4B9EA

Structure of a putative epoxide hydrolase from pseudomonas aeruginosa, with bound mfa.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
297
structure length
297
Chain Sequence
DPLLPGFDYLTLHTSAARLRVAVKGSGPPLLLLHGYPQTHLAWHRIAPRLAEDYSVVLADLRGYGESRALDEEGADYSKAALARDQLETMGQLGFERFAVIGHDRGARVGYRLALDHPQAVAAFVSLTVVPILDNWAAVNKVFALNAYHWFLLAQPYDLPERLIGADPEHFLDYTLRRMAQGRDIYHPQALESYRRAFRDPAVRHAMCEDYRAAVGVDADADQADRDAGRRLQCPVQVLWQERPYAAGQHPLEIWKTWAGQVEGAAIGASHMLPEDAPDAVLEHLLGFLASHREALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Aeropath Project Targeting Pseudomonas Aeruginosa: Crystallographic Studies for Assessment of Potential Targets in Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Hydrolase
molecule keywords PROBABLE EPOXIDE HYDROLASE
total genus 114
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4b9eA00
5JD6A 2QXTA 1QONA 5EIAA 3O0DA 2OAEA 2C5FA 1R50A 3R40A 1E5TA 2WFZA 3I2HA 1XZDA 2CBGA 1RP1A 2XE4A 4H35A 1UKCA 3DKKA 3UUFA 4EA6A 4CFSA 3D2CA 4DNQA 2VJDA 4V2IA 2V96A 1QIHA 1XZCA 4G1FA 4M0FA 4MWTA 5ALQA 2WJ3A 1WPXA 1QIJA 4KRXA 5AH0A 1CIJA 3VXKA 1U2EA 4BDTA 2O2IA 4KE8A 2WUEA 3WKDA 1WHTA 1ZI6A 1ZI9A 1SFRA 2O7RA 2JGIA 3RARA 3R3YA 5LP1A 1H2ZA 4F21A 5IVDA 2WJ6A 5JANA 1CUAA 4RGYA 5BV7A 2ROQA 1FJ2A 3LS2A 1HDEA 4WJLA 3F98A 3ICWA 1C7IA 5AM2A 2XUJA 1VKHA 2PSDA 1IZ8A 2XMRA 4Q3LA 4BVJA 6YASA 1J1IA 4AMZA 3R3XA 2ZVDA 4N8EA 1XRRA 1X2BA 1ISPA 1ZJ4A 5A62A 2OCLA 3HI4A 1FSSA 1PV1A 5JATA 1MNAA 1XKTA 2BJHA 3H1BA 4GLBA 1TKRA 4QA9A 5AK6A 1W4LA 1FFAA 4Q3OA 3I1IA 3F97A 2QUBA 4BAZA 1YB6A 5CH3A 4EZIA 3G0CA 2VA9A 5CXXA 3SK0A 3WL8A 2O7VA 3FVRA 3OG9A 3R3UA 4BE9A 2QZPA 4U2FA 5HCUA 1UOOA 2Y2VA 4HTAA 5LYYA 3C43A 4DSAA 5JZSA 4XWGA 2C0PA 3FWHA 4MJ3A 4H7HA 3C8HA 3HJUA 4G9EA 5LZ2A 3PF9A 1EI9A 2QR5A 1THGA 4DNPA 4BC0A 5T4HA 4DYHA 1Y37A 4DTCA 3B12A 4J0HA 1Z68A 5DWDA 4B85A 3C87A 1EDEA 4U2DA 5DTIA 4B0PA 5LLSA 3SC2A 3I6ZA 3VDXA 4UBNA 3I2GA 1QIEA 1LPBB 3C6YA 4QDTA 5JALA 1C7JA 3WL6A 3HZOA 4XVCA 4O08A 4UHDA 2XLBA 5I8PA 2Y1KA 3JYHA 4Y9SA 4IHAA 3RM3A 4UBIA 3F96A 4PO3X 3JW8A 2WHPB 1CLEA 1S8OA 3H19A 1ZICA 3I6YA 1TCCA 2QM0A 2JBWA 4NMWA 1U4NA 4OCZA 4KEAA 1D07A 4UHFA 5KWJA 2Z3ZA 1YCDA 2VJAA 4QE3A 4UUQA 1J07A 1Y7IA 1TCBA 4XJVA 3TGLA 5CH5A 1ODCA 4UBLA 1K4YA 2ZYIA 5YASA 2WJ4A 2QMQA 1O6FA 5ALHA 3MUOA 3BL8A 4I19A 3WWCA 1BROA 4RNCA 4U2EA 4I3FA 5LZ4A 4BYMA 1ZD5A 1RYYA 2OGSA 3WA7A 3UUEA 3FCYA 3WK4A 2WTMA 4DM7A 1P0MA 5CT4A 3WK8A 3OTQA 5DNWA 3T4UA 4QNNA 4X6XA 2B61A 1KEZA 4DMFA 1QLWA 4C6HA 5ALFA 1OXMA 3SX4A 1CQWA 3WL7A 1F6WA 3WZMA 2WU3A 5FOQA 3G9ZA 4J3JA 1YAJA 3HEAA 1WB4A 3ZI7A 5A7HA 1UOQA 1BE0A 2JIDA 5FXMA 3E0XA 4BTVA 4FMPA 1G66A 1CUWA 1MAHA 5AKHA 5AM5A 4WFKA 4LXIA 2QJRA 1LZLA 4LXHA 3V1LA 3ZLTA 1LLFA 4X93A 4ZWNA 5CT8A 5AI6A 2OQIA 5EIHA 3FOBA 4QDZA 3RLIA 4CIAA 4B80A 1KU6A 3FVTA 2PVSA 4BZZA 2GBGA 5HQ3A 4BCCA 3EQ9A 2G63A 5JAOA 3QMMA 4G4IA 4B82A 1GT6A 1ZD3A 1HBJA 1NU8A 2EEPA 2HADA 2AJCA 2XUHA 2HA3A 4G4JA 3WL5A 3A2NA 1GQRA 1CUZA 4G4GA 5EFZA 1C4XA 2ACEA 4ZXFA 3CN7A 1QTRA 1XLWA 2CZQA 1XQWA 4TPKA 2JGFA 2DHCA 2VAVA 4UFPA 4UFNA 1OCEA 2J4FA 4EY7A 2FJ0A 1WHSA 4L0CA 4CG2A 1AURA 1W6RA 4H18A 1OILA 2WHRA 2BGNA 2JGKA 2C7BA 1LPNA 3AILA 2RGUA 3G9UA 5D7BA 1R4ZA 1SCKA 4AO6A 1DWPA 2HL6A 3NUZA 3O4IA 3LLCA 1R9MA 2X8BA 1MPXA 1VA5A 3Q0TA 4MEBA 1XFDA 3WK6A 2PSEA 4YPVA 4JYPA 4UHCA 4BBZA 1QIGA 4FDMA 2I78A 1IMJA 3C6BA 5J3JA 1JJFA 1TQHA 2WM2A 2CUTA 4F5ZA 4WFJA 3WIOA 3P2MA 4Q34A 3V1NA 4BCBA 2IITA 2GBCA 3G0GA 3E3AA 3IBTA 1O6GA 1R3DA 5ALUA 2AJBA 2OGZA 3I6MA 3FLAA 1IUNA 4CCYB 1MX5A 4OSEA 5HFNA 5DLPA 1G42A 5AI9A 4OB7A 1BCRA 2HRRA 4H77A 3W9BA 5ALTA 2XQJA 5ALRA 1F0NA 4AO7A 1A8QA 2XUKA 5JAHA 1YS2X 1UT6A 5K3BA 4H7JA 5EHZA 1CUEA 4Q1VA 4BVKA 3UMJA 5JIBA 2WUGA 1EA5A 2PU5A 1R1DA 3WI7A 4MQMA 5ALKA 4J03A 2GYUA 2J4CA 1E8DA 1E3QA 2H7YA 2AJLI 2GZSA 3N0TA 4U2GA 1LPPA 4GDMA 4QWWA 1Y7HA 5AKZA 2WQZA 4EUSA 2QRUA 1CEXA 4H7IA 1EXWA 4Y2JA 5EI5A 3KD2A 4J7AA 5AKIA 1JJBA 2HHAA 3T52A 5DTJA 4KYVA 5FKJA 1MAAA 1CFJA 3LP5A 1EK2A 4RPCA 2WIFA 5LIPA 3QMWA 2VATA 3WJ1A 1YA4A 5JARA 3FCXA 5ALXA 4Y2RA 2AXEA 4E11A 1HQDA 1YASA 3R3ZA 3QM1A 3NWOA 5AI0A 5CBKA 2XMDA 2BUAA 1JJIA 5BWBA 2OCKA 4HAIA 3WWEA 4BRSA 3BIWA 3WLAA 1VZ3A 4BB0A 5CXUA 1T2NA 1N5MA 2QT9A 5ALNA 1CUDA 1G4HA 5AKGA 1Q0RA 4X71A 2XT0A 4W1QA 2VAXA 3E1GA 1K5PA 3PDCA 4OD0A 3STWA 1AZWA 2GBIA 3HYSA 1DTEA 5E2IA 3FYUA 3IUQA 1XZLA 1CUGA 3R3WA 2G5PA 1NX9A 2IX9A 4FFWA 2WG1A 1B41A 3FLEA 4AZ0A 3DQZA 2HA6A 3C6XA 3BWXA 4DMKA 2HA4A 4BP8A 2VQ6A 2QUAA 3OPMA 1VLQA 4C4ZA 3O9MA 4B9AA 3STXA 2VJBA 1EK1A 3DJYA 3I1YA 5E4YA 1QE3A 4HXFB 1XRMA 2G5TA 2PSJA 1EH5A 1MX1A 3WWPA 1ETHA 1IUPA 1XZBA 1J2EA 3H2HA 1WOMA 4OYLA 5F4ZA 3DL7A 2YASA 4BATA 3K9BA 5IKXA 4E14A 2BCEA 2XUIA 1ZGBA 2XUFA 1JMKC 3PUHA 1JU4A 3HACA 2OG1A 4NVRA 1HPLA 4WY5A 1XZKA 4J0IA 4BP9A 4C4YA 4HZGA 1L7RA 2FUKA 1BCSA 4LHEA 2JGMA 3D7RA 5ALOA 2R11A 4X6YA 3WMRA 5D6OA 3CCCA 3W04A 5K3DA 2RAUA 1UXOA 1DX6A 1DT5A 1W1IA 4TGLA 4MEAA 4P93A 3O4JA 2RHTA 1VE6A 2B9VA 2Y6UA 4CI9A 4Y2TA 1TCAA 3EQ7A 1Q0ZA 2VEOA 4A16A 3ED1A 4LYEA 3LIPA 5D3ZA 1TRHA 1QTIA 2HRQA 5AIBA 3B3QA 3GFFA 3PI6A 4H7DA 4QDUA 4GWLA 1ZI8A 4UFOA 5C8VA 