4B9JA

Structure of self-complemented cssa subunit of enterotoxigenic escherichia coli colonization factor cs6
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
136
structure length
123
Chain Sequence
APEPQIQPSFVGKEGGLLFSVSLTVPENVSQVTVYPVYDEDYGLGRLVNTADDSQSIIYQIVDDKGRKMLKDHGAEVTPNQQITFRALNYTSGIPPGIYNDQVMVGYYVEIATKNFPVSTTIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Enterotoxigenic Escherichia Coli Colonization Factor Cs6 Reveals a Novel Type of Functional Assembly.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords CS6 FIMBRIAL SUBUNIT A
total genus 23
structure length 123
sequence length 136
ec nomenclature
pdb deposition date 2012-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b9jA00
4B9JA 4B9IA 4B9GA
chains in the Genus database with same CATH superfamily
4NM8H 4LLAA 5IMLB 3HPJB 3PABA 4GUQA 5TQ0L 3IAPA 3N2JA 1SVBA 5J6GA 3ZDXF 4OD2A 4UTBA 4LVOC 1ID2A 1CD1A 1G6RH 3BQUB 5F88B 5BW7A 2JB6B 5JIQA 3UMTA 5IJCC 3BVVA 1X5GA 3VXUA 5CEZH 4MQSB 5T3ZE 3MOQA 3QDAA 3L1GA 4NGHH 4WW2B 2XA8L 1P4BH 4ODWB 1HAUA 3K4AA 4Q6IA 4UF7C 4AQ1A 1YC8A 1EJ8A 1MCHA 2GAZB 3QUZD 2NT1A 5DJDA 1OE3A 4RGNB 3A47A 3MYJA 1CGYA 4J3BA 5CFHA 4JFDD 4L1SA 1NCWL 3Q8FA 3S97C 4ANUA 5KJ4A 3SSGA 1N0XL 2YS4A 4N0CD 1AIFA 3AW5A 4PRPA 5DWUH 2B1AL 5IVNA 4QHLB 1ECYA 1HTYA 3DMMB 3M8OH 3ZE1F 3FYIB 4HEPA 2F9BT 3ZR6A 5CIPH 2HUHA 3QPQD 4KTYA 1ZANH 5FO9B 4NN7C 5EOQL 1KV7A 4BM7A 3PU7A 4P8QA 4WTZA 1BW8A 3EADA 5JNYB 1M56B 2P5WD 2WINB 3DK2A 2Q86A 8PAZA 1MAMH 4IKJA 2I9LA 3FB7A 3F3HA 2FHBA 2NUTB 2OR9L 3QFJA 5E8DH 2X4TA 1J1XH 5L2KD 2CK0L 5AB2A 5CEXB 4XMUA 5BO1H 1RZGA 3ULSA 3W2DL 3ZT6A 3TYGH 4WK4B 2Y22A 3BE1L 4LZKA 2V9RA 2R9HD 5F8RC 3ZDWA 1FYTD 3BVWA 3SCMB 5FWRA 1PG7W 1S7XB 2NUPA 4JHBA 1WHPA 3G7TA 3QEGH 1QSVA 5EEXA 1FFQA 1E5UI 4YDIH 3TJHC 5C0RL 3UPAA 1B4RA 4K0OA 2BY2A 5C70A 2H0FA 2AF2A 4ZTOH 5D2LB 5HHME 3QO1B 2P24B 4NUGL 5DQJA 2NW2B 3EFOA 1NLDL 2XKUA 2BIIA 3VFPA 4F2MB 5KZCB 3RURA 2C1OA 4MMZA 3S3PA 1IEHA 5GRYA 1FO0H 3WDJA 4QGTA 5C08D 3R8QA 1J87A 3NCJH 4CC4C 5FYKE 4N2NA 2FIRT 4O2FA 1U8PA 3RUGA 1M71A 4P48A 4WUKL 5HVHC 3ES6B 3K91A 2IDQA 3QDMD 1JPFB 3K2UH 3KYMA 4N26A 2R51A 15C8H 3ZUCA 4NERA 1SYSA 2IANB 3HHSA 3IM1A 2WXOA 4FABL 1JHLH 5F1IB 3WFEL 3IFNL 1T0NA 1IGYB 3DRQA 4O5LH 1XCQA 5F9OH 3DOIA 5BXFA 5I0VA 1VRSA 4JO4L 2UZIL 1T6WA 3C75A 4P2QD 5DEGB 1UWFA 1NANH 2WIIA 3UEZA 2DS4A 3EOYG 2OZ4L 3PWJB 3AM8C 3H9SA 4WSJA 5IW3A 2B2XL 5A2AA 2YO3A 1UACH 3II3A 3MJ8B 2OL3A 3BWSA 2EQDA 4YK4C 5EF0A 3QJHA 4U31A 5I1JL 3QUYB 3OMIB 3KXFD 2Z8RA 3C6LC 4P23C 4H8HA 3FF8A 4P23A 1GGYA 2O61A 3Q44A 3TEWA 4N9OB 3FU8A 2IH1A 1KCRH 4G2AA 2PPAA 4JHZA 5HYQA 4GO9A 1OK8A 3IJYA 4MNHA 4YZFF 5D9SB 3OB0H 4Z6AT 4GMTH 1GZQA 5AW4B 3C60D 1FC1A 2E4TA 4RFNC 3US0A 3GMLA 4N2AA 4R7NA 5MP6H 2CQVA 1XGQA 1VCAA 2LQRA 2VDNH 3EJPA 4WENB 1HCVA 1IFGA 1NGPH 3QH3B 4H88H 4JFFA 4X6EA 1KOAA 3JWOH 1USZA 4L8BB 4HXAH 1NH6A 1VGKA 1KFAH 1PZ5B 3GSWA 1EHKB 4N8UA 1OY3B 1ZHKA 5H2BA 4Y5VC 2FJHA 2AQNA 4PJGA 5HY9B 4MB5A 1AYRA 2XG4A 1FVEA 5L2JB 5I15L 3ATAA 3VW3L 4PJ6A 3G6JF 3DO4A 4G1EB 5C0CA 3MQIA 3DV4B 4UUJB 4RZCA 2CIIA 1MRFL 4KDTC 4DP8X 2OMUA 3S5YA 3ARFB 3KPSE 4M9OA 4ALAH 2BNQD 2DKSA 1HL5A 4Y5VA 3UC0L 3WUWB 2WTRB 1OW0A 2HJLB 3ZSTA 1EJFA 1ZS8A 2VN5A 3V9EA 1A21A 3RPBA 3PNRB 3B7UX 4FFYA 2AANA 3R1GL 1EJOL 2HVKB 2ZKMX 1WFIA 2GK2A 1ES0B 3WXVH 3KPPB 4B27A 4M61A 1UFGA 3QNXA 4PP2A 4JO2L 5EU6A 3QORB 1IAMA 1I8KA 3KWWB 1CG9A 3TIDB 4MNQD 1M4KA 1N68A 2ZCKL 7PCYA 1DSWA 5DC4B 5FB8A 3AAZB 3GBML 4F9LA 4K9EC 3ILPA 3QWNA 1JUFB 1NDGA 1VKXA 5L6YL 3NJGA 1FCCA 1XXDC 4M6OL 4UBDC 1V3LA 1Q1JH 1L4IA 3KHQA 1J9CT 1YN6B 3CN2A 4KJPC 2VUOA 2Z92B 2QV2A 1IBBA 1B0IA 4NQXA 2EUVA 3LRLA 4MB1A 5D7LB 3NOIA 4ZMLA 3WLWD 4N1CA 3OSVA 1JHKH 5AW0B 5C0IA 3OZLA 5H94A 3TA4D 5I5IA 1QSFE 2XN9A 4LLYB 3TIEA 2LAGB 3UTTB 4MA3B 2RALA 5FGSA 4AQOA 1G9NC 4HS8L 5IESH 2FRGP 4UT7H 4XE0A 5GS0D 2K6ZA 4JFYA 3U6XS 4DP4X 5AOJA 3BZEB 1DUYB 3BFWA 4N8CL 4UILH 4DP9X 3DETD 3MV7D 3TN0D 4HPOH 5IQ7L 3LEVL 3MCLL 2WLZA 3MA9H 5C0RH 4FQPA 1AGBB 3JZYA 4XVTL 5E8EA 5FGRA 2QLYA 4EI6A 4G8GB 3WMSA 2BSSA 1A7OH 2WUCH 3JYCA 3V0GA 1IRAY 3KLHD 2QGDA 4IEFB 5EZIH 4NRZB 4MJ5A 5JXAH 2GJRA 4U1NB 1PMYA 4J1UB 4KTDL 3SBRA 3U30B 1K8IB 4RDQG 4EZLA 1BZ9A 2AQQA 2R0ZL 3EO1A 4X6CA 3U2SB 5E5UB 3QFGA 4OZHB 2ZAHA 1Z2KA 2UXFA 2NYYD 2YXMA 3ARQA 5AL0A 3RL2B 4FQIL 1CU4H 4U0RC 4AYID 2VLKE 4UT9A 4XB8A 5HYJB 4KTDH 3ARDD 3HHMA 3TZVA 3MNZA 2DTML 4M9PA 3E8UL 4FAAB 4A38A 1UXLA 4LPWA 2WCGA 3FT1A 5HHOB 1RERA 4ABVA 5GGSB 1G7LB 2WJ7A 3CN4A 5I6XC 5T3XE 1A4KA 1ZEAL 1YEJH 4FI7A 4FQJH 1GCFA 5D6DC 2IMNA 2A74C 2C9SA 5E8NA 1QNIA 3H8NA 1ZSHA 3MKGA 4HIPA 4I2XB 4LVHC 4NO2A 3SYAA 1RPUA 1KPVB 1U95A 2I07B 2XTJE 2EDXA 2XSKA 3OZ9L 2J44A 2OXHA 2VLJA 5E00B 5I73B 5IMLA 4U3SA 1Q9OA 1BM7A 1S7WA 5CIPB 1BQHB 5E8OB 4EKXA 5C0BE 4U1SB 4PRHA 4H8QA 5DZJA 2ZX5A 5I1LA 4PS3A 2LLLA 4MQXD 3VXQB 5KSVA 3JV6B 4FCHA 1TEFA 4W93A 4LP5A 2EXYC 2ZF8A 4MJIB 4Y2OA 1W0WA 4Z3TA 2V8LA 1PU0A 3GHBL 1G7QA 1U0QA 4YHOL 3WJJC 4ODXB 5HGBB 4UM9D 1XB8A 2VLRE 4F3FB 3WS3A 1HNGA 4P46D 1I85C 3P9MA 3O2DL 3APMA 5C9KA 2P49B 4MA1B 3E6FB 1I8MA 1WDAA 4D0DA 1BIIB 