4B9AA

Structure of a putative epoxide hydrolase from pseudomonas aeruginosa.
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
298
structure length
298
Chain Sequence
TDPLLPGFDYLTLHTSAARLRVAVKGSGPPLLLLHGYPQTHLAWHRIAPRLAEDYSVVLADLRGYGESRALDEEGADYSKAALARDQLETMGQLGFERFAVIGHDRGARVGYRLALDHPQAVAAFVSLTVVPILDNWAAVNKVFALNAYHWFLLAQPYDLPERLIGADPEHFLDYTLRRMAQGRDIYHPQALESYRRAFRDPAVRHAMCEDYRAAVGVDADADQADRDAGRRLQCPVQVLWQERPYAAGQHPLEIWKTWAGQVEGAAIGASHMLPEDAPDAVLEHLLGFLASHREALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Aeropath Project Targeting Pseudomonas Aeruginosa: Crystallographic Studies for Assessment of Potential Targets in Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Hydrolase
molecule keywords PROBABLE EPOXIDE HYDROLASE
total genus 112
structure length 298
sequence length 298
ec nomenclature
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4b9aA00
3WL7A 5F4ZA 1FFCA 3GZJA 4J0GA 1YA4A 5IVIA 1IUOA 3MUOA 4WY8A 1LPMA 4BE4A 2QOEA 1VOTA 2GBFA 5AP9A 3GELA 5CRIA 4N8SA 4C4YA 2EEPA 3H2IA 3CN7A 2JGMA 1WB5A 4TVKA 4Z49A 1CUUA 3IUMA 1G5FA 4HXFB 1EK2A 2AJBA 2WHQA 3WKDA 2WG0A 4QLAA 1BROA 4EBBA 1AQLA 3WIOA 3ICVA 4Y2YA 4Q34A 4FDMA 3R3YA 1EB8A 3MVEA 2NW6A 4G8CA 4QA9A 4K2AA 1XLUA 1FFEA 5A7FA 5JAPA 4LYDA 1VLQA 3LIIA 3STVA 3WA6A 5FXMA 4CG1A 3H18A 5CW2A 3DDUA 3AIMA 5AKLA 3KWJA 1EDBA 3WIBA 4M0EA 4P93A 1DWQA 4HVTA 1UFOA 4UFNA 1XRMA 1XZDA 4LXHA 2WUFA 3O0DA 3A2LA 4B83A 3WWOA 1SCQA 1CUZA 2CMFA 4FNGA 5AM4A 2VJDA 1QE3A 1XRPA 5ALVA 3KXPA 4EB0A 1ZD2P 3C45A 2XQIA 5I7UA 4Y2UA 5AOAA 3FVTA 3GA7A 2YXPX 2PSDA 1MNQA 2ZYSA 3I2GA 2HA4A 3A2MA 2X76A 4G1FA 3R3WA 2X5XA 4AN0A 3DL7A 3WK5A 1CLEA 2QTBA 1EDDA 3DNMA 1WB4A 2QS9A 4WFIA 2RIPA 3QYJA 2PX6A 5EFZA 1ODCA 3R3VA 4GEGA 5AK6A 1M33A 1E5TA 4K6HA 1H2ZA 1ACLA 1J06A 1QIIA 4D9JA 2EDCA 3D59A 1DWPA 3I2HA 2WG1A 5AO9A 1U8EA 1T4MA 5DTIA 2WU3A 4LIPD 4DNOA 3SX4A 3HRHA 4UBLA 4WDRA 4C88A 4EY8A 2WTMA 3ILSA 5JANA 4NVRA 3R3XA 3R3ZA 4J0IA 1CQWA 5D3KA 2G5TA 1EX9A 1MT3A 3KDAA 3IA2A 1AC5A 5DWDA 1L7AA 4U2FA 2C58A 3RK4A 1LPSA 3WJ2A 5DLPA 3RM3A 3DKKA 2PL5A 4PSDA 5AI8A 4DSAA 3FVRA 3DS8A 2QJRA 4Y2QA 4B0OA 2WJ3A 4MWTA 4MQLA 3F96A 4B6GA 4X95A 3VVMA 1QJ4A 3AIKA 5K3CA 1DQZA 3D7RA 4DTCA 5K5EA 2H9YA 5CT4A 3V1LA 5JARA 3DYIA 1BEEA 1G66A 1R9NA 2CKMA 1QFMA 1GPLA 2WG2A 3I1YA 4OUKX 1XZBA 3O4IA 4BTLA 5FPPA 4HS9A 1TKRA 4B7ZA 1A88A 4Y2SA 2WIKA 5I8PA 4Q05A 3ZLVA 1N8SA 4LXIA 1BRTA 3QBJA 4CG3A 3WYDA 4KACA 1CUSA 3WWCA 1Q0ZA 2XT0A 4J0JA 1JJFA 1YB6A 2QMQA 1EH5A 4CFSA 1ZJ5A 3ESDA 2RGUA 1P0MA 1C4XA 4QDUA 3LCRA 4AO6A 2ZJ6A 3F98A 1YB7A 5JYCA 5HK9A 1U65A 1QFSA 2Z3ZA 3LIPA 3MGAA 3JW8A 2O7RA 1NX9A 1ZIYA 4F60A 1YSCA 4X6UA 3L1HA 3VJKA 1P0PA 1Q84A 4G8DA 3WYNA 5AM2A 2Y2VA 1XRNA 4BCDA 4UHDA 1F8UA 1H2XA 4BBZA 3I2JA 3N0TA 1G42A 4W1QA 2OCGA 4FBMA 5AOBA 2HA7A 2CJPA 3H0CA 4GXNA 3JYHA 3QMMA 2JGKA 2Q0XA 1BCSA 4AMYA 3VDXA 5CXUA 1Z68A 5AI4A 2JGLA 2IITA 2IIVA 2RI6A 2B9VA 3QH4A 5CMLA 1WCYA 5HF5A 2I03A 4UBOA 1UOOA 1K63A 3WWDA 1UKBA 3ICWA 4UBJA 1A8UA 3H2HA 5HF9A 3K9BA 1YASA 4X90A 1LPBB 2CZQA 1MU0A 4FBLA 1E8DA 5ALMA 2B61A 4U2DA 3KOOA 5JATA 3WK8A 3I1IA 4AMZA 4XWGA 1HLGA 4ZXFA 1R9MA 3BXPA 3BL8A 1ACJA 2OGZA 5ALTA 4MJ3A 2VEOA 4YX9A 4OD0A 1N5RA 4IQ4A 3LP5A 4KR0A 2PU7A 2WFLB 1HL7A 1W4LA 2ONCA 4AB1A 4J0DA 1FFDA 1QO9A 3G7NA 3SC2A 3HLKA 2WHPB 4N8DA 1UKCA 3I28A 2J4CA 4CG2A 1GPNA 1QIFA 4Y2JA 3TJMA 3K2IA 5LIPA 2HA6A 4QDZA 2OCLA 5K3FA 4Q3KA 5AM5A 4RE5A 3H04A 3CXUA 2XMSA 4HTAA 4EUSA 4MWSA 5C8VA 1THTA 4IH4A 3VISA 4RNCA 2BGNA 1LNSA 4FLMA 1ZGCA 1R3DA 1XZHA 2BUCA 4H7FA 1QIMA 3D5EA 1AURA 3IB3A 4L3WA 3WI7A 4ZV9A 2XMQA 5HK8A 5KREA 2ORYA 5K3AA 5KWIA 3WJ1A 2XQGA 4MXDA 1QIJA 4KE6A 4S0XA 1J2EA 3R41A 2ECFA 1IZ8A 3QPDA 2VT6A 4BZWA 5H3HA 5FPQA 5T4HA 1XRQA 5EIHA 2XQKA 2Z8ZA 3ESAA 2V96A 5AM3A 4Y2RA 4Y2VA 4ARBA 3S2ZA 3ZI7A 3G0BA 1ODTC 4EY5A 3WZLA 1CUEA 4B82A 5E4JA 1W75A 3DOIA 1JU3A 1UZAA 4GDMA 2IX9A 1RP1A 5AKZA 4UHFA 4IH1A 5HF6A 4FLFA 2XUDA 2HDWA 1AKNA 1K6EA 2OPHA 5CXXA 1UXOA 5AK5A 3AFIA 1CUCA 2H7CA 2ZSIA 2RONA 5CH5A 4JH0A 2DQZA 4DYHA 1VA5A 4X85A 5ALKA 1BEZA 2R11A 1ZI8A 4U2CA 1TK3A 1SFRA 2XUOA 2HHAA 3WK4A 5AKGA 4U2BA 1NU6A 3H1AA 4BZZA 2VJAA 1ZD4A 1EXWA 2PVSA 4M0MA 1KEZA 4GLBA 3BE8A 5ALYA 5A2GA 1LZKA 3G9UA 4X6XA 4QDOA 1W76A 1EK1A 1ORWA 4H7JA 2H7YA 4PW0A 5AK4A 2OCKA 1UT6A 5EHZA 4UFOA 5BV7A 2BUAA 2QVBA 5HZGA 2XUFA 4GHWA 2GBIA 1PJAA 5E4TA 3SWWA 2HU7A 2WM2A 5AKXA 3C70A 2XLCA 3I6ZA 3R0VA 3B5EA 1GQRA 3KSRA 2D5LA 1HQDA 1G4HA 1KU6A 1XLVA 2C5FA 1JKMA 3WKEA 1CUVA 5LKRA 4GI1A 1CUGA 3K6KA 2PUHA 4HZGA 3V9AA 1CPYA 4FFVA 3PUIA 3HACA 5FV4A 1TCBA 2O2IA 1JFRA 3FOBA 5AIAA 1XFDA 2QXUA 3HJUA 4KE8A 3RLIA 3G9TA 5IVKA 1DTEA 1ZI6A 3EQ9A 2RHTA 4N5IX 4OU4A 5EIAA 4JEIA 2OXEA 2VSQA 5LZ9A 1QZ3A 3DJYA 1E3QA 1XZGA 3I2KA 2WKWA 4PSCA 4W1SA 4X97A 4RE6A 2BCEA 4FMPA 3IUQA 3H2JA 4DNPA 3M82A 4MEAA 2B4KA 1VZ3A 4L72A 1YR2A 3AZOA 3I2FA 3IBTA 2QT9A 1FSSA 4BB0A 4BP9A 4U2EA 1TCCA 2WIDA 4QE3A 5DNUA 4G5XA 1CUWA 1XZAA 4X94A 2OGTA 5LZ2A 4DNFA 5D3ZA 4HXEB 1XRLA 4LXGA 5JIBA 3W9BA 4NMWA 4AX4A 2JGIA 3FYTA 3RKSA 3WA7A 1GT6A 1UK6A 4G4GA 1E66A 2LIPA 2WFMA 4P9NA 4KE9A 1EA5A 4ZGBA 4PV7A 1XZKA 4ZI5A 4WY5A 3FYUB 