4B9AA

Structure of a putative epoxide hydrolase from pseudomonas aeruginosa.
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
298
structure length
298
Chain Sequence
TDPLLPGFDYLTLHTSAARLRVAVKGSGPPLLLLHGYPQTHLAWHRIAPRLAEDYSVVLADLRGYGESRALDEEGADYSKAALARDQLETMGQLGFERFAVIGHDRGARVGYRLALDHPQAVAAFVSLTVVPILDNWAAVNKVFALNAYHWFLLAQPYDLPERLIGADPEHFLDYTLRRMAQGRDIYHPQALESYRRAFRDPAVRHAMCEDYRAAVGVDADADQADRDAGRRLQCPVQVLWQERPYAAGQHPLEIWKTWAGQVEGAAIGASHMLPEDAPDAVLEHLLGFLASHREALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Aeropath Project Targeting Pseudomonas Aeruginosa: Crystallographic Studies for Assessment of Potential Targets in Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Hydrolase
molecule keywords PROBABLE EPOXIDE HYDROLASE
total genus 112
structure length 298
sequence length 298
ec nomenclature
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4b9aA00
2BUCA 1EDEA 5CH8A 1GKKA 5FP0A 2R11A 4FTWA 3CN7A 1LBSA 5A71A 2I78A 4DNQA 3BL8A 4E46A 4QA9A 4BC1A 4QDUA 2WJ4A 3WK8A 4JYMA 1F0NA 2ZYIA 2WUDA 2ROQA 2PL5A 2LIPA 2OLEA 4GLBA 4J0DA 1WCYA 1EVQA 1QZ3A 3AILA 3LP5A 3C6BA 4GI1A 5EHXA 3I2GA 3M83A 2H7CA 2VEOA 3ZWQA 1A8SA 3FYUC 4H7EA 1ZJ4A 5SYMA 1WB5A 5IVIA 4AO7A 4U2FA 5HF5A 2B9VA 4EZIA 3WKEA 1XKLA 4FLEA 4JYPA 4K6HA 4CG2A 4EY8A 5AKLA 5AK5A 3C8HA 1JT2A 3H17A 5AKJA 4GBGA 5CXUA 4N8SA 3F96A 3VVLA 1O6FA 4XVCA 3WKDA 5AK3A 2GBFA 1UKBA 1CUBA 1ACJA 3ZLVA 3HABA 3V1MA 4C4ZA 4A23A 4KE9A 5CTAA 1RWQA 1J1IA 1D07A 3WWOA 1W6RA 3FCXA 3W9BA 4MQLA 4JNCA 1UKAA 2RHWA 3WK4A 1G66A 1GQRA 4BTLA 1LPAB 5HF8A 1L7RA 4B7ZA 1XZFA 4FWBA 4DLNA 4B81A 1XZLA 4GW3A 2GBIA 4UHBA 2QM0A 3Q8WA 1BN7A 1MX5A 1Q84A 2WFMA 1QIIA 2EDAA 1F8UA 2C58A 1OXMA 1MX9A 4A16A 1YS2X 1ODCA 4TVKA 1MU0A 1XZGA 1EDBA 4F60A 5AK4A 1FFDA 2AJBA 3IUJA 1AC5A 3QVMA 4H7JA 4ZV7A 4UPDA 2OQVA 1C7JA 4AN1A 4OB8A 4M0FA 5JIBA 3V1NA 4PSCA 2XMZA 3H18A 1XZEA 4G1FA 3F98A 2OCIA 5LZ8A 5FRDA 4X97A 2FJPA 2C5GA 1ZIXA 5ALZA 1C4XA 4BCBA 5I7UA 2HU8A 3E1GA 3VKFA 4QE3A 2OGZA 4EY4A 1BN6A 3BJRA 1MO2A 3QZUA 1CUHA 3DQZA 2WFZA 2WJ6A 1XRPA 4ARBA 1FFBA 3LS2A 3KWFA 1R3DA 3EQ8A 4LYDA 1XQVA 3GELA 1IUNA 3ICWA 3PUHA 1EA5A 3ZV7A 3ESDA 2BKLA 2QJWA 4MQMA 3WJ1A 1MX1A 4K2AA 1K6EA 1A7UA 4FLFA 1QIGA 1SC9A 2XLBA 1JU4A 3TRDA 4L0CA 1XQWA 3R3WA 1QIFA 3V1LA 1YCDA 3N2ZB 1BRTA 2VJDA 3EBLA 5LKRA 4I4CA 3WL6A 3O9MA 1VE6A 4GEGA 3MGAA 1XZIA 3IA2A 1VOTA 5ALWA 2VF2A 4X00A 4BRZA 1BROA 1UOOA 3ZI7A 1XZKA 5ALYA 1R1DA 2NW6A 3NGMA 5I9IA 3O4GA 4CCYA 5JYCA 3C45A 3QPCA 4KRXA 1EB9A 5E2IA 4P92A 5EFZA 3AZPA 2ZJFA 2PM8A 3CCBA 2WTMA 5K5EA 2JIDA 4X6XA 1Q0ZA 4C01A 5AM4A 3D0KA 5LZ5A 4C4XA 3T4UA 4WDRA 1AURA 2RGUA 5D6OA 1T2NA 5HK9A 5E4TA 1A8QA 4N8DA 3DLTA 2BGRA 4DSAA 3C87A 5DNWA 3NWOA 3R3YA 5AM5A 2HADA 5CBKA 4LHEA 1R88A 2HU7A 1VXOA 2HIHA 2QUAA 1HBJA 4FBLA 2XUKA 2XQJA 2QRUA 3ANSA 2H1IA 4UHCA 5HF6A 3GA7A 4HVTA 5FV4A 3WIOA 4HXGA 2WUEA 4Z49A 1VE7A 5CT6A 2XT0A 4ROTA 1WHTA 1BCRA 2HA0A 5D3KA 1AUOA 4DMCA 3B12A 3D59A 1VXRA 5YASA 3L1HA 4UHHA 5K3EA 3U1TA 1XRLA 3S2ZA 3TEJA 1VA5A 3FLAA 3O9VA 2HA6A 1K63A 4W63A 1DQYA 2XUQA 2DFPA 3OG9A 3B5EA 2ZYSA 1CVLA 2AJLI 3LCRA 4LXHA 4XIIA 4QNNA 1AX9A 5HCUA 3WLAA 2WJ3A 5AM3A 5AI8A 3CXUA 1EXWA 5EGNA 1Y7IA 3C6ZA 2GYVA 2XUIA 3EQ7A 3S8YA 4UBJA 4BDSA 5T4HA 4I19A 5A2GA 2J3DA 2XQFA 4KE7A 2WIFA 3DS8A 4G8CA 5CXXA 3RARA 3M82A 4BVLA 5ALRA 5BOVA 2AXEA 4XWGA 1QTRA 4X90A 3IDAA 1N8SA 3T52A 1PFQA 3HI4A 4Y2TA 4QLAA 2HHAA 2OGSA 3VXKA 7YASA 3FSGD 2V96A 4Y2UA 3P2MA 1WPXA 4KE8A 3QM1A 4X85A 4B0OA 4UBKA 3WA7A 5LYYA 2VQ6A 4X6YA 1W52X 4BZWA 2CKMA 1XLVA 2JF0A 1RYYA 3WZLA 5ALUA 2PSEA 5AK6A 4CCYB 3WK6A 1BS9A 1U65A 3U0VA 1YA8A 5AKGA 4UBLA 4BP9A 3STXA 3BF7A 3OPMA 4B84A 5E4YA 1XZJA 3VDXA 4Q82A 4CIBA 5ALGA 5CH3A 4D9JA 1GXSA 5LZ4A 4N5HX 3VISA 1QFMA 3C5WP 1RP1A 5JADA 2H7XA 3I2HA 1LPOA 1Q0RA 3F8SA 3FVRA 1ZGCA 3UMJA 1ZGBA 5IVHA 3BJMA 4L3WA 4UUQA 1SFRA 3JYHA 3D5EA 3IUMA 3I1YA 4PV7A 1W75A 1DWOA 4DM7A 3G9UA 1DINA 1DTEA 2Z8XA 4UHFA 5J3JA 5HFNA 4HXFB 4IHAA 3IBTA 5AM2A 3DYVA 4G9EA 5CURA 1IUOA 5JZ9A 2OAGA 2XMBA 3GBSA 4H0CA 3DNMA 5ALLA 2VT7A 3QMVA 2JEZA 2GZSA 1CUAA 4FKBA 1QIKA 1XQXA 2XLCA 3O0DA 4QZVA 3W2TA 1GPNA 3CN9A 4X7BA 1H22A 1PJAA 3MVEA 3IB3A 4JEIA 1DWQA 2HM7A 1P0QA 2YH2A 3A6ZA 1KU0A 2WHRA 4IQ4A 2WIGA 3TJMA 1MTZA 3DEAA 3AIOA 1HL7A 3QYJA 3WI7A 1B41A 4UFPA 4E11A 3STYA 2X8BA 1U4NA 3H2HA 4EUSA 3G02A 2PUHA 5HQ3A 2J3QA 1MT3A 1DT3A 4LXIA 3H0CA 5EHQA 1DWPA 5FLKA 3VJMA 4NMWA 4BTVA 1QIDA 4L9AA 1FSSA 4W9RA 4DIUA 1MNAA 1QJ4A 2QMQA 2VSQA 4Y2YA 2I3ZA 4QLOA 3HSSA 4LYEA 1E8MA 5ALNA 4ZGBA 3DKRA 4PQEA 4AO6A 3E4DA 5BV7A 3I2JA 4H7IA 4CG3A 5FUMA 3FYUA 5AKKA 2PSFA 5JATA 1TRHA 3PDCA 2WM2A 2WG1A 5CT4A 2B20A 1LZLA 3AUKA 2VAXA 4BAUA 4DMHA 1QIMA 1FFCA 2HA5A 4WY8A 2QZPA 2ONCA 3QITA 2D0DA 5JALA 3FLEA 2QS9A 3OM8A 1J2EA 4B0PA 4UFNA 1BCSA 4Q05A 2RHTA 2PX6A 4YX9A 1ZD5A 5EIAA 2PPLA 3OOSA 2PU7A 2BAGA 3DKKA 3K9BA 1E3QA 4J0CA 1YS1X 3GZJA 5E4JA 3I1IA 5DYWA 5DYTA 3W06A 4B6GA 4MXDA 2OCKA 3AZOA 4ZV9A 1G5FA 1VJ5A 4AZ3A 3VJKA 1S8OA 1YB6A 2BGNA 5LP1A 5ESRA 1LGYA 3VVMA 2Q0XA 1P0MA 3BWXA 2EEPA 5DLPA 1QIHA 5KWJA 3WK7A 5A7GA 4RPCA 4EY6A 1THTA 3FNBA 2HU5A 4AMYA 4BC0A 3ZLUA 2VAVA 1FJ2A 