4B9KC

Pvhl-elob-eloc complex_(2s,4r)-1-(3-amino-2-methylbenzoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide bound
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
141
structure length
137
Chain Sequence
b'VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
molecule tags Ligase
source organism Homo sapiens
publication title Small-Molecule Inhibitors of the Interaction between the E3 Ligase Vhl and Hif1 Alpha
pubmed doi rcsb
total genus 32
structure length 137
sequence length 141
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4b9kC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4b9kC01
4B9KC 4W9IC 1LQBC 4W9JC 4W9CC 4W9DC 3ZRFC 4W9HC 3ZUNC 4W9KC 4AJYV 4W9FC 1LM8V 4W9GC 4WQOA 3ZRCC 5LLIC 4B95C 4BKSC 3ZTCC 3ZTDC 4AWJC 4W9EC 4BKTC 1VCBC 4W9LC
chains in the Genus database with same CATH superfamily
4NQQA 4FQLL 1CXIA 1NLBH 3KNBA 3ROLB 5DUBB 3DVFA 4OR1A 3DJSA 1PNDA 3IDJA 4G42A 4HSCX 4N1CA 4NEHB 4JPVH 4LARH 3S5ZA 3RFZC 1KTDB 4R97C 3D39B 4RGMC 3VI3A 1QTPA 4K3GA 5LHDA 4M4RB 3A21A 4P23C 2RACA 1A3RL 3LIUA 5EV7A 2GIMA 3P0YH 4HGKC 5ACZB 2Z1KA 4FZEL 4NB7A 5JPNB 5IFJB 2XN9D 1LP9E 4JO1L 4RRPA 1T66C 2E46A 4A2MA 2GVYA 3NCJL 4G8IB 4I48A 2RB8A 3ORJA 1N7ML 4JPIB 3QZOA 4N8VA 3R8BB 3U30C 3LYRA 3SE6A 2V17H 3DC0A 3SGJC 4NT6A 4FCHA 3PWVB 3RX9A 3VXUE 1TZIA 2BO0A 3RHWF 2ISDA 2MEJB 3SEPA 3WE6A 4AQEB 3M7FB 5KANG 3UO1L 4HW6A 1CL7I 3RTQB 2XHNA 4FQXD 3U7WH 3ZK0A 1NCTA 4RA3A 3CC1A 1F3DJ 1Q9LB 4M8UA 1ZGLA 4BWUA 2G0LA 4LLQB 4S1RH 5IQ9A 4MAUL 4K8RL 4LSVL 3UJJL 3ZR5A 1AKJB 1ZT7B 5AAWC 3FQUB 3D39E 2ICWJ 2NY7L 3IDJB 3JYCA 4G42B 3PV6B 4UT9H 5BUAA 1Z2KA 2VUKA 3K71A 2ZX8A 4NXKA 5M94B 5EEZA 1M42A 3RJQB 1P7HL 3TJHD 1SVCP 3P2BA 2WW8A 2VMEA 4QR7A 5DF0A 4X0KB 3V55A 1MWAB 3BSHA 3ULVC 3BH9B 1KENH 5D1QE 1GYVA 4G8FB 2R1XB 3KYOB 4L4TD 1LEIB 4OZIA 4GRMB 4CA4A 1MCNA 1J8RA 1YEKL 3BLBA 