4DMCA 4J7AA 3WMRA 4YASA 2PSEA 2CBGA 2K2QB 5LLSA 3BIWA 1EHYA 1VKHA 3ZWQA 4OPMA 1XZJA 3ZPXA 2Y1KA 5ALWA 1ISPA 2PPLA 2PSJA 4QLOA 2OG1A 4PO3X 4RGYA 5JAUA 4AO8A 4KYVA 2DHDA 3H2GA 5C7YA 4Y2TA 2RAUA 3G9ZA 5CTAA 1TAHA 1LPAB 3KWFA 4JUIA 5A7HA 4KAFA 5FOQA 3D3NA 4BRSA 4YPVA 5EI5A 1RWQA 4J03A 1CFJA 3HABA 3IDAA 1WPRA 3BWXA 3R3UA 3C6BA 3DLTA 1MPXA 2HU8A 4Q1VA 3NWOA 2JEZA 3ZV7A 5EHQA 1CV2A 1C7IA 2DR0A 4JYPA 1XKLA 3L1JA 5D6OA 2WILA 2XDWA 3H1BA 4BVKA 2XUJA 3I2IA 4DMFA 4LYEA 3C6ZA 2GZSA 2GYVA 2O2HA 5BWCA 2ACEA 2VJBA 5LZ5A 5JAOA 1MX5A 4BDTA 4W1PA 1QIGA 4L0CA 3EF3A 2AJ8A 2C0QA 2QJWA 4JNCA 5A71A 1SC9A 1CUDA 3WZMA 1ETHA 1JJIA 4AZ3A 4N5HX 2XI4A 1YAJA 2PSHA 4G9GA 3BJMA 3C8DA 4OB8A 5FDFA 4IH9A 5HKAA 2D0DA 4EZIA 4H35A 3BDIA 2EDAA 5JD5A 1QIDA 2PUJA 3VXKA 4BVLA 3ANSA 5KBYA 5AICA 4K6GA 3OC0A 3STXA 2UZ0A 1WOMA 5JZSA 3E1GA 3SK0A 4OB7A 2AXEA 3ZLTA 2DHCA 1Y7HA 4PF1A 1IUNA 3F8SA 2XMGA 3I6MA 4ITVA 2OQVA 3D0KA 1ZI9A 2HFKA 3O4JA 2Z8XA 5FRDA 3ESCA 2W6CX 1LZLA 5DYYA 3WK6A 4Q3OA 3WQHA 1ORVA 2Y2UA 3HEAA 1CUFA 3BF8A 4F0JA 3F9CA 3O9MA 4H7DA 4E14A 2C7BA 4E46A 5DTJA 1XQVA 3VJMA 3QPCA 1UK9A 5AKEA 3QMVA 4BE9A 5LP1A 5FUMA 1ZD3A 3PFCA 3HC7A 3W04A 3EQ8A 3ZLUA 4H18A 2OLEA 3PICA 1FJ2A 1XQWA 1W1IA 2WUGA 4DMKA 3GUUA 3Q8WA 1UWCA 1VA4A 2QUAA 2WIJA 4UHEA 1X2BA 4Q82A 4WFKA 3M3DA 4C4XA 4Y2PA 5LYYA 2OGSA 1S8OA 1USWA 4FKBA 5AI9A 1VZ2A 5ALRA 3PDCA 1TCAA 1XZMA 2HIHA 4BVJA 2DSNA 4AQDA 5HQ3B 1ZIXA 5AOCA 4I4CA 2HRRA 4B80A 2XE4A 6YASA 1HKHA 3U0VA 4MQMA 2JIDA 3WKAA 5LZ4A 1NU8A 1QOZA 5EHNA 2C5GA 2XQFA 2WHPA 1MNAA 2VJCA 2XLBA 5T4BA 1GKLA 1QTRA 2H1IA 4MYDA 1DX4A 1UKAA 3A6ZA 1L7QA 2C0PA 1X70A 3G0IA 4TPKA 1YS1X 3ED1A 1THGA 2BFNA 3D2AA 2V9ZA 2XMZA 5FLKA 3STUA 4M0FA 3LS2A 3FCXA 1DWOA 4DSZA 4HXGA 1XZLA 1TQHA 5K3DA 2WLSA 2HA3A 2JGJA 3WLAA 3C5VA 4X00A 4WJLA 1R50A 5A7GA 1CUHA 2V97A 3OURA 2VA9A 2XMBA 2BUBA 3W9UA 1UK7A 4EY4A 1UOPA 3V1MA 2GBGA 3NGMA 2C4HA 4ARAA 1CR6A 5FKJA 1K8QA 2ZJFA 2XMCA 2BGRA 3HXKA 2XUPA 5ALJA 1E89A 3WWPA 5IVHA 4UHHA 2VQ6A 2WJ4A 2Y6UA 2HU5A 2O7VA 4NZZA 2Z3WA 4HRXA 5ALGA 5AKIA 1SOMA 3AJAA 4A23A 1XLWA 4QZVA 3OM8A 2J3QA 1L7RA 3Q0TA 1R88A 4QNNA 4XX1A 1XZEA 4NS4A 1K5PA 3G0GA 3QITA 2AJDA 4XVCA 5HKBA 2BJHA 1F6WA 3L1IA 1LLFA 4N8EA 2GYWA 5IH7A 4BTVA 1QTIA 3IULA 2PBLA 1AMNA 4UBIA 5E2IA 2HA5A 4TGLA 1WHTA 4DIUA 2ES4A 1CUXA 2V98A 4FLEA 4OB6A 4B9AA 2WQZA 5T4FA 1I6WA 1MJ5A 4XJVA 1BN7A 2JF0A 3NOXA 1J07A 2O2GA 2HL6A 1EDEA 2XUIA 4BC1A 3W2TA 1A8QA 2JBWA 3QPAA 3W05A 1DX6A 4H7HA 4BYMA 1Q83A 3EBLA 3OPMA 5YASA 3ANTA 4V2IA 4OSEA 5AI5A 4ZRDA 4KEAA 4G4IA 1Y7IA 1AUOA 2VT7A 4Y2XA 5ALQA 4UBKA 4AZ0A 5AJHA 2WHRA 4H77A 4HRYA 4IO0A 1UK8A 3UUFA 4CCYB 3AINA 5CT8A 2AJCA 2VAVA 2HRQA 4QWMA 3F97A 2PSFA 3PF8A 3AZQA 3D2BA 5C81A 2GZRA 1QIEA 1X2EA 3X3HA 1QO7A 1XQXA 3WL6A 4X71A 5LZ7A 4CCYA 3CN9A 4P92A 4QEKA 5ALSA 2ZSHA 5AKKA 2FJPA 3QM1A 3V1NA 2P8SA 3DYVA 5AKYA 4J0CA 1K4YA 4GW3A 2DFPA 4X3CA 4I19A 2PM8A 1KU0A 4X93A 2HADA 5AM0A 3C6XA 3IURA 2QR5A 4XIIA 2HFJA 3ESBA 3G8YA 3C6YA 1DINA 1MAAA 4B81A 2XQJA 1UOQA 1SCIA 4FHZA 4JYMA 3P2MA 3BDVA 3FSGA 1PFQA 1JI3A 1TIBA 7YASA 1IUPA 3GROA 1HPLA 1Y37A 5ISMA 4UFPA 4MEBA 5A6VA 1HBJA 5CT5A 5JAHA 5DJ5A 4OU5A 3O4GA 1FFBA 4DGQA 5ESRA 1ZD5A 2WJ6A 3S8YA 5CH3A 5CT6A 4PQEA 4O08A 5HCUA 3V48A 1N5MA 1WPXA 1C7JA 4FWBA 2I3ZA 4UHCA 5JADA 4PNZA 1EB9A 5A62A 3PFBA 3IUJA 5CBKA 4FTWA 3WK9A 3WKCA 5KWJA 3V1KA 4I3FA 3G02A 5EGNA 2OQIA 4LKOA 3I6YA 1OXMA 2XUKA 2E3JA 2XMDA 5JD4A 1MX9A 3FNBA 3STWA 4EA6A 4FOLA 5JZBA 3PE6A 4YK7A 1DT3A 2FUKA 5DNWA 1QGED 4X7BA 3DD5A 3C5WP 2G5PA 1CIJA 3FYUA 1ZJ4A 4AO7A 5BOVA 1VE6A 1VXOA 1MX1A 3DOHA 3PF9A 2JGFA 1BS9A 1JMKC 3M81A 2QM0A 1Q0RA 1TRHA 5C8ZA 2VAXA 2XUAA 4BAGA 1MAHA 1EI9A 3AILA 4WDQA 5LKAA 1R1DA 3O95A 3E3AA 1T2NA 2I78A 1JJBA 1CEXA 1J1IA 3H19A 2HM7A 5JZ9A 3C87A 5D7BA 1JT2A 3N2ZB 3FSGD 1EVEA 5LZ8A 3OOSA 5ALFA 2OAGA 1JMYA 1IMJA 5ALIA 1ZOIA 4X91A 1ZGBA 4CIBA 4CI9A 5DYTA 2WFZA 2WIFA 1MTZA 1ZICA 3FCYA 4ZWNA 1LPOA 5K3EA 3VVLA 2JGEA 4DNQA 1LPNA 4GBGA 5I9IA 1RYYA 4W1RA 5CT9A 4C89A 1LGYA 2FJ0A 4A16A 3PUHA 4AN1A 2QXTA 3HZOA 5BWBA 2G63A 4CCWA 4PSUA 4UPDA 4BCCA 4UHBA 3QVMA 4ZV7A 3D4LA 1XROA 1FFAA 3E4DA 5ALOA 3O9VA 3RARA 4H7IA 3MUNA 1IVYA 1AGYA 2QRUA 1R4ZA 5HFNA 1JU4A 3TGLA 3M83A 5AIBA 2HA0A 4QDTA 1CUBA 4LHEA 1SCKA 4G8BA 2R8BA 1WM1A 3W06A 3F67A 3IVMA 4FFWA 1CRLA 3STTA 2ZYIA 1LPPA 3T4UA 4EY6A 4WFJA 1GQSA 3A2NA 3STYA 4C01A 1VXRA 1GPKA 5K3FB 4OYLA 3VKFA 2PU5A 1F0PA 2ROQA 3TRDA 4HAIA 3WL8A 5ALPA 2J3DA 3D2CA 4GWLA 4ZREA 5SYMA 1D07A 4KJXA 5ALLA 5AKJA 4BATA 1DU4A 3QZUA 4DLNA 5ALDA 4MYSA 5IKXA 4ROTA 5AM1A 3CCBA 3G9XA 1O6FA 5AK3A 1YCDA 3AIOA 5ALXA 4KRYA 1HDEA 1A7UA 1CVLA 4J3JA 5ALUA 3WK7A 2Y6VA 4BAUA 1DT5A 5AI6A 2H7XA 4K6KA 4Q3LA 1CUJA 4FNMA 1CUAA 1BU8A 1N1MA 4U2GA 3B12A 3WKBA 4A5SA 4WCVA 4UBMA 2QZPA 3EIOA 3G0DA 5AKHA 4IHAA 1E8MA 1U4NA 4Y7DA 2VATA 3OTQA 1U2EA 4F5ZA 4J0KA 4G9EA 5AI0A 4B0PA 3H17A 2ZYRA 1CQZA 4KAAA 1GZ7A 3OG9A 5JASA 1WB6A 1LBTA 3FAKA 2YASA 5CH8A 2GBCA 1YS2X 4EHBA 5T4EA 2CUTA 1B6GA 2OCIA 1DQYA 2XUQA 5HQ3A 2W22A 2WTNA 4CIAA 5DYWA 2WU4A 4H7EA 5J3JA 4W63A 2YH2A 3DKRA 4H7KA 1GGVA 1XQYA 4BCBA 4OYYA 4B85A 2OAEA 3VJLA 3DL4A 3HSSA 4X6YA 1GKKA 4INZA 