5CRIA 3M3DA 5HK9A 5JADA 3BF8A 5K3FB 3OC0A 3H2IA 2WHQA 4DNFA 4X90A 1W76A 4YX9A 1VXOA 4L72A 3L1JA 3ZLVA 5AKKA 1BEEA 4FBMA 3R0VA 1ZIYA 3W05A 1MNQA 4X7BA 5T4FA 4E46A 3IURA 3DLTA 1H23A 2HA2A 1H2YA 2CJPA 1MTZA 4J0JA 5FPPA 3RKSA 1UWCA 5HF8A 4BE4A 4CCWA 4MYSA 1THTA 3HC7A 4Y2QA 4QZVA 4KRYA 4EB0A 1GZ7A 3A2LA 1SOMA 5I7UA 3BXPA 5EHQA 5ESRA 3C5WP 2I03A 1EHYA 4PF1A 4WDRA 4ARAA 3GELA 5IVIA 1WCYA 3BF7A 3WK7A 2RIPA 4DMHA 5AKYA 3O95A 3A6ZA 4GEGA 1K63A 4OB8A 4Q3KA 3IDAA 2DR0A 1JMYA 4PSUA 1U65A 1AQLA 3ANTA 5IH7A 1U8EA 3TEJA 4ZREA 5ALSA 1A8SA 2J3QA 4QDOA 1FFDA 3WWOA 1QO9A 4G8DA 2H1IA 2O2GA 1XZIA 2JF0A 5E4JA 3KWFA 1CR6A 5LKAA 2OAGA 2DFPA 4H7FA 4BRZA 1UK8A 2HU5A 2I3DA 2AJ8A 3NOXA 2XUQA 5DNUA 2QS9A 4LXGA 3G0IA 1BS9A 5EHXA 1CUYA 1MO2A 5CH8A 3SWWA 5D3KA 1ACJA 3DOHA 3HABA 1QIFA 2IIVA 3AIOA 1ZD2P 3D3NA 4HRXA 2VJCA 2WG2A 2J3DA 2XLCA 4INZA 5CW2A 4J0DA 2XMQA 5EHNA 5AIAA 3FNBA 4HS9A 1QFSA 2WUFA 5FV4A 1IZ7A 5HKBA 1K6EA 4X6UA 1LPOA 1W75A 1ZOIA 3BE8A 2ONCA 1R88A 2XMSA 1XZJA 4P08A 2Y6VA 3PFBA 5LKRA 1YS1X 5HFAA 1VZ2A 1X2EA 3FSGD 4BDSA 3QVMA 2NW6A 4W1RA 4FNGA 2FJPA 1IVYA 3H17A 2HIHA 1R9NA 4AB1A 4PW0A 5ALLA 3GA7A 1SC9A 4HVTA 3STUA 1ZGCA 1CUJA 1MX9A 4A23A 3M82A 4CG1A 3V1KA 2Q0XA 2Y2UA 3L1HA 4GXNA 1IUOA 3C6ZA 3QMVA 4AX4A 4BZWA 4EY4A 4X00A 5CT9A 5AOBA 4UHEA 2C5GA 2VSQA 2ZYHA 4UBMA 1CUUA 3F8SA 4ROTA 3EBLA 3DCNA 3EF3A 5KREA 4ZGBA 1QO7A 4U2BA 3WQHA 3PF8A 2BGRA 2W22A 3CN9A 2XMBA 2LIPA 2XQFA 3STVA 5AHXA 3I2IA 2CMFA 5JZBA 5LZ8A 1XRPA 4U2CA 1FFEA 3HXKA 4H7EA 5T4EA 4ZV7A 3DKRA 5ALEA 5CMLA 4CG3A 2WU4A 2XQIA 5CT6A 1CUIA 1L7AA 4KE9A 4KJXA 2OGTA 1MJ5A 5FRDA 3S8YA 5ALYA 2V9ZA 1VOTA 2PSHA 4DMCA 1QJ4A 4QDXA 1EX9A 5K3EA 4FNMA 3H18A 5AK5A 1EB9A 3G8YA 4N8SA 5HK8A 5HZGA 4B0OA 4IH9A 3PE6A 1N8SA 3OM8A 3AJAA 3BJMA 5A71A 1DINA 3WKBA 2XMCA 2WIJA 3E4DA 1E66A 4OU4A 4FKBA 4AZ3A 4ZV9A 2XUPA 4JYMA 4LIPD 3VVLA 1EDDA 1MN6A 1VJ5A 1XKLA 4K2AA 2ECFA 1YA8A 2QTBA 2WKWA 3VJKA 2XUDA 5HQ3B 2DQZA 5IVHA 2XUOA 2QJWA 3VKFA 3C5VA 1T4MA 3WKAA 5SYNA 3DS8A 4X91A 2ZJ6A 4TVKA 4YK7A 2QXUA 3KDAA 2QVBA 1GKKA 3D0KA 2PX6A 1XROA 4QEKA 5ALPA 2DQYA 2XI4A 2V98A 5IVKA 1HKHA 5DNVA 3M83A 3WJ2A 2WG0A 5AP9A 2WFMA 3S2ZA 4HXEB 3G0DA 4Y2XA 1B6GA 4PNZA 3ESCA 3QZUA 1NU6A 1LPSA 1UKBA 1SCIA 1BEZA 4K6KA 5K3FA 1ORWA 5ALJA 1H2XA 3MVEA 5DYWA 5AK3A 3PUIA 4OPMA 3I28A 3ZV7A 5A2GA 4FTWA 1DWOA 1ZD4A 4C88A 1WB5A 4FLMA 3HSSA 2E3JA 2XUAA 3AZOA 3HLKA 2HA5A 4X92A 4JUIA 4N5HX 2EDCA 4C87A 5BOVA 5C81A 5LZ5A 2XQKA 2WTNA 2YYSA 3EQ8A 3C70A 1XRQA 3BDVA 5AJHA 2XMZA 5FLKA 4B9EA 4MQLA 1YB7A 4C89A 2WIGA 2GYVA 1AX9A 1DQYA 2C58A 1CUFA 1J06A 4AMYA 4MXDA 4PSDA 2WUDA 4LYDA 4WDQA 1XQYA 2H7XA 3R3VA 1MU0A 2OCIA 1UZAA 1XLUA 3OOSA 4W1PA 5LZ9A 5AM3A 2ZJ7A 1CUSA 2XQGA 2ZJFA 5AOAA 1E8NA 1XLVA 3D59A 3MUNA 4EY8A 1F0PA 3AIMA 1UFOA 4PV7A 3NGMA 3H1AA 3TRDA 4JEIA 1EDBA 1GPLA 1LZKA 1CUHA 4X94A 2VT7A 4ITVA 2PSFA 3ZPXA 3DD5A 3A2MA 4KE7A 1QIKA 2OCGA 4W9RA 4NZZA 1LBTA 4QWMA 5E4TA 3STYA 3DEAA 1CRLA 2RONA 2UZ0A 4IH1A 1CVLA 4IQ4A 1TAHA 4X3CA 4L3WA 2XMGA 4J0CA 3IULA 3FYUB 1JKMA 2C4HA 3FSGA 3AZPA 1QIIA 3KXPA 5HF5A 3QPAA 2VT6A 5HF6A 2Z3WA 1LNSA 2JEYA 3QBJA 5CT5A 4Q82A 2ZYSA 1XRLA 2BKLA 2FX5A 1BN6A 4M0EA 2Z8XA 1CUCA 2GZRA 3MGAA 1G5FA 2ZSHA 3O4GA 4IH4A 2OPHA 1ACLA 1I6WA 3STTA 5FPQA 2ORYA 3ZWQA 5EGNA 5H3HA 2QKYA 4AXBA 4UHHA 2JGJA 4DGQA 4WY8A 3EIOA 4I4CA 1XZMA 4OUKX 4EY5A 4XIIA 5SYMA 3WWDA 5ALMA 1P0QA 4LKOA 2JEZA 3L1IA 4GW3A 4HRYA 3F67A 2XUGA 3VJMA 4J0GA 1XZGA 5AICA 1GQSA 1AMNA 5DYYA 1W52X 3WKCA 2C0QA 4KE6A 1WPRA 3DOIA 3G02A 3WYNA 2W6CX 3FBWA 4X95A 3KSRA 3WKEA 1TIBA 2DHEA 1EVEA 5KBYA 4BAGA 2HFKA 3WIBA 4B81A 4FFVA 1ZJ5A 3LIIA 1AC5A 1UK9A 2WILA 5AO9A 1Q83A 5AOCA 1CPYA 3C8DA 4W1SA 1AKNA 2JGLA 1LPAB 2D0DA 2RHWA 4H7KA 4CIBA 2YH2A 4P9NA 1WM1A 1K8QA 3ANSA 4Y7DA 2JGEA 2WIDA 1E89A 1BN7A 3O4HA 4G8CA 5T4BA 4FOLA 2ZYRA 1FFCA 3IVMA 2PL5A 2ZSIA 3VVMA 2QOEA 4N8DA 5ISMA 3N2ZB 5K3AA 5LZ7A 1JI3A 3TJMA 3G9TA 3G7NA 5AKEA 1DX4A 1PJAA 2HA7A 1H2WA 4RE6A 1KU0A 2PUJA 3DYIA 3QYJA 1DWQA 4H0CA 2Z5GA 5ALZA 3LCRA 4JNCA 1QIDA 4EHBA 3KWJA 4BTLA 5FUMA 1LPMA 1A7UA 4N5IX 1PFQA 2XB6A 3WZLA 3CXUA 3JWEA 4CCYA 3OURA 4F0JA 4DNOA 4Y2SA 4ZI5A 5JZ9A 5AM0A 1ODSA 4UBKA 4C01A 1DQZA 4AN0A 3G0BA 3U1TA 4QLAA 4KAAA 2DCMA 2BAGA 1VA4A 3H2JA 4P92A 3GROA 1A8UA 2P8SA 2OLEA 4J0KA 4Y2PA 3M81A 5ALDA 2WLSA 1SCQA 3DYVA 4S0XA 1XZEA 3GBSA 1X70A 1XQVA 1ZIXA 4KACA 4DSZA 5JD5A 3QPCA 2H9YA 4KR0A 1QFMA 1Q84A 2DHDA 2PM8A 2D5LA 3RK4A 5KWIA 1QGED 4K6GA 2CEKA 2R8BA 4A5SA 5FP0A 5JD4A 4Q05A 1ODTC 2XDWA 3ESBA 4OU5A 4OYYA 1E8MA 4JH0A 3IIIA 3IUMA 4G9GA 5AKJA 1RWQA 4ARBA 4X85A 2RI6A 2WHPA 5HKAA 1GKLA 3VJLA 2WSLA 3PICA 5CURA 5ALWA 3K6KA 5K3CA 3BJRA 1JT2A 2CKMA 1UKAA 4Y2VA 1A88A 4MYDA 1H22A 2VF2A 5ALGA 3GZJA 1CUXA 5HF9A 4M0MA 1GGVA 2I3ZA 2HDWA 1QIMA 5C7YA 1QZ3A 4OB6A 1EINA 1USWA 5AI5A 4B7ZA 1TK3A 1UK6A 4K6HA 5A6VA 2HA0A 3BIXA 4IO0A 3X3HA 4FHZA 3H2KA 3F9CA 1HLGA 3W2TA 2Z8ZA 1JFRA 3DDUA 3QITA 1CUBA 4PSCA 4DLNA 3FLBA 3Q8WA 3VISA 1XQXA 4YASA 2GYWA 5JAUA 1N5RA 4BAUA 4UHBA 2BUBA 4UBJA 1WB6A 3AUKA 4UPDA 1CUVA 1JU3A 1VE7A 3QPDA 5A7GA 1DU4A 3H0CA 1VXRA 5DJ5A 2B4KA 1MT3A 2VTVA 1AGYA 4AN1A 1M33A 5I9IA 4B6GA 5AK4A 1ORVA 