64L 1M3JA 1KNOB 4M43L 3NCXA 3ZUCA 3FOLA 3Q13A 1A5FH 1YPZA 4L3CA 3QQ9D 4NWUL 4TV3A 1K85A 1UZ8B 4NQXA 2VERA 3PUCA 4LCIH 4M8QB 2FWSA 4R0LB 3OMIB 1MELA 2A6JA 2ZWSA 3QGVA 1FNEA 3MNZA 4UIMA 5T1DL 2CE6A 3DETC 4WWKA 5FYJD 5F6IB 3MREB 5I76A 3MRCA 1M7DB 4NHCL 1ZGLM 2WB7A 1ASPA 4RAUB 1FL6B 3WY2A 2H3NB 2YZ8A 1SOKA 3P2BA 3OAZH 3PGCA 4AV4A 2CIIB 2IH1A 4WLCA 2CHNA 1RUKH 1ICTA 1MFAL 3N85L 3SE3A 4WFEE 2AVGA 3PV6A 2CKBA 2JKXA 2O6FA 4J3SA 3K6SB 1NGPL 1XCXA 1MFEH 4UQEA 1UT2A 4CL7A 4B50A 4GAAA 2YD6A 4GG6E 5DJYB 4J28A 3KYKH 3RAJL 4OM1L 2NYZA 3TVMD 4O51B 2KLRA 1XF3A 2AQSA 4JFDD 4IRSB 2CUHA 2VDOL 4FL4B 3M8OH 2K4WA 1I75A 1XF5B 5E23A 2R56L 2XRAH 1A7NL 1U3ZA 1CG9A 4LCVA 5E6IA 2NW3B 4JFXB 5IKCB 4KDVA 4I0PB 4X5WB 2EIKB 3QZPA 9PCYA 1W72L 1ZGLA 1J8KA 1KGCE 5HPMB 4M7KH 2BFVL 2B9AA 4MAZA 4QY8B 5TQ0L 3BQUA 3SPIA 1OE3A 3GDBA 2VIRA 2XG5B 4MMYA 2XY2A 1DYZA 4LVOC 4N2MA 1MCPH 4I18A 3U4BL 5B4MC 3MRNA 3VXTB 4N8CL 1B9ZA 1J9TA 2DDQH 3WAJA 2ZUQC 5ISZA 3US0A 2AEWA 3V6ZA 3EYQC 1JZJA 4NXKA 1ADWA 4PG9A 5DT1L 4P3WA 4HUMB 4JM2F 5F1NB 5KSBA 1CFSB 3VSVA 2WNXA 4NENB 2B1HL 3NIFF 2EDEA 1XB3A 4CADB 3WIFA 3ZRFC 3VRJA 1CQKA 1QP1A 5E1HB 2AJ3B 3EYVA 3PWUB 4DPAX 2B39A 1OANA 3K3QA 3MA7A 1DJXA 1F1GA 2AEPH 1AXTH 2NDGA 4P46C 4X7EC 2P7TA 5EH1A 1T89A 3BEVB 5HGHB 1JF5A 3DXAD 4GAGH 5KSBE 2FAUA 3WJJC 1JXDA 3QORD 2CM5A 1IEHA 2XPGA 3D18A 4F9LC 3HFMH 4TM9A 3TT3L 1GZQB 3MOQA 4WW1A 1T1YB 1SDAB 1Z5YD 2K7QA 2MH4A 1DVSA 4KRMB 4OZ4A 3T6WA 2TSAA 1KY7A 1AP2B 2G5BB 2W9EL 1JRHI 1ZIAA 3SO5A 2EKSA 5LVEA 3PWPB 2EIZA 3OMNB 3UEZA 2NW2B 2FL5A 1YJDL 2RMNA 3DX6B 2VDQB 5DFTA 2YA1A 4PWIA 4LKCA 2CQVA 3OG6B 3V5DB 4OQTA 3V6BR 2WANA 4HJGB 2IGFH 3J7HA 3CSGA 1F3DJ 3GTTA 4IKJA 3VO0A 3IKCB 1R5IB 3BAJA 3I6GB 5EORL 4AL8C 4IMLA 3SE9H 1QTPA 1VGKB 3W3BA 