3R3UA 1P0PA 5HKAA 4X6UA 1E66A 2Y2UA 1BEZA 1ETHA 4F0JA 4E15A 5AP9A 1LZKA 5D7BA 1NX9A 4ITVA 4LKOA 1UWCA 2WIDA 5JAOA 1E89A 4A5SA 2OPHA 5AKIA 2YASA 2WTNA 1K4YA 4CFSA 4ZRDA 1YAHA 4PF1A 1CUEA 3L1IA 2JGJA 3MUNA 1XRNA 2XUOA 2XUGA 1EX9A 1AQLA 4OYLA 2C7BA 2WG0A 5AOAA 3IUNA 4Y2JA 5A7FA 4FHZA 4OU5A 1W1IA 5ALHA 2WUFA 3MUOA 4FLMA 1WB6A 1LPMA 3STWA 1VA4A 2JBWA 4C4YA 2VT6A 1SCIA 3RM3A 1CEXA 1QLWA 1H2WA 2CJPA 5C8VA 3WWCA 3F9CA 4O08A 2EDCA 5EHZA 3G0BA 5DNUA 2QT9A 3WYDA 3R3VA 4AMZA 4C6HA 2JGFA 1AZWA 3WWDA 1ACLA 3STVA 1ZD3A 2XDWA 4KAFA 4MWTA 4JH0A 5BWBA 1EB8A 3G0CA 4G8DA 4J0HA 1YSCA 5EI5A 5AOCA 1XLWA 4F5ZA 3AZQA 4PO3X 3WWEA 2WLSA 3BF8A 4FOLA 3WIBA 2PUJA 5CRIA 2WSLA 5FDFA 5LKAA 4MEBA 5AICA 1QO9A 4B83A 2DHEA 4AQDA 5EIHA 5K3CA 3WQHA 3V9AA 2CBGA 1XQYA 5AM1A 3VJLA 4Y7DA 4NS4A 5IVDA 2C4HA 2XUAA 1WOMA 4S0XA 3R3XA 3Q0TA 1CUGA 3EQ9A 3YASA 1XZDA 4PSUA 3PICA 2XE4A 4XJVA 1UK8A 3FCYA 2BUAA 4B82A 2JEYA 2VATA 3DOHA 2DQZA 1UK9A 5A62A 1WHSA 4GECA 1FFAA 3GROA 4HXEB 4B85A 4K6KA 2O7RA 3PFBA 2PU5A 1ODTC 4XX1A 4LXGA 3PI6A 4C89A 5JD6A 1XZHA 3I6MA 4ETWA 1EVEA 3SK0A 4BP8A 2PSDA 1DQZA 1VZ2A 4OD0A 1EH5A 1EHYA 4IH4A 5T4BA 4KR0A 5HF9A 4EY5A 4YPVA 4X93A 4X71A 2QOEA 1U8EA 3H2KA 1XZAA 5F4ZA 3UUEA 1CRLA 2CUTA 4QEKA 5C7YA 5ALFA 2Z8ZA 3V1KA 4BB0A 2YXPX 4AN0A 4K6GA 1CUVA 2XI4A 1Y37A 2X5XA 4WY5A 4BCDA 4UBIA 3O4IA 3DCNA 1UXOA 3DYIA 5ALQA 4G8BA 1Z68A 4Y2RA 1K5PA 2GZRA 4EA6A 4H7HA 3ED1A 1UKCA 3OC0A 5AKZA 3IULA 3C5VA 3ZLTA 2ES4A 3FYTA 1ZIYA 3A2LA 4Y9SA 1UT6A 2HA3A 3LLCA 4KE6A 2Z5GA 5ALDA 1P0IA 4OCZA 1TAHA 3G7NA 2PVSA 5CT9A 5AJHA 3A2MA 1JU3A 4RGYA 4X95A 4N5IX 1L7QA 5JZSA 1BU8A 5A6VA 2K2QB 4J0KA 4KAAA 2ZYHA 1CUIA 4Y2VA 4WJLA 2V9ZA 3A2NA 2VJAA 4DMFA 5JAPA 1LNSA 4M0EA 2HA4A 4P08A 2G5PA 4AO8A 1ZICA 2W6CX 3B3QA 5DJ5A 5CT5A 4X3CA 1M33A 2QVBA 3ANTA 5JASA 4KJXA 1TCAA 3BE8A 1LPSA 4QWMA 5AI9A 3G9XA 2GBGA 1CUFA 3BIWA 3D7RA 4KAJA 2C0QA 3QPDA 4H77A 1E5TA 1OCEA 4OU4A 4UHEA 4WCVA 3QMMA 4Y2QA 1L7AA 2IITA 4IH1A 4J03A 4U2GA 5K3BA 4OB7A 2DQYA 2GYUA 3R0VA 1DX6A 5FPPA 5EIEA 4G4JA 1WB4A 3GUUA 3WMRA 2HDWA 3I28A 1CUZA 4J0IA 5HFAA 2XMRA 1QOZA 2QXUA 1YB7A 4Y2SA 4ZI5A 5KREA 1A8UA 4DTCA 2QJRA 5LZ9A 3K6KA 3QMWA 4QDTA 4P9NA 4X94A 5JD5A 5CH5A 1XZCA 2XMCA 2XMSA 4UBMA 3WK9A 1EINA 2JGMA 1PV1A 4QDZA 4DNOA 4OSEA 1R9MA 1DU4A 3FVTA 1UOQA 4DGQA 5KWIA 1MPXA 2PKYX 3RKSA 1AMNA 1GKLA 1CUDA 2QR5A 1KEZA 2VJCA 3AFIA 4KACA 3D2BA 5AHXA 3JWEA 4B80A 2HFKA 4I3FA 5IVKA 3H2JA 2WIKA 4UBNA 3OTQA 1LBTA 3NUZA 2P8SA 3C8DA 3WL8A 1GQSA 2JGEA 4H7DA 5AIBA 3C43A 3QH4A 4BATA 5AI0A 2Y1KA 5ISMA 4W1SA 5AKHA 2Y6UA 1ZI8A 4MYDA 1UK7A 5JZBA 5DWDA 1I6WA 4BRSA 1R9NA 1TQHA 3NOXA 4RNCA 4GHWA 1NU6A 1AKNA 1ZOIA 4W1QA 1U2EA 1CUWA 2WKWA 3D2CA 5LZ2A 3FLBA 1TIBA 5JAHA 2DSNA 2AJDA 3LIPA 1CFJA 3PF8A 5AKEA 3V48A 4F21A 3HRHA 1C7IA 2GBCA 4DYHA 4HTAA 3HZOA 1XKTA 4PSDA 3DOIA 4INZA 1X2EA 3I6YA 2OCLA 2OXEA 1Q83A 1QFSA 2FX5A 4YASA 3M81A 4J3JA 2I03A 4JUIA 2C0PA 1EK1A 5C81A 3BXPA 2ACEA 5DTJA 5AO9A 5C8ZA 4OUKX 2WQZA 1HQDA 1JKMA 3WL7A 3C6YA 5K3DA 1WPRA 1O6GA 3WA6A 2IX9A 1GGVA 2FJ0A 3H04A 2XB6A 1OILA 3EF3A 4Q3LA 1HKHA 3C6XA 2ZJ7A 4H35A 5ALPA 4HRXA 5IH7A 3G0DA 3HLKA 2OAEA 1VKHA 5ALIA 3SC2A 3FSGA 1QIEA 3HJUA 3PE6A 5JD4A 1VZ3A 4TPKA 1R50A 2QXTA 3I2KA 1EI9A 5A7HA 2XUHA 1G42A 2WIJA 4X91A 5FXMA 4YK7A 1CIJA 1F6WA 1ZD4A 1YASA 1VLQA 3ESAA 4BDTA 1W76A 2QUBA 2XMGA 2W22A 4H18A 2XQGA 2O2IA 5K3FB 4N8EA 4BYMA 4DMKA 1CPYA 2V98A 2ZSHA 1UZAA 2ECFA 5AI4A 1JJBA 4FNMA 1MAAA 2BCEA 4H7KA 1WM1A 3FAKA 4EBBA 3ICVA 2DHDA 1QONA 1W4LA 2YYSA 3BIXA 1YA4A 4X92A 2J4CA 4WFJA 4H7FA 1XFDA 4ZREA 3DL4A 3FBWA 4RE6A 1BEEA 1B6GA 2G63A 1JI3A 3D3NA 1N1MA 3KDAA 5ALTA 4AX4A 2D5LA 4GXNA 2HRRA 4G9GA 3QBJA 1LPBB 3H1BA 1MN6A 1TCCA 3AIKA 3K2IA 4MEAA 2J4FA 2QTBA 3PFCA 1LPPA 4U2EA 4FMPA 3I2FA 4MJ3A 4BCCA 4EHBA 5C8XA 1MJ5A 2G4LA 1JFRA 1ZI9A 4U2BA 4MYSA 4UBOA 2BJHA 3C70A 2DHCA 5AKYA 1H23A 3WKCA 3L1JA 3H19A 4UFOA 3WZMA 1ODSA 2QKYA 5LIPA 2XQKA 4OPMA 4KEAA 3R41A 1T4MA 2AJCA 1GZ7A 3CCCA 5I8PA 5FPQA 4J7AA 3H2IA 1TCBA 3DD5A 3PUIA 4DNFA 1UK6A 3EIOA 2PSJA 3KSRA 4GWLA 4CG1A 1Y7HA 1CQWA 2VA9A 5ALXA 3W9UA 3AJAA 1IUPA 4IO0A 1R4ZA 1H2ZA 2WILA 3G8YA 3KD2A 2VJBA 3O4HA 2WHQA 2XMQA 5DYYA 1DX4A 2XUFA 1BE0A 3ESCA 4FBMA 3WWPA 3G0GA 1XZMA 1QGED 1HPLA 2XUPA 3WKBA 1UFOA 3SWWA 3PF9A 3HACA 4KYVA 4Q3KA 4WDQA 5D3ZA 2G5TA 2Z3ZA 3R40A 5ALJA 4M0MA 1ZJ5A 3OURA 4G4GA 2IIVA 2JGLA 5LLSA 4OYYA 3KWJA 3GFFA 2BFNA 2OGTA 2V97A 1H2YA 1SCKA 4HZGA 3M3DA 3F97A 5ALSA 1CUUA 2DR0A 1MNQA 1JJIA 3R3ZA 1EK2A 4CIAA 2CZQA 1CUJA 3JW8A 2GYWA 4E14A 2R8BA 2BUBA 4W1RA 1CQZA 4BZZA 1K8QA 4NZZA 4U2CA 1SCQA 4BVKA 1LPNA 3E3AA 5SYNA 1TK3A 3WL5A 4HAIA 3WK5A 5T4FA 3DJYA 3IIIA 2OCGA 4BBZA 4Q3OA 5JARA 3LIIA 4DNPA 4FNGA 5ALOA 1GPLA 4ZWNA 3STUA 2WFLB 4WFIA 2HA2A 3ILSA 4WFKA 2WU4A 1IMJA 2RI6A 4P93A 1ZI6A 4L72A 4AZ0A 1N5RA 3W04A 3IURA 3WKAA 4QDOA 5EHNA 3RLIA 3ZPXA 1CUCA 3WYNA 4U2DA 1TKRA 2RONA 4PW0A 4QDXA 2H7YA 4CCWA 3FYUB 1CUYA 2O7VA 5ALEA 5AI6A 5AM0A 5ALVA 3G9ZA 3HXKA 1JMKC 1AGYA 4MWSA 3G9TA 4QWWA 2WG2A 4G4IA 1IZ7A 3A70A 5ALMA 5K3FA 1JJFA 1SOMA 1XRQA 1ZD2P 2AJ8A 2B4KA 2ZJ6A 1ORVA 5AH0A 4GDMA 1CUXA 2X76A 4V2IA 3SX4A 1HDEA 2O2HA 5CW2A 1XROA 2HA7A 