4B99A

Crystal structure of mapk7 (erk5) with inhibitor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
347
structure length
335
Chain Sequence
VTFDVGDEYEIIETIGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDILRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIHRDLKPSNLLVNENCELKIGDFGMARGLQYFMTEYVATRWYRAPELMLSLHEYTQAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQRVRAYIQSLPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCAPPFDFAFDREALTRERIKEAIVAEIEDFHARRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Crystal Structure of Erk5 (Mapk7) in Complex with a Specific Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 7
total genus 100
structure length 335
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4b99A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4b99A01
2XK6A 5L6OA 5JFVA 5A3XA 3LQ8A 4FEWA 3KL8A 2JAMA 4GT3A 4ZMFA 3OOGA 2C47A 1JAMA 3ACKA 5IKWA 2XKDA 3HLLA 3ZZWA 4XUFA 3VIDA 1CDKA 2CKEA 3RPOA 1G8AA 2FVDA 1ZZLA 4HVDA 3NYNA 3RNIA 4Y8DA 4CLJA 2W1EA 2PULA 4G6NA 2I0HA 4RT7A 4WIHA 1SNUA 4RIWA 2C6OA 2JITA 5FG8A 2YLEA 4BGQA 4C3FA 4LL5A 5HTIA 3VWAA 5HLPA 2WB8A 3QX2A 3W2OA 3FMDA 5AR7A 4U3ZA 4ANSA 2ITUA 3V51A 3A7FA 1PMNA 3TIZA 5AAFA 4FYOA 4ALVA 4MQ2A 4BTJA 1PY5A 2WQEA 4M3QA 3C50A 4EHEA 4ENYA 3R6XA 3R7GA 3B8RA 2YM8A 3DZOA 3NUAA 3SGCA 2UV2A 4AA0A 1F0QA 3TL8A 1UU8A 4ZP5A 5AV0A 2J0KA 2W06A 3GCSA 3EL7A 1YVJA 4A4LA 4BHZA 4ZOGA 4JT3A 4RRVA 2R3PA 4XBRA 3R8UA 5LMKA 3LFEA 2EVAA 3BEGA 3LFDA 5HGIA 1CM8A 3VUGA 3FZRA 1LEWA 4YJVA 2CGWA 5HVYA 3U9NA 3AGLA 4ACHA 4FKGA 2XJ0A 4RC4A 3GUBA 4MNEB 4WNPA 3F9NA 3L8SA 4IZ5A 1UWHA 3TUBA 4NTSA 1GOLA 1W83A 1R1WA 4D2TA 1AQ1A 5C26A 5HX8A 4BDJA 5BVDA 3FPMA 3WIGA 2X0GA 3ORKA 4NKAA 5CVHA 3OTVA 4APCA 4MF1A 1H1RA 2G01A 1WFCA 2R3RA 4F9AA 1OL7A 5BMMA 4GVJA 1APME 3K3IA 4FICA 4ERWA 4EUTA 3MFUA 4TKSA 5ITAA 2QKWB 4TWCA 5HO6A 5T6KA 5HHWA 4QMYA 3UVPA 4XX9A 1K9AA 2ZMDA 3RM7A 1Q62A 2QOFA 4EOLA 3SLSA 2QHNA 5FEEA 5CEKA 4U79A 4OTGA 5AUYA 5JRSA 4HPUE 1ZRZA 4MVFA 1O6LA 4BIBA 4QMXA 4DTKA 2X4ZA 3P0MA 4QP9A 1CKIA 5LVLA 2YZAA 3SXSA 3DJ6A 3U54A 1M2RA 3Q52A 4IMYA 4FV0A 4OT6A 3TNWA 4O96A 3SRVA 3PG3A 2PUUA 3MA6A 2IW8A 2BRBA 5JKGA 1OPJA 3VJOA 2GPHA 5L3AA 2PVLA 4XG7A 5F20A 3M42A 4C2WA 3DQWA 3EN6A 4FNXA 4NJDA 4EL9A 4EWHA 3RM6A 3NIEA 3EH9A 4M12A 2O3PA 5HBHA 4D0WA 4G31A 3FXWA 3WYXA 3SG8A 2R3JA 3FWQA 2HELA 2BFYA 4Z55A 2X2LA 3H9RA 2B9HA 5CI7A 3OCTA 4N0SA 3EQFA 3LXPA 3BU5A 2IVTA 1FGKA 4FTAA 4P90A 3OUNB 4HGLA 2OLCA 3KRXA 5D10A 2JEDA 2ZV8A 1JKTA 1DM2A 4YSJA 3BZ3A 2BRHA 4KKHA 4KAOA 3ID6C 2WU6A 1B38A 4IZ7A 3U55A 3QXOA 1Q8WA 2YERA 4LG4A 4AZTA 3ZFXA 5AV4A 1H00A 3FI2A 3SXFA 3MPAA 3NLBA 4Z7GA 2YCSA 4L67A 3I0OA 4A7CA 4UWCA 4XG2A 2ZM3A 3ZCLA 2Y4IB 3PY3A 3QTWA 5A4EA 3HMPA 2GS2A 2XS0A 1UU7A 2WD1A 3NIZA 3DS6A 4G16A 1KE6A 2W4JA 3WOWA 4WO5A 3UMWA 4ASDA 4KSQA 4D55A 3NMUF 2OIQA 3KXNA 3W2PA 4FTNA 4JLCA 5K5XA 3MV5A 4HGEA 5ANJA 5HICA 1YW2A 3QKLA 4BL1A 4ZLYA 1DAWA 5EYMA 4E6QA 3F5PA 2XK7A 3VO3A 4PDOA 4UMUA 3DPKA 4UMPA 3R30A 3FMHA 5D7AA 2VGOA 2AUHA 4FTLA 4V0GB 5EOLA 5ANOA 4YLKA 3R8ZA 2A1AB 1RJBA 1RE8A 2Z7QA 4U0IA 2VTJA 3VBTA 4IC7A 3CE3A 2CNVA 1K2PA 2XK8A 4D2WA 3P1AA 3U6JA 3V5PA 1ZY5A 4BFMA 2ERKA 4IH8A 5AUWA 3R9HA 1BL6A 2HW6A 5J87A 2FGIA 3G15A 4GV1A 2OZAB 4KINA 4AGWA 3OCSA 2J2IB 3PXZA 3FZSA 4PF4A 5EDQA 3FXZA 4NM7A 4WUNA 4QYHA 1K3AA 4BCPA 4KD1A 2UZLA 3ZM9A 4IWDA 3F2AA 3E63A 2I0VA 4FTIA 4YU2A 5KZ0A 5FXRA 4BTMA 3O23A 4DINA 4FG7A 4XBUA 3BELA 2XK4A 3QKKA 2GQGA 4OBOA 3NDMA 5IDNA 4R7IA 2XIRA 3MDYA 2Y6MA 3BE2A 4ITIA 3ALOA 5LCJA 4I0SA 3IOPA 4DHFA 5A4QA 1Z9XA 4NFNA 4C3RA 3F3WA 2R3HA 2EUFB 3U4UA 4IX4A 1P14A 3QHRA 4QQJA 1XKKA 2I40A 4RWKA 1OITA 3HMIA 2ZM1A 2C68A 3V6RA 3CY3A 1BX6A 1OGUA 2FB8A 1YXVA 2PE2A 3BV3A 2H96A 1ZXEA 5CANA 1ZYCA 4M97A 4EUUA 2C6KA 1UA2A 4C35A 4V05A 4A07A 1H27A 2PY3A 3GENA 4FODA 4S31A 4LV8A 5J1VA 3UPZA 4FTRA 1XH4A 3S1HA 5EKNA 5KMIA 4AE6A 5FXSA 2R7IA 2VO0A 4BTFA 5JGBA 3WZDA 4EYMA 5E7RA 2JKQA 2XJ1A 3DNDA 4OBQA 5EQPA 5DT4A 4KWPA 4CFWA 4ORKA 4NUSA 5I9XA 1OMWA 4IVCA 3ZUVA 4FKIA 4M14A 1ZLTA 3QCXA 3G6HA 3T9TA 5BUEA 4QMLA 1SNXA 3FY0A 4DH3A 3HP5A 4ZTRA 3SXRA 1KWPA 4XLIA 3FE3A 5C8NA 2W1ZA 4X3FC 2FH9A 5IZFA 4JRNA 4JXFA 3LFAA 4FIGA 4IX3A 3I5NA 1WVXA 3FXXA 4JG7A 3RAWA 4AZWA 4O0VA 4BF2A 4OTRA 4YBKA 4E8AA 1J1BA 2ETRA 1I44A 4FA2A 4QQCA 5L4QA 4MAOA 2X8DA 1KSWA 2YM6A 3FV8A 3POZA 2VTOA 4YNEA 4TXCA 2QG5A 2VO3A 4G5JA 4CCUA 4UZDA 3NVMB 4YJPA 2XIYA 2PZYA 3TN8A 5IA3A 3ORLA 4RVKA 4FL3A 3UZTA 4C4JA 3OP5A 4J99A 4AT3A 2Z2WA 4DC2A 3VS3A 5KNJA 3F69A 3JXWA 4P7EA 3A7HA 3EQPA 4X2KA 5I3OA 4BKZA 2EXEA 4USDA 2WELA 2G2HA 4PTGA 1OM1A 3PJ2A 4FKRA 4L3JA 4WD5A 4RWLA 3BBTB 2YACA 3QTRA 4RPVA 4WRSA 3RCJA 2X7FA 3V5JA 2C1AA 4C4FA 4DLJA 4JBQA 3I81A 4B9DA 2CPKE 4YHFA 5LVPA 4I6FA 5KMOA 5CF4A 3IPHA 4AZFA 2X81A 3NS9A 3PRFA 4QMVA 3HL7A 4I5HA 4ZTMA 3EKKA 4FTOA 4FZ6A 2VWBA 2O0UA 2W17A 4DTAA 4AAAA 4NKSA 1IEPA 1J91A 5HLNA 3NW5A 4EI4A 5CYIA 5H2UA 5IUIA 4X2NA 3ATSA 1JSUA 3ZXZA 3WF9A 4QYFA 4BTKA 3CJFA 4EK3A 2XYNA 4L01A 2XEYA 4RC3A 3WARA 3ZC6A 3PE2A 1Y6AA 2HCKA 3P7AA 4JBPA 3R7UA 4AW1A 1UNGA 3KRRA 2BZIB 4UMTA 4KBCA 4AA5A 