2CGRL 3RZCA 4OFIA 5FA4A 5D1QC 4JZNA 3HS0B 1OWRM 2VISA 2WBXA 4WTQA 1ZOXA 4MDJB 3U46A 3CSPA 5ABZA 1QSFB 3HRZC 3BKMH 1UATA 5CR8A 3P3RA 4HCRL 1UC6A 3BFQG 3WEMA 3ESOA 2VAAB 1TSRA 3GSOB 3OKYA 5KVGL 1O75A 4HCRH 3ZO0A 4BSVA 3M6DA 3VI3A 3RWFA 5EFIA 2Y5TB 2OW7A 3FO9A 1J88A 4QY8A 4Y1SA 2X4TB 4P2RD 2AJXH 2F1EA 3IFLH 4LDCA 1BSIA 1RJYA 5D7LE 3F6LA 4FNRA 4U6VL 3MBEA 4EJ1C 2MRYA 4JCLA 3HI6H 1HH9B 4S1SL 4H26B 4K5LA 3BKYL 3OR7B 4LVNB 3U4EB 4YDMA 2BSEA 5J0BA 3T6QC 4WO4D 4G9FD 2OI9B 3NPZB 3SJVD 4EI5A 2H41A 1J5HA 2E46A 3D3VD 1CDBA 1MRDH 2VLJD 2YRBA 4XBPA 2A0LD 5DHMC 2D9QB 3S4SG 1SEBA 3ULVD 4OIIL 1HCYA 2SEBB 1TITA 1UEMA 4TQ8A 3NQKA 1CBVL 2BJML 2W0PA 2OMTA 3VI4A 3DXAB 3KBFA 4OFYD 4KK9C 4N0UE 1X9LA 1TNMA 3CSFA 1ZANL 1T1XB 4WFEE 5BPPA 4TUUA 1YECL 2NQDA 2XWBA 3L1FA 3HS8A 4KI5F 1FZMA 2Z31A 1JPFA 2P3YA 4S1DC 5KEZA 1OANA 2XQBH 5MENB 4Z0BH 1JIBA 4XPBH 3F62A 1Y18A 4I9WD 3SE8L 3CDYA 4PRPB 1F41A 1JDAA 4XAWL 2HN7B 5GS3A 4Z7VA 4O2EA 1U30A 3IFOA 5F9AC 4HPOL 5IQ7H 1JFQH 2OTUB 1FL3A 3IFPA 4NUPA 5DVKA 3NEOA 4JPWL 5E5MA 5T5FH 3GSNL 3DROB 3HE7D 2APVA 1MCPL 2X4PB 3RKDC 3IJSB 3QWOA 1FVDB 5CJBA 3UMNA 3QUYA 3QFJB 3DHUA 1MFCL 3SOBH 3ZDYF 3ZYJA 3TVMB 4OH2A 2BHFA 5E1AA 2DM7A 5EZJB 3WJJA 5EZIL 2WBJC 4JKPL 1TTUA 2DLFH 5KSBB 3V2AR 4OGAC 4HPYL 2DLGA 4GKSA 3W82A 1KB9K 15C8L 1ZLDA 1JZ6A 3DUSA 5A2CA 1QABA 2K7PA 3RVWC 2WB7A 3MX0A 1O7DE 4KO7A 3WN5B 5A7EA 1KY6A 2Z65C 1I75A 3K6IA 4OAWB 2XWJA 1JYVA 4L5FL 2CCVA 4NQEE 2DQHH 5F7DA 4LQFL 1BAGA 3FU5A 1S5HB 3QDHA 2WKOA 4KU1A 1I1CA 3IYLW 3EJUA 7CGTA 1TQVA 1IBDA 4Y4FD 2ZUUA 3UTSD 1A7QH 3SKUD 2FLMA 3S5LA 1L3NA 2CO3A 3ARFA 4B9YA 5D1QE 1BJMA 5E4IA 2ZOOA 1M1XB 1HQ4B 4HZLB 5C08E 1F4XH 4JB9L 1F13A 2HJLA 1KTBA 3DSNA 4YSQA 3U0TA 5FEBA 2EVFA 4CNIB 4TLTA 1BDYA 5GGSY 2H3NA 3BAWA 3NCEB 1FZKA 3QI9B 1KIQA 5B8CC 3TYGL 5FYLL 1DP0A 6TAAA 1GTNA 1AD9B 4K7PL 4X83A 3P4MA 5KSAC 4JEGB 2WZPD 1KCUL 1JK9A 3G6DH 4LIQE 2NR6D 1DSFH 4LRIA 2F54E 4ZFZB 1AXTL 4R3SB 1BFSA 2ZXGA 3OX8A 2A5UA 3G6JB 4P59H 5ADOL 3PP4H 1HU8A 2OQJB 1H9DA 2ARJB 2YAMA 3FQUA 2QSQA 1WBXA 1W0VA 3UYRL 2F53B 2F08A 3WGUB 4NJ9L 1NBZB 3AMLA 3IXAB 3O2DA 1JZ3A 3I3EA 4G42A 1E30A 1L9TA 4X6CE 5FFOA 1NC2B 2H6PB 5I8KH 4HCGA 3QQNA 4GAFB 2FGWL 2N0KA 1MCSA 4MAYA 2VB5A 3BRDA 3ZGIA 4OD1H 2BSED 2DYPB 4F80A 3NZHH 4YDJB 2WYHA 1DJHA 4DK5A 1RVFL 2R2EA 2VMDA 5DZNA 1OQOA 4QRTB 3RI5F 2IOOA 4HKJB 4BSJA 2MJWA 4JQXA 2UX7A 2GIMA 1JJUA 4ZMYA 5BV7B 2VMCA 4NXKA 1BM3H 4ZMAT 2LABA 3HKFA 2HJKA 1FGNL 5EZLA 1V8HA 3U9WA 2BVUA 3VMNA 3LVTA 4PWKA 3SDAC 3BZFB 1EGJL 1E9PA 4HOZA 1YPZF 3ESVF 1CBJA 1HWGB 3BH4A 1MIMH 5IG7A 3NZSA 3K4ZA 4JY4A 3KYOB 4Y88A 4XNXH 2VLJE 1S9WB 4HBCL 3FB5B 4R4ND 2E4FA 2GTWB 5SX4I 5IMKB 3GMNB 1ANUA 1PY9A 1P69B 3EIFA 4R9HA 1NKOA 1HSBB 3MLUH 3LIZA 5ERWA 5B21A 5TFSH 4PJCB 4JJ5B 4N0FA 3LDBC 3FCGA 4NYLA 2XICA 4PGZA 2A74B 4FEIA 4LSVL 3H6JA 1HL9A 4JKWA 3PGFH 4LVHB 5TDNA 1C5DB 1JV2B 4HBQA 1UJTA 5CJXC 2NXZD 5EU3B 5F71A 1PSKL 1GAFL 3AZUA 3WSQL 4LSUL 4OLUL 2QPDB 2VJXA 3BW9B 4LHUG 4YDVA 3ULVL 5LXGL 2VDLL 1OP5H 1G7PB 3BZ4B 3LNGA 3GS7A 1DLFL 4DGUA 3PHQB 2CCLA 4ZTOL 5D5MF 3EFDH 2CGRH 3TPUB 1LM8V 1ETJA 3KE0A 5IK3A 2AZUA 3ZKNC 4GIAA 1YEKL 1N9PA 5M95B 2A6KB 4PJGE 3TT3L 3QG6A 1D5MB 4FS0A 4B9CA 4EBQH 4PVBA 1ESOA 1AMYA 1FZJB 2GSIB 4M1GL 1JGUH 1DQIA 4MA1C 2QHRH 1HH6B 4D9LH 2Q0ZX 4LLYA 2EH8L 5AB9A 1QSEA 3EOAA 5A2BA 2N4IA 1MFCH 1LNUA 4QYOA 4FYQA 4Q89A 1X5IA 2XWCA 3UTZA 2NYKA 3WLBB 1AE6H 5IQ9A 1AYOA 5KBPA 3BDXA 4U0QB 2WUBL 1KIRA 4N2IA 5IT2H 1PBYA 3U0WL 1DJGA 1A5FL 4JZJA 1NMAH 4XB3A 3V9CA 1U33A 4YHYC 1RAMA 2D2OA 3WIFA 4UZUA 1ZLVH 1PG7X 3MFGB 4JM4L 2BOBB 1BVNT 3DX1A 4NQDB 3PJLA 3ULUE 3VMPA 3SGJA 3LKOA 2R0KH 4FXGC 4HWZA 4RETB 2Q7AA 3NRPA 4H0IA 4PJCF 3CVIH 2EDDA 3L1EA 4OFPA 2JI3A 1JNJA 1ML0A 1SM3H 1SJMA 4LBEA 1JGEB 1DBMH 4WI9A 1E4XH 2IXQB 4H8VA 4BV1A 4OCRH 1FNEA 5FO9A 2Q3XA 5C0JA 1GGUA 2B1HH 1S4IA 5BMFH 1MFUA 1NICA 3MO1B 4NO3B 5C07B 2UVEA 4NFCA 5IJVA 1G84A 3NTCL 4NBXB 1A4CA 3BEWA 3N43B 3MNVB 1ZY9A 3KLSA 3RFRA 4BSVB 4QR7A 3VI3F 4PJ7E 2VAJA 4S1QL 1I9EA 3POCA 2FR4A 3VFTB 1EBPA 3QPQC 4ZXBC 5GGSA 1F3RB 2J2ZB 2YGVA 1T2XA 5EOTB 3VFMB 4DEWA 4JM2C 1XIWB 3A23A 3N0PB 1UM5H 3CXHJ 4HK0A 1EWHA 2JJWA 4U1MA 5DEFB 4I2XA 3VXUE 1TPXC 1Y1DA 2HRGA 5I75C 4M00A 2HFFB 3AG4B 1A7BA 3BPOC 1U3HB 4KK8D 2YLHA 4ZPVB 5DZ9A 5L4JA 2R8SH 3BISA 5CIPA 1XGPB 4NP4H 4C8XA 4N8CH 1NCNA 1Q9WB 3DOSB 1IGCL 3EFOB 3SZKC 2WBWB 4QD2E 1KB5L 4WWPA 2J71A 1CXHA 3STZA 5FPIA 4QO1B 1FZOA 3RWIB 5DJAB 1AFVH 2I60H 3ZL1A 2Z93A 1YNTB 4WHTA 1IT9L 4TRPL 2FJGA 2J88H 3HN3A 1L7IH 3DX3A 4L4VD 1T89C 5EEVA 1HNYA 4W9HC 4EAEA 4ZOAA 4FN0A 5KVDH 3F6IA 2NZ9C 1GZHC 3MGAA 1RUAH 2OFQA 4WU5A 3VGAC 4M48L 3ARGC 1KV3A 3CH8A 1NM4A 1A6UL 4YVUA 3WNOA 1L5GB 3V4LA 1SOXA 3MMEA 5D1ZB 4ZAKB 3H7LA 4LQ1A 5E99H 5LNGA 1THCA 3QK0A 4L4TE 4WTZG 4DAGH 4HH9A 4WWKB 5D2NE 5EBLB 4MXVF 4HT1H 3NESA 5AAWC 4EF3A 5CGBA 2OYMA 3QUMB 3GMOA 2X4PA 4JDTH 4RCAA 5T1LA 3VI3B 3O3AA 3ESPA 1UZGA 4UYPA 4ZDHA 4Y4HC 5GGVL 2AJVL 4FTVD 1RP8A 1TENA 3VFUB 2CGZA 3KM2A 5FUOL 2GK0A 3LKRB 2KT6A 4EUPG 4YHIA 2HVBA 2D8KA 4UT6A 3UJIL 2P5PA 1GZQB 4WAFA 4G6KL 5D8JL 1M3JA 3D2UA 5E0QA 5IFJB 2CDEB 4WZ9A 3S8WA 4G8FB 4HQQL 