4B9JA

Structure of self-complemented cssa subunit of enterotoxigenic escherichia coli colonization factor cs6
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
136
structure length
123
Chain Sequence
APEPQIQPSFVGKEGGLLFSVSLTVPENVSQVTVYPVYDEDYGLGRLVNTADDSQSIIYQIVDDKGRKMLKDHGAEVTPNQQITFRALNYTSGIPPGIYNDQVMVGYYVEIATKNFPVSTTIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Enterotoxigenic Escherichia Coli Colonization Factor Cs6 Reveals a Novel Type of Functional Assembly.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords CS6 FIMBRIAL SUBUNIT A
total genus 23
structure length 123
sequence length 136
ec nomenclature
pdb deposition date 2012-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b9jA00
4B9IA 4B9JA 4B9GA
chains in the Genus database with same CATH superfamily
3LSOA 2CRYA 4HA1A 4EN3A 2YBGA 5I16A 3PWVB 4XB7A 4OCYL 3QNFA 1IM3B 1WTLA 2UWEA 3MLYH 5TTRA 1NC2A 4LXFA 4ENED 1FZJA 3WTTA 3MRBA 4M56A 3OB0H 4JHWH 1NCCL 4U4IA 1N0LA 5ICZB 2ESVA 5D7JA 3ARFB 1MFCL 3SYQA 1BYNA 5IBLC 3NCMA 3BRFA 4XPHH 3KWWB 4YNYB 4Y1AD 2A9CA 4RFOH 3UDWA 4HULB 3EYUL 3APCA 4AUJA 5IFJA 2X4UA 4G9FE 4LCWB 4XVUD 1EV2E 1GGYA 5D4QA 3H42L 3N9GL 5EC1B 5HHOB 3LS5H 2Z8SA 1AYOA 1LK2A 3EHBD 1XH3B 5ISZD 5IIEB 4PWIA 3JZ7A 1CFVL 3DBSA 1NSNH 2GBUA 1T7VA 3QSKB 1KLUA 1AXIB 2DQJL 2YAPA 3LVTA 4S1RL 3OTTA 3SOBL 4BK8A 4YDIH 1MEXH 1ZLUH 3MHZA 3CK0L 3LZOA 1CQKA 4JG5A 2FWOA 5JIQA 3S3SA 4YHYB 4N5EC 5C7XL 2AXHA 3F5WA 1PLGL 3IK2A 5F96L 1G9ML 2GEEA 4D3CL 1UCBL 3C9NB 3D4ZA 4NM8L 3VFNB 1UD2A 4HUMB 4GYBA 1VRSA 2Z7YA 1ND0A 2G5BA 3HE7A 3U83A 5JHLA 3EYQD 1H3TA 4FQQB 4MCZB 3CFDB 1DSFH 3KJ6L 1KYAA 1CLVA 3JV6A 5DVLA 3TO2B 5DS2A 5CCHE 1FL3B 1KJ3L 4PR5B 4X4XB 3CZLA 4JN2A 4W6XB 3RIAF 3V6OC 3GSUA 1R3JB 1S9XB 1TTUA 4NWUH 1S9VA 3SJVE 4Z7UA 2GY5A 3EBGA 4RX4D 5AWNL 1TCRB 5DWPA 1UWEH 3TJEH 3SDXB 1PQZB 1HS6A 2Q8AH 4BH7B 2I07A 4B9ZA 4IS6B 2YQGA 3V4PH 2CJUL 1AGBA 4M61A 5D2LF 5AVYB 5DHYB 3UAFA 1TJHH 3PHQA 4CAGA 4MZ2A 2H8PA 2NQDA 4GQ9H 2YGNA 4OQTH 4NZUL 5CMAA 5TQ0L 3VFGH 3AG2B 1QSED 2YGVA 1BG1A 4HCFA 4BCYA 1ZD6A 4Q2ZB 5EH1A 3WTXA 3QE5A 2B9BA 4KZ0A 1A6ZB 3KPOB 3RHWF 4AVKA 4YVUA 3GMOB 3L3OB 5DRXB 3VFUA 1CICD 1A1NA 2LLLA 2YA2A 4P59H 4H4NA 2GY7B 5BRZA 3STZB 1G9MH 4X99B 5HYQB 5KSAA 1UHVA 3HMXA 4ZXBC 3CN2A 5E2JA 2J8OA 2BP8A 3RE0A 1KIQA 3NH7H 4AMWA 2GIYA 3L3IB 2OMWB 4YSOA 4AQ8C 5I15H 1JPEA 1ZHNA 3ULVD 3POHA 4IKIA 1KCRH 1QUNB 3FUHA 2WZPA 4P4KB 4B60A 3QDJB 3DHMA 4A63A 5CP7B 4P2RB 1JFHA 4K4KA 4QJ4B 3F01A 3SPHA 4B50A 3EGXA 4F8OA 3RVWD 1L9RA 3BOVA 5ECGA 1CFQA 5J12C 1OP3H 3GKWH 1TJIH 4QRSA 3L5XL 3GNMH 3QORC 5C0BA 2J25A 1TNMA 1TQSA 2RTTA 1FV1A 2ZAIA 4X5WA 3DOIA 4ZOBA 5K59E 2AJXH 4HUXB 4FCHA 3T65B 1UA3A 3JUYA 3WXWH 5JW5B 4ZYKB 1HCZA 5FUZL 1FO0L 5LGHH 3EYOA 5HHPA 3F62A 3T3MB 1A7RL 4X9YA 4F2MA 2MPVA 3IPBA 3K2MC 4MWFB 2OXHA 4ESKA 3HCVB 3L13A 4GBXA 4JZNB 5KVFE 4EI0A 4WU7B 4R26H 3NFSL 4FFYH 1A25A 5JIKA 1YEIL 5TF0A 1K8IA 1X6NA 2J20A 2A2QT 3V9FA 1KZQA 4W93A 5SV4A 3V4PL 2KLRA 5JQHC 3QZWB 5EN2A 5D70L 1MHCA 1HE8A 1A7OL 1R3LB 1XFPA 3D4CA 3KS0H 4QHUA 5DZPA 4QHKJ 1MJUL 3GTTA 5KBPA 3FSOA 4FYQA 1KXTB 2EIEA 3T0XA 1MAKA 3WJMA 1JJUA 2AABH 4ZUWB 1ZXKA 5JPMB 2P5ED 3MV9A 5IEHA 1V7NL 4DCQB 4E9QA 2DQUH 3SDAC 1XF4B 1EEZB 4Y8AA 4HIIA 4LAQH 1ORQB 2D9CA 4MSWB 4MB4A 4ATTA 5DXWA 1EAJA 3FUEA 2ADIB 4JREB 1N59B 1XGUA 4ZPTB 1WA0X 1FFOB 3TNNB 4G5ZL 4FG2A 3U0TB 4ZNEA 2IH1B 1GKOA 4ZS6C 5LGHL 4AG4L 2JKRM 3BP7B 1OKEA 2BSTA 1P5UA 3CHOA 2NXYB 2BSDA 3EGDA 3VFPA 6PAZA 4XWOD 2J1YA 1MHHB 3FSWA 4PJHE 4MQ7A 1TTFA 5CLZA 3SDAA 3CFBB 3IDYC 1ZV9A 3H7LA 15C8H 2ED7A 3OLDA 1JWMA 2W65B 4H1LG 2XN9A 3DUSB 5DJAB 1TJIL 3VXSA 5A2JH 3BN3B 4TN9A 3PGCB 3O0RH 4DVBA 4HXBH 4PJXE 3CN0A 4LLWB 3OKKB 4O2FA 4NDMA 5K59F 3H56A 3WEMA 1JF5A 2E9BA 1D5ZA 3CSBA 3HB3B 2KI6A 2KYIA 2Y06H 2OZ4L 2FWLB 1QEXA 1M9SA 4P2YA 4NUQA 4WFED 3KH4A 1WITA 4AQEA 3SGDH 3MBED 3A6BL 2WO3B 1DR9A 5DYFA 3DX9A 2ADJA 4KDWA 4M6OH 5FV2A 3KWVA 2NUPB 5E03A 3LZLA 2ICWA 2V4LA 3PY9A 1AGFA 1QZNA 2C1OA 3HC0B 1I3RB 2AJUH 2FECI 4NX0A 7PAZA 3GHBH 5IB5B 4WV1A 1JFQL 1LE9A 2UY6B 4I2XA 3QWRD 1WD8A 1T22B 2H6PA 4HKXA 3REWB 2PTUA 1WLHA 3UPRB 4BK4A 2JE8A 1A7OH 1ZT1A 3EG9B 2FNBA 2Y6SC 5I1JH 3PDOA 1ZGLP 1UT1A 2ZXDA 4HWZB 2G60H 4FQ2L 3ARPA 5DQ9B 5D2LB 1KBPA 1E3FA 4CN4A 2AABL 5AOKA 3ECBB 2Z8RA 5GGQL 1BLNB 4Y5YB 3D9AH 2XN9E 3IDGA 4TVSa 2PW2B 5GSRA 3MODL 3D4YA 4NIKB 2W0FA 2WBWB 4U6HA 4AK2A 2OK0H 1SEQH 1KBVA 4G7QB 4NHCL 4DF9A 2PP9A 3D2UB 4JFWA 4N2NA 1QACA 4XP9H 1HNYA 4HPOH 3L4UA 4U1HB 5T5FA 4NNYA 4KJYB 5C09D 3L4ZA 4NQEB 5IEKB 3NK4A 3TL5A 1LO5A 2H47C 1AANA 2W81C 1Q9OA 3V0WH 3DX6A 3WLBA 1N6QH 5BVPL 5JXEC 3MRJA 4AMKL 3UO8B 3DO7A 3TPKA 3K0YA 1P4IH 3QWQB 1OSZA 3MR9B 1OP9A 3FTZA 4JHWL 5C0DB 3JV4B 5ITBH 1EAPA 2BC4A 3D0VA 3RWJB 3R0NA 4NCDA 1GJIA 3IEAA 1PG7L 2BSSB 3FT4A 4YK4C 4ZTPH 4HXBL 4UU9B 2JKXA 2X4QB 1IO4C 1XGYH 1F8TL 4D9QE 1HEZB 5C8JB 3I50H 2IOMA 1HHKB 2VWEE 3HNVH 3B3BA 4PS4L 2Y7LA 4PCTA 4XH2A 1FFNB 5AFAA 3TPUA 1XCTB 4BA0A 4TQPA 2BMKA 2WLKA 5E8OB 3X2QB 2DM3A 1NEUA 2IGFL 4DP6X 1OAJA 5HHQB 5EPMA 4LRIC 1YC7A 1HI6A 3KL0A 3BX7C 5E2VH 2QL1A 4AYEC 2J6EL 2RA1A 2AEWA 1EGJL 