1QO7A 4IH9A 1GPKA 5DNVA 3D2AA 2VTVA 3HYSA 5AIAA 5HQ3B 5IKXA 1KU6A 5T4EA 1MAHA 3F67A 2ZSIA 1CUSA 4B9AA 2ORYA 2Y6VA 2WFLA 4PNZA 1X70A 2Y2VA 1GT6A 4FFWA 4Q1VA 5CMLA 4Y2XA 4EB0A 2JGIA 1XZBA 5HK8A 4W1PA 5ALKA 2C5FA 4BE9A 2WHPA 1CR6A 2CEKA 2CB9A 4BVJA 3I6ZA 5HKBA 2PBLA 1DT5A 2O2GA 3STTA 5JAUA 1E8DA 3QPAA 5BWCA 1ORWA 4HRYA 5DTIA 4K5QA 2RIPA 1XLUA 3KOOA 1QIJA 2ACKA 2UZ0A 2XMDA 2OQIA 1F0PA 4TGLA 3HEAA 6YASA 4CI9A 5JANA 3RK4A 2HRQA 1NU8A 3UUFA 4Y2PA 1HLGA 4BAGA 1X2BA 2WUGA 4BE4A 2Z3WA 3D4LA 3FOBA 3AIMA 5AOBA 4UHDA 4G5XA 1A88A 4HS9A 2E3JA 4OB6A 3HC7A 1YAJA 4C88A 2I3DA 4AXBA 3H1AA 3X3HA 3DDUA 1CLEA 3WJ2A 4EY7A 1J07A 2DCMA 3G0IA 3AINA 4AB1A 3IVMA 4FFVA 1XRRA 2XQIA 2WU3A 5FKJA 3H2GA 1FFEA 3BDVA 4C87A 1UOPA 2XUJA 5K3AA 4KRYA 3W05A 1JMYA 5KBYA 3ESBA 4NVRA 3IUQA 1XRMA 4BAZA 1H2XA 1THGA 3TGLA 2OG1A 5CT8A 1IVYA 1USWA 2H9YA 3N0TA 2CMFA 1QE3A 1E8NA 1YR2A 2XUDA 1IZ8A 3I2IA 2WHPB 5HZGA 1CV2A 4J0JA 2HFJA 4Q34A 1G4HA 1EDDA 5FOQA 4ZXFA 2HL6A 5AKXA 4J0GA 4ARAA 3O95A 4DSZA 2PSHA 5H3HA 2RAUA 4FDMA 4B9EA 3BDIA 1QTIA 3DL7A 3O4JA 4LIPD 1N5MA 1J06A 2ZYRA 1LLFA 2JGKA 5AI5A 2FUKA 5LZ7A 4RE5A 3E0XA 2B61A 2ZVDA 1ISPA 3FWHA 3KXPA
chains in the Genus database with same CATH superfamily
1V8DA 1M8FA 2BUCA 2RHOA 2XX3A 3M6IA 4MCHA 1TJPB 4K1LA 4MWZA 4QDJA 4OMFG 2D74A 1QK5A 2J9RA 3SYTA 1V9LA 3NYRA 2YFQA 4LSGA 2XECA 4MO2A 4O4JB 3LRTA 3BCHA 1JR2A 3PZRA 5I7EA 2VSYA 4MARA 4AZVA 4NRDA 5B1IA 4C4SA 3AR2A 4KGXA 2YVKA 5P21A 3WNZA 2WMDA 4X8LA 3W0LB 4CL0A 4KREA 1RAEA 2IWHA 1FXWF 4QJIA 3TOSA 2BFCB 1WW8A 2B35A 4M38A 4MJ7A 1LRJA 1CZNA 4PG4A 3ZD8A 3DE3X 2VYVD 3VPHA 4MVJI 2WJ4A 4QDUA 2VDPB 5FUXA 3TXYA 2Q5HA 3FIUA 3PNBA 1XWIA 3KYDA 3W78A 1QKJA 4OQNA 3A2KA 2ROQA 4BNWA 1HC7A 1MJFA 4DE5A 3LMKA 2B21A 2OLEA 3L79A 1LK5A 2YC4C 1KSFX 1ZW6A 2Q3LA 4J9VA 3CSDA 2C2BA 2B0JA 2B98A 2HCRA 1E3LA 3O74A 3SR4A 2P4HX 1HT1E 1QZ3A 3W77A 2H5IA 4D9NA 4R1UA 3GQBB 1MOZA 4GI1A 2UZ4A 3ERCA 3I2GA 5BWMA 4CUKA 4UTZA 3GF4A 2OK7A 4RHTA 3IVXA 3TD6A 1GL6A 5MFZA 1A8SA 3FYUC 2JVKA 3HSKA 4AF7A 4AS1A 4WOPA 1ZJ4A 1ND6A 1NL3A 2FHPA 4C3ZA 5EWMB 5ABPA 1FFXA 3O3MB 5DHQA 2BP7B 3U49A 2H4WA 4AC9A 2ZWOA 4DUGA 1NJSA 1WDKA 3HKDB 1H93A 4C2TA 3F7TA 3WKEA 1STOA 4IICA 4DBVO 3LKZA 2W6MA 1ST3A 4AVYA 4Q4HA 1BXGA 1W8DA 3TLBA 4EMUA 1HX7A 3L6EA 4NHOA 2O8BB 4JVNA 1ECLA 2PRYA 3PQEA 2I6GA 2ZIXA 1SHTX 3H9BA 4MI1A 4MW4A 4N7RA 5CLQA 4EPXA 3NHSA 5AKJA 2JLAA 3JATB 4CN8A 5AUPB 5C18A 1PNOA 3K0KA 3SE0A 3V4VB 1DJQA 3A04A 1EXNA 2EX4A 3QE4A 2WP8J 3AH8A 5DMHA 3CYFA 4ZA2A 2QV7A 3WRYC 3FFXA 3HHEA 1QV7A 4FX2A 3LGAA 1EEXB 1RQNA 3WGHA 2B7CA 3I0ZA 2GBFA 3Q5DA 4DXHA 1AKEA 2GEVA 4O1MA 1ACJA 2VA8A 1U9YA 3EAGA 3ZLVA 5AQEA 3UMYA 1ORRA 4HEA1 4CT5A 5A5VA 2BHLA 2YQZA 3OIVA 1GRQA 3FH0A 4POAA 1LF5A 4R6XA 3VJRA 4ICIA 3WRVA 2OR3A 5CTAA 2EL9A 3FSRA 1IOLA 1OLOA 1MCZA 2QZ9A 3IT3A 5KCMA 4XGQA 5BRAA 2PJUA 4KIWA 1J1IA 1Z35A 4H6XA 2IYSA 1D07A 2HQBA 3P2IA 2YNMA 4OXXA 1WZCA 3PR3A 3QXXA 2HSZA 2IYYA 2BJWA 1JIUA 4KQMA 1XTKA 3I04M 3W9BA 3O1HB 3LOUA 5BN4B 1FUIA 3TS1A 2XWBF 5CM9C 2O4UX 3UHPA 4BFZA 4EG8A 3EVTA 2R8XA 3PIRA 4U63A 1KAMA 2X9VA 4YONB 5KSOA 3UGKA 2VN8A 4M1SA 3WK4A 3CZPA 3SG0A 4QRDA 4DLLA 1CZRA 2O1SA 1NUTA 4L74A 3FOFC 4I8XA 3CPEA 3EAQA 1Q0UA 2WT9A 1G1AA 4YPOA 4Q4LA 1L7RA 2PJZA 2P4EA 4HGNA 2AD5A 1BX0A 4NWIA 4ACAA 4LNUA 5I8WA 2EQBA 4MX8A 1BHO1 2VJNA 4EPYA 1C1DA 3U16A 4UHBA 1I33A 2QM0A 3LX8A 2CGEA 1I01A 2VZ8A 4ABTA 1KOGA 1BN7A 5BQXA 1Q84A 2VJMA 2AB0A 3MTIA 5J5AA 3HGQA 2VDKB 5DP1A 1F8UA 2PH5A 4OLFA 1B8UA 4EFKA 5IYZF 5I4KA 3TF5A 1PGQA 1MX9A 4UNRA 2WB2A 4A16A 1YS2X 2OFFA 1SUIA 1IHOA 1UAYA 2H1FA 4L4UA 4OQFA 4WRRA 1QWOA 3RFTA 2C0CA 4AIRA 4BE7B 3U7IA 1UZLA 2R5WA 3MOIA 3QKTA 5EIWA 2OHFA 1T2FA 1QCCA 3D6UA 3L8CA 1D6SA 3TD9A 3WJAA 2QPTA 4BVAA 1EDBA 4D46A 4F60A 2EJUA 4RJ2A 1FMFA 4FI3F 4P7BA 1OBVA 4S24A 5DULA 5BVHB 5GINE 1KAEA 1V16B 1VIVA 2GASA 3VBEA 1IBSA 4J9UE 5J47A 2ZIEA 3B3AA 3JQAA 3IUJA 1AC5A 4MRRA 4JOQA 4NNPA 3QVMA 2DX7A 3HJCA 2QLFA 5CYOA 3K1ZA 1A4UA 1XU4A 4BNMA 2ZRCA 3T54A 3OE4A 3TQSA 1G3RA 3QW2A 3VZRA 4OB8A 3LWZA 4I1YA 2Z5FA 3KELA 1OUMA 4B47A 4K0KB 2W4QA 3OLVA 1KPGA 1XZEA 4G1FA 2LGJA 4RNDB 4UARA 4EKIA 3GGOA 3I3OA 5GV7A 2OCIA 1S8AA 2RHLA 4X97A 1S89A 1HT3A 1OFHA 1ZIXA 2QRVB 3JVUA 4RF4A 2ORIA 5ALZA 1H5NA 4BCBA 3L6OO 2DBQA 3PUKA 1UZMA 4P2GA 1I1QB 3I23A 2EFGA 4XX0B 2JJYA 4B3DA 1Z8FA 1AMUA 1P60A 1HOTA 1QHHB 2NQ8A 3INNA 2OGZA 4NC9A 3D4NA 2XXAA 4EY4A 2GXQA 2KI5A 3GRPA 1KR5A 4J07A 3HMKA 1IL0A 4PX3A 5I9LA 4GOLD 5FT9A 4U5XA 3AI7A 1T5SA 3CF2A 4YC7A 1MO2A 3QZUA 4EZBA 2PUCA 4LAFA 1FTQA 1NJFA 2P9CA 2SCUA 1XNRB 1QS0A 2HIGA 4ARBA 4YRGA 5DHRA 4HBGA 3SNKA 3GRUA 3LS2A 5COQA 2NVUA 5KYKA 4QQ8A 3TTXA 1PZEA 2I33A 4QUIA 4LYDA 5FI3A 4FHDA 5KYWB 3K0AA 1V7QA 2IOQA 2IYQA 2O7NA 2VYND 1SA0B 4TKUA 2IYNA 4G9BA 4UDYX 4F84A 3ICWA 4EL0A 3C14C 4K88A 4XASA 1DAKA 2V6IA 5CX1B 1PNTA 2PIDA 3OEHA 1XTVA 5EZYA 1MW8X 1HWYA 3H4MA 3TRIA 2QTVA 1MFZA 1ZLXA 1U0BB 4N41A 4M7WA 1Z6YA 2F3RA 2RGEA 3OD5A 5AVRA 1MX1A 4TZKA 1WMEA 3BH0A 3BM5A 9MHTA 1V8BA 1XALA 1YBAA 2AOUA 4AY6A 5KTSA 3ZWMA 4IO1A 3WGGA 3C1OA 3KKEA 3WSTA 2CDCA 4RZSA 3Q15C 3AEQA 5BSGA 3ADDA 2QBYB 1HEIA 1SC9A 4R83A 2P3LA 2XLBA 1RI3A 