4ZX4A 5DD3H 4UTAH 3OKKB 3NZ8B 5E2VH 4JFFB 3KLKA 4HS3A 5SX4H 1DFBH 3W11C 1EEYA 1WC7A 4NNPH 3BP5B 4LFHD 3S9DB 3H7BB 2VLMD 1D9KC 4DKFL 2YFOA 1N6VA 2XQ0A 4PVNA 1IFHH 3HRPA 1KIPB 4FFWD 3FZUC 4MCZA 3WI9A 1FORL 1FFNB 1G6RA 2QHRL 2Y7NA 3O6LH 4K7PH 3LOWA 3QAZC 5E9DB 4EXPX 1MF2L 5KTEL 1OKEA 3SO5A 2NNAB 1EZVX 1S6NA 4GO6B 5I8EB 3WL9B 4ELMF 1IC1A 1QFPA 1YHPA 2W5PA 3L9YA 4OQTH 1TNNA 4LCUB 3VFSB 3KWXA 1OF2B 3V4PH 3VGEA 4NKIH 3PWLB 2A7BA 4Z77B 5JHLH 1ES0A 3KAAA 3B9VA 5CBEA 3S36X 1OB0A 3VXOA 2ZX7A 1D7BA 4B0MB 1IM3A 4A66A 4CBZA 5JHLA 3HAEB 4DEUA 2EO1A 1MFEH 4U1LB 4URTB 4P2AA 2L04A 3MACL 4F8NA 5DF0A 2IFFL 3VD1A 2O6PA 3BGMB 2Q2EB 1YDPB 2YA2A 2XKSA 3RJQB 4JW3A 1PSKH 2WY3B 4C55A 4WO4C 5E70A 4QI3A 1PD0A 4KQ3H 1QR1B 3L45A 1DBJH 1KBGL 4Z7OB 4PJIA 2CJUL 3IS0X 1DZ0A 4PV1C 1T22A 4BZYA 2ZJSH 1FG2A 1TG8A 5EO1A 1E5BA 2KDGA 4JFQB 5E08H 4P2QE 5MEQB 2P9RA 2H6PA 4GSQA 4K3DL 3CN3A 4BH7A 5TE6L 1CDIA 2E3VA 4X6DA 1O9WA 2MPAH 5DO2C 2YAOA 3BUQA 3SHSA 4XTRC 2YSSB 2X4UA 5ECGA 3FUKA 3OKLB 1N2RA 4GKOA 3V5DB 2GTZA 4PJFE 1N5YL 2EUXA 1D2PA 3AS1A 1ITBB 3O45B 3QXDA 4OCSH 5GGVY 3V0WH 5IFHH 2ZSVB 2XWTB 3LPGA 2WXQA 1IGJA 4Q7DA 4D3CL 2YD8A 2WMPA 4LAQH 1EQWA 4GXFA 5F1OB 3V0JA 3MRRA 1BBDH 1T04A 1GYWA 4EE2A 5B1JC 2FD6H 2VSDA 3GC3A 3ZJAA 3WKPA 3QWRA 2ZOUA 4OCWH 2WQSA 2FL5B 2CIKB 1CLOH 4HHAB 4ZS6C 5GGRB 3C8KA 6FABL 1RJZB 1JPTH 3IPEA 4JO2H 2CPCA 5ACLA 1RY7B 3HZYB 5LBSA 4HGWA 5GJTH 1H0DB 1UGKA 3P2TA 3KW7A 5ICUA 3OXRB 4LGRB 2OJEB 1ZVYA 4EI0A 5LG1A 4NAMA 2KKQA 2Y5QA 4LLDB 4BRVA 2NXYD 1BYNA 1OVZA 4N0FB 1YZZA 4A7SA 2C7UA 1NFDF 2AXFB 2E56A 4M6NL 4BFOA 2RCSH 1QEWB 4ALAL 1RZKC 5TDNB 1CFBA 1A5FH 4M8UA 2WBJA 3NJMA 1NSNH 1TTAA 1BZ9B 5EWIH 4LPCA 4Q9BA 2OV0A 4EN3D 3AQYA 5GISH 4LLUA 3B2VH 2COQA 1U41A 1Q0YL 1KG0A 4HISA 1GHFH 1I1FA 1MN4A 4WY7L 4AENA 1W72B 3MUGB 5KVGE 4PJ5B 3TZVB 3CK0L 5LGHL 2ZCLH 4HUVB 4LAJH 1NAML 4RMSA 4CA4A 1NCWH 2W9DL 3JWNC 3IDXL 4KKAC 5SWSE 4XNUH 2KMWA 5IK3B 1UM6L 1DJSA 2B4CC 2QR0B 3GKZA 5DMKA 5C0EB 5E08L 3HZ3A 1D2OA 1PCXA 3AXLB 3PDOB 4QF1B 4ATWA 3LXBA 4BKLA 2R23B 2F5BL 3QG6B 3V0IA 4PLJC 2EEDA 4M8QA 4LCYA 4V2CB 2NY7L 4UTBL 1NZRA 4NZRH 4FG6D 1X44A 4EMZA 2CJUH 2VYRE 5BS0A 3EOAB 1NDTA 3KVDD 3PWUB 3KYMB 1F18A 5GIRA 4IRJC 5C2BH 3MOAL 2Q5BA 2FBOJ 4X6CF 5CZRA 1P6FA 1M7DA 4F8PA 4YSEA 3A6CL 2AV1A 4BKSC 3CHOA 5DC0A 5AVSB 3UPCA 3VWKB 1MPAL 4LSRL 5EU7E 1WUZA 1CDCA 1QA9A 1VJSA 3EGXB 5IB1A 5HVWA 3PGFL 1EFXA 2O4EA 5DJZB 4I0PC 4GO8A 3ZE0E 3PFQA 5LGYA 2DQTH 3AUVA 4XP6H 5IB3B 3DYPA 1X5AA 4GSRA 1N26A 1XZ0B 1OP5K 3DVGB 1QLRB 4ZO9A 4IBVA 4PWFA 4PJCA 4ABWA 2DL9A 3ZOAA 4FD0A 3PQYE 1YAIA 1MJ7L 5G55A 1IGTA 4LNRA 4LLWB 1T7WA 1ZHBB 2X9YA 3JWDL 3JTSA 3F8UB 4LDLB 1M05B 2DQEL 5GRJL 1LQBC 1D7FA 2VZTA 4BZ1L 1LO2L 3MBWA 4HEME 4A7QA 5SWQB 3UYOD 1MY5A 1F02I 3MUZ1 4ZXBB 4OBRA 3L81A 3KPOA 4JDEA 1BJ8A 3DJRA 3LKQB 3RUGF 1Z0MA 5CEYB 4J27A 3SDCC 5JHLL 4KKZA 4YE4L 3VFGH 3V4PL 4J3SA 1WIUA 4NO0B 1T2JA 4U7KA 3BLBA 3IDGB 5K39A 1ITCA 4S0HA 1NAKH 4NFDA 4QHNB 4Y4KA 3RIFF 4R4BA 5IBLD 3SKJL 1L0YA 3GKWH 4OZFH 1CGVA 2VJ8A 4G6FB 3BLKA 1RUMH 3U4EA 4NNYA 2DTMH 2W65B 2CK0H 1RUPL 4FXKA 1R3HA 1GS8A 2AK4E 2WZ0A 1HHKB 4PBVC 5DK0B 2NQ3A 1KLUB 4Y19A 1DVYA 4U1HB 2XTSA 3M88A 3FTYA 1P2CA 1KIRB 3NA9H 4JFEA 2P5EB 2Y7QB 2J1ZA 4X4KA 3CVBA 4FQHA 4K5MA 5EIIB 1B90A 1MCBA 2WNGA 5ESAA 3OKEA 3QORC 4HA1A 1KIUA 4I13B 3ATBA 4OBSA 4FXGB 1QKZL 2L7JA 1B0GB 2P7TB 4RSYA 4FQCL 1WFNA 1D5XA 3MRGB 1IQDA 2H47C 1F4XL 3CQQA 4J4PC 3C87A 3B2PA 4JB9H 5AG9A 3B2XA 4DW2H 1TYRA 2R69L 4WU5B 1CTMA 1P9MA 4YH6A 2HKAA 5EZOH 4BSWB 4KKRA 4U6TA 2C5DC 4B9IA 3MRMB 1D6EB 2VWEC 3ABMB 4C4KT 1NIBA 1YMMD 2J1YA 3GSUA 5JIMA 1A4BA 1AR1B 5DHDA 1SHMA 43CAA 2PP9A 3K8LA 2G75A 2WZ6A 1OLZA 4L9LB 3MO1A 4NO3A 1IC7L 2FX8H 3LQAH 2FO1A 3BFOA 2PETA 3II1A 3SE4C 4P3WA 1B4LA 2XVLA 2MHAB 4PG2C 1F6AB 1K3ZA 2ZCZA 1U91B 3N0AA 1XF4A 3JYBA 2QGBA 3BUYA 1ZE3C 2CDGB 2GK0B 3LKRA 5FYKD 1SJVA 4NQEB 3ZHLA 2DWSA 3UBHA 5IJKC 1L7TH 2X3AA 1NOAA 3L3KB 3QUZA 4HC1L 3QCUL 4U1MB 5DEFA 1XCTA 2TRHA 4JHAH 2AJZB 1G5GA 4E9QA 4AW4A 4MQXC 4RIRA 1WAEA 2BMKB 3JVGC 4JRWA 2VABB 4ODSL 3Q05A 3G5YB 1WHOA 4BE5A 4P3DB 3QI9C 4BH8A 1RZ7L 3MX0B 4MYWB 1ZGLP 4QHPA 2WZPA 1FE8H 3MBXH 5E8EB 2X4OB 3EW3B 4YN3A 4MB3A 3DOSA 4PRDB 2UVFA 4XXCC 5T1DL 4PRID 4Z0XB 4LPTA 25C8L 1K4CA 4WJ5A 3GMMA 3D52A 1KIPA 5I6OA 1U6AH 2F5BH 3AU1B 3KPLB 5HI5D 1WZLA 4D0CA 3SE9H 3ABKB 3CZLA 4L1DA 5ILTH 1JZGA 5E6ID 2YK1H 3O4LA 3QXVA 4U1JA 2R2BB 3CMOL 4G5AA 1A3QA 2D03H 3D8MA 2UXTA 4S0TD 1KUMA 1KGIA 4PJEF 2YKLL 3OKDA 5GPRA 5AVYB 4G80A 1T66D 4G70B 1M6OB 2Q10A 4FTVE 1R34A 1F3JB 4NWUL 1KBWA 2RBLA 3HAEA 3OJDB 3ZQXA 2DMKA 5LN8A 1MEXL 2QQKH 4NNPL 1VZHA 5E7FA 1FO0B 1KCSL 3EH5B 4BIKA 2X9WA 5EU5B 5EC2B 4PJXB 2OXHB 3REVA 3ULVE 1N0XH 4U05A 4GW1B 4KITB 4KKBD 5GSVB 3QDGB 3I75B 1T5WB 1YNKH 2PPEA 2V2WB 2E47A 3AVEA 5T3ZD 1BQSA 2BFVH 3GMQA 3WHXA 3RBSA 4R8WH 2UY6A 2ZYHA 3NZ8A 4L4VE 2K78A 4IRZA 5IQMA 1MWAA 1T1YA 1TMQA 2FWOA 4RRPM 4UOQA 3Q1SH 1M53A 5HGBA 1MCOL 2LU5A 3HE7C 4HDIA 3DURA 2FUTA 1Q90A 1WC7B 2DQDL 2CR0A 1QLFA 1NQBA 4K8RC 5GZNA 4JN1H 1UACL 4V2BA 4GQ9H 4NRXB 2D7NA 4XN1A 3BP6A 4UQBA 3HZMA 3QHFL 4FLHA 5FM5O 4ANKA 4NDMB 2UUDK 4WI0B 