5DNVA 3PI6A 3BF7A 4B9EA 4C4ZA 4DMHA 1XZCA 3DCNA 1H22A 1BN6A 2QKYA 2WFLA 5JALA 1AX9A 3C43A 2ZJ7A 5K3BA 5C8XA 4E15A 1QIKA 1XZIA 3GFFA 4EY7A 5FP0A 3LLCA 4AXBA 1BE0A 1PV1A 2G4LA 2I3DA 5HF8A 2BAGA 1XKTA 1QLWA 2DCMA 2CEKA 3GBSA 3B3QA 1A8SA 5JD6A 3EQ7A 3QMWA 4BDSA 4GECA 2XUHA 5ALHA 1H2YA 2PKYX 1F0NA 1QIHA 4DM7A 2B20A 4QWWA 3KD2A 5CURA 2RHWA 4BP8A 4KE7A 3YASA 3DQZA 1AZWA 2AJLI 5HFAA 1P0IA 1LBSA 1P0QA 2ZVDA 4ETWA 2XUGA 1IZ7A 1CUYA 3FLAA 3O4HA 2WUDA 3FLEA 2FX5A 1EINA 4L9AA 2BKLA 3HYSA 1YAHA 3U1TA 3AZPA 5E4YA 3H2KA 3E0XA 3IIIA 4C87A 4F21A 2ZYHA 3G0CA 1H23A 2VTVA 1MO2A 3FYUC 2YYSA 1XRRA 3IUNA 1OCEA 5ALZA 4G4JA 4KRXA 2ACKA 5IVDA 4BC0A 1QONA 3DEAA 4OCZA 5EIEA 1EVQA 1MN6A 1H2WA 3T52A 4J0HA 5ALNA 3WWEA 2WIGA 3BIXA 4B84A 4X92A 3FWHA 3UUEA 2WSLA 4UUQA 3C8HA 3A70A 4RPCA 5AHXA 4W9RA 1ODSA 4BAZA 2WUEA 1VJ5A 4KAJA 2JEYA 3CCCA 3FLBA 4UBNA 3FBWA 2X8BA 2Z5GA 4QDXA 4H0CA 2DHEA 2QUBA 3NUZA 1YA8A 1B41A 1XZFA 2XMRA 1CUIA 2J4FA 1VE7A 5SYNA 4K5QA 2VF2A 3WL5A 3UMJA 2GYUA 4P08A 1BCRA 4Y9SA 5AH0A 4BRZA 3AUKA 3BJRA 1GXSA 2XB6A 1WHSA 4E11A 1OILA 2HA2A 4C6HA 3JWEA 2CB9A 2DQYA 1E8NA 1O6GA 5EHXA 5ALEA 3TEJA 1W6RA 1W52X 3HI4A 3R40A
chains in the Genus database with same CATH superfamily
3LDUA 5F4ZA 3WBFA 1ONNA 2UVQA 3PPVA 4RQBA 1GT91 4LISA 3JR3A 4X64B 3GZJA 1YIOA 3ZGYA 3ER9A 1DOHA 4QFMA 4YJ3F 5IVIA 4ZJYA 1F2VA 1ZOOA 1XTZA 2FPIA 2R47A 4MP3A 4JR0A 4XFKA 2MSLA 1K6JA 3UFXA 1QRTA 1O3YA 2R6DA 1LPMA 3VYUB 1M2WA 5B2ZA 1VOTA 4OJQA 1HNWB 2AVDA 1J24A 1P77A 4N8SA 3P1JA 4FCWA 3KIPA 1A7KA 3IQHX 3BGOS 1SOWA 2JJYA 4G6ZA 2EEPA 4KFUA 2R4UA 3S1LA 3BMQA 3NI2A 3GDFA 2HO4A 3FNGA 3X2SA 4CDNA 3U4QA 1SOUA 2JFVA 3CLSC 3E35A 3K9CA 4TOIA 5LYJB 1WB5A 4UAJA 2F67A 1P3Y1 2HPHA 2JLAA 4W7IA 1EK2A 1MDFA 1RYZA 2FE1A 3O3OB 2I55A 1XMIA 3ZQKA 4AQ7A 2QU7A 2ZRQA 4FOPA 4G0WA 1T8UA 2GFIA 3R3HA 2YYYA 3WKDA 5CFZA 2J8ZA 1K7CA 1I33A 3E15A 5G4LA 2XSZD 4F92B 1BROA 4UDOA 3Q9LA 3RC8A 1PEAA 2ZT7A 3PB3A 1LTKA 4XPZA 4I4TB 3S7TA 5LDDC 4ESOA 4WADA 5CB4B 5IZCC 4NXMB 4KVGA 2WYUA 1L3BA 4C2UA 1FLVA 2M6LA 2A88A 4BO8A 3WLTA 5LWHA 1ZD8A 4QTTB 3MJRA 5A9SA 1N7GA 5BR1A 3ICPA 2E4VA 4G8CA 1NBHA 4QRDA 2ISQA 2GM4A 1PJ2A 1JDBB 1MF7A 3TZ6A 3NV7A 3NXKA 5A7FA 1E1RD 2ERYA 3RQIA 4DZTA 5J2TA 3BGDA 5JXWA 1ZONA 4C08A 4BXOA 4QSHA 3LIIA 1OLXB 2REOA 4BVAA 5KNBA 2Q3BA 4KO2S 5FXMA 3H18A 3DE3X 2GZ2A 2EERA 2HBRA 3H4IA 5F78A 1VPEA 2ANBA 3AIMA 1ETUA 3RC2A 4E6PA 1ZM3A 5A4KA 3ITEA 3KWJA 4FXPA 4JLPA 3T12A 4YUZA 2JL1A 2PRIA 2Q3FA 3NHFA 5TT0A 1IJBA 2C7RA 1UM9B 2ZYAA 1UBGA 3O2NA 4PRZA 4XDZA 3WIBA 4WXMA 4F4UA 5A3RA 5C1DA 1V45E 4RESA 1XZDA 2NTNA 5AVXA 3UEOA 2VJMA 3SFZA 3N6VA 4OXRA 1JLRA 3AKCA 5HS6A 2IPMA 4M1MA 5E1DA 3QPVA 2CMFA 4L6IA 2VIIA 2C8JA 4ZQGA 4JC4A 1BFUA 1QE3A 2ZREA 5E0KB 5IW8A 1H3EA 1XRPA 4ZN6A 1AQYA 3TOCA 5ALVA 2HJVA 4ZIRA 3TG8A 4R81A 1JQEA 2JFQA 2AMJA 4B73A 3HVUA 3HJCA 3MIIA 4EB0A 3C45A 4F6RB 2QJFA 4W7SA 5AHKA 3HBNA 1Z0KA 1DPFA 5FEUA 3EA5A 2OZLA 2XNDA 3ZW7A 3NT5A 1HM5A 3GA7A 3VR4H 1M2FA 1RYHA 3ENWA 2A57A 3D4NA 3LVFO 1C3OB 2IUSA 2A9RA 2BFCB 2MHCA 1KJIA 2VDLB 4A2CA 1RKUA 1D1TA 1Z0AA 3OPYB 3WIEA 5KNDD 3V8EA 2ZYSA 3TG2A 1JTEA 3W1EA 3BZBA 8ATCA 4LFAB 1V8FA 3I2GA 4L4SA 3DOOA 1PDWA 4MVXA 5B55A 2QD1A 2X76A 2WOJA 3G17A 2A2ZA 3INTA 3IQIX 1DBPA 3A4IA 2UVPB 4OFZA 1W94A 1Y3DE 2H0AA 4C6SA 4Z2YA 1PR9A 3A0RB 1JE0A 3Q15C 5ARDA 3WK5A 3DTVB 5BMVB 3MYRA 4JB8A 4CTOA 4DANA 2CE2X 3QLVC 4RVFA 3CUTA 4CGZA 4LZLA 3KOMA 4Q24A 5FWYA 3DNMA 3OX2A 4EYGA 3OP4A 4KUEA 4D8YA 3GEHA 1L4EA 3VMMA 3ZHSA 1BWSA 4ES6A 5I51A 5M3BA 1ITZA 2WAAA 4XTRA 4ZZ1A 4WESA 1SPBS 1MHTA 5EFZA 1Y9DA 4L76A 4TQGA 4FQ7A 1ISHA 3KETA 3ME5A 4OI2A 4C7MA 2BRUA 5CDFA 5AK6A 2ISCA 2ISSD 1IPHA 2GEJA 4POAA 3FI0A 4GOLD 4TYMA 3LRXA 4PHHA 4PLZA 1NY5A 3O73A 3L05A 4RFLA 5ARBA 1FDSA 5CCXA 1E3WA 4HLNA 3W4JA 3EVFA 1VFNA 3JD4A 2IIPA 2PZBA 2GH1A 1DWPA 4IV0A 2QLJA 3DVQX 1CZHA 1BVHA 4GBJA 2HEGA 4U9UA 5DN6D 4CQMB 4RDHA 3N6RA 2JHFA 1Y3CE 4L1KA 1LX6A 2ZAMA 3HRHA 2H2FA 1BVUA 2FK8A 4IJKA 2FZ4A 1A2QA 4NPHA 4MGYR 4D3DA 1KEKA 4EY8A 4TYQA 4PFSA 1Z75A 4R3WA 5I3CA 4PYJA 3L07A 3MPUA 2OXCA 4M87A 1QHGA 1Y6JA 3AGPA 3CUYA 5K0LA 1CEQA 2HQSA 2EKLA 4NZMA 1EGVB 5CFNA 5A9RA 1MT3A 1SVKA 2C42A 3WNDA 1P7ZA 2G67A 2I4IA 2X41A 2FEMA 3IP9A 4US0R 2ERCA 2AEFA 2Q5EA 4JENA 4FFLA 2VLIA 1DMSA 1OF1A 2IYFA 3OO1A 4QVIA 3HR7A 2EJWA 3RYIA 5E3JA 3K0FA 2JDIA 3IA2A 1AC5A 3HXLA 3G8AA 3LAWA 5DWDA 4AROA 3E27A 2AK2A 2R7NA 4JBXA 2ZJ4A 1V1RB 2CXOA 2I0FA 4H59A 3RK4A 3GCXA 3MGCA 1LPSA 2HNAA 4Q7QA 5B37A 1IIBA 5K6AC 1GRQA 3PPWA 4PSDA 5TVGA 3TF5A 1UDXA 4Z9AA 4YRLA 1VL0A 1V1JA 1RPAA 1G60A 2QT0A 1D09A 3N58A 2UDPA 1FPQA 1OKKA 3C3XA 3PUWA 3HVKA 4FNOA 2FPUA 1ADBA 3EXHA 3PNLA 3UHOA 4KQEA 2JZCA 1XKXA 2NPIA 2QJRA 2WTEA 3KJIA 2WJ3A 1NZFA 3BH7A 3M6AA 1BWQA 4MQLA 3TB4A 2H4JA 3BRQA 1FTQA 3EVNA 3FKJA 4JUFA 1O95A 2F8LA 2YIMA 4X95A 1WQ3A 5GQSA 1RYNA 2VXYA 5B7NA 3GLFA 4GMGA 5LMUB 3AIKA 4I5DA 1MR3F 2Z6VA 3H1GA 3EGWA 3L6BA 1C8LA 2QTTA 3CJQA 1G8JA 3QY0A 3NHLA 1JIJA 3GFPA 4WNIA 1KY5A 2FW1A 5IC5A 4NSNA 1MO5A 1V9CA 4OYHA 3DUFB 1KEEA 2W2OA 2WV9A 4EATA 1JAYA 5K3OA 1BDIA 2P3QA 3D7RA 3H2SA 2GVNA 3D5TA 5AUQA 4I5EA 1PZNA 4U2KA 2DWOA 4PHGA 3RTCA 5FNVA 2OHFA 