1I24A 3G6KA 3HS3A 2HI0A 4CEJA 2JHCA 4QJBA 4M1QA 1CRPA 4L0CA 2JBAA 3KHSA 2VLIA 4KZKA 1MGOA 3KPYA 3R3WA 5BMVB 1Y6ZA 2JLZA 1QPGA 4HLNA 4KXYA 1JKIA 3QXJA 2PMFA 4FGJA 3IAM6 4PC3A 4XDGA 4FYJA 3V1LA 3WRXC 4K3UA 1BRTA 2I62A 3P5SA 5ETJA 1C7EA 4MYHA 3R74A 3VC3A 3FDJA 4O4HA 2RGNA 1TF7A 3RAFC 3EBLA 2YWGA 1L1RA 4FK8A 3O9MA 4D3XA 4ZYYA 2EWVA 1X3LA 2RFLA 3EA5A 1FDRA 3ZTWA 4C2UA 1RDFA 4GEGA 2J0VA 4INAA 1XZIA 3OJ0A 3K6JA 1QYCA 5BSTA 2J1LA 1VOTA 4FMDF 2EHJA 2LE0A 4ZN6A 4HGRA 1Z6ZA 2YMPA 1L5FA 1XL0A 1MQ8B 1OT5A 2VF2A 1XZNA 2ETXA 4M8IA 2O8DB 4N1AA 4B6EA 2CMGA 1XZKA 4M1MA 4UVIA 3B5IA 4N01A 5ALYA 1EJ2A 5EMNA 2QP9X 1XDUA 4CQJA 1Z5PA 2EW2A 4OHMA 1DJMA 4BNHA 4ZYXA 1KK3A 5F1PA 3GJZA 3BSWA 1XX6A 3F8WA 4CCYA 4E4TA 4K86A 1ZMOA 4YPFA 4KRXA 3LA6A 3NH6A 1CCWA 3UJHA 3ML1A 4LZJA 4WN9A 5A03A 2IOFA 3QI2A 1E2LA 1XUOA 3OKAA 4Z1OA 3FHCB 2PM8A 3CCBA 3HXLA 4LBYA 1Y63A 4LYJA 2NT3A 4P7GA 1E9DA 2IU0A 3BWVA 3GN1A 3RADC 2GEUA 5DYIA 2OUIA 4ZO7A 5H5JA 1OGIA 4MVJF 1RYZA 1ZM2A 1E6WA 5LL6P 2C7RA 1OI3A 4AJ2A 2Y68A 4WDRA 1UDCA 3BWMA 1ZKDA 4BJ5A 1VCHA 4K9NA 4BKQA 4KFRA 4R9RA 2OHJA 1VFPA 4YO8A 2YIVX 5CJ2A 4A6PA 4DQVA 2CLSA 3D7LA 3DLTA 1XHEA 5DBFA 4ENQA 2BGRA 4DSAA 3X2EA 5E1MA 4RC9A 3E9MA 1XTJA 1OREA 2Z98A 1JLSA 3VSBA 3AQIA 1QP7A 5J4KA 3TEMA 1LBIA 2FAXA 2GF9A 2H51A 4EKNB 1NG9A 9LDTA 2GHRA 1DC4A 1VXOA 2YW2A 5DZSA 4TV9F 1XSEA 2E6UX 1R0XA 1C1XA 3IUBA 4JENA 1CE8A 3B70A 4MVJH 4V38A 2HYIC 1YRWA 3EZ6A 4CEHA 3CGGA 2IP1A 3M6UA 4HVAA 3QBEA 4PONA 2HWUA 3B2NA 3OPYB 2WU1A 3TFWA 1SXJB 3BXEA 1HTBA 3MB8A 3RUCA 4DREA 2GPAA 3NIDB 4L51A 4QPJC 1E99A 2N42A 1Q91A 1X8XA 2XH8A 2ZE5A 1CXZA 2NTVA 3QKWA 5KC9A 1Z47A 3H0KA 1UUFA 2W2PA 3ROZA 3DZHA 2HJSA 3GBPA 1XF9A 3VU0A 1VE7A 1CY2A 2FETA 3KX2A 4Z49A 5JCZA 4ROTA 3N0VA 4DSUA 3ZW9A 1SIOA 4PNEA 4QHTA 3CT4A 1JIVA 2HA0A 4OGWA 4RTSA 2QSUA 5TMBA 1XN4A 5G4LA 1IE3A 2ZBDA 3NLLA 3RV3A 4CIYA 5A2QA 1KL7A 2HK6A 4WTOA 1H2FA 5BWNA 4QTZA 4AROA 3NHBA 1QDLB 1P2VA 1DQRA 1SHLA 2O07A 3PHLA 3L1HA 4G0OA 3UXYA 1RRPA 1PGJA 1VB5A 4JZYA 4PY2A 4BRUA 1T1JA 3LZ6A 4HCJA 4HJRA 1BE8A 4BXOB 1XRLA 3S2ZA 4GICA 1NMQA 3D81A 1VA5A 4N18A 1SVLA 2W6NA 2IZOA 1K63A 4OY3A 1I6KA 1A27A 2IUSA 2DFPA 1UMBB 3BJZA 1P18A 2XT6A 3I04A 4D4KA 4O3MA 4RDCA 1SURA 1RYHA 1CVLA 1XU7A 2ZYSA 3LCRA 5KX5B 1FYEA 3E35A 4LXHA 4Y1GA 3WMWA 1BMTA 3CEMA 3RYIA 3LPNA 4GPIB 1Q0LA 4ZI7A 5HCUA 3AF4A 8ABPA 1EVJA 1GKIA 1H0HA 1U94A 5AM3A 2WJAA 1J97A 1N5LA 3CXUA 4N0QA 4WFQA 3GLVA 4IIEA 1GNSA 2ID9A 2QEQA 1Y7IA 1QK4A 2PQMA 3H5IA 3LHFA 2XUIA 1P5ZB 3MJSA 3DTTA 4R5MA 4I19A 4YRPA 1QZXA 2QTFA 3K0HA 4KOAA 1P7VA 1RBYA 1Z28A 2X1LA 1ULSA 4L9SA 4DNXA 1UM8A 4ER3A 4RY8A 3ZU5A 1YFKA 1G6KA 1T9CA 1LTKA 3B3FA 3USCS 2HWKA 2P5YA 3OM1A 3K9GA 1UJ4A 4G8CA 4H1VA 3M82A 1Y5IA 4BVLA 3RS4A 3NTXA 3ZV5A 2PTHA 1C1XB 2AXEA 2QW0X 4P83A 2AN4A 2C61A 4X90A 1MENA 3LUHA 1T2DA 4EJMA 3IDAA 2XTJA 5GZ3A 1KMHA 2XIQA 3ANYB 4ZT4A 2DLDA 2AQ8A 3QU5A 5DK4A 3LQKA 2EKLA 4MMXB 3OESA 5HCNA 5HDBB 7YASA 3H8WA 2I8CA 3PC6A 1II8B 2VH5R 3U13A 3EH1A 5HHTA 2BGLA 1U6JA 3H6KA 5CUQA 3J80A 3P2MA 2FPIB 3QFTA 4PANA 2Y1OA 4UAGA 4KE8A 2BFFA 2F8LA 5JH7F 1FRZA 3IR5A 2BOVA 3OMXA 3QM1A 1LKZA 4X85A 1CQJA 1HFKA 2GNPA 4MV1A 3JQDA 2OO5C 5KPJA 5CVTA 4H1UA 1G19A 1L8OA 1ZGHA 3PT5A 1Y1TA 2GHTA 2VQ6A 2JIBA 2H1WA 1GGHA 2DBVO 2FZCA 1NR7A 4IYJA 2A9QA 1JJVA 4F56A 3Q3EA 1J2JA 1EWKA 4IF4A 4L4YA 4R1OA 5JZVA 2JF0A 3HCDA 3CBGA 3PDIA 3WLIA 2J9YB 4CPDA 3DMHA 3R0JA 4WN9B 3WZLA 4DLZA 4W8GA 2QYSA 1AS3A 2VG8A 2PDAA 3M2TA 4JOSA 5DT9A 2XBMA 4CCYB 5JXWA 5AW1A 5JI3E 4YLEA 1W2HA 3WK6A 1U65A 5EJ7A 3QQ5A 4YJFA 1FDOA 1NIJA 2ZE7A 1SELA 4ZT3A 4DCVA 1L4GA 1PZFA 2VP4A 3ECSA 2VHXA 4L8VA 3ZDEA 2VHYA 1OFIA 4D9BA 4UBLA 1VRWA 3K16A 3BF7A 1Z5ZA 3ND5A 4QXOA 1I7SB 1L4FA 2D13A 3ZEAA 1GUDA 2CLDX 4MRAA 4YT5A 2XAUA 5E4YA 3PRHA 3U9TA 4BWFB 3F5SA 3VDXA 4Q82A 4Q3DA 2KS6A 3HADA 1AQIA 1W88B 1LVHA 3O8NA 4FZJA 4TQ9A 1GXSA 5AUOB 4TZ0A 1Y6JA 3SKVA 1U2PA 3IDZA 3RSFA 1F8YA 1PUIA 3FYDA 2LDXA 4HH1A 3H42B 4WVLA 1LDNA 3BN3A 4EI2A 2ECQA 5IDWA 4AK9A 1Z82A 4F3CA 4HB4A 3K4PA 5JXJA 4CEIA 4OYHA 1LPOA 1SVSA 3AR7A 5HIMA 1RXCA 4W5OA 4HDKB 4BKRA 4IJKA 2VZEA 1CE8B 5K8IA 1RYBA 3CWZA 4L3WA 3OCCA 3S2YA 1NW9B 1IH8A 2D8MA 5EJ4A 5KJ1A 1D7AA 4OFZA 1OZFA 2GCOA 4RYDA 4PLCA 2A6PA 3RABA 5IAOA 3IUMA 5KMGB 2N75A 3PUJA 1TC1A 2EGGA 3UFBA 1TU0A 4MWCA 4UCWA 4DKXA 3OQOA 1J8YF 1RWVA 2E85A 5BN5A 4FYXA 4LJYA 5BN1A 3G8AA 4NG5A 3LPDA 1KMQA 4OK6A 4JKIA 4UHFA 2X4IA 5HFNA 3CPHA 1PQ4A 4O25A 4HXFB 4FDAA 1H9BA 4H60A 2P5TB 5ESXA 4AJEA 4D4IA 4EA7A 1TI7A 1O95C 3IV6A 5G3ZA 1Y8QA 3LQQA 3GBSA 3OQVA 4TYNA 1SVNA 3CB4A 1YZHA 4HDMB 2Q5JA 2VT7A 3FZQA 3X1DA 3TFOA 4XIJA 2B37A 4L3OA 4LJAA 2FLWA 2GZSA 4LQCA 2YV4A 3ZY6A 3PI7A 2HMAA 4GD3Q 1DBRA 3BBPA 3IR7A 1XQXA 4EEXA 4NECA 5HOQA 4YALA 1G0OA 1KWKA 2VK1A 3PHIA 1CS0A 1PS8A 2QAGA 4ASUD 1GRCA 3AP3A 3O0DA 1XVAA 3NTRA 1SVOA 4DDVA 4C7JA 3SBOA 1PJSA 3IUPA 2ZPAA 2SICE 1VIDA 4I4IA 1GPNA 1Z2OX 4N3AA 5JTUA 4OHXA 1V25A 1D2EA 3UAYA 1F2TA 2K7FA 3O6VA 4NJEA 4BV9A 4BNJA 5IU6A 5AVYA 3PHGA 5LB4A 1KO7A 4F45A 3HUTA 3IB3A 3IPYA 4PAGA 2QMHA 5EESA 1PK8A 5EE5B 2UUAB 4E1AA 4N0PA 2A4KA 1DWQA 3RYHA 2CFIA 2HM7A 1EG7A 2YH2A 1FPMA 3A6ZA 3IJRA 1XD8A 4PTLA 