3ZBMA 2X6AA 1D5BA 3PRZA 5E9DA 3VH8A 3IE9A 4OGAD 5F9OL 3VD4A 1QSFA 2XN9E 4IM8A 5DURB 1O6VA 3TU6A 1BD2A 4MRCA 3FO0H 4XCYB 4ZMWA 4NNXA 4GQQA 2B39A 2WM0A 3D85B 1YEIL 3SZ6A 4JVPA 1CR9L 3U36A 2ITCA 3T65B 4OIBA 5CJ8A 1J1PL 1DZBA 2UY7B 4BQ9A 4K3JH 2LU7A 4LASL 3TF4A 1QFWL 2HZHA 3QAQA 5CKAA 5HVHB 3GJFB 4GP4B 2EH7L 1Z0NA 4QRRA 1N8ZB 4ZW6A 5C08A 5MHSD 2EKJA 3QJQB 1ND0A 4YDNA 1A65A 1CICA 1K85A 3FRPB 1J7VR 2CLVA 2V9UA 4FFWC 4PJ5A 4DW2L 3QQ9C 4MNGB 4NQCB 1N64L 4ZJ9A 4HEMA 5I8KL 4OZIB 3ASNB 1A7PL 3AQXA 4IGBD 1TZOA 3CFEA 3FFCD 2HLEB 5D7SH 1TVHA 2NY2B 2QR0A 3BP7B 4ODHH 5LLIC 4OLVH 4DP1X 2X53A 3Q5TA 2P5WE 1IVTA 2AK1L 1NFDB 1XH1A 2D31A 2A38A 2BRRL 1T7VA 3IPFA 4K7FB 5FO8A 1EMTL 1T1XA 3HKZA 2BNQA 5GZOD 4QYOB 4FQIH 1RSFA 2WSKA 4P5KB 2ZUVA 4WUUB 2LLGA 3P77A 1EXUA 1ZWIB 5I1GL 1XSJA 3GXNA 2NY4C 4BA8A 1UZ8A 4YUEL 1M7DB 5EV7A 2WTPA 1DE4A 3MROB 1PG7L 1T04B 4JVWA 4Q6IC 3ESUF 3HI1A 2JNZA 2CIKA 2H1XA 4HCRA 4HHAA 4F1ZA 2J43A 3PFUA 1W6LA 4PCKA 5E2UH 4V33A 5GSRB 2MH4A 3TA3D 3HS0C 4J3VA 4RRPG 2EDTA 2R0LL 1IM9B 4M5YH 1XQ4A 3G3LA 1Y7VA 4IGBA 4R7LA 4Y16A 1N5AB 4IJ3C 1RUQL 1QZNA 4JM2B 5DJ8B 1E8ZA 3VSVA 5DMGD 1GR7A 3AUWB 2MNWA 3HG1A 3Q8BA 1BA9A 4N0UB 3DJ9A 4HWEL 4X7DC 1ROWA 2IADB 1IKNA 1PKQB 3CFJA 2FQGA 2Y6TE 4FF9A 4ZFOB 4F7KA 1GMIA 1WD9A 2VJ0A 5I9QB 4QRRD 3MJ6A 1FN4A 4JJOA 2ZYIA 3G9VA 4HS8H 3S96B 4FNQA 4XP4L 5DLML 1W8EA 1MQKL 3MRIA 4KQ4H 5CFAA 1FPTH 1ED3B 2Y2TA 4JQIL 3BI9X 5MERA 1HX0A 4L9DA 2N1TE 3RX5A 1U8IA 2VXTH 3ARPA 2D7PA 3Q01A 4Y4KB 1MQKH 5CILH 3RGVA 4G6JH 4Z7NB 4KUZL 1GC1L 2YGQA 3DJZA 3DO7A 3H4FA 35C8L 4K23H 1S9XA 3BRGC 1MZZA 2CPUA 4IBQA 4QNPE 4ZK8A 1UUNA 3HPJA 3CDZA 4MJHA 4RMUA 1JZ8A 3ARED 1TZIA 4GPVA 1AR1C 3SY0B 1SVCP 4JN2B 3V6ZA 4YS4A 2H3NB 5DMYA 3L7EA 1MKFA 2AXJA 3NH7L 2X5PA 2AJYH 2TSAA 3NCFB 4HJ0C 2ALAA 1QATA 2WWMC 4HPYH 1ORQB 1WWAX 2GJ6E 1CCZA 1OP9A 2RQ8A 4H13C 4F92B 3D69A 1HHIA 4L8CB 3MJ9H 4IBLT 1GYVA 3U7YH 2VDRB 2UX6A 4TNWF 3TCTA 5T3ZH 5CEZE 5F7EH 4LHUD 2PN5A 1JCKA 4PW4A 5KSAA 3KLDA 3ULAB 3QXWA 1L5GA 1M05A 2C1OB 3DA0A 1BEYH 4JFPA 3IS1X 1J9SA 4F93B 1RZIA 2J8HA 2R4RH 3RVUC 3VX1A 4CBPA 3EG9B 3N91A 5HI3D 1JTPA 3ULVC 4LARH 4ZTPL 5AOMA 3ARFC 3ARBC 3M1OA 3D0LA 5F1KC 3LKNB 3UTTE 2LFEA 3R0MA 3KPNA 4O2CA 4GQPH 4KAQH 4JFDB 8FABB 1PZUB 5BS0E 3ZE2E 4EIUA 2BCKA 2P28B 4CU7A 1JZ7A 2AQPA 1S3KL 4ZMXA 4E9WA 5I76A 2WIIB 1BBDL 4HJGB 1DQQB 2X05A 1XCTB 1I7RB 3NCYS 3C8DA 1SUHA 3DV6A 5TQ2H 2OL3B 3PP4L 4ACPA 4Y5YC 3APFA 4AT6A 3WTVA 1KGXA 4P3DA 4NKMB 4BH8B 4FERA 3RAJH 5DK0A 2XT1B 4KOCA 3ZRCC 1PTZA 3HMXA 3PF2A 5IBUG 2G5BB 4QRQB 5KBNC 5L2KB 3F5WA 3Q48A 1KBVA 4UV7H 3S48A 3ZMRA 3VDBA 1I3VA 5D4QA 5DEJA 5T1KD 4URKA 3NPSB 5FV1L 1T4KA 4M48H 2KPWA 4TS6A 5C6PB 4UIMB 4FXGA 1DQJA 4LKCA 4WCYH 3V7MA 4A7TA 5EEZA 1XF3A 2ZKHH 2DI8A 4GAAA 5CU5A 3U6RA 1A3LH 1ET5A 1PX4A 5CUSL 4OU3A 3K5SA 4TRPH 1OXYA 5FUZL 4EDXA 4AJWA 4F57H 5KVFE 2H1LM 4U3CA 4BSWA 5HY9A 4CDGC 2NNFA 3HA0A 1Z3GH 4M1CC 2ZKYA 3F00A 5D7EA 4AYSA 5BO0D 1IM3B 3MCKA 4XBGB 2Z9TA 3GSUB 4U1LA 5KJRH 3CDCA 5GGTH 3N04A 3EYUL 4PJXF 4UUJA 1NINA 2VE6A 2OZNA 2NX5B 2YA0A 2Z31C 2EIMB 2UWEB 1HZLA 3GI9L 1I8LC 1HQRB 3FFOA 5I1DB 3M45A 3QWQB 4GS7C 2OSXA 4X9YA 5DJYA 3QAZB 3QS3A 1WITA 4NPJA 2AP2A 3QWRD 2X40A 2X4SB 2FB4L 3REVB 2HA1A 3V6BR 4JO1L 2N7AA 2JJSC 2F6AA 1ZA6A 4HGKC 3QORA 4Z3HA 1UKTA 5C0BA 4I0KA 1GVIA 2X41A 3NJHA 4RDBA 2FVNA 3RVXC 2G2RB 5KSAD 2KZBA 3PCYA 4WHDA 3RWCB 1GY2A 1KGYE 4B6ZA 2Y1AA 2ZUXA 4W9DC 3WS6A 4X8CA 2J21A 3VD7A 3KXFB 4G9FE 4NKOA 3TN0A 4UTCA 5DFTA 4R7VA 1JBJA 4JRYD 1LE9A 4GUPB 5KANG 1KTDA 1HT6A 5F7LB 2XZCH 3MRNB 2EC9T 3EGDB 2QDVA 2HTKC 5DMIL 2ZXQA 3M7OA 3I2CL 2HT4D 3TEXA 5I30H 1JNNL 2D7TL 2JKTM 4G8EB 1SDDA 2F19L 2OULB 3O0RL 4PJBE 3CFCH 2XN9B 4OZ4A 5FM8A 3RPIB 2H6OA 2Y7SA 3D39A 4XVTH 3QXAA 4G59C 4B9KC 2KHAA 3J27A 4ZD3H 5LDUA 5ANMA 3C2AH 4BDVB 3IJEA 4HUWB 3EOTH 5I1GH 4OGXH 4PD4J 2Z91B 2J8OA 1B9KA 1NJ9A 1EAQA 4LEXH 2FIKB 4EVNB 2Q76A 4QTHB 4XP1L 4JQXC 4Q52A 4KZ0A 2EIEA 3SIKA 5C1MB 5E95B 1WIOA 3V4VA 4BK8A 3SBQA 3ILPB 1K2DA 3FTGB 4GXVL 5H37A 5KUKA 3QZOA 1S78C 1FYTA 3L9EA 5EC2A 3S88L 3FRPA 1LWHA 1OPOA 1QRNA 3GBNH 3JVFC 4XBEH 1JPSH 1EO8H 4ELKA 5E24E 4WF7A 2XV0A 3GIZH 4WV1C 2EXSA 4U6VH 4KI5C 1T5WA 1A7QL 2ATKB 1LK3H 3QCTH 4ES8A 1O7DC 1VFMA 4BHUI 2XY1A 4IBSA 1ZV2A 5I6MA 3K1KC 1WRFA 2YPLE 4H8PA 4IJ3B 4KROB 3I6LE 1NFDA 3ALXA 1BAWA 1Q0XH 1QFWH 2PTTA 1WBYB 3ECVA 3BO8A 2P26A 5C07E 2JKSA 2H0JA 1NEUA 4I5BB 3IGAA 1F90H 1AIZA 1U2CA 4K94C 5A2IH 1F3DJ 2NY6B 1FGVH 4HF5L 5D4JA 2X6MA 1D5BB 4ES9A 2Y4SA 5HHXL 3A4FA 5D1ZA 5D1ZC 5T1MB 4MMXB 1RK1B 3ZKND 1B0WA 4WCYL 1H15A 1XD1A 1FJ1A 2ODHA 3ZY7A 4Z78B 5JPNB 2Z6FA 3HMXL 5LWYL 1N8OE 4GKZB 2J6EH 4PWJA 5DTFB 3COOA 1N6UA 4Z3FA 3DYOA 3WIHA 5HHVL 3HC3L 3R7RA 3VXUD 3IF1A 1I8AA 4B41A 3K71B 3ZDXB 1EO7A 4AXWA 4M43L 2K45A 2A6JA 1AHWB 1K8DB 2JKLA 2K8MA 2WLIA 2RD0A 3LS4L 5JHDE 3LX9A 1RZGB 3ULSB 1FI8C 1KJ3H 1QSZA 4DQOH 3QARA 5CGYD 1G7QB 1F3DH 3AU0A 4OZGF 1CLYH 1ZAGA 2NZ1A 5F3BA 2XWEA 4PV8B 3S3SA 1CL7I 3L7FA 3OF6D 4ZMZA 2DJMA 3KBPA 1G9EA 3IRPX 3K6OA 3V0VB 5ES4B 4MVBC 2ATPB 4AKPA 1V7NH 2DMHA 5F7YC 3QULB 3KS0J 3L3DA 5JYMA 4FRWA 4PB9L 1A4KB 4Z8FL 3L9BA 1CBVH 3ETSA 