3S36H 4GAYB 4PJ9A 4F5CA 4PRPB 1K5WA 3HRZB 3F5WA 1PX4A 3L13A 4TNEA 1MH5B 2B8OT 2NSXA 3TGXA 1JG9A 3PS6A 3ZRFC 5LN4A 1A6WH 4J23A 3GSQA 5CCKL 3NIDB 2CGZA 2D4DA 2ZXDA 4N2AA 3GXUB 4Y19B 1UT9A 5DRWB 5EU6B 5JDSA 4E9RA 2W9DH 2XN2A 4DP7X 1DN2A 2UWEA 3RI5F 5AZ2H 2Z34A 2VOTA 5AAPA 3P4OB 4AWJC 5B38G 4FLQA 2AK4A 2Q86A 3LRMA 1IEAA 1G7MA 4YWGH 4YDIH 2A3TA 3BSZL 4GO6B 4R96B 4TNWF 4KDTA 5LCVL 4CGTA 2CMRH 1EQWA 1OSPL 2EDTA 4Q6IA 3L5XH 3A47A 2D31B 3P9MA 2ADYA 4FN0A 3VRIB 4C4KT 1RK0B 1N2RA 4WWOA 5B1KA 4U6XA 3DJ9A 5C0RL 3PIQB 1FBIL 1S9YB 3BUYB 2NXZD 2VYRE 5C0DB 4NPYA 4MJ5B 1JHTB 2VISA 2DL9A 2XJKA 3GWJA 5JZ7D 1DFBL 4OFQA 4FTVB 1I1FB 2EIEA 1BQHB 1CICC 5EOCL 4WV1C 5I0XA 3NESA 4JHBA 2DAVA 2J20A 4I9XA 3GMNB 4N2DA 3X14B 2XN0A 2OTUB 4EI6A 3ZR6A 4QDGA 4YAQA 1FV1B 2IV9A 2VLMD 3HW7A 4PJXE 3K6FA 1OP9A 5E2TH 2Q76A 3S8FB 2HTKC 3VB8A 3WS3B 2B4CL 1OSZA 1ZTMA 4V33A 3DURA 3VFWA 4UOZA 3KWWB 1T0PB 2ZWSA 2E6QA 1CD1A 2BOBB 1OXYA 2XYBA 1CGWA 3THMH 2K70A 3BPOB 1L4IA 2CA3A 1MFNA 2WHVA 2DS4A 5D71L 3O6FA 1D9KC 4RSVA 4CDGC 1IFHL 3HRPA 4HH9A 3QC6X 1DQDH 1J12A 4MJIB 3T2OA 4JFDD 4QF1B 2C7UB 5GS3A 4YSEA 4YX2L 1U8LB 4NZRL 4WTWA 3SN6N 4N68A 3RVVC 2COVD 2ZYIA 1EZLA 4PVNA 5AW5B 3ZZSA 4QCIB 4QXUL 2ALAA 4MVBC 2B1HL 3RY4A 5E56A 1E2WA 2VR9A 1QW9A 3Q8BA 1MAML 1T6VN 1TCRA 2HFFB 4N8CL 3FRPA 3PXLA 3FCTA 3SD5A 3VWJD 4ENEC 1DEEB 2YGPA 4IDJH 3WKMH 1H8LA 4IBWA 2FYYA 5D1ZI 4F8LA 9PCYA 4PWFA 4V2CB 3ZY7A 2WQAA 4K9EC 4LAQL 4E41B 5IB3A 5A2AA 1SPDA 2RQ8A 3GI8L 5IV2B 5C8JA 3VYPA 1SHMA 4R4ND 3WTYA 1ZHKA 3FOLB 4M5YH 2P80A 2W0PA 3L4ZA 3JQOB 3ZN6A 3H56A 3MOQA 2VR3A 1ZEAH 3CE1A 1OV8A 4QHLA 2VXUL 2FIRT 3TNNA 2TRHA 2M1KA 2H32H 3C6EA 2ZCKH 4KTDL 4OM0H 3BGAA 1U8KA 1CVRA 2IG2H 1JRHL 1N6QL 1TJHL 2F18A 4PUBH 1KB5H 5J89A 4HP5A 3VFMA 4EDXA 1CIDA 4GP5B 5J6HB 3RYMA 4KRMB 4KVPA 1JGVH 4OD1L 4WO4D 1JHLL 2I69A 3MLUL 1G0YR 3ZHNA 5EEYA 4L18A 2CK2A 