5TEWA 3KEFA 2WIGA 1W36D 1A7AA 3TJMA 5LVAA 4MWOA 5FBHA 5FQOA 3HY6A 1KI8A 3MOGA 3NMUF 4JQCA 1V1MB 1Z6TA 2NQTA 2IDKA 5I45A 3R3HA 3PV0A 5JBIA 4ZJZA 1M7GA 3QYJA 4EB8A 2JFXA 3FOEC 3WI7A 1G9SA 5L7TA 2QB5A 4HK4A 4O2AA 4UFPA 4YCDA 3ON5A 4I1SA 2CV2A 4IHJF 1YJQA 3M5PA 1IOZA 2Q41A 2RH5A 3QEJA 5EJ8A 5JI2E 1COZA 2PLWA 3GO4A 3HCRA 2FUG6 3I2YX 1YS4A 3FF1A 1AUQA 3EPRA 3AF6A 2PUHA 4W5WA 3SM9A 1Z56C 5HQ3A 4QBGB 3UUWA 2FPUA 4RA9B 5BV2P 3TXAA 3OIGA 1TZJA 2P3QA 2QYHA 4K46A 3URMA 4Z5XA 5JNTA 3PGMA 4W9NC 1E4EA 1HDZA 4P33A 3ZZTA 1M83A 2VRWA 1EP2B 3VZQA 3IAAA 5AUNB 2V7PA 1EFPB 5K0JA 2H4FA 5TXGA 4KO2S 3DQQA 3AGQA 1YNOA 3CZ4A 3SLKA 2XYVA 5BYAA 5HUQA 2C98A 2NUAA 3A9VA 5D1HA 4X3OA 1BC5A 4BTVA 3DKIA 2D7JA 3I01A 2BGJA 4A1FA 3ZDZB 1XKXA 2J9GA 4TTSA 4LHXA 4Q02A 3GRAA 1H0KA 1MNAA 2QMQA 2TRSB 4MA0A 2XRMA 2ZXUA 2MYTA 5TQJA 1LLQA 2E7ZA 1P1IA 1U0JA 3GDHA 3PGA1 4NFLA 4QO8A 3R6GA 3PDHA 2P4QA 2MSLA 2EZ9A 2OBXA 2WNSA 3BQ9A 3FMPB 3QBDA 4H9GA 1E8MA 3EFOB 3N2KA 4CIXA 3G2HA 3AUFA 3PX3A 1KDVA 4CTKA 4EI9A 5JSZB 5G0WA 4PQEA 3OTIA 1QCZA 3IPCA 4AO6A 2E4ZA 4AUNA 1SCNE 2FRVA 4PVDA 5THQA 4OI2A 1HDIA 1IZYA 1SBYA 5G1OA 2FWIA 3IUSA 1WZIA 4MQBA 3AONB 4UTPA 4EJ2A 3N2GA 4H7IA 4K3VA 1FYDA 1MVOA 1PYDA 5FUMA 1CJSA 3FYUA 4YJ3B 4YCJA 2PSFA 1GKYA 5G40A 1KRWA 2IBSA 3HA7A 3TSZA 1RWBA 3K6SB 3DTVB 3WDKA 2WM2A 5JNWA 5BPHA 1RQPA 1GG9A 3UK1A 1HSOA 1PRYA 5IM4A 1LZLA 2OENG 4DMHA 2RKBA 4RTRA 1FFCA 3JQ8A 4HN4B 1MHPA 3TDKA 3C48A 3MPOA 2BHNA 3BERA 1KYXA 2QMYA 4LHSA 4HADA 1E3EA 1KVRA 4HH4A 3KZVA 1W44A 4LZWA 1XTBA 2DTDA 3EXHB 4UVGA 3FPCA 3IPLA 1KGSA 2VZ0A 4XIYA 4UFNA 4CM9D 4EG4A 3AFNA 3RSQA 4KN8A 3U3RA 2I4OA 4BLOA 1NW6A 1PZHA 4TROA 4UEJA 1PYOA 1B7GO 1IQUA 1ZD5A 2WB4A 1DG3A 4X6LA 1YHZA 2PPLA 3OOSA 1EJ0A 3ABIA 2J0UB 4Q9DA 4XARA 4BO0A 2XF2A 5F33A 4QSHA 4JV5B 3JQ9A 3RC3A 3HVUA 3DKKA 3IHKA 2H31A 4HATA 2NO0A 4RV5A 1UQRA 5M34A 1UBFA 4B8ZA 3K3PA 2P41A 1ANKA 2CNNA 4P86A 5TS3A 5KOYA 4GSKA 5LCXA 2GZHA 3UJDA 4B6FA 3PJFA 5DYTA 3VO9A 4JT8A 2O8VA 1QRAA 3NC0C 2OCKA 3Q1LA 5KHAA 1Q2XA 5AXAA 4AYWA 1RIFA 4YVFA 1DAFA 2BMWA 3NTQA 1EUDB 4HX9A 3R9IA 5KUTA 2FW9A 2IU3A 1KMHB 3DEHA 3HV2A 1G5FA 4DQLA 4EKGA 2C9OA 1M72A 6GPBA 2WICA 3F71A 1PFKA 1QU3A 5DIZA 4DCMA 3MWYW 3VNQA 1XDSA 1IJFA 4K87A 4M1KA 4WZ6A 4YBZA 1EFTA 2BGNA 3RE1A 3FRIA 4G86A 4YUZA 5KVCA 4CMIA 2ZOSA 3MUEA 1XV5A 3QTTA 5ESRA 4CV0A 1LGYA 3L82B 3QUBA 3OZWA 4NBSA 4YAOA 3VVMA 5JMTA 3E8XA 1WY5A 2D06A 5EMKA 2F1OA 3BWXA 2Y1GA 1QHSA 1J2YA 2DCUA 3WNVA 1QIHA 1T24A 3CWCA 5IT4A 5IZCA 5KWJA 1VGVA 5FL3A 3BTVA 1YV9A 5A7GA 4HRVA 3RTBA 2AQHA 3MJTA 3SHOA 4RPCA 1MABA 2I65A 4G5SA 3RVKA 1IN7A 1THTA 2EBWA 3FNBA 1KJWA 4HFJA 3ZCQA 2O2CA 2QLNA 4GXRA 4K6FA 2D1QA 2A4MA 1E0AA 1K8XB 2XTMA 5FUBA 2FVXA 4PYJA 3ZU3A 3K7EA 2XYQA 3CM0A 3OJCA 2BFCA 3P0JA 4BJ1A 2AN5A 5BQ3A 3WL4A 5HKAA 4LTMA 4R81A 3AETB 2VOJA 1A9TA 3TAUA 3TTYA 4K81B 2PX5A 3QUCA 1E66A 1W48A 1GTL1 2Y2UA 1XP5A 3P94A 3M9LA 4UUBA 5BN4A 4PGGA 1J7KA 1NJGA 5ICGA 3GVCA 1ETHA 1YH3A 2QLJA 1DBIA 4F0JA 5KCZA 1EM8B 1DIOB 1W4RA 2YV1A 3A27A 1YQEA 4EX7A 4FCVA 2EW8A 1CY7A 2KQUA 1XDGA 4L7VA 4M89A 4BX0A 5DGTA 1U2TA 5KNCA 1YF3A 3HDYA 4ZZ2A 2ZB4A 4FW8A 1A5TA 2XSZA 4IF6A 2JJQA 2M1ZA 1M9NA 2R96A 3JQQA 4EDHA 1JHZA 5DX8A 4R9NA 3LOPA 1VBMA 4LKOA 5I7RA 1UWCA 4LCJA 1YE5A 2VQFB 4XOUA 5GM1A 1E89A 2RHRA 3BTSA 4KC0A 3TTUA 1W5FA 5EZ5A 3VAZA 3VDRA 4A91A 1ENYA 1PR1A 5HKOA 4PS0A 4Z4FA 2YASA 2UV8A 1ZUNA 2WTNA 3PXGA 5K7SA 2FP4A 4WCFC 4HNRA 1NBME 3DE6X 4ZO4A 5H0IA 2OY0A 3TTVA 4YMUA 1GDTA 3VPCA 1PEAA 4LHYA 2GH1A 1UFRA 1HQCA 3PFWO 1J9ZA 4PG8A 3ADBA 3SC2A 2AXPA 3E7XA 2FN8A 1E9AA 1JWLA 1SPXA 1G59A 4I5GA 2C9ZA 1RNLA 3L18A 4PTZA 1N9GA 4OSOA 5LBUA 5B55A 2JGJA 3TCKA 5CTJA 2OM2A 4CLRA 1JJAA 2TECE 3EVEA 3UCEA 1ZMTA 4UMDA 2QN6A 3ROMA 1V95A 4FKMA 1YBVA 4DWOA 4HWTA 4UU7A 1ZH0A 3MUNA 5CX4A 3W6PA 3TZCA 2PPVA 4G65A 1K3TA 2C2GA 3QFSA 5BQOA 4MR7A 3ROXA 1NUPA 1WQ3A 3WBKA 4QYMA 1QNFA 4YP9A 2BFOA 3RBAA 1PZGA 3PIIA 3ZDRA 1BJRE 1W1WA 3IO3A 5JZMA 4IQ0A 1KKLA 3EVFA 2ZVQX 1JW9B 5AOAA 1C0PA 1MEEA 2GDJA 4AS3A 1WUYA 2CJXA 2R25B 1JYSA 3MSCA 4X60A 5T7BA 3D3WA 3MJVA 4R51A 5CFLA 2VDWB 2NQ2C 5K0FA 2HUPA 2HHJA 2Y27A 1PT9A 1Y8QB 1YUNA 1Y82A 3A6LA 4IEEA 2G8NA 4MYRA 3RU3A 3CVUA 4TMYA 1J5XA 4YMIA 4DJJA 1V5IA 4PIVA 4LDQA 1BX1A 2OWEA 2E18A 3HB0A 4FONA 3WGTA 4BBAA 5F12A 5EVJA 5PNTA 3JVIA 4I5FA 1WJGA 1UFKA 4EW3A 1B23P 4S05A 5BN5B 5FEUA 1VA4A 2VT6A 4I4LA 3JTMA 4I66A 5EZ6B 1DIGA 3O1JC 5K51A 3RM3A 4YRNA 1ZHHA 4HEHA 4D3FA 2VF8A 1DS6A 4O08A 2VAWA 3W6UA 2EDCA 2JCGA 2ZTMA 3DUFB 1ZCJA 3G0BA 3R6DA 4KWTA 3GGSA 5SZHB 3REGA 5AVWA 4LSWA 3LX6A 2PKEA 1E1CA 4INJA 3NAZA 4GM1A 3WTBA 4AMZA 2OBBA 2RKWA 5FLXA 1GQFA 1T3SA 3WWDA 4MCJA 2ERYA 4U1RA 4E2FA 5KVAA 3LY7A 1M0WA 2KPOA 4GVPA 3W5CA 1JEOA 2ILVA 1WL8A 2ZCJA 3OBIA 3JYLA 2V5AA 2OSVA 1NY6A 3KQPA 4DV2B 2CD7A 4JH0A 2ARKA 1NNSA 4GE3A 4FMCB 2I91A 1EB8A 1DJPA 2J0SA 4G8DA 4I2NA 1Q16A 2W37A 2OCYC 1E4VA 5EUQB 5FBRB 4X66B 2QTMA 1HQYE 1ADFA 2IEZA 2ZRFA 1GLVA 3AL2A 4DLXA 5K99A 1A69A 2QWXA 4YP7A 1GQYA 4WLEA 5F9MA 1WHSB 4MQ5A 4U7PB 3V4RA 1U0EA 3U4AA 3WWEA 1NPDA 3IPRA 3BF8A 2DWUA 3PR1A 4S1TA 3CR3C 2VP2A 4PAOA 2CF6A 2HMYB 5CB4B 5K4HA 4JI7B 4PQGA 1IRXA 1M2VB 