1BJ8A 2A38A 4Z78A 2I9TB 3VDCA 3IFPB 2IV9A 1INEL 2DQTL 2WTRB 2HUHA 1ZHLA 1W0WB 4J6RH 3F7QA 3BEVA 4P23C 1KENH 1AHKA 3C2AH 4N68A 1FI8C 3GI8L 1DUYB 5GZOD 1AHWA 5DDHB 4PRAA 5IB1A 2J73A 3A67L 5JZ7D 3S37L 3DSFL 2XPGB 5E9DB 4X7FC 4Z7WF 4XOCA 2EDFA 2Q1EA 3EOYG 3G6JA 2LV4A 4IQHA 1CCZA 3DPBB 3VQLA 43C9A 4F7MA 5T33L 5IVNA 3MFGB 4R90L 3K4DA 5C9JA 3KBEA 1OWRM 3T3MF 3W9DA 5DRWB 2O61B 3HJ0A 3O3EA 1BQLH 1PD0A 4F7EB 2QGDA 4A67A 4B9FA 4N26A 3P4LA 5EEWA 3ARSA 5ENWA 5F9JB 3U36A 2YEVB 3CHSA 3PPSA 4L23A 1HQ4A 1CD9B 1CICB 1T0NB 1O9WA 3CLEL 4JN1H 1H9VA 1ITCA 3LAFA 3UJIL 2CR3A 5DQJB 1C5CL 1FVEA 4LO9A 5DEJA 4YX2L 3TZVD 5DJ8A 4FFVC 4PJFF 4PJBA 1PX4A 4XC3H 5DHXB 3CBKB 1YAZA 3OKNA 1JGLL 1NGQH 4R8WH 2V0AA 3SPJA 3W5MA 2DWDA 3BHBA 2MNWA 2L4OA 4AMXA 5ESAB 2VDRB 5AZUA 3MA9H 2Z4QB 3PNWB 4LDLB 3P4NB 4YHIB 2EO9A 4GG6F 3FRPB 4G70B 3WS6C 2MQ0A 1IIKA 2GC7C 4JDVA 2YK1L 3IF1A 1JZFA 1CLYH 1UC6A 1NWOA 4QGYA 2B3RA 3GJEB 2BVPB 2GBTA 4NFDA 3H8NA 2X4PA 1JGDB 4A2HA 5HGHA 1PLCA 1WBXA 1A4AA 2XYCA 3IETA 4JFPB 4PCSA 3SSGA 1J5IA 5HJ3B 3FF8A 2ZYRA 2AK4E 3UPAA 1WAAF 2XV6B 1ZAGA 3KYOB 4JDTL 4UQDA 3RI5K 1P2CA 4AENB 2FYYA 3RKDC 4APQA 4GUPA 2YD1A 4W81A 1GOFA 1Q9WA 2HRHA 1DQQB 1KGWA 1R3IH 2CO7A 2Q2LA 3D39E 4PD4K 4TVPL 4F58L 4B3VA 1NFDE 5F7DB 1QSVA 5LWYL 3W5NA 3EDKA 2XIIA 2ZJSH 3FRPG 2AJXL 2IXQB 1PZ5A 3M1OA 4MJHA 4LSPH 2GTZA 3AS3A 1N12A 3BKYH 4PLKC 3V4VL 3ZYZA 5HBBA 1I7UB 1WH0A 4F7PB 2C7FA 4KVCH 1B2WL 1A65A 4IMKA 1EVUA 2AQNA 3ES6A 3MDJA 1JNLL 5GZND 3L5WA 3P4OA 5FV1L 3V7AE 3AY4A 2JJTA 3IGAA 3HI6H 4FQCH 4XNMB 3GUTA 1RL1A 1YPZE 4BK5C 3SGJA 4KO9A 4JO2H 2ITEA 1FYHB 3CVBA 4LE8A 2COQA 3LNIA 4DGYL 4MHHG 1CFVH 3KMDA 2JJVA 3CDZB 3QJVB 3DX0A 4U31A 3VX0A 4EI5C 3UTZB 4B0MB 1S3KL 1UA6L 4PQXA 4ELMB 1IJ9A 3EGSA 3PWUA 3Q2NA 2OTUB 1RZJH 5FOBB 1BM7A 1QX1A 3RIFK 3VMPA 1BM3L 2F7QA 2QPFA 2W0KA 4FFZA 4GPVA 1HYSD 4H20H 3EYUH 2FR4A 2P8MB 3ZSTA 1V54B 2IDTA 1OM3H 2AS5M 4JPSA 2F58H 1JXDA 3EOTL 3IJHB 1Z6JT 4XX5A 4LOFA 4KTEL 4Z3HA 3E9TA 2BXZA 4N9GB 1FH5L 3B9DA 4ABWA 1I9IL 5CHNA 4EBQL 3B9VA 1RZ7L 4N8VG 4ODWB 4P4KC 4HIEB 4DK3A 3VQ1C 3NZSA 2ENSA 1MNNA 3VH8G 4RRPG 1E5YA 1ODAA 3WFZA 2ODHA 1G5AA 4QUOA 4HSAC 4BZ2A 4H1LA 1BFVH 5DLLA 5IESL 3BYYA 3H1ZA 2DQHH 2PWDA 3BC9A 5B7FA 2EYTA 4LHJB 3EH4B 4UQEA 4RZCB 1X44A 1NTDA 5I1KH 3RVXC 1EJ6A 3LIZA 5ACZA 2EDTA 1A4CA 2VRKA 3ETSA 1MPAH 4GT7A 1TLMA 1P9MA 2R2EB 2IPTL 3ARXA 1AHWC 5C0GB 3RY5A 3OJ2C 4B6ZA 3NZHH 3QW9A 3TCLB 5JHMA 3ULVC 2CDGB 1KJMB 4LSQH 2EIZA 4P59L 4IKKA 4PGBA 4AQ1B 3EHBC 3A4AA 3I9AA 4FABH 1FL5A 2ETWA 1QTSA 1K8DA 1MIMH 1ZE3H 5F44A 4HJ1A 1X5JA 4J3UA 5KSBF 3PWPA 4EIUA 3VXMA 2F54A 4AV4A 1KG0A 4F15C 3PQYA 2B1AL 5JW4M 1D6VL 5EO0A 3VI3E 3OKEA 4TL5A 5EDSA 2XQBH 3VFTA 4C56A 4KITB 3NA4A 2J88H 1C8PA 1QKZL 4TLTA 1QI4A 1WF5A 3GI9H 1JVKA 2H1XA 3QNZA 4DP7X 2HPTA 1KCVH 4W4OA 4KKPA 2X2UA 1CVRA 5EUOF 4ABUA 1BGXL 3SGKA 3SY0A 2DD8H 1NCBH 2E7HA 1Q1JL 4JFSA 1J0HA 2FT6A 3DDGA 1SF3A 3N55A 3OR6B 3QEQD 2DOCA 4HIQA 4MAZA 2TSAA 4ACTA 4ALAL 4LPCA 2VL5A 3JWDC 3N2JA 4JMNA 3WMQA 3M1CA 4FQPA 1GSKA 1FDLH 2C3VA 4Y9FA 1W80A 4I48B 1MFDH 2R0WL 3TO4A 2IMNA 4OIFA 4C57C 2HX9A 2X4RA 3LKPA 4I5BA 4MMYA 5T5NF 3SN6N 9PCYA 1CG9B 1KT2B 1P53A 4ZUTA 1RK0B 2OTWB 3MREA 1CD1A 1DDHB 4HIHB 1BP3B 4XP5L 5DJDB 2JB5L 5DVMA 4N86A 5SWSE 1I31A 4MCYB 3VI4A 1LJMA 1AC0A 3OZ9H 4L9DA 1JTTA 4NPYA 4TSCH 3VFOB 4FFYA 3MRIB 5C0CB 1WZAA 4FKHA 1L0XA 1JZDC 2D7MA 5D6CB 1LE5B 2YUWA 4P23B 3DGGB 3QIUA 5I1DA 3RWGA 1XF3B 3QZLA 5LGJB 4IOIB 4IJ3C 4LQFH 3KR3H 2BNQB 4HHGA 3G6DH 3V9EA 4F9PC 4G7RB 3T3PB 3WIFB 4M5YH 1M1XB 2QADC 1YJDH 3C5ZA 4QWWD 4R84A 4ZFGH 4M8QB 5BRQA 3WU1A 5JXED 3K72B 3MXWH 1A64A 2HFEB 4NO2A 2I85A 5DD0L 5E4OA 2A3TA 5IREA 2AVGA 2OR8A 1NGXA 1ZWIB 5FGSA 5L0QB 3TNMB 1TYRA 3HS0A 4N0FB 4GG6B 3V0VB 2QKIB 4TVUA 4YLCA 4XVSH 1QQDA 2CK2A 2IBBA 4JRYA 1H19A 3L4XA 5IHBA 3OMIB 5BJTB 2XBDA 4YSCA 1IAIL 1Q0EA 5DC9B 3AT9A 1ML0A 1YNTF 2VXQA 4QY8A 3RURA 4PWKA 2ZKWA 4D0CB 2BCKB 5C0ND 4LGSB 3DSFH 3WI9A 4UOQA 4EDWH 4RISH 1AIZA 3SE8L 2W60B 8FABB 5GZOC 4XNUH 5E0QA 1PEZA 2H45A 1NLBL 5JDSA 1BD2D 2WVUA 4R90H 1CD0A 2XUWA 2E56A 5KYXB 3AGWA 3FQTA 5GJTH 3WUZA 3HAEA 1KDIA 4U1JA 2YUZA 1WZKA 4U7SA 2JLPA 4MMZC 1E4XL 2BVYA 1N3NA 2HJLA 3NGBC 3MCLL 4WWKB 3UJJH 3ZKXB 3N44B 5F9WB 1DEEA 1HINL 3ERXA 3MGAA 4ZS7L 5HHXL 1BOYA 4NQDB 1D9KA 1SY6L 3FO0H 2WXPA 4V1DE 4GKNB 2FB4H 3CDGA 4AUUA 1S7TB 4XC3L 4G83A 4IMLB 3B9EA 3A3YB 4CMHB 3O0RL 4DQOL 1T0MA 3US1A 2UX7A 2ZXQA 2K6YA 5C0IA 4KVNL 5IJBC 5F2FA 4MXVF 2WXRA 4E41D 3S8GB 2A83A 2OX5A 4N5UA 1UM6H 2A0LC 5IOKA 2OZ4H 3L3HA 2OPCA 3U4KA 1ED3B 4FMVA 1F42A 4EZKA 4ZAKA 2F5AL 1BD2E 3FCBA 5DJ0B 1JTPA 5D7IB 5FYLD 1CGVA 4DEUA 1EERB 2KBGA 5FFLA 3WBDA 1M71B 3AY2A 1AP2A 2BZDA 1HOCB 2H0JA 3EBAA 5C0BE 2BINA 3W39A 1VHPA 1YO4A 2ZOKA 2X7LA 3QH3B 4MJ4A 2WNKA 1XX9C 5D71H 1JUFB 5FECB 4ODSL 3D25B 4B96A 3H9SB 2HJKA 2V5SA 4EDXA 1CYGA 2Q7NA 1TQTA 4X7EC 4L05A 1VEPA 2EE0A 3HW7A 4IOSD 4H26A 5E7FA 5TDNB 3TT1H 4OZIE 4OI7A 4S2SB 4FNQA 5HSFA 2IDQA 4GS7C 4AM0Q 5BV7B 2ZG3A 3CC5A 1E6JL 4RAHA 4N2EA 3T4AC 4DZBB 4YO0A 4IGBB 3FU7B 3DDFA 4Z7UF 3MBXH 3ZLQC 2K1MA 3PQYD 3RTQD 2OCCB 1W6LA 1L4IA 3HVNA 4TNVF 3V5KA 4DO6A 1QR1A 