4NZDA 1X5AA 1CVRA 3BT2L 4P2OA 2PETA 4JFYA 4ZFOL 1FNEB 3MNZB 2DAVA 4UNUA 2HA1A 3BHBB 4KNTA 2BNQD 2R0LH 1NDTA 3AREC 4HT1L 5F7NC 4IGBB 1I1RA 4P2RA 2F53B 1OY3B 4G2AA 2K45A 5KVDH 1WGVA 4TNVF 1O9VA 1GGBL 5FWQA 1TZ8A 4HPOL 2HKHL 1N4XL 4IRZL 1SGKA 4LK4A 5H37G 2VMDA 1FIGH 1BQUA 3GSXA 1CXLA 1QUPA 3L3KB 1YEDA 4KKBD 3BAKA 5E9NA 5ESVA 3ZKXC 1YNLL 3WS6A 3T0EA 1V05A 4DP7X 3E2HC 1TG8A 1WFNA 5D2LE 3RNQA 2K78A 5DK2A 3DIFA 1XV8A 2IAMD 3HE7B 4EI5B 1T20A 1FDLL 3WL9A 4XTRD 1L9QA 3ARWA 2VE6B 2ZXBA 4YZFF 1R17A 4TTDC 3MLYH 3ARUA 3U2JA 3KLHC 1XEUA 1H6EA 4ELKB 5AKVA 2GK0A 1QA9B 2DQFA 4PCSA 5J6HB 1G84A 3BJ91 5HDWA 4QTHB 2H41A 1AC0A 2BW4A 2YGQA 1UYWH 2Y5QA 4U6YA 3GK8H 4I77H 2DWEA 4H0GA 4JVPA 3KLHD 1YZZA 5HVHB 1R6VA 4NAJA 4P5MB 4MJIE 5L4JA 2F9BT 4XB3A 3NMEA 3UEQA 3P54A 4OVUA 1P69B 1X7SA 1EEZA 2IAMC 4I2XA 4TVPE 1XZWA 4R26L 1AR1D 1DVTA 2VDRB 3O3AA 1OCZB 4OCSH 4A38A 3G5XA 3LN5A 2F1EA 1D5ZB 3OR7B 1BQHB 1XF4A 3MLYL 3KPQA 5GS0L 5K9OA 4UDTB 4JM2B 4QHKI 5CEYB 1KG0A 5F21B 4JN1L 4D94A 1U36A 3ZSSA 5DGQA 4BD4A 4XN5A 3BQUB 4UQ3A 3D3VD 2UWEB 4KK9D 4NPKA 1K4DB 5F88A 2HFGH 2VZSA 5KS9E 1PDKA 2NY4C 3UG4A 3VWJC 3W9EA 5EEYA 2VDKL 5EBMB 3SQOH 5HJGA 1GYWA 2QV4A 1QW8A 3NEXA 4M8VA 4A7QA 3KJ4B 3D12B 1WIOA 2H0EA 4PGBA 3S9DB 2KDGA 3DC0A 5CU5A 4NCDA 2OYMA 1P7QA 5PCYA 3VX1A 1JGVL 5CEZL 3ZZQA 4Y1AB 5DA0B 4TQIA 3F65A 4F9PA 1F6LL 2IPKA 4KY2A 1BXVA 2PCPB 1OM3H 4A6YL 5C08E 2R69L 3QXAA 3BZ4A 3S4SA 2JF1A 1SXNA 1D5IH 2IADB 1I8KA 1IKOP 2WXNA 1LMKA 4XPGH 2NY1D 3WG7B 5DSCB 3UBGA 1JZ5A 3DO7B 3QZWB 4IKNA 4OBSA 2KZKA 1HHHB 3HG5A 3N5AA 4MNQA 4XWOD 1TSRA 3QZNA 2HT2D 4OCXL 4LOVA 5EU6E 2P43B 2VDQH 1FVEB 3UADA 4C56A 4NAMA 3VFSB 1P4IH 2B1AH 3VFWA 4MDIB 3STLB 3PJNA 1V10A 3S88H 4JE0A 4WO4A 4O02B 2GHZA 3PWNB 3EYSL 4GBXC 5JO5A 