2PU7A 1EVQA 5DYTA 4HXGA 3WA6A 1CV2A 1LGYA 3I2KA 2WFLA 5AKXA 2PBLA 1N1MA 3WK5A 2YXPX 1L7QA 5AM1A 5AM4A 2GBFA 4Z49A 3CCBA 3K2IA 3DNMA 3KOOA 3FYTA 4X97A 1XRNA 3H04A 5C8ZA 1BU8A 1P0PA 5JASA 1XZFA 3FYUC 4WFIA 4AQDA 4BC1A 3DL4A 2X76A 3ESDA 3I2FA 1LBSA 3AZQA 5AI4A 5FDFA 2HFJA 2ES4A 3ZLUA 4AO8A 7YASA 5AI8A 2CB9A 2HU7A 3HRHA 2B20A 1XZAA 1FFBA 3IA2A 4GI1A 1GXSA 4GHWA 5A7FA 1XZHA 4Y2UA 2BUCA 1QOZA 4NS4A 3YASA 2PKYX 2OQVA 4BCDA 2H7CA 4Y2YA 3IUNA 4KAFA 3V48A 1GPKA 2EDAA 5BWCA 1DT3A 5K5EA 1YAHA 4PQEA 2HM7A 4MWSA 3V1MA 4BVLA 2V97A 4DIUA 4FLFA 3C45A 4F60A 3ILSA 5EIEA 4ZRDA 4B84A 1YSCA 2PUHA 4FBLA 3D5EA 1P0IA 1YR2A 1BRTA 3W9UA 3FAKA 3WYDA 2ACKA 3PFCA 3U0VA 4RE5A 2WFLB 3R41A 3IB3A 2DSNA 3IUJA 4E15A 1EB8A 4GBGA 4EBBA 4XX1A 3QH4A 2K2QB 3G9XA 4K5QA 2BFNA 1F8UA 3I2JA 4KAJA 3A70A 3V9AA 2AJDA 1AUOA 4B83A 2G4LA 4C4XA 4L9AA 1UOPA 5JYCA 4W63A 5CTAA 1UK7A 3D2AA 5JAPA 3W06A 5AKLA 2X5XA 3ICVA 3GUUA 2WIKA 2OXEA 4G5XA 4GECA 1GPNA 2O2HA 2HU8A 4ETWA 4G8BA 3AINA 1HL7A 3D2BA 3WK9A 4EY6A 3H2GA 3AIKA 3BDIA 3O9VA 5ALIA 4D9JA 5ALVA 3D4LA 4WCVA 5C8XA 2PPLA 1CQZA 4QLOA 4FLEA 4UBOA 3AFIA 3B5EA 3ESAA 4FWBA
chains in the Genus database with same CATH superfamily
2AR7A 4NCJA 2BEWA 2KJQA 3G88A 3HB7A 1NPTO 4RESA 1ZNQO 4ZO7A 1BU5A 3ENNA 1P2VA 2AOUB 2XWBF 2YJGA 4QJ4A 4K0RA 5EJ6A 1XN1A 1Y3CE 1BQ3A 2Z2KA 3HMQA 2IP1A 3LUKA 2C94A 5E6RA 4AJIA 4DV7B 4TWAA 3PCTA 3RTCA 3TZCA 2SCUB 3NHBA 4FKMA 4UM7A 5HJ2A 5KYKA 4D9FA 1JFFA 1ZNZA 5JSQA 1SUEA 4FJ0A 3EIEA 3H1GA 2XE4A 3G68A 4M1WA 4NBWA 1C7FA 3BK1A 1PFWA 3O7WA 4H35A 4QL3A 4RTNA 4QJBA 4ZVPA 3UUFA 5BMVF 5UKDA 1XLTA 2PHZA 4CFSA 4ZN6A 1CHNA 1PK7A 3PNSA 4RETA 2YHSA 3JD1A 3S2IA 3ZD9A 4D44A 1TK9A 4X0EA 4AIRA 1CP2A 4WK2B 1PBNA 1GRNA 2XT9A 5K0BA 1UXGA 1XWFA 1PFKA 3IAS1 2WHYA 4I1YA 4EP1A 3EXHC 2Q1TA 4HFJA 3GJ7A 4G1FA 5LOVB 2QNRA 3REFA 4M0FA 5ALQA 4UE3S 2B30A 1EX6A 3OTHA 2O8EA 5I7SA 1FU8A 4ZGWA 1QK5A 2DSTA 2WJ3A 3NWBA 1WPXA 2CXTA 4DQ0A 2PV0A 1K2WA 1ZUNA 4HP8A 5AVKA 4M7PA 2OXFA 3QE4A 3AUUA 1E9DA 4JUBA 5DM2A 3MQFA 1AS0A 3U31A 3L9WA 4J1SA 3GJ3A 2DY0A 2FV8A 2CL0X 2QYTA 3JAKB 2FQ1A 1DC8A 4KIJA 3ZY5A 3WKDA 3AR6A 5DN6A 2PH3A 2IS2A 4Y1FA 1QCCA 1TZBA 1AQIA 1ZN9A 2JGIA 2R8RA 4ZCMA 1TAUA 1XTIA 4HGNA 5LP1A 1Y34E 4F21A 2NUAA 3DG9A 4ZK6A 5C1DA 4LTDA 1K8RA 4FDUA 3LY8A 3KVNA 3SF0A 4LISA 1E2UA 2JAHA 2ZXFA 3KTFA 4AY6A 4MDFA 5BV7A 2H06A 1FJ2A 3H87A 2AK2A 2YV5A 2HV8A 5FLEX 4IUYA 4PZPA 3F98A 4JIGA 1C7IA 4XTRA 2PSDA 2WOJA 3CLRD 1R9GA 2H08A 2VSYA 1IZ8A 3H9QA 4HEHA 1T15A 4MVJI 2ZJ1A 4Q3LA 5LQUA 3B20A 4BVJA 4K2HA 3RSFA 2V5UA 3NHSA 1J1IA 5E7IA 2FR8C 1OD6A 3QX8A 2NYVA 4ZYYA 3R3XA 2ZVDA 4GVLA 5TQ2A 4F4IA 4EQ6A 1HG1A 1X2BA 3OPYI 2OCLA 4FOTA 5CP8A 4QYSA 1NULA 4AF6A 3TPZA 1P60A 2CFTA 1KZ1A 1ONSA 4Q03A 3W6ZA 1CXZA 1FXSA 1CQJA 1H3EA 1NOKA 3BXEA 5ILGA 1PV1A 4AY4A 4Q5IA 2RJ3A 1G1AA 2A9KA 2BJHA 4B3CA 1C8VB 5FUVA 3CLTD 1K97A 3FMOB 3KYCA 1KI6A 3IT0A 4G5GA 4LBVA 4FD2A 4WVLA 2AX3A 2EARA 5DLEA 4BMNA 2P9GA 1Z2CA 4BNVA 3VTAA 5AK6A 4D4GA 4ECAA 1W4LA 1FFAA 4Q3OA 4QXPA 2GWHA 5LQSA 2PD4A 4DRZA 2QUBA 3BFKA 5JQWA 3I37X 3QW2A 1C8LA 4FGKA 4GOOD 3UYLA 3PRHA 5E0KB 1T1EA 3IJRA 5CH3A 2JI9A 4AG5A 5C9ZA 3FMGA 2NPOA 3D7SA 2O7VA 4IUDS 1ETUA 3OG9A 5ESDA 1PDWA 1PTJA 3R3UA 1VFNA 1AKRA 4GYWA 3VRHA 1GN8A 2X7XA 1NUUA 4KXVA 4U2FA 4ANFA 5I9MA 4RF2A 1W94A 3OF3A 4P22A 3PPXA 1AA9A 1ZCFA 3CV3A 4OA5A 4ACBA 1QG6A 3QEBZ 1U81A 3U09A 2HJWA 2QLFA 2AG6A 5B7GA 3EGCA 1GD1O 4AAYA 3LUHA 2JLXA 2NIPA 4RTLA 3I12A 1RLTA 4IDHA 1XAJA 4XJXA 5JC8A 3QE9Y 4HTAA 2IA5A 1U28A 1E9SA 3LXXA 3CBGA 2H2DA 3EUWA 4DMMA 2VIIA 1T8SA 2OZEA 1D4OA 1XDBA 2ZT8A 3C43A 3QXCA 1W36D 5CB4B 1ECCA 5T64A 3HKDB 4XWGA 3TQIA 3OQ1A 3BRQA 4J7CA 2Z6AA 4EITA 4JBGA 4MJ3A 1NWHA 1Z2NX 1XMOB 3OWXA 3BXFA 3PTLA 4G9EA 4XKJA 5LZ2A 3PF9A 3B6KA 3B6MA 3A4VA 1CNMA 1EI9A 2QR5A 3KLMX 4L8WB 1AHIA 4DNPA 1WF6A 3LY9A 3KC2A 4R0NA 4ZU1X 1WUHS 3PI7A 1QUFA 2ATVA 3AF3A 4IYJA 1C3XA 3UT6A 4B6EA 4DJDC 4DTCA 3AUAA 2LKDA 4WBNA 3MTGA 1T4BA 4NHOA 5SZJA 3U4AA 3ZHVA 2CV1A 2VCHA 2QN7A 2PUDA 4EGAA 3QG1A 3CG0A 2C2OA 4LVCA 1ZFNA 2J0EA 3DH0A 3IIEA 4MYUA 3VDRA 4GVPA 2E0IA 2WM8A 4PC1A 3GJ0A 4YCDA 3UGTA 2NZXA 4BO2A 2IYOA 2XWQA 2PMEA 2J7PA 4PVCA 3S7TA 3K8QA 1XHLA 1KAQA 3T7JA 4DXDA 3NM4A 1LX7A 3B38A 4BVEA 3R5XA 1IZZA 1FX0A 1MXFA 5DRTA 3VDXA 3HWX1 1Q7BA 4M89A 2P4UA 5IEBA 3WLNA 5I51A 5LMUB 3VNVA 2V5VA 1X80A 1TZJA 2PYDA 3EC1A 1PIWA 3C6YA 3CZ5A 4RENA 2X3UA 4YJ3A 4DVJA 2C8LA 5JALA 1EVJA 2Q4OA 3OIUA 2CK3D 2P3SA 3T9EA 1LSUA 1LV7A 4XVCA 3ZDYB 2OMEA 4G01B 3RS9A 2ZIWB 3LQRA 4JR0A 2QMZA 4ILKA 5JVDB 5I8PA 4EZEA 4X7MA 1UJMA 4Y9SA 1DC4A 5TPZA 3JATB 5A9SB 2V6MA 4N6GA 2Z2ZA 2XJ4A 3KQYA 3I6IA 1VLLA 3U4CA 3SJBA 1RFLA 4CR7A 4KR7A 3ZE6A 4P0QB 2Q5QA 4FEYA 1UC9A 4PO3X 5DI9A 4RU1A 1XP8A 4Q7QA 1NXSA 3ND9A 1MRSA 4QYXA 1S8OA 2HIAA 3BGOS 2J6HA 3H19A 3I6YA 5EQDA 2Y0DA 2UZIR 4PM4A 1GGJA 3S8EA 2YW2A 1YACA 3GLHA 1S8FA 3GUVA 2IXBA 4ZC8A 1V45E 4S3MA 2MOKA 4G1UC 1K06A 1XAGA 5BYJA 2FMKA 3BIJA 3CSSA 4NMWA 4HN4B 2RKWA 4A8PA 5ED0A 2FN3A 4CR6A 1ZNXA 3HR4A 2XNSA 1JHOA 4OCZA 5J5VA 4BOYA 4BFWA 4ALJA 4C2AA 1BKSB 1T1IA 1QZZA 2PDAA 4MUBA 3FTDA 2CF6A 4WGFA 5FJIA 1JEQB 1D7AA 1Z08A 3RSOA 3RV3A 5KWJA 