3O9WD 5IBUB 2VN7A 4JKKA 2Q2EB 1FRGH 4ZO6A 4OI8A 3KHOA 1N59B 4YDNA 1LQSR 4Y89A 4TSCL 2ADGB 3ULVE 3ULUD 1V3MA 3RA7L 2VZUA 1ZK5A 5HGDB 2UYLA 5FUCE 4HIJB 3WY4A 2VLKE 1CUOA 1OSPH 1AQHA 3FH7A 1SJEA 3EGXA 3ETBJ 4XNMB 4NZJA 3WXWH 3O4LB 4HIPA 4Y16D 4JDTH 2P5WD 2A9ML 5DEJA 2ODIA 3LKSB 2C9SA 5C0AE 2ZXQA 3E7JA 3F12B 4P5MB 4C58B 2OW6A 1ASPA 3DX0A 2VXTH 3IETA 3Q5OA 2VLKA 3DRQB 4ZMOA 1QI3A 2BPBA 4MNGA 1Q1JH 1QHOA 4N0YL 4KJQD 4LBAA 1P7KB 4QHMB 2R39A 2QSVA 1I1CA 3L3IB 2ZPKH 4RGOH 3K0WA 4J2QA 5GRVK 3VWKD 4OTXH 5D93B 2CKBL 4PS4H 4O51A 3SO5A 5BV7H 2OMWB 1QMUA 1TU2A 4LBEA 2OR9L 1DBAH 1YEGL 4HS8H 4IHBA 1U8NB 5MEPB 1AKJD 4QOKB 3EJYD 5HHNA 4CVWA 5CKAA 2H6OA 1U42A 2CCVA 5DLMH 1H5BB 3QWOB 3V4PB 4AVJA 2HP4A 4L2YA 1RHHB 4M7ZC 5I1DB 2PWEA 3CDGB 3FPYA 4GXVH 3UTTE 2WGNB 3PWJB 3RGVD 1AR1B 1E5UI 4NZUH 4DGYL 3N43F 1ZA3A 3P54A 1M53A 1H0DA 3UBXI 5AD0A 2YD2A 4NZFA 4FD0A 3U25A 4JVUA 1AZVA 2FUQA 1VEOA 4JQIA 5DURD 3LKOA 1ITBB 2I9LA 4WQOA 3AY2A 1A7RH 2JTYA 3C6LA 5IMOB 4HUUA 5KJRL 3OMAB 4WUUB 2F68X 1J0KA 4CMHC 5C8JB 2XT1B 2J8UA 1MAMH 1T4KA 2RD0A 3CH8A 1TTBA 1FVEA 1IBHA 1S78C 2KZKA 3TNMA 3VAEA 4AYDC 3EO0B 3FAWA 1X5XA 1LJMA 4PMEA 3ZO9A 4YHKH 1E9PA 3BHBA 3U6RB 1JHKL 5EU6D 3DHUA 4G1MB 4PS7A 4X5QA 4UT9A 5ESQB 3CGTA 2HFFA 1BLNB 1FZOA 3DIDA 1PQZA 1CFSA 4P9ML 2WBWB 3BVNA 3T6WA 3CLFL 3TLRA 3AREC 5IROC 1VFBA 4CJ1A 4GMTL 2EUWA 5DMGC 4LIQE 4PLOB 2X09A 4TLKA 1UWEL 3D51A 4DEPB 3G9AB 3DXAD 4JO3H 4WSJA 1CR9L 4NN5B 3WENA 1O9WA 2F58H 1ZANL 3WIIL 2UZIL 4J3TA 2D2OA 3FT3B 4TLSA 5KSVA 2ENJA 3D48R 1VERA 3DXAE 4YGAB 1IFRA 4U1HA 3MRCA 3FFCB 4ODTH 1QSEE 2EYSB 2XG4A 3PFQA 5AUMA 5C07B 2B5IB 4G6KH 4NAMA 1NC2D 2ENSA 2XN9E 2FEDC 1E90A 3K6SA 1FNFA 3MLUH 4TTGA 4DEWA 4YHPB 2YD6A 2XPZA 4M1DL 4B95C 2R2EA 5EOCH 2H2SC 1HC1A 1DZ0A 3H9SA 4OFKA 4YK4B 4L4JA 4FAAB 4OVVA 3NABH 3OKOA 1ZHNA 4Q9BA 1NLBL 5AZEH 1TIUA 4FC3E 4HIEA 4AIZB 2FJGB 4ZJ9A 