3DSNA 2C9XA 4XX1E 4KQ3L 3GSNA 5D7LD 4JCMA 4HU2A 3P3UA 4OZFB 1DUZA 1ZSHA 2WMPA 4G6JL 3T0AA 3TBSA 1QVOA 5DHVA 1WFIA 3PYCA 5DRXB 3KWUA 1QO3B 3NZ8A 4JGUA 4XCEA 3VFMB 2ZXWB 1QPPA 5JW4N 3K81A 2MWCA 2X09A 1HSAA 3N1FC 1XB6A 3OF6A 3MLRL 4W93A 4GKOA 2YMXH 5B21A 2VUKA 4ONGL 1NPNA 2FSDA 4ODWA 1KXHA 1G7LB 1AZCA 3F05A 2B0SL 5A2CA 1VCBC 1Z9PA 4QJ5B 4QRPE 2DQTL 3KW7A 4JFPA 3P11L 5TE6L 1BF2A 5D1ZC 5DWUH 4AYID 4WKZA 3SBRA 2XICA 4M8RA 3AG2B 4U1GC 3O6MH 4X98B 1M6UA 2C3XA 5EFIB 5FW8A 5C6WH 3CHXA 3TBYB 1ZLWH 3WXWL 4PJXA 2HX8A 2AMUA 1KCUH 3N43B 1E4WL 4RETB 5J9PA 1YEEL 4XXCC 2YUZA 2Z92B 3JVFC 4YLCA 1SN2A 5GGTL 2XV2A 4M5TA 1ZHKB 1U93A 5JIDA 5FYKL 5ENWB 3S8WA 1CTMA 1M7UA 5IFJB 4UIMB 1FBIL 4OM1H 2DQCH 5IY5B 4H0HB 2AERT 5HJ3B 2FBJL 3MOBH 5IHUH 5C0CD 1NKGA 1C08A 4UT9L 4U1HA 4Z0BH 2GTWB 4YDJB 1UZ8A 1MPAL 1WC7A 4DUXA 3GJFH 1IAMA 2NCEA 2WY3B 1F58H 3C5ZB 2TSBA 5C0AB 5IVXF 3IDMB 3QISA 5A2BA 1ET5A 4F80A 1DJHA 4GW1A 3MRCB 2R7EA 2DN7A 1CIUA 1WVZA 3F01A 3Q1EA 4JFDA 1TCMA 3I85A 3K2IA 4Y5YC 3VM5A 1O6SA 2I5YH 4OBRA 1JV5A 5C0GA 5CD3B 5D96B 2HZHA 1PZ5A 3NH7H 1IE5A 1S9WB 1C5DB 1KIQA 1ORQA 3L3HA 1CLZL 1MJ7H 4LSTL 4W70A 2WLHA 1XEDA 1LE9A 1YNKL 5EBLA 1PX4A 2QPEB 4HWZB 1PZSA 4Y1SA 2D7QA 3BRGC 1BIIB 3CFEB 3QEQD 1A3RL 1HS6A 2DM7A 1KCRH 4DO4A 3EBGA 2CK2A 1JZEA 4FZEL 5I1LB 4GQRA 3ZMNA 1NFDA 5DFVD 5I0XA 1NCBH 2WWKT 5L2KD 3UABA 2BOBB 3BLBA 3TBYA 4BINA 4QHUA 4P2QA 1Z9NA 5ADPH 2XI9A 3EYOB 4N2FA 1XSIA 3ARBC 1OP5H 1LD9A 3UZVA 1VSCA 4NQVA 5I6XC 4HOMA 4LASH 2DL2A 5ALBL 5C71A 3ET9F 1FVCB 1GC1L 5ESQB 3WTYA 1FGNL 2W5PA 1T2QL 4L4VE 4AE1A 4GSRA 5HXMA 4M1GL 5ID0A 4JG1L 4JCWA 3L3GA 3ZE2B 3OAYK 1HSAB 5HHPA 2D2OA 4CUCA 4P3CH 1JRHH 1WLHA 3FCTB 4LNRA 3VAEA 5E9AA 1TNMA 1NAMB 2J71A 5DUPH 1F4AA 5TDPA 1EHXA 3KCPA 3LRMA 2W38A 