4B9AA

Structure of a putative epoxide hydrolase from pseudomonas aeruginosa.
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
298
structure length
298
Chain Sequence
TDPLLPGFDYLTLHTSAARLRVAVKGSGPPLLLLHGYPQTHLAWHRIAPRLAEDYSVVLADLRGYGESRALDEEGADYSKAALARDQLETMGQLGFERFAVIGHDRGARVGYRLALDHPQAVAAFVSLTVVPILDNWAAVNKVFALNAYHWFLLAQPYDLPERLIGADPEHFLDYTLRRMAQGRDIYHPQALESYRRAFRDPAVRHAMCEDYRAAVGVDADADQADRDAGRRLQCPVQVLWQERPYAAGQHPLEIWKTWAGQVEGAAIGASHMLPEDAPDAVLEHLLGFLASHREALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Aeropath Project Targeting Pseudomonas Aeruginosa: Crystallographic Studies for Assessment of Potential Targets in Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Hydrolase
molecule keywords PROBABLE EPOXIDE HYDROLASE
total genus 112
structure length 298
sequence length 298
ec nomenclature
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4b9aA00
4G9EA 5DYWA 1C7IA 2XT0A 5FPPA 3QMWA 2WIFA 3M3DA 4KEAA 1TRHA 2DCMA 5T4BA 1ZIXA 3VVLA 4JH0A 3WK5A 5C8ZA 3HJUA 3H2HA 5AKHA 2GYUA 4IHAA 2VEOA 1H2WA 4N5HX 3PE6A 1ZICA 3WLAA 4QLAA 2H9YA 2VJCA 3R3UA 2P8SA 2EDAA 2CUTA 4HVTA 2QOEA 4IH9A 1FFCA 4ZV9A 2HU5A 1SCQA 3H04A 3E3AA 5A2GA 3EQ7A 2IIVA 4DMKA 4AXBA 2WHPB 4GWLA 3H2IA 1ZJ5A 4YX9A 3OTQA 5ALKA 1XRNA 4I19A 4EA6A 3K9BA 2PSHA 4AN1A 4MJ3A 1XFDA 1XKLA 5A6VA 2XI4A 1E8DA 2OPHA 1I6WA 4K6GA 3G9UA 1ODTC 1F8UA 3GBSA 4HXEB 4Y2YA 4B84A 4J0KA 3C6XA 3G0CA 1YA4A 1YAJA 4LIPD 4FLEA 3V1KA 1X70A 5AIBA 1L7QA 1KEZA 1LPPA 2XUFA 3O0DA 4G9GA 3RARA 5C8XA 2OLEA 3KDAA 4C4XA 2WIDA 1JJFA 4U2CA 2XQGA 5J3JA 1LPMA 3HABA 3KWFA 2WHPA 1DX4A 3UUFA 5A62A 4F60A 1WHSA 2OXEA 5DLPA 4FBMA 1CUXA 3HLKA 2D5LA 4ZGBA 1CPYA 1XZDA 5AM1A 3ICWA 3WQHA 1UOPA 3WL6A 1ISPA 5ALPA 3ESDA 2Y2VA 1EDDA 1LBSA 5LZ7A 2OQVA 5AKYA 3QZUA 3PUHA 4DTCA 4B0OA 4J0GA 3BIXA 3ESCA 1QIEA 5HF5A 3DYIA 6YASA 3AZPA 5LLSA 4BE9A 1XQVA 1EDBA 1IUNA 1QIGA 4PW0A 1GKKA 4B82A 3GA7A 2DHCA 3HACA 2PX6A 3E1GA 1E5TA 3QPCA 5FRDA 4HAIA 4BZZA 4UBJA 3ZLVA 3A2MA 4DM7A 5FPQA 2B4KA 5AK5A 4HXFB 4K5QA 4EY7A 4C88A 5HZGA 1DQZA 4P92A 1XZAA 2B20A 1GKLA 2NW6A 3I2GA 4BRZA 1LZLA 3VKFA 1XRMA 2PUJA 1ZD3A 4KE6A 2VATA 4F5ZA 1G66A 4FNMA 5AOAA 3JWEA 1QOZA 4CCWA 5DTJA 2ZJFA 3IVMA 5DYTA 3DJYA 1SCIA 1J1IA 2B61A 4UBLA 3E0XA 1PJAA 4X6UA 1Y37A 1J07A 3ESAA 5FLKA 3I28A 4BYMA 3DQZA 4Y7DA 5HKBA 2WFZA 1DWQA 1G5FA 2QVBA 2ZSIA 3I1IA 3D7RA 3WYDA 1P0IA 1FFDA 1R4ZA 3D5EA 3IBTA 5JALA 1EINA 5DJ5A 1CEXA 4OYYA 1R1DA 4GI1A 1CRLA 1MU0A 5ALZA 1UZAA 4MQMA 2RI6A 1QIKA 1MT3A 4F21A 2XMSA 5CH5A 1W52X 4ARAA 2WJ3A 1HKHA 2JGFA 4EUSA 5BWCA 4ZV7A 3VJKA 5CT8A 3VISA 3O9MA 4FFWA 2PM8A 4QDUA 1HDEA 3VVMA 2JGKA 3G9XA 4Q34A 2HA6A 2BKLA 2XQKA 4OPMA 2YASA 1ZGBA 4G4IA 2QM0A 2I3ZA 3FNBA 1R9MA 5CW2A 3WZMA 1CUDA 2WG1A 4QDZA 4NMWA 5FV4A 3GELA 4N8DA 2HADA 1XQYA 2V98A 2WU4A 1U4NA 2Y6VA 4M0FA 4IO0A 4WDQA 5JATA 3VJLA 5K3FA 2RGUA 3R40A 1EB9A 5HF6A 1CUGA 1CUVA 5K3CA 1B41A 5AM5A 5ALHA 1YSCA 3FYUB 2JGIA 2IITA 3O95A 4OYLA 5AM0A 5LZ9A 2QZPA 5DNVA 2G5TA 1UK8A 7YASA 1GQRA 3ANSA 4W63A 5AKZA 1O6GA 5A7GA 4HZGA 2GBIA 4AZ0A 1P0MA 3WKEA 3HZOA 4QZVA 4UHHA 4L0CA 4C89A 5CH8A 4EY4A 1QGED 5D3ZA 3G0BA 4C01A 2ORYA 1MNQA 3O9VA 3UUEA 2XQIA 4FOLA 3O4JA 5CXXA 4KAAA 3RLIA 1QO9A 2IX9A 4DSZA 1YA8A 3I6YA 4PO3X 4E14A 5AOBA 1XRLA 4DIUA 4E46A 1ZI8A 3YASA 1PFQA 5JZSA 1EX9A 4UFOA 1R50A 4U2GA 5K5EA 3FVTA 4MWSA 2ZJ6A 5CH3A 1L7RA 4H7KA 2WILA 3I6MA 3BIWA 1WCYA 3I1YA 1CUSA 2CB9A 3B5EA 2BGRA 5AKXA 4LHEA 3BDIA 1N1MA 2GBCA 1VE6A 3F98A 4U2FA 5JARA 1BN6A 4BZWA 1EVEA 1W4LA 3AZOA 4PSCA 2BAGA 4H35A 5ALVA 4G5XA 3HC7A 3BXPA 5DWDA 5ALQA 3WWOA 2GZSA 3IUQA 3T4UA 1JFRA 3H2KA 2GYVA 2XQFA 3R3XA 1XLUA 4G4GA 1ZIYA 5K3BA 2DFPA 1RYYA 3W2TA 2VJBA 5AOCA 1ZJ4A 1JJBA 5AKKA 4FLFA 3BDVA 2WHQA 4X93A 3AIMA 1TCBA 5AK4A 5AKLA 2PSFA 3QMMA 1IZ8A 2XMGA 1H23A 3EIOA 1Y7HA 2ZYIA 3ILSA 3R0VA 5ALGA 4ZREA 1QIDA 4XIIA 1H2XA 1CUBA 5I9IA 5HK8A 5JAOA 3W04A 1CUUA 5JANA 3KWJA 4G8BA 3WKBA 2RAUA 4CCYA 4Q1VA 4G1FA 4ZWNA 2OCKA 3V1LA 1DTEA 2JEZA 2X76A 3W9BA 2QUAA 4MQLA 3VXKA 4H7HA 1CUAA 2CJPA 1H22A 4AZ3A 1K5PA 5HFAA 3C8HA 4C4YA 1XZGA 4A16A 4EZIA 3AIKA 2H7CA 1VA5A 2HRQA 2XUIA 1XZCA 3FCXA 1ODCA 1AZWA 2DHEA 3I2JA 4J7AA 1XKTA 1A88A 2C7BA 4B7ZA 4X3CA 1AKNA 3C45A 5JIBA 4X90A 4X7BA 5AI4A 1GPKA 2C4HA 5E2IA 4B6GA 1VLQA 5KREA 2HU7A 3AZQA 4IH1A 4AO8A 4GBGA 1ZD2P 2WFLB 2DQZA 2QRUA 3JW8A 3L1IA 3DYVA 4H77A 5AKGA 4CI9A 4B80A 2VJDA 3H1AA 3SWWA 2ZYHA 1K4YA 2O7VA 1ZI9A 5ALYA 3Q8WA 1FFBA 2V96A 4J3JA 4WCVA 3TRDA 3WJ1A 3FSGA 1T4MA 2WUDA 1DX6A 5EIAA 4Y2JA 2XMZA 2VQ6A 4NZZA 4BC1A 2OCLA 3FBWA 3HSSA 4FNGA 2WUFA 3G7NA 1T2NA 1UKAA 1JJIA 2OGZA 2I78A 1P0QA 4PSUA 2XUAA 4GXNA 3SC2A 2VAXA 4DNQA 4Y2QA 2Z5GA 3AUKA 3NOXA 3WA6A 2RONA 4JUIA 4X00A 1JMYA 1WPRA 3DKKA 4INZA 5LZ8A 5FOQA 4B85A 3G8YA 3QM1A 4BBZA 4UBKA 2PSDA 4DLNA 5C8VA 5ALDA 5AI5A 4TVKA 1YASA 3ZLTA 2FJPA 1QFMA 3LCRA 3G0IA 5IKXA 2WFLA 4PF1A 3O4IA 4K6KA 1QIMA 4HS9A 4X85A 4QEKA 1G4HA 4Y9SA 1R9NA 1QZ3A 3AFIA 4BAUA 4DMHA 1VXOA 2HA2A 1CUZA 1YB7A 5CT9A 3U1TA 5CXUA 4OCZA 1SOMA 1TKRA 3STYA 1LPAB 2WQZA 1DQYA 3GROA 1Q84A 4J0DA 4BCBA 4BAZA 2BUCA 3DD5A 4G8CA 4D9JA 5K3FB 2JGMA 2XUKA 5T4FA 1USWA 3CXUA 3STWA 2BJHA 