3FN9A 1UQSB 2RJMA 3GMNA 4PJIE 1LEIA 2CK0H 5EWIL 3KLHC 2OMTA 2PMZA 1DYZA 5I5MA 1F1AA 1G0DA 1GPOH 1U3HC 2ZNXA 2MNUA 2X44D 1O5DT 3BSGA 5D1QB 2YD1A 2BSTB 4MJID 4N2EA 5FFLA 5ITFA 5KS9F 4LDLB 3ECVA 3ARUA 3B83A 2CPCA 2ZAIA 3EHBB 4DZ8B 2P24A 4FI8A 4RLDA 5D5ME 3G5ZB 1J87A 3KJ4B 4AKOA 3AY4C 2D2CC 1A21A 4OF3A 4P46B 2CKBH 3UTSA 2HLAA 1BJMA 1LO4L 3ZE1B 3DO7B 2VAJA 2E7LA 4G8EA 5I0WA 4K5NA 3RVTC 5DC4B 4Z7VE 2IADA 3OLGA 3FUEA 1INDL 2X9ZA 4D0BA 4YSUA 2HPOA 4XC3L 5BV7L 2OLDA 4C4KO 2JI1A 1CK0H 4JY4A 3UZQB 3DX8A 4WK2B 2VT0A 5C08A 4HBCL 4UUJB 3ULAB 2RQEA 4IGBB 3ZU8A 4TPRL 2FX7H 3GXFA 2Q3AA 3QQXA 1P5VA 2ADIB 3L3HB 3T2PA 1JZFA 2G5BB 4NN7B 2DWEB 2DTMH 4NO0D 4P2RA 3BWUC 2Y6TE 3MV7D 1A3LL 4ODXA 1THCA 2DIBA 1I75A 4PRPA 3T2LA 3VFUA 3CV5A 4PG9B 1OAQL 1CU4H 1OEZW 4PJ5E 1G7IB 4OZIB 1RUPL 4HIIA 4DQAA 2EO1A 1XT5A 5F7NC 4IDJL 3G08B 3QO1B 4N2KA 5C0AD 2WSPA 1F6AB 2WVTA 4DPAX 1KPUA 4YIQA 4WWKB 3FT4B 4R4FL 3OR6B 3PL6B 1PKOA 2OXGB 5F9DC 5I8EA 1YYCA 3MRPA 1OB0A 3RWEB 1S5IH 1Z3GH 4NQCE 3KS0H 1UC6A 3MACL 2BNRA 1JVLA 4ZO8A 2YOCA 3N3EA 3COOA 3CMOL 3QQDA 2O1AA 5FKPA 2IG2L 1UCBL 1N6QH 5J5EA 5I0DA 5SWZB 1EEZA 1XF3B 4M7JH 5F93C 1IGJA 4PB9H 3RFRA 5BNXD 1U0QA 3OBAA 5DI8A 2Z1PA 4E5XG 4JN1H 4PREB 5GSRB 5JW4M 1U3HD 5GGRA 3UC2A 4LPVA 3SQOH 3DMMC 3K6NA 4QI3A 5DQ9B 2YAFA 2CO3A 1QFHA 4M7LH 1JHLH 3V5DA 1G7PB 2Z64C 3LH9A 4OZHF 3VWKA 1BFTA 5C6WH 5T1MB 3CXDH 1UH3A 3LKNA 2FX8H 4A7UA 1AYOA 3WNMA 1QVOB 3GUFA 1OP5K 3F8UB 1NAMB 5L7XL 4FXGA 1KULA 2EACA 1S7WB 2WKLA 3IK2A 4B41A 4ZFFA 3HUJF 3RG1C 4X7FC 2XWDA 1UFGA 3RWJA 4I0PA 3Q43A 1J88A 5J6GA 5G4MA 2PWDA 3FTZA 5JNYB 3MCKA 5IJVA 1KXQE 1QX1A 3O9WB 3QEQB 1ADQA 2A6KB 2X4TA 4D8PB 5CJOH 3TWCH 1D7FA 4I9WE 1ADQH 5FYKE 3WIHH 2A6IA 4Y1SA 1IGJB 5IK3B 4LPYA 3OG4B 4JQIL 4OGYH 5BRZA 4YC2C 5E1IA 2DWYA 1OSEA 3DHMA 1NC2A 3S88L 3AREB 3HHSB 4Y5YB 4R7LA 2JI3A 2FJHB 4AQ8C 2BINA 2B16A 5GZNA 