2UV3A 4ENZA 1T3FA 1KN2H 2BIOA 3B7TA 5I1JH 5TE7L 1U8PB 4L4TB 3T4AB 3KEHA 1E4JA 2WNWA 3P77B 4EKJA 1O6TA 3APDA 1F4WH 5G4MA 5LXVA 5B22A 4JFEB 4B7IA 2YJQA 4JO1H 1JCVA 2YD5A 4NSKB 1CURA 3MNWA 2JIXD 5B39G 1LJMA 1MSPA 1XR8A 2N01B 3F7RA 4RFOL 2KQMA 3D4GA 5BVJA 4QWWC 5HYFA 5I1AA 3X1GA 1PAZA 1W0WB 5L9DH 5MEOB 5DEGA 5B7MA 3BGMA 3CLEH 3VD3A 5T1JA 1QD0A 2DPKA 4KX9A 5LVEA 3R0NA 1D5XB 5B3SB 3P9MB 1JWMB 3PQYB 4EN3C 4ZAKC 1J8HE 1I7TB 3LEVH 3MCLH 1JHTA 1HI6B 5I5RA 4AQ8C 1I8MB 4XMPL 4GAYB 1MI5D 3MJ9A 4YBLB 3CCHB 3J8F7 4APQC 5HGGS 4CAGA 2RACA 1A6AB 2V33A 4WUUE 4AJ0A 4DESA 1IGCH 1TDQA 3V7AG 1NEZB 4Q9QH 1V54B 4OLYH 5IVOA 4P3CL 1OAZL 3UZQA 4OB5H 4E9VA 1P7KB 4G6JL 1X5HA 3HC4H 5HI4D 4UNUA 4AOFA 4JHAL 4BFGA 5FV2A 5IMMA 5TFSL 1QRND 3WIHL 2VZUA 1F6AA 1N2RB 3LV3A 5D5MB 2Q8AH 5CF3A 1JPSL 2V7HB 1I53A 2WLYA 2AV7B 3D87B 4HXBH 4MKMA 2WCSA 2BNQE 4B95C 1NMCB 4U33A 2ED7A 2V3DA 5B7EA 5EORL 1Q1PA 1XGZA 3IFOB 4G1EA 4QJ5B 1Q0YH 1QSED 3ABLB 3LMJH 4XHJD 3RWDB 3RVUD 3PLYA 3MLXH 1XAKA 1H0DA 1ZVSA 4E9YA 5CINL 4ACTA 2VN7A 5DD6A 4BHUA 3VGFA 2YUZA 3VXPA 2OJEA 2A4ZA 1NGZA 4XO3A 4EXKA 5FYKL 5TDPB 3N55A 3FXIC 1SZNA 4TQIA 2CBOA 4Z7QE 1QWNA 3PL6D 4N5EC 4TULH 3TO4B 2J1KA 4D7PA 1R24A 4AC2A 2ZX9A 3FCSA 3T1WA 3GTTA 3LTVA 2DEWX 1BD2D 1HYSD 3OB0K 5G5DB 1YY8B 4E9SA 4HUUB 1NDGB 3HG4A 3U9UB 3GSNB 4WEBH 5ETUB 4U1IB 3OKDB 3BAYA 2DJUA 1M6OA 4WNQB 1AKJA 4HUVA 3TBWA 4NC0B 2YMOA 3HNTH 5AUMB 3DVNA 2MCPH 2IDSA 4KO6A 5C0EA 3DXAD 4XMLH 2CRMA 1NCAH 1EBAA 4GRMB 5SWZB 1B4JL 3FTWA 5D7LA 5GGTA 5EUOF 3ARGA 2EH8H 5TQ0H 4HIXL 4R97B 5HBBA 1PW3A 1QFWI 5EA0L 2WUCL 2ZSWA 2CA3A 4O2CB 3U83A 1X9RA 2QPEB 2XV3A 1RZKL 3KDMB 3VM7A 4JE4B 4N85A 4PBWD 4Y9CA 1DQLH 5HD8D 1ERNA 4R0LB 4HWBH 4YC2C 2N56A 4KVCL 5EOCL 5E1QA 2V2WA 2G2PA 3FT2B 1TU2A 2C26A 2VL5A 3X13A 4OLXH 2W88A 4PGEA 3KR3L 1H8OA 3LZQA 1KTKE 1FYHB 1CICD 4NKQB 4HJIA 2G2RA 1F11B 1QO3B 4JPIA 4O9HL 3PE9A 1AGCB 1WCBB 2EE6A 4DPBX 3EZ8A 5DI8A 2CXKA 3F83A 5JIDA 4NP9A 1W8NA 3DURB 4GRWB 4UQ9A 5CMAA 5KS9A 1GH7A 3S3DB 5AVTB 5CSBA 2RIKA 4BWUA 5FUZH 2ISDA 4IOIA 3QS2A 3QB7C 3S36H 4LSVH 4J4PD 3RDJA 3BZ5A 1J8HD 3GHEH 2WK2A 3IGFA 2HRHA 1JXJA 4JG5A 3RTQD 3TJEH 3WFEH 2CHNA 2C1PB 1Y1UA 1INQB 4IBUA 1WEJH 4RFOH 5DVMA 5TPWH 4K2UH 2A2QT 2B1OA 1IGML 4LO9A 5DQDL 2X70B 1KLGA 2ITEA 4H44C 2XPGB 2HAZA 3U7WL 5ID0A 3VYOA 4TUJA 2EYTB 3QJFA 2KLRA 4GBXC 4JRXB 2WINA 1ZSDA 3IBEA 4KQ4L 5I0WA 2IWGA 1ET7A 5ACZB 4HSAC 1UT1A 5IM7A 5IVXA 3WNJA 4BFRA 3NJLA 4OCYH 3V79C 1DEDA 1ZVHA 1I8UA 2RGSA 1GJWA 2MSPA 1AD0A 5A6IA 4JDZB 4IMLA 1JFQL 4EVNA 3EJZC 3S34H 3LXUX 4WLCA 2EP6A 4Z7WB 1IB5A 3F7KA 3MAWA 3RGHA 4Z0BL 3T4YB 4CGTA 4HQQH 4NUJA 4AQ1C 2W65A 4HUXB 1IBZA 2F8VA 3ZZLA 3BRFA 3DGGA 3W39B 1W0VB 2CH8A 4X4MA 2B14A 1YEGL 4JMNA 2OTWB 1CDJA 3QI9D 1A25A 1WH0A 1DSYA 4PJXE 3LH8A 1CLYL 1FHNA 1OT1A 3IETB 4P2OC 1FFTB 3MRHA 1SXCA 4HIIA 4DNLA 1BHGA 2CM6A 3AG1B 5FHAL 5HDBF 2DWYA 4HT1L 2YWYA 1JPGB 1RHFA 3BGFC 3GJFK 2FWLB 3BW9A 1NCHA 1A64A 2PO6D 3L5XH 5FGBC 5EN2A 3MREB 1IL1B 1M7UA 1YEHL 1B4TA 1ODUA 3E1ZA 4W4NA 3MRDA 1OCZB 4WI7A 3QT2A 4Y89A 5F7FA 3X14A 3LJ3A 3BVTA 4P2RE 1EFXD 5EZLB 3EJQA 5J4MA 1DE4B 2O72A 3MROA 3N1GC 4AMWA 2QKSA 2RB8A 1E4XI 2VN6A 1IGYA 3DRQB 3C6SA 4LKXB 3BSZA 4GSXA 5DHVH 4PRPE 4HKXB 2YWZA 3KYOA 3GHPA 2AJXL 2EZ0C 2V17L 2CO7B 2QSCL 2QEJA 3D39D 2BZ7A 1KBPA 3GMNA 5GGUA 3H54A 2XHNA 1WWCA 2NY4D 2GITB 4Y1AE 3BQUD 4GG8B 1JI1A 1U91A 2CUHA 3MV9B 3TJPA 1BFOA 1UVQB 4TSAL 2WYTA 4FJ6A 5DO2D 1DVFC 3RWFB 3WMPA 4ECNA 2Y5TA 3FO9B 1TQBC 1AHWA 1K8DA 4OF8A 5GZNC 2CSPA 3QE5A 5D7KE 1JYXA 1OT2A 4UIKL 3SYQA 4DUWA 3VWJB 3QUZB 3KPSB 5AVUB 3T8XB 3I9GH 2IAMA 5CILL 3KWUA 3WENA 3T6ZA 4D9RD 3VI4E 2QT6A 4JANA 4HK3N 3ZHKA 1JNHA 2DI7A 4TOYH 3C08L 3O2DH 1LP9B 2FECL 4JQIH 5IV2B 3QEQE 5DJXA 3ATEA 1JZEA 2PWGA 4YEEA 3TPUA 1SRDA 3I9GL 4IBYA 5HP5A 1FRGL 1B3IA 1GYAA 2IXQA 2QVTA 3L5IA 2A6KA 2XJLA 3D3VA 1M2VA 1C5BH 5BNXD 5GQBA 2FNBA 5HDBB 2V8MA 1LO4H 4G7QB 4E42A 5K59F 2XTJD 3HC0B 3QZWA 4BXSV 4BGLA 1WFUA 2FSEB 4DJMA 2QADB 1MLCA 3GB7A 4R90H 4XE5B 4O02L 3ARZA 3MNVA 4NZFA 4AIZB 1EZVY 2ZCKH 3C2AL 5KVDE 1I4FB 1NC4B 2VMFA 3GGWB 4PRAB 4NQVA 5EZOL 3CN1A 3P73B 3RWHA 2R0LH 1IAIM 1BREA 3SKNB 1Y07A 4YSAA 1AGEA 4IMKA 1BBJA 2NCMA 4EPSA 4I77L 2ZCLL 3DVIA 4LCWE 1I9RL 5DRZB 2WSDA 1MCWW 1OARH 4X5WB 1S78D 4JY5H 5F9WC 4D9QE 2AQSA 5CS7A 2R4SH 1S7TA 1AZZC 4YUEH 3KLQA 4A2MA 2BVEA 4Z7NF 5J6GB 1GZPA 5BOJA 2AJ3B 4ZS7L 3AY4A 1FVDA 4M7KL 2V3EA 1YNLH 3RNKA 1J0YA 3QUXD 4XXCA 1OLLA 1NOLA 4TM9A 4PJIE 5TE7H 1CLCA 1YN6A 1DEEA 1YNLL 2E7DA 2BOCB 1UA6H 2C3VB 4PHZA 2DBLL 3AT0A 2MKLC 3P4LA 3NJKA 2ICWB 4UB0L 4ZX3A 3SKJH 3L3OB 2ENPA 2KQNA 3U1PA 4ANXA 2C3XA 2VDQB 5ILTL 2YAQA 1GJUA 3BN9C 1UJ3B 2CO6A 2B9AA 3NPSC 4RQQA 2UYLB 3MA9L 1ODAA 4YDKH 3F58L 4P2QB 1Z5YD 3CPLB 2DICA 3AWFA 4A2GA 2KI6A 3SDXE 4NDMA 2VM9A 1I7UB 1PKQE 4P2CG 4YFLI 3MXWH 2MOQA 5CEZL 2LLNA 5JNYA 1N5YH 3M1BB 3LB6D 4NLAA 1MW1A 4X9FA 4BQCA 4BZ1H 2EXTA 2VLKB 2X4NB 4P4KA 4HWBA 3TT1L 3S35H 3HC3H 1S7SA 2OMYA 3JWDH 4NNXB 3NIGF 2ITDA 2C4FU 4XNQB 4OZHE 1TR7A 2VR5A 2DD8H 1MHCB 1KGCE 4KUZH 1H5BA 3R18A 4MDRA 4X4ZA 5AAMC 3VXPB 3IAQA 3OXSA 5F0MB 2IBBA 5HJ3A 3SE3A 5I1KL 4NC1E 2GFBA 2UZPA 