5EWJB 2H9YA 5BR7A 4L4XA 4FFPA 3V1LA 3FZGA 2ZUTA 4BJ5A 4BX8A 1HDIA 3O4FA 1WU8A 3GNLA 1ZEJA 5DBOA 3NH6A 2OLKA 1GPDG 4JLVA 1NJ8A 4I1PA 2CKMA 2CSUA 4FMCF 2QTVB 1RWMA 3EH1A 3AF6A 1XWWA 3EVDA 5HM6A 2IYRA 2H85A 1TKRA 2X0FA 4B7ZA 5TDHA 5JE8A 1GITA 2XTMA 2WIKA 1VJRA 1YQEA 1ZINA 3PHIA 2BW0A 2OHIA 2WK1A 2JVIA 1N8SA 3K5HA 1VJTA 4GLLA 4HZIA 4NCKA 2E6UX 4LZJA 3WYDA 1QF7A 4GL4A 1KKUA 1CUSA 1KEUA 1U11A 2AL7A 3ZY6A 5CA0A 1E9DA 3HP7A 2Q7XA 4R8MA 1Q0ZA 1WVIA 1ZIDA 1JJFA 4ICIA 4CW7A 2XJ4A 5K8LA 3VC2A 3IP1A 1T0IA 3UVEA 4HVCA 3O47A 5BVHB 1NJGA 2RGUA 3W9YA 5IX8A 1C3VA 1V11A 1AK2A 3ADKA 3IAUA 4JXKA 1P0MA 4K9PA 4YT2A 2XCTB 1PR0A 5KUTA 1X1TA 1L4YA 1RKXA 2GM9A 4U9HS 3GAFA 4LXYA 4A27A 2ZJ6A 3DP7A 2PCJA 3IT1A 2R5WA 3IVRA 1FMTA 2OHVA 3GOHA 5G53C 2R7MA 1IG0A 4WA8A 4AS1A 2UVPA 3EX7C 1SIBE 3U3KA 2WJWA 3IBYA 4OJKA 5DDIP 4M0KA 3KB8A 3QUCA 2VSYA 3QXCA 5ITSA 2Q3JA 4DR5B 3PQEA 1P4AA 3MS4A 1G0OA 1BYIA 1U65A 4MRMA 1WP4A 2XRFA 1QH1A 1BHJA 1I10A 2Z3ZA 3W0LB 3A1TA 3TQOA 4X7RA 3KUXA 1S5PA 3E2MA 2GTHA 4F60A 2XHEA 4V3CA 1NPTO 3D8UA 4HQ6A 4U7PB 1MENA 1P0PA 1IZ0A 2HREA 2YZNA 2VNIA 3GLTA 3DB2A 4O4LA 1XRNA 4BCDA 5AM2A 3EA0A 3P45A 2B5WA 6CHYA 1RWXA 2IOFA 1TEXA 4XWYA 1N9ZA 2JCSA 2RK4A 1OFUX 3QRWA 4V0NA 3AHDA 1G42A 2ZJ8A 3KXKA 3LFUA 4JCCA 4W1QA 2F6RA 1SBYA 3ZWYA 1NXQA 5EJ6A 4N7JA 3RV4A 3U4IA 4K26A 4ZI3A 4CMEC 4IPTA 4QGHA 3W5DA 2CJPA 2QVGA 1Y3FE 2ID7A 3P26A 5H0IA 2PGNA 2ON6A 2F3TA 3ORFA 1DKLA 2Q0XA 2X2FA 1OZAA 3CZRA 2C3PA 3UH0A 1R5JA 4YWJA 3VDXA 2AG0A 1Y5IA 2Z58A 1K5GA 4PYRA 1P7YA 3GA5A 3SNKA 5EUQB 3PQ7A 5CCDA 2P41A 3M9WA 3KX2A 4FSDA 4E5YA 5GV8A 2A9KA 4M7WA 2B9VA 1NNUA 3QH4A 3TZHA 3SKXA 2NUPA 1WSWA 3FWYA 4JVSB 5EHIA 4ID3A 3GRZA 1B2LA 3PC3A 2DBRA 5JMTA 1UPTA 1O4WA 2EQAA 2QRZA 1YRYE 2I03A 4HZUA 4KPUB 4EB6A 3GFRA 3EXEB 2FRVA 3QBEA 1CZKA 4OIMA 1ZGGA 1CYDA 3O9ZA 4FONA 1UFKA 2R00C 3VHXA 1UKBA 4CTMA 3RTGA 3TLXA 3A9TA 5E6UA 1OFUA 4H1HA 3A11A 4WA7A 4QOHA 4ZEXA 3GZNB 3K9BA 4PVDA 4B3FX 2A86A 3SYMA 1F4PA 3C24A 4ZEMA 1S8AA 2IBTA 2JJMA 4L2IB 1QS0B 4M88A 3HN6A 5FTNA 1G3UA 4AQYB 1BXRA 4UASA 4D3XA 4QYIB 4GPBA 3MPOA 4QRIA 4CMIA 2W4IA 5ALMA 5AW8A 4E33A 2B61A 2C2GA 1TFRA 1MAVA 2Q4TA 3JAKB 4CKCB 3RWOA 2GHRA 4IVRA 3NJRA 4QSMA 3HGMA 3KOOA 4WUTA 3U6KA 4D9HA 4Z4EA 4BU1A 4J4BA 3H1EA 9LDTA 4Q1CA 1XL0A 1GAJA 2JJ2A 3ITDA 4JT8A 5I47A 3EG9B 1Z7GA 1WF3A 2IZZA 4V02A 1M2JA 4AWXA 1HLGA 3CBGA 3PRYA 1OHHD 4C6RA 4D92A 3PS9A 2HJWA 2XKKA 4D82A 1OWOA 4GYKA 2O8EB 5KNCD 3DOEA 4YB8A 5LQRA 1RPTA 3DAPA 4MJ3A 3ZWCA 2PQ0A 1OAAA 2PWPA 4OD0A 1N5RA 1SUSA 4IQ4A 4JP3A 1EFPA 1NXXA 2WZDA 4UZSA 1BHQ1 1EX1A 1KJJA 2Z8YM 5AW2A 5BSHA 4RUKA 3BWYA 2NO9A 3FCEA 3RT9A 3N2KA 4NV3A 3USCS 4KR0A 5BW4A 4AUEA 3D4OA 4ZAZA 1HL7A 1Z6XA 1Y48E 4UTOA 4NF2A 4CTJA 4DR3B 1DFIA 1DUSA 2ONCA 3T7EA 1JX6A 4B8YA 2JFXA 5EXPA 3VJRA 4A8JC 1AUQA 1FFDA 2CBXA 4GLOA 1A50B 4O4HF 3F0TA 2OD2A 2ZU6A 1J0XO 3HLKA 4C14A 4D7AA 2WHPB 1SXJD 2FW8A 4N8DA 3I28A 3USES 5MHTA 2AI2A 1A5SB 1UM9A 1AIPA 1I4WA 3FNFA 5EWMA 5TVKA 3TJMA 1G7CA 3QVUA 3WRVA 2B37A 3OJCA 4HK4A 2J32A 1YZVA 4RY0A 3LWDA 3JQEA 3R77A 2PWAA 5D85A 5CPFA 3ULKA 4FNAA 4N49A 3TAUA 5EE9A 1SKBA 3AVXA 1ZM7A 2HA6A 3JPWA 1INLA 4QDZA 3VAZA 2OCLA 2WJPA 3HJTA 5K3FA 3BXOA 1A7AA 1YRWA 2V8OA 3AWIA 4M9CA 5LCXA 4Q3KA 3TQCA 3I0ZA 4BFLA 1SG6A 2GCGA 3T4PA 4MDYA 4OQLA 2SBTA 1OWLA 3ZY2A 2YVQA 3DFUA 2C2YA 2RAVA 1ECLA 3BC1A 3JZAA 4IOMA 2GGSA 1PYDA 3OE7D 3TBKA 3M89A 5FOVA 3OUUA 4MWSA 2AA3A 1OIVA 4MV7A 1THTA 5AVWA 2IC5A 4BNIA 3HRIA 1GGJA 3QHPA 3ZVNA 1QQAA 3IA7A 2IVZA 4J94A 1LNSA 3MNFA 1LSOA 3UGJA 2EFGA 1ZGCA 1T6ZA 4DLXA 1ZJZA 2BEUA 3OFVA 1B6TA 3N07A 1VRWA 2FKNA 3PKZA 1ZLXA 1M1XB 1T4GA 4H7FA 4KQ9A 4B4DA 3I5XA 3ITNA 3DMTC 4UU0A 3FR7A 4D56A 5G41A 3RTBA 1FFXB 3WI7A 4ZV9A 1CY7A 1OJ7A 1YB1A 2XMQA 2QL9A 3H7AA 1RM4A 4G1EB 3ZYCA 3ABRB 4B43A 5KX5F 1QC5A 3G85A 2P5YA 2PT6A 1H9BA 2NU8B 2CLFB 3N3AC 3K0AB 2SNIE 5K3AA 3VPFA 4MRAA 5FWNA 2FDRA 4V38A 2QVLA 3LLMA 4S0XA 1J2EA 1RLUA 2MINB 2X6QA 4ZQHA 3VUEA 1KMIY 4QBKA 3U81A 4AYWA 1QCDA 4W9NC 5EYPA 1WW2A 3QPDA 2VT6A 3SJCA 5LOVB 1WS6A 3KQKA 5IT5A 3VKUA 2ZJOA 1B8OA 2O23A 3FPKA 5ERYA 3DMGA 4X65B 2D2XA 1GTZA 2CHFA 4P98A 2DG2A 5J43A 1D6SA 3AY0A 3I4CA 2ZB2A 5EIHA 1Z08A 5IJAA 4US1R 4JB3A 3ROPA 4E32A 2C9DA 3ESAA 4TKVB 3UJ8A 1G38A 1EQ2A 3CRQA 3R5SA 1Y1PA 1SA0B 1TVEA 3SF8A 4P6VF 4ARBA 1FEZA 1YL7A 4HDMB 2C77A 4NP6A 2G0TA 4DS3A 2H2DA 4O6VA 3TSZA 4DV2B 5LD2B 2HRCA 3VSAA 4KITB 1NDHA 1U1DA 3WZLA 1DRUA 5B4UA 5E4JA 4M86A 2H4HA 1L8QA 1GYRA 2JCVA 3Q6MA 4JJ4A 1EWQA 2CXRA 2QAGA 2QPOA 1HDZA 2HMUA 2YRXA 4DN6A 4QTYA 3SXUB 4ABTA 1CJUC 4MA5A 2VP4A 4PC7A 2Q45A 4PQFA 1JQAA 3JQGB 4TLLB 6Q21A 5KU7A 2Q4EA 5A9SB 5HF6A 2G9QA 3I42A 3ADBA 2YV1A 1O77A 4RY2A 1N7IA 4DCJA 2PR2A 4U6NA 3CH6A 2AYXA 3U3DA 5BMVA 2CHGA 5KYYB 2WB2A 2ZI7A 2PJRA 5CXXA 1FSZA 1YS9A 1AO3A 3FJ1A 2I6TA 4PCVA 4OHZA 1WBBA 5FD8A 3IPAA 5AK5A 4BNNA 3DAYA 2F00A 3GNTA 1W36C 4LBZA 5GVRA 1C7FA 2ZSIA 3I9V6 3FRHA 4M1YA 1W6UA 1T9HA 2RONA 1T9DA 3L0OA 5KTTA 2I5PO 3LYUA 1JXMA 4PG4A 1W44A 3HFJA 4O5AA 3ISTA 2JFWA 4EYSA 1JU9A 5FH9A 5THKA 1UIRA 2YHIA 1KJ9A 3JQFC 3OIWA 4Y6RA 1PK7A 2PL9A 3V8BA 5GGXA 5ALKA 1MJHA 3CC8A 1BEZA 4LV5B 4OVKA 5GMOA 3IIEA 1RT9A 