4EHIA 3NIWA 2AE1A 1XEWX 1K2VN 3I5AA 2A7XA 1XK6A 2OOKA 2X9LA 3D6UA 3OD1A 1NNEA 3ODPA 2YN0A 4XEUA 3NCHA 3O26A 1GTVA 3DAGA 4LTNA 5K2MA 3U48A 5HRCA 3WBJA 1BMQA 2DH6A 1KMHA 5EZYB 1TCBA 1THZA 2OZPA 4QECA 4XJVA 2ODEA 4O4HA 4HSEA 4DR1B 1EWRA 3DT8A 3IRUA 3UV7A 2JLQA 1PLKA 3KLOA 4JUFA 3VSBA 2BDTA 3EWIA 5E2AA 4JD5A 2QD1A 5KYUA 3UAWA 4EX7A 1K89A 4J94A 3IUYA 1ENYA 1Z18A 3RVBA 1KOFA 3NBYC 3OT1A 2OHGA 1LV8A 3MB8A 2VK2A 2ZIFA 2HH9A 5DU2A 2ZWPA 1JXMA 1X0XA 1NQXA 1YQQA 2HEIA 3OZDA 3SYRA 1BFUA 4KWIA 3RV4A 4CI0B 2NSLA 1JQKA 3EK2A 3KQLA 2H00A 3KXLA 3H9EO 4AJEA 4CKWB 3P9XA 3UOAB 2YQ5A 4AL4A 1QQTA 2JA1A 1U6JA 2X1HA 5CVCA 3ILHA 4Z0PA 3QNWA 1M7HA 3TW8B 4F6RA 5G4KA 1CDEA 3RT7A 5A4AA 2P0EA 3QPBA 2GD0A 4JOQA 2PWPA 4AZ0B 1DXHA 3WK8A 4FMCF 4BWGA 1DG9A 2Z6VA 5JH7A 1SBIA 221PA 4QNNA 3ZS9A 1KI9A 3A0UA 3U7QA 5KSYA 4CG0A 5EMHA 1CC1S 1PKXA 4FOSA 3I09A 1YC5A 4KQIA 4CKCB 2XUZA 5D84A 2JBAB 2W0MA 2R85A 4J16A 4DQXA 2H5LA 5IH3A 2VJYA 3DPUA 4WKOA 3ETGA 4QU8A 1UBLS 1P39A 1C7ZA 3RTEA 3NS7A 4MS4B 5F5NA 4EKEA 2OWEA 3HCPA 4KQKA 3FI0A 1L7DA 4KFCA 3V55A 4PNHA 3KZNA 3IE2A 1YL7A 3ME5A 2NYRA 2DFVA 1YAJA 5KYYB 4ONEA 4EVQA 3C39A 3HEAA 5KQLA 3EZXA 2IQ5A 4UEQA 2OBMA 4OI4A 1UP7A 1FU7A 4RVHA 4KOEC 3TZEA 3ZHYA 1ISGA 2RJNA 1CB0A 2FLVA 2JIDA 2QNIA 1UM8A 3F7TA 1YK0A 3QVGB 4O8CA 2Z2XA 1JHPA 3OZAA 1U0SY 2AYYA 2KX7A 4N0EA 3KT8A 5M3BA 1GG9A 2VCEA 1T24A 2NQ8A 3BCRA 3N6XA 4H1UA 4LXIA 5KKCA 3M9WA 4PYNA 1JSXA 4Q1FA 1LZLA 3C5HA 3E5HA 2NZJA 4HLUC 4UJ3A 1HNWB 2ZJ5A 3PXGA 1U11A 1M1NA 2RAFA 2V7EA 4MLPA 4QUJA 1SOVA 4S1VA 3TKYA 4ALLA 4BNXA 3AKZA 1KZYC 4Q1BA 1OPXA 4X93A 2ZCJA 2XGSA 5C1BA 2UZAA 3EYWA 5CB0A 1N2XA 4MKZA 3OU2A 5EIHA 2I76A 5LVAA 4W8HA 3VGPA 4CEJB 4PRYA 4QDZA 4F85A 2R7NA 4CIAA 4NXNB 2Y76A 2FLKA 3PXAA 5F2KA 4OGFA 1ABBA 1WBDA 5HQ3A 4BZZA 2GBGA 2L82A 2DUUA 2FW1A 1QYCA 4DV4B 4YO8A 1NR1A 1ODFA 3FHOA 3PNLA 1MEEA 1ZD3A 1TVCA 2HO4A 2XOXA 1E7WA 1HEYA 1NU8A 1Q15A 4QTYA 3UPUA 1RPAA 4OJNA 2AJCA 2HNKA 2H2FA 2ZIXA 3ETEA 4E09A 3A2NA 1H1LA 2BFFB 3WLIA 4RK1A 4LF8B 1GQRA 3OOYA 3P2JA 4WCFA 5EIBC 1HA3A 1ZQ1A 5CDHA 1ZMTA 2CLMB 3EVZA 1X9GA 3IAEA 1E3DA 2I4IA 4KGZA 1XLWA 2CZQA 5JI3E 1WXXA 1NM5A 1XQWA 3CF4G 1DMSA 1QP0A 2JGFA 2XTMA 2JK0A 3B1YA 3GCXA 5T3YA 5HR5A 3FNEA 2VAVA 3SZUA 4E1VA 2FK8A 4UFPA 2IYSA 2C7GA 4EABA 3NV7A 3JQ6A 4EY7A 4HZUA 1CY7A 2RHOA 2AQIA 2RB4A 2FJ0A 2HY7A 4EHLA 1QJCA 3H3XA 3A3PA 3O75A 5FYQA 4ZZIA 3K9QO 1GGKA 2I6TA 1IIBA 3OQPA 3S2UA 2D2IA 2P2CA 1W6RA 2EGHA 1OILA 3L93A 1VRCA 4H18A 4M7OA 5L7YA 2BGNA 5E3JA 3RVMA 4PZ9A 3VA7A 2O8BA 1NW9B 1C9KA 2C7BA 2FMIA 2IYEA 1H2EA 3NEPX 4HNSA 4C04A 1FS4A 1Z8HA 2AKYA 1BVHA 3G9UA 3RC8A 1LJ8A 4NICA 3WMGA 4MRMB 3L2OB 3LXUX 4RD6A 2BTEA 2CV0A 2WSBA 4OMDA 5JAZA 5AVXA 3ZZNA 2K5UA 4DBLE 1SCKA 4AO6A 3QXXA 1E9VA 2HL6A 3NUZA 2EWMA 1DRWA 2C98A 2FH5B 2P62A 3C3DA 3K30A 4W9NC 3OZWA 4EYKA 5MN5A 4JR2A 3RIGA 2WTBA 1C0PA 1R15A 2VBFA 1IOVA 2ZJ3A 2W2LA 4B71A 1OX6A 3Q0TA 5I7FA 1OU4A 2QLJA 4MIOA 1PQUA 5SZIA 3VAZA 1PJ3A 1U3GA 3ZGOA 3UJ3X 4OP1A 1F6BA 1IMJA 4ZAYA 3OWOA 4Q00A 1KH2A 2I1QA 5FT9A 2R9VA 3GJ4A 2ZP1A 3JQ7B 2HDOA 1H8EA 1I6KA 1NXQA 1W46A 1G6OA 3WQBA 3SJAA 1FSPA 1J8DA 1ZOLA 1Z0JA 5H68A 3WIOA 4EPVA 2CE7A 3A06A 1BX1A 1X9HA 2QX7A 3FUCA 3HB5X 2QUZA 1J49A 2X0EA 4Q34A 1P33A 3OQ6A 3FNHA 3QF4A 1NFRA 1J5PA 1GZ5A 3G0GA 2GBCA 4YJDA 5COBA 1J0EA 1WE2A 2Q3FA 3BGWA 1AXRA 3NZEA 1P5JA 3FSEA 2PCLA 3H2BA 3T61A 2QT0A 3P2IA 4UPEA 2OGZA 3I6MA 3JX9A 3GRAA 3FPEA 2ZWIA 2ECOA 1UKVY 3FLAA 3LW8A 4L22A 4IDBA 4Z9FA 5KNCD 3GFQA 1W0JD 5AVJA 1RMTA 1VJ1A 3O8DA 4MUXA 3HBFA 1A2QA 1H9AA 5EFOA 3P4YA 1IHUA 3DE2X 1VRVA 2R7KA 1E5QA 3FCEA 3RUFA 3S55A 3X0DA 4BEBA 1CLUA 3L0PA 2XF8A 2K7ZA 4EYQA 4HLNA 1RLIA 2ZUVA 1RCTE 2GASA 4YALA 3WB0A 1O6BA 2FUG1 2HF7A 4D3DA 4BIMA 5J43A 2ATCA 3ILVA 2WSYB 3LV8A 5B1DA 3MMNA 4BBAA 4QVKA 4JXJA 1IBKB 3IP8A 1KMCA 1BCRA 4UNRA 5CHEA 1CFZA 3HYRA 4H77A 2IYYA 4TS3A 3HDJA 5LB2A 1ZQ9A 2UU9B 2WF7A 4JI6B 1N2BA 1WMDA 2XYQA 3BD7A 1R0KA 5ALRA 2J5KA 3RHFA 4DR3B 3UXMA 3PXUA 4NCAA 1CEEA 1ZK4A 3W6OA 2HYDA 3A6JA 3IP1A 2WR8A 2XUKA 1V25A 4IFBA 3GQVA 2QRMA 2PX2A 3TPCA 4NNOA 4OAQA 3EPJA 3FPFA 1TC2A 2FDXA 5LP6C 4F3NA 1RP7A 1EK0A 5JQGF 2WUGA 4XH9B 1B3RA 2PNFA 2GXAA 1R1DA 4BQRA 1YJ8A 4CUKA 3JARB 3JZFA 4URXR 5BOSB 3QBDA 3LUPA 1F12A 4C7MA 4RORA 2HWKA 4MQMA 2H18A 3ZCPA 4MHSA 1W581 1TMGE 2IYVA 3CUUA 2V54A 3MS2A 4H4DA 4D0NA 4Q4CA 5KYUB 1T10A 2W5UA 3IBGA 4PYIA 2FOLA 2QRKA 3K7EA 1E3QA 3ZCTA 5JAIA 2PKRA 3O3NB 5DOZA 2NTJA 4GP7A 3H3FA 1LPPA 4URHA 3TQSA 2PO5A 2QU8A 3L84A 3BD8A 3AM5A 3CR7A 1G5RA 4B2YA 1NI5A 5A5GA 4WLEA 4PAGA 1J21A 4PLTA 5DHRA 4BL5A 4Z8YA 5FUWA 3CUKA 1XI2A 1VC2A 5LQMA 5G3YA 1BKYA 2FZEA 2QL6A 4GI5A 3EJWA 1I7NA 4OOFA 4YTEA 2M9MA 3T9AA 4Y2JA 2GZAA 1S96A 5EI5A 2CLIB 1GPYA 3K6SA 2YFYA 1COWD 1PR3A 3KD2A 1QG2A 3HXLA 4UZFA 5CLGA 3NBMA 2DEUA 2XBUA 1VYVA 3T9BA 1OC4A 3WFZA 1NQUA 4LVOA 1Y7PA 4H6WA 1KK1A 4GWKA 2OE2A 4KYVA 4HQNA 2DY1A 3JD4A 1Y42X 5IUKC 4BLQA 4BNDA 1GZDA 2E4XA 4H08A 4KGDA 3MJSA 4BPBA 2ZIUB 2PRJA 3IPXA 2CE2X 1Q0PA 1EK2A 2R79A 3IQZA 4CCSA 2JLWA 3QMWA 1E5XA 5FPYA 4PONA 5AJVB 3SFVA 2FRXA 1SVSA 1IOZA 3KOZA 3WJ1A 1S4QA 2YFHA 5JARA 4N76A 1DQNA 5DNEA 3KKMA 3R8XA 3PJEA 3X1DA 