4W9RA 2WUEA 3ZPXA 1U65A 3FLAA 5AO9A 3ED1A 5EIHA 2JIDA 3FCYA 4IQ4A 1SC9A 3LLCA 2OAGA 3FYUA 2Q0XA 2RHTA 1CUYA 3QPAA 5JYCA 1GQSA 5LKRA 4GECA 4LKOA 3STUA 3WIOA 1A8SA 3FAKA 1UWCA 1WM1A 3ICVA 4Y2VA 4LXHA 1YS2X 4XX1A 5ALIA 3N0TA 1LPBB 1AC5A 3LP5A 5LZ2A 1CIJA 5LIPA 1QO7A 3A2LA 4BB0A 3DL4A 3G9ZA 1GT6A 4PSDA 2BUAA 4XVCA 4BTVA 3WK6A 3AINA 3F67A 1MJ5A 4OUKX 3P2MA 4NVRA 5IH7A 3R3WA 4RNCA 3WKDA 1A8QA 4J0HA 5ALWA 4JYPA 1YAHA 4CG3A 1TCCA 1YB6A 3MUNA 3EF3A 1QE3A 3PDCA 4BATA 1WB6A 3HYSA 4CCYB 1W1IA 2XUJA 4UFPA 1O6FA 1CUWA 3DCNA 4RPCA 3DKRA 3KSRA 5CT5A 1QLWA 1VE7A 1CUHA 1D07A 2JGLA 1FFEA 2HA4A 4X91A 2C0PA 4UBIA 2H1IA 4OSEA 4WJLA 4UBMA 2AXEA 4X95A 1LBTA 1ETHA 4CIBA 4AQDA 5AI0A 2OAEA 3IB3A 3ESBA 2JBWA 3KXPA 4KJXA 2CEKA 2HL6A 1BE0A 1GPNA 3G0DA 1DWOA 4BVKA 4EHBA 3S8YA 2PBLA 3HI4A 2EEPA 3VDXA 4DNFA 5A71A 2C58A 3AJAA 4V2IA 5ALUA 3U0VA 2AJCA 1CLEA 1ZGCA 1GZ7A 3WWPA 5DYYA 4JNCA 1Q0ZA 4GLBA 3WKAA 3FOBA 2ZJ7A 2AJLI 2OCIA 1SCKA 1CUIA 1NX9A 2VAVA 1MPXA 4OB8A 3H18A 5AM4A 2FX5A 5AICA 3DOIA 5YASA 2OG1A 4ZXFA 1WHTA 5C7YA 2WIJA 5DNUA 4OB6A 4LXGA 5JD6A 4WY8A 3R3ZA 4H0CA 4FHZA 3T52A 2K2QB 1C4XA 4BVJA 1CQWA 1F0PA 4Q05A 1UKCA 4MYDA 4OB7A 2HA5A 3WI7A 5HK9A 4AMZA 2XLCA 3L1JA 1S8OA 1W75A 1ORVA 2Z8XA 2QR5A 2WTNA 4MXDA 1GPLA 1NU8A 3C43A 1BRTA 5AM3A 1RWQA 2WLSA 4WFKA 3OC0A 1JU4A 1VA4A 5CMLA 1ACLA 5AIAA 4H7EA 3DEAA 3ANTA 3PICA 2WIGA 2JGEA 2R8BA 3QITA 4WDRA 1MX1A 1CUFA 4QA9A 4QDOA 3F9CA 1QIJA 5K3AA 1ZOIA 1H2YA 3C87A 5HCUA 3TGLA 2ACKA 5AK6A 2YYSA 3RKSA 2VF2A 4FBLA 3H17A 2XUOA 4BDTA 1HLGA 5A7FA 5I8PA 4HRXA 4FFVA 1CQZA 1XRPA 1QTIA 3SX4A 4JYMA 2HA3A 2H7XA 5AM2A 3OOSA 1K63A 4EY6A 3D2CA 4X94A 1IUPA 4OD0A 4W1PA 4U2DA 4DGQA 1ORWA 1GXSA 1ZD5A 1CVLA 1DU4A 1MAHA 1FJ2A 1EB8A 3C5VA 3ZI7A 1R3DA 3W06A 1EDEA 1TQHA 1XZFA 5HKAA 3I2IA 5AK3A 4K6HA 5ALFA 1MX9A 5IVHA 5ALLA 3A70A 3MVEA 3CCCA 4GHWA 3H2GA 3D2AA 3UMJA 2Y1KA 4J0JA 5BWBA 5ALJA 1XRRA 4MEBA 3B12A 4QWMA 3H1BA 4X97A 4QLOA 4WY5A 5FUMA 4EBBA 4E11A 5DNWA 4QNNA 1XZJA 5AHXA 1CUJA 4QDTA 4PQEA 1IVYA 1NU6A 4E15A 2VJAA 1E89A 3WWCA 1E8MA 4Q3OA 5ALSA 1KU6A 4TGLA 3BE8A 3RK4A 5A7HA 4EB0A 1N8SA 2WSLA 3H2JA 1YCDA 5AI9A 1AX9A 4KRXA 2Z3WA 1BROA 2DQYA 1TK3A 4X6YA 4BP8A 5HQ3A 2AJDA 1LGYA 2XUPA 4FTWA 4BP9A 4AO7A 4W1SA 2HDWA 3GFFA 4C87A 2CKMA 2WKWA 4Q3KA 1XZHA 3L1HA 4W1QA 3LIIA 1DT3A 3O4HA 4AN0A 2Z3ZA 2QUBA 4FKBA 4J0IA 5ALMA 1XQXA 4H7DA 3QMVA 1X2EA 2ZVDA 1WB5A 3V1MA 3BF7A 5HF8A 1EH5A 2PUHA 5ISMA 4XJVA 1UK9A 3ZV7A 4KE9A 4HXGA 4Y2PA 1CFJA 1UOQA 4N8EA 2C0QA 5H3HA 3OURA 2D0DA 2DR0A 3R3VA 1H2ZA 3DDUA 3QPDA 1EVQA 4GW3A 3IUJA 4W1RA 3ZWQA 3WK8A 3IUMA 4ETWA 4FLMA 1N5MA 2DHDA 4N8SA 2XMQA 2XMBA 1LPOA 3HRHA 1UKBA 2HFKA 3FLBA 4B9AA 1C7JA 2J4CA 2GYWA 1VOTA 3TJMA 3KOOA 4UHDA 2AJBA 2O2GA 5E4YA 2XMDA 3BWXA 2V9ZA 2HA7A 1RP1A 1AMNA 5E4JA 1EHYA 5JZ9A 2O2IA 4BCDA 4BAGA 3QVMA 3WIBA 1J2EA 4ITVA 5BV7A 1OILA 2W22A 1KU0A 3MGAA 5AKJA 1LPSA 5T4EA 1M33A 2JEYA 2CMFA 4LXIA 5JASA 3BJMA 1HPLA 3D0KA 2QJWA 3QBJA 5JD5A 1EK1A 3OM8A 3CN9A 2XLBA 5AP9A 2ZYSA 3V9AA 2C5FA 3DLTA 1XRQA 5AI6A 5ALNA 4DSAA 5SYNA 2WG2A 3MUOA 2QXUA 2QKYA 3I6ZA 2XMCA 3ZLUA 1IMJA 4G8DA 2PL5A 5D3KA 3OG9A 1BEZA 4ZI5A 3DOHA 2CZQA 2I3DA 3A2NA 1ZI6A 2QS9A 2HIHA 1XZBA 3D59A 1XLVA 4J03A 5FXMA 4ROTA 1DWPA 5EHXA 1JU3A 4UBOA 1A8UA 2ZYRA 1AGYA 5BOVA 2DSNA 5D7BA 3IURA 5FP0A 2J4FA 3RM3A 5AJHA 2WHRA 2WJ6A 4UPDA 3H19A 2XQJA 3W05A 1L7AA 4EY8A 2OGSA 5I7UA 3FYUC 4GEGA 5LKAA 3HXKA 5EFZA 1XQWA 1VKHA 2RIPA 4UHBA 3C8DA 2WU3A 4LYDA 3V48A 4ARBA 4KR0A 1EA5A 1F0NA 1QJ4A 4NS4A 3WL8A 1OCEA 2W6CX 1QTRA 3C6YA 3K6KA 4AX4A 5LYYA 3WWEA 2QXTA 1IZ7A 4RGYA 2GZRA 5ALTA 4AMYA 4BDSA 2GBGA 2HU8A 5KBYA 1XZEA 2HFJA 1MAAA 3QYJA 2J3QA 4X6XA 1E3QA 3F97A 3M82A 5JZBA 2PPLA 4P93A 3BF8A 4M0EA 3WK7A 2G63A 1UT6A 1FSSA 1WB4A 5HF9A 4J0CA 2CBGA 4QDXA 3O4GA 5ALEA 5CURA 4C4ZA 3GZJA 3WL5A 1AURA 2OGTA 1VZ2A 4KE8A 3TEJA 5IVDA 3G0GA 4H18A 5EI5A 3WK4A 3I2HA 5ESRA 1UK7A 3I2KA 5CRIA 1QIHA 3EBLA 3WL7A 5ALOA 5LZ5A 3STTA 1TIBA 3D3NA 3SK0A 4YK7A 2PU5A 4UHEA 4M0MA 5EHZA 2YH2A 2YXPX 4YPVA 5FDFA 2QJRA 1MNAA 4PV7A 1Q0RA 1QIFA 4LYEA 3PFCA 5EGNA 1XZMA 2HM7A 4MEAA 1SFRA 5LZ4A 1HL7A 2VTVA 3FSGD 2E3JA 2X8BA 1CR6A 2WG0A 4Q3LA 2XUQA 2ZSHA 1JKMA 2QT9A 3C70A 3WYNA 4Y2UA 2ONCA 1BEEA 2FJ0A 3EQ8A 1BS9A 1B6GA 3IULA 4UBNA 1ZD4A 4Y2SA 1VJ5A 2WFMA 5E4TA 4U2BA 3C5WP 3D4LA 4KAJA 1TCAA 4DNOA 1CV2A 1THGA 1WPXA 4IH4A 2Z8ZA 2Y2UA 5HFNA 1XZLA 4QWWA 3A6ZA 5F4ZA 1VZ3A 5SYMA 4KE7A 2X5XA 1LNSA 2PKYX 4ZRDA 1A7UA 3WZLA 3B3QA 4L3WA 2JF0A 3LIPA 3N2ZB 4UFNA 1BCSA 4KRYA 5IVKA 1U2EA 2EDCA 1E8NA 3WWDA 3PI6A 3Q0TA 1QIIA 4OU4A 5AH0A 1K8QA 2UZ0A 5DTIA 3CN7A 2J3DA 2ROQA 1J06A 3R3YA 3G02A 2VSQA 3FVRA 1HBJA 5CBKA 3NGMA 1YS1X 2OQIA 2ECFA 3LS2A 2PU7A 5KWIA 5JAHA 4Y2XA 4YASA 4EY5A 4BVLA 4FDMA 3PF8A 4O08A 4BTLA 4DYHA 4Y2RA 4I3FA 1HQDA 4CG2A 1LPNA 2RHWA 2WUGA 3WA7A 4OU5A 1AUOA 4UHCA 3FYTA 2GBFA 5LP1A 5EHNA 1W6RA 2C5GA 3V1NA 1ACJA 5CT6A 5K3DA 3WJ2A 1FFAA 1G42A 2LIPA 2XUGA 2ACEA 5KWJA 2WJ4A 1MX5A 4K2AA 3C6BA 1UFOA 1BN7A 4DMCA 4I4CA 4HRYA 2PSEA 5AI8A 4DMFA 2AJ8A 3G9TA 2O2HA 5T4HA 5K3EA 2XUHA 1THTA 1PV1A 1ODSA 4DNPA 2G4LA 3FLEA 4X92A 1LLFA 2XUDA 4BCCA 2VT7A 2QMQA 5CTAA 4JEIA 1WOMA 1E66A 