2Z65C 1CT8B 3GNML 3IXTA 3FKUS 4KRLB 3CBJB 1CI5A 3L3GB 4K5MA 5FWRA 2DLIA 3G9AB 1I1YA 1X5KA 2QVFB 4KVNH 3FHQA 1F8TH 4WAFA 1OCCB 3STLA 4XMPH 4PJIB 1SF5A 1OTUD 5GS1B 1QSFA 5D2NB 4EAEA 1NCDH 3X11B 4E9SA 3PG2A 1IAII 1NAMH 1KBGH 1BQHA 2QADD 3MV9E 4DP5X 4TTDD 1ADQH 1Q9LA 2VR5A 4TF4A 1MG3C 1K6QH 4M8RA 5HVWA 4J8RA 5LAXB 5MP6H 4PRID 3BPNB 1ZE3C 1YMMB 4KPHH 4QGTA 1H15B 1LP9E 4YSSA 1GTFA 1UEYA 5BOPA 1J5DA 1S7XA 4U3SA 2F53E 1XZ0B 2FL5A 3PGFL 2PPEA 4PRDB 2LOEA 5IJKA 1XGRB 3NT0A 4TVPD 4G9FB 2OZ4A 3ZE0E 4DT2A 3QDAA 3ESNA 3KG5A 2HT3D 3P0VL 4RQQA 1V3MA 1CLCA 2WGXA 3TIEA 1B6DA 1AFVH 3QIWD 3X3FH 3B2VH 4OZIA 1NMBL 2BP3A 5AL0A 3IFLH 5KSBA 3ZDYB 1FIEA 2EABA 3T71A 4W9FC 1OSPH 4TNGA 2DQUL 3AQZA 3UGEA 4NUGL 2P9RA 2ZWLT 4PGCB 3JWDH 5M7QA 1J0KA 1X4YA 1UOKA 4J4PA 4MA3A 4QRQB 2MPAH 2PO6B 4ZX6A 7TAAA 5EOTB 2VMFA 3DBXA 2E0PA 2NXZC 3KYMA 4F9PA 4R7NA 1IBYA 1PBYA 4PBDA 4G8GA 3D52A 5JHDB 1F6AA 3ZYOA 4UM8A 2Q2EB 5C7ZA 4KY2A 5E6IB 5TK4A 3PP3H 4OGXH 5CJOH 4WKZA 3QXUA 4HCGA 1RZFH 3I6GA 1QBAA 1BHGA 3BP5A 4W9HC 4HOWA 3L4VA 2Y36H 3LKRB 3WAKA 4XCCH 2F7OA 4KHXL 4YNYA 2G2RB 4QJ3B 4OFPA 4BYHA 2H2PC 3CHPA 4OV6F 3SYCA 1U8IB 2XXGA 3DXAB 3FFCA 4MQSB 4PJ8C 4UOJA 3QCTL 4XPTH 3RFZA 1OGAB 2VQ1A 3DX4A 1GC1L 4PJEA 3V52L 3VGDA 5L4JA 1HL9A 4LVOB 1NCDL 3FQRA 1WFTA 3HLAB 2GUYA 1BZ9B 1RUPL 5E8PB 1IUZA 4LASH 4RAUA 4AEEA 4UIKH 4V11A 3HC4L 3SDXF 3F3HA 3TBTA 1E8YA 4L3EB 2R0KL 5BV7H 3LIZL 3X13B 3EUUA 4PV9B 3MRNB 4L8SA 3G5VA 3JTTA 4KKCD 1D5XB 2CO3A 3U9PL 4Z7OE 1C1EL 3DX1A 3LS4H 1AO7E 3FFDA 2VDML 1J12A 3DGDA 3F5WB 4CVXB 4NGHH 2EDOA 1O6SA 1WG3A 3VFNA 4N8VB 1AVAA 1D6EB 3BISA 2RB8A 3TBCA 5KYUB 2YXWA 2CLRB 4OF8A 4MCZA 4OM0L 1NBVL 1NAMB 1FZKB 4P2QA 1RV6X 3B83A 1IE5A 4BSWB 3CPLB 4P4KD 3TBBA 1IAKA 5HGAB 1JOIA 1X4ZA 4N90D 3EO9H 4KWUA 1TQCB 4FTVB 4Z7NE 1Z9SB 3QZNA 1U95A 1W2KT 5DUPH 3U25A 4DERA 4IS6A 3KXFB 1FLRH 4LASL 3PWJA 1RP8A 3T0ED 2CCVA 4C4KT 3U1PA 1SYSA 1DJWA 3P2BA 1N5YH 3S8FB 5IR1A 5DJZA 1OANA 5ICUA 2DWSA 3TONA 1PF3A 1IBZA 3OAUH 3B7SA 1YEDA 3SPVB 3FH8A 2VLJE 4F9LC 5B8CC 4LBEB 1R17A 3AC0A 4Y8DC 3TYGH 1U4FA 5D1QA 1WBZB 1XSOA 3KLSA 1IC7L 2V2TB 4O5LH 2CO1A 5CWSB 4ODUA 1DQLH 2UY7B 4DOHB 2FT8A 3RFRA 3OG6B 2BNRB 4BHUA 3HE6B 2WNGA 3GZPA 4AITA 5CEZE 3RUGE 2AXJA 3OJDA 4G71B 4UQ2B 5CJQH 4I87A 3TEYA 4M7LL 4KKLD 5CP7A 2YSSB 3EF4A 5HYIA 2A9NH 1SJEB 2WQWA 4DW2H 4HBCH 2GSIB 3LIZH 2WB1A 3EGXB 4NZUH 1TVBB 2DRUA 4A6YB 1JZJA 4ZRGA 1KTLA 2KT6A 4U1KA 3TYFA 1WICA 2MSPA 4P0DA 1MELA 5KJRH 5FLVA 2PCXA 4JE0A 3MLVL 1H0DB 3QEHA 5B1JA 4AGNA 2EVGA 4FKEA 3SOTA 3S3DB 4NZDA 1IGTA 4Q9RH 4FQIH 2H0FA 4G7YH 2EVIA 3A22A 3C2AL 1IFGA 1NDGA 2OSLA 3BH8A 4IBTA 4RRPM 1KFAH 4TUJA 2EEDA 3SKNA 3QFJA 3RY4A 3HOGA 2VR4A 3QDJD 3EJJX 4P5MB 1H3XA 4IIQA 4E41E 3HCVA 4JZNA 1N64H 2EICA 4EEEA 1IC0A 2NX5A 1KV7A 1WIUA 2HG0A 1IT9L 2EE3A 1E5CA 1MFBL 1K8IB 4Y4KB 3NA9L 4RGOL 1TJMA 1GGIL 4G82A 1ZLWH 5ITFA 1EHXA 3OKDB 4M7LT 3QZWA 2IH3A 2YKKA 3TN0A 4F57H 2P5EB 4K9JA 3P2TA 5FGBA 25C8L 3UBHA 3HPLB 4ILDA 1MFVA 1NFIB 2V2XA 3C8KA 2CUIA 4L2YA 3KD4A 4YHZL 5B1CA 4IIQC 5CD5C 4YDIL 3WJMB 4IBZA 1VB9A 3O8XC 5B3JE 1A9EB 1NCBL 5KS9A 4DCQA 4FZEH 4QNPF 1JWUA 1EEZA 2FJUB 1YC8A 4U1NB 4LL4A 1B6UA 1U58A 2VISA 4HUVB 3KLAB 3L9RA 3MRCA 4HGWA 2NY2C 2AEIT 3U4BH 4YZWA 4ODTH 2WAQA 3L16A 3U0TA 4X83A 1L6PA 1JHTA 2KQNA 3LMJH 2WZ0A 4HIJA 4XTRD 1IILE 4I3GA 1J5HA 4QLRA 4CKVX 3QJUB 3VXNA 1I9JH 5IQLA 1EHNA 1ERNA 4R4ND 4BRJA 3D18A 2XQ0A 5HHME 1MHHA 2UUDK 2FWSA 4XMWA 4JHBA 3IGKA 1HSAA 3WXVL 1MEXL 1Z7JA 2G30A 5D2LE 5AAWC 1TMCB 4LSSL 2RCSH 1MCSA 2FJFB 3F6IA 2HRPH 4Q6IB 4KX9A 1U91B 3IU4H 4WI9A 3T4AB 5T1MB 4CJ1A 5CILL 5ADOH 5IWLA 5D96C 1EO8L 1J11A 3FONB 3WFDL 1HHHB 1BREA 2WANA 3Q7JA 2CIKA 3FB7B 1P6WA 4QJ5B 3FSVA 5IV2B 4XPBL 2PWHA 2PYFB 3FT2A 3U79A 2PMZA 3WN5C 3U82B 2BXYA 3D85B 1IQDA 3EDDA 3RVVC 2QQLL 1JNLH 1ACYL 3VGEA 3C60A 3KVPA 1MFBH 4OF5A 5TE4H 2Q87A 4I2XB 2O5ZL 3GHBL 1PZ2A 4WWPA 5B22A 4B9JA 3VRJB 4HWBH 5C0RH 3NIFB 1KB5A 4QTHA 4CU8A 4PG9A 3GBEA 4ZSOB 2EXWD 5ICXB 3FT3A 1MZZA 3R8QA 1SYVB 4OLZH 4XNYH 5E9DD 3O81A 5B1AB 4UNUA 1H8NA 3WNKA 1DQVA 2ZUVA 2PW2A 4POZD 2W0FB 3F05A 2Z7ZA 4NUPA 1QO3A 5EIIA 4ZPVB 5DJ2A 4E2OA 3K6SA 4YXLL 3KW8A 3L7EA 3GO1L 4CN6A 5JOPE 5MEOA 4NOFA 4OZHF 3Q2VA 2XWBB 3DJRA 4YEEA 3PIQA 4WFGD 1TETL 4Y2NA 1IGCH 4ZZKA 1JRHH 4EN2A 5GS0C 2NY6B 2EEFA 3AAZA 4LIQL 1A7RH 4JZJB 3DRQB 1IARB 1S8DB 4LVNB 2VL4A 3U6RA 3BPOB 4UT7H 3WDIA 4A7UA 4KTYA 3ZT6A 5EF0A 2XWEA 5FKAA 1MCWW 3AABA 4GXUM 2Y1ZA 1NINA 3A6OA 4LMQI 1E4HA 4R96A 1G7MA 4GQRA 4XP1L 1C16B 3FN0L 2DLGA 4HPHA 4HWEL 4FXKC 5ACLA 4DUVA 1Y18B 5FYKD 2QQNH 4LLDA 1X5HA 1ZHBB 5IB2B 1TR7A 3F85A 4JG0H 4HJUA 3B6SA 5DMYA 2NXYC 2WYZA 4K3JL 4ELKB 4BINA 3M7FB 2W8CA 3ILPA 2I32A 2G9HA 2ZOUA 5D96B 3P3SA 1OCRB 3MNZA 1H6TA 2XSKA 5HVGB 3KLHC 1FNEA 5BUPA 5K9KB 1E2VA 5FYLL 3RTLA 3T2OA 4P05A 3NABH 3NSYA 3UYRH 3L3JB 4N24A 3X14B 2XQBL 2WBKA 2GKIA 1F02I 1EVTC 4X4ME 1JGIA 1LDSA 1A6UL 2VZOA 4OFKA 4YE4H 5DDHA 2XRAH 5KJ4A 2V5TA 4JFZH 3UGUA 1U8PB 5JORA 1NICA 2W0PA 3VGAB 4BCXA 3C6LD 5J6HA 5AW9B 3VD3A 1JERA 4U0QB 1KEGL 3BJLA 3G6JB 2G3ZA 1F4AA 4IU3B 3RAJL 3SKOB 1G9HA 2EILB 2CWRA 1AKJB 1V3KA 3V9CA 2XOTA 5JPNA 1K85A 