3F7KA 4JCLA 1Z9MA 1YAZA 4LKXA 4ZNEA 1ZGLP 1HDMB 1WG3A 2IDCA 4K7PL 1YUHA 2ZOKA 2D0GA 1B6UA 2P42B 3WFDL 5C6TL 5CCKL 5DK0A 1NAKL 5LBSA 5ADOH 2QGBA 3IXAA 2YLHA 3ARVA 4X5PA 3VWKD 4WU7A 5B38B 5LAXA 1GC1H 3FRPB 3RWIB 4DKAA 2CHZA 3TWCH 3K71B 3M7OA 4P2OD 4ANXA 3BEWB 2J6EA 4Q52A 2ZOLA 1IFHL 3ERXA 1W0WB 1JBJA 1A6UH 3GJFA 4AKOA 2OMWA 2WYZA 1CN4A 2ERJB 2YS4A 3D06A 4NFDA 2WOBA 2X2JA 2NY5H 1UZGA 3QDJE 2JB6B 4WW2F 5DCCA 3QFJD 5T5NF 3IWUA 4TS6A 5F7MC 1NIAA 4ATWA 3DV6B 1INDL 1USQA 3QS2A 4PJXE 4D9LH 5AOZA 4M1DH 2MQ3A 4S1QL 3ISWA 3RWDB 4NKDB 5I0YA 3UAJA 1C12A 3PXHA 4OV6F 3AACA 4ZUTA 1X5JA 2VOTA 2XWBB 3AZUA 2J8OA 1GS6X 4ALAC 2BXYA 3BUYA 1GTFA 2QGDA 1FO0B 3ASWA 3RURA 3H3PL 3WO3B 3IU3A 2X44D 3L1FA 5H94B 3D3VB 3MRLA 3GMOB 3JVGC 2H6OA 2VJ8A 2JK5A 1ML0A 4AJVA 3ARDB 1G0XA 2ZKHH 2FX9H 2JQAA 4HIIA 5EZOL 1WRFA 1HX0A 1Y1DA 4OCLC 4GXFA 4X7TA 4KO9A 2H3XC 3RUGE 3SJVE 1LO2L 2BZCA 3PQYE 2ED8A 5C0CA 4EMZA 4WI3A 2YOCA 5ACZA 1XXDC 3G5VA 3DOIA 2CGZA 3FO1B 4LSUH 4GG8B 2QEJA 5D6CB 2AJYH 2BNQA 2YD2A 3BH9B 3D69B 3P0VH 4JREC 2DD8H 4P2RD 1DLFH 2WTOA 4G80A 1K8IA 4LOUD 4RMRA 3LD8B 4YSDA 4TUKH 3ZHFA 4IHOB 3ZTJH 4X6DE 5JIIA 4ZO6A 2VMJA 1CDBA 5IQ9B 4KJQD 4M61B 4O2EB 1BF8A 3PNWB 5JNYB 2ERJC 2ADFH 5D72H 2ZOLB 4HKBA 2PPAA 3QZBA 1O6SB 1B0GA 2YD1A 2ZWLT 3I02B 6PCYA 4XOAA 5D1ZI 5IEKB 5I6NA 2EIBA 3SYQA 4I1NB 3MV8A 3U7WH 3QUZB 4APQC 4Y7MA 4OFQA 3KPNA 3WIHH 5HYSB 3REWB 5AZ2L 2ODHA 4NRXB 3BLPX 2BP8A 3O8XC 1YY8B 1OSPL 2YXFA 4C83B 4X4YA 4H2CA 4B5EA 2HFEB 5HI4C 1NDMA 5L6YH 1GHFL 3C6LD 1WZAA 3EO0A 1S46A 5DMYA 1TZOA 2K3TA 4AZ8B 1S3KL 1TVHA 1TYJA 2OJ1A 3KPSB 5IW3A 1VPOH 3UIYA 2OMTA 5D5MB 1G7PB 3QB7C 4JQIL 1EHKB 3I2CH 3FNKA 3PIQB 2ZUXA 2P8PA 4J2XA 4PJXB 2WW8A 4MJ4A 1N6VA 4U1IB 4ZTOH 5FUOH 3CFCH 3DECA 3RX8A 1JXJA 