3I76A 4GIBA 1A04A 2JKZA 3EF1A 2HHAA 4HNGA 3TD2A 3ES9A 4MMXB 1P2GA 4W5WA 1YJ5A 4L9WA 2PUWA 2WF8A 3O91A 3WGYA 2VJAA 2BY4A 3OZSA 2G1PA 4BLSA 3SSOA 1EXWA 1I2AA 4YRZA 3DZGA 4QGAA 3OEHA 2GPYA 3T1OA 3V1UA 3VU1A 1EK0A 2OVBA 2PVSA 2YJ4A 4M0MA 1KEZA 1E1QD 2VDPB 1R8YA 3SR0A 3UXYA 3AP2A 5J5AA 2XQVA 3N28A 5HR5A 5JAZA 3BE8A 4PGHA 3UG7A 3AOEC 3LT5A 2EX1A 3H4TA 5A2GA 1CBUA 2CJYA 1JA1A 1H69A 3IV6A 2O0KA 3U31A 3L8EA 3GCZA 3DMHA 4QDOA 1NIJA 1ORWA 4NNOA 5FL3A 3ZZ1A 5J4LA 1YHYA 1IHUA 1TC2A 1E9VA 1BHSA 3OE7A 4DQXA 5JAIA 5EC8A 4J76A 5H80A 1P6UA 1P8AA 2Y76A 3BCHA 2O1XA 3WFJA 2HMWA 4IQ0A 1EVIA 3IHTA 4LJ7A 1K4KA 7MDHA 2V6FA 4RPIA 3BGVA 3ORQA 3AESA 1VL6A 1C8VB 2QVBA 1UXKA 2I99A 3CF4A 3WHIA 2WABA 4KCGA 2XUFA 1V8ZA 2N9UA 4LK3A 3VC1A 3EXIB 4JQSA 5HCNA 3SWWA 3QTBA 3AVQA 3CW2A 1Q12A 3RS2A 2LGJA 1D03A 1ZFNA 1JEDA 3C70A 2ZULA 4CM9A 2XLCA 1S2IA 3EGXA 3K1ZA 4IIJA 1XDDA 5AVJA 1DKPA 2JAOA 2PSSA 2BHRA 3IERA 5DW0A 1CYEA 2VZLA 4E2YA 4F46A 3DPSA 2EJCA 2B4QA 2D5LA 2OLJA 1HQDA 2YJ6A 4X0EA 2HIGA 4I1IA 4JBWA 4NRDA 3DHNA 5JW6A 2C5FA 3ABOB 2AN5A 3L8ZA 1JKMA 3OF3A 2BM1A 2YHAA 2LDXA 4BPBA 4B4OA 1AN9A 3IKLA 3UQZA 5CDUA 1YB4A 4ME6A 3GRVA 3HFGA 4HTFA 5MN6A 1XIVA 3QELB 4CT4B 5C9ZA 2JAHA 1UJNA 5JSFA 3ZVKA 5F98A 3TJZA 3BM5A 1E9CA 3I04A 2PUHA 1YMQA 4M9XA 1JPNA 2A58A 4RD0A 1YZKA 1MORA 4L7VA 1U8YA 4KX5A 1CPYA 3KR2A 3AF5A 2V5VA 2CUZA 4P4NA 4E31A 2I9KA 4FFVA 1QCZA 1HEYA 1B8NA 4M0LA 4FD3A 3VSEA 4OP3A 5IAAA 4QU8A 1RXEA 2K7FA 3GVCA 3UXEA 4LJRA 2O2IA 2HOQA 3A28A 3M6UA 3NPAA 3EE6A 4BYGA 1US8A 3QF4B 1X7ZA 2X8AA 1AQUA 4JODA 3J7AC 1TVMA 4JVLA 1MAUA 4S1PA 5JZMA 3WL3A 3TAHA 1ZI6A 1L1EA 2C9OA 4WQMA 1JG4A 5B3KA 3L8HA 5SYAA 2GCPA 5KPDA 1I7NA 3TL2A 4JC5A 2RHTA 2YW2A 5TGDA 2BF7A 4G1UC 2XR1A 4K9MA 4FR2A 3RFTA 2RK3A 4OU4A 2EX4A 4DV5B 4Y18A 1THZA 1T9AA 2NU7A 1OREA 3AUFA 5DBEX 3ZXUB 1TYZA 3G2JA 3LPNA 3L1UA 5DWVA 2I34A 2IYTA 1BH2A 3DJYA 3IPXA 1KJ8A 4LJLA 3FCUB 1E3QA 5CM2Z 4XDYA 3I2KA 3NDPA 2WKWA 1X7XB 2Z9DA 5KQSA 2PGXA 2R86A 2JLVA 5KNDH 3GLFE 1UFQA 1X1BA 1Q57A 3WS7A 2QRNA 2I3AA 5CDHA 4ENVA 2OUKA 5F9FA 3H2JA 3N59A 4CF3A 4EB6B 3EFHA 3R5TA 4URZR 2X2PA 1QDEA 5DN9A 4MUNA 2B4KA 3C15C 3MEQA 1L6RA 1VZ3A 2J0UB 5E1OA 4EJ2A 2Y0DA 1IXZA 4CCAA 3K0BA 4OHKA 3G2MA 4DVGA 3AZOA 2Y9PB 1NLMA 4XR4A 4AZVA 1ONBA 3ETEA 4PZZA 3D3QA 5K3SA 5LSAA 1JIIA 2FPOA 1NMXA 3PEFA 2H11A 4U2EA 6GPBA 2QLMA 2VG8A 1F5NA 4G5XA 1DPGA 1GTSA 1FFWA 3CM0A 3ETJA 1NW5A 2CVOA 2NSHA 1A2OA 4QUEA 4QYIA 1NKTA 2C5AA 4AZTA 4B7AA 4DLYA 5D3ZA 4F9FA 2B35A 3TS1A 3FPFA 1XRLA 4LXGA 4IY1A 4FFSA 1WMEA 3IOBA 4F11A 3KZNA 1H2FA 2B0JA 3PNYA 4ID9A 4MULA 4ZVMA 3LBFA 1A9XA 2YY7A 3GQBA 1HE2A 1QGAA 2BZ0A 2JGIA 1RLIA 3RKSA 5KTRA 1GL7A 4RVUA 1GT6A 1O94C 1A9ZA 2BGLA 4ZZ3A 4B3XA 3ENNA 1AKTA 2QR2A 2XT6A 4F96A 1AVTA 1E66A 5CK5A 3DE4X 4DA0A 3R44A 1I7PA 2J4DA 4QJ4A 1L1FA 4ARZB 3D8RA 4D8VA 3L6OO 1R0KA 1QDLB 2Q0HA 3L7IA 1CXZA 3PNKA 2WP8J 1MB0A 4ZVKA 4BMYA 2IYLD 4B6SA 4ZGBA 1R6DA 2NU9A 4PV7A 1UPFA 2ASEA 3DT8A 2QHXA 2G36A 2Q8QA 2CZCA 1NSTA 2MOKA 4LDJA 2NUPB 4WY5A 4YJHA 3SS7X 3E58A 3SDZA 3B20A 3QFHA 2GRJA 3QVKA 1JHPA 3VBCA 5IKXA 2HLDD 4YASA 4YRKA 2PSEA 4R5MA 3THWB 1FUUA 2B3DA 4E1VA 4MGIR 4O0MA 2DVMA 1V11B 2JCXA 2ZKIA 4P7GA 3LVBA 2Q6TA 1VKHA 3ZWQA 3WGNA 4Q02A 1QH8B 2O3SA 4ZOAA 3EGOA 3ZPXA 4BO3A 3K05A 3MBOA 2REXB 1L4KA 3I04M 4CI0B 2WWYA 4Z5XA 1U7HA 2AI1A 5CPBA 4MUXA 4O4IB 4JVOA 1VG9B 5CIYA 4J16C 3W6OA 3O1JC 1J8YF 4RGYA 5EJMA 2IF2A 1MC4A 2RHGB 3O2QB 2Y67A 2O5RA 3N3BC 1HDGO 3U9TA 1N2SA 4KYVA 2PHZA 4YROA 4U7JA 2DM6A 3W6UA 3EUAA 1GFZA 4RMJA 3NGLA 4ZT4A 3P9ZA 3IRUA 1NQXA 3K8QA 1BVRA 4Y2TA 2NGRA 2ZJZA 1Y1LA 2YVUA 1OWNA 3AT1A 4S2UA 1N0IA 2GI4A 4UM9D 3ZTYA 3R9XB 1TE2A 5CTAA 5A7HA 4JUIA 5EQTA 3TAXA 4KK4A 2QRHA 4ZU6X 4BRSA 5EI5A 3CRMA 3C6QA 3MWJA 3OOWA 3CX3A 4Y6QA 4B2YA 4C22A 2R751 3HABA 3N86A 5DEOA 3WRYC 4DLKA 1IC6A 1IY0A 3JQPA 3E23A 1P72A 4U0KA 3L4BA 5AJXA 2RHRA 1ULHA 2JFYA 3RC1A 2CLIB 1NY6A 2FLWA 4YRIA 3DLTA 4G1MB 4DIBA 2OHHA 1HR0B 3WWZA 3RU3A 1BGWA 3X1XA 4ASUD 2BHSA 1QK4A 3A1EA 3NM4A 4Z4QA 1RWPA 1BQ4A 2P2NA 2VHZA 4UU8A 1T0HB 2JEZA 3K31A 2YOFA 4RO0A 1NI4B 3R1IA 2VQDA 1KZ4A 2VDMB 4GZ3A 4XIGS 3WO1A 2ETXA 3OC6A 1C7IA 4GKVA 4JYPA 5FBLB 1SC3A 4R6XA 3X1YA 1IOZA 3HA3A 2HLPA 1T6YA 3D8NA 4BY9E 3L1JA 4PC2A 3R0QA 4MRMB 4KN8A 4PPNA 1T26A 5AUPB 3EWAA 1OBOA 1AK1A 1O2DA 1JEJA 3P9IA 5T8KA 4BVKA 4C5AA 4Q39A 3C6ZA 2A0XA 3HPQA 1F2UB 2OCAA 2VAMA 4YMWA 4NYMR 3X43A 4M21A 2GXAA 3A36A 2HQRA 1QHFA 2IV2X 4Y7CA 4E1BA 2WSYB 2Q0SA 2ZYDA 1LY1A 3V2GA 3WLKX 2EFEB 2V0CA 4BDTA 3O1LA 4EEZA 4TT3A 1NUUA 5JSQA 5FYQA 2KX7A 2W0SA 4L2IA 1BA3A 4L08A 3E0QA 1S7CA 2QYTA 4QUHA 3VSBA 3R3JA 1JB9A 4W5HA 4BQIA 2O2CA 2YCBA 4MI6A 2B2NA 1I4OA 4D0GA 3CZPA 4HYYA 4JNCA 1YB2A 3ZQUA 3FDZB 5A71A 3UMGA 1SBIA 8OHMA 4P53A 1CUDA 3JYQA 4BV8A 1KWGA 4LNUB 2IOFK 3MD9A 3A32A 1HV8A 4FILA 3LXRA 2QZJA 4ISCA 5JJLA 1EU1A 1XPJA 5EIOA 2GN4A 2X8LA 2AOUA 3GLKA 4W9MC 4OQXA 1WDWB 3C8DA 5TARA 3K0SA 5U9CA 1N8TA 1ZBQA 4KH1A 2PXHA 2JH9A 3H9BA 4R7ZA 3VR5H 3BWDD 2EVWX 2VYNA 3BMNB 3GK3A 4FZVA 2ZPAA 2VWGA 4H35A 3WGLA 2FN4A 1GUAA 5K9ZA 5JAMA 3PQ6A 1KSFX 4RAQA 3KB1A 2MCFA 4PHCA 2O6HA 3VXKA 4L5JA 3PLNA 2YOHA 3B85A 5KBYA 1Y89A 5HQTA 