3O50A 3ZONA 4L46A 4AN9A 3CXWA 4CRSA 5TT7A 1OBDA 1ZOEA 2PE1A 2J50A 3KB7A 4XV1A 3ZU7A 1Y57A 4O7SA 4BVUA 4BGGA 4YSMA 3MB6A 3MB7A 4MWIA 3KU2A 1IAJA 5BUJA 1KV1A 4ZLOA 3OUKA 5ETCA 5CEQA 2BTSA 4RSSA 3GFWA 2V7AA 3FZOA 4TW9A 3FQEA 3OW4A 4YJSA 5D41A 4C58A 4AT4A 3DXQA 4JQ7A 5T3QA 4MBLA 1UWJA 3VBWA 3V3VA 5IH5A 2P3GX 4FSYA 2UW7A 4AU8A 2Z60A 1MRYA 2VUWA 3NRMA 4BDKA 3PZEA 2X2KA 4C2VA 2OJJA 4O0XA 1OL1A 3FL4A 4DGGA 2BHHA 4DFLA 5JGAA 3LMHA 3TDVA 3F88A 3VBYA 4WNMA 2VWZA 2C5XA 4RIYB 4MF0A 4NM0A 3RCDA 4YZDA 5DBXA 2ITZA 4ZXTA 4N57A 2O5KA 3FMNA 2ITQA 2X6EA 4O82A 3TUDA 3DLSA 4KIQA 4U42A 3I79A 1IASA 2GNIA 2RFSA 5LVMA 4JR3A 3R22A 4ITHA 5A4LA 4JX7A 3JYAA 4PP9A 3A4PA 3KN6A 3LAUA 2W1IA 3R21A 3G33A 1S9JA 5ACBC 3UIBA 3V8TA 3VUTA 5DYJA 2VZ6A 1Q4LA 4P5ZA 4QO9A 4TYGA 4DG0E 1OUYA 1VYZA 4FK6A 5JFSA 3BYUA 3RAKA 2XNGA 4WNKA 3UQFA 2IVVA 4TWOA 2R3GA 3QUDA 4MEDA 2W5BA 4YJRA 3GCQA 3D15A 4LRMA 4EK5A 1AGWA 5J7BA 3NUSA 3RVGA 3KF4A 2A4LA 4Y83A 2UZVA 2FSOX 2P0CA 3HDNA 3THBA 4O27B 4F0IA 4H1MA 3ZLYA 5E92A 2XNBA 4D4YA 3S3IA 5FP5A 4O22A 2ZV9A 3L8PA 4RZVA 5L2TA 5HLWA 4J8MA 4Z3VA 4DT9A 1PF8A 4D5HA 3RWPA 3OOMA 1H08A 4HGSA 4CFFA 4R3CA 2YWVA 4FTQA 3N9XA 3Q5ZA 3WF8A 3G90X 3E87A 4RG0A 3IDPA 2VTIA 3HMNA 4PMTA 5CY3A 3TZ8A 2C6DA 3HMMA 4FSTA 2FYSA 4FT7A 3PJ3A 3C7QA 2OXYA 3ODYX 1NVSA 2W96B 2YN8A 3HAVA 4W4VA 3D14A 3OWJA 4IW0A 3R9OA 4E4NA 4FEXA 4N4SA 3BU6A 3OT8A 4IIRA 3PXFA 4HCVA 4RFMA 4CKIA 1FVRA 1YOJA 1SVGA 3OD6X 4X2JA 4ZY5A 5CALA 4EKLA 5H9BA 2BKKA 2WOTA 3FKOA 3P7BA 4DG2E 4I24A 4QMZA 3H10A 2YM3A 2JIIA 3KKVA 5FM2A 3FJQE 1GZKA 2I7QA 2C3LA 5K4IA 3KMUA 4AGCA 3FMMA 4ITJA 2PVFA 4BBMA 2WGJA 1OIUA 2R7BA 4WG4A 4O7NA 2XIXA 2OXXA 2JIVA 2GHLA 4FKVA 3H3CA 4ZLZA 4Y5QA 4MKCA 5HESA 5CQUA 2QHMA 3GU4A 3MN3A 4WRGA 3MVLA 3FDNA 2YM7A 3Q4ZA 4QYGA 2J0LA 2OO8X 1ZMUA 4EYJA 3QD2B 4JIKA 3CTQA 2R3QA 5IQDA 3EFJA 2IW9A 4MXAA 5BUIA 5M06A 3ZH8A 5AR4A 5LWNA 3DV3A 2Y4PA 4R3PA 3MI9A 2X9FA 2CCIA 3PUPA 3ORNA 2ETKA 4RLKA 4C7TA 4EORA 2Z02A 4KABA 4DT8A 3CKWA 3GP0A 3O0GA 4XHKB 5HOAA 4PDYA 4YUQA 3KXZA 4LRKA 2OK1A 3ZS5A 2B7AA 5BVKA 5HNGA 5ANIA 2CCHA 2DQ7X 4AX8A 3LFBA 3O7LD 3COIA 3BGQA 4O0UA 5FRIA 3TTIA 3GT8A 2QG7A 4FL1A 1XBCA 2WEIA 1E9HA 3NW6A 4DFBA 4D1SA 2UVYA 2BAKA 4I94A 4FTUA 4Y46A 3Q60A 2JKMA 3LCOA 3PXRA 2VV9A 4DCAA 2VTSA 4E3CA 4H3PA 4IE9A 4NM5A 3DT1A 5K9IA 5E1EA 5IQCA 3AXWA 2XBJA 2YHVA 4F6WA 4CGAA 3PIXA 3IO7A 3QC9A 4FZFB 2ZMCA 3RALA 3QC4A 4DH8A 3OWPA 4AOIA 1BKXA 2EXCX 1NY3A 3RPRA 3OG7A 4BIDA 3GC8A 5H3QA 2Z8CA 4PWNA 5AM7A 3R7EA 4GSBA 3VUIA 4BDGA 3TKUA 3R8PA 2WTKC 4MCVA 1B6CB 2C6MA 3MJ1A 2XM9A 3HV5A 3R1QA 4YHJA 5LOHA 3EQCA 3QCQA 4MBJA 1XHAA 1URWA 4QNYA 5ANEA 4R6VA 5EKOA 3DDPA 2F7EE 2GS6A 5CEIA 5I9ZA 4E7WA 3A8XA 2OZOA 4U97A 5C4LA 5HBEA 4KS8A 4DA5A 2CN8A 3R04A 4FC0A 1Z5MA 2R3KA 5DWRA 2UZDA 4C34A 3HZTA 4Z7HA 5E90A 1BL7A 2BAJA 4C62A 1GZNA 3LXKA 4CKRA 3MH3A 5EOBA 3W2QA 4J95A 4XYFA 4KIKA 4QTEA 2R64A 3LM5A 1V0PA 2C0TA 4FMQA 4LUDA 4O84A 3JPVA 3CIKA 3PZHA 4FG9A 4WSYA 1YWRA 2RL5A 2WMTA 3G6GA 2ITWA 1LPUA 3I6WA 5E8UA 3ELJA 4MTAA 3LCKA 1ZYSA 3F2RA 2QURA 2OFVA 2PZ5A 3DK7A 5FTQA 2DYLA 5EHYA 1PJKA 4I21A 4J7BA 4TRLA 2PL0A 5HE0A 4ANMA 1ZYLA 1V1KA 3TZ9A 4F1MA 4RA4A 3QFVA 1F3MC 4RJ6A 3R1YA 4LL0A 2OIDA 4YBJA 4JI9A 1W98A 4RJ5A 2GQRA 2WIPA 4BCJA 5BQ0A 3LHJA 5HCXA 4EKKA 5I5ZA 3FQSA 5DR9A 2BROA 5E9EA 1PMVA 4PY1A 2YIRA 4DGOA 2QOIA 4FVQA 2QKRA 1SVHA 2IZTA 4EH2A 3LLTA 2WNTA 1WVYA 1ZMWA 1ERKA 2RG5A 3UGCA 4FE2A 4X7QA 4L45A 3ANRA 2PMLX 3UQGA 5M07A 2X2MA 1FQ1B 5HE3A 2BALA 3CCNA 3EFKA 5EYCA 5M08A 4I6BA 3QWJA 1P5EA 2ITYA 4JVGA 3I0QA 4FT0A 4FX3A 2CLQA 3FMEA 4BN1A 4FIJA 1YOMA 3UOHA 4AWIA 2X7GA 1Q8YA 3EQRA 3EYGA 5TOZA 4R3RA 1W0XC 3AD5A 4EOSA 4HW7A 4TWPA 3PA3A 4G9CA 2VN9A 5CF8A 4BHNA 1R0EA 2WKMA 3HP2A 5IQHA 5A46A 3QRJA 1JLUE 5DFPA 4EC9A 4FTTA 3P78A 5FBOA 3GU6A 4O91A 3GQLA 3R1SA 3SAYA 5DN3A 2HZ4A 5IMEA 1OL6A 1ZAOA 2G1TA 2OXDA 2R2PA 2WMUA 2UW9A 3O96A 4IWQA 4ACCA 4A9TA 2XNMA 3GQIA 4FIEA 4R8QA 2YAAA 4M66A 3R9DA 2P2HA 2C6IA 5IEVA 2W9ZB 5AA8A 4TYJA 4M0YA 4PMPA 4M0ZA 3LW0A 3GB2A 5J5TA 3AT2A 2JDSA 2ZJWA 4HOKA 2QCSA 3A7IA 1Q8ZA 4LYNA 4NIFB 5FUTA 3NCGA 4F9YA 3D5XA 1B39A 1M14A 3AC3A 4KIKB 3Q4CA 4FV8A 5E8WA 1WZYA 3LMGA 4GFGA 3GNIB 5FEDA 4FKPA 3WZKA 4KUJA 3GXLA 5AV1A 2XKEA 2KTYA 3RI1A 2UZOA 4YZCA 2OWBA 1H1WA 1O6KA 2X6DA 4GJ3A 4EHGA 5A14A 3D7TB 3FYJX 3UO5A 2JDOA 3UZRA 2VO6A 4C59A 2VX1A 2XIZA 4AW5A 4YMJA 2YEXA 4MXCA 2PUIA 2OJ9A 1UKHA 4G17A 3F7WA 4OW8A 4FKOA 3TCPA 2J0JA 1KE8A 4M69B 4AACA 5KHXA 4QT1A 3R8MA 3ZFYA 3EOCA 3COKA 4AE9A 4E5WA 4EWQA 3BHUA 3WIKA 4O21A 4UEUA 4QP1A 2EWAA 2QO7A 4PMSA 4B99A 4YJUA 5HE2A 4MBIA 5CSWA 4FKJA 4NFMA 4TNBA 3T3UA 4XH6A 5M56A 4OGRA 4FUXA 4UXLA 4QQTA 4PDSA 3Q4TA 3U87A 5AR8A 3ZRMA 4QMWA 2BIKB 4RFYA 4GKHA 1KV2A 2BRMA 4W8DA 2WZJA 1DI9A 2JAVA 3ZOSA 5JMSA 5LMBA 3HA6A 3PWYA 4GH2A 3R7VA 2O8YA 2UW5A 3ZLXA 3MVHA 3MY1A 3U51A 3KXXA 4QMOA 3LQ5A 3IW4A 3LFFA 4DFXE 1STCE 2P55A 3KK8A 1YWVA 5AP6A 4AGDA 4RIXB 4F08A 4BY9E 3DA6A 4BI0A 2X9EA 3IGGA 4M84A 3NAXA 3RINA 4NJ3A 3BBWA 4LRJA 4YTHA 3UO4A 2WU7A 4YC6A 3ZRLA 4O7TA 4FGRA 3RK9A 4L8MA 3ZEWA 2BR1A 2UZTA 2ITXA 4IFCA 4MNEA 5AAGA 2B9IA 3MSSA 2J9MA 3QU0A 4AW2A 4I4FA 