2BNUA 5EN3A 5HVFB 3P02A 3UTOA 2E6JA 2CDEA 2VDLB 3RQ3A 3GHEL 4QKTA 5FM4A 1NL0H 1IT9H 5I28A 3STLA 2F74B 3QEQB 3TL5A 1HSAB 4YDLB 4OZHA 1UXSA 1E4KC 7TAAA 4XVJH 4YHKL 4YSUA 2PWDA 2BINA 4UT9L 4YO0A 2HT2D 1EZLA 3FQUB 4GRWH 4DGIL 1A1NB 5HYJA 1ASQA 4DUVA 2HTLD 1RZFL 2XIBA 1U9KA 2XZZA 5AVRB 4TVPD 3N5AA 5JXED 1WAAE 5BRZD 2ED8A 2P1YA 5FHBH 2Q1EA 5T5NF 1PD6A 3X3GL 1I3GH 2CO1A 4OKVA 3OZ9H 1P7KA 4MAUL 3CX5K 2NNAA 3MGTA 3NMEA 3VH8G 2O30A 4TNVK 3ZHNA 3HVNA 3KCWA 3UXFA 1E40A 3PWLA 4ZX5A 1CS6A 1VFAB 5ITFA 1MFNA 2EIZA 1BQKA 3IXTB 5J89A 5EF3A 4NPYA 1NBVL 1T0NB 1IAIL 4MNQB 1S46A 5DRWA 5BO1L 3RVVC 3HLKA 5EO0A 5ANHA 5FYJL 3DETC 3TN0C 3UPRB 5E4EB 1JGLL 4YVNA 1JWSB 1TMCB 3IDJA 4NHUB 4OLWL 4PGEB 1MRFH 4JO8A 2W59A 4I18A 1E90A 1QR1A 3X3FL 4AIEA 1EMTH 5DI8B 3ZDZE 3FN3A 5DD6B 1SYVB 5AZEL 4LXFA 1YMHB 3B6SA 2ZUQB 3KLHC 3EDFA 1R6VA 2BHUA 5ITBH 2WAHA 3HAEG 4PTUA 1KJ2L 2QBWA 4PJAE 4XXWA 1A7PH 3HR5B 1TJMA 3Q7JA 1ECZA 2CO4A 4YK4B 4G8EA 4XNYL 2EIKB 3QYMA 3IWUA 5ADPH 1XGQB 1UXMA 2NYYC 3AS0A 3B9AA 6FABH 3QQ4A 2C9RA 3QH3A 3EHBC 2OM5A 2L0DA 1NDMB 4XC1H 4FNLL 5BCAA 3OAUH 4ZQKB 3IVKA 2HJFB 1E4WH 4OZGE 4HMCA 1TF4A 2EC8A 3QXDB 4Y2LA 3RDTD 3UZVB 1JRHI 3U9UA 1EJ6A 1GTFA 1LO3L 5IVXB 1LK2A 5CBEB 1U8JB 3HG3A 2VLRD 4YMPA 3DECA 3MV7B 4L5FH 1VADA 2R2HB 1A7RH 3K2MC 4CVZA 5AUMA 5CZVL 4FQXC 4GRWF 4CL7A 3MTRA 3OLGA 1F0LA 4UOZA 4QHUA 2FL5A 1HKLL 3NFNA 4PY8J 3TOPA 2W38A 4GW4B 4B9GA 4Y4KC 3V4VB 3CIQA 5B4MD 3CBJB 2WWKO 3TJEL 3OV6A 1H6TA 3EBGA 3ZO9A 1O0VA 2BP0A 1RIVH 5IVZA 2FB4H 3E9TA 2N3JA 1F2XK 1HAWA 3ATFA 2ZYRA 1ZA3A 1EUTA 1JSYA 2W95A 2IIJA 1HKLH 1VEOA 4ZUSB 3O2VH 2WVVB 2A9AA 2WVUA 4L1HA 5JOPE 3CUPA 1UEYA 1R0AL 5ICXB 2V2XA 4B9PA 4F7PA 1P7QB 2LVCA 2NY1B 4X7CC 3GBDA 1NBCA 1R1CA 3BPCA 2ZXWB 2VDRH 5F6IC 3QR1A 2WQXA 1OSEA 1Q72L 1AP2A 3C6LD 2RH0A 2MNJB 1WBZA 2DJ4A 4AENB 5KS9B 4C56B 1HHIB 1F42A 4N1HB 1TCRB 2H32A 3GIVA 2AAAA 3IE4A 5C09D 2WNKA 2QSTA 1BPLB 4I5BA 1T03H 1JZ5A 4WK2B 4DF9A 1Q9KA 2LVEA 1K5WA 1H6UA 2RQEA 2HB0A 4GFTB 3FHQA 2GBUA 1QKZH 1H3UA 4HSQA 1EEQA 2H45A 1KLGB 2X70A 4DGYL 3C8KB 4GRWE 4HKXA 5DUBB 3D12B 1B2WL 2DQMA 5IROA 3SGKC 4X5RA 4ZTEA 4EQ2A 3AG3B 4B53A 3QUYC 4R7XA 4FQQB 2WYIA 3AMKA 3VFRB 1KACB 4OD2B 2O6EA 5AKRA 1L9OA 4U7MA 1U2HA 3CZFA 3TM6A 5JR1H 1BM3L 5EHFA 2WLKA 1TVDA 2AQ2A 1DN2A 1DBML 1P0SE 4GLRH 2BW4A 2NPLX 3DVFA 2PW2A 2J2ZA 4NCC2 2YRPA 1ZE3H 2GC4C 2IV9A 4MMYB 4HJGA 3T8MA 1U8HB 4Y9GA 2BSTA 3PAVA 3E2HC 3CMOH 4NZ8A 4EI6B 4XX1E 3DUSB 1RMFL 2HFFA 3QISA 4O4YH 1W72A 3MUGA 3HNSH 4YBLC 4CN4A 2OTWA 2XG5B 4JLRA 1CZ8L 1QSFD 1D6VH 1U8OB 2BHZA 4DVRH 4HZAA 2DLHA 4LU5L 5IBTL 2R39A 4OCSL 4QO1A 2FO8A 4H8WH 2QLVB 1KN4L 4EN3B 1AHWC 4F15B 2W81C 1FC2D 1S5IH 1R9FA 3FQYA 3RRQA 3TCLB 1K3IA 3OKNB 1DQJB 1FE8L 3MBXL 2WW8A 2VDPH 3V0WL 4I85A 4XP5L 5EN2B 3N43F 4X7SL 3IU4H 4PJ8B 2KDYA 1DCLA 3H1ZA 4HZLA 4X7TB 3HMXH 2NY5H 5LWYH 5T5NG 3W3BA 3BAXA 3DGCR 4K94L 1OV8A 2IGTA 4O02A 3H9HA 4XGZB 1KIQB 1CXIA 4OY9A 4D8PB 1BYOA 3EGXA 3GM0A 4LKXA 1T0MB 4X9HA 4UMSA 1NTDA 3V0EA 1NLBL 4FJZA 4PTTA 3SPJA 4AM0B 5IB3A 2HG0A 3DBXA 3GSVA 3N9GL 3L3JB 5GGUB 4HH9B 1HCFX 4OB5L 4WWKA 3SQRA 2VLJB 3ZYIA 3IKCA 1I7TA 4GG8A 5D2LA 3QO1A 1J48A 1P2CB 2PWFA 1RZJL 1WBXB 5E8PA 5CSGA 2N7BA 32C2A 4DN4H 2G0LA 1SMAA 1Z9MA 4BELD 4B50A 1VGEL 4G3YL 4A2HA 5J1SC 1BGXL 2HX9A 3U0PB 3Q06A 3T0WA 1B0GA 1C1EH 4AIOA 4XVUC 4EEEA 1I1AD 3FONA 4KTEH 1UM6H 5GRVL 4L8SB 1P5VA 5IHHA 2IANA 3HHSB 4OF7A 4U1KB 4GMSL 5FYJE 5CCGE 2JJVA 1CF8L 2GG1A 3KYKH 3W56A 1OSPL 1TJIH 1XH2A 2NT0A 1ZLVK 2V3FA 3GUTA 5BQDA 1G1OA 5J12B 1FGNH 4GAGL 4HU2A 4IKIA 4PGDB 3SEPA 4FCAA 3QUXC 4KKCD 4C57C 3C9NB 1MLCB 3GB7B 4LOFA 5HPMA 3HLAB 5D6DA 4C56E 1SDDB 3GSOA 2VQTA 1KB3A 5E2VL 3VGDA 1QNZH 3JV0A 3ARDC 2BS9A 2X4NA 4PJ9C 1DFBL 1WFMA 2IG2H 4PRAA 1XF4B 1XVSA 1BMZA 4LIQH 4QRBA 3BUYB 4YXKL 1F2QA 3SE8H 1TQCB 3ZYZA 2CXGA 4BDVA 2KZWA 3TO2A 3EYFA 5JPMC 4JNXA 1GZHA 5D9SA 3WIAA 3VXOB 5DVNA 2A74A 3UJJH 4AWJC 5CP7B 5CHNA 4ZOEA 1EHLL 3LHAA 1A6WL 3VGHA 2F7QA 4H26A 2FE0A 2NNCA 4JG1H 3P4NB 2DM3A 2OI9C 1PLGH 2GKIA 3LY6A 2NSXA 1VGKB 4BUQA 4N2MA 4KKLD 5PAZA 2KLSA 2ZP0T 2DQJL 1VERA 5C6TL 2P8PB 3I50H 1K4CB 1CIDA 1YPZE 3GNML 4FKKA 4WJ5B 4P57A 4Y4FB 4CKQA 5GS1A 1ROCA 2ESVE 2Y6SC 2JIXA 5DUPL 3ZDYE 1ZTXE 4PJBF 4GP8B 1FA4A 1TKWA 1VENA 3O9WA 4KX8A 4I8DA 4NLHA 1RPQA 4OKVB 2LR4A 4QT5A 4EBQL 4TOYL 2A1WH 4FQ1H 3HI6L 3KPRB 2Z8SA 3WGVB 1E0OB 3FUFA 3QCVH 3ZTDC 4JQVC 2BVQA 4JKKA 3DARA 4CJ1A 2R83A 2XU9A 2PR9A 3O45A 3DIVA 1LVEA 2CDGA 2AK4A 4DZ8A 3ZT5A 1UWXK 4F7EB 3O8XB 4KY1L 2H1PL 1IQWL 2MOVA 3A6OA 2RMNA 3CTTA 1X5KA 5DZVA 4JFUA 4N6RB 4YHKH 4XHQA 3OG6B 4GP5B 3N41F 5EBMB 1LDSA 2UXVA 5LNEA 5I0YA 3T3PF 1FNGA 4HALA 1YUHA 3DPDA 2QSCH 1XAUA 3NJXA 5D5ME 1O6SA 2H3KA 4QRPA 3NK3A 4XBEL 2QMKA 3TVMA 5I5MA 1UTDA 1KEMH 2XPYA 4MB4A 3MGOA 4MXWL 3VXMD 2ERJB 3ARBD 1RULL 4R6UA 1AQDB 1ZT4A 3TURA 2ZOKB 5DFAA 3EYVA 5DQ9B 1NMBL 1EAOA 1UOKA 3GT6A 5F9JB 1L9MA 2XPGA 1KXTB 3S35X 4G9FA 4BZ2L 3BEVA 3HR6A 1UA6L 2YPLB 4JRFA 1U58A 1JZ4A 1OGPA 3BZDA 4OCXH 1WICA 2XBDA 1MREL 4PRIB 2OKMA 5AD0A 3IEAA 3HZMB 1CB4A 1E2ZA 4L2YA 3RB5A 5C92A 5F6IB 5LAXA 2JV6A 4NZDA 1OAQH 4JG1L 3IKKA 3S5ZA 5L8KB 1S3KH 4AGMA 5M7QA 