2GW5A 3O3EB 1YNKL 4IBQA 4JB9H 1CTOA 1RHHA 4PTUB 2X89A 2VLKA 4FQHB 2D4DA 1ES0B 3OXSA 2E6QA 4KKRA 5E1IA 1RCYA 3S5YA 2IDUA 3FH5A 4MJID 3T6QC 3KGSA 2M1KA 2X3BA 5D7KD 1NGPH 1G87A 3BSGA 4IHOA 4R7XA 2O5YL 2WPGA 4WW2B 5E2UH 4ECNA 4RMWA 2DLFL 1I9RH 2R7EA 1VZIA 1FCCA 1TXKA 5JPMC 4KI5C 1F3DH 3DV4A 4PHZA 2XVKA 3QIUD 1MIEL 2CR6A 2J6EA 3FB8B 2KDGA 4OD1L 2EXWC 1U8MB 5ESAA 4NI6A 1BQSA 1UM4L 2WQXA 3FSAA 4PRPB 4GAJH 3OHMB 1IGFL 1SDAB 3LB6D 1JCVA 5C07E 1UADC 1PZCA 4HK0B 1BQLL 1G1OA 1PX3A 1ZVNA 1V3JA 3WNNA 2X4PB 1L9MA 5DVNA 4NOBA 1LEKA 1ZJAA 1OAZH 2VRAA 2VJXA 1O7VA 2F6AA 3S96A 3WDJA 2H4EA 1MNUL 3FU3A 4ELME 4MQTB 5J9PB 2XU9A 3OSKA 4MDJB 2Y23A 4BKSC 3VW3L 2ERJB 2WM0A 3KYOA 2CBOA 2XBTA 4I18A 3K8KA 1R3HA 1OE3A 1DJYA 2NPLX 4H0GA 4H25A 5CLWA 3VXRB 5GS2H 2WLJA 2DEXX 1NGQL 2EC8A 3QJQB 4Z0BH 4LVHC 4L1BA 4X7TA 1ZHKB 2QSCL 4AMKH 1X9RA 4GO8A 3V4PB 1FZOA 3PNRB 3QZBA 3CX2A 1SHWA 3O4LE 3ZE1B 3V6OA 4F7PA 2HH0L 5EC2A 3MBEC 4I9WE 2EADA 4X8GA 3CFEA 2YR3A 1DUZB 1NIBA 3NP4A 3FSZA 4NP4H 3IT8D 4XP9L 1N64L 4LCCB 5E8DL 5BZWA 3K4AA 1HZKA 3RWHB 4OCLC 4Y16A 4XNMA 2CZNA 5DR5L 1XAUA 4NQCB 2NLJA 1DJSA 3CLWA 3BJ91 5KAQF 5D9SB 5I6XC 5IHLB 3UROR 1M9WA 2FEDD 4M43L 4H2AA 1RSFA 5BMFL 3H9HA 4P5TD 1MRFL 1FO0B 1U3HD 4CILA 4JR9L 1A3RH 4HV8B 1NCGA 3MBWB 5F7YC 4HYTB 2VGLM 3EW3B 3U7YL 2OTUA 3IWVA 2QR0B 3IVKA 4GI8A 4IGBD 5FOBA 4ZJ9A 2CHNA 5GS0D 4OLXH 1R19A 4X0NA 5JMOC 3G6AA 3ZTEA 5GIRB 4L5FH 4XCNA 2AEPL 2QSCH 3P30L 4EIBA 4NM4H 2HFGH 4N9GA 1UM5H 4L37A 3LMJL 4HS3A 4WO4A 1IAOA 2B59A 4P3CH 1OTTC 3HR5A 3ZSSA 5FR3A 5EFIB 1HIML 3DARA 3E6HA 3AB0B 3LHPL 4V2BA 2YAHA 4AJVA 2GJZA 2XXFA 1JHLH 1A47A 2R27A 3U30C 1N2RA 1G0YR 3LB6C 1DSYA 1KYDA 4P2OB 1VCAA 5DK3A 2QGEA 4PGEA 1SJXA 3LN5A 2QGCA 1KYOK 4JPWL 1GZPB 4A2EA 3SGJC 4RZCA 1U8CB 4M48L 4W4NA 5DK2B 4AKQA 5CILH 2UWEB 1P7QA 3ZK0A 1MRFH 3EOBB 3GLAA 5JNYA 3T77A 2ZKMX 2CGYA 1B4RA 1IKFH 1C5DB 1GOHA 1P7KB 5C0GA 3ARFA 1FZMA 3V0FA 1V8HA 3MJ9L 3VD7A 3OLIA 2OYKA 1E9QA 1EIBA 2R2BB 3HNSL 4PCKA 3I2CL 5D93B 2EIZB 5G5DB 2UZIL 2VZSA 1YHPA 1J8HD 4L48A 5F3BB 4E9RA 3MLWL 1AI1L 4LCUA 2CJTA 4FABL 1YUKB 3PXJA 5EU6A 4QXUL 3MA9L 4HEMA 5AYUH 5GRJL 2GC4C 2EH7L 1MN4A 4N0UE 1MW0A 1OGPA 1UM5L 1R0AL 4ANXA 1Z3GL 4GW5A 1K4DA 2HFFA 3MMEB 2PXYD 4U3HA 3VXUD 3ZKMC 3QEQB 1J1OH 1C12B 3WFEH 4APXA 3CZFB 4PG2C 4XN9A 1WRFA 3Q2CA 1XZWA 2VITB 1GPOH 1SUHA 2DD8L 1S7VA 2CGRH 3QI9B 3QZOA 4XHJD 4ODHL 4NLAA 3F84A 1DVTA 3P3TA 2NZIA 3IDMB 4X9HA 1N7MH 1U4EA 1WGVA 5HD8D 4IBYA 3QJFB 5I17B 1PZBA 4WHDA 3UTTD 3TA3B 4FG6D 3EDFA 3TO4B 3T2LA 2EC9T 3HG4A 5D7LE 5DJYA 4E42B 2WOBA 3OV6A 1GS7A 3SJVB 1UKSA 1KT2A 4Y4FB 2UXTA 3BZEA 3BKYL 1CICC 3V4VH 4ZX5A 2PPDA 2HXAA 3QUYC 4M6NL 1CFTB 1M3IA 2APTA 5EULV 3TBVB 2FQDA 3FT9A 1UH2A 5I73C 2FECL 2ZD0A 4U1LB 2NY0D 3IJSA 4TQHA 4Z95L 5DJCA 4G8EB 5MERB 5HHOD 4P2QD 5A3ID 3MRFA 2H7WA 4XC1H 2BNQD 3BXNB 4OGYL 1EMTL 4JO3H 4JUTA 5ALBH 4TULH 5I1DB 3C87A 1E67A 1XF3A 3PHQB 5J13B 2YGQA 1BDYA 1XGTA 4DGYH 4IOIA 3QQ4B 2QPSA 3BN9D 4D9LL 2JI3A 2OJEB 1XGQB 1YMMD 1ZANH 1JGEA 2WWKO 3KCPB 1A1NB 2OMZA 3IFOB 4WIQA 5F0MB 4HJIA 4KQ4L 1Z66A 4X99A 4XP5H 5KN5B 4UV7H 2VAJA 4Z6AT 4BSVB 3CVIH 1OB0A 3QHZH 4PLJD 4ZNCD 3ZDZF 1T1ZA 2UZXB 1WPCA 1FFTB 1AHMA 3QWRA 4G7VH 5HVFB 4YE0A 4YSRA 2Z0BA 1GYVA 2TSBA 5L4FA 3OGCA 1CIUA 3VXUA 3MLZL 2A73B 1BBJA 1BZDA 2WOYA 1CJYA 1KY7A 1GMEA 2QQKL 3HS0B 1SUJA 1TFHA 2OP4L 3HTLX 1S5HA 4N0FA 5SWQA 4O58H 3VDBA 3ME0B 4GXUN 3PRZA 2NQ3A 4X6DE 4L3CB 2WK2A 3O8XB 5DEZA 5GS3A 3HG2A 2BSEA 4LCYB 3NN8B 5ABAA 3MNWA 5EBWA 4KZDL 5D7IE 4E36A 4IRSA 1AMXA 2AK1H 3QR1A 3MV7E 4PJGE 4P8QA 2W60A 5EO9A 5C0BB 2RD0A 2ICEA 5KYXA 4XMKH 4G5AA 4K2UH 3SDCA 1Z9NA 5L2JA 2W88A 2X6VA 4ZYKA 1CN4A 5DEGA 3DYOA 2E8YA 2MWCA 2NY6C 1SQ2N 4FEIA 4F2MB 1JZ6A 5C09A 1CR9H 4LNRB 5TE6H 2ZICA 4MWFA 4OFDA 5SWSD 4I1PA 1ETZA 3NDYE 4F3FA 6CGTA 4L8CB 3UXFA 1J9TA 3MLRL 2IEPA 4XVSL 3GIVA 5D1QE 1Y07A 1E5UI 2B7DT 2OMXB 3NRPA 1YEKH 3AFLA 4OZ4A 3TWCH 2YA1A 3VCLB 4UQ9A 3I75B 1RHFA 2MCMA 1MFMA 4BUHA 5SX4H 4OD1H 1G7JA 2OMUB 5AZ2L 1SXZA 3QJXA 3IDIB 1I8MA 2C3XA 4XNUL 2M2DA 1AQDA 1E5AA 2OQJB 2X6AA 2Z31A 4PIBA 5BUAA 3WFHA 4ODVL 1VGEH 2I9LB 4PUBL 3F64A 4ZMWA 2PNDA 4QRPB 5I1CH 4IKJA 4PJIF 1XF4A 1I8LC 3V4VB 1BVKA 2HWZH 1J0JA 5I8OL 3L3OC 3W39B 2ADIA 5E5UB 5I1LB 4MJ6B 3O6FB 3ZRSA 3KAAA 3BSZA 1FH2A 5FECA 4U1GB 3D25A 4J2XA 4P4RB 2F53B 2K8QA 2ICES 5I8KH 4Q9BA 2BM3A 3LS5L 3VACA 2V9UA 1U33A 5I74B 4RFEA 4LLVB 3C12A 3BP7A 3ZE0B 4JZOA 5SWZD 1T5KA 2HVKA 1AGCB 4X6DF 5F0PB 3FTGA 1HH9A 3TZVB 1D5BB 1J8HB 3UADA 4PJXB 5BZDA 1ET7A 1JV2B 3ZDYE 3ZKXC 4DN4L 1DBJL 5DJAA 3RWFA 3WEXA 4BFIB 4J23A 3VXSB 5GISL 1RZKH 1F4HA 4ZMLA 3ZTDC 4GSXA 1NH6A 3PGCA 3IXTB 4HC1L 1YDPB 2PR4H 4H0IA 4LPVA 3U6XA 4DVBB 5MI0C 4NRXB 2CCLA 4PBVC 1UWXH 1PLGH 4NDMB 2P8LB 2PTVA 4LRNL 2XTJE 4ADIA 5IW6B 1FDLL 1X7TA 1MCRA 4ODXB 5HI5C 5IWLC 4YDKH 2YQ3A 5DD5L 2QQNL 2ITDB 3CWGA 2DWXA 1YYMH 1BBDL 1T0PB 1JK8B 3DSNB 3DVNA 5JHDE 3SQBA 3UPCA 2BRRH 3G6DL 1ZLSH 3RU8H 3TIDA 3LNHA 1DDTA 2X70B 5C9KA 4K3JH 1KJ3H 4NAQA 3FC8A 4ZO8A 4WSKA 4B9GA 1UZ8B 1Q94B 3OZ9L 4OIAA 1OK0A 1YMMA 5IB5A 1ID2A 1OIOA 3CLFH 1ZIAA 1E6JH 2YD2A 1K2DA 1PY4A 2ZAGA 3PAYA 4YDMA 3REWA 