2HA0A 4S0XA 4RE6A 2I03A 3X3HA 3PF9A 5HQ3B 3WKCA 4MYSA 3AIOA 3R41A 5IVIA 1EI9A 3BJRA 1P0PA 2XMRA 1XZIA 4P08A 1UOOA 4X71A 3M83A 3HEAA 4H7FA 1EK2A 3IDAA 5JADA 1W76A 2R11A 3AILA 4RE5A 3CCBA 1UXOA 1MN6A 3WMRA 1F6WA 1MO2A 4U2EA 3STXA 4N5IX 3QH4A 1XLWA 2PSJA 5D6OA 4G4JA 3E4DA 1X2BA 5JAPA 5JD4A 2XE4A 2V97A 1CUCA 2XB6A 4B83A 3D2BA 4FWBA 3DS8A 5JAUA 2H7YA 4WFIA 4CFSA 3PFBA 2QTBA 1QONA 2BCEA 3NWOA 4WFJA 4CG1A 3STVA 1XZKA 3EQ9A 5ALXA 4B0PA 1BU8A 1YR2A 2HHAA 4AO6A 1Z68A 1JMKC 1Y7IA 4FMPA 2BGNA 4BC0A 1R88A 4PNZA 1LZKA 2BUBA 1JT2A 2PVSA 4AB1A 3IIIA 1AQLA 3K2IA 5AKEA 5EHQA 4XWGA 2ES4A 3PUIA 3OPMA 3S2ZA 4KAFA 1CUEA 1DINA 3C6ZA 4H7JA 4Y2TA 1IUOA 1GGVA 1VXRA 1DT5A 3H0CA 4GDMA 3F96A 2G5PA 2B9VA 3DNMA 1QFSA 5ALRA 4A5SA 1MTZA 2WTMA 3NUZA 4BRSA 1U8EA 2BFNA 5AKIA 4HTAA 4P9NA 3FWHA 5EIEA 2O7RA 3F8SA 3DL7A 3I2FA 3JYHA 4Z49A 1OXMA 4B9EA 4QE3A 5FKJA 1UK6A 4H7IA 4TPKA 3IA2A 2XDWA 2WM2A 4BE4A 4MWTA 2VA9A 3W9UA 4B81A 3BL8A 3M81A 1N5RA 4KACA 2VT6A 1TAHA 2HRRA 4C6HA 2FUKA 1Q83A 1JI3A 4Q82A 4UUQA 5C81A 4L72A 3VJMA 5CT4A 1EXWA 2WIKA 4KYVA 4UHFA 1K6EA 3WK9A 2Y6UA 3GUUA 3IUNA 1XROA 4CIAA 3KD2A 2OCGA 2JGJA 4A23A 4L9AA 4F0JA 1BCRA
chains in the Genus database with same CATH superfamily
4G9EA 2CNBA 3P2YA 4KNYA 4G0QA 1C7IA 3ZY3A 4CMKA 2CLDX 1W4ZA 4GI3A 2PV0A 4ZARA 3F2VA 4BUCA 1ECPA 2GCOA 3R7FA 1TI7A 1YS6A 3V8VA 2VXCA 4OHKA 1A5SB 4L27A 4FKZA 3DHYA 3AX6A 4B3IA 2C2XA 5JWHA 4BQIA 2EX4A 1GNRA 2Z5LA 4RMJA 4ZOBA 3UA4A 2DCMA 1T34A 1KS9A 1YGPA 1YR6A 1BHSA 3SIPA 4C7MA 5HX7A 3K5WA 3DBHA 3QWFA 3RRFA 1JHPA 5JBIA 3QF4A 3VVLA 3I6IA 3WIVA 3HBMA 4DSUA 4AURA 3USCS 1I3OA 1ODFA 1SPXA 1TKBA 3CX3A 1Y3BE 3DM5A 3OX1A 4M1WA 4X6LA 1LS1A 2NUPA 1HKUA 1N2SA 5CU7A 1HXHA 5C8ZA 4Q0MA 1EUYA 4EB3A 1FYVA 2ZKIA 4FS3A 2G9QA 3RABA 4QYIB 2GJ9A 3PQ3A 4XCXA 3CNHA 2SICE 1R7RA 3O7MA 3HM9A 4H0FA 2O0LA 3WDSA 2VEOA 3HMQA 4PE5B 3HY3A 4N5HX 3O8OB 1L7MA 3QYPA 3VH1A 4E6PA 5HRAA 2UYCA 5MN6A 4TL8A 1K8RA 2XOKA 4UXJA 1HEYA 2WVJA 1VYTA 3L04A 2JFPA 2W2PA 4LNUB 1LSSA 2JI6A 3HR7A 3T7SA 5CDFE 4HH4A 2VCEA 2JANA 3W2GA 4GVPA 4HVTA 5DHTA 1XA3A 1T10A 3QLVA 2IZZA 1E96A 4IXWA 4LMAA 2AG8A 3C7KA 3PLNA 4NTZA 1EWYA 4JYBA 5KNDD 4Y6QA 3R5XA 1SCQA 1JDUA 3D3WB 1N8NA 2G72A 2PKQP 3CB2A 3WGYA 4G25A 3H42B 4UAVA 4XDHA 2PMKA 3KUUA 1GSOA 3W4KA 2GXSA 1SY7A 1FP4A 1H6BA 2ZS8A 1TZBA 2EJCA 4XSHA 1CU1A 4YQYA 5I9TA 2NM0A 1J0AA 1JJAA 3ESZA 3SEZA 4ZDKA 5KEIA 4CGYA 4Q4DA 1XUOA 3BMOB 5JQGB 1QG4A 4MRMA 1SGWA 4DLRA 1JG3A 3DGEC 4PZAA 3ITEA 1XRNA 4I19A 4BNXA 4C0AC 4QG3A 1FW6A 4ARSA 4EG7A 4TZ0A 3NTQA 1UFVA 3L2OB 1PFGA 4K6OA 4CIXA 2PSHA 1XLTA 3P9RA 3PKIA 1R0YA 2ENUA 2IEBA 3EPHA 1KJYA 3MJDA 4OGLA 2PV7A 3AONB 4RKQA 3V80A 2XI4A 3ORQA 3PXDA 4JBWA 4JY7A 1UDRA 4M8NE 3T7EA 5B1SA 2G8NA 3M0EA 1EXDA 3GLGE 5KYXA 1MCZA 1PE0A 3W5UA 2OPHA 1AGRA 3EK2A 1CNEA 1VL1A 4IMRA 1I6WA 4K6GA 1CDEA 1NQOA 4LVNA 4DQLA 5BSRA 5FUVA 2MSKA 4R1PA 3WICA 1GRVA 3P9CA 3RHSA 4Y2YA 3VU1A 1QC5B 2RHOA 1ZUD1 4J0KA 5T6BA 3ZNNA 1YA4A 4YBRA 1F51E 2DE0X 1PLLA 4UZFA 2IWHA 5AIBA 4LE1A 1L4FA 221PA 1F6DA 4MRVA 1YCGA 3IS3A 3VR3A 5C8XA 3V6MA 3OECA 2X8JB 2F4VB 3HXPA 3VDNB 4ZEXA 1Q0PA 2H5JA 1YO6A 4GFDA 2W2MA 1W25A 4RJLA 5K9ZA 4HDAA 2ZETA 5D5QA 2XQGA 1ZLYA 1RS0A 2HTEA 3ZWWA 2A5GA 4OAQA 3UUGA 1G20A 5CNKA 1W2HA 1OUMA 1VSQA 4GRDA 2I66A 2JZOA 2NNLD 2WHPA 3WIUA 3F90A 3HCWA 3SY8A 2PNJA 4X1KB 3T7RA 4EKDA 2NYUA 2ODAA 3DF9A 2YDYA 2ASEA 4P7JA 4XM0A 1UMDB 1G38A 1GPDG 2WYOA 5E7QA 5KSWB 3KUCA 1HE1C 4HWSA 2BCJQ 1ID1A 4I6EA 5MHTA 2OXEA 4KX5A 3PZRA 4O4LA 2H9IA 3R0IA 1K4KA 3AVYA 3R3JA 3Q3GE 4FBMA 4J0FA 1FJHA 2BHLA 5JAMA 4GRIA 1UBCA 3IP8A 2OLKA 3TAHA 3SC3A 3W5AA 4J1TC 1XA0A 3MPUA 3OEEA 3IEKA 4E51A 4S04A 3PFHA 2ZS7A 5AM1A 4ZGBA 3WQHA 4ADSG 2B7CA 3C3XA 3ZEIA 2Z2XA 1DFGA 4EYEA 4TT3A 2FEWB 1OLUB 1FPQA 2PQ2A 5JNRA 4UOEA 2I67A 2BONA 3F4KA 4LHXA 3T54A 1W9HA 2QRMA 4KKXB 4LUCA 3L7CA 2XWBF 5ALPA 2FSUA 4ND3A 3EGCA 4Q48A 1BHJA 2C5EA 3I9MA 1T0UA 1ESNA 1JTEA 1P9RA 3V4PB 1A8IA 2FRDC 4BTEA 3C3PA 4H0NA 1BS1A 4PVCA 4MWCA 5GVRA 3OFNA 3I5YA 1X7ZB 3QZUA 2YWGA 3DHWC 4YMWA 1HG0A 3VO1A 5KPJA 2VF5X 4JR1A 3SBXA 3GJ4A 3GLGB 1Z5GA 3BIXA 4JVMA 1W6UA 3KKPA 3IR6A 4AM8A 3CS3A 4KREA 5HF5A 2SCUA 2H5LA 4K9MA 4OHWA 3PXAA 5LLSA 4JB8A 6YASA 3RH0A 4PFQA 1ORRA 4DR1B 3UBTA 4G97A 4MJLA 3NASA 1I3MA 1QIGA 1TA9A 2VEDA 4LJ9A 5M5BA 2FUNB 3EUFA 3PUXA 4GQBA 3AEUB 3DT9A 1XQ1A 1LU9A 2NO6A 2VT2A 3RYIA 4DMLA 1M2OB 5AWFC 3WWZA 2N3ZA 2P5SA 3G8AA 5F78A 1T3SA 3WNQA 3SJBA 1QWOA 5DX1A 3AO0B 3EN0A 1MO4A 2BFDB 2OFXA 5ECYA 2GZMA 3NKLA 4DM3A 5HUJA 3D6FA 4EZEA 4LF9B 2O8BB 2FN8A 3HU5A 3TAUA 3TRKA 4IX1A 4UBJA 1U9IA 4IGIA 4IMPA 3LVBA 4YCJA 2OO7A 1NM5A 5L3ZA 3FRJA 4GI5A 2OCDA 5FPQA 3ZGZA 2Q41A 2FWAA 3UT5B 4AKEA 1SHKA 4OK6A 4HXFB 4J8PA 3NRBA 1Y4UA 1XELA 5BN4A 5AUPB 1XTZA 1S1MA 3I2GA 5KKCA 4K03A 1K08A 5KSOA 4I4TF 2Q3FA 1Z07A 4NIMA 2HYIC 2QMUA 4D3XA 2Q5JA 4EYKA 1JSXA 13PKA 3RE1A 3TFOA 5KNDA 1RMYA 1B0PA 1MBZA 3FGPA 2C5BA 1ISGA 2OV4A 3JPWA 3C1UA 1WW3A 3N39C 2VATA 4B40A 2FRDA 2QVLA 2ERYA 2NSJA 2Q8PA 1GVHA 4FE7A 1U0NA 2HCBA 1G8FA 3L7LA 2F90A 4ID9A 1C8VB 2H2IA 1RR6A 3PRHA 4UMEA 4D0LB 1M2NA 4F9TA 3B5IA 5NULA 4CCWA 4MUXA 2CLFB 4XA8A 2G5GX 3WHIA 5IT5A 1J0XO 