1C9YA 5IKEA 4Y2RA 5FL7A 4Z4HA 3KSUA 1IN7A 4AQYB 3RQSA 2I4TA 2Z3VA 2AKAB 4FDLA 1XMPA 4P2GA 4XB6B 1SKYE 3QM1A 1NKTA 3A28A 3NWOA 3KSDO 5F1YA 3U56A 3JR3A 1E79A 4DBVO 2ORIA 2CMDA 3E53A 3TSYA 3RUCA 2JLYA 3HB1A 4N0MA 4O2BF 2VRNA 3PGXA 3IUPA 4UQPA 4Z3KA 2IYWA 1L4GA 4HWRA 1T6YA 2BUAA 2ZTSA 4IGAA 4CM9A 2H2HA 5BWBA 2OCKA 1F7VA 1JSZA 2N46A 3VPAA 3VTFA 3UJCA 5CU7A 2J9RA 3Q6IA 1SCAA 3BIWA 3DKVA 2MINB 4JB2A 4QGHA 4AY5A 1T2NA 4NDAA 1KAGA 2RH8A 1Z26A 3HA2A 3TO5A 1IZ0A 3G2QA 3I3OA 4UD2A 2P7IA 3OUTA 4M7RA 4PYKA 3GGJA 5GJVC 3H13A 1QH1A 3D4NA 1TJYA 3KTAA 5DTMA 5BNTA 5CFMA 2AGVA 1RWNA 1SN7A 2VBGA 4J76A 3COYA 3KIPA 3PJFA 3L77A 3VU1A 3VI4B 4CEHA 5GPBA 5EKXA 1MORA 3SQDA 2PPVA 4R40A 1Q16A 1ZUIA 2LE0A 3D8NA 4L78A 3L8FA 1DTEA 1H2AS 3H1PA 4CKEA 2PVPA 2X0JA 3C24A 3HKBA 4RHEA 2EGUA 1XQ1A 2G1UA 3FYUA 3LT2A 4HDAA 5T3UA 1XZLA 1CUGA 3DXZA 3VR5D 2OBLA 4FNAA 2D1SA 4D9MA 3ESXA 4EH1A 1TIPA 1QWOA 4MV7A 3MWDA 2HR1A 4I1UA 4OV6B 3TOSA 3HZHA 3M6UA 3SMVA 1N77A 3RF6A 3HZRA 3RIXA 3CT4A 3UW1A 2C4WA 1B8PA 3QVLA 2YWXA 3UV6A 1D5WA 4AJNA 2PJUA 2WG1A 2WVAA 3HFJA 2QI9C 1S2GA 3FLEA 4LG1A 3G6WA 3IHTA 2O6LA 4E5SA 4KZPA 3KR0A 3PIDA 4RVCA 1PT7A 1DJLA 4CFZA 1YZNA 3MT7A 2C3OA 3WY9A 1IPEA 1EP9A 1JLMA 3B2QA 4DB4A 5K1ZA 5ICEA 3CINA 4C29A 3BORA 3OPMA 4C3ZA 3C4JA 2WA1A 4JU9A 4CXMA 4NJMA 5FR1A 2BH2A 2BZGA 3GBPA 5HJ7A 2EV9A 1KY5A 3G2KA 3ZN2A 1V3QE 3GU3A 4TTTS 4B2IA 4P4NA 2VNJA 3L7YA 4Y9TA 2P4SA 5AVQA 1SVKA 1I5OA 4URUR 5B3JC 1UPBA 2IF2A 1SRQA 1V4VA 2V6GA 5HIMA 3WWPA 1QGAA 4UASA 1ETHA 4HDRA 3F0TA 4KXWA 4QQRA 3UA3A 1KO8A 1XZBA 1WL8A 3I8OA 5A1TA 1G18A 2QAJA 3ESZA 1L4EA 3CG4A 4PCAA 4X7PA 3S2GA 1FSFA 1NUPA 4G81A 4R84A 3C3XA 3TLJA 3GJZA 2ZYVX 2A0UA 4JBNA 4JP1A 1K6MA 1ZBQA 1WPQA 2BE7A 3CRNA 3DL7A 4MITA 3RBZA 4BATA 4XWOA 4A73A 5ADVA 5IF3A 3I73A 1YDHA 4G0WA 4E14A 3GAMA 1DEKA 2JEOA 2H8GA 3TRJA 4HCJA 4CZ2A 3NEAA 2Y93A 1JMKC 1HT1E 1WWKA 2ZUWA 4KBGA 3PUHA 5CIQA 1FTSA 4JELA 1SAYA 4TMFA 5F73A 3H6GA 1GAWA 3C3KA 1S2IA 2A35A 2UDPA 4R2MA 4AJ4A 2VG8A 1KJYA 2IYAA 3BH0A 3JSAA 1YHNA 1YT5A 2DPMA 3B82A 3M1LA 3AHHA 1EFDN 4Q9IA 2A1UB 3LFTA 5CBPB 3J80A 1XF1A 3HWSA 3JTEA 4OBWA 3VSDA 3CXRA 3MYYA 4ZA2A 3ORQA 2EKDA 2IXTA 2JGMA 1GYQA 4N39A 5B6IA 821PA 2ZZNA 4F2HA 4FZRA 1U99A 4X6YA 1E79D 2MYNA 3W04A 1OI3A 2P9YA 2A0XA 1C7RA 5K3DA 1TO6A 3P0FA 4BBPA 3GBVA 2RE8A 5JO9A 2RAUA 2W6QA 1M74A 4NABA 5C1OA 1WXDA 1YIDA 1Z34A 4H4CA 1UEJA 4KB5A 3CLVA 2W70A 3T3MB 3ZKWA 1DI0A 1KQOA 4LBZA 1JAIA 4C22A 5JZMA 1W1IA 1R12A 4JXZA 1IN4A 1FJHA 3M8KA 4D8VA 3UMVA 3E82A 1LVUA 5EPEA 2ZEJA 4L0MA 2IT1A 2ZREA 3ZNOA 4BLOA 4YNBA 4Y2TA 2YXNA 3RJMA 4EEKA 2XXAB 4MDHA 1JHAA 2BMJA 1TLTA 2VYCA 3AOEC 3N39C 4LYEA 1GG8A 2ZGVA 4WA7A 4LY0A 3H5WA 3PVZA 5KJCA 3T5TA 1YS6A 3ENVA 5E9QA 4NQRA 4ABYA 3KR1A 4CM5A 3HPRA 4QOEA 3EFEA 3Q7IA 1U5AA 3V00A 3PFGA 4EAAA 2HO5A 1U2GA 1QTIA 1DV1A 3K9LA 3OM9A 4WNAB 2FCRA 4KQXA 3IT3A 2FWNA 4E07A 5AIBA 3SM3A 1SUWA 2HWXA 3RWBA 3UMCA 3GFFA 4P53A 1ZXBA 3JYQA 3MHTA 2VXOA 1R0RE 3PI6A 4YIHA 4OHCA 4H15A 4NY1A 1E2EA 2D5AA 2PSSA 2R00A 1NE2A 2HCJB 4GWLA 5DHAA 1UZMA 1JUDA 4U7JA 5FWXB 4AJ1A 3NNNA 4UFOA 1TEXA 5ENVA 3MGBA 1G8MA 2ZE5A 3CNEA 3DWEX 5H7XA 4D41A 4Q12A 3UTDA 4K46A 3ZHQA 5JW6A 1GLNA 2A0KA 1B23P 4GKBA 1NXXA 2BI8A 3NBXX 4GUAA 3M34A 1ZGGA 1ZM3A 4CMKA 3ZDEA 2PIDA 3CKLA 2HIMA 5K3FB 4ZYVA 3EXAA 2JFXA 5CA0B 3WGGA 3DPSA 2ON6A 4GM4A 3VQTA 1A97A 3QX9A 2WT4A 3FKSA 1E7MA 1W35A 4TT3D 3V34A 1ZK0A 1PJLA 3CIOA 2FSPA 3WJAA 4YGXB 2HRDA 3AF6A 3AONB 4DLKA 2Q5CA 2YFKA 2ZBDA 1S7CA 3FUTA 5JSHA 1OIXA 3KG2A 2BCJQ 4M6WB 2R5WA 2HF2A 3NUQA 4L72A 3RD5A 3K6RA 3KB8A 4CNBA 2LWIA 2W00A 5HK9A 5JZOA 2GVZC 4RZUA 2BWJA 4CQMA 1WCWA 5E9WA 4YMTA 4X7BA 5F1PA 1P4RA 2WZDA 4E46A 1DSSG 2JJ2D 2AFHA 4RSMA 1QGUB 2ABWA 2ADMA 2OOSA 3TOVA 4DLLA 4ZEMA 1NKVA 5B4VA 4RFVA 4L08A 4Y18A 4DA6A 5DGTA 5CD1A 2HTEA 3N2GA 1UWCA 3LZDA 2FGKA 5DLYA 5K0EA 1G20E 2VHWA 4AKIA 2A57A 4EM6A 4W99A 1W88A 1PG5A 2HI0A 1ZX1A 5H3CA 1UAGA 5CEJA 3SC2A 2OSVA 1QYRA 4ZAWA 2J3EA 4JVOA 3L6RA 4UAVA 4ZDJA 2DLDA 4O0LA 3AG6A 4RPJA 1O89A 1U0LA 4KXFB 2P2DA 3GX1A 3K8ZA 1H8ED 3NVAA 2HBZA 3OKCA 1EFPB 3RU7A 2LDXA 5KDDA 2R6HA 4NAVA 4PQRA 1OB2A 3CLHA 4FMCB 2FPXA 3LYHA 1D7OA 1WABA 2IUYA 2F48A 1PYOA 3ZH2A 3CH6A 1YFKA 2NO6A 5CVTA 1X7GA 1ADFA 2OHOA 2QPAA 3EIXA 3NOQA 4K9KA 5IVIA 3QA3E 3PX3A 1IBLB 2QAGB 4IV0A 1BH6A 2NTNA 3EFBA 3JD2A 4NXMB 1JV2B 3W90A 1SU7A 3D31A 4EPTA 4JJAA 4ME6A 3CMMA 5AKYA 3O95A 1HNZB 1EHIA 1YBVA 4LYGA 1RM3A 4DYDA 3RS8A 1KVQA 2VNAA 3OIFA 1K63A 1EGQA 1U7XA 1OGYA 4OB8A 2C1XA 5FO1A 1IXRC 3FF1A 3L1UA 4Q3KA 4W7HA 3IDAA 3SVZA 3ZCQA 4BNMA 5J4LA 2NZ8A 2DR0A 1LS6A 2QQ5A 2Z9DA 3NHJA 1U65A 1RKVA 5TNXA 4DLYA 4Q9JA 2RFLA 5EE3A 1JXAA 1P4HA 2WSSD 2P6NA 2PQMA 3GRKA 1LDBA 4O2BB 2QRQA 3REGA 5IH7A 3HO8A 2JLUA 3VO2A 1GCAA 5IN5A 1X14A 3TEJA 5J58A 2P9CA 2OCBA 1A8SA 3JQ8A 3HN7A 4J0FA 4DR7B 1H5NA 1V7PC 2BZSA 2QRHA 3CRQA 3A1CA 4OQZA 4Z3DA 4BMXA 4TV9B 1DAFA 2EJCA 2RIRA 4DLWA 3Q3VA 3DMDA 1EUDA 1F4VA 2O2GA 1XZIA 5E4JA 3RROA 4GPEA 2HAEA 1NXOA 2CUZA 2NPFA 4YUAA 1PZEA 5JRZA 1VE9A 2WWHA 3G5AA 1C1HA 3KJXA 2B82A 2G08A 2CYCA 2GF0A 3AF5A 4R0MA 5JFOA 2DHRA 2OAGA 5BQOA 4BRZA 4C4PA 4ZQBA 3TTUA 1T3HA 3NOXA 2I3DA 