5IA0A 1JVPP 5KMKA 3ZM4A 5FLFA 4AP7A 5IISA 4JIAA 1H1SA 2HIWA 3VBXA 2BDJA 4M8TA 3DKGA 1VJYA 2B9JA 3Q4UA 4HJOA 4EH7A 4ZJVA 3KREA 2UVXA 2OJIA 4I5PA 3NYOA 1ZYDA 1YDRE 2WQNA 4L68A 4LM5A 2QI8A 1W8CA 4E1ZA 5GZAA 4BRXA 3GFEA 3OY3A 3Q04A 5IH6A 2WTWA 3HRFA 4X6QC 4I0RA 4QP7A 4QTDA 2W4KA 3QRTA 3ZFMA 4W4YA 3SV0A 1FPUA 3MS9A 4O7WA 5IQGA 3P5KA 4F7LA 2F7XE 3D5WA 3VVHA 4CXAA 4O0WA 3W33A 3NYVA 4I1ZA 3MFTA 3HAMA 2XB7A 1J1CA 3FI4A 2B55A 1IAHA 4PV0A 3NZ0A 3UO6A 1YI3A 5DRBA 3KMWA 3OCGA 4KB8A 1OVEA 4X0MA 5EH0A 3EQHA 4I93A 5CVFA 1TKIA 4HZSA 5KMMA 3TTJA 4XS2A 2YDIA 2X1NA 3UNJA 1PXOA 4UX9A 4EJNA 1XWSA 4O0YA 3IW5A 3QTZA 1H24A 4F4PA 4LGGA 1OECA 3EB0A 4IADA 4YZNA 3IK3A 3LFNA 2YM5A 1VEBA 1OIRA 3EKNA 3R8LA 3F3ZA 3HRCA 1NW1A 3G0EA 1H28A 5JRQA 5DA3A 4FKTA 3E88A 4HNIA 3OW3A 1JOWB 1Y6BA 3QAME 4DBXA 3UE4A 5A6NA 5I9WA 3H30A 3C4CA 3QTUA 3KC3A 4KA3A 4JDJA 2ZOQA 3VS5A 3UDBA 5L8JA 4Y73A 5EQYA 2YIYA 4ZMEA 4U43A 3MVMA 4L7SA 4AOTA 4CEGA 2G9XA 4EOQA 1GNGA 4BI2A 1FMKA 3PSBA 4XG6A 1SVEA 2C0IA 3VNTA 5GZ8A 2ZV7A 4KIOA 4BDAA 3BQRA 5EYDA 4JX3A 2WMAA 4IDVA 2XVDA 5IQIA 1W82A 2JBOA 3IONA 1A9UA 4F65A 4L7FA 1NT2A 4RJ3A 3IDCA 4A9SA 1OKWA 3BX5A 2GSFA 2DS1A 4UY9A 5EM8A 3QA0A 4I5MA 1T45A 2WEVA 4IBMA 4E5AX 3SDJA 1T46A 3R00A 4F9WA 5CVGA 2GS7A 5IG1A 4YJOA 3AT3A 3O8PA 3NYXA 2CGXA 4F64A 3HV4A 3TIYA 4XCUA 3IW6A 3LZBA 4MX9A 4PTCA 2XF0A 5DEYA 5ICPA 4CG8A 3EQBA 3UYTA 3SW7A 3RJCA 4I41A 4IAFA 2O2UA 2W1CA 3L8XA 4E4MA 2H9VA 5L2QA 5HE1A 3FZTA 3MYGA 3DBEA 3B2TA 5HTCA 2QOKA 2RFEA 2W1FA 3C4WA 4QNAA 4D1XA 4L3LA 3RK5A 2QNJA 4FI1A 3E3PA 1H01A 3TG1A 3TXOA 4NU1A 3ZHPC 5JEBA 1YHWA 5FGKA 3RHKA 3TNQB 4ZIMA 4FIIA 1MRVA 5DLSA 3ORIA 3ZUTA 2VTRA 3BI6A 3MH1A 3OC1A 4V0GA 4YGAA 3MVJA 4RX5A 4QQ5A 3B2WA 4F09A 1IRKA 4A4XA 2SRCA 4B6LA 4C4HA 4CZTA 2OBJA 4DE4A 4IFGA 4CTCA 4GMYA 4LMNA 2BZJA 2BUJA 4DEEA 3F5UA 2CNQA 3TKIA 4QD6A 5EI2A 3SC1A 1GAGA 1SM2A 3DDQA 3GI3A 4QTAA 4X6RA 2OJFE 4TTHB 1U46A 4G3DA 2F49A 3E8DA 5LMAA 3V5QA 1V0BA 2VWVA 5B2KA 4E6DA 4YZMA 3BRBA 3LFSA 3LFQA 4U8ZA 3W2CA 3G9NA 2R9SA 4BCMA 3MTFA 4OUCA 3BYOA 1VR2A 3ALNA 2XK9A 2CHLA 2WTCA 1M7NA 4ZTLA 5CAQA 4NSTA 4B8LA 4BDHA 5A6OA 1A48A 4ANBA 1JPAA 4OLIA 1WBOA 1Q8UA 5K0XA 3BHHA 2WFYA 3A8WA 4XP3A 4HYIA 2W1HA 5CNOA 3VQUA 4BZNA 4EK6A 2VTTA 5H8EA 1G5SA 4ACMA 5DMZA 1OUKA 3HNGA 3R01A 3P7CA 4EH5A 2IG7A 3IDBA 5CSHA 4DEBA 2XCHA 3L9NA 3WZJA 4M67A 3DJ5A 1TQPA 3EYHA 5E8ZA 4U3YA 3GC9A 4FOCA 4B8MA 1VZOA 5EYKA 4O7YA 3LJ1A 5I3RA 2F57A 2JKKA 3GGFA 3QQGA 1G8SA 1UVRA 3VHEA 5HQ0A 3N4UA 5AR5A 4CNHA 4YPSA 4BCFA 5HCZA 4FVRA 1YDTE 3QQUA 3QYWA 4YR8A 3TV6A 5B2MA 4EH6A 5FXQA 5TO8A 4OAVB 4IVDA 4YURA 5K4JA 1PYEA 4D4VA 4FK3A 1IA9A 3Q6UA 4EHZA 2C6TA 4U6RA 3A7JA 4MWHA 2X39A 2OSCA 2BRNA 4R7BA 1PXJA 4QMTA 3EN7A 3PJ1A 3FBVA 3R28A 5HVKA 4NL0A 4YNOA 1A06A 3U4WA 4I92A 4X3JA 3KCFA 4I3ZA 4N70A 1JNKA 3OWKA 4H58A 1M17A 2B1PA 2HZNA 4DH1A 1ZWSA 1EH4A 1PXIA 4CFMA 2ITNA 1Q61A 4QYEA 1QPJA 1OKVA 3IOKA 1BMKA 1Q5KA 2ZM4A 3MTLA 4ENXA 3R0TA 3NNXA 4NW6A 2X8IA 5C03A 4O7VA 4ACGA 2WTVA 3EQDA 4FT9A 4JAIA 4A4OA 2GCDA 3CQEA 4O7LA 1O6YA 2V5QA 3QZIA 1CMKE 4F9CA 5FTOA 3QLGA 4NTTA 5DIAA 5KZIA 2R4BA 5DRDA 3PVGA 4IB5A 3KF7A 4E4XA 4AXAA 3PXYA 4RJ8A 3DQXA 4O1OA 3WE8A 5HO7A 3ATTA 4IZYA 3I4BA 4UWYA 2LGCA 3DB8A 3ORZA 4M7IA 5CENA 2JDVA 3KVXA 3NNWA 4XRLA 3WZUA 5HU9A 4EH3A 2A0CX 4MH7A 4C3PA 4XP0A 1FBNA 3A99A 3VS7A 5C27A 3ZUUA 5AA9A 3NVKI 1Y8GA 3R63A 5IEYA 4NZWB 5CF5A 2VWWA 2IO6A 3BYMA 3BV2A 4MD8E 3CBLA 3U9CA 2XCKA 3ZBXA 4GL9A 4JRVA 4BGHA 5HX6A 2BCJA 4EBVA 3LOKA 3QGYA 5HNBA 4RFZA 2HYYA 4PQNA 5TKDA 4FKSA 3TNHA 4NEUA 4IM0A 1XR1A 3ZDUA 2F4JA 3PY1A 4ANNA 3PE1A 3C1XA 2JDTA 5CI6A 2UZNA 5HVJA 4X3FA 5FP6A 2VTNA 4TYIA 3HEGA 3M2WA 3QHWA 4NK9A 3DAJA 3K3JA 4L53A 2BDWA 2VTLA 4EQMA 3IGOA 5AP7A 4D4SA 3IW8A 4WBBB 4CSVA 4FV5A 5AUZA 4RWIA 2NP8A 4MK0A 4IAKA 4FV3A 4O0TA 5HIEA 1VYWA 3Q9ZA 5CU0A 3OBGA 5HORA 5JH6A 4IWOA 1KOAA 3ENHA 3UOKA 4H05A 2CMWA 3FYKX 3OS3A 3I1AA 3LE6A 2QU5A 5E1SA 5FTGA 4FNZA 5CZHA 1ZYJA 3GOPA 4ACDA 4YC8A 5HTBA 3R7IA 5EK7A 2Q0BA 3S95A 2WTDA 1FVTA 1RW8A 3V5LA 4A9RA 5M4CA 3KVWA 3C5IA 2XA4A 4EC8A 4EOMA 1M2PA 2CKOA 1XH6A 3VW8A 3SW4A 3LJ0A 4OTDA 1W84A 2OJGA 1PXPA 3UP7A 4ARKA 2XNPA 4NT4A 2GNHA 5FD2A 1KE5A 2VRXA 3AC2A 3U6IA 5DHJA 2YDKA 4ZTSA 5IQFA 3FI8A 4DH5A 4LOOA 3ORPA 2YAKA 2EXMA 3OHTA 4X2GA 4D2SA 3E5AA 4IQ6A 1JKSA 3HECA 4J71A 5EQEA 3COHA 3D94A 5AUTA 3R71A 5EM7A 2OF4A 4AA4A 5IPJA 3GEQA 3FY2A 5CEOA 3PY0A 1MQBA 3ODZX 4U41A 5CQWA 5AV2A 2OH0E 5KUPA 5AUVA 2HWPA 2O64A 4ANQA 3V5WA 2W1GA 3CY2A 1BI7A 3LCSA 2IPXA 1YXUA 4UYAA 3OXZA 5IA2A 3D2IA 4YC3A 3V01A 4BBFA 4QOXA 4BWPA 2F7ZE 4ZSJA 2C69A 2WMQA 4OR5A 3BLQA 3QRKA 4FSRA 4S32A 4FYNA 4C33A 5JQ5A 3ZRKA 3A62A 4LGDA 5IQEA 3JY9A 4U5JA 5CWZA 4NW5A 4R5YA 2CNUA 2HOGA 3QF9A 2R3OA 1OL5A 4G34A 3EHAA 3UP2A 3Q53A 4QP2A 3WILA 3ZMMA 1TVOA 1Q41A 3VS4A 1U59A 1U54A 4BCHA 5IQAA 3BKBA 3LCTA 3EN9A 3PPZA 1QCFA 1OIQA 5D1JA 5KCVA 1UU9A 5BMSA 5AP5A 1KOBA 1H07A 2IZUA 2AC3A 4L9IA 3ZC5A 1XH8A 3D5VA 5KE0A 3MA3A 3QWKA 2ITVA 4NCTA 3PG1A 5HIBA 3QTQA 3C4FA 1DS5A 3F5XA 3D7TA 1P4FA 4KBAA 4C61A 3FQHA 4YPDA 4JDHA 3E93A 4GW8A 4I23A 4IANA 1F5QA 4QP3A 2WTJA 2Y7JA 2EU9A 2QD9A 3Q2MA 