1DBAH 4ZFOL 3PL6C 3ILEA 3F7YB 2D0GA 2TSBA 2OA9A 3VGGA 1ZMYA 3O0RH 4JGMA 4KGJA 1DBAL 4AI7A 1FF5A 2B16A 2IPKA 2EIZB 3IXTA 3VRLF 1WLHA 3BMWA 1MFBL 2H32H 3T65A 4ICXA 2WUBH 5IT2L 4X5LA 5AOKA 5JR1L 5EO0B 3UPRA 3CUPB 1PZCA 4J1UA 4ZMTA 2DQIH 5CCJA 1A3RL 1J5DA 4MDIB 3UJTL 1EAPA 3L6FB 4Y1TA 4APXB 4F2FA 1EK3A 5EDSA 1KGUA 5AKSA 5GRJH 3DGDA 4ZFZA 3TEUA 3BLPX 1M57B 2R4SL 4OZGA 5EU7C 1AP2B 1FCGA 3EGSB 5EO9A 2Z0BA 3NACH 1AZRA 1FFPB 1UCTA 1JRHH 1N12A 1SXSA 2EEXA 3KL5A 3ZHFA 2YD4A 3VG9B 5I8OL 5KVDL 4K3DH 2HXAA 3QDGD 4JKMA 1NCBH 3BP6B 2DJSA 2DQUL 3CFEB 3WEXA 4L18A 3S36L 2CRIA 5DUMH 1UT9A 5D55A 4N24A 3WNKA 2X1OA 5GHWL 4OD3H 3ZDZB 3PIQA 1L0PA 1CICC 2MKWA 1G7IA 2YQ3A 4FLRA 4BWWA 4LSUH 4HKBA 1UT2A 4ZQKA 5T1DH 1CFTB 2JCWA 3GI9H 2WGNB 4QRTA 5C0DB 3MN8A 2WVTA 1RHHA 1Q0XL 5KG9B 1G43A 3ES6A 2BVPB 1ZWIA 4PG2A 3TGXA 1R33A 5T1LB 3GSXB 3HCVA 3C5ZC 1NUFA 3TYFB 2GT9B 2V7HA 3OMZA 1NCOA 3RHWK 3LZRA 1R46A 2A0LC 3O2VL 5ESQA 3KGRA 3N9GH 3QO0A 4YHIB 3RL1A 6CGTA 1NGXB 4UDTB 1MFAL 3CLFL 1SY6A 1N8ZA 3BVUA 3D1MC 2H26A 4ODXA 1U8HA 3CVCA 3H9SB 5IVXE 2FEJA 4GBXD 3LEXB 3ZE2B 1N5AA 3FSWA 3BC9A 1ACYL 3SO3C 3NSXA 5HHPB 4AGNA 4UV7L 2FZ3B 1F8TH 3TNMA 4F7PB 5DJCB 1M2VB 3QUYD 5T5FL 1I9JH 1IFHL 4MCZB 3ATDA 5HHMD 3PWVA 4FXKC 1MWAH 2PYEB 4PS4L 5KVMC 4L29B 2W80C 4NQQA 1UD2A 2GW5A 1R24B 3L4WA 2VQ1B 3U4BH 4HVBA 5ANME 5HHQA 5E5LA 1VESA 4LEOA 3RGBA 4NQCD 3T2PA 3WXVL 1UZ8B 2DF3A 3R1GH 1SLXA 3FFCB 1WYJA 4LIQL 4S1DD 5CXPA 5FYKH 2EYSA 5L2KE 1IAII 4L0PB 3TBWB 5EPMB 3U4BL 2P8LB 4LARL 2MCMA 5JQHC 2H9GB 1HN1A 4DKEL 1OSZA 3SQBB 1YDPA 1DFXA 2CDFA 4HS6B 4ZO7A 2HYMA 4PCSA 3T0ED 3B2DC 4ZTPH 3D50A 4R4FH 1QVOB 2AEQL 3J7HA 4V11A 4YLBA 5D7IF 3RVWD 4J2XA 2VIRA 1DQDH 1FIGL 3CHPA 1X9QA 4RVBA 1JPEA 1N7ML 4QTIL 3SODB 4UQCA 2PP8A 2WXHA 1KCUH 4A39A 1TZHA 2WQ8A 4KZDH 1NIDA 1HXYA 4PJ9A 3S8FB 4GI9A 2AJUL 3FT2A 4H88L 4JMXA 4X6DE 1P84J 4ZT1A 3VI4B 3FAXA 5H37H 3PAYA 4G8IA 3TA3B 3IU3A 2PWEA 4RFEA 1AQ8A 3K8MA 4W9GC 1TQCC 4ZMPA 4L8DA 1OGAD 1XSKA 2WLNA 2PYFA 2XZAL 4Z7UE 4HF5H 4QUOA 1CVRA 5D1ZD 5T33L 4L23A 3MV9E 5DSCA 2NXZC 2P46B 1E4HA 1JN6B 2EH7H 3RILA 1HINH 4WWKD 3BXNB 3WEAA 4POZC 4Z1PA 2Y7OA 4NN5B 2A9MH 1GC1H 5C0CB 1IEBA 1GKEA 3JT0A 1ADQH 3CLWA 3IFPB 4DK6A 2AW2A 3MVSA 1XB6A 1RZPA 5E1IA 2EVIA 3IJSA 2J25A 3KPNB 3QNYA 2LTQB 1SXZA 3FTSA 4NC1C 3SPCA 3BWZA 1MHCA 1NEZG 1D5IL 1JHLL 3MRQB 4BWTA 1A7NH 5I8OH 4UNIA 4JKPH 5C97A 4LLDA 3LSOA 3M86A 5LGJB 1H6FA 3WJLA 1IBFA 1HL8A 1RFDH 2JE8A 2JI1A 1BVLB 5IHUL 4CADA 2F74A 1NCCH 4AL8L 2QTVA 3TIDA 1QPXA 4LSPL 1N4XL 4P2YA 4E9XA 3MJ7B 3VM5A 5FDWA 2D3VA 3IAGC 4RMWA 4HHWA 4WWID 3UG3A 1N18A 5D2LF 3A0OA 4QRQA 1HS6A 4DVBB 4IK7A 4M5YL 4MMXC 3R7QA 1S5HA 2W91A 3ISWA 4HW6A 5C7ZA 3SCMC 1FUNA 3FH8A 1QASA 2CAKA 4MJ5B 1SJXA 3OPZH 1MVYA 2Z7WA 4HIIB 4J4PA 4YHNB 1K8IA 2NY6C 3GMQB 4PLOB 3Q43A 2YBRA 5D1XA 4QYAA 4M6ML 3MBEC 2DM2A 4UB0H 5AOLA 4DFIA 4J3XA 1VFAA 2L4OA 4OZFG 1NFDE 5JXEC 4E41A 4PJEB 5AZEH 3U4KA 3MCKB 2JJUA 2ZYSA 3OLIA 3BPLC 3VW3H 3C5JB 4JY6B 3UAFA 5K9QG 1JD9A 1I9JL 1DUYA 4I0CC 3HMWL 5DA4A 5D1XE 3ARDB 2ROXA 2VXVL 1AI1H 1HQRA 2R29A 3C9NA 4M62H 5HPMB 5I17A 1KWKA 5JMRA 1N3NA 5DJYB 4NO2B 1WZMA 2J8UB 3V5HA 1JL8A 4HG4J 4I1NB 1XZ0A 3HN5A 2GITA 4Q58C 2DLEA 2F53A 4G8GA 3RVVD 4OM1L 1ZV9A 1B0RB 4PTUB 5C09A 4K3EH 1A7OL 3CFUA 5C0AB 4XPTL 4TNGA 1RJLB 1YEFH 1FSKB 4X8JA 5FYJD 4ANVA 5B3JE 4TVPH 2ZOKA 1AKJD 3RWCA 4OTXH 4WW2F 4F1SA 4AQEB 2VN3A 2I24N 1NDMA 2ED9A 1XL4A 1DQKA 3SQOL 3BD4A 2DDQL 3WY3A 1IGIH 5J8OA 3I02A 1Z7JA 2GCYA 3SQOH 1LE9B 4AYFA 4TF4A 3HBGA 5IV2A 1U3HC 4OTXL 1OCOB 4KJPD 3EYQD 2XQYK 3LD8C 4KK5C 4MJ4A 4XP9H 3ESMA 2HG5A 5E56A 4XPAL 1AZVA 3SGDH 4KKCC 5HHOA 3P3TA 4W9EC 1DDTA 3LNIA 1JHKL 4R4BB 4C47A 4OZ4B 4JFXA 5LDSA 2CLZA 2OP4L 2ADGA 1UCBH 1FL6B 3QJUB 1WGOA 4GXVH 2CO2A 2NXYB 3NP3A 2DIBA 1SXAA 3IJEB 3HFMH 4HUWA 3ET9F 3IU4L 2F18A 3MRKA 4WQOA 1ZXKA 4LRNL 4MA7L 1IM3D 1CGSH 3GSRA 4DKTA 1K4DA 1C5DA 1JV2A 4HWUA 3CX2A 3GYRA 4XVOA 5CSZB 5EU3A 4PLKC 1P7QA 1NWOA 1Y0LB 3A67L 1HHGA 1R17A 3MXWL 4TTDC 1MJ8L 5KYWA 1H8SA 4PJDE 4M5TA 3BYTA 4PJ5D 1U3ZA 3U2JA 2R69H 2NY3B 2WWKT 2WP3T 4KRMB 1JF5A 5JQ6L 4YDKL 4HIEA 2P80D 2OYKA 2XQBL 2XV6B 1EX0A 3O41B 2ARWA 4P9ML 2KUTA 1KTDB 1R5WB 3LZFL 2NY0D 5AYQA 3EOBB 5CAYB 5JORB 1OT4A 1YN7B 1EHXA 2CWRA 4GSDL 4ZSOA 1XL6A 3FB8A 2FDBP 2QTEA 4OF5A 2VXQL 2ZTBA 2MEJB 5B1KA 3RFZB 5ADOH 1KXVA 2PO6A 1LEKB 4MKTA 5F96H 4F8QA 2MWCA 4MYPA 1QPPA 3F7QA 4HJJH 4KK8C 1KYFA 3CZFB 3FTZA 3FPXA 4KX7A 1LEGB 1UQSB 5F97E 1RFDL 5ICYA 2FIKA 1E9QB 2JXMB 3E7JA 4L9LC 1UD4A 3FFDA 4WIQA 1P4LA 5TH2B 1T89A 3V4VH 5IB2A 2JH2A 5MEPA 3N85H 3SPIA 5DTFA 4N2OA 3Q8AA 2IALA 4B9ZA 4YE4H 4OF3A 2YD0A 4TV3A 5GGVH 3Q3GA 1JDDA 1U6AL 5E6ZA 3SN6N 2D3JA 4LESA 1Z9SB 2BY0A 4PREB 1AZNA 2ZWKA 3OC8A 4RZKA 5KOVC 1IQWH 4UILL 4ICWA 3ARRA 1DVFD 4R97C 2XIIA 1HINL 3QFJD 4KJYB 4KVNH 2AI0L 3PWPE 1AXSA 3O6FC 2EILB 3TVMD 4GSUA 5B7FA 5GS0H 1WFOA 2A4CA 4L29A 3EGSA 1K6QL 1H9VA 4P5TC 2X9XA 4X7TA 3WN5A 3BDYL 3ZK0A 3FO2A 4D94A 2NY5L 3L95A 4AL8C 5L0QC 3HUJF 2O5ZH 5H35A 5FA3B 4M02A 2QZ5A 4S1RH 3WJMB 1T0MA 1X7QA 4QOKD 3GHBH 5FR3A 3NCCB 3QHTC 2DLIA 2M8XA 3ECUA 3M17B 2JJSA 5I1IH 2AHIA 1NM9A 4WTXA 