2O7SA 3TQCA 3RRZA 2I6GA 3RSSA 2B1JA 4J1TA 2BZSA 1PV2A 4HYYA 3T3OA 3WL4A 1VPEA 1LF5A 1KI7A 1FMJA 3E0XA 4H17A 4E1BA 4EF4A 1R5NA 1PJAA 4X6UA 2ZANA 2B1QA 1Y37A 2GPBA 4L76A 4KO1S 4MRPA 5C3MA 2FW6A 2YNMC 3FDXA 3HEBA 4W99A 5FLKA 3RSOA 1RJWA 3JALA 5A5DA 2RHMA 1BOFA 2R2AA 1SQSA 3MYRA 3DMTA 2B92A 3WC4A 4RM3A 3PR3A 3DQZA 1V8DA 3OZIA 4TROA 1DKRA 1AK1A 4P36A 1TOAA 2CXOA 2G9UA 3H99A 4Y1GA 5B37A 3PVCA 3RF7A 2QQFA 1MO3A 1G5FA 1JPNA 1C0IA 1M7HA 2ZSIA 2PX8A 3L93A 4GEKA 4BU1A 5BVGA 3OIGA 3BE5A 1P2DA 3DTVA 3IILA 4LRWA 5KWSA 1GCOA 5K99A 2DUWA 2J3HA 3HXOA 4GGPA 3RUCA 4ZEWA 1OROA 5ER9A 4D79A 1W5TA 4FWIB 5JALA 5B1IA 1ZH8A 4JJZA 1Z16A 1ZH6A 2I7XA 2PZEA 3GUCA 4V02A 5DJ5A 2WF9A 4ASUD 4OYYA 3D9QX 5LBUA 3TCXB 1IY8A 1GYQA 1N9KA 4L8FA 1O9GA 1X86B 2I8CA 5ICGA 1RYDA 1HGXA 3K1TA 1R1DA 1P0FA 3KTAB 4P4UA 3E7FA 4MQMA 5C8YB 3Q3CA 1UWVA 1GU1A 2FEAA 4ZC8A 4F21A 2C2WA 1IJBA 1RJEA 1ULZA 1V35A 1ZNZA 3DF7A 2BR4A 1TW2A 5F3DA 5ELXA 1DVRA 2HDNB 1RC1A 3EOAI 5CCEA 5TMPA 5CBPA 4BFZA 3BHJA 1M5TA 2C31A 3NGXA 5EKTA 3H9EO 2CLEB 3M4XA 3SC6A 2JGFA 4H4DA 2CDAA 3RT9A 3TW6A 4JN6B 4E5VA 2HCRA 4QGAA 5FI1B 4LC1A 2YIMA 1TD1A 3VISA 1FDRA 1XLTC 3OIDA 3FNFA 3O9MA 4OQLA 4FFWA 2EQ5A 1RLTA 3NXSA 1UEIA 1Y1RA 3PC3A 2PM8A 4XDYA 3K8OE 4D43A 3SZGA 4N3AA 3LO8A 3HDVA 4X64B 3VVMA 4E3WA 3I62A 4M1ZA 3TLMA 5C8DA 4JLNA 5H70A 4Q34A 5FJIA 3BPSA 1FY2A 3GEIA 1T91A 2XQKA 4XEHA 4JLKA 5FOSA 4KQ9A 1Z7BA 5H83A 1NYRA 5HDQA 4EI7A 1O8CA 1JXQA 1T4DA 3CO5A 2I3ZA 4G4IA 4YTEA 3T3IA 3T3EA 1CYEA 4ZYLA 4A1FA 2CWWA 3ZWOA 4Z4CA 1JHOA 4NJMB 3GELA 1P2TA 1XTKA 2E1RA 3D3KA 4GRAA 1W4CA 4N8DA 5LOVF 1XNQB 5KNDH 2HADA 2NXWA 3VYUB 3E3MA 3SXUA 1XQYA 4KQ6A 3TIGA 3O8QA 3S68A 2BFCB 3NHBA 4XQEA 2XKJE 2JAXA 2NPIA 2Y6VA 4AYXA 3NNDA 3EDRA 4KTTE 4WDQA 1HUQA 2WTBA 1N5LA 2COEA 3LBNA 4PSVA 5FWXA 5G0VA 5SY4A 3HUEA 3H3XA 1E5DA 2ZXUA 1ZZEA 1AKMA 3IDSA 1U9ZA 5FWNA 4ALIA 1IY9A 1R3UA 1S8NA 2H65A 3WL3A 5K3FA 1ZXBA 2XCTB 1A4RA 1DAEA 3DVRX 5P8WA 2RGUA 3EXHB 1XJ5A 1B2RA 1TLLA 1FMTA 3GPIA 3GN1A 5DI3A 5CB4A 3HK2A 1Y3DE 2DFDA 4R68A 2WHYA 3L7JA 5HF6A 1JLLA 1GR0A 4AWXA 3ZCVA 2IYYA 1PZNA 2P9QA 4BQQA 1MR3F 3ROTA 4EVQA 3HJGA 5FAKA 3PFWO 3GDHA 4MRSA 5HJ5A 4I1UA 5HP4A 2PKWA 1B41A 2PA0A 1AS0A 2I3AA 4QYSA 1P7WA 4FIDA 1YJ8A 1OA0A 2VPXA 3E9RA 3FYUB 3GH1A 1AQUA 4OMCA 4QQFA 1XNHA 3R9XB 2BFOA 2YXNA 3KEFA 3SXPA 2MSCB 3ZD7A 2IS2A 1FXSA 2JNWA 4CF3A 2IT1A 2PAFA 5D86A 4OXKA 4KLNA 3WHLA 3HGTA 1X19A 4HQLA 4NZOA 2YBEA 1UK8A 2EEZA 2YFYA 3ANSA 3QXHA 1E2PA 2CVOA 4RFLA 2JA1A 2XWSA 4ME6A 5TARA 4TTPA 5JSZA 2VYNA 2GF9A 1EUCB 1O6GA 4NYMR 1TTHA 4HZGA 5CG2A 1CE8A 1VCHA 1FNMA 2YNMD 4AZ0A 4J0QA 3U0BA 3L46A 4DUGA 3CRNA 4EF5A 1P0MA 3WKEA 1NFRA 2P5UA 4URUR 1XZQA 2X2OA 4J1SA 4UHHA 1M7GA 4L0CA 1E61A 1U8UA 1GVNB 3PCXA 2FWJA 4KFCA 2FWMX 4J9UE 4Q02A 2QLTA 2O7NA 1PK8A 4JVNA 1QGED 1BMTA 4HDKA 4C01A 2ORYA 4R2WA 3K09C 2ZEJA 4NAHA 1DEKA 5F4BA 2PGDA 2R6AA 4IRXA 1XXHA 2DULA 5KYYA 1SM4A 1IBCA 1PBNA 1QMPA 2ZRHA 4GC9A 4LW8A 2D1FA 2FVXA 2WA2A 4J1NA 1DS6A 2ANBA 4GX1A 4DV0B 2KB0A 5B6IA 3T9AA 2WWYA 4PO3X 4XIYA 3S7TA 2JDID 4PLFA 1FP6A 1ES9A 5EXDA 3RVKA 4R41A 3D3WA 2A0XA 5AOBA 1NXQA 3GRCA 1D2RA 4J94A 4A0HA 3W1WA 1NUAA 2CXHA 5CGQB 2R8EA 3GX1A 5JO9A 1V6AA 2PJUA 2I1VB 4KIGA 3NIWA 3IR7A 4HB3A 1KPHA 4FGUA 4MVJD 5DHAA 3WFIA 1HDYA 2H54A 1PF7E 3BK7A 3YASA 1PJ2A 3EMDA 4KNWA 5F3WB 1ZW1A 2HX1A 2QMEA 4Q7QA 2G04A 4RAOA 3U7IA 4EUKA 4H1WA 1Y80A 2FAXA 1KBZA 1RBZA 1ONPA 2PBRA 3NOVA 1RI5A 1ORTA 5EXXA 4JI6B 4U02A 4FGJA 3FVTA 5K5EA 1IXYA 2BTEA 3F7NA 1EBBA 3PGA1 1AUXA 3O8OA 2DAPA 1BCRB 1L7RA 3AF4A 4LOLA 1I01A 1BDMA 3ZBPA 4HAVA 1XCBA 3I6MA 4WEOA 2P9HA 1TM5E 3E5HA 3KLOA 3FVQA 2YQ4A 4GKKB 1P77A 4C0BA 3IAS6 2CB9A 3B6JA 3DEZA 4IKEA 3B3FA 3HI6A 5BSHA 5ED4A 1N1MA 2J5XA 5FA5A 3OOHA 1A7JA 1HI9A 3CEHA 1BN6A 5FV4A 4BZWA 1CT9A 1EP3B 3E84A 4GF5A 4M1EA 4ZAYA 1JYEA 5JFTA 3FH0A 3GLFE 2CMHA 4ZOLF 3LM8A 1OXBB 1WY5A 3AZOA 3QKUA 4QAQA 3SC2B 4CTOA 1E77A 2NZUG 2M98A 3HU1A 3LGSA 3ME5A 1M8FA 4NYJQ 5TJ9A 4CV0A 1RI4A 3U7QB 1VSUA 2ZQZA 1GN9A 2CMGA 3DAGA 3K15A 3KTOA 3QLUA 4WCDA 4HLUC 4YFVA 3MXTA 5DLEA 5LNK6 3DOCA 3CPEA 3WWOA 1YE8A 1N1DA 4Q6BA 2GSWA 1NYTA 1JFRA 1LQTA 1ONBA 2VZ0A 2XQFA 3VH3A 4FZ3A 2P6OA 3PLRA 3R3XA 4N65A 4Q12A 1HEIA 2ZRLA 1GILA 1WXIA 2NUAB 4Q6WA 5K45A 2OCXA 4XLLA 1FYWA 1BFKA 4B5LA 3L0CA 2I6QA 1VG1A 5E3HA 1XTIA 3WB0A 1NN3A 1QK4A 2IH2A 4D0RA 2PVCA 1Q0HA 5COQA 2H8GA 2DLDA 5AOCA 1ZJ4A 4P81A 4QYWA 1JJBA 3KVVA 2NO7A 4FD2A 5IYZF 1HE3A 5FBKA 1KARA 1P80A 3MFQA 1M34E 3BDVA 2O2CA 1PVOA 5CDGA 2WHQA 3G68A 4X93A 1NY5A 4ZT7A 2G28A 2H4ZA 3NVAA 2H31A 2FPIA 5FA6A 4YV2A 4I1YA 3ZE7A 1UH5A 1MFPA 1RLIA 2I65A 4H31A 4NQRA 1KKMA 4C5CA 3UIEA 3OPNA 1BWRA 3DUFB 5CB4B 4WY2A 1GU0A 5HNKA 2KLBA 3BXGA 4DV4B 1EESA 5GZ6A 4Q7EA 4M1QA 3EIOA 1Y7HA 1KY2A 3U7RA 2ZYIA 2ZJYA 4JJKA 2GVNA 1F4PA 5CITA 1BMDA 3P4UA 2CCGA 3N2GB 1OVMA 3C5HA 3KPVA 5ALGA 1BAPA 4ZREA 3TVYA 4XQ0A 5IKPA 1FU8A 1CEQA 2WJJA 4FMCF 4XIIA 2FF7A 2G36A 3K0SA 2JH9A 2NUTB 2VPTA 2ZYUX 5CHEA 2F55A 2P91A 3NC1C 4Q9KA 3COWA 2B2NA 4YYEA 2JBAB 4M9CA 3EA0A 3I72A 3RFXA 4RU1A 2Z09A 1FL9A 4QUIA 2W6IA 3W04A 3SQMA 1F14A 1E4OA 5IKOA 1CF4A 3VR4D 3JAMA 4EHDA 1L5GB 4KQXA 3KWJA 4G8BA 1NVWQ 