4DCGA 5LKAA 5AICA 2O20A 5H4GA 4FB4A 1PQPA 1TK9A 1PQYA 3PVZA 3I9V6 4GR9A 4DJEC 1INLA 3WQHA 3E6AA 3V9AA 4EQZA 2CBGA 2OFOA 1E6MA 3MMPA 4EG7A 3AESB 1V6SA 2VZLA 3QEOA 3R7WA 5KHOC 3EXG2 3O8OB 4D3DA 4BNYA 4EYEA 3WRXA 3VJLA 3ROPA 5C9ZA 1NJ5A 2OL4A 2VXOA 3AEKB 1C30B 4EG1A 3LTNC 3B1KA 3BQNB 2ZJ3A 1R0CA 4F2GA 1WOMA 1ZM9A 4XD7D 3QKSA 1VBKA 2CBXA 2CCGA 1IBRA 1TJYA 1KTIA 1IAVA 1VCNA 2Q4RA 3NW9A 4MDEA 2XYPA 2BTOA 3D6FA 5I9SA 3WQRA 2MSCB 4S0XA 2W48A 5K0BA 5DFAA 1OFVA 1UIMA 5FBQB 3B6MA 3FCUB 3GJ7A 4A0HA 4HRAA 1OVMA 3QPBA 3OCUA 2JBHA 3AKDA 3CMMA 2I5PO 1C0IA 1NXTA 3EEBA 1XZDA 3CLKA 3YASA 2ZUBA 3B51X 3VUFA 2XWQA 1O08A 1F20A 2G5GX 3KKQA 3VPDA 4X64B 4ENPA 1PNRA 4A36A 1L7NA 2Q3HA 3FCYA 2J85A 3CV3A 4IIJB 3RS8A 4JC5A 5HQTA 5CA1A 1FXSA 3ANXA 5J4LA 4JUDX 2VATA 2GYYA 4UPEA 1P8AA 1JQDA 2ZYTX 1KH1A 3O91A 2XQVA 1T29A 5G0VA 5EKDA 5A62A 1WHSA 4PGAA 1K9SA 4BASA 1ZU5A 4HDSB 2WMNB 3IFSA 3O3NB 4RF3A 3E9CA 4BNIA 4GECA 3GROA 4F85A 1Y3FE 2FGJA 1IBCA 4W6QA 4GUDA 5DXAA 4A15A 3GLIA 1EDZA 2O7RA 4M7RA 1JIJA 1GM5A 4GMFA 4IFTA 4PNPA 5JEDA 2ZE8A 3LXUX 4XX1A 2RCNA 4F9EA 4RORA 5H7XA 3BHNA 3EZFA 1H8HA 3I39X 2R8ZA 3A1TA 4FINA 4G0XA 4ZQBA 3S1LA 3IELA 1NKSA 1DAIA 2Q2VA 3KKMA 3OIDA 5HS4A 1SBQA 4D5EA 1GT91 1OBCA 2E1PA 2AUTA 3FFTA 1EVEA 3Q3HA 1YU9A 3TLYA 5KNBA 3C6KA 3EG9A 5K4GA 2PSDA 3EPHA 3DOEA 4YAIA 2ZJ4A 1Y5MA 4TUYF 3RRJA 2GAAA 1QAQA 2C4WA 4HB0A 1EH5A 3CNOA 3ZNNA 2XTAA 1ZGAA 2ZULA 4B2IA 2NVWA 4MWDA 4XR4A 3T94A 1OT3A 4B4DA 2GUWA 3EEIA 1AKRA 2QAIA 3SICE 5LPNA 4OXIA 5K8CA 5IWAB 2PH1A 1MOQA 1UXIA 4X93A 4D8XA 4YPVA 2JHFA 1O5OA 2AFHB 3HDVA 4O4IB 1Y6QA 1BZYA 1I4DD 3EXIB 4F97A 2C83A 1U2DC 1BA3A 2IHZA 1XZAA 2WP0A 2VRNA 3C7KA 3ICPA 5L4LA 1PL8A 3UUEA 2V55B 1X1DA 4I81A 2CKDA 3ZY2A 3GD7A 3RIYA 4BPBA 4RHYA 3SXJA 4QEKA 2R47A 5ERGB 3IEVA 4IGIA 3OZFA 3I9NA 1UXKA 2NPOA 5ALFA 3KZNA 3V1KA 1V4NA 1HTTA 2QX4A 3KJXA 1X1CA 1ZMXA 2MINA 2O05A 4M1WA 4M88A 1XCOA 1E62A 1TT5A 2CD9A 2I0FA 2JD2A 2XI4A 4ZYLA 1Y37A 1D4OA 3THXB 1SHKA 1J8VA 1IMOA 3OUUA 4MYCA 1YONA 2FYTA 1Z74A 1TQ6A 1UBSB 1ARZA 2QIOA 3AY0A 3DCNA 3O1IC 3LT0A 3PQ4A 4DTIA 4RJTA 3I37X 3B7WA 5IBCA 3G1WA 1OI2A 4MGZR 5TQ2A 1HY3A 4BWVA 3EF0A 2RHMA 4Y7CA 5B4UA 3WDSA 2H54A 3ED1A 4M0PA 4OATA 3WYAA 2ZTUA 1UKCA 1H8ED 2LXNA 3TNJA 3W6NA 3EGDA 4CQMB 2DRIA 1JSRA 2I9PA 4IVRA 3ZQ4A 4LRSB 2ECPA 3P7MA 1FS4A 3C7DB 3CNHA 4FGWA 2PV0A 3A2LA 2FDRA 4YCAA 5D2CA 1MQSA 3MLBA 1OKKA 4Y9SA 3LLCA 1ILWA 3KE8A 4JJ7A 2CLMB 5ALDA 1LLDA 2CHEA 2JRCA 5L53A 3SJUA 2N1BA 2VHTA 3AHHA 4NOLA 3T7DA 3E9YA 4LE0A 3S2EA 4CIWA 4EZEA 1I36A 1Z5VA 1JDZA 3DF9A 3SSNA 1XDBA 4N5IX 2GN8A 1L7QA 3NRCA 5JZSA 2F1HA 3HBAA 3N87A 1IY8A 5GGYA 5AHOA 1A5ZA 2CN1A 3PT9A 5SZIA 3H5LA 4BO3A 5GIPE 4KPYA 1UPTA 2WOJA 1XXLA 3MLAA 2G71A 4LXXA 3ZJTA 4HDAA 3WLKX 5ADVA 3VHLB 3GNTA 3SZLA 1QVVA 2PRSA 3DOUA 1NVTA 5L3SB 3AP2A 1C7QA 2X3FA 2XNDA 3I34X 4RZIA 2ZUFA 2Y3IA 1IC6A 1X94A 4I1UA 4LBZA 4Y2VA 3PLAE 2FG6C 2QN7A 3L7IA 5JS2A 3A7DA 4EPWA 4ER0A 5J4YA 3W90A 1RI1A 3BD7A 4IYRA 2N46A 3WGOA 4DMFA 4V1CI 3FKQA 1M5UA 2QSYA 4CLOA 2ZJAA 1YXMA 3B9QA 3UJ8A 2WI8A 4KSCA 4E22A 2GBPA 1W7AA 1TADA 2G5PA 3C6QA 4C7KA 3LGSA 2CCKA 4PYOA 3U5TA 5C4MA 1E6EA 2IPLA 3GDOA 4NH0A 1J8QA 3LXMA 1MEJA 3IOBA 3B3QA 2CYAA 1P31A 3PC8A 2VJOA 4MAMA 5FTMA 1AOXA 3THWB 5CT5A 3TRHA 4L2IB 3H9UA 2SNIE 1M33A 3O8BA 3HB4X 3KZKA 4ZANA 2C5SA 3ZH9B 3IDFA 5K1ZA 2OAQ1 5ECWA 1W87A 4OIFA 5BSMA 4KJXA 4ID3A 1CVRA 3SQXA 3QEMA 2ZKIA 4QWMA 3T7KA 1UJCA 4B3SB 1LH0A 3G9XA 3ITDA 4LX8A 4NCBA 1ONPA 3Q7TA 3ZWBA 1NLZA 2DYKA 2NV6A 4N0EA 3BIWA 1P4RA 1K5DA 2JAQA 3A28A 2J5RA 3D7RA 3N76A 3Q11A 3DMDA 4OXKA 1NVEA 4P84A 3LYAA 3ET5A 1VG9B 5EJFA 2C1ZA 3B82A 3WAJA 2B1QA 3G5TA 3ECCA 4H77A 3VKGA 4TL7A 4DWVA 3OE7D 1Z7WA 2O6LA 3GLHA 3OLWA 4KSBA 1V3VA 2AMVA 4X1KB 1JHXA 1XVLA 3QELB 3X1WA 3ZY5A 5IJ9B 2NUBA 4ERNA 3HXOA 3ZK9A 3U1BA 1DKMA 1U3WA 4FFPA 4GM4A 3ZKAA 2CFSA 2UVDA 2HK7A 1N2BA 1ZXXA 3K72B 5KWVA 2ZJ1A 3DOCA 4J03A 4QTXA 2PUGA 1IPEA 5K3BA 1DPFA 3ROTA 4YRIA 1DXHA 3E2MA 4BO4A 2LWIA 1B74A 2EX1A 2AYZA 4LXYA 4O4JA 1KH2A 2BM1A 2XDQB 1NLYA 4M9RA 5CW1A 5IN4A 5EIEA 1QDUA 3CMCO 1WB4A 1ML4A 4G4JA 3GUUA 3EDRA 2GERA 2XV1A 3UT6A 3WMRA 4ENTA 3UCFA 4EPTA 5DH9A 2NT4A 3WL3A 3JQRA 3A06A 5ARBA 3PEFA 5LWQA 5GONF 1LTQA 4P22A 2YN2A 1LUAA 5CX1A 2P40A 3ZBQA 3RFXA 3T5BA 3IAHA 5IUJC 1ZH2A 4KL8S 4TKUB 2EYQA 4Y2SA 2VUUA 5E6RB 4ZI5A 3NHFA 4IM7A 1A82A 3OX4A 1P5FA 4O33A 3ZYZA 2NXEA 3D4PA 2MSNA 3T4PA 3GGPA 2B2CA 3RRZA 3WC4A 3QXSA 4O29A 4IHQA 3V4SA 4M21A 4YCMA 3LC0A 4XKJA 4ZCMA 2Z5LA 4Q9AA 3CA8A 1QS0B 2VHZA 3EUWA 1WVIA 4HB2A 4X94A 3PFFA 4F3NA 1Y4ZA 5CH5A 4YRAA 1VJDA 4GKVA 5DP2A 3Q87B 5JG7A 3LKVA 3QENA 4UBMA 3WK9A 1OZGA 1OROA 2ZUDA 4C1BA 1EINA 4RQBA 1GG2A 4CMHA 2F8MA 3C3EA 2G08A 4AJKA 2Q3JA 1V35A 4LTNA 3BA1A 1PV1A 2WT4A 1SU6A 1K92A 2MMCA 4OHOA 1P29A 2NTYC 4OSEA 5A3RA 2G0NA 3OIFA 4DGQA 1U0OC 2L19A 3DZFA 1F12A 5KWIA 3JWGA 3LCVB 2WUWE 4RF2A 4XJXA 3ZVRA 4B6QA 3TB6A 5CVUA 1CUDA 4BNDB 2GCEA 3FI9A 5EIOA 4O5OA 2M6RA 3H5VA 4Y1EA 3SIRA 1ZL2A 3DWGA 3V1TC 4BWYA 1ZN9A 1V0JA 1KEZA 3E81A 4M55A 2X41A 3H1FA 2CNWA 4IOJA 3T3IA 3TPFA 4ALKA 4D45A 4MV4A 1NAHA 4RIEA 2DETA 2OXCA 3OZEA 2I71A 3NVDA 1SZPA 3L8EA 3QUAA 1SKMA 