2GK2A 2LU3A 3TIEB 2N0KA 4XGZA 4DWHA 1CU4L 1QOKA 3ZGIA 3MRLB 3MV01 5D7LD 5HGDA 2W9EL 2O1AA 3RI5F 3ZTJG 2Y7SA 5TK2A 4JRYD 2BP5M 2ATPB 2B1HH 3C08L 3IRZA 4N1EA 1IAMA 4QOKA 4NAMA 4UBDD 2XXCB 4HCRA 4MXWH 3BP4A 4PBXA 2KZWA 2XKNB 4P57A 3ESMA 2YD5A 2ZUWA 3D2UA 3QUKA 4NYLB 3ARZA 3I9GL 3OGOE 5IJVA 5E95B 3KXFD 5JUEL 3D5OF 3LNEA 1LO5B 2J8HA 1W72B 4DQAA 1U21A 3WTUA 5E6UB 4G8GB 3DX6B 5JHDA 2F7IA 4K71C 4GI6A 1ZLSL 4DP0X 4FMKA 2VLKD 1RURH 5BUGA 3B2XA 3MJ7A 3ESUF 5CN1A 3AJ7A 4U6VL 3I6GB 2CDEB 4FKKA 2H6UA 1PW3A 1T7ZA 3HG1A 3V10A 1D7CA 3B5TA 5M94B 3C6EA 3LZFH 3CCHB 2X1XR 1RZGB 4D0DA 1JPTH 1DCLA 4HHAA 2H3NA 2P44B 2MIZA 2HKHL 4RESB 3TBWB 2BIPA 3P02A 1MIEH 3UO1H 5D5MF 2R23A 1NBCA 5HPMA 3MSPA 4WLCA 2X4QA 2CDFB 4G9FD 4YHNB 3RFZB 1PNDA 5FUCE 2DDQH 3QUMB 3GHEL 2AW2A 4JQVC 1L9OA 1OEZW 1AO7D 2EUVA 1ZPLA 3NRQA 1FFNA 3KXFE 5E8PA 2XX0A 1D7BA 4LSUH 1IGJA 3IWUA 3OF6A 2XC8A 1FNSH 2BW5A 2ZNXA 3TEWA 4L3EA 3BKML 1BYOA 4LOUD 4N3TA 1HI6B 3P54A 1X5GA 3Q3GA 3HHSA 2QZ5A 2QMKA 4Z78B 1QD0A 3FXIC 4Y7OC 1KGXA 2CBQA 2WSDA 4LSRH 5CSGA 3ULUC 1TEFA 2J7LA 4K7PH 3EZ8A 4DN3H 2XBZA 3QXDB 2QPDB 2D3VA 1F5WA 1LLAA 4PEEA 1DQIA 5KBNC 4KOBA 1AIFA 2AEOA 1KENL 1OCWH 2DQIL 4FQ1H 2XPGA 3OPZH 5E9DA 3VWJC 1TU2A 4MAYC 5CIPH 1IAKB 2IALB 1NPNA 3DPBA 4M1CD 4F7MB 1MLCA 4Y2DB 5EUOB 1AAJA 1F97A 1FNHA 3IFNH 2W91A 3DVGA 1H6EA 1U95B 2R15A 4R4FH 5GJSL 4LRIA 4L0YA 2KLSA 3EJRA 4HT1L 4UV4L 2YC1B 1Q72L 2IPKA 3A47A 2IADA 2B2XH 1CICA 1R3KB 5DHMC 2VLLB 1T0NA 1MDAA 2XY1A 5EBLA 3UTTB 3DJ9A 2MCPH 4U0RB 5TDOB 4XAKD 5BMFH 5IR1B 1I3UA 5DJZB 5FO2A 4FFTA 3BP6A 1FVEB 1E65A 1SN2A 3ZE0F 2A6KA 3VXTB 1SFHA 4LEOB 2EDJA 4M3HA 2B77A 5GGSA 1BFOB 1NBVH 1KGYE 2A74B 2VERA 4X9GA 4HS6A 2RBLA 2EECA 4A37A 1YAIA 3ETBF 4HUNB 4MNQD 4NZ8A 4HJ0C 4X4MA 3SGEH 3KW7A 1S9KC 2QELA 2NXZB 1C5BL 2NDFA 1UYWH 2DICA 3FRPA 3NAAL 3VVVA 3ZT5A 2P5WD 3MV7D 1YEWA 3FB5B 2I5YL 5I5IA 3VAEA 2DMHA 4LLQA 2QSVA 4YDVB 5FKPB 5C3TA 3DC0A 2GT9B 5F7NC 4ONFL 4CU6A 5JQIB 1KZYA 4EUPB 4X8JB 4A6YA 1MI5B 2DQJH 3P77B 1JZIA 2HVJA 1XIWD 2AEQH 3P73A 1NFDB 1E27B 1PYWB 3MUGB 1BYPA 4GIOA 1AR1C 1WV7T 4JKMA 3GPSA 3QEHB 4XPAL 4ZG1A 2ITCA 1DQJA 1RUAH 2A1WL 1FBIL 2VT0A 4Q4EA 5F6HJ 1PCSA 1OAUH 4TQ8A 1LEIB 4OT1L 2BSCA 4HSQA 2R59A 2Z93A 3HMXL 2XACC 5E00B 3SB3A 1T6VN 3SKNB 1TEGA 2GTZB 5A16A 2DYPA 5CEXB 3O6ML 3DI2B 4XCCL 4IIQB 3MO1B 1RZKC 2WQUA 5CJQL 3VI3B 2NX5B 4QRTB 5FO9B 3WLWD 3E80A 4ANWA 3P4OB 3LQAL 2BSED 5F1NA 1MLBB 4RMVA 1L7TH 5D4HA 4P5KA 3WFBH 1C5BH 4PW9A 4TUKH 4F24A 4QXUH 3DMMD 3L54A 4N8UA 3WFCL 1VADA 4JO4L 2KZBA 5I5JA 3TWCL 2Z1KA 3T8MA 5F7UA 1RLBA 5GGVH 1MG2C 2P5EA 1AXTL 3MV9D 3V0WL 4WDIB 4LEXL 3HPLA 2EP6A 2HT2C 4PGZA 5AVRB 4G11A 3HZVA 1SMDA 2QQQA 1NCWL 3QIWA 3U9UB 4JY4A 1FC2D 2IAMB 3Q06A 5FW6A 2C9UA 3Q8FA 4A2LA 1KELH 3X1BA 2CGRL 3NJVA 1VACA 3QUYD 5LLIC 5B1JC 1AOZA 2OCJA 3O2WL 1MXGA 5EZOL 3WIIH 5I75B 2DQMA 4GW4A 4MFHA 5CFAA 3BT2H 5DRZA 3NP3A 5DZJA 4DAGH 5IMLA 2W94A 3PDGA 1F2XK 4LB8A 3B5HA 3NQIA 3NJNA 3QRFM 2CKBL 2HYMA 2J57A 2NXZD 5FYJU 1TQUA 3DURA 4AC2A 3UJTL 1JZEA 3LQAH 2KKQA 4N22A 5A2KH 4FQXC 3GSXA 3TESA 3UTSD 1UT2A 4S0SD 2RR3A 4PB0L 5T3ZL 4Y4KC 7FABL 3FONA 1HHHA 4C83A 3I6KB 2J1KA 3L3DA 3RNQA 3SDAD 4DP9X 2CIKB 3FB7A 3WFDH 3KNBA 5AVSB 3WKPA 3RZCA 4JFQB 2JIXD 4Y5VB 1WAAE 1QFWL 4CU7A 2E9IA 4O02H 4WW2C 4LCIL 1QLFA 4MASA 1ZANL 2CDGA 4JFFE 5A43C 1JNNH 3CBRA 4N2IA 5FA3B 5EOQH 1I8LA 1AGDA 1F86A 2PN5A 3W37A 1SZNA 3RDTB 1ADQA 3QULB 1LD9A 1ZEAH 2PTTA 1MHPL 5DR5H 3VXMB 2EDYA 4M8VA 2F54B 5DRNB 3VNZA 3M88A 2DKUA 2VC2L 2BZ7A 2AJSL 2QTVA 4U6TA 4H0LC 5CNHA 2GCYA 3RVUD 1RUQL 3FQXA 3QNZB 4WHTB 1B0GB 5GGRY 2XDHA 1YEJL 3NCJH 3KH3A 3LKNB 3L5IA 4RMQA 4HVBA 1PZAA 1T1YA 4ZZFA 3VFSB 4OLXL 2AGJH 1A7PH 3THMH 4S1QH 3TCTA 5KVEL 2N1TE 5CBAA 1WA1X 3W2DL 2QLVB 4I18C 5MEOB 5FDWB 3CZGA 4OUOA 3FBKA 2DJSA 1SVBA 1VFAA 3VXRD 2QZQA 4M1DL 3MRDA 1HKFA 4GI9A 1CG9A 4ZUTB 5C08A 4DPAX 2MFNA 5LBSA 5DJDA 1JGVH 2HN7A 4YMPA 4GO6B 2GITB 5K39B 2GB2A 3MJ8A 2WBJC 3E8VA 3K6DA 3JWNG 3K6IA 3ELAT 3Q9PA 3T6WA 3U6RB 4PY7B 3GXTA 2AZUA 2AJZB 4DFIA 5FKAB 5EU6E 1P6FA 3LV3A 1HH6B 1JP5A 1MW2A 4Z7UE 5C0CA 2YUXA 4N0UA 1WUZA 4ODBD 2AJ3A 3GYRA 4GXVH 3VXOB 4N2AA 3WL9A 2VR9A 1BXVA 4S1SH 2EO1A 5G4OA 3FJTA 1A8JH 2BOLA 1C16A 3SZ6A 1KTJA 4CBPA 4D7BA 4GKSB 3MRHA 1HWGB 2UZYA 4BJLA 1PIFA 1ZS2A 2X4SA 5CUSH 4M5ZL 5IB2A 3L48A 3EJYC 2WYTA 1I4FA 1YN6B 4OCWH 4PYGA 3VSUA 3WNLA 2WXKA 3MRPB 2CLVB 3THML 4YZFF 3VFRA 4M8QA 2YD9A 3ILPB 3N43F 1NAML 3QDME 1IBBA 4AE1A 2VTFA 2FBJL 5BRZE 2VMEA 2WJ5A 2PP8A 4N6RB 3FZUC 2MQCA 3LDBC 4NO2B 3DIDA 4GIPD 3UAJA 4GG6E 2LVEA 2X2YA 4KMTL 1JPFA 1A6VH 1K5NB 2XY2A 4Z3GA 2YUVA 1J5CA 3W38A 4N2FA 5D4JA 3RKDD 5C2BL 2HUEA 5I15L 2CM5A 3B3IB 3MAWA 3O4OC 4OGAC 3MA7A 3WFEL 5HDOA 3VTAA 3VH8B 4Y9EA 4AYBA 1MQKH 5C07B 3SPGA 3BVVA 3AU1B 3IPFA 1OAKL 4FXKA 3WJJA 1KGCD 2V3FA 2CRMA 4UQIM 5TQ0H 3X3FL 2YEZA 4ZFOL 1X9LA 3ZL2A 2LVCA 5JR1L 2BCKA 5FK9A 4RSVA 1CBVL 3RBSA 2KL6A 4HIPA 2HTKD 1B0IA 3GKWL 1MKFA 2HP4A 1NIEA 4J3VA 3IDNA 4DJMA 4G6KL 4MAYB 4S0HA 1E5BA 5C2UB 2HT3C 5DC0A 3FQTB 3MRRA 3O2DL 2WVVB 3N85L 4G6JH 4DKAA 1ES0A 2X2IA 1Q72H 3LCYA 1KJ2L 1RU9L 3FCSB 3DMMB 3H3PH 4ZW3A 1QYGL 4HKZB 2KQMA 