5K9OA 3HHRB 1ORSA 2JLPA 3MRPB 5F6IC 1FVCA 5DRXA 5EZLA 3M86A 3PGDB 1P7BA 4Z3JA 2GY7B 2IMNA 1A4BA 2JF1A 4QKXB 4JN2B 5J7CC 4DP9X 4NQEA 4Q9RH 2HG5B 4DHLA 1T5WA 3D2TA 1UWFA 4PSRA 4AJ0A 5IWLA 5HTSA 3LD8B 5TDPA 3D3VE 2CUAA 4PLKC 1S7UA 1S78D 5AKVA 1BEYL 4FNTA 5HGAB 3MAWA 3FQ1A 2IBZY 3SGEI 1KCUL 4DVRH 4N8CH 2DWDB 4FMVA 1LD9B 4P3DA 3CDCA 1CI5A 3VXRE 4BEIA 3TBYA 3HZMB 2UX6A 1TVBB 3NACL 5DO8A 4JPSA 2DY2A 5E00A 1Q9OB 1PY0A 2CRIA 5GRZA 5JMRA 3P0GB 4XCCH 2YUVA 2WN3A 1WWAX 1MCJA 2I5YL 2J1WA 3MV9E 5IB2B 1UENA 1A7QH 1UWXK 1BF5A 1AS7A 1QWUA 5DQJA 3VD0A 3KYAA 2VCOA 5MENA 4WJKB 5IJKC 1RJYA 4FQCL 2ZWNA 3DOIA 1JXFA 2WB1A 3MO1A 4ZMXA 2H1XA 3MUZ1 2YWYA 1B3JA 1MCBA 5FOBB 3WHXA 2PO6D 3ARVA 5A1AA 4R4FH 4DZ8A 4GAGH 5EU5B 5FK9A 2EUZA 3CMGA 4M9OA 5EA0H 2YFNA 5B21A 1E8YA 2KYIA 1L6PA 4R26H 4XE5B 2VM4A 3IGUA 1BGXL 1RMFH 5TGBB 2IH3B 4MDIB 1H9VA 4RAVB 4YHYB 1W0VA 1IC4H 1UH2A 1BFVL 2G2RB 3PY9A 3VD3A 3IMSA 2CG9X 3QJQB 4G9FD 4YFLF 3ZZQA 3RL2A 2ZKXA 3ILPA 4P2OD 1U8OB 4XPBL 5IW1B 1GCYA 3KBFA 2NY3B 1YJDC 1WZAA 1JTTA 3X13B 2BSBA 2X4PA 2JXMA 3F7YA 5G4NA 5DVOA 4Y4FB 2H3KA 4GSDL 5D6DA 5F0PB 3ABMB 3HCVB 3PDOB 5DJXB 5I6LA 3UROR 5CGYC 1QSFB 1RURH 4YHPA 1AJ7L 1D5XB 3FZUC 4XN9A 3T0BA 1F86A 5EO9A 1N64L 1MIMH 2W80C 3VTAA 4DKFL 4XZUA 4WY7H 4B9JA 4DP5X 4R0LC 5F7YC 4Y5XB 4Z6AT 4KTEH 1E30A 5KSVB 2FJHA 5GJSL 3TO4A 2J8UE 3ZKMD 5TJWK 1HOCA 1KEGH 4Z7VF 4JMNA 1BSIA 3HB3C 2P5ED 4LNVA 2W0FA 2G0KA 1EVTC 3O11B 4NNXA 3VFVA 1BM3L 5IK3A 3NFSH 1HDMA 4FOMA 1GGIH 4P07A 3IDUA 5CJ8A 4JAMA 1ADQL 4A39A 2J5LB 4JX0A 4OI9A 3O9WA 3QUXA 3WNIA 1UD4A 4BJLA 3NSXA 1YEWA 2EIDA 3H3KA 3KLLA 5AG8A 3ARFD 3OJDB 3PQYE 4UYPA 5D4JA 3UTZA 4X98B 4EI5D 3VWKC 4HQQH 5EC2A 5IBLC 1FVDB 4ZFOA 1L6XA 4MNHA 1NPUA 5HHMD 2W95A 5D4HA 1J8KA 4JFVA 3U6RA 3FSWA 2VN5A 2IV8A 1FH5L 2NW3A 3TEXA 4JHAL 2AEQL 3I75B 2UXTA 1N19A 2JCWA 1IBDA 3ARDD 3RHWK 1Z32X 2AJYH 3BW9A 3QPQC 