1G2IA 5JAQA 3RIXA 1D2HA 2H48A 2AVDA 4EF4A 1K0FA 2ODPA 4RZXA 4P80A 2YFKA 4JHLA 4EF5A 3AFOA 3RH0A 4CLXA 1FCJA 3A6FA 4BB5A 3SHFA 2ZPTX 1PK9A 3OVMA 1I4LD 3UMGA 3H2JA 1P0CA 4ZHQB 4I8IA 3PG5A 3OTQA 1X13A 4KQJA 5DCWA 4CQLB 4V0NA 2H9IA 4NU8X 4X1KA 4Q66C 5BW4A 2JDID 4DWJA 1ZESA 5KC8A 2CL6X 4FHGA 3SSOA 1RWXA 1GPJA 2YCBA 5AIBA 3NDRA 1GD1O 2GEKA 2WJGA 2W2KA 1KDYA 3UJAA 3D02A 1OIXA 4XUEA 3QH4A 4BATA 1JMVA 2G4CA 3AR6A 2QLTA 4LJ5A 2JLBA 5AI0A 2ZJOA 4KQ1A 4QULA 4W1SA 3OCYA 5AKHA 4A9AA 2QP3A 1PWYE 5D5QA 1U0HC 4ND6A 2D5IA 1WOYA 1DRJA 2GB4A 1EWRA 2ZTSA 4M4SA 1FXUA 1H69A 3F3SA 4WIAA 5M3BA 1FP6A 4LV5B 4QBFA 1QYIA 2H9AA 5CFOA 3KR2A 1ZNWA 2POQX 3ZU4A 3RTGA 1U2EA 3MTGA 4IIJF 1ZXLA 3D6MA 4P0QB 5GP1A 4FWTA 3FLBA 2MWMA 4UD6A 5DRYA 3V2IA 4G5QA 1HETA 2DSNA 1HF3A 2XCUA 1P1KA 1W0CA 2AJDA 4H08A 4B3FX 4J2OA 3PGJA 4DJTA 3PF8A 4GKBA 4BXOA 1JH8A 4HAWA 5DK6A 3V48A 1ULHA 3HRHA 5TIIA 1PNVA 4KXMA 5JSQA 1Z8NA 2D1RA 2GBCA 4NCJA 1FF9A 3IDOA 1FJXA 4HTAA 2OQRA 1JDTA 3HZOA 1OHHA 5BNFA 4U0KA 1GDDA 4ZVOA 3VTKA 4REQB 3OETA 1ULZA 5IUKC 1TDJA 2RBEA 2OXEA 1A9ZA 1KQFA 1PG0A 1XEXA 1JA1A 3T15A 2GPTA 2OMKA 2X0EA 2H4JA 1ENZA 5C3UA 4A0GA 3RV4A 4CIDA 4DHEA 3JV7A 4KLZA 4UDOA 3LX5A 2FX5A 3BK7A 3M1IA 4DT1B 4TKVA 1I2DA 1KMNA 5JRDS 1UKZA 1E3SA 1KJIA 2I29A 1YUMA 2Z4RA 3GFGA 3ZHQA 1KAHA 2E4XA 5D1NA 3K9FC 3L5KA 3AUXA 5H83A 5AD1A 5C8ZA 4DR5B 1ZQ1A 3QKUA 1AH2A 2E4VA 5LA6F 3E5RA 1N8NA 4GSYA 1KDRA 1ZVKA 2IPAB 2RHBA 1ZVVA 1ZR2A 4MYTA 1QSGA 2FZKA 1ONBA 4OOFA 3AG5A 3STHA 1EQAA 3ICCA 3TE7A 1RQLA 3IAS1 2I9KA 2NZYA 4KGZA 3EIUA 4RXTA 3DPUA 4CQMA 1A8IA 2JL1A 3CW9A 4WZAA 1I4TD 3PIDA 4ZARA 1GGVA 3B38A 1VL1A 5TQ2B 3Q7PA 3KOZA 4OTZA 3H04A 1AKVA 5LD2C 2XB6A 1V9SA 2C2MA 4OVKA 4EJSB 5CVVA 3I8XA 3PHHA 1XIVA 3EF3A 3UB2A 3V1YA 4HGQA 4Q3LA 5LQKA 4OLBA 2BV3A 1V7CA 2WPDD 2X3YA 3U7HB 2NV0A 2IW3A 3UA3A 1JG3A 4ZK2A 1OFUX 2JGNA 2J07A 5ALPA 4HRXA 2H85A 4KMSA 2WD9A 5K0NA 3VHXA 3QLJA 2NSJA 3G0DA 1SBHA 1JEJA 4AI6A 3HLKA 2IW1A 1W9HA 3G9QA 3W5AA 1VKHA 3L9XA 4M60A 2Z1MA 4P31A 4Q1CA 4PYLA 1RBMA 3EVBA 2PL3A 3PHBE 1OIVA 1VSVA 3KSZO 5CDFA 1WWKA 3FVWA 2PKCA 2Q46A 4G09A 4TTPA 5B1SA 4AN4A 1R50A 2C95A 2ODNA 5C7OO 1OLUB 3JZFA 4RHCA 2AFHA 2HWYA 4EUKA 3ZWNA 2QVZX 2A86A 4WLUA 2WIJA 4BGEA 5KYGA 3IOCA 1IONA 5B58C 4JX9A 3ZN2A 5FXMA 4YK7A 1F6WA 2R5FA 4EKYA 3ESAA 4AAYA 1W76A 1JE1A 1P2UA 2W22A 5LMCA 4ERXA 3ESXA 4XJTA 1U6IA 5A0FA 4QVGA 4MWBA 4FZ5A 3NT4A 3PITA 1V6CA 2XD4A 2O2IA 4HNHA 4JCOA 1BH6A 2GZDA 2P2GA 2QM8A 4GU5A 4BS9A 3A6PC 4CHTA 3U4MA 4JI3B 4DMKA 4EH1A 5BSEA 3COSA 2I4MA 2KB0A 1ZUHA 1KDPA 4NCHA 2ZSHA 3QNWA 1LBQA 4LXUA 4H0FA 4YGYA 3GCXA 3QUTA 5K0EA 1UZAA 3VH3A 1JJBA 4HNQA 4JJFA 4AJPA 3T7RA 1M34E 1JR6A 1RWKA 3DV2A 5D00A 3UFXA 1QUEA 1RE1A 2DWCA 4EBBA 1CF9A 4LDAA 3ICVA 2JCSA 4E21A 1O2DA 3ENQA 5JMPA 1QONA 3OZVA 5AVJA 1QRTA 3H5WA 3P27A 1FTSA 1X7HA 2QL6A 2RHJA 4GPAA 2LCIA 1SCUB 2Q6OA 2MCFA 3VI3B 3VZCA 4E70A 5FBKA 2UZ3A 4BNVA 1O95D 5JC1A 4X92A 1IZZA 3FM9A 2J4CA 2ZUCA 1OWMA 1LX6A 5I7WA 4J4HA 1XLTA 3ZGVA 4DSTA 1RHKA 5C3MA 3TUZC 1E1QD 2DXIA 1W5AA 1ORHA 2FW0A 4CM6A 5K2OA 1BWQA 1JALA 2AFIA 4DRZA 3D6VA 4LI0A 4YMHA 1WULS 4J91A 1AGNA 2G63A 3E9DA 2JB9A 3BMOA 1DDIA 3RANA 4I1PA 1ADBA 1M2GA 3VVBA 2PLFA 4MB6A 2G76A 1XCJA 1OA0A 3EIFA 4IZOA 4UTRA 2J0UA 1D5WA 1QMPA 4EGQA 3SIPA 2ZT5A 3LYUA 3TNLA 3ND6A 5HJEA 3BH7A 3OSUA 4AX4A 2D5LA 2YV3A 2C4NA 2ISQA 1TYZA 5LLTA 5LMNB 3KJHA 4RY0A 1C8LA 4UZEA 4BYGA 1XD2A 2O8NA 4Z0PA 4LX0A 1T0HB 4G9GA 5FOTA 5U1PA 1XNJA 4CM4B 1H2HA 2A9OA 4B3MB 3N8HA 1MN6A 1EFDN 3EXIA 1GQQA 2A9JA 4X5OA 1ZITA 2R00A 4TXHA 1IBMB 4KX5A 2C31A 3JQ8B 4A0FA 1Y0BA 2P3OA 3IXMA 4HO1X 1O87A 1WEKA 5EE0A 1IULA 4RPJA 4MEAA 1Z4OA 3I9FA 1YO6A 1ZW1A 4LVNA 4U2EA 2ZI9A 4I50B 2FP3A 3I2FA 4FMPA 1C3LA 4M49A 3LWNA 3E22A 2YY6A 2E49A 3KQHA 1H4SA 1S4QA 4MW7A 2M6KA 2J5KA 2FB9A 3FZEA 1MABB 2BDEA 5CB4F 1Y6GA 1CJTC 2A1IA 5D7NA 2V1UA 5DLEA 3HNOA 1JFRA 2PS1A 4GXQA 2FEMA 2G9QA 1XZ8A 1B43A 1Z45A 1TZMA 5BURA 4MYSA 1K98A 3ZNQA 3AVOA 4QIHA 5A4KA 4M8LA 2EJWA 2CLCX 1KY3A 4CMJA 1Z0AA 3IPAA 3L1JA 3TNDA 2I55A 2WM3A 3EFBA 4OI0A 2O8CB 2WJZB 3MM4A 5LNK1 2VTBA 3LG2A 1ODSA 4RACA 1ZGGA 3N5KA 3U4CA 3UF0A 1JSZA 2ZJ8A 3S29A 4QOJA 1Q19A 3B3GA 2BFDA 4WZAB 3OLCX 3R9XA 3HA5A 1JPNA 2QKYA 4ND8A 1EUDA 3QVVA 3VC1A 3LKDA 2AKAB 2IHBA 5FUVA 1M1UA 3MQFA 3CZRA 2ZW9A 1DKLA 3AHDA 4W7IA 4PHHA 1IZ9A 1ZIDA 4RBNA 2W2XA 3OT5A 3PNPA 4WLNA 2XCTB 3B7PA 3AW9A 3B36A 4RPIA 5IMBA 5KYVA 3TGWA 4FOSA 5DTEA 5FPQA 2NUTA 1NBWB 4KGDA 1IUKA 1HE2A 2BLNA 3DD5A 2IBTA 4DNFA 2PZ8A 3PYLA 2QMOA 1YE8A 1A72A 3GYGA 2ID7A 3HLTA 3I4CA 1JIIA 2HGZA 4CG1A 2P0AA 2BGMA 1M74A 1QV9A 2CY0A 3PVSA 3NEYA 3RJMA 2QPLA 1E2GA 3NM6B 2OK8A 4LZPA 2E87A 4RF5A 5ALXA 2EBUA 2YXBA 4F4HA 2XA9A 4HWOA 2M2IA 1RMQA 1J22A 3F6RA 4QT4A 5F2KA 4FS8A 5HKLA 2IP4A 5LYJF 3TEFA 5DHUA 3BEDA 3K6RA 3PUVA 1P91A 3O4HA 4HYQA 3I6BA 5DYYA 3JRWA 4KFTA 2OOSA 5J43A 3LC2O 4UNPA 4JASB 3KEMA 5DEIA 3PQDA 1PDVA 3EIWA 3JD4A 3KJZA 3G0GA 3OM9A 4YP1A 4LXQA 4QUBA 1A5SB 1RXUA 3CUWA 1HPLA 2G7MC 4EB6B 3WKBA 4B3BA 2FEXA 2PNJA 3SWWA 1MB4A 1GRRA 3UXEA 1DXYA 3E18A 2GO7A 5GMOA 4MDHA 3N7UA 2NAPA 3H11A 1TVEA 4YHHB 4M8SA 1BWSA 3RTDA 4Q3KA 1G7TA 1V1JA 4KPGA 4O4HB 5FUQA 