4NO5B 3NSFA 5EO1A 4V1DB 3ZGHA 1A1MA 4ADGA 2BK8A 3QYMA 4NN6C 4PJFE 5E08L 3QDMA 4WW2A 2MCPL 4Y1AA 2FBJH 3O45B 2Z91A 1UKQA 1VERA 4Y19B 1SXCA 4Z95H 3BVUA 3D3VE 3TBYA 4GKNA 4FQ2H 4JVPA 1JWSB 3BRDA 1I9EA 1RJZA 2G5UA 3LPFA 3QUXA 4KHXH 2R4RH 1AS6A 2JQMA 3F7PC 1A3QA 1I82A 2A83B 2OX5B 5D7JC 4JO1H 5GGRB 1X5AA 5D7SH 3K2UH 3RVXD 4XN5A 4OQ1A 1N67A 1TTCA 1U8NB 4Z3JA 1XH1A 4KTDH 2ZXEB 2CKNA 1LEKB 5H37G 3WXWL 4KQ4H 4TUOB 3MCLH 1UWXK 1N6QL 2D7PA 4JO8A 2YRZA 2FX8H 4LK4A 1VFOA 2SEBB 1N19A 1YEGH 3HC4H 1FNGA 1U8KA 3F83A 3R1GL 1C08A 1DJGA 3E3QC 3E8UL 1WISA 4MA1C 4QAMB 2A9MH 4FFWD 4LGRB 2HLFC 3N85H 3IDUA 5HI4C 1IC4L 5AW3B 1YEIH 4K3EH 1UB6B 3NZUA 3NIDE 4Y4FC 1EX0A 4ENZA 4F8LA 2EDMA 3GI9L 4QR7A 1CU4H 2B5IC 3T9WA 4Y1AE 1EDHA 2NY5H 5E8NA 3K8LA 2C9RA 3FBQA 3G5YB 3HVDA 4UT7L 5DURB 4E9TA 3RNKB 4IEFA 4LSTH 4UNTA 2G75B 1Z2KA 4PGDA 4C55A 5IBTL 3QDJE 2ZYIA 4ZQKA 4D2NA 3FZUD 3HG1D 3UBXG 4P2RE 1P4LA 4K7PY 1T1XB 3ZZ1A 4P2RD 4F2FA 2XV2A 3VE0B 1CT8A 3CZSA 4A2GA 3X1EA 5C0JA 2WD0A 3DGCR 2F08A 2A9DA 2F9BT 4UYPA 5D72L 3LN9A 4XAWL 43CAA 1GCFA 4NQCA 1QSFB 2NLJB 3DTXB 1IEAA 2D0FA 4NEHB 2MJWA 2R0WH 3WNMA 4G5ZH 1WFNA 1X5FA 4WFHE 5CD3A 1IAIM 2EYSB 5E08H 4AYMC 5DHVB 3ECUA 5DD6A 1TF4A 3GRWL 5BS0D 2H2SD 2E5EA 3AB0C 4CC4A 4K7PX 1XDTT 2A4EA 1JVLA 2V8LA 3HN8A 3K2KA 3JWOH 4XNXL 4PRDA 4QHMB 1XGRA 2VAAA 4WJ5A 3LRSA 4WHYH 4JFFD 5LB1A 4WTQA 3ZTNL 5E99H 4HWEH 3RKPA 3KDPB 5HYJD 2AV7A 4HS3B 4Y16C 2B59B 1DN0A 4I13B 4JRXA 35C8H 2VDPH 5EFIA 2A5UA 1OQXA 4AL8H 2P80A 3QEQE 5DMKA 2VE6B 1P1ZB 2WLLB 2J6WA 3DNKA 1M7UA 1JD9A 2WXHA 3MLTB 2WUCH 1T7WA 5I71B 4XPGL 4MXVE 2K3HA 4NPKA 1UZ6F 4P3WA 2YAEA 1VF5C 2ZWYA 3KYMB 1GZPA 4UTAL 2DLHA 1CYWA 5DZOA 1U8CA 3QAZC 2Q10A 2OMVA 4M7ZC 1P7QB 1SNRA 1BJMA 2OSWA 4FFVD 4WEMB 5IVXF 4R97B 3D06A 1G9NC 3N42F 3BQUA 1JN6A 1KB3A 3I85A 4HH9A 2R2BA 5E6IC 4BZYA 1NBZA 3ZX1A 4AEHH 1QSEA 2WCPA 2YQBA 2YOAA 3LD8C 2G2RA 4QAWA 3MROA 5G5DA 3RGBA 1FLTX 3O2VH 4QXGL 4PJHB 1MRDH 4QRBA 1BPVA 2VNCA 2KZKA 1U8IA 3DXAA 2GFBA 4X6CB 3RAJH 1DQML 3UZVA 3UOAB 4WTZG 1ASOA 1T2QH 4FXGA 1B9KA 1MAML 2FQFA 4AJYV 4B95C 1INDL 4ZMAT 1BZ9A 1EDQA 4N2HA 5G55A 4KQ3H 2C9QA 3D4GA 4WI8A 3QEQA 3HPJA 1AZBA 1JV5B 3CZFA 4S1DC 1J0YA 3N1GC 3AVEA 5F21B 5FO8B 2IG2H 4L4TB 1THAA 2Q20A 3MUJA 2YD8A 3I6LD 3T1FA 4ZT1A 3CLFL 4LARH 3GMNA 4E5XB 3KJ4B 2X44D 4HOZA 1TOXA 1GJUA 4A7GF 1LO4H 5DU7A 4NN7C 3WN5B 2VN3A 4FZEL 1XH2A 2Z92A 4YSTA 4UT9H 1ZGLA 2V5YA 1K4CA 1RQ5A 2NYYD 4OT1H 4GRWE 4L8SC 4TL4A 4E42A 1ZA3B 2AP2A 2ZOWA 1CD8A 2PXYB 5EZJA 4FZ8H 5D1ZC 3S4SG 2ZSVA 3RY6C 2FSEA 3JTSB 4HKBA 3J07A 2DIBA 5LKNA 2ENPA 1QTPA 3LDBB 1I1FB 3BH4A 4EBQH 3WTYA 4TLSA 4QTFA 4FTVA 4TQIA 2ZIDA 1E40A 2AMUA 5CCKH 1S7QB 3MV7B 2V9RA 2P5WB 4PRHE 3ARYA 3QUHA 4ODSH 3RWCB 3OSVA 4HJTA 5IOPA 1W0VB 3PLYA 1KIRB 4NQEE 1SYSB 5E1QA 5E2WH 5H4ZA 4PJDB 1BM3H 2VABA 2ZP0T 1B4LA 1B9ZA 1SBSL 4L9LB 1FAIH 1EO8H 2R9HC 4JHVA 5KYWB 1UVQB 3QORB 1GGBH 1YEDB 3S4SB 1JE6A 1RIUL 2ICWJ 5KN5A 4LBEA 3KZ8A 1WQVT 4RNRA 1I9IH 5K93A 4GKZB 3EYQC 2ZUXA 5D1QB 4JDEB 3UG4A 2UZXA 1AGEA 2JSFA 1IGIH 4AJWA 1AD0B 2ADGB 2X53A 4R97C 3T04D 2BY3A 3NIFF 4HUCA 4OF0A 1J8KA 4HK3N 5EOCL 3ZL4L 1UWGL 5A2LH 3H42H 2CHZA 3TJHD 4NZRL 3GJFB 3QEGH 1Z0MA 4UQ2A 2HJFB 3LQMA 2NSMA 1KC5L 5SWQB 2F54D 4Y5XB 1ZK5A 1YQ2A 2AITA 5EU5A 4A39A 5CN3A 1JF6A 1RVFL 4UNIA 3SE6A 3BAKA 4QRRD 2EUZA 3NN8A 1KN4H 1MQKL 1KTLB 4AYID 3RP1A 1HHJA 2WXOA 1NCNA 3MOAH 1S78C 4RIRA 1XGPB 4JW3A 2AV1B 4OLYL 4TSAH 4S0TD 3M45A 1C5CH 2BS9A 4O2CB 4PRHA 4YX2H 1U8LB 2X1QA 4WU5A 5KVDL 3OAUL 3NZHL 5JW4R 2VXUL 3WOVA 2ARWA 3OWRA 4UT9L 3NK3A 1GKEA 2NW3B 1XSIA 2XG5A 1IGTB 2ICEB 2OA9A 3O2WH 5GGUB 3PABA 3MJ9A 5MENE 5M95B 2X4NA 4OJDH 3L3KB 4YHLH 1CGUA 1T6WA 2MOQA 5AB0A 4I3SL 5EU3A 1WFOA 3N9GH 3IDXL 5EEUA 3FTSA 4WZ9A 5EMYA 4BQ6A 5KYNA 4F3FB 4TRPH 3S2CA 3HG5A 1MI5D 5DVKA 3SBQA 3VMNA 5CCKL 5DMJB 2OI9C 2YAMA 2YRPA 1GY1A 4NENB 1N10A 3LRLA 1PGRB 3C8HA 4JHAH 5INCA 4PV1C 3FFOA 4AT6B 1IBGL 3EOAB 5FX3A 4OF6A 4PJ5B 4APQD 1FJ1A 1YPZA 2EDWA 5KW9H 4GAAA 1RUQH 5SX4I 1URIA 2IGTA 2XTJB 1GRWA 3IDIA 4YC2C 4F27A 4PWFA 4FQLL 5I74C 5KWYC 1A7QL 2N7SA 2ZKHL 4J3SA 3DXAD 4JRLA 5LWYH 2XTLA 4AK1A 4GQ9L 5F72S 1ZS8A 1UOVA 2FH6A 1A0QL 1RJCA 5GGSY 1FSKC 4FL4B 3I02A 1PDKB 1QRNB 1T7YA 3G08B 3OXRA 2BVQA 1EZVX 5LBSH 1BVKB 1A7PL 1MCJA 2MCAA 4JG0L 2AK4D 1JD7A 4WGVB 4PJ9C 4OM1L 4MJ6A 3ILQC 4HP5A 4BDVB 5MHSD 1NMCB 1QEWB 5DYOA 3GMMB 2B1OA 5E6ID 4HIJB 1TQWA 5I8CA 1QHPA 4ORZC 3GMQA 4LVEA 5L2KE 3VXNB 2NR6D 3BVXA 1OF2B 1E5ZA 5KVMC 3BWUC 3D07A 2BNUA 1HSAB 4HQQH 4M6NH 3S3BB 4MNHB 3TZVA 4F57L 1JDCA 3BD3A 2FJFA 5JA9A 1P7BA 1TKWA 1G7LA 2F61A 4WFHD 1FYTA 2YPKB 5I9QC 3F58L 2H26A 4JHAL 4XCFH 2IAAC 4HG4J 1EXUB 2EDRA 2AI0H 4Z7VF 1SOSA 2Q76A 4P48A 5IW6A 1NWPA 1X7QB 1YJDL 2FLMA 3EADA 1JGUL 2R51A 2BVOA 4YQXL 4NT6A 3D39B 1XR8A 5H94A 1JF1A 3UBXB 2PYFA 3FT2B 4OCWL 3DECA 1T04A 4FMFA 5F0LB 5E4EB 1IM9A 1BMWA 2O93L 3ZVVA 3HZ3A 1U3ZA 2NMSA 3W0WE 1OZTG 5FIEA 1CGXA 3C60B 2NUTB 4JGUA 2AXWA 4LSSH 3RGHA 1IFRA 3QI9C 1XQ4A 5AOZA 3V0GA 4DETA 5HYSA 2PR9A 3A0OA 3NBNA 3VFWB 4U1GC 3P69A 1VA9A 1Z0NA 1WIOA 2J2ZA 4TULL 4XGZB 5HPOA 4HWBL 2K8MA 4RGNC 3TA4D 3K6FA 1ET5A 5HHNA 2VZ1A 3RVWC 