3QVVA 1XKXA 4K28A 1NVUQ 3D8RA 1SUIA 2XUQA 3HA5A 1RYBA 3ZE9A 4C2UA 1GCIA 2IKSA 4RXMA 1BS9A 2VNSA 4P82A 5LMZA 3OM0A 4K6FA 3BFVA 1YKFA 2PH1A 4A2QA 4YVFA 4FGJA 2VDMB 5FBRB 1C3JA 4YR7A 1Y6ZA 3A1NA 1UKYA 2D6FA 3EFHA 3W5DA 3H5RA 4HLDA 1HF3A 1E3WB 1XTBA 3P96A 1CZNA 4TKUB 5IHXA 1Z6GA 3DOHA 4RQTA 4S0ZA 1QIFA 1OREA 3GJQA 4J29A 2GEVA 4XB2A 4HRXA 1ZJYA 1DAKA 3Q9NA 2J3DA 1KIFA 2WIBA 3FIJA 4G1CA 5CW2A 2G9RA 3JYLA 2C5EA 4PU0A 3K70B 1E0AA 2XA2A 3A9VA 3Q7PA 4BV3A 4Q3CA 3ZTTA 3EGWA 1QFSA 4KODA 1ID8A 2WWVD 3W8DA 3HZZA 1RHQA 4X6UA 2F3RA 1LPOA 1K68A 4TUYA 3AHDA 2ONCA 3LC7O 5E8JA 1WX1A 3CZAA 2BEJA 1ZCJA 1XZJA 3WAGA 3L7KA 4U9HS 5JCJA 2WU1A 3DW1X 3MBIA 5SY4A 4O2LA 5D1NA 5K8IA 1VIYA 2Z1MA 3JATA 1UFKA 2LDBA 2JK1A 2VDOB 5E8RA 5FEMA 5GONF 4D74A 5A9SA 4CRWB 1JKIA 4B7UA 4IY1A 4NAUA 2OV8A 3AHJA 5TLSA 5HS4A 4IDDA 2Z04A 4WZBB 3HJGA 1SUCA 5GV7A 4YJ3B 1I24A 3N8NA 1NLUA 1VLJA 1KMQA 1NGSA 1RDFA 4BQIA 1RE0A 5B4UA 4ZJPA 2O6HA 5DWQA 3ZI4A 3CLUC 4U63A 4FXPA 4X1YB 1GSHA 2Q8QA 3R3JA 4NBTA 5ALLA 1MR3F 4ENQA 5BQ3A 3HR7A 4AICA 2X14A 3F6EX 3NP7A 2YR0A 4YYEA 4P36A 4R9VA 3QF4B 1TU3A 3IPCA 2DPHA 5EPOA 1NUQA 1UBCA 2N1BA 2Z43A 4A23A 2JCSA 1E7SA 3M82A 3PQ7A 4CG1A 3LU1A 1SHLA 1KKUA 1RBYA 2ESRA 4V39A 5A3JA 1N7IA 3QKRA 1ZK3A 3S28A 3RC2A 3L1HA 1IUOA 2C2BA 1A9YA 1DBQA 2B7LA 5CVJA 2Q2NA 4X1IA 3WSWA 4BZWA 1N4DA 3DL0A 5AYVA 4ZD6A 2MT9A 1SELA 1ODIA 1K08A 3K94A 3MPOA 8ABPA 2C5GA 4H1VA 1Z7EA 2ZYHA 5H9WA 5I5EA 1VCMA 3CH4B 4GM1A 2WE8A 1RYZA 4UBMA 1JQJC 5LPNA 2LZ0A 4L9WA 1Q0LA 3DW3X 1Y7LA 5KREA 5F98A 4KMRA 1ZRNA 1MEOA 4U2BA 5KTTA 4Y8VA 3RYCA 5G02A 1XDGA 3DBLB 3PF8A 5FTJA 1KFBB 3G79A 4FFRA 1TKBA 4NFSA 1GDDA 3NYQA 4EW1A 1U8ZA 1FNSA 3IQDB 4JNKA 2FPOA 4IEIA 4QUDA 1M83A 3STVA 3VHLB 1YBMA 3AESB 2AOXA 3I2IA 1DJOA 3O3MB 3VR6A 4ZOQI 3ANYB 3R7FA 5HZHA 3SBOA 1HYEA 3AL0C 1TMOA 4MULA 7ABPA 4M54A 4H31A 3VYVA 4HGRA 2J0VA 4ND2A 1UJCA 6CHYA 1G8SA 3HXKA 1QP7A 4MR7B 3DF9A 4GLJA 4RKRA 3R6DA 5CG1A 4FJ2A 3DKRA 2JIBA 4ZV7A 3BTUA 3K4PA 1AV7A 3AVUA 1PWYE 1V96A 1E98A 3DZCA 3PGMA 1IWOA 3IP7A 4Q7JB 1W30A 1C3OA 4J1TC 1OYOA 1WNTA 3ND5A 3EB9A 1QCZA 4MUHA 4NG4A 4F4DA 5FRDA 1RWPA 1ZKMA 1GAJA 3JV7A 2M6RA 4XYGA 1P7ZA 5ALYA 5HILA 1LEHA 1KVUA 2AX4A 5K51A 4BX8A 5BV2P 1BVUA 2RHJA 3K16A 1VOTA 3PFIA 3GLSA 2VUUA 2W2KB 5C31A 4K03A 4RL4A 3QKWA 2G17A 4MR9A 5IUJC 2FMTA 4OSOA 2HBRA 4KRGA 4DQVA 3GFOA 4HLQB 1JLLB 4JODA 5EXDA 3TW0A 1XTTA 2HCBA 2ZR8A 3NAZA 4FUTA 5K3EA 3AERA 1G3RA 3KB6A 4F56A 4DUYB 2PGJA 3TXYA 5BQXA 5FEUA 1A96A 1VDMA 3RSSA 2EF1A 1G7RA 2FJUA 1UC8A 1JWBB 4O5AA 5FBLB 1LH0A 4OGGA 4RDXA 3UM9A 1M2HA 3LYAA 4DZZA 6REQA 4BNHA 2E37A 2O5CA 3LZCA 5ABPA 5I4BA 5EWJB 1B42A 4HAVA 1C9JA 4K7JA 5COAA 3Q7QA 2XYGA 3EGXA 2HPVA 2H0AA 2NGRA 3VTZA 2D7DA 5L40A 1X80B 3KKZA 2HGSA 1PJ8A 1MPTA 3VOBA 2CKDA 2QYSA 1E66A 4OU4A 1R8QA 2YV4A 4FE3A 4GLOA 2FW8A 4N54A 4YRDA 4G6ZA 3NHAA 3R77A 3W9YA 1DGQA 4X44A 4QARA 3VVLA 5HTKA 1GCGA 1GSAA 1HMPA 1V1MB 1UIMA 2F64A 1MN6A 1VJ5A 1GTJ1 1XPJA 4TMVA 3RGWS 3ZD7A 1XKLA 4RMJA 2X3FA 2WIAA 1I0LA 1JIUA 1GPWB 3MJVA 3CVXA 5IWCA 4PAMA 2ZBRA 3HE3A 3TTWA 2IHVA 1YBHA 2VNIA 5KTPA 1TA0A 3HN6A 2GVNA 4MUIA 4KH1A 4L9SA 5EZYF 2ZB3A 3M1YA 1VIMA 1N0VC 1T4MA 2I4LA 2VSFA 1I32A 1XNGA 4RZ3A 2WJGA 3WKAA 3UJHA 2YWFA 4MUGA 1U90A 4Y9RA 5KINB 2ERXA 2WNHA 3DMTA 3PGLA 5IDWA 2CDBA 3O90A 1G21B 1ZUNB 3HNPA 3G3EA 4EUNA 4PQYA 1ONOA 2JHPA 4CMBA 2Y71A 2ZWMA 4FFNA 2EZ9A 3TD2A 2QXUA 1ZMRA 3KDAA 3R0QA 3K5IA 5D3MB 4S1PA 3TOCA 2AZDA 2QUIA 3OMLA 4PZDA 3VC1A 1OLOA 4QJ3A 1YI0A 3V7YA 4D42A 1SCDA 2Q5FA 2R68A 3CPEA 3V6LA 5AVRA 1NXPA 1XCMA 3RS4A 4D0SA 1FUEA 2DWOA 3R7AA 2YNMC 3ZIAA 3SJCA 1EWQA 2IIQA 3IE0A 4DDMA 2REXB 1VKOA 1SVLA 1B73A 1ST2A 1DOHA 2PY6A 4JVNA 4C4SA 1GGMA 3OC6A 1JL3A 1AQYA 4FWTA 2H0QA 4TTSA 1LLQA 1Y4AE 4L4ZA 2C8KA 4MVXA 4B43A 4N9QA 4FZVA 4LV6A 5IAJA 3L8MA 5AP9A 3Q15C 4D8UA 3ADPA 2WFMA 3S2ZA 2NWQA 4BFTA 1M6EX 4LF4B 4ZQEA 4Y2XA 4YJ2A 1B6GA 3NYIA 1NV8A 1NU6A 2X13A 5B2EA 4BTEA 2PTGA 2QZJA 5JWOA 1SVIA 3P7MA 1V9LA 1YDFA 2I1VB 1TLFA 3ZNQA 3CO0S 4MS1A 5CDTA 1AUQA 2KW5A 1XNHA 4Z4FA 3R7NA 1AZLA 5DYWA 3P2YA 3FPHA 3PUIA 4R8MA 4RMHA 4Q9DA 3W3AH 4RFSB 3FTEA 3A3NA 2B3TA 1N6NA 1NSYA 4LQCA 3NANA 4MINA 4TTIA 4XLZA 2FQWA 5JG7A 4OI1A 3WGZA 4Q4AB 4ESHA 2E6KA 2WY2D 4UU7A 4DADA 4ZI7B 1VIAA 4I2NA 3WLOA 4AKSA 4BFUA 2LGJA 1E2GA 3FOWA 5ICGA 1J70A 4FOPA 1JR4A 5J63A 4D9HA 3OJWA 2BMVA 4DAEA 5L53A 3AZOA 2XODA 2M6SA 3T1YB 1QU3A 5MN6A 1YE5A 1WMAA 2F43A 2X4LA 3KUDA 3PT5A 4NHEA 4X92A 3WGTA 4BGEA 4F72A 4WN9A 5KMGA 3BL6A 4HB4A 4O6VA 1W93A 2W58A 2VRWA 2YWGA 4JUIA 1QKIA 3DBRB 2ZBVA 4N5HX 3OPQA 2MSKA 1XD8A 2IK8A 3V4SA 2CXXA 3KL2A 1HKUA 1NF9A 4GDFA 1SQFA 1ESMA 5BOVA 4HNGA 4WL0A 1N7GA 1QH8B 4TMXA 5K0NA 4J3FA 5P21A 1I3OA 3E0QA 4WXPA 5F7XA 4WAUA 3VR5H 2GPTA 2IBMA 3CYFA 2YCLA 3RQIA 5AMXA 5CUQA 1EIWA 4C0SA 2N42A 2VPIA 3U7IA 4TS1A 4ZQGA 4CTKA 1GUZA 2YYSA 1ULTA 1RKBA 1WVIA 1ZUWA 1NBMA 3GGCA 4FD3A 4G85A 5AJHA 1M34B 4WNCA 3ZY2A 3AEXA 4LECA 2NSDA 1NM5C 3E48A 1ZM4A 2JFPA 4YWJA 2HF8A 2GXQA 5D1HA 1QHHB 1IK6A 2C58A 2EFHB 4QXAA 1MGOA 1VECA 3E18A 5IAAA 2IELA 3G8AA 3ORHA 4AMYA 5GONB 5EQTA 4C7OA 2YQZA 4LYDA 3DMHA 4LWQA 1TFUA 1Z5VA 3WLMA 3VBCA 1J20A 1UDRA 