1WMKA 2BZKB 1ATPE 3GC0A 3RAIA 3V6SA 4ERKA 2YABA 4OTPA 5I4NA 3PPJA 3TEIA 4AN3A 4A06A 5AEPA 1MQ4A 2B53A 3CPCA 2BIYA 4EZ7A 3AC8A 5L8LA 2YJSA 3BHTA 3CQWA 4J53A 2W5HA 3NNUA 4ZSGA 4DEIA 4IWPA 5M55A 1W7HA 4GK3A 4HYUA 5BVWA 5CAPA 4IAZA 3ULZA 5FM3A 4CFNA 4JOAA 4QRCA 5TR6A 2GNLA 1KE9A 3CD3A 5F4NA 3DBQA 4QTCA 3SVVA 4FZAB 3E64A 2E9UA 3I5ZA 3NSZA 1U5QA 4H36A 4BDDA 1PRYA 2W7XA 1PHKA 3GOKA 3PA4A 4O6LA 5CX9A 1SMHA 2W05A 1GIIA 4LMUA 4EH9A 3EMGA 5C8KA 3K54A 4FNYA 4W9XA 5EG3A 3EN4A 3RPSA 5CU4A 3TV4A 3CPBA 1R3CA 3O71A 2CGUA 4K6ZA 4GFOA 3OXTA 3OBJA 4G3CA 5KMJA 3HX4A 3C4EA 1JBPE 1PW2A 2G15A 5TE0A 3MH0A 4EK8A 5JQ8A 4DFNA 4RBLA 3COMA 5GIPE 3ZLSA 3IECA 2XM8A 1O9UA 5J9YA 3HUBA 4GT5A 3HDMA 3A4OX 3KK9A 2VTAA 3SOCA 3VC4A 3ZYAA 4ZSLA 5F95A 4JDKA 3P9JA 3ITZA 2Q83A 4QMUA 4OT5A 5L8KA 4KRCA 4OTIA 1YI4A 1PMUA 2BPMA 4TT7A 2PTKA 3QTXA 3NEWA 5E8YA 2GHGA 3QTSA 4I22A 2ESMA 3PWDA 4BI1A 2IZSA 4S33A 4R1YA 5M53A 4HNFA 3O7LB 3CLYA 3EZRA 5BX0A 2C5OA 4IM2A 5LWMA 5AV3A 1WBPA 3FC1X 5T68A 4BYIA 2ZVAA 5IUHA 3C0IA 4FKQA 4JBVA 4FNWA 2QOBA 4PUZA 1YHVA 2BRGA 3QUPA 3KGAA 5H8BA 3ANQA 2CSNA 5JGDA 2QR7A 2I6LA 4PPCA 4F0FA 4MXYA 3CSVA 4PL4A 4U7ZA 5D12A 3JVRA 5IA5A 2YJRA 2P4IA 3C13A 3FSFA 4D2VA 4C02A 4IX6A 2YDJA 3LVPA 5LVOA 5CSVA 4RLLA 4WKQA 5L6PA 3VAPA 2WAJA 3W8LA 5M57A 1PKGA 4AQCA 4ZJIA 1LR4A 4KKGA 4PP7A 3LXNA 2RFNA 1U5RA 1R39A 5AAEA 5CS6A 4OTFA 5CNNA 4OTQA 4HVIA 2VTPA 4FSQA 3FMJA 3S4QA 1P4OA 3FZ1A 3RGFA 4HVHA 1YOLA 4FIFA 3AC4A 5KKRC 4U45A 4FOBA 5IMXA 1Q24A 4R77A 1XQZA 4BCIA 4BB4A 2RKUA 2W0JA 5C1QB 3GCUA 4MD9E 4I6QA 4OTHA 1IA8A 1GZ8A 3DY7A 4APPA 2PMNX 4WHZA 3W18A 3N4TA 3VN9A 3FUPA 4D4RA 1XO2B 4E6AA 2REIA 1JWHA 2YM4A 3NAYA 2OW3A 2YZLA 3OEFX 1J3HA 4R78A 4ONAA 4TYHB 5E8TA 4CFVA 4ZY4A 3DTWA 3D2KA 4U44A 1OPLA 4YZBA 4DITA 2OI4X 2R3LA 2HK5A 3FAAA 3ZTXA 5EI6A 3L9LA 5KMLA 2NNWB 2VTHA 5CEMA 5KHWA 3OCBA 4UALA 4W4WA 4Y85A 2PVMA 5GNKA 3C4XA 3UQCA 3DKFA 1BI8A 5JFWA 3BHYA 2JLDA 5EW3A 3VQHA 2NPQA 2DWBA 3ZEPA 4F99A 3PFQA 3W16A 1OB3A 2QC6A 3JUHA 3VUDA 5KKRB 4B7TA 3CEKA 2BHEA 4EZ3A 1U4DA 2PK9A 2YISA 4KBKA 3RHXA 3VUKA 2OFUA 4CMOA 3DFCB 2R3IA 4GS6A 4JNWA 4QTBA 4W4XA 2R3MA 4FUYA 1UNHA 2LAVA 5BPYA 3O51A 2GMXA 2CKPA 2J5EA 3GU8A 1CKPA 4XOZA 3BGPA 1FVVA 3G5DA 3LXLA 4Q9SA 5HO8A 3K5UA 2HAKA 4CT2A 1NA7A 3VW6A 2QR8A 4Q5EA 2WMBA 3RWQA 4BCOA 1KE7A 3DJ7A 2I1MA 5DT3A 4BR3A 2QOHA 2PVNA 4ZTQA 4JAJA 5KMNA 2C3KA 3QLFA 5BNJA 4ZTNA 3QD0A 3R7YA 5ETFA 1XBAA 3SQQA 5K0KA 5IH4A 5H8GA 5AP3A 4RQKA 4ZS4A 4I6HA 4OTWA 5AMNA 2JD5A 3GVUA 4O6EA 4RGJA 1QPDA 4IHPA 4BIEA 4H3BA 5E8XA 5HCYA 5JFXA 3KXMA 3QL8A 5B0XA 4BCKA 4NYEA 1YXXA 4Y5HA 5CSPA 2WMRA 3CD8A 2IW6A 4GYIA 4TYEA 3FLSA 2GTMA 3ORMA 5GIOE 3P86A 4C37A 2BZHB 2UZUE 5J9ZA 4O81A 2W9FB 4BKYA 2C0OA 3R73A 4ZAUA 2XZSA 4RVTA 2Z7SA 4ZEGA 4IAIA 4YHTA 2H6DA 4TN6A 3RZFA 4GYGA 4D0XA 4PX6A 3FLYA 4AF3A 1U54B 3D9VA 1QL6A 3KRLA 4BICA 3BPRA 1E1VA 4CQEA 4WBOA 4X2FA 2XNEA 4P2KA 3SRVB 3G2FA 2IVUA 4BYJA 3OVVA 4C4EA 3DCVA 3KXHA 5I0BA 1IR3A 5E8SA 4QP4A 2V22A 4CFXA 3FKLA 2E9PA 2PMIA 3ZXTA 3V8SA 4FV9A 4GU9A 4GVAA 4FGBA 1TQIA 4UB7A 2RFDA 3VS0A 5KO1A 2J5FA 3G9LX 3FL5A 3QRIA 2QO9A 4BBEA 3I60A 3D7ZA 4W8EA 5K3YA 3QD3A 5IF1A 3AMAA 4GK4A 1HCLA 3UG2A 4J8NA 3BU3A 5CLPA 3ZSHA 3NW7A 2IVSA 4FEQA 5K5NA 3FMKA 3QCYA 2IJMA 4IEBA 3H0YA 1Q8TA 2FSMX 1XBBA 4PMMA 4UMQA 4UYNA 4HYHA 4MQ1A 4DF3A 4FSNA 2JGZA 4RX8A 2BDFA 5I9VA 2C5YA 3ZLWA 4QYYA 2PHKA 2CGVA 4TY1A 2H34A 2YA9A 1WBVA 2WTKB 3TNPC 1WBNA 3UODA 2FUMA 5CASA 2ONLC 2QODA 5EDRA 3TDWA 3FKNA 4QPMA 1QMZA 5JZNA 4PNKA 5CAVA 4M13A 5LJJA 2FA2A 5CSXA 2ITTA 3QZFA 4TZRA 4C4IA 3EWHA 3QKMA 4GIIA 4FV1A 3SD0A 1FINA 4FTJA 3ZO3A 3F3UA 3REPA 5CXZA 4YO4A 4IB3A 4JJRA 2CLXA 4F1TA 4EOJA 4DGLC 1M2QA 2E9VA 2XBAA 2YLFA 3POOA 4QPSA 2XUUA 2VU3A 2R5TA 4L42A 3VS1A 4FR4A 3ULIA 3QYZA 5IQBA 2AC5A 1PXNA 3DBFA 3G51A 3UOJA 1PXMA 2YIWA 4KKEA 2XH5A 3WE4A 3DKCA 1JKKA 2YITA 5J8IA 4AFEA 2WQMA 5E8VA 5GHVA 1OPKA 3HA8A 3H4JA 5IA1A 3QA8A 3IQ7A 2WHBA 4XG3A 4ZZMA 4E5BA 3LFCA 1Z57A 2IN6A 4CFUA 3E7VA 4XMOA 1GZOA 1RQQA 2UW0A 4OAUC 5J5SA 1WBWA 1LP4A 2IWIA 4FEVA 2R3FA 3K2LA 4KIPA 4UV0A 3QZGA 2C3JA 3ZO1A 4DN5A 3TWJA 1H4LA 5A9UA 5C9CA 3UMXA 3TACA 5EW8A 5FBNC 3EIDA 4TYHA 4AT5A 4BKJA 5HBJA 3W2SA 4PNIA 3ETAA 2OKRA 3LKMA 4RIWB 5BVOA 1H26A 1YDSE 3AGMA 2P33A 4LOQA 3DOGA 3E8NA 4D9TA 4RIOA 4CV9A 2WMXA 4ZS0A 4WOVA 3QX4A 4GUBA 4AGUA 4USFA 2PUPA 2ERZE 3AMYA 3W55A 2E2BA 2W4OA 4FV2A 2E9NA 4BCNA 2BTRA 2ZDUA 5M4UA 4I4EA 2CKQA 4DEDA 4O2PA 3Q5IA 3PP1A 3Q9YA 3VS6A 4FBXA 3NUUA 3PVBA 3TV7A 4X3FB 3VBQA 3HYHA 4ASEA 2OF2A 2OZAA 4BDIA 3CKXA 2OH4A 3EJ1A 2VGPA 3MIAA 3DBDA 4DEGA 2C6EA 5AADA 5CXHA 5DT0A 3ET7A 2B52A 3OWLA 4M15A 4MXZA 4F6UA 5ANDA 5L2IA 5A4CA 4BWKA 4KRDA 3KQ7A 1ZOHA 3O2MA 3P23A 4NWMA 4ASZA 3MY0A 2GQSA 2YCRA 2VTMA 4XP2A 3RTPA 2EB3A 3OTUA 4RMZA 5E91A 5BVEA 4WG5A 2JKOA 3IG7A 3QTIA 1H8FA 4RX7A 3DXPA 1Q99A 4FSZA 4G1WA 4F7JA 3T8OA 2VX0A 3OEZA 4D1ZA 4EBWA 5KBQA 5CU3A 3MIYA 5EFQA 3FPQA 3ZDIA 5F94A 2GNFA 4R7HA 3WZEA 4BWXA 2DUVA 4TWNA 1YXSA 3NNVA 2GU8A 2RG6A 3FSKA 1YI6A 4ZTHA 4CKJA 3OT3A 5HG5A 2G2IA 3VRZA 2Y0AA 3R9NA 3PXQA 2WMVA 4DH7A 2OIBA 3MGYA 5C8MA 3BGZA 3ZO2A 2QONA 2YCQA 4Z9LA 5DOSA 