5I76A 1DE4A 1FAKT 3HMWH 4JUTA 5E9NA 5C9KA 4LFHD 3OKNA 3VH8B 5CGTA 3IWUA 1IGFH 4AXWA 5I6OA 4LXFA 1UB5A 4MNQD 4Z77A 3Q7JA 3EJCA 3VX0A 1TXKA 1RULL 5CCJA 4UYQA 4Q2ZB 5DJDA 5B7FA 5D7JA 1UT2A 3UJJH 5GGQH 2BNRD 2WCGA 5IT2L 3WD5H 3D25A 1FN4A 1TKWB 4NKQB 2VDPL 3I9PA 4OZGF 2VDQH 3ZQXA 1E4XL 1JD9A 3O9WC 2XPYA 3OF6A 1MHCA 4JDVB 5EOCJ 1Y18A 4JPVL 1T2JA 2VDKB 3N55A 3WFDH 3WKNA 1GR7A 4GKOA 1ZJAA 1QTSA 1UTDA 1SZNA 4IK6A 3FCUB 1V10A 4O51B 5JXEA 5EUOE 4KFMA 4ZAKC 4JQVA 3V8CA 4Y5YC 1R3LB 4XBPA 4O4YL 3P3YA 4QNPE 4PIBA 3SZ6A 3VW3L 1YY9D 4U1LB 2A6DB 4MJJA 1Y07A 4JFDA 2BC4A 2AABL 1ZV5A 5JUEL 3L45A 5AVXB 3F04A 2O5YH 3RAJL 4IKNA 2X4RB 3UGXA 4X6BB 3VH8G 4XVSH 2AEWA 1T04B 3TXAA 2W0FB 2R9HC 3PE9A 3S35H 5MHSD 4HIJA 1L5GB 2ERJB 3AQDA 4PRAA 1D6EB 1SHWA 1VB9A 4YHKL 3UTSD 5HPOA 5ISZE 5FAAA 3OPZL 4BQ6A 3UXFA 5FDWA 2ZOLA 3EJPA 4NUGL 4ZMYA 4W6YB 1C5BL 1NH6A 3RNQB 3FB5B 3NIFF 3QUZA 2Z31A 2OQJB 1TDQA 1WFMA 1D5XA 3ABKB 3AUVA 2OM5A 3F3HA 3JUZA 1U3JA 2V7NA 3LEYL 4JQXA 4MS6A 5I30L 1YC8A 2FD6H 4LT7A 1WLHA 5EZJA 2XA3A 1QQDB 4TVUA 5JOFB 1XGQA 2BMKA 4WKXA 2FK9A 5FHBH 4F91B 4PJHE 2W88A 3IXTB 4WSGA 3RIAF 5AWNL 3OG6B 1YEJL 2VLJA 3ELAT 3INOA 2O4EA 2ODHA 3JVFC 5DMKB 3T71A 3S88H 1RZ7L 1KDIA 5K33A 1QBLL 3LRGA 4FFVC 4PBWD 4OJDH 1S3KH 3GQFA 4YJZL 2DQJL 4CMMA 3UBHA 2VW6A 4U0RC 4IBUA 4XPFL 5I2IA 1SM3H 1PYWB 3D4GA 1CXEA 2ZOLB 2AVFA 2HTKD 2I32A 2WZ5A 2YKLH 1HYSD 2C9RA 4IRJA 3MOBH 5L2KB 3FO9B 4ABQA 4NC2B 2F0CA 3LJ3A 4NM8H 1LWHA 4JM2B 4I1RA 3VTMA 4AEIH 2ZT9C 3CSTA 2G9HB 2VL5A 5DJYB 3LH8A 1XGUA 4NZRH 2E76C 2V5TA 3QVAA 4NO2B 4RSYA 5JZ7C 1RK1A 4XMKL 5HXMA 3GLEA 4M8QA 3IMTA 3OGOE 2QGCA 4DCQB 3KDMB 5CEZL 1Q9OA 3LZFL 5GRJL 3QP3A 4UINH 4OQ1A 3SKMB 1U8PA 3CN3A 5KSUB 3HZMA 5DTFB 1C16B 1WC7B 4HUCA 1CG9B 5TD4A 1E3FA 4BK5C 2V8MA 2LE9A 2DWTA 4TXVB 4HMCA 1MHPH 1F3DH 4X99A 4XBPB 3SDYL 3JV6B 3LNEA 4GIAA 1KBKA 5T3ZL 1S7UB 4IMLB 1SHXA 