2D0OB 2R1VA 3SAJA 3MJEA 4OLAA 2GNAA 4G1FA 5LP6F 1VGQA 1DADA 3PD1A 1R6BX 1UCFA 2OYSA 4GGMX 5LP6A 2DR2A 1UBTS 4D41A 1BVRA 4JL5A 4LDAA 4MW4A 3V1LA 3DXYA 1IH8A 5J5AA 1M8JA 1I3LA 1EKXA 4KR9A 2A0FA 3A6KA 4K86A 3USZA 1NURA 1E69A 1PWXA 2RI0A 4YEDA 3ZHTA 4C04A 1V9SA 2VOJA 5EIXA 4US0R 2V7XA 3VJRA 2DKOA 1V4VA 5FRDA 3M49A 1G0OA 2GH1A 3N8DA 4H7HA 5EUBA 3RFVA 1CUAA 3SZ3A 4YPOA 3MRVA 4AZ3A 5KX5F 2I6FA 3G8CA 2QMYA 4UEKA 3C8HA 3TOCA 5K8UA 3KSAC 1CDZA 2VYQA 4GKAA 2XA1A 2WUWE 3KU1A 4IDQA 2HRQA 4KMOA 3D81A 2BFEA 3U2QA 1KTIA 5J2TF 2JIZA 1ZNQO 3OY2A 1N5KA 2HZ7A 3NATA 5G40A 3VR1A 2P9YA 3CURA 2DHEA 3RS4A 1M72A 2BFMA 3EPKA 2AFVA 1TF2A 2WAMA 4ECEA 5DLYA 4EW6A 1XKTA 1A88A 2R7NA 5AUNB 1G5HA 2D3WA 2UVDA 3BRWA 4Q1BA 2F9FA 3X1KA 2VNAA 5L4LA 1GPKA 4UUNA 1B0ZA 2BTQB 1RAGA 2YDXA 3JWGA 2ECKA 2JJ8A 3RSZA 3RVQA 4D9EA 2XOKD 4K3VA 4RXTA 1YZLA 4UE3S 2HU7A 2AOWA 1DB3A 5B58T 2ZYWX 3ETNA 3TQTA 4HAUA 2VZ8A 5AVSA 5LYJB 2O8EA 2Z1DA 3PS9A 4IH1A 4IV0A 4TRRA 3B60A 2BP7A 3GRYA 2ECOA 2WF6A 4I4IA 1ZD2P 2JFYA 2WFLB 4JJ4A 5TB5A 4WBSA 4C0WA 3LCUA 121PA 1KJWA 2QRUA 3JW8A 2FU5C 1BOOA 5B5SA 1E9DA 4FGSA 2P7HA 1P4HA 2CNLA 3NWBA 2R6JA 1XIVA 2HNAA 2JI4A 4IWNA 4UW9A 4AMUA 1QQTA 3H4TA 4B80A 1Y6FA 1A9ZA 3LH5A 5JCZA 4PGMA 1ARZA 1USUA 3N6XA 3SWWA 4KR2A 5AD1A 2IRWA 3KJHA 4HQ0A 5DWQA 1K4YA 5TRTA 1FB5A 1XNJA 5ALYA 5KDOA 3TW8B 3KHSA 3P71T 2DFLA 4IDAA 1AN9A 1O5IA 1KFKB 3D6MA 2FW9A 1QYVA 4ER6A 1VSTA 4I5GA 4ITUA 5FFMA 1FP1D 3FMFA 3TRDA 1IM8A 5L7TA 1RWMA 3RYCB 2ZTVA 4P4TA 4QXQA 3ASVA 3Q10A 4V2UA 5L3VA 4RJJA 3INTA 1SXJC 4MW2A 4V39A 1PL7A 2P3LA 2XHZA 1FS5A 2WE7A 2NUAA 3JD1A 3MT0A 4B34A 2V1UA 4NZZA 1TAGA 2BH2A 1G291 2CDNA 1O9BA 4H08A 4EUFA 2MR6A 3VAYA 2OCLA 3FBWA 1GQFA 3CLUC 3HRKA 4GZMA 2WUFA 3G7NA 1B42A 1GD1O 1KEPA 3B89A 3EEQA 4X41A 3K6JA 4HATA 4FZRA 2I78A 4R16A 1MB4A 4IIBA 4QNRA 1E0JA 1ZL2A 1H42A 2GEDA 2N47A 1TF5A 3KSDO 4O2AB 3D02A 3GLHE 2CLHB 4LN1A 2I3BA 4L6CA 1MT0A 2OCBA 5MN5A 1O95A 4FOSA 1FOEB 3SC2A 3FZEA 2IYRA 1UC8A 4DV6B 5EPOA 4OLHA 5CIQA 5IJ9B 2F62A 1QPGA 3NOXA 3W3AD 4RORA 2QZ4A 2RONA 3PB3A 3HCBA 3GCWA 5AVTA 3UHPA 4MH0R 5CVDA 1QO0D 2GWHA 5C1DA 1ZVVA 3C0KA 1JHZA 2RH9B 4ZYXA 3DW1X 3N74A 2PUVA 4L0DA 4TKVA 4LISA 2UYYA 3L4BA 3PA8A 10MHA 1JQDA 2FE4A 3HFJA 4LWQA 2F9LA 1GG5A 1RXCA 1QANA 4DBLC 4PWYA 3UW3A 2QY9A 2Q1UA 4HBGA 2PSDA 2WJIA 3H8WA 4UZSA 5I51A 3DFKA 3GP8A 1Y8AA 3ESRA 4R81A 1UKEA 2J67A 1LK5A 3KR2A 4DRZA 5JYDA 4R9SA 3U4AA 3U81A 4IVRA 3ZLTA 3MWYW 2DQSA 2XNKA 4ZMRA 3ROQA 3RRNA 1N6KA 5IM4A 2I22A 2IE0A 3MA0A 2CCKA 3HUDA 5JWOA 4LJAA 1TE2A 1SEPA 5IKXA 1YBMA 1Q44A 2GASA 1FQKA 3N8IA 3CF6R 4ER7A 4DABA 1NF2A 4NESA 3DZGA 3RO7A 4QELA 5HIIA 1GTJ1 1QIMA 5TVGA 1I5OA 1JQ5A 1NDHA 3PQ8A 1EAYA 1G4HA 1UBGA 1YOBA 3E9MA 3U4GA 2QV0A 3WYGA 4F4IA 2LXNA 1OTHA 2QM7A 3JVVA 1P7CA 4MTLA 4EUHA 2OENG 2JRCA 4TXHA 3AFIA 4KO8A 1EM8A 3BTUA 3N53A 1CJSA 3VH2A 4OX9B 4C4RA 2HA2A 2GZ1A 5TQVA 4W4TA 3PP8A 2HCTA 2V65A 3CR3C 2UVPA 3U1TA 3P52A 1URPA 1K89A 1UDBA 1NBMD 4IVNA 1ZQ1A 1QP7A 4BV3A 4PTYA 4D7AA 5BP7A 1Z2DA 3E9CA 4ZGGA 3COZA 3FTQA 2OUIA 1SUCA 3HKDB 1Q84A 4R5MA 1G4AE 1U7UA 3PKJA 3SSNA 2I6UA 3FWYA 1MHPA 3I5MA 4UTOA 1DIRA 1US8A 1AM4D 3JCZA 3PE4A 3UAXA 4BAZA 1GPBA 3TW4A 1VMEA 4TT8A 1GCGA 5GGYA 2G1AA 3UJ7A 1H4QA 1ZHHA 5KJEA 2JGMA 2XUKA 3EBOA 3OOWA 1ORIA 1S9HA 1UDWA 1USWA 2WAYA 1Z8HA 4ILEA 3TSYA 2VC2B 3VAAA 4LF8B 3AK4A 1JALA 1XZ8A 2YMMA 3V7YA 3R77A 1S5PA 1RQ7A 4OVKA 2F59A 2FWRA 3DR5A 2WUEA 4Y9DA 5IFKA 3FLAA 4MP8A 4BLOA 3H5AA 1VG9B 1R00A 3EMKA 5LP6B 4PC3A 4DKXA 3KLNA 2PZFA 2QAIA 3ADBA 3FNIA 4HEQA 4L8GA 2B8EA 1BXGA 3FYUA 3WGOA 1N2ZA 2B8JA 2RHTA 2V7TA 2AZ4A 2A5JA 2YVUA 1TC1A 3HRIA 3NGLA 4YP5A 2DFVA 2YHSA 4FCVA 2AW5A 1E1NA 1Z35A 2Y9MB 3NTXA 3U3DA 4CMEC 5K8IA 1QU2A 3UJ6A 2LBPA 2ZDGA 1PCXA 2I34A 3GRUA 4NAUA 1N7HA 3A6LA 5E7IA 4CE6A 3K20A 4GECA 1D7OA 5F5XA 1L5HA 1V37A 2SKCA 3STUA 3CZAA 2CFOA 3UMBA 1JHVA 3LL7A 4E09A 3LHSA 2W6JD 1JT9A 1C1HA 1NHWA 1QHHB 2QNBA 3B1YA 2WKSA 3FAKA 4MV0A 1Q77A 4W6QA 5EJIA 3RKRA 3VR4H 2QX4A 1TQ2A 3ZDDA 2OD7A 4I4LA 2F9MA 3FZNA 3VYVA 3WDLA 2WMOB 4JUFA 1C9JA 4DLZA 1E3EA 4GIBA 5ICCA 1GNVA 1QK5A 1U3FA 5SZIA 1XCMA 1ZRSA 2A1IA 2ZUEA 2GT1A 4PFSA 4FHDA 4L78A 1V4BA 4OKNA 4AN4A 3PNQA 2IEZA 1AA9A 1RAFA 3AJRA 1P60A 4K26A 4WMLA 3HDQA 3MQ2A 1ESDA 1EHIA 1TT7A 2KWIA 3CMMA 1UKYA 3FGNA 3OLVA 4Z9AA 1DBPA 1ZAKA 2QXYA 1NQXA 3L8DA 4MPJA 4MWBA 4PAGA 5JT1A 1QHHA 2Q6IA 3AINA 4OXIA 4RGVA 2IHKA 1C30A 2OSVA 3RLFA 3T1OA 4X8HA 5DM2A 2PZKA 3AH8A 4PTLA 4RSGA 4MW9A 1I6MA 1BS2A 2QMZA 3KB8A 4JC0A 2YRXA 4AG6A 2NU8B 1E9RA 1JEYA 4HEA6 4NKRA 1NMYA 3FDJA 4Q18A 3P96A 4COOA 4NHEA 4WBNF 2YJGA 5E1BA 1TMYA 2Q3DA 2VYFA 4E5MA 2PS1A 4NU0A 3CQ9A 3MTQA 3RC8A 4O4IF 1NXTA 1FCJA 1U3DA 1ISFA 1F8XA 3LT0A 2IX3A 3AI1A 1N2JA 4CUJA 3PT9A 3AXSA 1FVFA 1LW7A 2PMWB 2B7LA 4ARUA 1UR5A 3U7QA 2V9PA 4QJIA 3TTXA 3WE7A 1Q1ZA 3KRTA 4MYUA 3R7NA 3VHXB 1WO8A 3KYDA 4INJA 1JTFA 4D6XA 5A4FS 3HYSA 3MCTA 3ND5A 5IAEA 2DSTA 3DTTA 3O4RA 4JWKA 3AM3A 1W2WB 3T95A 3TB4A 2GN8A 2NO9A 2QYHA 5KTKA 2YCLA 4LSWA 1MEOA 1TGVA 2P9BA 5FF9A 4OQDA 4E5SA 4FU0A 2GR9A 3W8FA 4P58A 3GQBB 3WP0A 1QLWA 2EP5A 4OP1A 3NDBB 1YQ9A 2PD3A 3K72B 1AH2A 1E1KA 1A72A 4MP6A 1PFYA 3LZ6A 