5I1GL 4GRWF 4J3OG 2FHFA 4OCRH 3EO1A 4U6YB 5LHDA 1VKXB 5HDLA 2Y0SA 3KM2A 4KROC 4Y4HC 4O2EB 3GTNA 5F9AC 5I24A 1DLFH 1TCMA 1FYTE 2ZCKH 4L4VD 5FYKH 4M7KL 4ONHB 5I76B 4NNPH 2VDLL 1JNHA 3DI3B 4CNIA 4LGPB 3C60D 1Z9OA 3E6FB 3PYCA 5F7FA 1E28A 3DROB 4JE4B 4JKPH 2XVLA 4P07A 3QYNA 4FNPA 2B39A 3MJ7B 3HRZA 5CM1A 4Z5RB 5E4AA 4WTWA 2J8UA 1CB4A 4ALAC 1QKZH 1JYVA 3GFUA 4GXFA 4YEFA 1KB5L 3ARWA 4MS8C 1U8HA 3QI9D 4CW1A 3U7AA 3TM6A 4XBPA 3OKLA 2WP3T 4OFYA 3QUMA 3FDWA 4NJ9H 2ZT9C 1Y18A 4WFFE 3CQPA 1KYUA 4LLDB 3N6YA 4OJCA 5ISZE 1ZJBA 2R1WB 2ZWKA 2FEEI 3B1UA 5AW4B 3AREB 3L9EA 4YDNA 3AWFA 5K9JH 1YVLA 3D0LB 5CR1A 1JPSH 1QSFD 4OD2A 2EYRA 3VUAA 4L8BB 3GSVB 1OQOA 1SRDA 2Y1YA 2OMNA 2YS4A 3H4HA 4LDEB 5JO5B 4M43H 4NBZB 1QFWI 3ASWA 4MAYD 3AG1B 2FATH 3MNZB 1NKRA 3O41B 5C6WH 1NM4A 2V3DA 2GSMB 3Q3GB 3HHSB 3MRQB 2EIJB 1D3CA 1AZCA 3PV6A 3MCKA 2YKLH 4H8WL 2XKUA 5H37H 4MVBC 1HILB 3VSTA 4E9YA 3QXDA 3N41B 5LO7A 1MJ8L 1O5PA 5F7LB 3K6OA 1JPGB 3G6JE 2WO4A 2F74B 1WAPA 4JBSA 5HGBA 5JORB 1T20B 3CAFA 1NJ9A 4GUOA 2D7TH 3EJTA 4DZ8B 5CKAA 2OULB 1ICTA 1MREL 3QIUC 1KCSL 4N2DA 4Q9QL 2XN1A 3BYTA 2YZ1A 1V55B 2A4CA 2DQDL 4NNPL 5EIQA 1I7RA 3MV8E 1NA8A 3SKOA 3A6BH 1KTDA 2WLHA 5AZEL 4LESA 3B2UD 5CAYB 3DVGB 2NSQA 4PTUA 4OKVB 2ARJQ 2VLKB 4QT5A 1PZUB 1OTSD 3BSZL 4M1DH 4TKWA 5I8KL 6TAAA 3OXSB 2DYSB 3T4YA 3HZYA 2CJ3A 1IE4A 4FI7A 4NPJA 2MNUA 1OPOA 5KEZA 5FB8B 4OFQA 2XTSA 1IBFA 5LGYA 5D4IA 2EVJA 3OR7A 5KZCD 4HD5A 2NY1B 1OP4A 1F41A 2R7EB 1BF2A 1CFNB 4LEOA 5GGSB 1IKFL 1EANA 3RX7A 1CZ8L 4B5ZA 3F7VB 5J1AA 2OJZL 4XNQB 2YKLL 3EH1A 3D9AL 2G3MA 1KNOB 8PAZA 1TDQA 4XRCA 1HHGB 2WMPA 4PP1D 2BOCA 2DL2A 4M5TA 5AW7B 3KYNA 2WINB 4DO5A 1BW8A 1MHEB 3MX0A 5IVZB 5J11C 5JXEA 4KXAA 1MREH 4YDVA 2VDPL 4K3DH 4XOBA 4ONGL 4QD2E 2XA8L 4FFWC 1SLVA 2BNQE 2GUOA 4JCMA 3NJGA 1PNCA 3VXPA 5K33A 3P77A 4HOXA 4QXVA 4PREB 1L3NA 4F91B 3MPCA 2FO4A 3IXAB 2YEQA 2GEQA 2V2WB 3WS3B 5AVVB 5FGBC 4H8WH 1UA6H 2Y3AA 2ZSWA 1LNUB 1F45A 3US9A 1R5IA 4KRPC 4LCVA 4HU8A 1LEIA 4JRWA 3R8BB 5KVGE 2VDQB 3WKYA 1MVYA 3L1OH 4NKIL 4Q8BA 1YY8B 4MA8H 5DJXB 1AE6H 2MEJB 2WCSA 3ARDB 4JFHD 1OM9A 4JM2A 4YFLF 3FO1A 1TTRA 2V7NA 4ZFFA 3I3EA 4QRTA 4FA8A 3WE1A 1QLRB 3MBEB 3O8XD 4P5KB 3RWHA 4NZTH 3SPCA 4ACPA 4EXPX 2H9GA 2XHNA 1T83C 3GHEH 1B2YA 1TPXB 3GIZH 1TZIA 2AHIA 1SJMA 4XMLH 3WHE1 4JQIL 2ZCLL 1INDH 3WFCH 5EBMB 4OZGA 3LSOB 2Y07H 3KDMB 1U36A 3O6KL 1OWWA 4WUUE 4MGXA 3DWTA 5EU4A 4L9LC 4P3DB 5IHHA 4LIQH 1UJTA 4NFBA 3GMLB 5I6XB 2K7QA 4B97A 1N5AB 1U93B 5D8JL 3UCQA 2DWYA 1H5BC 2C34A 2WWMD 3G6AB 4XN2A 3N04A 5GIRA 1Q0YH 3B8YA 3P4MA 4EOWL 3WG7B 1U41A 4GW4B 3JVGC 1ZTXH 3SD5A 2E9GA 4HWNA 4KXZI 5LN8A 3ARRA 3EO9L 3ABZA 3EYSL 4JO4H 5DJ6A 1XH3A 3EZJB 4NB7A 3FQ1A 3E6HB 4FQ1L 2XZQL 1NFAA 5IIEA 3ARGA 5HDBF 5JLZB 4PY8J 1OAYH 1K3ZA 1Z5HA 2RJMA 4YXHL 1RZIA 4P2OA 3FL7A 1LWHA 4BFEA 2HPOA 4BFNA 2ZWSA 3Q8AA 1OO2A 2ZX5A 4Z76A 1DFBL 2WLMA 4NO0A 1HZHH 1HXYB 1T7XA 2O26U 4LF3B 5AVQB 4EI5D 4M00A 5KYYA 3K5RA 2ISDA 2UZPA 3QQDA 4EE2A 4FN0A 4C83B 4XXCC 4CRPA 3RNQB 1DVFD 2WVTA 2JCCA 3H2PA 3MN8A 3LNDA 4ELMF 4JFQA 1P7KA 4Z3TA 4OKDA 3ZR6A 5DUBA 1SFDA 1QLFB 1DBAL 1Q9KA 1ND0B 4WKXA 2YD7A 3OZKA 5AVZB 3V0EA 5L9DH 4FQJL 3CVHH 2EKSA 2DQGL 3DO4A 1RIUH 3FN9A 4LCUB 3VI3A 1WS7A 3GXPA 4JN2B 4QHKI 4TLKA 2XJLA 2XQYA 1HSBB 4XZUA 2PWFA 5EHFA 3SGDI 5EU6B 1LD9B 2PTTB 3Q5OA 1J8SA 3TT3H 1WS8A 1PAMA 4Z7UB 4Z7WE 5DRNA 1UOWA 5KOMC 4R5XA 5J6GA 1TTAA 2NNFA 2DI8A 3Q44A 3SDXA 1AQ8A 3NA9H 4BH7A 2XZQH 4LLUB 1T4KA 1B0GA 3VXQB 4H2CA 5E7BA 1A9BA 1DBBL 1AGBB 2Y7QA 3OL2A 4M61B 5D2NE 2X1WL 5LDUA 5B3SB 5J0BA 3LKNA 2H8PB 1QNIA 4LU5H 4R7DB 2EO7A 1UUNA 1GAFL 3J8F7 2I60H 1S7VB 4A55A 3UTSB 3QI9A 4KV5E 4HMCA 4WENB 3WLWC 5BOZG 5I5MA 3L3OA 3ENEA 4XCEA 4G80A 2VDNB 3QHFL 3R7QA 3LS4L 4NC2B 5BRZB 1KPVB 1LP9B 1MWAB 3IKCB 3STZA 4BSJA 5MEPB 3QJFA 5I17A 1CFMA 4UNVA 3U7WL 1E30A 4M5YL 4PRIA 3CVDA 5AB1A 5FYJD 3SDCC 4ORGB 4HUWB 4XR8C 3HNVL 4B9KC 3A6CL 2OMWA 4J4PD 3IDXH 4JKWA 2G4GA 3ARGD 1RUPH 4DP2X 2CD0A 3HAEG 4KKAC 4MYWB 1HNGA 4JRXD 4K9EC 1R5WB 3QA3A 1CXIA 2FQEA 4PRBB 3RZWA 3WJLA 3LV3B 4MNQB 1OW0A 3RJDA 3BFQG 3IJSB 3NCJL 5DJCB 4UT6A 3BZFB 3ROLA 2YHGA 3SY6A 1F1GA 1RPUA 5TGBB 4TTGA 1QMUA 4GW1B 5I8EA 2AQPA 1NCTA 1L3WA 4X9BA 1G6VK 1UJ3C 4FDWA 5AKVA 1YUHB 1QASA 4ZMPA 5GGVL 1JXFA 1T5WA 1WFUA 2XNAB 3BMVA 3ALWA 3T0VA 1P0SE 1MW3A 2BHFA 2YPLA 1INQA 1ID5I 1RUML 1I4FB 1OGTB 2R56L 1JGEB 2IQ9H 1I53A 4C47A 4RA0C 2P48B 5HHPB 3BKJL 4PJBE 4G8IB 4PJXF 4BSVA 3CQQA 3LH9A 1CLZL 5L8KB 1IC1A 1ACCA 4L1SA 4YHPB 2AQ3A 4FD0A 4PLKD 1PX8A 3E7JA 3GM0A 1IJNA 1JMZA 1K5NA 1V3LA 4DGWC 3TBSA 2KLTA 1BBJB 1T89C 1XB8A 2VN4A 1DQLL 2XQYK 4ZW7A 3V6FA 1S5HB 3MA7B 3OAWA 1U8OA 3OKOA 1UXWA 4PJCE 5CSZB 1XR9A 3AU1A 4IYKA 1SHMA 2EKJA 2VH5H 4LCYA 2YEZB 1NGYA 3WGUB 4UT6H 2Z0UA 3DIVA 3KWXA 5D1XD 2Y69B 3O3DA 5F7AA 1L5GB 3MJGX 1CBJA 5AG8A 2QJDA 1TSRA 2DJUA 4IDJH 3IDNB 1MCNA 3ZYIA 2WUBH 1YNLH 4Z7OB 2DH3A 3NJHA 4OZHE 3FTXA 3O3AA 4QRRA 1ZVHA 2BERA 1FL6B 2JKSA 1ZDQA 2YPLE 1UCBH 1XGUB 2NY5C 4NM8H 4ZPTA 4P46C 3T0EC 1FFOA 1RIVL 3TNNA 4M9OA 3NIDB 4ZW5A 5CKGA 5C09B 5KTEL 4V1DA 1A1MB 1CLYL 4RBPH 5CEZL 3RWEA 4L1DA 4Y1AB 1ZA6A 3VFPB 4JFXB 4Y19A 3R06B 