4LDCA 3T8XA 4PJXA 2IWKA 2L7UA 3QCTH 1JD7A 4ZYKA 1LEKB 5HHOD 2VL5B 1E28A 3G6AB 2CRZA 5D8JL 3C08H 5FXCH 3MA9H 2F8XC 1YEHH 1SJHA 2R29A 4GQPH 4OD2B 1NC4A 1U3ZA 2AJXH 4KPHH 1T0MA 5I19H 2ZYSA 5I16A 5SWSE 4BGDA 1BZQK 3BKCH 4YDJA 4OLXL 3HVNA 2YZ8A 2I9LB 2DTML 1ZVHA 2YD9A 5FYJH 4PJ6A 1P4UA 1UOVA 3NUKA 3VRLE 2VQ4A 5D1XE 3D6GA 1H9DA 2XCMC 2N4IA 2FO4B 4ZPVA 1H0DB 2NY7H 5A2JH 4YE0A 1JGVL 3QEHB 3FUFA 3WL9B 3BVXA 3L1GA 4Z7NF 2X4TB 4NKOA 4LVHC 3S35L 2XTSA 3BUYA 2VZOA 3VMPA 4GUQA 3MCKB 2LAGB 1ZLDA 3LKRA 4DGWC 4FLRA 4L0YA 3LS4H 3L3GB 4PB0H 5J6GB 3HS8A 4GBXD 1IARB 5G5DA 5GS1B 2EDMA 3P3TA 3QO0A 5T5NF 4EVNB 3FONA 4QOKA 1M2VA 1M3JA 3VXNB 5AOIA 2YBRB 1FVDA 4KH2A 4TSAL 4NP9A 1ZLVH 4ANWA 3OKKA 3O2WH 4NLHA 4P46C 4YMPA 4Q9QH 5AALA 2J1XA 3DTUB 1OOWA 3JUYA 1BF2A 2OMYA 4WENB 4POUB 3H42H 3ZSTA 3QHTC 1HHHA 3HC4L 1EERB 1NICA 3IE9A 3T6QC 3AACA 1MPAH 2F1AA 1U6AH 1NUGA 4HPOL 3JT0A 4G6AD 4LDOB 3VM5A 3IBOA 1WFUA 1PTZA 1TSRA 2NY1C 3UBXA 2KDYA 3Q9QA 4NO5A 4YDZA 4HIQA 2JTDA 1QFWM 3MXWL 5FCSH 3NZSA 3LN9A 1AIZA 4HJGB 3GSVA 2B08A 4GAYA 4PJ9B 4P5MA 5KS9A 5FWRA 1PD1A 4OSUL 4QWWD 4QT5A 1MCOL 1J1PH 2G3ZA 2JELL 2P5EB 2UUDH 1H3WM 3DI2B 2FNWA 3F84A 1M6UA 3AVEA 4PLJD 4XNBA 2YKLL 3RWEA 3WTVA 5KVFE 2X1QA 1O9VA 4IDLA 3C8DA 2D3LA 1MRDH 3IDGB 3RP1A 3ULVF 5LGHL 1AHKA 1GZQA 3QG6A 5GGQL 4GG6F 3NEOA 1GSMA 3VCLA 4LKCB 4I13B 4XAKE 1XH3B 2WSDA 4IMKC 4XNUH 1G7IA 2BWDA 2P5WB 3SE4C 2G2RA 1U8KB 3BZDA 4IJTA 2JJWA 3S3SA 1BOYA 3WE6B 3FTUA 1AH1A 4JCLA 4GI9A 4XVUD 2NY3C 1HXYA 4ZD3L 2NR6A 1VEMA 3F7RA 1YYMH 5EF2A 4NKMA 3M88A 1JGLH 5I8CB 3QXDA 4P59H 4GOSA 4IGBA 1F2XK 2P5EE 3DGCR 1GC1H 3EUDA 5HVFB 1Z5LA 3C60B 3TCTA 5GGTA 3S37L 1P4LA 4RETB 3KPRA 5C0FA 3ISYA 3STLA 5GGTH 2W0LA 3CVHH 1KXHA 1UKTA 5FUOH 4ZUWA 4HXBL 4ELMA 3TBTB 1IC4L 3GXPA 3N0PB 4D0DA 1QRNB 3HE6A 4P9HL 2IWEA 3UTSB 2VDOH 1PZ3A 5C0EA 2APFA 2WVSA 5GS0L 5TPWH 3SJVA 5DZNA 