3CCFA 4YMGA 5HKLA 4UVHA 1S1CA 2YWBA 2FX3A 4JHXA 3ZH9B 1GPJA 2X8LA 4OQXA 1Y8CA 2C8VA 3ACBA 3CGGA 5A3QA 2QVZX 3R3VA 1M6VA 3PGJA 2JHAA 1DJNA 4RBNA 4CM4A 2QY6A 4F11A 1P7WA 1GKYA 1U28C 4W1PA 5BN5B 1UBRS 2GAAA 4V0OA 4WT7A 3ZWMA 5AM3A 2VHYA 5HZMA 1ZR2A 1XT6A 1J8VA 3LL4A 3C0KA 4XGQA 2OO5A 3NBKA 3P71T 5FUQA 3HR8A 2EL7A 3F6SA 4KWHA 4B44A 2VKTA 1F0PA 4MGYR 2VCYA 5KX5B 3A4YA 4IQFA 3OTOB 2RHHA 4EFMA 1QRSA 4LKRA 1W36B 1ESNA 2A9VA 3EVDA 4AWAA 3U19A 1NSTA 3NGMA 3HJNA 2CLCX 3PHHA 2O8FA 4QG3A 1P9LA 1L7PA 3KV3O 1BMFA 3G89A 4PGAA 1RZ3A 1EE1A 2BEWB 3MJTA 4KV7A 4ZOLB 3CLSD 4G5SA 1KHHA 1AH2A 2UZ4A 4HF7A 3IXMA 2VPPA 1OA0A 1LC3A 2B7BA 3URMA 1ID1A 4NLLA 2WI8A 1JLSA 2BTQB 2OQ2A 3DOFA 1MX3A 4WZAE 1KBOA 1MVOA 3FTNA 3ZPXA 1YBAA 4BKQA 1XEFA 2A0YA 3REQB 4LRUA 1EXDA 4BZQA 4XQGA 4LRXA 1JAYA 1GPBA 1MC5A 1VCIA 1YK1A 2GD2A 3PS9A 3A26A 1DEHA 1EVIA 3NONA 2B83A 4YROA 2YOGA 3AYXB 3IX7A 4BB9A 4CTOA 3UK0A 1C0IA 1CQIA 2DKNA 5KSWB 3STYA 3X2SA 3NUGA 1EM8B 2VYNA 5B7QA 4JX9A 1RYHA 4RO0A 1Z2AA 4L8GA 4E4RA 2MSLA 3MWFA 4F4FA 3CLRC 1CRLA 2C57A 5F51A 2UZ0A 2LNDA 3SKXA 5BRJA 1FSGA 4DJJA 2P35A 3MRXA 2Q7DA 4M0DA 5DTRA 2XMGA 3RKRA 4B8YA 3FYUB 5H1YA 4QLBA 2C4HA 9ABPA 3AZPA 5ELLA 1ZZEA 4X1KA 1H85A 5AXBA 3RYIB 1I2BA 4KQCA 4LNHA 1RJ9A 2VT6A 1DV2A 3AG5A 2R6ZA 2PT5A 3HU5A 2AVNA 2WYIA 1LNSA 1X6VA 4XDZA 3CKMA 4WEOA 4YHHB 2COEA 1RRKA 1XRLA 2BKLA 3QOFA 1RPJA 4M0EA 4W6QA 2Z8XA 4U7PB 4WN3A 1IXKA 2P2LA 2P1RA 1JG3A 4H7PA 1F1BA 3Q8KA 4WUVA 3NETA 4MLDA 2C2GA 2ZUUA 4JXKA 1RRPA 4D80A 3BTSA 4QRDA 5B3KA 4DLUA 4D4KA 2JIPA 3KM0A 5E7QA 2I67A 5FPQA 1A9QA 2ORYA 4BJ1A 4GNRA 5H3HA 2ERCA 4KTVE 2Q9UA 4PIMA 4WH0A 5IMSA 1Z56C 5E0OA 4AXBA 3INGA 4UHHA 5JJLA 2NNWB 4U9IS 4B4DA 4WY8A 3RJTA 1A4XA 3ZV5A 3DE1X 1H42A 1HC7A 1TNDA 3MTAA 1Z25A 4XIIA 1I1HA 2YBEA 2BMEA 4WHMA 3CWCA 3UJ9A 3ZBTA 3MCTA 2WJYA 3LKBA 1OAKA 1DELA 1NFFA 2IZ0A 4Q1EA 1YR7A 1KOGA 1BMTA 1MQ9A 4UCQA 3RYFB 3AMVA 2I7DA 3TL3A 1VE1A 5KB3A 2VDRB 1XZGA 1QORA 4HOYA 1VL0A 3EZ9A 4OI0A 2UVDA 2BFBA 3GPDG 4Z1MD 1NRJB 4G89A 1ULAA 4RIEA 3JD3A 4D92A 1X1RA 1OFIA 1G6Q1 2YFQA 4D46A 3EXEA 1WDMA 4ZAXA 3JQ9C 1R5BA 4YCSA 1M1ZA 5BSTA 1E99A 2BEVB 2V6BA 3DOIA 3G02A 2FSGA 4YXWA 3QVJA 2GK6A 3RHSA 4E2YA 4JUAA 3B60A 3D3WA 1XX6A 4KYUA 1U0OC 3GJTA 1GILA 1L5RA 4MW0A 5AHKA 5TSDA 3VUFA 1U3DA 1Y3HA 4UM8B 1TIBA 2PL9A 4O8ZA 4DC1A 4F3RA 2CXQA 2DHEA 3D1JA 4HQKA 1JHUA 2NVBA 3PXCX 5GV8A 1JLRA 3ONWA 2FFHA 4B75A 4KG7A 4O5OA 4FFVA 1W5TA 1B8VA 2OCDA 3PUZA 4RACA 4B3XA 5L3QB 3H8JA 2ECQA 2QTWB 3B89A 2GHQA 1W48A 4F8YA 1VHQA 2GF9A 2W2PA 4LC0A 4RKFA 3VU0A 2QD3A 3ER8A 2KQUA 1PS9A 4EVIA 5D3MA 2DP4E 1NVBA 2HMWA 3FCCA 1FQWA 1NW8A 1A4IA 2JGLA 1TCVA 3WDSA 3NVMB 2AEJA 2WF5A 4H7KA 4CIBA 3KX2A 3PLAE 4I4NA 1RZRD 5EKTA 3ADBA 1HZJA 1HRDA 4CF3A 2VP0A 3ANSA 1DIHA 2A5FA 4Y7DA 3DTNA 4C78A 4IZHA 1EFVA 1J9ZA 4O25A 4YRIA 2QTNA 3WXMA 4ER5A 3QFTA 4NF2A 4MGHA 5BN3B 1XMSA 3TLKA 5DZSA 3I0ZA 4LY9A 1KYIA 1BAPA 5KNBH 3VVMA 1EIZA 2C84A 4OEHA 1GITA 3OIGA 2AN3A 2D59A 2O05A 3N2ZB 5T8KC 5K3AA 3PEYA 4FYWA 4F84A 3GFBA 1KDTA 1LY1A 3R09A 3ZZUA 4DA8A 5CPBA 4MW4A 3TKLA 2JC3A 3IB6A 4ZYUA 4LYYA 3NIFB 2PX5A 3E9MA 2FPLA 2OUKA 4TV8F 3S70A 2IV2X 1KY3A 2CJXA 2C3MA 3N2GB 4G0MA 4RE6A 2PUJA 3LDHA 2BSQA 4M36A 3B51X 4H0CA 2GQ0A 2V1XA 2Z5GA 1XMIA 1X8KA 3IP6A 1P2DA 3QVUA 1PKEA 3OCVA 3UHOA 2DFTA 4ZICA 4MVJF 4LC9A 4EHBA 4D9BA 3HBLA 2I6FA 3K0CC 3FGPA 3KP1A 4IOJA 2FWIA 1IZ9A 2NV6A 3GZ4A 1COZA 4R1UA 5H0IA 4C7BA 4DG9A 2Z4TA 2CW5A 3KTDA 3TVTA 3VVBA 4N5IX 2XB6A 4D97A 3CXUA 3H1TA 3JWEA 4L5CA 5B2ZA 5IW8A 1IQPA 4JC5A 1F38A 2VP9A 3FZNA 1O97C 2IL1A 2VLIA 1LBQA 1IJFA 4J91A 4ZI5A 3U62A 4YMUA 3T5CA 2JAPA 3KEMA 3MJHA 4KQEA 3OY2A 4KITB 1M1NB 2P2ZA 4QXQA 1ODSA 2OD7A 4UBKA 5GINE 1IXZA 1H6CA 2QRVA 2NTEA 4RX1A 4Y6RA 1Y1KE 1G5TA 2GHIA 3U1BA 3TB6A 1P6UA 2G9VA 4R3WA 4UUOA 3VPBA 2VF5X 3E61A 1TO2E 2IY9A 2NXJA 1OC2A 5BY2A 4EUKA 5EIFA 4QLAA 2H8KA 2O8DB 2YN2A 1FYEA 2TS1A 5JPIA 3ZQJA 4GL2A 3I0NA 4G0PA 5FHRA 1VA4A 2ZTHA 3NM5A 3OCJA 5LM3A 5M34A 4ZXPA 3GLRA 3PEUA 4INPA 3LVFO 1WW3A 1MKYA 2P8SA 1BIFA 2YXDA 3F5DA 4HEA1 5C8YF 1CULC 2H4ZA 2HNAA 2OHFA 4I0WB 4QU9A 4YJHB 4US2R 3E3LA 4HQFA 3AI7A 2EW1A 3DBHA 1Z9BA 3L8DA 2WF8A 2JD1A 3NCTA 4RD2A 2XE6A 3VPGA 3M81A 2OBFA 1MJGM 3EAGA 3IDQA 3V4RA 1JQBA 3UUWA 4HWGA 3F6BX 1VP3A 1XZEA 2MYTA 1MV8A 4CIXA 4C2TA 1QRDA 3HPQA 2O8CA 1J0XO 2O2EA 2QP3A 3OX1A 1YMUA 1ZIXA 2XWPA 2Z08A 4GI2A 4DLVA 4FB5A 4ZHSA 2ZRDA 3NLLA 1QQBA 2X19A 1HURA 5ICFA 3H5NA 5BNWA 2O54A 2PD6A 3B5IA 2G7MC 3K2EA 4O3FA 3WLQA 3BMNB 3NBUA 3DMRA 4HX5A 3T38A 1DRUA 3TVDA 5IF9A 1I3KA 2PM8A 1UC4B 1SQSA 1UP4A 3A4IA 1OTYA 5I5GA 2GEBA 3RK4A 3K1YA 4TXJA 4K6GA 3W3ZB 4QAQA 1WG8A 3BMXA 5IDQA 2CEKA 2FNAA 2XHZA 4A5SA 1I4WA 2CXUA 3HFRA 1NYTA 3ZQ6A 4BX0A 5JD4A 4Q05A 3DZBA 1O0BA 3DVQX 3FSJX 1EJ0A 4UARA 4BGVA 1ODTC 2V7VA 4G09A 4BMPB 2UZ3A 4XYLA 2XDWA 3C15C 3VO8A 4PPYA 5TT1A 5D5PA 1JW9B 1JDVA 1HDCA 2NU8B 2VJKA 3WR5A 4ZVUA 4DA0A 5AQ1A 2XMPA 3MILA 4MTLA 1RR6A 3E84A 4G9GA 4ARBA 3FWPA 3GLIE 1ENOA 4PHCA 1NXVA 1ULBA 2WHPA 4NARA 4LJKA 3RYFA 3PDUA 4JCOA 4NKRA 3SZ3A 3UXEA 3B2NA 1G9SA 2H1RA 4UNPA 3LLSA 3UYKA 4BZPA 2BKVA 4RDIA 3NFRA 2OLJA 1GKLA 5KSPA 3H9GA 1E6EA 4CMIA 3IPRA 