4N90E 5C70A 4YFLI 4MQ7B 4S1RH 3FFCD 3CFBA 4RWHA 4ZMNA 1XB6A 1HX0A 1JWSA 1IT9H 2DQFA 1E50A 4YUEH 4HLJA 1OLLA 5HVHC 2VDMB 3UTPE 1UENA 5I75C 2ZYHA 5DFVC 4ZFZA 4LLWA 4O2FB 3OKKA 4K94H 3HE6C 1QA9A 2V17H 1LL1A 4G6FB 4QRPE 5ELIA 5GGRA 3D87B 4YOKA 1COBA 4F58H 3QNYA 3TURA 2GSGA 3MLUH 3RGVC 2I9LA 2X2JA 2EXSA 1LO0H 2VDRH 4TUOA 1FQ9C 1QSZA 3QZPA 3QDGE 1BG9A 3V8OA 3PXLA 3V4VA 3HUJA 4D9RE 2NUPA 2VR8A 4PI0A 4ENEC 4FI8A 2B4CH 3H6AA 4QRRE 1AGFB 1W8NA 2W38A 3G3LA 4LZKA 4YIQB 3VYNA 1PKOA 1ADQL 1I3RA 2VLJB 3IJ7A 4UMGA 4LEEA 4Q6YA 2H3XC 4BD4A 5L4IA 3Q13A 4GP4B 1B4JL 2HA1A 4HS8H 5JW4N 4LLVA 2WQRA 2OYLA 2VXQL 1T22A 2FO8A 5KTEH 12E8H 1UFUA 3FPYA 3PJNA 2VLRD 4Z7QF 3UPRA 2VLRE 1HH9B 2WKOA 3G5YA 1NC4B 3O9WB 4KRPB 4XP1H 2R1YA 4NQTA 4DVRH 1CDJA 2HLAA 2A77H 4PGDB 2PCFA 4JO1L 2O30A 5CCGE 4NN6B 4OLYH 1AOHA 1QTYT 2LLGA 2HB0A 1P4LB 5D2LA 5FOJA 3U46B 4ICWA 5C0CD 4Y5YA 3W3BA 5K69A 1ZGLM 4IKLA 4XMXA 5L88H 3G5XA 3KPRB 3HN5A 2E47A 2PR4L 2F18A 3QDGD 3IS0X 2ADFH 4PRNB 4X8XA 1WHOA 5D72H 3MU3A 1HXMB 2K9FB 1AY1H 1EFXA 2LE9A 4F8TA 1M42A 2HZHA 4YSPA 1JK8A 4GBXC 3LKOB 4F7CB 3EOTH 3T0BA 5DTFB 2YBRA 1XSJA 5CD3B 1LTXA 3WLBB 4HSCX 3R0MA 2CHWA 4TRPL 2IBZX 4K23L 5I1AB 3HUJE 1RJYB 1WEJL 4N2LA 4CSPA 4EO5A 4KI5F 2IDSA 3FU8A 3UBXI 4BUQA 4CMMA 2C4XA 3WDHA 4FADA 5ICYB 2ADYA 4QF1A 4A6YL 5J7CC 2PF6A 4B9IA 3CFIC 4OSUL 3HZMA 4IRZL 1EAPB 2BC4B 3LKSA 3MXVL 5LNGA 1DCEA 2P7TB 4JM4L 2BSSA 3ELQA 3FT4B 4NHUA 3UTOA 1BWMA 1Q0YL 4JFEE 4UU9A 3DJSA 3L81A 3BAEL 2BH0A 3Q1SL 4DQOH 4XXDB 1I3VA 4QXTB 2ATPA 4QOKB 4F37K 4JJ5A 4MB5A 5IBUB 3UG3A 3VRIA 2YJQA 2VDRL 3BP4B 5DMKB 2E59A 1X5YA 5CGMA 3E2HB 4P57B 2VMDA 2AFNA 2E46A 1CF8L 5IJVB 1Z3RA 2K70A 1A21A 4OD3H 2WUCL 1XIWA 2GK0A 5AVTB 3QQXA 4X7SH 3S3CB 3U2SB 3OVUB 2UVFA 2OMVB 1RERA 1TYJA 3KPMA 2ROXA 1KEML 1ACXA 3HUJF 4WK4B 2I9TA 3IFPA 2VDMH 2WTRA 2CDEA 3PUUA 1F11A 4XX1G 1JN6B 4EIGB 4K9EH 4U7MA 4YDJB 4DFHA 3CCHA 2CMRL 4PMEA 5IBUG 5IB1B 4F7KA 1FIGH 2GFBB 2DQCL 2VERN 1CMOA 1M7IB 5H2BB 3GRBA 2P46B 2A0LD 4JLRB 4ZFOB 2DDQL 4JKLA 5IW3A 5FCUH 5E8DH 1ITBB 4WO4D 3BSZH 4X4KA 3HKFA 4OCSH 1AR2A 1U2CA 1R75A 2VRQA 2IPUG 1IZJA 1Y0LB 3O4OB 4PJDE 1MVUA 1WSST 4G9DA 5TD4A 4MD4B 2XZZA 4OI9A 2BP0A 4PJCF 5KSUA 3C5ZD 1KBGL 4NKQB 2OW7A 1RZ8A 5L2KD 1N5YL 3JBG7 2ZF9A 4IHBA 4WK2B 5DJ8B 4Z0XB 4JFTA 3AXIA 3GMRA 4NZFA 2F1AA 2IDCA 1WBYA 5E94B 1TFPA 4I2XE 1QNZL 1KCKA 1I1AC 3RDTC 1NL0L 2WQ8A 2G5RA 2VR3A 4OCNC 1ZOXA 1TJGH 3SYAA 2NTSP 2PXYA 2OLDA 4WRLA 2WKGA 3PNWA 4HMEA 3L1OL 1OT1A 5DA0B 4D8OA 1R34A 4XMPL 3B2VL 2CNZA 3I9IA 4JRYE 4JZJC 1DLFL 3IRCA 3ZRFC 4AV0A 3QP3A 5I66A 4LSUL 5B38G 3GJEA 4MX7A 1CF8H 4FHJA 4I4WA 4JAMB 2W9DL 5AG9A 3T6ZA 3ULVL 1JK9B 2XZAL 3QFGA 3VD2A 4FRWA 4PB9L 3SE4A 3ZQXA 1MH5A 1QABA 1KXQA 2LTQC 3BAJA 3RBGA 1I8UA 3D08A 3IDYB 2YC1A 2P5WA 5AZEH 1RK1A 5ISZA 4CDHA 4ERSH 3K3QA 2JK5B 2P80D 5DUMH 1QATA 3GSNH 3KL5A 5IOPB 2IADB 1W0VA 1A1OB 1CF1A 2BSRB 3SHSA 5HDQL 2Y07L 5TDOA 5IHUL 3NEXA 1UH4A 3IJYA 2EDNA 1M7DB 2NCEA 2CO7B 1GZHA 1UOLA 4PS3A 3CVHB 5EZIL 4Z8FL 3GBMH 1UB5A 2FGWL 4X80L 5F9OL 5D6DC 4U0RC 3FUJA 3D3VD 3IAGC 3U0WL 3Q2WA 2GAZB 2A74A 3QYCA 5F0JB 1BAWA 4PRHD 4NLHA 4G3YL 4OCMC 1BVNP 2YMXH 1AZUA 1KEGH 4FXTA 5T3ZE 3E0GA 3GQFA 3RX5A 1IQWH 2ZZUT 3LZQA 2LU7A 4LKCB 4RISL 2OK0L 1TJGL 4NERA 4GKLA 4WCYH 5CS7A 4GAJL 2UVEA 1CFSA 3UGXA 5GRYA 1XHHA 3H9SD 4WEEA 2UUDH 4D0BA 3TX4A 1SM3H 2E9JA 1CO1A 5GHWL 1I3GH 1CL7I 3QEGL 1SGKA 2IFGA 3RL2A 1BD2A 3SO3C 3FQWA 1II4E 4X8JA 3CFTA 4M7JH 3C6LC 2DWEB 3CDZA 1IGMH 4TNWF 4KK8D 1HHJB 4N4YB 4W68A 3QQ3A 4YXHH 1XGPA 1NDMA 1YEJH 2FD6H 4DEPC 3UMTA 4ELMA 1U6AL 2ALAA 4OZGF 3KVQA 2C9SA 2P42B 4NRZB 4IK6A 2E6JA 4HUUA 3H2WA 1YN7A 3U9PH 3UYPB 3LYRA 3W57A 4PJ8B 5DC2A 2P8MA 3RVTC 1ZLWK 1ZTXL 2NDGA 3TEXA 4AZUA 5A16B 1KTBA 1YY9C 3F7YB 4AQAB 5JPNC 4XN1A 3IJHA 1D5MA 1UH3A 3AACA 5KVFL 5L0QC 1EXGA 3GSOA 4JFDA 5HDWA 4X7DC 5AVUB 2GHWB 3MO1A 5DMIH 1JTOA 4KK6C 5L7XH 4WNSA 4XHJC 5KVEE 3MGOB 3OMAB 2MOVA 3WTSA 5AW0B 1HQRB 1R33A 1RVFH 1I1RA 3FULA 4B7LA 3DOSA 4PJDF 4UDUA 4NENA 1A5FH 3EOAA 4ZO7A 3VQMA 1FJ1B 5FUCC 2P24A 2YO3A 1UWYA 3FTVA 1MFEL 1QLEL 3HZVB 4LKXA 1S5IL 5C1MB 3FO9B 4Z0BL 3U9UA 5ACZB 4F15B 3MRBB 3QZWG 2YLKA 1SJVA 2IAMA 4OLVL 3QJSB 4JN1L 2CO6A 2R2EA 5I1HL 3F8UB 1NANI 1B0WA 4PGJA 3NCFB 2KHAA 3W1ZA 1QI5A 4YDZA 4BFKA 2PPCA 4G8FA 1KPUB 1B90A 4NQDD 5DYOB 4A04A 5IFJB 2G0LA 1K8DB 2X4UB 3ZL1A 4Z3IA 1TVDA 5EZOH 3FU9A 3WIIL 4AIXA 4HG4K 5KVFH 2WBXA 4QEGA 4PRPE 4JFDE 4XOAA 5G4MA 3SJVD 1CLOL 1ZLUK 3WEBA 3H9YA 1KG0B 2GJ6E 1T5XA 3C5ZC 3S5LA 2VXQH 2IGLA 2BNUB 4JM2F 3TO4D 1UGNA 4UIMA 3NEOA 3V4UL 1AQMA 1HIMH 5IJDC 4UAOC 1YEEH 3JTBA 1ZV2A 2IG2L 3GGWA 1G7LB 3GSXB 4G1MA 4F1SA 5IG7B 4WO4C 1U6AH 1FYTB 3QG6A 2H26B 4F7TA 2ZX7A 5CD5D 1PSKH 4KDVA 3T0DA 4J5VA 1MFEH 1CDIA 2N0MA 4LSRL 2OL3B 1BZOA 4IJTA 5F1OB 3RPBA 4ALAH 2DYRB 1V7NH 3LN4B 1EEYB 1R3IL 4TVPH 5H94B 4ZDHA 1JF1B 3UBXA 4P46D 3QFDB 1JYXA 2BX5A 2NNAB 1T04B 5FA3A 3BZDA 3VXME 3BIBX 3P9MB 1CD1B 1DDHA 3JV6B 4LSVL 3SCMD 5IFHL 1EDYA 3PQYE 3FMGH 3RDTA 3MUUA 4UWQB 3HEIB 4IGBC 3KBPA 3QULA 4UILH 8CGTA 3JWDL 4WWKD 2R4SH 5FYLE 1OVZA 5HYSB 3IDJB 3ATBA 5D1XC 4NO3A 1BX2A 4L2LA 1BGXH 4PJEE 3QS3A 3VFWA