1KQPA 4EHJA 1L4UA 3EUWA 4YYZA 1QYXA 1YC5A 2A5YB 5LLDA 1LB1B 3L7OA 1NVUQ 3C5EA 2VUTA 4OYRA 4X45A 3V4SA 3G8DA 4HFMA 2H06A 1RABA 3K0FA 2Q5QA 1KYQA 4EARA 1QYRA 3C7DB 4PGGA 1T5DX 4MIEA 5BQ5A 4IP0A 4YHBA 2XVYA 1K1EA 1U7HA 3TYXA 1IU9A 1MAWA 1NR1A 1QCCA 3CEAA 1YV9A 4KYUA 3FNRA 1GGJA 4QUAA 1VJGA 5JXWA 4OYHA 4X1YB 3VR5D 4YRAA 4Z5XA 2ATCA 4AQDA 2FH5B 1QFYA 3UEOA 4MQEB 3ESBA 3GO4A 4FSDA 1AUVA 4CMBA 1PUIA 5M7EA 3N2KB 3ASYA 1LC0A 1LTHR 5DU2A 5CP8A 1C3OB 3MTIA 4YRMA 2XW6A 2J3IA 3SJUA 4D97A 2BHRA 2XDQA 1UWLA 3CTMA 3CNQS 5DN9A 3CH7A 3EW9A 4YUYA 4ZVPA 4UVDA 4KAXA 1O8BA 1U6KA 1MV8A 3CA8A 3GUZA 3C4QA 3S8YA 1IN6A 1XP5A 5LL6P 2CBXA 2PZAA 3VZCA 5AVJA 1XDGA 1UC9A 2N1BA 3CW9A 3ZV6A 3ZLJA 4DNFA 1L6IA 4YUAA 4TVOA 3FB1A 3NW9A 1EEHA 1CLEA 3KQWA 3IEVA 4NMXB 3WTCA 3FYSA 3IE1A 3QX8A 1OBOA 2IYOA 2IUSA 3IRUA 3MHTA 3RVMA 4HDKB 2LCFA 4N0EA 3GJ3A 5JNTA 1ZGCA 4L7VA 5IXYA 1GTVA 5DYYA 2BWJA 3IHLA 3QXCA 1ZIOA 3M4JA 4ZRMA 3KQTA 4DQVA 4HV4A 2OHHA 2H07A 2WU1A 3NXKA 3SLGA 2O5VA 4GLBA 3OZXA 5CVCA 1U0FA 1XVLA 2I71A 1SVMA 2OE2A 2Q9AA 4G0ZA 5K1ZA 5BWNA 3TK1A 3CUUA 4FP9A 3UOWA 1RJ9B 4BFCA 4LJ4A 3QEKA 1NMQA 4FR0A 3G2OA 1V26A 4OP3A 1L5MA 2V7VA 1O57A 2W6ID 2ZJ2A 3UJHA 5K6TA 1Q5PA 1CUIA 3KVRA 5E1DA 3WMXA 1TTTA 5T41A 2VAVA 4PS0A 3WZ2A 3CLTC 2FX5A 1SC3A 2GLTA 5AICA 3SZLA 1E58A 3VSAA 3DOIA 2LZ0A 1RAHA 3UXHA 1EIZA 4YALA 5DOZA 5JV5A 4NATA 2NVBA 2MSWA 2WIJA 4F6LA 5C7YA 5L45A 5JZOA 5LDHA 5HOEA 4R2IA 1SC6A 3D7LA 3HNRA 4MKZA 4D9CA 2WMDA 1R8JA 1N1GA 2G82A 1P2UA 3R3ZA 4WY8A 5I4BA 4FHZA 4ESVA 1BD4A 5ESDA 4DR4B 5E9QA 2JIZD 1CK4A 1XP8A 1H65A 1ZNYA 3DFZA 4O8CA 5KB3A 2O0JA 5KYWA 4W9NC 1OFVA 2P78A 2J32A 3SIXA 1R9JA 4B3BA 1V16A 1UKCA 1AKVA 3UV3A 1X94A 3VTFA 4Z7NB 2HA5A 2IXFA 2JAWA 2FMIA 2P62A 1EFRA 2Z5FA 4NU6A 1EHCA 1Q0QA 2GN1A 4PPGA 1G18A 2QN1A 1P4AA 3W78A 2ZSKA 4ZALA 5EQJB 4JSTA 4DTIA 3BD7A 3HADA 2DWUA 3CONA 3H5VA 3B1FA 1G64A 1RYZA 4JLUA 4MXDA 2WAXA 1MJGM 1GPLA 1NU8A 5JMPA 3WNCA 3UK6A 3LUDA 4XLZA 2ZG6A 1F3OA 4OP2A 4RX1A 1RWQA 5AM3A 5IZ4A 1PGOA 1PO7A 3WAJA 1VA4A 5EWMA 4RVCA 3OOYA 5AIAA 2Y0BA 3LUJA 2QPLA 5ENZA 3HUUA 4TYNA 1I8TA 2SKEA 4AULA 4FFDA 1NNSA 4E2FA 2GEUA 3GJQA 1LTKA 3NM4A 4CV2A 5MFZA 4RVFA 3PICA 1W8DA 4YBZA 5DEOA 4EHLA 3IKMB 3KSMA 2QF7A 2V7EA 3PG5A 3QITA 4V0LA 4DLVA 5A4DA 2C1XA 3DEHA 4G0NA 1N0HA 2E4AA 3AEKA 3ORYA 4HYTA 5ADWA 4PCLA 4TLAA 2FXIA 1VHDA 3F9CA 3WP1B 3VZSA 3W9SA 1D1QA 3L8FA 3RS0A 2WSIA 4A03A 2ACKA 5H02A 4L5CA 5AVRA 2VH1A 1UDCA 4I50F 1LI5A 2LD4A 2ZWVA 3G5TA 3AB8A 3LDFA 4B7CA 1PTJA 4B6EA 2FPXA 5JAIA 3GEMA 3FFBA 2JFBA 1GGFA 2PS0A 3LCCA 2PBZA 4B45A 1S3IA 2OCYC 2RAPA 1QH8B 4MVJI 1ZIPA 1Q7RA 1R0CA 3OFND 3ZKWA 5A7FA 3A6HA 4MW6A 4BWYA 5I8PA 1I13A 3ER9A 5IEBA 5KDLA 1J2YA 1THMA 3U7JA 4Z86A 5IC6A 2QTLA 4OHMA 3MJFA 4N0DA 2DKFA 2A7QA 4RC9A 4JYMA 3U6BA 1WXFA 2C7OA 1OH5A 5TQ2A 3NUGA 3OVMA 4XKJA 1OFTA 3LCJA 1J97A 2DFTA 2J5RA 3UKOA 4AICA 1QM5A 4Q7KA 4LX0A 4PLYA 3FW1A 1GPWB 1IB0A 1Y8ZA 1BWSA 4OUDB 1KYIA 4C0SA 1LNZA 4TT3D 3KSBC 2P3OA 3HCAA 3QFHA 1GRNA 2BFAA 4HSEA 1GXSA 1AQIA 1NL3A 1ZD5A 2FCRA 4DLKA 2YWFA 3L7NA 1AMOA 1IBLB 4IDHA 4ZCLA 4LF4B 3EQZA 5F7JA 1YCHA 1JIIA 3I32A 4LJ8A 4K2HA 3ANMA 4FFRA 4PHCA 1D2AA 1YS9A 3KZOA 2QR2A 4HLCA 4LRSB 4RTOA 3JQ9C 2V8OA 4EG6A 3F1KA 3W06A 3DMRA 1HLDA 1XZFA 4C7VA 1IG3A 2IHBA 4MV3A 2VTDA 3O26A 1EQ2A 5IN4A 5ALFA 1D2HA 1QCDA 2I76A 2A1TS 1PR3A 2NTEA 2JBAA 3MIZA 4IHQA 4L2IB 1EGVB 1NP6A 2PIAA 2VF8A 3W6ZA 5KWEA 3U19A 3ENWA 4QGBA 4QYIA 2IH5A 1KDVA 1XCPA 3VC7A 2J6CA 4OAPA 1H9CA 5E9AA 3VM6A 2ADFA 3GNQA 3SQWA 2IEIA 3CCCA 3QYAA 3PXBA 3F7TA 4IBOA 2I8AA 4OXYA 2DU8A 4KYIB 2HPAA 5DMXA 5LQMA 4RULA 2RHLA 5EJGA 4XB6B 3DWEX 1TKCA 1QHEA 3CZ9A 3CX8A 1UIMA 4IJ6A 2GN0A 2V5VA 4MVWA 3TI9A 1XRRA 2OBBA 1OT5A 4FC6A 2XTNA 4DGSA 3H5LA 2WKRA 3P4YA 2E5WA 3NWEA 1UDXA 3DMFA 4FYIA 4BFSA 4BNMA 2PX3A 2FN9A 4QLOA 4X1OA 3BRCA 2FR8C 4EBBA 4B7UA 4MCHA 4XB2A 3WLQA 1PNOA 3SKXA 1XZJA 2AC4A 4AIRA 4GAEA 3O8RA 1YR3A 4KPUB 3W77A 1PQWA 2H3HA 4EKNB 3AKZA 2WDZA 2NGRA 2B36A 4RVDA 2GYYA 4I5EA 4PQEA 2HMVA 4PQGA 5H5JA 1QV6A 5T3UA 4EF6A 1OX4A 1IQRA 1M0WA 3EC7A 5JDCC 2OHFA 3FIJA 1DOZA 3VDQA 4DQKA 1V48A 3SS7X 2VJAA 2X9QA 4OFXA 1E89A 3NBFA 4O59O 1KDRA 3U5TA 4ND5A 1DDGA 4MUYA 3R9KA 2QTNA 1NF8A 1E6UA 2QR3A 3BVPA 1KU6A 3HY6A 2VSYA 2XTJA 3QWIA 1US8B 1Z9BA 8OHMA 4P8RA 1RTKA 2X0KA 3C3MA 2NXNA 3TQFA 2B2CA 1N8SA 3NH6A 4RM2A 4G84A 5AW5A 4EB0A 4B6PA 2AG5A 2QMHA 4MVXA 4RHEA 4XCQA 3CX6A 2CGEA 3K30A 5JS7A 5T3YA 1Y33E 1MABB 4JI5B 3ET5A 3H2JA 4HEHA 2A4KA 1ZXXA 2RGCA 3Q3IA 4C4SA 4EW1A 4EDFA 1H9BA 2ZU0C 1F8FA 2YZGA 3ZYCA 2WBLC 2ZCUA 1TK3A 2F00A 4X6YA 2ZUFA 4JI8B 3T7CA 2IDMA 3FXAA 1LGYA 2XUPA 4QTTB 4AO7A 4NMMA 2BHTA 1ZN8A 1CULC 3P9ZA 1MXHA 3L0YA 3U09A 3OE7A 3MILA 1Z0DA 4PCUA 3F5MA 3OU6A 5TY0A 2VPPA 3SQLA 1VJCA 2R4TA 1U3UA 3P9YA 4W82A 2VXBA 4O4JA 1KC3A 3L1HA 1SOAA 3DE0X 1IHUA 3C7CB 3JZMA 4IILA 4B3CA 1U4OA 3PNVA 1MO6A 1O97D 1XXLA 1SCNE 3AF2A 4UKDA 1NXXA 3GC6A 5EMMA 4EJ0A 2KX7A 1FDWA 4JJ8A 4LYHA 2Z3ZA 3H3JA 2RGDA 4RCYA 2VJLA 5EJ9A 1J7JA 2FJUA 3UHAA 2ZBQA 3O92A 5EMJA 3V7FA 1J0EA 4CFZA 4UVIA 3FNHA 3DEIA 4I9GA 5E2AA 5ALMA 3T4EA 1HO3A 4BO1A 5CEEA 2O3UA 1W5EA 4JUAA 2PGXA 2ZRAA 2OHOA 3FDIA 2Q1TA 