1OL2A 4DFYA 3ROCA 4K0YA 1NVQA 3KCKA 4N6YA 4PRJA 4R5SA 2GFSA 4DGMA 4D5KA 3PVWA 3HVCA 5EDPA 3S0OA 3BCEA 3V04A 4ALUA 1PKDA 3II5A 5LARA 2PPQA 2XMYA 3AC1A 2PMOX 4MXOA 2C1BA 5AP4A 4JQEA 5JT2A 4RIYA 4FKWA 4MXXA 5CT0A 3EFLA 3PPKA 4GIHA 3BWFA 2OU7A 4B0GA 4EZ5A 2XP2A 5AIKA 4G3EA 4EOIA 3KN5A 3OFMA 4CMTA 4DGNA 4E6CA 2PVHA 3CJGA 3F66A 4IAAA 3RPYA 2XYUA 3MFSA 4BDFA 4K77A 4DLIA 4QPAA 5CT7A 5F9EA 4RX9A 4XV9A 3L8VA 4DEHA 3F5GA 4ASXA 5DR6A 2YCFA 3L9PA 4U9AA 2O65A 3EFWA 3PIZA 3KRJA 1R0PA 3MH2A 4C36A 2NRYA 2QVSE 4I20A 2R0UA 3O8TA 4V01A 1YHSA 5JN2A 5KBRA 3I7CA 3QALE 4E4LA 2XJ2A 3HUCA 4RIXA 1J7UA 3GC7A 3EQIA 3AD4A 5BVFA 3QXPA 1RDQE 2XRUA 4N6ZA 4NCTC 3K5VA 2ZB0A 2F2UA 2VWYA 1YQJA 1CTPE 4GU6A 2W5AA 2C30A 5EHOA 4IXPA 3DU8A 4XG8A 5GJFA 4RA5A 4L6QA 2X4FA 4RQVA 1I09A 2BILB 1OKZA 1XH7A 2PZRA 4QMQA 2ZAZA 4K18A 3CTHA 5EM5A 3HV3A 4QMSA 2HZ0A 3E8EA 3Q3BA 2ETMA 3PA5A 3A2CA 3F2NA 4FL2A 4NIFA 3VS2A 2CN5A 3PDTA 2V0DA 1ZARA 3BQCA 5GINE 3W8QA 4H3QA 2HW7A 2ZDTA 3WI6A 3RPVA 2I0YA 3TZ7A 4E73A 4WG3A 4M69A 3T9IA 4AZSA 3LQ3A 3HRBA 3W1FA 2GHMA 2GTNA 4DTBA 2YFXA 4BDBA 4YJNA 4CQGA 3W32A 5M4IA 4UN0C 3ZBFA 5LVNA 4NH1A 4XLVA 3QRUA 5CF6A 5CEPA 2QO2A 5I9UA 3QQKA 3SOAA 3R9RA 5CAOA 3GCVA 4RVLA 3VULA 4CV8A 4Q5HA 4ALWA 1LEZA 3DGKA 5DI1A 5HG7A 3FI3A 2ITPA 3DB6A 1GIJA 4EOOA 3M11A 2C4GA 3QUEA 4ZJJA 1E1XA 4I5CA 1H0VA 4S34A 2HY0A 2J0MB 2XIKA 4GG5A 4HCUA 5HD7A 3KXGA 3R8VA 3NUNA 5DH3A 4FVPA 3PJ8A 2UW8A 4PDPA 4IB0A 2QLUA 2PVRA 3UVQA 4WNOA 3P4KA 4GT4A 4XV2A 4BZOA 4ZSEA 3R83A 4RWJA 2HXQA 2JC6A 2AYPA 4K2RA 3HV6A 5HEZA 2BFXA 2ZB1A 3ZZEA 3VUMA 4FT5A 2UZBA 2WOUA 2B54A 3TI1A 4A9UA 1GJOA 4IAYA 3QQJA 4IVBA 4QMNA 2WQBA 1XH9A 2UW6A 2PZPA 3OZ6A 2PE0A 1M7QA 3VBVA 3F61A 1NVRA 2E9OA 2QU6A 3D4QA 2Y4IC 4NM3A 4CZYB 1GIHA 4FSUA 4J1RA 4S2ZA 3UJGA 3ORTA 4C38A 1OI9A 3Q2JA 1PXKA 3GU7A 2BVAA 2R0IA 4FF8A 3UNKA 4UBAA 1J7IA 3HV7A 4M68A 4U40A 5EHLA 4EOKA 4K33A 4BDEA 5DNRA 4FKLA 2GNGA 3NUXA 3IW7A 2Z7RA 2HZIA 5HI2A 5AUUA 5C4KA 4A9YA 1S9IA 1LUFA 2XKFA 3LIJA 2RIOA 1CKJA 2XNOA 4IJ9A 4LV5A 3ZSIA 1Q3WA 1FOTA 3VUHA 3C51A 1BYGA 4JBOA 3OROA 3L1SA 1G3NA 3DAKA 3M1SA 5BYZA 2J0IA 3DK3A 3TKHA 3UBDA 3GU5A 4EONA 3E62A 5D11A 5ETAA 2QQ7A 4MNFA 3CC6A 3AQVA 3R1NA 2VD5A 1CSNA 3JS2A 4RC2A 3FLNC 4YTIA 4UMRA 3KRWA 3UTOA 1ZMVA 3NCZA 4DYMA 4WUAA 2HY81 2VTQA 2A2AA 2P2IA 3B8QA 2VWXA 4HVGA 3AC5A 3AT4A 4XV3A 4EEVA 5FDPA 4S30A 1ND4A 3R2BA 2C6LA 3MFRA 5KX8A 4F70A 4QMMA 4U81A 4CZUA 4IM3A 5AX3A 5AWMA 1GY3A 2XRWA 3ZO4A 3UG1A 3WYYA 5J7HA 3PRIA 5GJDA 4G5PA 4UZHA 3SKCA 3KA0A 4K9YA 4D2PA 4USEA 4JG6A 5DR2A 3MWUA 4CT1A 3C5UA 1MP8A 2ZV2A 3MBLA 4HVSA 2XK3A 3MY5A 3H0ZA 3UC4A 3KULB 5DE2A 2BKZA 3E3BX 3DZQA 4JS8A 4C8BA 3NUYA 4FSMA 2WMWA 5AJQA 2J6MA 4FG8A 5D7VA 2B4SB 5M44A 3FLQA 1L8TA 2VNYA 2VNWA 5GJGA 4AN2A 4QMPA 2H8HA 4ZSAA 3JVSA 3JY0A 2FO0A 4YO6A 3AOXA 3T3VA 3UYSA 5HZNA 3TM0A 2WXVA 3IS5A 5IA4A 1PMEA 2V55A 4E26A 1Q97A 3HGKA 5JK3A 4V04A 4EQCA 3QGWA 4F7NA 5DEWA 3DK6A 4L43A 3PP0A 3TNIA 1QPCA 4CMUA 5E4HA 2OG8A 3BHVA 3VHKA 4FZDB 1YXTA 4FT3A 4D28A 4E20A 1REKA 3QQHA 4P5QA 3P08A 4CD0A 1XJDA 2C3IB 4D9UA 3H9OA 3PLAE 1OZ1A 3F3TA 5HG8A 4HZRA 3MESA 4AW0A 4O38A 3UC3A 2OICA 4KNBA 3UZPA 4E93A 5M51A 3Q6WA 5CAUA 4ZZOA 2HENA 3ACJA 3KULA 3H9FA 3NR9A 5IU2A 2QOLA 2XKCA 5DPVA 3W2RA 2PU8A 3UOLA 3DTCA 4XG4A 3GCPA 4GJ2A 4O0RA 5AM6A 2OGVA 4MYGA 2WTIA 4ZZNA 5L2SA 4EJ7A 2X7OA 3BYSA 1FGIA 3PTGA 4HGTA 3RK7A 3EQGA 2QOOA 4II5A 4WSQA 3MW1A 3C4ZA 2RSVA 2CJMA 4H39A 4ZK5A 3Q96A 3UNZA 4EH8A 4G3GA 4IZAA 4O86A 1JQHA 3VRYA 3F3VA 4DAWA 4F9BA 4CYIA 2QLQA 2VX3A 3FLZA 3QCSA 4CLIA 4L52A 4FTKA 4FV4A 5ETIA 2Q0NA 3MPTA 3FLWA 1JKLA 4YJTA 4LQMA 4DEAA 4RVMA 2IZRA 5ACKA 3CGFA 3WF5A 4PL5A 1Y8YA 5AUXA 1SZMA 3G0FA 1YWNA 2R3NA 3HKOA 3FMLA 5HKMA 5JZJA 4ID7A 2C5NA 3E7OA 4YTFA 3RP9A 5TF9A 1QPEA 2B0QA 4O7ZA 4KSPA 4GRBA 4BDCA 3KMMA 4JQ8A 3ENMA 4U80A 2F2CB 3FEGA 1DAYA 3GBZA 4ZY6A 2A27A 3QQFA 5G6VA 2G2FA 3O17A 4FV6A 4O1PA 3ROYA 5LMKC 4G2FA 2JFLA 2VAGA 3LM0A 4Z16A 5B7VA 5AIRA 4O7RA 3BWJA 4QP6A 4L00A 4CTBA 4JDIA 3BYVA 3LJ2A 3NGAA 4LOPA 4UWBA 4XG9A 4YLLA 4BCQA 4Y95A 5FEQA 3NWWA 4XEYA 4TL0A 5D9HA 2JDRA 1ZOGA 4W9WA 4K11A 5JSMA 4CCBA 3ERKA 1X8BA 3BLRA 3MJ2A 3CQUA 4G9RA 4C57A 3PIYA 3R7OA 2ONLA 3PSDA 3SHEA 4TNDA 5M09A 2J4ZA 4XJ0A 3SA0A 3OMVA 3S00A 3WBLA 2F9GA 4Q2AA 3CR0A 2Y8OA 4P4CA 3Q9XA 3N51A 4IVAA 4RZWA 2KULA 1OBGA 2O63A 2PYWA 2UVZA 1UNLA 2UW3A 4ANOA 4F7SA 2GNJA 4PL3A 5FWKK 4AZEA 1J7LA 1KUTA 1M52A 3U8WA 4G3FA 3S2PA 4BCGA 3AG9A 4D58A 2RGPA 5EI8A 2NO3A 5CTPA 4KS7A 3TJDA 4CRLA 5AFVA 4GFMA 2ZYBA 2QOQA 5ANKA 2W1DA 3A7GA 3PYYA 5F1ZA 5G1XA 1Q3DA 4CVAA 2B9FA 1PXLA 3QBNA 3RBWA 2Y9QA 1IG1A 3EL8A 4PPAA 4AUAA 4RJ7A 3D83A 4QP8A 4IC8A 4EQUA 5J79A 3DLZA 4FIHA 4UXQA 4Q9ZA 4I0TA 5HIDA 4YTCA 4G6LA 1JSVA 5A4TA 5CU2A 2HWOA 3MPMA 4R1VA 5HG9A 2YIXA 4TPTA 2W99B 3PLSA 4CYJA 1H1QA 4GG7A 1WAKA 2WO6A 2GDOA 2YIQA 3FZPA 3Q9WA 3R2YA 2J90A 4YLJA 3F82A 5AP0A 4AZVA 1H1PA 3P79A 4IB1A 3E8CA 3EZVA 4F1OA 2PVJA 5M4FA 4HPTE 2WPAA 3LPBA 3NPCA 3V8WA 5CU6A 4OBPA 3FC2A 4ANLA 3KEXA 2CDZA 4BC6A 3AD6A 2J51A 4LUEA 4IDTA 4DCEA 2ACXA 5GZ9A 4F0GA 1UV5A 3AMBA 3QD4A 3UPXA 1R78A 1ZY4A 4K8AA 3NX8A 5AX9A 1OIYA 4J98A 