3OC0A 4NJOA 1LQUA 4LYYA 2UZ0A 4NENA 1WOMA 4J6EA 5JZSA 4FB4A 1KNQA 1OUMA 4H3KB 3IFSA 3CRZA 3N7TA 5K0EA 4RHUA 2Q46A 2RGWA 1QWSA 3SJZA 1EFAA 2AXEA 1GGKA 4GC5A 1QB8A 4R2WA 3ZHUA 1QSGA 1PZFA 3JVDA 3QE3A 4HDQB 3ERCA 3GUCA 2IYEA 1IUNA 4I3GA 1BJTA 3I6MA 3OCCA 2MMGA 1X8LA 2CHQA 4YXWD 3RVQA 4G36A 4OHBA 1DCMA 4IICA 4OYRA 5A3VA 3TLYA 2BMFA 2HFKA 1BKDR 4OQEA 5TPZA 4CVNA 3HYNA 4R9UC 3PTLA 4F56A 3MHTA 1P9RA 3PJEA 2Q6OA 5DYYA 5AUNB 5EQJB 5H5JA 3EGXB 3EWNA 4OQ4A 4YCMA 3O8OA 2BFFA 3A6EA 1Q5PA 2BDEA 4QAJA 1HE5A 1V3TA 1BO6A 3WV5A 1OU4A 5B36A 3QV2A 4DIDA 2D2IA 3IVXA 3O9MA 2JIBA 2WSBA 3RAEC 4W5JA 1VB5A 1EWKA 1Z56C 2NXEA 3C98A 1OH6A 4E46A 1UBUS 1WUJS 4FHGA 1G8SA 5BYKA 4AY2A 2ID9A 3NTQA 1R7RA 1SUAA 4LZOA 5DBIA 5DTJA 5BSVA 1TJNA 4RJIA 2JGRA 2I6XA 1GSIA 1LK0A 2VO1A 4MW4A 3VGJA 4CLEA 5F3WB 4UW9A 3BMQB 1GILA 5DCWA 2ZM6B 4BE9A 2ODTX 4R1NA 3WHLA 3H9EO 1ZD3A 2IIBA 3PFCA 4BP3A 4EVRA 3OQOA 3HC7A 3NYQA 3OX3A 5T7BA 1W34A 1ZMOA 3WHPA 2OLEA 4A2WA 1HTTA 1FJ2A 4Q7MB 4QBIA 1XQWA 2JHPA 1W1IA 5LR6A 4FOSA 1LQ2A 1GCGA 1S2NA 2WUGA 1HK7A 4RHEA 1V8DA 4F4FA 1CF9A 1I0LA 2ZIEA 1E2QA 2BJWA 2C1EA 2LV8A 3CUEF 3ZV6A 1D7AA 2BHNA 2ORWA 1ZG3A 4UEJA 4DMUB 2VJMB 1VA4A 2ACWA 1X2BA 1YE5A 2VPYA 1PYOA 2O8CB 1O03A 4HLQB 4WFKA 2PIDA 2D54A 2DTXA 4FI3C 4DQLA 1OYOA 4C4XA 2C2HA 2PH7A 2OGSA 4PZ9A 5LYYA 4GPZA 3EH2A 4HCJA 3Q7TA 5BV2P 1DC5A 2J3EA 1DG9A 2HY7A 2D3WA 3F71A 4K9NA 3NOQA 4CG0A 1J8DA 1AV6A 1VYTA 4QICA 1GJRA 1G1AA 5GAJA 4F6RA 2QY6A 3EZNA 1V95A 2HIMA 3PGLA 2YUIA 3U39A 2VJLA 3FM9A 2J9RA 4N3NA 5BN5B 1GU7A 1LK7A 4I4CA 2DFTA 4H15A 4JYCA 3NWBA 5FLYA 1YF3A 1T36A 2H2AA 4D9GA 1CR0A 2XE4A 2OWEA 5JI3E 6YASA 2P6PA 4DB2A 2XB4A 1SXJC 1X0VA 1DJLA 1G20B 3B5IA 1PEDA 3G8CA 4INPA 4R68A 4UD6A 4D26A 1EQUA 5LZ4A 2PYIA 1NU8A 2RGNA 4PZCA 4RKYA 5IN5A 1LRJA 2Z09A 1TT5A 3F2IA 1NAHA 3LH5A 1VL8A 4MUKA 5U4XA 1X86B 3DDNA 1R18A 3DMFA 2C5GA 3U40A 4CN9A 1ESMA 1IDN1 3TZQA 2IY8A 1M0SA 2CNWD 1RABA 1G7SA 3L0DA 3QU4A 1E9EA 1RJDA 4FJ2A 4KVZA 4LQLA 4CQJA 4Z1OA 5JCXA 2FFQA 5AHWA 4ALKA 4TYNA 2QSUA 3B1WA 1P3JA 2H1IA 5CFQA 1GUZA 1VKRA 1L7QA 5B1HA 1XTTA 4TN5A 4AP5A 4RV4A 3RRZA 1O6CA 3FRIA 3CSDA 3PBKA 1OU0A 2H59A 3TE7A 4TTAA 3FGOA 3IRVA 3LPDA 2AVNA 3LHSA 3SVLA 3KFLA 2QMYA 1W47A 2W6OA 2HJRA 4K6OA 3TIGA 2EG9A 4AZ3B 3ED1A 4RLFA 2B7LA 2Q6LA 1THGA 2BFNA 1KEPA 4MUJA 4S2EA 5EXTA 3STUA 2JJ2D 2I76A 4M0FA 3FCXA 3V1TC 4DSZA 1L7EA 3L6RA 3PJFA 1NV9A 1U2PA 2BEJA 2PX0A 4HXGA 5I9MA 2XV1A 2Y92A 5AW5A 2H1FA 1L0BA 1QHXA 2HK9A 1LB1B 4FIZA 4JBIA 4JR2A 5K3DA 3LTEA 1WXWA 2F2TA 2JGJA 3S8EA 1XD2B 2P68A 3C5VA 4X00A 3CA8A 4X5OA 4EHJA 4BFXA 2CYAA 3OCUA 4WJLA 3MK31 4KI7A 4Y9DA 3S55A 2V97A 2JG3A 1HE4A 1P44A 3OURA 3V8PA 3SXUA 2KLBA 4C0KA 1IE3A 3W9UA 4B6FA 4ZJZA 4JEMA 4IDAA 2BVNA 4WV3A 2ONYA 1UK7A 2H1HA 1UOPA 4EY4A 3NGMA 2GVZC 3I8OA 3DBIA 1NI3A 1CR6A 1I3KA 1GPMA 4ZOLB 4BGDA 3LZCA 4CNQA 2AJTA 2BMWA 4WESB 2FR8A 2O3QA 4GI7A 2XMCA 1SQ5A 2WM9B 4IBOA 4IL5A 4N1AA 4OGKA 3Q3CA 2X6TA 1RQXA 4OBEA 2R6R1 4DWVA 2BGRA 5DNYB 3G1WA 2P7HA 3BQ9A 4MO2A 3TR0A 4F04A 3D5QA 4Z1MD 3R6TA 2QVYX 5EN4A 1RQRA 3LX6A 3M1YA 4V0KA 1ODIA 1IOLA 1TUBB 2PRYA 2W8BB 2P3LA 1FSGA 1MXFA 2WJ4A 3Q2KA 1FMFA 3QJ5A 5BN1A 2O7VA 1UEJA 3N2EA 2P7IA 4NZZA 5DXAA 3IEUA 5H59A 5AKIA 1U02A 4XFJA 2O54A 3AJAA 3VH2A 1OTYA 1OT5A 4QUGA 1FRZA 1QG2A 3KJNA 5ECDA 5BP7A 3I30X 1EM8A 2IZ7A 1O97D 2F3RA 3OM8A 4LYJA 2QEQA 2J3QA 1RIIA 4NV0A 2IUTA 1IUKA 1T0UA 4NG4A 4CLRA 2H4ZA 2Q3HA 5D2CA 1TF5A 1UJCA 2DERA 2L18A 4ZHQB 4M99A 3ENQA 3W2HA 1UANA 5HOEA 2Z98A 4BNHA 5CXSA 4EL0A 1Y80A 3BXFA 3NP9A 3TDNA 3UYLA 1IHPA 2R2AA 3DAGA 5KQLA 3B1ZA 3EHEA 4X54A 2JJQA 2XD4A 1XCOA 4UUPA 2G06A 3G0GA 3AVOA 2ARKA 2BM9A 1EZZA 5HVNA 4NLLA 5DX0A 1U2SA 4MINA 1QRDA 1RZVA 1ZVJA 1P60A 2EJTA 2CYCA 4IRMA 4GS5A 3JPYA 4BFYA 1PUIA 3CRVA 3PIDA 4QYXA 4U3JA 4OHYA 2FDXA 2GN0A 1KBQA 1TZBA 1GTRA 1ECBA 3SKVA 1D5CA 3WIDA 4KFSA 1AMNA 4V03A 3E1KA 3SQWA 1MC1A 2VYVD 4PLHA 4QASA 1GDTA 2I4OA 2YJNA 4RK4A 4WZBB 3VHQA 4RMGA 3ZWDA 2XWPA 2YV3A 5ESWA 1E7RA 2ES4A 1ML4A 4DIUA 2FW6A 4IV8A 3WLPA 1WNFA 3O74A 5DGHA 4OB6A 5GZ3A 4KKXB 2R6HA 4IZHA 4N82A 3VOAA 1I2CA 5J5VA 2HTFA 1C1YA 3MJSA 1C5KA 3HI6A 1W5SA 4IUBS 5ESDA 6LDHA 5I48A 3LZDA 2O2GA 4EBFA 3TK1A 1ICEA 3TX6A 5IK2D 4NECA 1XYGA 3KHKA 5KNBD 4XGRA 1NC1A 2DFNA 1V8OA 1HY3A 4WBSA 3E8SA 2P35A 3HYTA 3MG9A 1FX1A 4DZRA 1WX1A 2J9XB 2NAFA 5J1SB 3W2TA 5DYGA 2BZ1A 2X40A 2UUOA 3HKCA 4FKZA 1YBMA 4GNKA 1A8QA 4HRAA 4DA8A 3TKYA 4YCLA 2UZ3A 5B64A 1PT7A 4MI9A 5BNWA 1P2FA 1PAUA 1T1GA 2F9FA 2JBWA 3ETGA 3G8DA 3T7CA 5KYNA 1Q20A 4B3MB 5CLLA 1MJGM 3W05A 4DDHA 121PA 3PQ5A 3MXOA 1PGPA 3B48A 3R7BA 1YS7A 4TLCA 3TTWA 1N3LA 4EFMA 3ROZA 4HD8A 5KJ1A 3L8FA 3KG2A 1Q83A 1TU0A 4RBNA 5CGQB 4TVSA 2BTQB 1TOAA 3ANTA 1L5NA 3A9SA 3SIRA 3PKIA 3UH1A 2PJDA 4RXMA 5AI5A 1UBCA 3KQQA 4QPNA 1SVLA 2FGJA 4G4IA 4LF9B 2VJKA 3IEPA 5TQ0A 3RVNA 1H8EA 1QOPB 4G67A 3MJFA 1AUOA 3P32A 3S44A 5ALQA 4UBKA 4ZFNA 1SXPA 1QYVA 1B8UA 1DO0A 2JIRA 2WYIA 1SKMA 4AMGA 2VTBB 4TRMA 4CEHA 3DBLB 2O07A 1HT3A 2CCJA 5EMHA 3EEBA 1ISRA 4HRYA 4G5OA 4IO0A 4L3OA 3LX5A 4S0ZA 5TE9A 3JAMA 1EGAA 1V96A 2IEAA 1GDDA 3TZKA 3LO8A 3NS7A 3AINA 1J6UA 1Z2AA 1KDRA 4NPCA 1T0JB 5KYVA 3PC7A 4CCYB 