4A2QA 3NKFA 3T5DA 2RE8A 1WCIA 1I4LD 1J20A 1FFSA 2Q3HA 4UEOA 1JNYA 2PR2A 5GPBA 5LQKA 1S2DA 1JLSA 1YH3A 3SSOA 4R5HA 1E62A 3UATA 1U9YA 4C5BA 2P6UA 4F4HA 2R1TA 3A1WA 3JZIA 3WO0A 3ICQB 3P9SA 1WKVA 4DNXA 3TLGA 1K27A 4JVOA 1H69A 5CCXA 2ZTHA 2I2AA 4RD2A 1KJZA 1J21A 1PLKA 3WOHA 2H1WA 3L6OO 5K03A 4KV7A 4ESOA 4BNFA 4BFTA 1C3EA 5ISMA 2H63A 2OP0A 2EJUA 2Q3EA 1RW4A 3H5NA 9LDBA 4AZVA 4HXGA 3OQBA 1UJ6A 4N7RA 4XCVA 4N8EA 3F0TA 3K1AB 3OCJA 3AHCA 4OIMA 1CZKA 4I46A 4LOHA 1XHEA 4EYGA 1TGYA 3A7DA 2NO4A 3HKEA 4OXRA 2FG6C 3QVOA 4A6XA 4RMHA 3R9WA 3EVFA 4D0NA 1N3LA 1UEXC 1QRRA 3OAAD 1ADJA 3HL0A 4PTZA 3WXMA 1U63A 1J39A 3DMPA 2H1CA 3TE7A 2CFTA 2G1UA 3OJWA 1FRFS 1T4CA 1E2IA 1EX1A 2OMEA 4GW3A 3NHRA 4JCCA 3OH8A 2D5AA 4AZSA 4H60A 2QUJA 1E3TA 3B6ZA 5DXFA 4CL0A 5K0ZA 1L5YA 3T15A 3ZU6A 1SH7A 1U1FA 1H66A 1T25A 1V1RB 3AUSA 1GDHA 3RK0A 2QQEA 3UB4A 4B32A 2ZVPX 5KOJA 2ATVA 2PH1A 3EB9A 1XJCA 2DHDA 4O0MA 2QVYX 2AR9A 1G2OA 3ODPA 5HSGA 5L4NA 4DR7B 5DT9A 3ZQ4A 3P26A 4C06A 3LFTA 1RRFA 4IDDA 4QO7A 3U17A 4G56A 1UKBA 3KIPA 2EOAA 2RBKA 2YFHA 3GLRA 1SCDA 4UUBA 3FLBA 5DXJA 4E88A 1GYRA 3X1JA 1C7JA 3FUTA 1JDBC 1SZJG 1Q7TA 1JVNA 2AOTB 2Q3JA 1BVYF 2YV2A 3QVKA 1JLLB 1VIVA 4X8OA 1DC7A 3TJMA 4UHDA 4RGBA 3R8FA 2Z04A 2I4OA 4OTZA 2YC2C 2NV0A 3BQ9A 1M6EX 16PKA 3TLJA 2WWRA 2QLBA 3QKTA 1JYSA 1I4OA 4H6VA 2GD2A 2C2ZA 3LDGA 2L19A 4F6RA 1EHYA 2ONZA 3QI7A 5ILQA 4GE3A 2DQ4A 1SQ0A 1F1JA 1NC3A 2ZRJA 2V7PA 2EW8A 3DVAA 4MUHA 4N48A 2AVNA 1K0UA 1BWQA 2F8MA 3KJEA 5IJXA 3WVNA 1Y3IA 3LUKA 2Z58A 2EX0A 3HLYA 4AMVA 1Q57A 2OZEA 3Q72A 5IABA 2ZT7A 5K05A 3T99A 1JWBB 1RAEA 3TLCA 7MDHA 3CGWA 1I4DD 3MBKA 4R84A 1TM4E 1LWNA 5AW8A 3IEMA 4G26A 3BJMA 1FX1A 4AS1A 1W59A 1TMOA 3HHPA 1WZCA 1PSZA 3PFKA 1KP9A 2GPNA 3OM8A 4H1TA 4UM7A 3U4QB 2C88A 2NUPB 3O73A 5FFFA 4BMYA 4DW8A 1RM4A 1EWTA 3EZFA 1CDDA 4JVSB 5DBIA 721PA 2CL0X 2GAIA 1E2FA 1EIWA 2VP2A 2ZYSA 4RY8A 2Q45A 3LO5A 2B69A 4Z0NA 2ZZMA 2O4UX 1JSCA 4M9UA 2C5FA 4P53A 3DLTA 3H6KA 4F86A 5F2NA 3GL9A 4RPLA 5GZ1A 5BSEA 3PSHA 1DG1G 4RSRA 5EXTA 3MK31 3IAUA 1IPHA 1Z4MA 4PYLA 5E6UB 4D9HA 5C80A 4RA9A 5AJUA 5TGTA 3LLVA 1XMVA 3KDSE 4PLTA 3PDHA 3HB7A 1X9HA 4RDIA 1HFEL 3L18A 4C3OB 2Y92A 4WXEA 1CRPA 5DP2A 3M4YA 4G8DA 2P0EA 5HZKA 1CVIA 2DUUA 2AK3A 4QRIA 4ZI5A 2P2LA 2SBTA 5HBGA 1XL1A 5IM5A 2I3DA 1I6KA 2IPAB 1II8A 2QZZA 4FCWA 4QUBA 3O0TA 2DEUA 3ZUPA 1V7QA 3AJ8A 3K32A 1ENZA 1H05A 1OLSA 4NQZA 3L41A 3P27A 3IH5A 1TB4A 1JUDA 1OX6A 2NTJA 2OQ2A 3QWHA 3V8QA 3T9DA 3UFXA 4Z7QB 5BUZA 1XD8A 5JECA 2W2QA 3I92A 4MKIA 4W5QA 2IA5A 1PQUA 3F6EX 1V11A 4M9SA 1XF1A 1IVSA 3KVNA 1IFXA 2G70A 1I2MA 3EXAA 3I4FA 4CM8B 2X6RA 2VHVA 2Q21A 5KYTA 4HXYA 3F6PA 4G0YA 1VPLA 1V8FA 1H2FA 1F3LA 1SZPA 2CNOA 1A8UA 1VB5A 2ZYRA 1DG3A 3OLZA 4UBOA 5FQOA 2VS1A 4GGOA 4XD7D 1O95D 4L5YA 9LDTA 5JPDA 2GLUA 1RSZA 4JLOA 3DWIA 1MZVA 2XXAB 1OYYA 2H8KA 5FP0A 4G2NA 3BSFA 3IAS1 4PZ9A 3NBQA 5AJHA 5B2EA 2BEUA 2FPPA 3DH0A 2LE0A 3BL6A 2WJ6A 3O84A 5I9LA 5KNBD 5KQSA 3ZW9A 1OZ0A 4EUNA 3ECCA 4R9UC 2JI9A 5CNIA 4NU5A 5I9BA 3TKAA 4Y6RA 1GDDA 4JL8A 4CMEA 1JE1A 1WPQA 2XQJA 4NNOA 1WSBA 5ELLA 3T5CA 2Z1NA 1X1QA 1H5UA 4Z1OA 1ST3A 2OGSA 3DE3X 4LOJA 2Q5FA 1H8ED 3FYUC 1TM7E 1ABEA 2IYLD 3OX3A 3AM1A 1BJRE 4K9NA 4BGDA 3HXKA 2XJ9A 3LUGA 1EFCA 1XQWA 1ZK4A 4MS1A 1FFXB 3LXXA 2RGXA 4UHBA 1LLUA 4RFSA 2XHEA 5PGMA 1MO5A 4CM1A 3RPEA 1T9KA 5E6SA 4JLDA 1ZESA 1F0NA 3MINA 4NS4A 2F3PA 1NE7A 3AQIA 4HNAA 3BWMA 2W6CX 3GP3A 3T7TA 4C0QC 5H80A 1ILWA 1D6JA 4AX4A 3EG9B 3GLHA 3NV9A 2KM1A 4O2BB 4JOQA 2I4MA 1QHIA 1GLVA 2YWEA 1TYBE 2QXTA 2EJTA 3LTNC 4RGYA 1NUSA 2J3KA 3PEFA 5REQA 2K7ZA 3LKDA 4XOIA 2ZYDA 2IU6A 2JCBA 2MSDB 3L82B 4M83A 2BEKA 4WINA 4YRRA 5F9MA 4AMYA 4BKPA 2QM3A 3T1NA 3JVUA 2HU8A 3QEMB 3Q41A 4DDTA 4DWJA 1QUEA 2C9MA 4KWCA 4XYLA 5HMLA 5HPYB 3UA3A 4X20A 2VJPA 2ZWOA 2O3QA 4FFPA 1U2QA 2DBVO 1GWNA 4C7BA 3SR4A 1JKFA 1H2BA 4K46A 3BZUA 3I5XA 1BTOA 3O1HB 2FGKA 4EJSB 3W5CA 2EFJA 2QRHA 1IHYA 3AU8A 1HY3A 3BYZA 3BF8A 3EZGA 1P5HA 1LDYA 2OO5C 2G63A 1N6OA 1YK1A 1NBOA 4ZEVA 1OFUA 2E4VA 1NP7A 4NFHA 3S2YA 4KQEA 1YHZA 5HF9A 3MYYA 1SZDA 1YGYA 4JT2A 4BKQA 3OQOA 2G06A 3D6AA 4N5MA 4QPPA 4D8UA 3BJEA 2CF5A 1C4KA 1XTBA 2DWOA 3O6VA 5ALEA 3PQFA 4C7JA 1ZP6A 5BUCA 4Q3BA 5A6SA 2E6KA 1UBUS 3D8RA 4C29A 2JATA 3I6BA 1HEUA 4YJ2B 1GNPA 2FPWA 3HN7A 5SYAA 3V4LA 3K1YA 1M6NA 1NUTA 3O5AA 1P0CA 3KJFA 1UMBB 2EBWA 1TYZA 4HAOA 4HDRB 2X13A 1Y3AA 3E18A 1WAMA 5IVDA 1OI3A 2PZ8A 4Q1FA 3LF2A 4HT3B 2IYAA 4A2CA 1UBEA 5A5EA 3DONA 3G0GA 1L7VC 1NW6A 1HZZA 1QOQB 4DT1A 5EI5A 4IR7A 1SELA 1JZSA 3I2HA 4MR8B 4ZOEA 3LRXA 3I04A 3O1IC 4MQEA 5BYJA 3MWGA 1L1QA 3PKZA 3RR2A 4YRIA 2M6SA 2YV5A 4RVOA 5AVQA 2VQFB 4UQLA 4PIMA 2KSQA 1SKUA 3AL3A 4L7QA 4XYEA 3VZRA 5ERGB 2BHNA 3DDOA 1PW7A 1XZPA 1VECA 2ZR7A 4PGHA 3RTEA 4JSRA 4MVJA 1L5ZA 5FOVA 2KE5A 4W8HA 4POAA 4WVLA 5ALOA 3UKDA 2VJMB 1TIBA 1QHXA 4BVAA 4NCBA 1VP9A 1K86A 1HDXA 1O95C 4DYVA 4DIEA 1BCSB 5A3JA 2QSZA 4JS0A 4U6QA 3N7UA 1ZIDA 2IZ5A 3OLCX 4PIVA 2VTKA 1E9AA 4UHEA 5H9VA 3VI4B 3WJ7A 3WLMA 1X8LA 3VVBA 4GMDA 2YXPX 4JJ6A 2IH4A 1HURA 2N1MA 3HM2A 4PZCA 5L3SB 2EAUA 4NCIA 1KEUA 4PV7A 1ATIA 1ZW6A 1QIFA 4UEJA 5F35A 4FB4A 3JQ8A 3BRWD 1L1EA 3E58A 3F7OA 3PFCA 4F45A 4LJRA 5EGNA 