3I7BA 3C0GA 3CGOA 5CZIA 4DFUA 3QZHA 3HMOA 3ZSGA 2GFCA 5LQFA 4FKUA 3OF0A 5EW9A 4YJQA 5HNIX 1Y91A 3A60A 4AG8A 2NRUA 3DFAA 4PTEA 3NUPA 5A54A 2VWUA 2PWLA 4YZ9A 4XOYA 4L44A 4GEOA 5IUGA 5AP1A 4RJ4A 2FSTX 2Y6OA 4FTCA 5DG5A 3DKOA 2HXLA 1REJA 3IKAA 4IJPA 3CS9A 4D2RA 3N4VA 4EOPA 4H1JA 2RF9A 4AFJA 3ORXA 3BLHA 2VWIA 2Z7LA 3L9MA 3U6HA 4WA9A 1TQMA 4EK4A 4XNEA 5LXMA 4HCTA 2EB2A 3EN5A 3UVRA 1WVWA 3C0HA 5AP2A 5HD4A 3VF8A 1YKRA 2ITOA 3I6UA 4YP8A 3TT0A 3W10A 1UKIA 2PSQA 5LCKA 4AOJA 4B4LA 5IEXA 5C01A 4C0TA 2PZIA 1HOWA 1XH5A 4HYSA 3Q32A 1V0OA 3UIXA 5FQDC 5I9YA 3DXNA 2PVKA 4MHAA 4PPBA 5BVNA 5J1WA 1PYXA 1YRPA 5B2LA 2JIUA 4O2ZA 1HCKA 1SYKA 3RZBA 3UIUA 3F7ZA 5IDPA 3JR1A 3LCDA 3OXIA 4F63A 2C5VA 4MD7E 4X21A 1DI8A 4J96A 2X8EA 3PJCA 2VO7A 2YWPA 2XEZA 2UUEA 4FSWA 4GUEA 5BYYA 3CTJA 3D0EA 3F6XA 4JR7A 3PVUA 4XRJA 2QOCA 3BEAA 3D5UA 1H25A 2BMCA 3BIZA 3KY2A 3O8UA 4GK2A 5J95A 4LI5A 5FDXA 2UW4A 4GCJA 1BUHA 3DAEA 3TZMA 1P2AA 1UU3A 1ZZ2A 3RAHA 1FMOE 2A19B 4JL9A 4LGHA 5L6WL 3PSCA 1MUOA 3C9WA 3SX9A 4AS0A 3RNYA 5J9LA 2J7TA 4FZ7A 3BE9A 2UZWE 3PXKA 4DG3E 5AR3A 3SG9A 4O0SA 2V62A 3E92A 5EM6A 4FEUA 1H0WA 4FTMA 3DBCA 3VF9A 2XNNA 5L2WA 3CP9A 3DNEA 2PUNA 5HU3A 3TUCA 3FHIA 3FHRA 2I0EA 5DGZA 2JFMA 2WQOA 4Y72A 5DVRA 4F6SA 4FV7A 3QQLA 1URCA 3RKBA 4DFZE 3RMFA 3TJCA 1WBSA 4IX5A 4G6OA 4WT6A 2UZEA 2BAQA 3LLAA 4CG9A 5BYLA 2PVYA 5ANGA 3R02A 1AD5A 3WF7A 4J52A 4BZDA 2V7OA 2JBPA 1OKYA 3WF6A 3VJNA 2FSLX 4K1BA 3A61A 5AR2A 1WCCA 3UIMA 4DBNA 3OY1A 4GKIA 1JSTA 3KFAA 3V5TA 4J97A 4O83A 2WIHA 1WBTA 4C4GA 3LMIA 4EHVA 4LFIA 4JG8A 1BLXA 4IACA 1L3RE 2WMSA 1NXKA 4L3PA 4EH4A 1MRUA
chains in the Genus database with same CATH superfamily
2XK6A 5L6OA 5JFVA 5A3XA 3LQ8A 4FEWA 3KL8A 2JAMA 4GT3A 4ZMFA 3OOGA 2C47A 1JAMA 3ACKA 5IKWA 2XKDA 3HLLA 3ZZWA 4XUFA 3VIDA 1CDKA 2CKEA 3RPOA 1G8AA 2FVDA 1ZZLA 4HVDA 3NYNA 3RNIA 4Y8DA 4CLJA 2W1EA 2PULA 4G6NA 2I0HA 4RT7A 4WIHA 1SNUA 4RIWA 2C6OA 2JITA 5FG8A 2YLEA 4BGQA 4C3FA 4LL5A 5HTIA 3VWAA 5HLPA 2WB8A 3QX2A 3W2OA 3FMDA 5AR7A 4U3ZA 4ANSA 2ITUA 3V51A 3A7FA 1PMNA 3TIZA 5AAFA 4FYOA 4ALVA 4MQ2A 4BTJA 1PY5A 2WQEA 4M3QA 3C50A 4EHEA 4ENYA 3R6XA 3R7GA 3B8RA 2YM8A 3DZOA 3NUAA 3SGCA 2UV2A 4AA0A 1F0QA 3TL8A 1UU8A 4ZP5A 5AV0A 2J0KA 2W06A 3GCSA 3EL7A 1YVJA 4A4LA 4BHZA 4ZOGA 4JT3A 4RRVA 2R3PA 4XBRA 3R8UA 5LMKA 3LFEA 2EVAA 3BEGA 3LFDA 5HGIA 1CM8A 3VUGA 3FZRA 1LEWA 4YJVA 2CGWA 5HVYA 3U9NA 3AGLA 4ACHA 4FKGA 2XJ0A 4RC4A 3GUBA 4MNEB 4WNPA 3F9NA 3L8SA 4IZ5A 3UDZA 1UWHA 3TUBA 4NTSA 1GOLA 1W83A 1R1WA 4D2TA 1AQ1A 5C26A 5HX8A 4BDJA 5BVDA 3FPMA 3WIGA 2X0GA 3ORKA 4NKAA 5CVHA 3OTVA 4APCA 4MF1A 1H1RA 2G01A 1WFCA 2R3RA 4F9AA 1OL7A 5BMMA 4GVJA 1APME 3K3IA 4FICA 4ERWA 4EUTA 3MFUA 4TKSA 5ITAA 2QKWB 4TWCA 5HO6A 5T6KA 5HHWA 4QMYA 4DHIB 3UVPA 4XX9A 1K9AA 2ZMDA 3RM7A 1Q62A 2QOFA 4EOLA 3SLSA 2QHNA 5FEEA 5CEKA 4U79A 4OTGA 5AUYA 5JRSA 4AXCA 4HPUE 1ZRZA 4MVFA 1O6LA 4BIBA 4QMXA 4DTKA 2X4ZA 3P0MA 4QP9A 1CKIA 5LVLA 2YZAA 3SXSA 3DJ6A 3U54A 1G8KA 1M2RA 3Q52A 4IMYA 4FV0A 4OT6A 3TNWA 4O96A 3SRVA 3PG3A 2PUUA 3MA6A 2IW8A 2BRBA 5JKGA 1OPJA 3VJOA 2GPHA 5L3AA 2PVLA 4XG7A 5F20A 3M42A 4C2WA 3DQWA 3EN6A 4FNXA 4NJDA 4EL9A 4EWHA 3RM6A 3NIEA 3EH9A 4M12A 2O3PA 5HBHA 4D0WA 4G31A 3FXWA 3WYXA 3SG8A 2R3JA 3FWQA 2HELA 2BFYA 4Z55A 2X2LA 3H9RA 2B9HA 5CI7A 3OCTA 4N0SA 3EQFA 3LXPA 3BU5A 2IVTA 1FGKA 4FTAA 4P90A 3OUNB 4HGLA 2OLCA 3KRXA 5D10A 2JEDA 2ZV8A 1JKTA 1DM2A 4YSJA 3BZ3A 2BRHA 4KKHA 4KAOA 3ID6C 2WU6A 2XALA 1B38A 4IZ7A 3U55A 3QXOA 1Q8WA 2YERA 4LG4A 4AZTA 3ZFXA 5AV4A 1H00A 3FI2A 3SXFA 3MPAA 3NLBA 4Z7GA 2YCSA 4L67A 5BV3A 3I0OA 4A7CA 4UWCA 4XG2A 2ZM3A 3ZCLA 2Y4IB 3PY3A 3W0NA 3QTWA 5A4EA 3HMPA 2GS2A 2XS0A 1UU7A 2WD1A 3NIZA 3DS6A 4G16A 1KE6A 2W4JA 3WOWA 4WO5A 3UMWA 4ASDA 4KSQA 4D55A 3NMUF 2OIQA 3KXNA 3W2PA 4FTNA 4JLCA 5K5XA 3MV5A 4HGEA 5ANJA 5HICA 1YW2A 3QKLA 4BL1A 4ZLYA 1DAWA 5EYMA 4E6QA 3F5PA 2XK7A 3VO3A 4PDOA 4UMUA 3DPKA 4UMPA 3R30A 3FMHA 5D7AA 2VGOA 2AUHA 4FTLA 4V0GB 5EOLA 5ANOA 4YLKA 3R8ZA 3KIOC 2A1AB 1RJBA 3W0RA 1RE8A 2Z7QA 4U0IA 2VTJA 3VBTA 4IC7A 3CE3A 2CNVA 1K2PA 2XK8A 4D2WA 3P1AA 3U6JA 3V5PA 1ZY5A 4BFMA 2ERKA 4IH8A 5AUWA 3R9HA 1BL6A 2HW6A 5J87A 2FGIA 3G15A 4GV1A 2OZAB 4KINA 4AGWA 3OCSA 2J2IB 3PXZA 3FZSA 4PF4A 5EDQA 3FXZA 4NM7A 1XMLA 4WUNA 4QYHA 1K3AA 4BCPA 4KD1A 2UZLA 3ZM9A 4IWDA 3F2AA 3E63A 2I0VA 4FTIA 4YU2A 5KZ0A 5FXRA 4BTMA 3O23A 4DINA 4FG7A 4XBUA 3BELA 2XK4A 3QKKA 2GQGA 4OBOA 3NDMA 5IDNA 4R7IA 2XIRA 3MDYA 2Y6MA 3BE2A 4ITIA 3ALOA 5LCJA 4I0SA 3IOPA 4DHFA 5A4QA 1Z9XA 4NFNA 4C3RA 2XAMA 3F3WA 2R3HA 2EUFB 3U4UA 4IX4A 1P14A 3QHRA 4QQJA 1XKKA 2I40A 4RWKA 1OITA 3HMIA 2ZM1A 2C68A 3V6RA 3CY3A 1BX6A 1OGUA 2FB8A 1YXVA 2PE2A 3BV3A 2H96A 1ZXEA 5CANA 1ZYCA 4M97A 4EUUA 2C6KA 1UA2A 4C35A 3TYKA 4V05A 4A07A 1H27A 2PY3A 3GENA 4FODA 4S31A 4LV8A 5J1VA 3UPZA 4FTRA 1XH4A 3S1HA 5EKNA 5KMIA 4AE6A 5FXSA 2R7IA 2VO0A 4BTFA 5JGBA 3WZDA 3O5AA 4EYMA 5E7RA 3P5JC 2JKQA 2XJ1A 3DNDA 4OBQA 5EQPA 5DT4A 4KWPA 4CFWA 4ORKA 4NUSA 5I9XA 1OMWA 4IVCA 3ZUVA 4FKIA 4M14A 1ZLTA 3QCXA 3G6HA 3T9TA 5BUEA 4QMLA 1SNXA 3FY0A 4DH3A 3HP5A 4ZTRA 3SXRA 1KWPA 4XLIA 3FE3A 5C8NA 2W1ZA 4X3FC 2FH9A 5IZFA 4JRNA 4JXFA 3LFAA 4FIGA 