5C7IO 3D6JA 2HRQA 1EVLA 4HS4A 3N5CA 4C6TB 2XVYA 4MLPA 3EARA 1Y1QA 4TM8A 3EGIA 2PSFA 5EFOA 1RI1A 1XD9A 3D2BA 3B7PA 2GZRA 2W71A 1X2EA 2NU6B 3M3PA 1YXMA 4EO9A 1TKCA 2C2MA 4MK4A 1ENOA 4TWRA 5TEWA 3PU6A 3WGZA 2VHYA 1WVMA 2JZOA 4HP8A 4MW6A 3CN9A 3VPBA 2FPLA 4MV8A 1YL5A 3UHPA 5CW1A 3OFSA 1G8MA 5AW0A 3MOGA 4IDPA 3AI1A 5C0OE 4HAXA 1V16B 3F6EX 3KR9A 4NK5A 1ZMXA 3I4LA 1UPBA 2P8SA 4G0QA 3IQXA 3K09C 4CF5A 2C2KA 1WZNA 2H5LA 1YRAA 2HUPA 2WMDA 2XKAA 4GW3A 1KI6B 2OBXA 4YDRA 5JQGF 2PM8A 1GFIA 1SRRA 3IPLA 2HHHB 3VH1A 1KPGA 2B21A 1RWKA 2VPIA 2VYQA 4RVNA 1V8BA 3QY9A 2EW1A 2Y0PA 3DWGA 2P5TB 3K73O 4H1TA 2VH1A 1PNRA 1N6LA 4UD2A 3T0GA 2JW5A 5JNUA 1RPJA 1MAAA 4B81A 2XQJA 1UOQA 1E6WA 3FFXA 1BXRB 2PKCA 4GC9A 5CHEA 4EKYA 1I7DA 4MMZB 3VAAA 5MN4A 1Q3KA 1TTHA 1RU3A 1HOTA 1K6MA 2A84A 5B53A 4D3ZA 5HW0A 1UIMA 4QUKA 3GB9A 1IG3A 4PPYA 4KPYA 1JI3A 2B98A 1J5PA 1GPUA 1PK8A 1TIBA 2HBQA 4XVRA 3WG9A 4K9SA 3WBJA 3N0RA 7YASA 2XMPA 2YZMA 3B52X 1RXVA 4J7CA 1Y37A 2ACVA 1DQNA 1LF0A 2WMYA 2ZVQX 4W99A 2AOTA 4DQVA 3IO3A 5DOZA 2LNDA 2PBRA 4YRNA 4BKQA 3M1IA 1Q1QA 1T0BA 2VAWA 8GPBA 1HBJA 1QP8A 3FNIA 2QLTA 3LI2A 4FOOA 3T5GA 1FFBA 5EE3A 3AF4A 3I0MA 3GMSA 1XEXA 1E1RA 1DKOA 1PZXA 1Z13A 4E5PA 2H1VA 3EIQA 5KQRA 5ESRA 3F46A 5TMDA 3OTOB 3UATA 3GFOA 5BW5A 4W5NA 5FOWA 3ZNQA 3H65A 1OBFO 2ZQYA 3UCEA 2OBYA 5CH3A 3B2QA 4CTKA 3T9CA 5BUQA 1WDKA 3H83A 3V48A 2QBYA 2PWYA 3T3HA 1ZR4A 8AT1A 2XZLA 3DXYA 4GSLA 2QW1A 3DF9A 5LQSA 5F12A 1YZFA 2FETA 3PD1A 4JLJA 4FWBA 2FHPA 2RI0A 1O7JA 3LOUA 3QWHA 4NFSA 2OMKA 1R8SA 2IXGA 3G5UA 3O84A 4OXYA 4DJJA 1IEVA 2DUJA 1QR6A 1NI4A 1TJPB 1Z06A 4LK2A 5DKFA 4WVFA 1PD1A 4B6QA 4C4SA 1YRBA 5A62A 3PFBA 3ZE7A 1VRCA 3AJ9A 3CZQA 4J29A 4D8WA 4EGAA 1J25A 5CVEA 1P9LA 3WK9A 4C1NA 2EKBA 2ODAA 2Z4SA 4KPFC 1KI9A 2I4LA 1Y42X 2CNBA 3DH0A 3FB1A 3HADA 2RGXA 4Q1AA 3UC5A 4K46A 4GVXA 2OZEA 1CJSA 3AUYA 2G9RA 3HJHA 4KUHA 3IOCA 4PC1A 2QTCA 4GYYA 4Q21A 2OQIA 4LKOA 2W2KB 1USIA 3I6YA 2WVGA 3DG9A 4PU0A 4X45A 1F8GA 2AZXA 4EGQA 4EO4A 3K4HA 3QOWA 4LVCA 3UB2A 4BMNA 3MRVA 1D2HA 1Y8RB 2GLTA 1OGJA 3WDMA 1U7OA 1YBHA 1KIFA 2R8YA 1CJBA 3O1HB 4EA6A 5JZBA 5HS4A 1DT3A 1I1QB 3FZQA 5A4AA 4DARA 1QGED 1RPZA 2G9VA 3TW4A 1SBZA 1K7XB 3LSYA 4IOJA 3ZC3A 5CYPA 1YI8A 1P6QA 1LLDA 2OR3A 4HB2A 3KL2A 3PEYA 4YQYA 4GPD1 4O4HA 3JVEA 1LCIA 4E5NA 3V8VA 2NZJA 3RIGA 4ZCQA 1W96A 3EIFA 5BV0A 1B42A 1HI9A 2V6MA 3DOHA 2WE7A 5JC8A 1URPA 3ZQ4A 3FUXA 3AL2A 2O59A 4FYYA 2OHOA 4NABA 3M81A 2FAXA 2WQ6A 1J8VA 3NIGB 4WOPA 4YNBA 5JH7B 1S2OA 1T5SA 4B48A 3QLTA 1B6SA 5FCDA 3GDWA 1ECJA 3KLBA 4EKDA 4LEIA 5J4YA 1TRHA 4IHQA 1ZIOA 3BKXA 1HX7A 4NJEA 4RCZA 3SY8A 4MKHA 1PDOA 5FR1A 5KZMB 4FN4A 4BAGA 3P2OA 4PRKA 3BXGA 4DT1A 2CLKB 1CZUA 3RI3A 5LNK6 4FHDA 1IHDA 5LKAA 3L01A 3P4XA 2NNLD 3HBLA 3HM2A 2AX4A 1PWYE 3RFVA 3R7WB 4JV5B 2R6GA 4WZAA 3O95A 4BASA 4QQNA 2OCXA 3MHPA 3E3AA 5DSZA 3DO8A 4Q4JA 3TNJA 1KY3A 2Y93A 5K2OA 1MRSA 2Q07A 2YYZA 3GMIA 3VNUA 1SM4A 3FDZA 1CEXA 3RW9A 4EI8A 4M1OA 4F2HA 3IAM1 5U1PA 2HM7A 1GA1A 2ZJAA 3RBZA 3DOUA 1GFWA 3H16A 3IQEA 2IP1A 3IH5A 2CDAA 3Q9UA 3MIZA 4HDKA 1KS9A 3THXB 3N2ZB 2RC5A 3HEMA 4UDYX 1ZXBA 2G72A 3SZUA 4A9AA 1U28C 1RACA 4YMIA 3L84A 4BUZA 1E1CA 5FI5A 5GWXA 1YCFA 4WOKA 5CVDA 1UAGA 5LZ8A 3BSWA 3OOSA 4UC0A 1E92A 4BBPA 4DR6B 2CVFA 3KPVA 2PQ6A 3UAOA 1TA4A 1RQGA 5I01A 1IMJA 1Z82A 3GNQA 1E96A 1CKEA 1PV2A 1W73A 3KT3A 4HBGA 5KVCA 2A14A 1BGVA 1NXSA 3UW1A 3CEPB 1FNDA 5IM5A 1H94A 1KE1A 4RCYA 1KY2A 3ZNNA 5L6MB 4EUNA 3MMZA 5DYTA 1H8HA 3H84A 2WFZA 2WIFA 2M6RA 5IUNC 1LUAA 1ZICA 4RPLA 1OZGA 3QYAA 1Y7LA 2XTZA 3F6CA 4LMBA 1JFSA 1VG0B 4CLXA 1OVMA 2NUAB 2YNMD 4DREA 3VVLA 4Q93A 1PHPA 1RYEA 1C1XB 5D87A 3SD7A 5I9SA 3GNSA 1GYQA 2JGDB 3N8HA 4WL0A 3AW9A 2OCYC 1GAEO 1SG0A 1QGYA 2I1WA 1PZHA 2G88A 1UC4B 4QM6A 5DBFA 4A16A 4EI7A 3EOAI 2EFCB 3ACBA 3NJ4A 5B58C 2JBHA 1X1RA 2W7TA 5AVQA 2AQKA 2G63A 2FXIA 3RJMA 3T6KA 3VZRA 2KBEA 4CM4A 4HLUA 3U16A 4RZUA 2CL7X 4MYTA 4INOA 1J23A 3I61A 3D4LA 1JHAA 1O95C 1TCUA 3PWTA 1JAIA 4KZPA 4D4GA 4Q4CA 3UJBA 5CVJA 1EUQA 2VT3A 3RARA 1GGHA 5IKOA 1Z0SA 1GNPA 4PG6A 4FEEA 1ZWLA 1IVYA 1GTG1 1HL3A 3EY4A 1AGYA 1P9NA 1N9GA 1Q1GA 1QBGA 3NONA 3QUTA 4MVJM 4XZ3A 5LXTF 1AXRA 1T6BY 2W6NA 1DKNA 1Y9AA 3MWKA 4LC9A 2AUTA 2BFDA 4GM0A 2HJHA 5HYVA 2YFYA 3PKJA 2BGKA 3AF2A 4QXPA 4ASUA 4AZWA 2HA0A 1WLYA 2EFYA 4AM8A 3VTFA 1CUBA 2FUCA 3OLXA 1OZHA 4JD5A 4JKOA 4XPIA 4LHEA 4H3SA 1NR5A 3DNPA 2ODWA 4LZZA 3CIFA 1Z5ZA 3DZIA 5IT9A 2CK3D 2JA1A 5JUWA 1DG1G 1CQXA 3B1XA 3FPSA 4RTSA 3NFRA 1GAWA 1AG9A 4ZZIA 4BZQA 4G0NA 3W06A 2D1SA 3F67A 2QWXA 3PHJA 3SXPA 4A8TA 2JFZA 3V34A 4Z7NB 4ZJUA 3IR7A 4IS2A 2J87A 1X14A 5T6MA 1S3IA 1CRLA 1V48A 3EG9A 3RHTA 1FQKA 3A05A 4EY3A 3ZLBA 1TO1E 1ZSYA 2WNSA 3RDPA 1B23P 2ZT8A 1ADJA 2X7XA 1MV5A 3T4UA 3IE1A 5FA6A 2GRAA 1W25A 3QU7A 4H6WA 4XQ9A 3EZ9A 3EDOA 5COBA 1XJQA 5DXJA 4B8ZA 2G4CA 2GJAA 3DBVO 5JJKA 4N40A 2FP4A 3C39A 4TQAA 3INNA 5G4KA 4YWHA 4OHXA 4JI0B 3KS9A 4MZDA 2OFFA 1GPKA 1E2MA 1WZCA 4GAEA 3O8NA 1GV1A 2ZUVA 2YTZA 1U8AA 2R6ZA 4KBFA 4URVR 4ENTA 5KWSA 1II8B 3LBNA 2ZRNA 2WB4A 3SIWA 3GHYA 3VZQA 3G2PA 4QRHA 1XA4A 2WKSA 3AMVA 5DCLA 1Y33E 2I6FA 2FPGA 4IDDA 1KEEB 3F4BA 3JYOA 1L1RA 4XAQA 1P33A 1HEUA 5BNTA 5ALPA 