4H7VA 2CDFB 4AYDC 5FCSH 3SDAB 3CGTA 2P5ED 4JPWH 1JXGA 2IC2A 4ANWA 4OGXL 5B4MC 2YZ1A 1CFNB 4LSTH 4FKEA 4FFYH 5SX5H 4CNIA 5E8PB 1H5BC 1FYTE 2BFVL 3STZB 2VZOA 3KL3A 4GW1A 4NSKA 3ULUD 1FV1A 3DK0A 5H4YA 2JK5A 4MA8L 4Z3EA 2H5UA 4XNYH 4P4KC 2FGWH 3U0PA 1EO8L 5FUCC 4ZQTA 4WHTB 4B5EA 5CZXC 4C4KO 3LN5B 3HUJA 2VDOH 3NQIA 3VDAA 4HKZB 1OPGH 4RFEB 4UCFA 1DUZB 5IF0A 5ISZE 4I18B 3C5ZA 4Y2DA 1VAHA 1SFDA 1HDMA 3WUZA 3A24A 1YEHH 1OCCB 4NIYE 1S2EA 2ZUQC 4JFSA 4LLWA 4MZ3A 2ITFA 2B08A 1JMXA 2G5BA 2R4RL 1NBZA 5L2KA 3L3DB 1TVBB 3KCPA 3I6GA 4RWYH 5D7HA 2O26U 5DA0B 1HE8A 3MJGX 4PM1A 4QXTB 2Q87A 4OT1L 3HR5A 4BINA 3OQRA 4ISVA 4LSSH 1ETZB 1NCDH 3MV11 1OTUD 3CXFA 5CCHE 1JI2A 4IYKA 5GS2H 5IMMB 1RSYA 2DYPA 1C8PA 4RNRB 1NC2D 2KYIA 2FQEA 3CVIL 2HJFA 1KXQA 3SB3A 1UWEL 4C83B 3H42L 4J6IA 3FFCA 5DD1H 4WI3A 3MV7A 4IRZH 1LILA 1G9NH 1IVLA 1MJ8H 1XR8B 1IARB 1I3GL 5BVJB 5I1AB 2CZNA 5FYJU 5AYTA 4QRRE 5J13B 1U3YA 3TH2T 3L2NA 1OSZB 5DGQA 3SQBA 3ARWA 2X6CA 2X89A 1F00I 5EIQA 1A6VL 3AT8A 1LO4L 1Q0EA 1GY1A 2VWEE 1U8QA 4G5ZL 4IMKC 3HC2A 4NZUH 2ED6A 3H7BA 4U1HA 1ZA3B 2X4SA 2CA4A 4Y9BA 3WU1A 4OQTA 4P0DA 2WBJD 3QRGH 1L7TL 1CGWA 2JIXB 4OZIA 3OKEB 5ICXA 4G42B 1FFNA 3WY1A 1J05A 3TT3H 2G30A 3Q9QA 4NQTA 5AVQB 3CZGA 1MCLA 1YEKH 4L3CA 1KTLB 4GIPD 1FFOA 4WUKH 1UWGH 2IGFL 3QUGA 5IHWA 2NXZB 1PNDA 4G7YL 3AABA 3QRGL 3NCJL 2XFXB 3F85A 4ODTL 5IEHB 1BQLH 1VEPA 4NBYB 5JMOC 3QZNA 2L8AA 4NJAL 3Q2LA 3MRMA 1BFTA 5CP3A 3WELA 3BPNB 3SKOA 4GUPA 4JG0H 3H9YA 4FMKA 1UKSA 3GBMH 4P2RA 4IKLA 4KJQD 5C0BD 4XN2A 4Y4FC 4OD3L 5DHYA 3WUWG 3KR3H 4IOFD 3V4UH 1BJ1H 5AVXB 5EBMA 1FSKC 2X1QA 2ZUSA 4NHCL 4UWQB 3SCMD 3T1FB 3L17A 4OZIF 4PH8A 2JVUA 3PV7A 2FBJL 3QXAB 1EDQA 3BHBA 3T71A 3KL0A 1YC7A 3AWGA 5ERWB 3WLBA 4GFXA 1BLNA 1XHHA 2YRZA 2E7CA 1J1XL 4CSSA 4QLWA 3WFCL 5MEQA 3L3KA 4AV4A 2G3XA 5JHBA 2IPUK 4JZJB 4PR5B 2VQUA 3D0VB 3UDWA 5JQIB 4JPSA 1QTPA 4WSKA 4NRYB 3AY2A 1VLXA 2CLRA 2YSSA 3I74A 2Q7YB 4MMYA 1QPKA 1E3XA 3CXHK 4LLMB 3N3EA 2PCPA 3ZTNH 5I8CB 4X7FC 3RWGA 4LLVA 2X4OA 4XVUD 3HVDA 5ELIA 3OHXC 1E8WA 1R5IA 1W2KT 1ED3A 4ZYKA 2AXHA 3DSFH 5AZUA 1ADWA 4RSVA 1U8OA 4PRBA 1JGEA 3FNKA 1LWRA 2ATKA 3ILQD 2CIIB 3LZNA 3UTSE 3V0HA 3GUFA 4BFIB 1T21B 3BSZL 3ARGB 5AZ2L 2YBRB 4JCMA 2GSIA 4HGWB 5B8CA 1UH3A 2B59A 1FL6A 1UWXH 4XOAA 3UYRH 2APFA 1A2YA 3QIWD 4W4OA 3QUMH 4LSTL 5I19L 4O02H 4R0LA 3KJ4C 4WI8A 5EU6B 2PKDA 3VU1A 2OSLA 4AZUA 2VR9A 3Q6GH 4J3OG 4MD4A 5CEZD 4MDIA 2OZ4H 3ARDA 4YSDA 5FKAA 4CC1A 4FNSA 4N87A 4YSOA 4MBOA 4P04A 5F7EL 3T4YA 3QXTA 4LBAA 1UD5A 3C60B 2GJ6D 4GG6A 5MI0B 1XF5B 1MCDA 3QIBB 2ORBH 3ZL4L 1Z6JT 3DGGB 4E5XG 1AGDA 4W6XB 1D5IH 3JWNE 5BZWB 3WV0A 3QDMA 1O5DT 4YHZH 2ZWLT 1BF2A 3E80A 3OKMB 1Z9PA 1XCXA 3BIBX 1JV5B 5D7IA 4GRLB 1J5OH 5HDOA 5JOFB 1G7IB 5C0JB 1D9KB 4GKNA 2NLJB 5F21B 3UTTA 5F3BB 2ZZUT 2Y23A 3L5HA 2PR4H 3P3YA 5G4NA 4BK4A 1U92B 3X14B 4KFZC 2NY7H 2CR3A 4UTBH 3VE0B 1XF2A 5F0LB 3WKQA 4PJFB 5D70H 1HEHC 3O6FA 3L3IB 2VXTL 4MX7B 5I24A 1QAWA 5AYUH 3R4RA 3RYMA 1NGXA 3CZEA 1YQ2A 3RIAF 2YPVA 3ZKMD 4BFFA 5I76B 1G4MA 4P5TB 5E6IC 4HIXH 3QORD 3WD5L 1XIWA 3L4TA 4JFZH 4PGDA 5DZLA 3REWB 2PYEE 4WVRA 5H37G 3FMGL 3DVGA 3VSQA 1S9VA 2G60L 4U49A 4W9JC 3FB7B 1AI1L 1AMXA 2IGLA 3TFBA 2MFNA 3U36B 5KYYA 1BXAA 4AMKH 4AEIL 5F8QC 1F1DA 2PMZA 3KHOA 2ID5A 2FUQA 3VWJA 4FFTA 4JGUA 5CJOL 2PYEA 2BNRA 1Y6KR 2NZ9D 1OARL 4JDEB 2WVSA 5FKPB 2K3HA 2J4WL 3WOVA 3PYCA 3ALWA 2F7RA 2VDOL 5J6SA 3H55A 1OTSD 3BIAX 3MPCA 4LVOB 4PB0H 4ZW3A 2PLTA 1TT6A 4NWTH 1OIOA 2QVMA 2WLLA 1FVCA 4Y4KD 5ALBH 1AO7D 1R3KA 2R59A 3P11H 3T3ME 1E7UA 3VA6A 3G5XA 2OR8A 3F7VB 4GUOA 1LP9E 3SO3B 5KN5A 1CO1A 4KRNA 4F2MA 3C6SB 4FZ8H 5CU9A 4A63A 1KULA 4HMDA 2HWZH 2OCFD 3RP1A 2IMMA 1GW6A 2WQWA 4ZAKA 4MAZA 4JFVA 3LMJL 1QX1A 3LNFA 3PXLA 5KBDA 4J3OF 4N0YH 4FXKB 3WHE0 2PO6B 1MRDL 1OWWA 5E00A 1YMME 2DEYX 5EBLA 4UU9B 4K15A 3HFML 5GRXG 1S8DA 2QKIA 5K69A 4ONOA 4YWGH 1CF8H 1KLUA 3KYKL 4Y19B 3TBVB 1FL5A 2UUDH 2OMXA 4AUJA 1SOSA 2X2HA 3U7WH 3EHBB 5EEYA 3U82B 1UCBL 3MZTA 3HHRB 3T8XA 2CHXA 2QMJA 3HOGA 4X5WA 4XI5C 5HHXH 3D2UB 1NFKA 5A2FA 4PIRF 4M3KB 1XH3B 3TNNB 5GS0L 2X4QB 4IS6B 3UG4A 2XIDA 1M1SA 2EDFA 2OMZB 1QLEB 3ULVH 3MLVL 4WGVB 4CKVX 2ESVB 2NY0C 5AVWB 4ZZKA 4PREA 3L3GA 1A0QL 1OAXH 3C5ZD 4HUMB 1KB5H 2ZP9A 5FUCE 2IH8A 2HFEB 4W6YB 3UYPA 5IY5B 4QKXB 3P3UA 4JM0A 4L3AA 1F58L 2YAHA 3I6SA 4NP4L 2FHFA 2J55A 3FQWB 4ZFOA 2ICWA 4K7PX 2AABH 3VXNB 4JBSA 1HZHL 1OM9A 1YYCA 1XD0A 4IRSA 5B38G 4JCWA 5AZ2H 5F7AA 2XBTA 2BWIA 4LSQH 5F3FA 3BEVB 3UC2A 1NC4A 1X3DA 3O2WL 2E7LA 4E5XA 2Y69B 1YY8A 4JGNA 4POZD 2GVYA 1E6JH 5H8DA 4WHYG 4X0NA 1YEDB 4RGMC 1AGEB 4JO5A 5DUPH 4AQ8A 4MAYD 1IAOA 4QXUL 4YPJA 3DTUB 4PVLA 1EERB 2VDPB 3OD3A 4ILDA 3UP6A 2B1HL 2HKHL 2VDMH 4N2LA 2F68X 2NZIA 5L4FA 5E0FA 3B2VL 5F96L 1G7MB 5IBTH 4FI6A 2OMUB 1AS8A 3ME0B 4ZBJA 4FMFA 4GG6F 3FTGA 4N6QA 2VXUH 2FBRA 2VMEA 2FYYB 3CJJA 5SV3A 4DVBA 4ZX6A 5AAPA 1GGIH 1QP1A 5AW8B 3V55A 1BLIA 4ELKB 1SM3L 1ZHLB 2YQGA 2R9HC 4XVSH 3R8BB 1A4JB 5MP6L 4OJEH 4TULL 2Z35B 2H0EA 4EZKA 2LOEA 4M7LL 4H8WC 1HIML 3HNVL 3VB9A 4BH7B 4L8CA 4JPIB 4PS7A 3V4UL 2DM4A 1NWPA 2AK4D 1UJ3A 1KT2A 3LHPH 1BECA 3FRUA 1MRCH 3SKMA 3ZU8A 1FFPA 1Y18B 2AMGA