3JV4A 1X9LA 3TJHD 3UGUA 4FZEH 1N2RA 4DCQA 1I3RB 2PYEE 3O4LE 4YWGL 4AW7A 4PLKD 4U3XA 5F7DA 2J73A 3LSOB 3HUJA 1WK0A 1YEFH 4MZ2A 4NQCA 3RNQB 3EG9B 4JO4H 5BMFH 3FU8A 2Q6WA 3IJYB 1ZDSA 3VFRA 1AY1L 2JIXA 3NRPA 3PV7A 4MNQB 4CSTA 4KWUA 2YQ3A 4PJFF 5ICYB 3T0EE 4XMWA 1PY9A 1SEQH 1XH2A 2NXYC 3ZO0A 4OZHB 4BBWA 4YK4B 3GMLA 3IAPA 3LHAA 4Z7VF 3VXPB 2CCVA 1AE6H 4LSDA 1F86A 3JWNG 4PGZA 3EJSA 3KLQA 1T5WB 2VXQA 3TO4B 2B8OT 2EDLA 2N4IA 3QFJA 3KPNB 3GRWA 4PBDA 2PYEA 2GIXA 3T3ME 3MUHL 2JV6A 2X0UA 1CBJA 1T1YA 5J6SA 2H2SC 4R97C 4LCUB 1MHEA 2Q5BA 4NZUH 4X7DC 4MQ7A 5EWIH 5FAAA 1A7RL 4JQXA 2AQ3A 4MASA 4WDIB 3UBXB 2BSED 2IBZY 3VRLF 3G08B 3G9AB 3O6FA 4XMVA 3WHE1 5I1HH 1FYTA 1GZPB 1PZ3A 1UACL 3WD5L 1CPUA 5GRUL 1ZS8A 2BIIA 4JM4H 4JRYA 3S0PA 4RIRA 3VE0B 3MRFA 2BCKB 2BPBA 2VDNL 4BDVA 1LM8V 3EKCA 1Y0LB 4HUUB 1KB9K 1JPSH 4OR1A 1EZSA 2DIEA 1BAFL 4IRJC 3RL1A 1AZUA 4JN2A 3ZTEA 3OSKA 2XLLA 1A1MB 1TVDA 3OVUB 4NBXB 4MD5B 3W2DL 4JDTH 2JLPA 3K8MA 3COOA 4G6AC 1Q1PA 1I9JH 3MLZL 1AVAA 1SXSA 4QO1B 1IQWH 3T0EC 2O1AA 2AK4D 4ONGH 2OMYB 3MCYA 3JWOL 4S2SB 2EDXA 5CS7A 2ED7A 3B6SA 4IQHA 2I26N 4M5YH 5HHOA 4JJHA 5LAPA 3NA9H 1S7RB 1RUPH 4Q89A 2ILLA 3PG2A 4J3XA 3K1DA 1KFAL 1U8MA 1SFDA 3W9DB 4F37F 3RX5A 1A3ZA 3RY6C 5CMAB 4EQ3A 1N19A 1NCDL 3NGBC 3R8QA 3ULUH 3QZWA 5FM5O 3PABA 1M56B 2H1LM 4K71B 1CGWA 3SE4A 2DYSB 2OQJA 3JTBA 3QUXD 1AGEB 4P48A 4WHTB 5EU4A 5C08A 1YECL 1BLNB 1JHTB 4BYHA 4C4BA 3L1EA 1KJ2L 5DRWA 4L3EA 4MGXA 2OKMA 3B9KA 3OKLA 4P4KA 3RY4A 4UTBA 5SWQB 1DBAL 3SPCA 2YAMA 2C8NA 3WDJA 1IBZA 1OE2A 2JQZA 4X8JB 2HKFH 1LK3L 2IDQA 2B1AL 3FTYA 4R4FL 3DX0A 2K9FB 3QH3A 1NA8A 3MREA 5I76B 1RZ8B 2D03H 3CCHB 3KWXA 3MLWL 4NRYA 1GZPA 4RMBA 4YPJA 3U9PL 5DVOA 4X7SL 2APWA 1W91A 3EJUA 1JGEA 3VXRA 5LGYA 1A1NA 2BM3A 2VDKH 3SQOL