5C7OO 1GSAA 4OA8A 4X3PA 4OI1A 2BGGA 3Q6IA 2Z56A 3FNEA 3MILA 7ADHA 4EZEA 3H8SA 1WXQA 4D44A 1Z6YA 2AR9A 1FU7A 4KJXA 1VCOA 2HK7A 1V47A 4OGLA 5LWQA 5JPIA 4WE3A 4F85A 1LDGA 4NH4A 4BNTA 2FW9A 1O0BA 1CHDA 1MRZA 4DLNA 2XITA 4LC0A 3QVJA 1QTNA 3MSXA 4RS3A 5DHTA 4CKBA 5C5DA 4GM4A 1SJ9A 3LF1A 3O4VA 4N39A 1VHDA 4G5QA 2C29D 2CE7A 4BNGA 2VTDA 3B7GA 2AMLA 5ALXA 2GPTA 2YWEA 1VLLA 3QBVA 4R0MA 4JL8A 3LUKA 1BDBA 3P2KA 4WZAE 1H9CA 4E0BA 1NBME 4GYWA 3V2IA 4XWWA 3B5JA 1TJ5A 1O57A 4GOMD 1A9PA 1HMPA 2ODBA 2Q8PA 2Y6VA 4BAUA 3GFBA 1ZH4A 4HQKA 1E5VA 1YIAA 4K6KA 4NU8X 4FNMA 5IBRA 3KUKA 1EVJA 3IKJA 1MOPA 5H83A 2O57A 3CX7A 3EIUA 1ODJA 2PMWB 4KBGA 3V55A 3ZDXB 2H29A 4B46A 4EGJA 4MR9A 5A3JA 5CDYA 4MOWA 1QG0A 3KZXA 3JWJA 4R8KA 3GJ7A 5BSKA 1ZXLA 2QI9F 4YXWA 1I2DA 4WBNA 3KPJA 4KR7A 4ZAFA 3QFCA 1FMLA 1ELOA 2FZCA 5JJIA 4GZ6A 4IUCS 1GR0A 4S3MA 1SU8A 1EHIA 1KMMA 4IEEA 4Y1RB 3V4PB 1P5HA 3MGKA 1FF9A 1SA0A 3EGCA 1LI5A 4EQZA 3UMSA 1KR2A 2AGVA 4LE1A 3HKEB 2HSJA 2WJGA 2R6CA 5AKHA 3X44A 3EEOA 1MABB 3AJ8A 3L5KA 3M4JA 4JLBA 4Z3DA 3TUJC 3IVGA 5HG0A 5KYKA 4YAJA 1NWCA 1P73A 5FQOA 2HF2A 3F5QA 3IEIA 2GUGA 2FHSA 3W2IA 1XF9A 3O82A 4KXQA 3R8FA 4GKJB 2KSQA 2VATA 1HDXA 3LHKA 2B1GA 2G17A 2XRMA 4QGSA 2B0CA 5K09A 1VMAA 4XYEA 4JCOA 2ZTMA 4RY8A 2ZJ0A 2QN9A 2AN3A 4IS3A 3OJXA 4NMHA 2LIVA 3NMUF 1YJCA 3A7DA 4FZ5A 4G9EA 2Z6QA 3QX3A 3VX3A 1GTVA 1NN1A 3K2EA 3LMKA 4WCFC 1NTOA 4UULA 3K5IA 3ZD9A 4BB5A 4S04A 3CNOA 4MAAA 3FDFA 4LV8B 3N70A 3OG9A 5JASA 2GCNA 3BQMB 2FZVA 2ECPA 5GIPE 3AFNA 3MM4A 5IUKC 4N5NA 2EWWA 1BWRA 1GEEA 1P1JA 2EGUA 3BH0A 5GZ1A 5T4EA 4M60A 4DMLA 2CUTA 2HGSA 1YBVA 3TOSA 4D0RA 2ZANA 721PA 2XUQA 2W22A 2YZ2A 5KNCA 1K2VN 2PKQO 1K8ZB 2O2DA 1MGPA 2CLSA 3EEYA 4IKPA 1FE8A 3E9MA 2NU6A 4AJKA 1Z3IX 3GUYA 4TTRA 4R2JA 2P2SA 4HR7A 2WU4A 4F2WA 4H7EA 4KO8A 2PLAA 3RK0A 5J3JA 2XKJE 3GIDA 1GKYA 2FG7C 2AN4A 1SWWA 1PK9A 4EPVA 3TQRA 1RHRA 2XBUA 1PJQA 3HE3A 5FYDA 5L3QB 1XEXB 2VDQB 1SK9A 3TE6A 3ZBPA 2V6IA 2IHJA 4P3NA 3LP6A 2N3ZA 1L4BA 4L0DA 3HSSA 4N0QA 1J2YA 1GGMA 4LGVA 5BQ5A 2NO5A 2ADMA 1NWHA 2CHUA 1KI6A 3OLZA 5EERA 3ZHRA 2WPDA 1XZCA 2VCEA 1AZTA 3HCAA 3ADPA 1HORA 3BE6A 4J8PA 4ON9A 3Q3EA 4QDJA 1P2DA 4BO5A 4DMGA 1BN6A 1LDYA 2WJIA 4I4LA 1ST3A 2YC2C 3IO5A 1OYVA 2BMAA 3LUHA 4NBUA 3RWMB 2QKYA 1VQ1A 1H6BA 1AX9A 2ZKLA 1VLHA 1P4GA 1R4AA 1JLHA 2VDVE 1CZNA 4BKPA 4UATA 2BTQA 1KY4A 4B09A 2X22A 2B30A 3CHYA 4CV0A 9MHTA 1AH2A 2ZSFA 4I1YA 1I94B 1N2XA 4E15A 1I3LA 5AW1A 2JS7A 1L7VC 2ZIFA 3FGZA 3ND8A 5G0WA 2FP4B 3GFFA 1VHWA 3KT0A 1XK7A 4GSKA 4LYFA 4N4AA 1LRLA 2ZYTX 4EY7A 3LLCA 4AXBA 4DLWA 2EBWA 1RS0A 2OBLA 4LMRA 3WSTA 1QG4A 1Z6QA 1PV1A 4H1UA 1ZSVA 1ZMBA 1K6IA 3O38A 5FOUA 2J5XA 3UV3A 3TYXA 3E9RA 1IN6A 3PJDA 4KTTE 5HF8A 1N4AA 2C4VA 1XKTA 3A3PA 5KOHB 4LHYA 3Q3GE 1YDGA 5HIKA 2I71A 1Y4AE 2QTRA 2QTZA 4OSOA 1PGNA 4CKYA 4MPJA 3GJ4A 5I5GA 2WP0A 3USZA 4EPTA 3PSHA 3WJAA 2C59A 2YMPA 1Z73A 3WGGA 1XMXA 3IPRA 3NANA 1BMQA 1R0ZA 3EQ7A 1ZHHA 4ECAA 5FI3A 1VE3A 2Z5VA 3HCBA 3P9NA 4BDSA 1KZYC 1U3VA 3H5NA 4YREA 3TUIC 1N9KA 1YULA 3UYKA 4JN6B 3AEYA 1EMDA 4TKLA 2D0PB 4HO1X 4XVUA 3PFWO 2DQ4A 3H1FA 4LMPA 3IMGA 4UE3S 3QBDA 2LRHA 3DCJA 1EP3B 2P6UA 2P0YA 2PKYX 5JNWA 3HVHA 4JBLA 2IPNA 1Q0UA 1F0NA 1N6IA 2C96A 3QEOA 5K01A 5FWXA 3U6BA 2V03A 1SU7A 4ED9A 4MR7A 5CNIA 1M2VB 4PX5A 4XB6B 1D5WA 3BULA 2B20A 3HO6A 3HH8A 3WAGA 2DP4E 2JJ1A 2RHWA 3C48A 2BISA 1G6HA 2X4GA 1KNXA 1SZJG 4K3UA 4KE7A 4L4YA 1E6LA 1QO0D 2QUJA 2G40A 1IXSB 3DQZA 4MR8A 5KB3A 1VE1A 1Q2UA 2GUWA 3DEHA 1PQWA 4JQZA 2FVXA 1NKSA 3EMKA 4HB4A 3HG7A 2BOVA 1TLTA 1BD4A 2AJLI 4LECA 1NZJA 2FSGA 3T34A 1P0IA 1MQSA 1P0QA 1IL0A 3KJXA 1HE8B 3MT7A 2XUGA 4J1SA 4DPLA 4AG5A 1VSBA 2I9PA 1G63A 3IV9A 3FLAA 4AUKA 1SCUB 2QMHA 2WTXA 5G1NA 1K3FA 2IT1A 1BQEA 3O8DA 4I7EA 3VA7A 3V6LA 2CNDA 2FX5A 2G09A 3LYAA 3GP5A 3JRNA 3TTTA 1Y8CA 1YAHA 7AT1A 1W1UA 1WCIA 4Q18A 2E9SA 3KFVA 4YJDA 3H2KA 2QRGA 3Q3IA 3E0XA 3UK7A 4F21A 1EIZA 1LKZA 1T24A 1WOYA 1T15A 1H23A 2VTVA 2ZUUA 1MO2A 3L7CA 3QV1A 1DQRA 1L1QA 3K71B 2B92A 3T9FA 4MHTA 1EUZA 3IUNA 1E4EA 4G07A 4WK4B 4YFVA 1AZLA 1VMKA 1QPGA 1UC8A 1I13A 3FTPA 3MTDA 4P0QB 4KRXA 1Q17A 4S1NA 1FW6A 1X7ZB 3SG0A 2P2DA 4IKEA 1LJUA 1RBMA 4P82A 1G2PA 2QAGB 2PS3A 1QC5B 2J85A 3OF5A 1QORA 4JOCA 1NRIA 1LBEA 3R5JA 2G08A 3ADDA 1LDMA 3SHOA 3GIWA 2O4CA 4ZC8A 2YIVX 4F8YA 5CGZA 2G71A 4MGHA 1UP7A 3DONA 1BE6A 1U1IA 2IH2A 3FKSD 4FWIB 3JQQA 3WWEA 4I4IA 1UDCA 2GILA 2P4QA 3BIXA 4H0NA 3RVJA 5L51A 3THRA 3RTDA 4D57A 2OCPA 3L0PA 4WK2B 3M1LA 2FF7A 3ZK8A 4UUQA 4CMAA 3VNAA 4WEQA 5A6SB 4FYVA 4RPCA 3NEPX 1DRWA 3UCXA 3ZBTA 2IUYA 3CKKA 4E70A 2WD7B 4WKOA 3CGWA 4W9RA 2C88A 1LSSA 3GLHE 5JCJA 4U6QA 4MRNA 4YJ3A 2F3QA 5AUOB 3W5JA 4LGYA 1KQGA 2AV6A 2J09A 2OC4A 1PYGA 2QPLA 4UOZA 2VNAA 5CLHA 3BICA 2JPDA 5BOSA 1C0EA 5F1PA 1MH9A 3K5PA 4KAJA 2PD3A 4H4CA 3KQHA 2P9JA 3EK2A 2C04A 4DEVA 3A2KA 2JFPA 1A5ZA 4YAWA 5LQDA 5DASA 2IYSA 2CVHA 2A67A 2GZ1A 2HF8A 3NBAA 4PC6A 4ZKEA 1GU1A 3E3LA 1NSFA 2FGKA 1RQNA 1NLZA 2R60A 3FBWA 3ON5A 1KQFA 3QFRA 1B74A 5FHRA 1Q7CA 2JI8A 4MS4B 1D2CA 3L43A 1W48A 4H0CA 2IE8A 3IHWA 1FTGA 5K6RA 1YA8A 3U7QB 3ODGA 4JJAA 5IM4A 1GNLA 2G9ZA 1MV8A 2J4FA 1FUEA 2Q21A 2VZ9A 4UUNA 1JFLA 3UJPA 1VE7A