2WSMA 3MJDA 3CZQA 3DFZA 2CXTA 4MIOA 2G5TA 4JZKA 4B48A 1KP3A 3HVHA 5SY6A 3K53A 2UXCB 1IVSA 3KB1A 2QUKA 3OAAA 4UVEA 4D9FA 3FYHA 2ZIWB 3LLMA 3WGJA 3JALB 2EBFX 2AVNA 3H5NA 4I1IA 4M0MA 2DWPA 5FTNA 5IBQA 1ZJ5A 5A3SA 3VH4A 1YB4A 1C3VA 2NZWA 1KWGA 4GX0A 1E1CB 4V1CB 2RMKA 2IEDA 2JGLA 5LLSA 1KFKB 4OYYA 7GPBA 3I3SR 1NF2A 4QBTA 1UP7A 4WZBE 3FCCA 3H6GA 3VM6A 2BFNA 4F5DA 1BD3A 3IO5A 1Z18A 2W93A 5J2TF 2XZLA 5KJFA 4S3MA 2CWDA 4MDYA 3UB3A 3M3DA 4C03A 2HREA 1NT2A 4WBNB 1VMIA 2AI3A 3R3ZA 3NETA 1Z6QA 5A9TA 3LUCA 3LO5A 3THYB 3GAFA 4JGGA 3WGLA 4CEIB 4DC0A 2QXYA 2FEKA 1EQ2A 3LC1O 4OQLA 5KKCA 4QYTA 1ISSA 4U39A 3CUKA 2GYWA 2QW8A 1I7QB 3D3WB 1VB3A 1JXQA 4P4SB 4CUJA 1AZSC 2W0MA 1LQTA 2ATEA 3KXIA 4PN7A 1V1MA 4ANFA 3FTPA 1UAAA 1SUCA 3T7CA 1T36A 4XOIA 4AQYB 1W88A 1N2GA 5GY7A 2NGRA 2FFRA 4MPDA 3N6XA 4NI5A 2P30A 3VR2D 3TLGB 1H94A 1SCQA 3NWJA 4CMKA 2EFHB 1BHQ1 2ZSAA 2YS6A 2J9ZB 2VQEB 1Q1AA 2GGSA 4FE4A 5ERXA 4ONEA 3A0UA 4D98A 4H1WA 4YI3A 4OFXA 3CKMA 4UM9B 3QU9A 4HZIA 3UK0A 2TS1A 5F1YA 5IT0A 3FBTA 4KI7A 1LPNA 3E3AA 1M67A 4B33A 1KK2A 2PBFA 1ZPDA 2P90A 5EC8A 3HJNA 4HTFA 1YR8A 3L05A 1GZVA 3ZHUA 3UXMA 3TQRA 2OB2A 1C4WA 2DWQA 2O1WA 3SJZA 3D9QX 1QCDA 1SQ6A 2P9QA 4HBZA 5TQ0B 4BNNA 4EGSA 2O0JA 3COVA 5EJ2A 5IHPA 5KQRA 2Q6LA 5FBVB 3EFHA 4HLQB 2OCGA 3QTBA 1HXHA 4I2VA 4NP6A 2BYTA 3KQSA 2R66A 1CIPA 1PJZA 3LIIA 2ZATA 1V5EA 2WMOB 4GP9A 2AG8A 5I7OA 4FNGA 4MS1B 4QPCA 3RWOA 4ATNA 4AYXA 2I4TA 5EJMA 2AFVA 1P4AA 2ZJYA 3I5XA 2O3QA 4BZXA 3DMPA 3ILSA 1E2IA 4P4UA 4WFKA 1LSOA 5I6DA 3NEPX 2NSLA 3M70A 3Q2IA 1XA3A 3HSYA 4KX3A 5EPUA 4FQ7A 2H1LA 3H1EA 2WLTA 2RI6A 3DDHA 1PFUA 4QNRA 1Y34E 4EP1A 1RAIA 1T5DX 5FORA 4Y6GB 1LD3A 4DJAA 1EM8A 4F71A 5K01A 1Z0KA 4AZ0A 1ZMRA 1CSEE 5F21A 3B3JA 4HDNA 2WD8A 1K89A 1JVSA 4KR2A 4EJSC 2CHVA 2IHYA 3U40A 4EWLA 3UENA 2BM8A 1DB3A 4QDOA 5G41A 2P35A 5EHNA 4EW6A 1CUCA 1JV2B 1U2QA 2QNBA 3I9LA 4XB2A 2H3HA 1Q3KA 3GPCA 2RONA 2H4XA 2IF2A 4B2YA 2C9BA 4Q37A 4JOBA 4RMJA 1F9AA 4DLVA 5LDDC 2BEUB 1SG9A 4NHEA 5IABA 3L93A 3E70C 1SKYB 2C5BA 3KFXA 1VYVA 1ZD8A 5A4FS 4NBRA 1RSZA 1TKBA 1RP7A 3E23A 4JYAB 1JMKC 1IM2A 2UYOA 4YDSA 4I08A 1Z62A 1OYYA 1AGYA 2WVGA 2EZUA 2O5VA 5DSXA 4HQ6A 2ZJZA 5E1BA 1LCIA 1GITA 1LS1A 2BGKA 3BRQA 1NDHA 3AVWA 4C7OA 3EJ6A 5J1SB 2B3TA 2Y93A 4Y0AA 1CYDA 4E5NA 3BS4A 3U09A 1WP9A 1A96A 2EW1A 3HG7A 4YNBA 5IAKA 3S28A 2O2EA 1LS6A 1IVNA 2FOLA 3IOMA 2OAP1 4Z2YA 4H59A 4UXJA 4WJKB 2C57A 3UY4A 1HDYA 3W7BA 1QU2A 4W5NA 1Z7BA 1Y3DE 1SD5A 2FG5A 3B9BA 4O4JF 2PQ2A 1XROA 2HA7A 3I30X 1F1BA 4ZDIA 4KUHA 1J00A 2SKCA 2JZNA 3FRJA 1AK2A 1USVA 2OD7A 2Z08A 4J94A 4KFSA 3WSWA 1M3SA 1KI6B 4MKGA 5LOVF 4OHRA 1UDAA 4RHFA 4BHTA 4EOGA 5BPFA 2BY4A 1TQ8A 2AZ4A 2W71A 3TLZA 5I51A 4DIEA 5HQ3B 1AK9A 5IKXA 2LRHA 5T4EA 1SK9A 2RG1A 3VR2A 1MAHA 1F3LA 1YI8A 1ML3A 1PTKA 3HCEA 4E09A 3OTOB 4AY4A 2PUEA 1KZ4A 1S01A 5TRTA 2CVZA 1WUTA 2DPGA 3JQFC 1QO0D 1HE8B 1P5RA 4NZOA 1P1JA 1NC3A 2VH1A 4B87A 1D03A 3L0OA 5DNYB 4TRJA 3C41J 3P9PA 1HFJA 2WFLA 4PNZA 1VMKA 1X70A 3LBNA 4JYBA 2Z04A 3MT0A 4TRMA 5HRUA 1DMRA 4RDIA 1SBIA 2VTEA 4ZOCA 5KYUA 2M98A 2P2YA 3ETDA 2IEIA 2ZRAA 3IGFA 4DCSA 1P7YA 2FN9A 3P4UA 5CMLA 3BDAA 1R5BA 3RYHB 3DNPA 3ETEA 2I8LA 2VR1A 1X80A 2WUVA 3SGLA 4ZYVA 1XZBA 4G81A 4FN4A 4OGLA 1Z4IA 4M87A 4N9QA 1C7RA 2GDZA 4W1PA 2EP5A 5ALKA 3LXXA 1AHHA 3N2EA 2B6NA 5DGIA 3HP4A 3HM2A 4GL4A 1D7OA 4U2KA 1ZH8A 3ZHTA 4YRFA 1E1RA 2WJJA 4PPFA 5FHRA 1ECCA 4HF7A 4IIJA 2JK0A 5E3IA 3U7JA 2MSEB 3SF8B 2RIRA 1DT5A 2O2GA 2YNMC 3ND8A 3NM4A 3DAPA 3STTA 4GKAA 1WB9A 4E5MA 2O8FA 1RLJA 1NUQA 2AK2A 5EOVA 1QGUA 1ORWA 3CNNA 4DBLE 1M1ZA 2CT8A 2P6OA 2OYCA 4YT4A 3ILXA 2F6RA 3U56A 3F5QA 4DRYA 1T6XA 4R1MA 4K5QA 5FWXB 2YY5A 1N2CE 2PRIA 3O7MA 2PAAA 4D4GA 2DHRA 4EATA 4RWEA 3SFZA 2QLMA 3KOOA 1HK7A 1V47A 3DVAA 3A6EA 3GA0A 5FJJA 3ETJA 1Q3HA 4ALJA 4O63O 4ZZ3A 2NIPA 2JAPA 1JJ7A 1QFXA 3M3PA 1J4AA 1HH4A 1C30A 5T3YA 2X9LA 3RNOA 1WKVA 3H5TA 2IH2A 5M5BA 3DDCA 4Q00A 5JECA 1YDWA 1U1DA 1U8AA 3DG9A 3RRFA 4MS3A 1T4CA 4FD2A 4ESHA 1O94C 2GCOB 3ZHOA 4XWAA 1N3IA 5TLSA 4E12A 6YASA 4CI9A 4HAXA 4DLRA 1JG4A 1NBOA 2HRQA 1FS6A 4GAEA 3M4NA 1XEFA 4HGZA 4PHTA 3H83A 4CW7A 4Y2PA 3G7UA 4KPFC 4L15A 4E5DA 1WBBA 2O8EB 4JA2A 4YS6A 1QX3A 2WUGA 4MVXA 5FFMA 5KAPA 4HT3B 2W90A 2OD9A 1GTZA 1T13A 2Z3WA 2Z0MA 4MNTA 1TMYA 2J32A 3FOBA 3AIMA 3GJ8A 4ZVPA 2CLOB 3WLPA 1HNXB 2NO9A 1A88A 2ZEJA 1NN1A 2YUIA 3PFIA 4OB6A 1DC3A 4C88A 4C3VA 3NV7A 4AXBA 4FHFA 4XVQA 2B5OA 2G1JA 1DKOA 1F14A 1IK6A 2VP6A 1RM4A 3DDUA 2GEJA 1FNCA 1OHHD 1P75A 2HC9A 3RWMB 1CLEA 1TX4B 1Z0UA 1YGPA 4EY7A 4C5BA 1FQWA 2PQ0A 2DCMA 2CDRA 4CTJA 4HQNA 3AINA 4QRIA 3LBYA 3KXKA 4XRRA 5CVDA 4OX9B 1XRRA 3PXXA 1QQ6A 2XQIA 5FKJA 3C5EA 4YQEA 3S7TA 1WMAA 4Q4CA 2VDJA 1UMKA 3AJDA 5E1DA 3RREA 4WI1A 5C8YF 3N2IA 1M8GA 1BXRB 1TAQA 1FFEA 1I7LA 1UBCA 3T3MB 5AW8A 4NV0A 1X1QA 2VUSA 3BDVA 4C87A 4UM8B 1FE8A 2NADA 3EMKA 1TIPA 1Z36A 4HUQB 4JHXA 4X0EA 2A5JA 2LR0A 3PXEA 4NONA 2IYFA 4J0QA 5CHYA 5K3AA 2W6JA 4O0MA 2X2OA 1JMYA 4J49A 1FFWA 3HCWA 5KBYA 2UKDA 4S12A 3CTPA 3L0PA 3IUQA 3X1XA 3GAZA 4BAZA 4JP5A 4V24A 3DKVA 3GT3A 4JJIA 3TI9A 1THGA 1L7XA 2Q1YA 1SBCA 2HF9A 1F7VA 3L4KA 1R4MB 4RMHA 2OG1A 4FB5A 1ENOA 4Q9LA 3SF8A 5U4QA