4IX3A 3I5NA 1WVXA 3FXXA 4JG7A 3RAWA 4AZWA 4O0VA 4BF2A 4OTRA 4YBKA 4E8AA 1J1BA 2ETRA 1I44A 4FA2A 4QQCA 5L4QA 4MAOA 2X8DA 1KSWA 2YM6A 3FV8A 3POZA 2VTOA 4YNEA 4TXCA 2QG5A 2VO3A 4G5JA 4CCUA 4UZDA 3NVMB 4YJPA 2XIYA 2PZYA 3TN8A 5IA3A 3ORLA 4O4FA 4FL3A 4RVKA 3UZTA 4C4JA 3OP5A 4J99A 4AT3A 2Z2WA 4DC2A 3VS3A 5KNJA 3F69A 3JXWA 4P7EA 3A7HA 3EQPA 4X2KA 4LV7A 5I3OA 4BKZA 2EXEA 4USDA 2WELA 2G2HA 4PTGA 1OM1A 3PJ2A 4FKRA 4L3JA 4WD5A 4RWLA 3BBTB 2YACA 3QTRA 4RPVA 4WRSA 3RCJA 2X7FA 3V5JA 2C1AA 4C4FA 4DLJA 4JBQA 3I81A 4B9DA 2CPKE 4YHFA 5LVPA 4I6FA 5KMOA 5CF4A 3IPHA 4AZFA 2X81A 3NS9A 3PRFA 4QMVA 3HL7A 4I5HA 4ZTMA 3EKKA 4FTOA 4FZ6A 2VWBA 2O0UA 2W17A 4DTAA 4AAAA 4NKSA 1IEPA 1J91A 5HLNA 3NW5A 4EI4A 5CYIA 5H2UA 5IUIA 4X2NA 3ATSA 1JSUA 3ZXZA 3WF9A 4QYFA 4BTKA 3CJFA 4EK3A 2XYNA 4L01A 2XEYA 4RC3A 3WARA 3ZC6A 3PE2A 3W0MA 1Y6AA 2HCKA 3P7AA 4JBPA 3R7UA 4AW1A 1UNGA 3KRRA 2BZIB 4UMTA 4KBCA 4AA5A 3O50A 3ZONA 4L46A 4AN9A 3CXWA 4CRSA 5TT7A 1OBDA 1ZOEA 2PE1A 2J50A 3KB7A 4XV1A 3ZU7A 1Y57A 4O7SA 4BVUA 4BGGA 4YSMA 3MB6A 3MB7A 4MWIA 3KU2A 1IAJA 5BUJA 1KV1A 4ZLOA 3OUKA 5ETCA 5CEQA 2BTSA 4RSSA 3GFWA 2V7AA 3FZOA 4TW9A 3FQEA 3OW4A 4YJSA 5D41A 4C58A 4AT4A 3DXQA 4JQ7A 5T3QA 4MBLA 1UWJA 3VBWA 3V3VA 5IH5A 2P3GX 4FSYA 2UW7A 4AU8A 2Z60A 1MRYA 2VUWA 3NRMA 4BDKA 3PZEA 2X2KA 4C2VA 2OJJA 2X0OA 1OL1A 3FL4A 4O0XA 2BHHA 4DFLA 4DGGA 5JGAA 3LMHA 3TDVA 3F88A 3VBYA 4WNMA 2VWZA 2C5XA 4RIYB 4MF0A 4NM0A 3RCDA 4YZDA 5DBXA 2ITZA 4ZXTA 4N57A 2O5KA 3FMNA 2ITQA 2X6EA 4O82A 3TUDA 3DLSA 4KIQA 4U42A 3I79A 1IASA 2GNIA 2RFSA 5LVMA 4JR3A 4JMQA 3R22A 4ITHA 5A4LA 4JX7A 3JYAA 4PP9A 3A4PA 3KN6A 3LAUA 2W1IA 3R21A 3G33A 1S9JA 5ACBC 3UIBA 3V8TA 3VUTA 5DYJA 2VZ6A 1Q4LA 4P5ZA 4QO9A 4TYGA 4DG0E 1OUYA 1VYZA 4FK6A 5JFSA 3W0OA 3BYUA 3RAKA 2XNGA 4WNKA 3UQFA 2IVVA 4TWOA 2R3GA 3QUDA 4MEDA 2W5BA 4YJRA 3GCQA 3D15A 4LRMA 4EK5A 1AGWA 5J7BA 3NUSA 3RVGA 3KF4A 2A4LA 4Y83A 2UZVA 2FSOX 2P0CA 3HDNA 3THBA 4O27B 4F0IA 4H1MA 3ZLYA 5E92A 2XNBA 4D4YA 3S3IA 5FP5A 4O22A 2ZV9A 3L8PA 4RZVA 5L2TA 5HLWA 4J8MA 4Z3VA 4DT9A 1PF8A 4D5HA 3RWPA 3OOMA 1H08A 4HGSA 4CFFA 4R3CA 2YWVA 4FTQA 3N9XA 3Q5ZA 3WF8A 3G90X 3E87A 4RG0A 3IDPA 2VTIA 3HMNA 4PMTA 5CY3A 3TZ8A 2C6DA 3VONA 3HMMA 4FSTA 2FYSA 4FT7A 3PJ3A 3C7QA 2OXYA 3ODYX 1NVSA 2W96B 2YN8A 3HAVA 4W4VA 3D14A 3OWJA 4IW0A 3R9OA 4E4NA 4FEXA 4N4SA 3BU6A 3OT8A 4IIRA 3PXFA 4HCVA 4RFMA 4CKIA 1FVRA 1YOJA 1SVGA 3OD6X 4X2JA 4ZY5A 5CALA 4EKLA 5H9BA 2BKKA 2WOTA 3FKOA 3P7BA 4DG2E 4I24A 4QMZA 3H10A 2YM3A 2JIIA 3KKVA 5FM2A 3FJQE 1GZKA 2I7QA 2C3LA 5K4IA 3KMUA 4AGCA 3FMMA 4ITJA 2PVFA 4BBMA 2WGJA 1OIUA 2R7BA 4WG4A 4O7NA 2XIXA 2OXXA 2JIVA 2GHLA 4FKVA 3H3CA 4ZLZA 4Y5QA 4MKCA 5HESA 5CQUA 2QHMA 3GU4A 3MN3A 4WRGA 3MVLA 3FDNA 2YM7A 3Q4ZA 4QYGA 2J0LA 2OO8X 1ZMUA 4EYJA 3QD2B 4JIKA 3CTQA 2R3QA 5IQDA 3EFJA 2IW9A 4MXAA 5BUIA 5M06A 3ZH8A 5AR4A 5LWNA 3DV3A 2Y4PA 4R3PA 3MI9A 2X9FA 2CCIA 3PUPA 3ORNA 2ETKA 4RLKA 1W2CA 4C7TA 4EORA 4KABA 2Z02A 3CKWA 3GP0A 4DT8A 3O0GA 4XHKB 5HOAA 4PDYA 4YUQA 3KXZA 4LRKA 2OK1A 3ZS5A 2B7AA 5BVKA 5HNGA 5ANIA 2CCHA 2DQ7X 4AX8A 3LFBA 3O7LD 3COIA 3BGQA 4O0UA 5FRIA 3TTIA 3GT8A 2QG7A 3UDTA 4FL1A 1XBCA 2WEIA 1E9HA 3NW6A 4DFBA 4D1SA 2UVYA 2BAKA 4I94A 4FTUA 4Y46A 2IEWA 3Q60A 2JKMA 3LCOA 3PXRA 2VV9A 4DCAA 2VTSA 4E3CA 4H3PA 4IE9A 4NM5A 3DT1A 5K9IA 5E1EA 5IQCA 3AXWA 2XBJA 2YHVA 4F6WA 4CGAA 3PIXA 3IO7A 3QC9A 4FZFB 2ZMCA 3RALA 3QC4A 4DH8A 3OWPA 4AOIA 1BKXA 2EXCX 1NY3A 3RPRA 3OG7A 4BIDA 3GC8A 5H3QA 2Z8CA 4PWNA 5AM7A 3R7EA 4GSBA 3VUIA 4BDGA 3TKUA 3R8PA 2WTKC 4MCVA 1B6CB 2C6MA 3MJ1A 2XM9A 3HV5A 3R1QA 4YHJA 5LOHA 3EQCA 3QCQA 4MBJA 1XHAA 1URWA 4QNYA 5ANEA 4R6VA 5EKOA 3DDPA 2F7EE 2GS6A 5CEIA 5I9ZA 4E7WA 3A8XA 2OZOA 4U97A 5C4LA 5HBEA 4KS8A 4DA5A 2CN8A 3R04A 4FC0A 1Z5MA 2R3KA 5DWRA 2UZDA 4C34A 3HZTA 4Z7HA 5E90A 1BL7A 2BAJA 4C62A 1GZNA 3LXKA 4CKRA 3MH3A 5EOBA 3W2QA 4J95A 4XYFA 4KIKA 4QTEA 2R64A 3LM5A 1V0PA 2C0TA 4FMQA 4LUDA 4O84A 3JPVA 3CIKA 3PZHA 4FG9A 4WSYA 1YWRA 2RL5A 2WMTA 3G6GA 2ITWA 1LPUA 3I6WA 5E8UA 3ELJA 4MTAA 3LCKA 1ZYSA 3F2RA 2QURA 2OFVA 2PZ5A 3DK7A 5FTQA 2DYLA 5EHYA 1PJKA 4I21A 4J7BA 4TRLA 2PL0A 5HE0A 4ANMA 1ZYLA 1V1KA 3TZ9A 4F1MA 4RA4A 3QFVA 1F3MC 4RJ6A 3R1YA 4LL0A 2OIDA 4YBJA 4JI9A 1W98A 4RJ5A 2GQRA 2WIPA 4BCJA 5BQ0A 3LHJA 5HCXA 4EKKA 5I5ZA 3FQSA 5DR9A 2BROA 5E9EA 1PMVA 4PY1A 2YIRA 4DGOA 2XAOA 2QOIA 2XANA 4FVQA 2QKRA 1SVHA 2IZTA 4EH2A 3LLTA 2WNTA 1WVYA 1ZMWA 1ERKA 2RG5A 3UGCA 4FE2A 4X7QA 4L45A 3ANRA 2PMLX 3UQGA 5M07A 2X2MA 1FQ1B 5HE3A 2BALA 3CCNA 3EFKA 5EYCA 5M08A 4I6BA 3QWJA 1P5EA 2ITYA 4JVGA 3I0QA 4FT0A 4FX3A 2CLQA 3FMEA 4BN1A 4FIJA 1YOMA 3UOHA 4AWIA 2X7GA 1Q8YA 3EQRA 3EYGA 5TOZA 4R3RA 1W0XC 3AD5A 4EOSA 4HW7A 4TWPA 3PA3A 4G9CA 2VN9A 5CF8A 4BHNA 1R0EA 2WKMA 3HP2A 5IQHA 5A46A 3QRJA 1JLUE 5DFPA 4EC9A 4FTTA 3P78A 5FBOA 3GU6A 4O91A 3GQLA 3R1SA 3SAYA 5DN3A 2HZ4A 5IMEA 1OL6A 1ZAOA 2G1TA 2OXDA 2R2PA 2WMUA 2UW9A 3O96A 4IWQA 4ACCA 4A9TA 2XNMA 3GQIA 4FIEA 4R8QA 2YAAA 4M66A 3R9DA 2P2HA 2C6IA 5IEVA 2W9ZB 5AA8A 4TYJA 4M0YA 4PMPA 4M0ZA 3LW0A 3GB2A 5J5TA 3AT2A 2JDSA 2ZJWA 4HOKA 2QCSA 3A7IA 1Q8ZA 4LYNA 4NIFB 5FUTA 3NCGA 4F9YA 3D5XA 1B39A 1M14A 3AC3A 4KIKB 3Q4CA 