3F4KA 2PL3A 4ER3A 5CURA 4B3SB 3RUIA 4RY0A 3NDBB 3BJRA 1Z39A 4ZVKA 2YHIA 2V65A 3AC0A 1UKAA 2HWUA 2JDID 2J45A 5CXQA 1A88A 1BC5A 1JEAA 2HWYA 3AR8A 4LV8B 3SXUA 3U5TA 4IX9A 3QX3A 2VF2A 2WF6A 1WMEA 3AJEA 1X15A 3M6XA 2QB5A 3DDNA 5HF9A 3WAKA 3RGGA 2PVCA 4ERXA 5I9NA 1BNCA 2ZIGA 5JVDF 3DE5X 1NI3A 4AZ3B 2HDWA 1M6YA 2VZ8A 5LYJA 3V8MA 2H5EA 2O5EA 4INAA 4MUFA 2D06A 1OFVA 2EZ4A 2PH5A 2XW6A 3HA7A 4E4TA 5DEIA 2CT8A 1NV9A 4GOMD 4BKUA 1BXKA 2DUMA 3HCAA 1D03A 1JR6A 2RBEA 2E49A 3OLWA 1PJTA 2V8OA 1USWA 4PSAA 4B7ZA 1EESA 4EG4A 2GDZA 5DNCA 3MIZA 4KPUB 3EVCA 3PBKA 4LE1A 4A0RA 4PX5A 3ZHUA 4DIDA 5A6VA 2PT7A 1SBYA 1P9RA 3N2EA 3NC1C 4ZQCB 2LR0A 3TNJA 1G63A 4HSGA 3OY7A 3ELBA 4GPBA 4O4JF 1ZOSA 3A7DA 2XOEA 5BSKA 2BE9A 2VTDA 4ITRC 4OX9B 1JSCA 3ASZA 1GUYA 2EZTA 3CURA 2L17A 3IHLA 5CA0F 3ZWXA 1XCGB 1HLGA 2NP6A 2VAWA 3EMBA 1L4FA 3MJ4A 3F49S 3RNLA 4LDPA 1U9YA 5JDIA 1J2RA 2GKGA 1XZ8A 1WXFA 5L9AA 2I7TA 4FEEA 1TZKA 1GEGA 3IP9A 3CRRA 3EMDA 1QHHA 4PSCA 4XTCS 3UH0A 4ZHQF 4P1ZA 2WD8A 1T5HX 3FE2A 4MJ7A 3ZC3A 4DLNA 3L9XA 2JAXA 4JP3A 5JR3A 1E4EB 4MYHA 4ZJYA 4YASA 4JLSA 3WZ2A 2NZVG 2VDWA 4MO9A 1PK8A 2WAXA 4QJIA 4BAUA 2K87A 3RRXA 5JAUA 2NTVA 1HTTA 3SF8B 1TT5A 5I7VA 4I1SA 1F9AA 1J2JA 4HBGA 2M98A 1Y1QA 1FQOA 3AUKA 4HDSB 3NHUA 4JA0A 4QGAA 4UPDA 5D5HA 1JU3A 2P0AA 1O95C 5CXSA 5FD8A 4FIZA 3GVXA 4MKXA 1VE7A 3RAJA 1N6PA 1X7WB 4CM4B 2NU9B 3ZVMA 4BLSA 1P1BA 3PD1A 2MINA 4IGIA 5A7GA 1DU4A 5KJEA 2R2AA 4DDTA 4YBZA 4MICA 3LDAA 4R4JA 1RJDA 2I6XA 3LSTA 5KU1A 4DV0B 4TMTA 3EISA 1IONA 4DCCA 3GVPA 4B6GA 3CX4A 3FAZA 4DV6B 1V95A 4RXTA 3PR2B 2V59A 1Z07A 2IHKA 3D6MA 4HADA 5LP6F 4WZZA 5K3SA 3HP7A 1WDTA 3F2IA 2W6MA 3HXPA 5FPKA 1ZJWA 2D2EA 3P5SA 2ZQZA 2OXTA 2AN5A 1PWHA 4HXGA 3VNAA 1QUEA 3EE6A 1HFJA 1HUQA 4ZEOA 4B35A 1KNXA 5BN5A 2R1VB 4I9GA 3KZMA 2VKQA 4YB8A 1AXGA 2Z30A 4AKTA 1T26A 2RARA 2X42A 4NOLA 4XQCA 4G0QA 1CZHA 1KO5A 1PWXA 2YS7A 2JD2A 3PD0A 4UATA 5BSFA 2DWQA 2PBLA 3P26A 4KDFA 4M1QA 1WIWA 4KPFC 1M2EA 1B3BA 2BIFA 3JAWA 1FXUA 1QKJA 2O8NA 4IVRA 5AM1A 1Y1PA 1YXMA 4FHFA 4PSVA 4K6OA 4R2KA 4GLFA 1LWNA 3L6CA 3ANLA 3MT8A 4IF6A 4FZJA 4ZOAA 3LQQA 3PDJA 3STHA 1NJ2A 1T9ZA 1AUXA 4NECA 4TN1A 4NONA 1RPZA 1A7AA 4PIVA 2HMTA 4DABA 1BJKA 3SCZA 3BSSA 1AGXA 3LGAA 3VYTB 4IV8A 3H04A 3T4PA 3FVQA 2NYAA 4N1AA 2GEFA 4JYCA 5IWAB 3EXG2 2VJLA 3BJZA 3MUFA 2IPLA 1RVDA 1Q0UA 4YP9A 5KHOC 2XCUA 5JASA 4UHJA 5KQMA 3COZA 4WFIA 1KZHA 3IAS6 3B7WA 3RC1A 2Q5OA 3DL4A 2A0FA 3GLHE 2ORED 4RF4A 1Z2EA 4MLCA 3F47A 2X76A 5KYNA 2PS1A 5G3ZA 3FWZA 2GN2A 3SDSA 3P52A 3VR4H 4DVGA 4N3BA 5C5CA 3KALA 1NP3A 4RZSA 2CNDA 3AZQA 3PXXA 2H54A 2FPRA 2FW0A 2FI1A 2J48A 1U1EA 1SCNE 2YVUA 5A04A 4MVJD 2ES4A 4G07A 4C08A 7YASA 1FP6A 3N86A 1A9ZA 2EEZA 2R7LA 4NOMA 2HU7A 3GR6A 2ORVA 5A4KA 5IJ0B 1D1PA 1EM8A 2QLBA 3DO5A 3ONDA 4QRHA 3MGKA 2QTGA 1T0JB 1Z38A 1KSJA 4YRCA 2Q4EA 3IA2A 4QPZA 4RH1A 2G6TA 1W73A 4GI1A 4XI9A 5A7FA 1GT91 2GZ2A 2JCBA 5F33A 1CR4A 2VXCA 2RBGA 3ETLA 2G36A 3AB8A 4NS4A 4NZYA 4U7HA 3SXPA 1ZN2A 2XD9A 4EUEA 1G3UA 5FCDA 2I1WA 3HNOA 3AP3A 5IPFA 3HMKA 3MSXA 4K8RB 3ENQA 3SVLA 1F2DA 1T6BY 4KAFA 4KQ2A 4JYZA 2XYRA 5EMKA 1GPKA 4EJSC 3BZWA 1NVXQ 4L2IB 5I8WA 4YC7A 4DB2A 2A9PA 2IRWA 1QXSA 4UMDA 2PXHA 4GXQA 1WY7A 5DBIA 3P9CA 1JECA 3DMNA 3TM4A 4BGIA 1IYZA 5F12A 1ML4A 1YAHA 4KNWA 4ECEA 2ISSD 2HM7A 3U4IA 3R7LA 3FUVA 4LZZA 4NDZA 1BWQA 4GP6A 1PI3A 4REOA 3PQ3A 3R8CA 3MK31 1UAAA 1KFEB 3WL3A 2CLOB 1GCOA 1MA0A 4ZT3A 3I9OA 2HHHB 4MCJA 1GNLA 1B6TA 2ZSEA 2I66A 4MYTA 4FN5A 4NFHA 4BMZA 1ATZA 1U3FA 4KUHA 1JQLB 3W77A 5AVSA 1Z4MA 2AT1A 3ILSA 2H4WA 2WK1A 4F2GA 4WASA 3CRMA 4HDNA 1G0OA 1FDUA 5EJAA 2OL4A 5CLHA 4FBLA 4HPJB 2CBZA 1H4TA 1NVDA 2OM6A 2FFRA 1A5TA 4ZT4A 4EGJA 1PG0A 3U0BA 3X2FA 2Z0MA 3KXDA 5D5QA 3WRYA 3V80A 3OU7A 1RAIA 1FDRA 4QX6A 3A2KA 1GKIA 5ECGC 3WYDA 1Y1TA 2ACKA 3EULA 3LAWA 1MVLA 3DQQA 4M87A 1E2NA 2SKCA 3VSEA 5CBPA 5IN4A 1QO0A 3PFCA 4B3TB 1E3TA 3OE7A 5CFOA 1NP6A 3P0IA 1Q21A 1PQPA 2CFIA 1KVSA 2QTMA 3G17A 2YZNA 3R41A 3IB3A 5DASA 2DSNA 1KE2A 1O6ZA 3K0CA 3S1AB 1OI2A 1EB8A 3WVNA 3ED5A 3HH8A 1OFTA 3HJTA 3UPDA 4AXXA 2CHUA 4RCYA 4PWYA 1KOLA 2K2QB 3DVRX 2LXNA 4URYR 3I9JA 4WA8A 3G9XA 2EW8A 4EB3A 3RG8A 4KPEC 4RV5A 3H84A 3ZCSA 3I2JA 1W9HA 4I81A 4UM9B 1JX6A 1WV0A 4KAJA 4F9TA 3WO0A 3RADC 2AJDA 1RLOA 2GOYA 4U6QA 4V0RA 1QR2A 4B3IA 1P18A 4Z1OA 3NO4A 3QVTA 3TOZA 4PICA 4BUJA 8ATCA 2DXIA 3FR8A 1ZUHA 3ORSA 1XHEA 3HBJA 4C4XA 5KSZA 4R2XA 3FOCA 4L9AA 1H8HA 5DTQA 4W63A 1DKPA 3LBYA 4D9NA 2EKBA 2DQSA 3PHJA 4UTPA 1KORA 3V4ZA 1H4QA 4LDZA 3AHIA 3W06A 5AW4A 2ZR9A 1YVDA 1WDKA 3L6EA 3U40A 2ZM5A 2ADFA 1Z5NA 4UCXA 1GLVA 2Q4RA 4MV6A 4KPUA 2AD1A 3DVLA 3KQKA 3EPRA 5FR2A 1SA0A 3LVQE 3PJGA 3JQGB 4LHYA 3OT5A 5AW9A 1IOWA 4BWFB 4BVHA 5J4KA 2XDQA 4POOA 1Z8DA 2WJIA 4DEYA 3GGGA 3DXFA 3L3BA 2YYYA 2XBMA 1W36C 1ZIPA 1G8FA 2VTBB 2XB2A 1UODA 2X6RA 3V7WA 2PR7A 3AV0B 1HEUA 3A11A 2Y66A 3E9ZA 4X8LA 3GP8A 3RJ9A 1L1RA 3W1VA 2CDCA 1YQUA 4XD7A 2WB4A 4AWBA 4IBOA 5M04A 2XADA 1DRVA 3AIKA 1B2RA 3DTVB 3ZCXA 4DQKA 2JLBA 2Y0CA 2CJWA 5LA6B 5BXQC 3CX3A 3JQDA 3O9VA 3QA9A 4YJ2B 4UTVA 3BE6A 1FRNA 1JQAA 5REQA 5JBNA 1PSDA 2I6GA 3CVWA 3D4LA 4MIYA 4R9RA 4DBZA 4JWKA 2NG1A 1S5PA 4WCVA 2IGTA 4R5MA