4AG3A 4HDMB 2UXDB 2HM7A 1C9NA 1N6LA 2FZGA 2Z6UA 2OILA 3N8HA 2VYVA 1NQ5A 1FE8A 3GQVA 1SXJA 3HFGA 1VB3A 3ONVA 1IOLA 2N0SA 2AWOA 4HVCA 4RHCA 4JT9A 2YJ4A 4FC7A 3K70B 4MIYA 4RW0A 1JKMA 1G59A 1T2CA 4KL8S 2AUMA 2H4YA 1NN0A 4Y2UA 4V0NA 1FRZA 1VFNA 3ANNA 4S12A 4ZCPA 2F3QA 5KHLB 2BMEA 3ZVNA 2XVMA 1P3DA 2QUIA 3UY4A 4F1WA 5B30A 4NH4A 5BNWA 3EQ8A 3FF4A 1B6GA 4JKYA 4UBNA 1WDLA 3H3FA 4RGQA 2GAAA 4CJXA 4WESA 3ADKA 3H2YA 3T9CA 4ZDJA 3DLHA 1IN1A 4EW2A 3C5WP 1XOIA 1FJXA 2H11A 2VP5A 1TCAA 4TV9F 2HHCA 4UUOA 1WSAA 1CV2A 2WAOA 1OYOA 4HTFA 4G86A 1FRQA 2C77A 2G7ZA 1U8FO 3AEQA 4L28A 5EJAA 3W6OA 3BCSA 3HXMA 4ZPXA 4TUYA 1NR7A 4IJWA 2D7CA 5LB4A 3KL4A 1YKFA 1SOVA 1XZLA 4QWWA 1XTJA 2NZ8A 2Z1MA 1KWGA 5F4ZA 3F5FA 3L06A 3NG1A 3U48A 1A96A 4KE7A 4C0XA 1TEHA 2P0YA 3SGLA 3NJRA 1UPAA 2XYGA 4D5EA 3RIXA 1JG7A 1SHZA 4CKYA 2VQ3A 4LXUA 3ZU4A 3ABRB 1IJKA 1IHXA 3L8MA 3B3QA 1NBMA 1VYVA 4L3WA 4AQYB 3BXOA 3EWIA 3CRQA 3LIPA 3N2ZB 2GESA 4RF4A 4DLWA 4JV5B 5IVKA 1GUDA 2JJ2D 1YZQA 1QQBA 1LDNA 1QAOA 2EDCA 4LOIA 1VRVA 3WWDA 3S1SA 2AL7A 1KDPA 3CLRD 4FEYA 2BV3A 5CAEB 2IDKA 3VTZA 5FUQA 5AH0A 1TFRA 2QG6A 1QYCA 1V43A 2FSPA 3PPWA 4P7FA 3R7SA 5DTIA 1T6NA 2XOXA 1MEJA 3CN7A 2GEJA 4LZWA 3HYCA 4RY0A 1ZH2A 3D6NB 3SQNA 3W90A 3ZZ0A 2IP4A 3H9JA 3VR2A 3C98A 4RWEA 1OIVA 3B1JA 4QYXA 5DHPA 2YHUA 1DIBA 3E7PA 5AMXA 5CJJA 4CLEA 2YW2A 4CT4B 2IS6A 2HXYA 4K87A 3IXQA 4OMUA 4M0KA 5J5CA 2SNIE 4AC9A 3FVRA 1NR5A 3L7AA 5A3SA 4ZCTA 1RM0A 1GPH1 3GCDA 3OCCA 1XU9A 4NBWA 5J1TB 5CBKA 1G3UA 3VKGA 4J4HA 4DC1A 5DBOA 2WM3A 3M2PA 4OA8A 4G1CA 4TRNA 2ECFA 1YBAA 3LS2A 5HTKA 1KVQA 4K7JA 2Q9BA 3FYHA 4LCBA 3FUUA 2FI1A 2TSYB 5TGZA 4Y2XA 5JAHA 5KWIA 5TF4A 3VZDA 1KMNA 4IS2A 1R74A 3F2IA 4O2RA 4HGOA 3DTVB 1WLYA 2HDOA 1FNCA 2CYCA 2QYOA 3ANLA 4L08A 4YAKA 1XMSA 4J76A 1SUIA 2C9CA 2MIIA 2RARA 2ENWA 2DLNA 1WG8A 3FOAA 2VQEB 2DR3A 4I3FA 2B6HA 1KZYC 1B6TA 1L3IA 2XE7A 3AR3A 1MQ8B 3GLHB 4IDOA 2IK8A 4O2BA 1P5RA 2PUCA 5LD2C 2BZ0A 4H59A 3MBOA 3GDWA 4GPIB 5PNTA 1AUOA 2BFWA 3TLYA 3WA7A 3MUFA 1GTSA 3FYTA 4UEWA 4C30A 5LP1A 1PSWA 1A2BA 3KJZA 1R8SA 4XD2A 3AYXB 4XJTA 1ZJJA 2ZDHA 1FFGA 4HB4A 1JB9A 2II6A 4UXIA 2INGX 2V55B 4IJUA 2I33A 4MYTA 2OMKA 4MQ5A 5A9SA 2IHTA 4BECA 1FFAA 1FUUA 1NSYA 2CVHA 1QQ7A 2LIPA 5EGSA 1NUUA 3TR0A 2PBFA 2XUGA 2ACEA 3X1DA 3OQNA 4GNRA 4P4NA 4LEIA 1L7DA 1M3SA 3P45A 3RV3A 4G4SO 5IVPA 4J49A 5C4MA 3LLUA 1QVRA 2E4WA 3AEXA 4DMCA 4I4CA 1M83A 4U3JB 1EVIA 4HEA1 1SCAA 5BWMA 4XR4A 1K7YA 5FBHA 4DMFA 2AJ8A 1YRYE 3UK0A 1FVXA 4N7JA 3E22A 5CDHA 5GVSA 1B3BA 1CW2B 4QJ5A 4CUKA 1MH9A 3GCZA 1DZ3A 5K3EA 2XUHA 1THTA 5BYKA 3C7TA 1XJ0A 4U7PB 1O94C 3L8EA 4EY3A 4BHTA 3K4PA 2W4QA 3PCTA 3FLEA 1PW5A 3H5OA 5F98A 4UM9B 4X92A 1LLFA 3PQ4A 2HMTA 2ONYA 4X84A 4BCCA 5JJBA 5EZYF 4ZHQF 3HJAA 3UWDA 4EAQA 1MOPA 3INNA 4ZGWA 5I3ZA 4F91B 3CJRA 4AKGA 2F3UA 2MOKA 3CHYA 3UFXB 1N3IA 3RFFA 4RLSA 1U5AA 3N87A 4M98A 5GGXA 4QKQA 5IDWA 1ZONA 3HE3A 4AF8A 5JMTA 1OY1A 5CFPA 1XDSA 1G0NA 2OZKA 4JXXA 1Y4SA 2P9TA 4DCPA 4MWEA 2P8JA 4MYSA 4PLVA 3AIOA 3RC7A 2R86A 4KGXA 5L3QA 4WECA 2EZUA 2EZ8A 2PLWA 3R41A 2ZI7A 4RPKA 4XOUA 2YS6A 2YX1A 1N5DA 3ETJA 3THYB 4FFSA 3U39A 3H9CA 3FPAA 2I6TA 1DG9A 4RA9B 4CF5A 2D2EA 4Q9DA 1SKMA 2FW8A 2WSYB 3VU0A 5ABPA 1ZSNA 3TRHA 3PXUA 3ENNA 4P08A 3ORFA 1ZCFA 1PRYA 1JEEA 2BSQA 1GSAA 4YCBA 4FX2A 4LJLA 5DRTA 4PZUA 1KAEA 2C95A 4QBKA 3KKEA 1ZCZA 4IDNA 1I80A 1ZRMA 1NW5A 3JAWB 4FYJA 1PYDA 4M76B 4KQJA 3G5LA 3T5GA 3TW8A 2ZR0A 3OQHA 5FTKA 3KV1A 1E3WA 1TDJA 2CXXA 4PYOA 5HUHA 3QEBZ 3UV6A 4MX8A 5AVWA 1BE6A 4YP1A 5KYUB 4OHOA 3AILA 2AX3A 3IVXA 4PSAA 2JAHA 4W7SA 2PWPA 1N75A 2I2CA 3FPBA 1T3TA 2I99A 3RI3A 3H8VA 4DE5A 4KSBA 2LTAA 3ZVKA 1VL5A 1NBEA 1JR3D 2B5VA 2G9VA 5LVAA 2GKSA 2GNPA 2QX6A 3OHMA 4W5TA 1CY7A 1GM5A 4QFCA 5FPYA 1MGOA 1X7WB 4N5IX 3UG6A 5ECDA 2AEFA 3QH4A 3VU9A 2X41A 1XO1A 2DZDA 4TSFD 3REQA 2ZUTA 1NQUA 4D6YA 3CGGA 1KOLA 1I0IA 2IIQA 4F72A 1NMZA 1SUDA 4Q7JB 1ZWKA 5KYNA 3RIGA 3W8DA 1RPTA 4YIKA 4DRYA 3PNLA 3CEMA 5C1IA 4B35A 5KQPA 4WGGA 3UANA 1UP6A 2PKQO 5FR1A 3EEYA 2YHIA 3AB3A 4UUPA 2XTZA 3CISA 3GIDA 1X2BA 1DKLA 2QRPA 2XE4A 3B13B 4X54A 3VUFA 2QSJA 2GOYA 1O96B 2W2LD 3E61A 3W8RA 1HE4A 2ATEA 4L2IA 1N32B 2D5CA 3L9WA 2DGDA 4OHUA 5AW0A 3I30X 1VMAA 1WBJB 1CUCA 1LSJA 2PMBA 2AIRA 2XZLA 2OG2A 1A2OA 1QUFA 3K5IA 4EA7A 5J23A 1JN0A 4OJQA 1IN7A 3DS8A 4MUJA 3KDPA 4UM8B 2H7YA 4B3JA 1OSNA 5KQGA 4YT8A 4CEJB 2QTBA 4WFJA 4CG1A 2C7GA 3NWOA 2PLRA 4Q4AB 3DO5A 4AWAA 4MS3B 3OKPA 5LQUA 4RELA 5KJFA 4ZI2A 4Q1DA 1KERA 3EQ9A 2WV7A 4AZ3B 5ALXA 3Q9SA 2QTZA 1YR2A 2QB5A 3HYLA 3VC1A 4MKFA 1UBMS 1KZ1A 1SU4A 5A04A 5F7OA 5KQLA 3DA8A 4R3NA 4AJLA 3DHVA 4ZT6A 4FYVA 2P9FA 3KB1A 3K2QA 3S40A 4ALJA 1UPFA 4XLTA 3ROPA 2G80A 3RSQA 4D3SA 2P67A 2XBMA 1RE0A 4O29A 4XX0A 3K5HA 1V95A 1RI1A 1HSZA 2BGNA 2WW8A 3PC8C 4A8HA 4AP6A 2DT8A 1KJJA 2JPDA 4EO9A 2REOA 4BNZA 5LBIA 4AB1A 5IM4F 1TJYA 3AM5A 3IIIA 3KYCB 3SNKA 3VX4A 1E2UA 1KOJA 1AQLA 4WTOA 3K2IA 1NOIA 7AT1A 1FSPA 2Y05A 4QULA 5AKEA 5EHQA 4F12A 4XWGA 2DCUA 4UPVA 1SULA 2A9QA 2LWIA 2G3YA 2WYIA 3PUIA 1YMUA 1V1RA 4DIMA 3OPMA 1ZC4A 5SZKB 1HK7A 4TSKA 4KAFA 4M87A 2Z56A 1DUVG 3C6ZA 3LUHA 4Y2TA 2RGEA 4ATNA 5KOHA 3VPDA 4URFA 5K0JA 4DV3B 1VXRA 3TMKA