4FV8A 1XMMA 3BL7A 5E8WA 1WZYA 3LMGA 4GFGA 3GNIB 5FEDA 4FKPA 3WZKA 4KUJA 3GXLA 5AV1A 2XKEA 2KTYA 3RI1A 2UZOA 4YZCA 2OWBA 1H1WA 1O6KA 2X6DA 4GJ3A 4EHGA 5A14A 3PFYA 3D7TB 3FYJX 3UO5A 2JDOA 3UZRA 2VO6A 4C59A 2VX1A 2XIZA 4AW5A 4YMJA 2YEXA 4MXCA 2PUIA 2OJ9A 1UKHA 4G17A 3F7WA 4OW8A 4FKOA 3TCPA 2J0JA 1KE8A 4M69B 4AACA 5KHXA 4QT1A 3R8MA 3ZFYA 3EOCA 3COKA 4AE9A 4E5WA 4EWQA 3BHUA 3WIKA 4O21A 4UEUA 4QP1A 2EWAA 2QO7A 4PMSA 4B99A 4YJUA 5HE2A 4MBIA 5CSWA 4FKJA 4NFMA 4TNBA 3T3UA 4XH6A 5M56A 4OGRA 4FUXA 4UXLA 4QQTA 4PDSA 3Q4TA 3U87A 5AR8A 3ZRMA 4QMWA 2BIKB 4RFYA 4GKHA 1KV2A 2BRMA 4W8DA 2WZJA 1DI9A 2JAVA 3ZOSA 5JMSA 5LMBA 3HA6A 3PWYA 4GH2A 3R7VA 2O8YA 2UW5A 3ZLXA 3MVHA 3MY1A 3U51A 3KXXA 4QMOA 3LQ5A 3IW4A 3LFFA 4DFXE 1STCE 2P55A 3KK8A 1YWVA 5AP6A 4AGDA 4RIXB 4F08A 4BY9E 3DA6A 4BI0A 2X9EA 3IGGA 4M84A 3NAXA 3RINA 4NJ3A 3BBWA 4LRJA 4YTHA 3UO4A 2WU7A 4YC6A 3ZRLA 4O7TA 4FGRA 3RK9A 4L8MA 3ZEWA 2BR1A 2UZTA 2ITXA 4IFCA 4MNEA 5AAGA 2B9IA 3MSSA 2J9MA 3QU0A 4AW2A 4I4FA 5IA0A 1JVPP 5KMKA 3ZM4A 5FLFA 4AP7A 5IISA 4JIAA 1H1SA 2HIWA 3VBXA 2BDJA 4M8TA 3DKGA 1VJYA 2B9JA 3Q4UA 4HJOA 4EH7A 4ZJVA 3KREA 2UVXA 2OJIA 4I5PA 3NYOA 1ZYDA 1YDRE 2WQNA 4L68A 4LM5A 2QI8A 1W8CA 4E1ZA 5GZAA 4BRXA 3GFEA 3OY3A 3Q04A 5IH6A 2WTWA 3HRFA 4X6QC 4I0RA 4QP7A 3BL9A 4QTDA 2W4KA 3QRTA 3ZFMA 4W4YA 3SV0A 1FPUA 3MS9A 4O7WA 5IQGA 3P5KA 4F7LA 2F7XE 3D5WA 3VVHA 4CXAA 4O0WA 3W33A 3NYVA 4I1ZA 3MFTA 3HAMA 3W0PA 2XB7A 1J1CA 3FI4A 2B55A 1IAHA 4PV0A 3NZ0A 3UO6A 1YI3A 5DRBA 3KMWA 3OCGA 4KB8A 1OVEA 4X0MA 5EH0A 3EQHA 4I93A 5CVFA 1TKIA 4HZSA 5KMMA 3TTJA 4XS2A 2YDIA 2X1NA 3UNJA 1PXOA 4UX9A 4EJNA 1XWSA 4O0YA 3IW5A 3QTZA 1H24A 4F4PA 4LGGA 1OECA 3EB0A 4IADA 4YZNA 3IK3A 3LFNA 2YM5A 1VEBA 1OIRA 3EKNA 3R8LA 3F3ZA 3HRCA 1NW1A 3G0EA 1H28A 2ZFYA 5JRQA 5DA3A 4FKTA 3E88A 4HNIA 3OW3A 1JOWB 1Y6BA 3QAME 4DBXA 3UE4A 5A6NA 5I9WA 3H30A 3C4CA 3QTUA 3KC3A 4KA3A 4JDJA 2ZOQA 3VS5A 3UDBA 5L8JA 4Y73A 5EQYA 4AXFA 2YIYA 4ZMEA 4U43A 3MVMA 4L7SA 4AOTA 4CEGA 2G9XA 4EOQA 1GNGA 4BI2A 1FMKA 3PSBA 4XG6A 1SVEA 2C0IA 3VNTA 5GZ8A 2ZV7A 4KIOA 4O4EA 4BDAA 3BQRA 5EYDA 4JX3A 2WMAA 4IDVA 2XVDA 5IQIA 1W82A 2JBOA 3IONA 1A9UA 4F65A 4L7FA 1NT2A 4RJ3A 3IDCA 4A9SA 1OKWA 3BX5A 2GSFA 2DS1A 3W0SA 4UY9A 5EM8A 3QA0A 4I5MA 1T45A 2WEVA 4IBMA 4E5AX 3SDJA 1T46A 3R00A 4F9WA 5CVGA 2GS7A 5IG1A 4YJOA 3AT3A 3O8PA 3NYXA 2CGXA 4F64A 3HV4A 3TIYA 4XCUA 3IW6A 3LZBA 4MX9A 4PTCA 2XF0A 5DEYA 5ICPA 4CG8A 3EQBA 3UYTA 2IF8A 3SW7A 3RJCA 4I41A 4IAFA 2O2UA 2W1CA 3L8XA 4E4MA 2H9VA 5L2QA 5HE1A 3FZTA 3MYGA 3DBEA 3B2TA 5HTCA 2QOKA 2RFEA 2W1FA 3C4WA 4QNAA 4D1XA 4L3LA 3RK5A 2QNJA 4FI1A 3E3PA 1H01A 3TG1A 3TXOA 4NU1A 3ZHPC 5JEBA 1YHWA 5FGKA 3RHKA 3TNQB 4ZIMA 4FIIA 1MRVA 5DLSA 3ORIA 3ZUTA 2VTRA 3BI6A 3MH1A 3OC1A 4V0GA 4YGAA 3MVJA 4RX5A 4QQ5A 3B2WA 4F09A 1IRKA 4A4XA 2SRCA 4B6LA 4C4HA 4CZTA 2OBJA 4DE4A 4IFGA 4CTCA 4GMYA 4LMNA 2BZJA 2BUJA 4DEEA 3F5UA 2CNQA 3TKIA 4QD6A 5EI2A 3SC1A 1GAGA 1SM2A 3DDQA 3GI3A 4QTAA 4X6RA 2OJFE 4TTHB 1U46A 4G3DA 2F49A 3E8DA 5LMAA 3V5QA 1V0BA 2VWVA 5B2KA 4E6DA 4YZMA 3BRBA 3LFSA 3LFQA 4U8ZA 3W2CA 3G9NA 2R9SA 4BCMA 3MTFA 4OUCA 3BYOA 1VR2A 3ALNA 2XK9A 2CHLA 2WTCA 1M7NA 4ZTLA 5CAQA 4NSTA 4B8LA 4BDHA 5A6OA 1A48A 4ANBA 1JPAA 4OLIA 1WBOA 1Q8UA 5K0XA 3BHHA 2WFYA 3A8WA 4XP3A 4HYIA 2W1HA 5CNOA 3VQUA 4BZNA 4EK6A 2VTTA 5H8EA 1G5SA 2AQXA 4ACMA 1OUKA 3HNGA 3R01A 3P7CA 4EH5A 5DMZA 3IDBA 2IG7A 5CSHA 3AKKA 3TMOA 4DEBA 4BJJA 2XCHA 3L9NA 3WZJA 4M67A 3DJ5A 1TQPA 3EYHA 5E8ZA 4U3YA 3GC9A 4FOCA 4B8MA 2AEGA 1VZOA 5EYKA 4O7YA 3LJ1A 5I3RA 2F57A 2JKKA 3GGFA 3QQGA 1G8SA 1UVRA 3VHEA 5HQ0A 3N4UA 5AR5A 4CNHA 4YPSA 4BCFA 5HCZA 4FVRA 1YDTE 3QQUA 3QYWA 4YR8A 3TV6A 5B2MA 4EH6A 5FXQA 5TO8A 4OAVB 4IVDA 4YURA 5K4JA 1PYEA 4D4VA 4FK3A 1IA9A 3Q6UA 4EHZA 2C6TA 4U6RA 3A7JA 4MWHA 2X39A 2OSCA 2BRNA 4R7BA 1PXJA 4QMTA 3EN7A 3PJ1A 3FBVA 3R28A 5HVKA 4NL0A 4YNOA 1A06A 3U4WA 4I92A 4X3JA 3KCFA 4I3ZA 4N70A 1JNKA 3OWKA 4H58A 1M17A 2B1PA 2HZNA 4DH1A 1ZWSA 1EH4A 1PXIA 1VLRA 4CFMA 2ITNA 1Q61A 4QYEA 1QPJA 1OKVA 3IOKA 1BMKA 1Q5KA 2ZM4A 3MTLA 4ENXA 3R0TA 3NNXA 4NW6A 2X8IA 5C03A 3LKMA 4O7VA 4ACGA 2WTVA 3EQDA 4FT9A 4JAIA 4A4OA 2GCDA 3CQEA 4O7LA 1O6YA 2V5QA 3QZIA 1CMKE 4F9CA 5FTOA 3QLGA 4NTTA 5DIAA 5KZIA 2R4BA 5DRDA 3PVGA 4IB5A 3KF7A 4E4XA 4AXAA 3PXYA 4RJ8A 3DQXA 4O1OA 3WE8A 5HO7A 3ATTA 4IZYA 3I4BA 4UWYA 2LGCA 3DB8A 3ORZA 4M7IA 5CENA 2JDVA 3KVXA 3NNWA 4XRLA 3WZUA 5HU9A 4EH3A 2A0CX 4MH7A 4C3PA 4XP0A 1FBNA 3A99A 3VS7A 5C27A 3ZUUA 5AA9A 3NVKI 1Y8GA 3R63A 5IEYA 4NZWB 1TFFA 5CF5A 2VWWA 2IO6A 3BYMA 3BV2A 4MD8E 3CBLA 3U9CA 2XCKA 3ZBXA 4GL9A 4JRVA 4BGHA 5HX6A 2BCJA 1W2DA 3LOKA 4EBVA 3QGYA 5HNBA 4RFZA 2HYYA 4PQNA 5TKDA 4FKSA 3TNHA 4NEUA 4IM0A 1XR1A 3ZDUA 2F4JA 3PY1A 4ANNA 3PE1A 3C1XA 2JDTA 5CI6A 2UZNA 5HVJA 4X3FA 5FP6A 2VTNA 4TYIA 3HEGA 3M2WA 3QHWA 4NK9A 3DAJA 3K3JA 4L53A 2BDWA 2VTLA 4EQMA 3IGOA 5AP7A 4D4SA 3IW8A 4WBBB 4CSVA 4FV5A 5AUZA 4RWIA 2NP8A 4MK0A 4IAKA 4FV3A 4O0TA 5HIEA 1VYWA 3Q9ZA 5CU0A 3OBGA 5HORA 5JH6A 4IWOA 1KOAA 3ENHA 3UOKA 4H05A 2CMWA 3FYKX 3OS3A 3I1AA 3LE6A 2QU5A 5E1SA 5FTGA 4FNZA 5CZHA 1ZYJA 3GOPA 4ACDA 4YC8A 5HTBA 3R7IA 5EK7A 2Q0BA 3S95A 2WTDA 1FVTA