1JPEA 3VWJC 3VXTB 2CRMA 3D2UB 3VRLF 4DO5A 3MREA 4IOSA 4O2EB 1L6ZA 4D7PA 2V6HA 5HHOA 2KQNA 4LPUA 1AQMA 5HGAA 1VLXA 4J8RB 5T1DL 1SDDA 2ESVA 2NSMA 4MVBD 3FO1B 3SCMC 2VRAA 5I1IL 5B1JC 4OIAA 4DPRA 1EJOH 4OLVH 2IH1A 2G2PA 1OSYA 5FGBA 3SPCA 4KH9A 3OKDB 3QUXC 4HJUA 3TZVA 2XZQL 5JORB 3Q1SH 1P9MC 1GOGA 4PRIE 4BWTA 1U8MA 2IPUG 2CO2A 4NHUB 1KCVL 1Z9PA 5FCUH 3QYNA 1O7DC 3S98A 3ZMEA 3FBQA 5K59E 1B90A 1KTRL 3KWVA 4P3WA 4X9HA 5BS0A 4TSAH 2Q1EA 1KIQB 3R4DA 3MUJA 1B4JH 1LVEA 1UJ3A 3GBML 2F53D 5DWUL 4F3FA 1R5WA 4JLRB 3V6OA 1X4YA 3UGUA 2WIIA 2JVUA 2UUDK 4LLDA 2UY7A 2NY2D 2AJ3A 3IDYB 3RWGB 5ICUA 3B2DC 4FULA 5GJTH 3A23A 3MV01 1HQRA 4IRJD 1SYSA 2PYEA 4N4YB 5K1NA 1GA2A 3VE0B 2EVFA 1FYTA 1MPAL 2Z0BA 1ZEAL 3ILPB 1CICB 5I15H 4HGWA 4R90H 5DK0A 2MCG1 2RALA 3SQBA 4HIXL 2BP8B 5D1XA 4QRPA 5D7IB 2LFGA 1EHKB 4K8RD 1GGCH 2HRPL 2AMGA 3CFBB 3MXWH 1J1PL 4D0DB 4UQ9A 3RA7H 4O2EA 3RZCC 4J3VA 1KTBA 4ELMB 1N2RB 1PQZB 1QYGH 4DOHE 3VGAC 1M1XA 4AC4A 2F54B 4IBTA 4KQ3L 4MA8H 1KCLA 1G7PA 2VNCA 1NZRA 2PW2A 3U9UB 4NKMB 3KCPB 4N0CC 5DQ9A 3SGKC 3E6HB 3IJ9A 1BD2A 2WQSA 4NZDA 1FHGA 4HFWA 4WUKL 4ZG1A 1J5HA 2AQ2A 3QQ3A 5MHSE 1H6TA 1QWHA 3K74B 3O45A 2GTWA 2WBJD 5FLVA 2YN5A 2VDNB 5HDOA 3NCFB 1XV8A 2EDXA 3D50A 2F7PA 3J27A 2AJUH 3AGWA 4XNUL 2HMIC 1M6OB 2UVEA 2YXMA 1HXYB 2YK1H 3RUGE 3BH8B 4LFHG 1DQKA 2KS0A 4NQSA 1JGLL 1NBYA 2YUWA 4Y2OA 5JW5A 2NX5D 1FIGH 1F8TH 3KYOA 1I9IL 4BXSV 4JW3A 1F2QA 3ABGA 4D9RD 1TFHA 1X7TA 1XDTT 3KYKH 4M93B 3MX0B 3MUGA 3ASOB 2VO5A 1KXTA 3TASA 3CHQA 3ZT7A 1VFMA 4Q6YA 1PMYA 2GUYA 3W2DH 1XR8B 4QT5B 1UCBH 4KNSA 3HN5A 3ZL2A 2VXSL 4P05A 1AO7A 1T22B 2K0RA 2WYHA 3M17A 3FW6A 5EFIB 1OW0A 1NEZB 4HD5A 1OY3B 1JPFA 4WTQA 4X2UA 3WLBB 2AI0L 1NMBL 4LLQA 4OT1H 3BO8B 3FT0A 3EYFA 3ZE0F 4U3SB 4UOW0 5EBGA 4M48L 3OF6D 4AQEA 1J0JA 1XGPA 1F0LA 2X4SB 4FQXC 5CSZA 4E9SA 3M46A 4I2XE 4LHUD 4NJAL 1CE1L 4XHJC 4UV4L 2F15A 2DQDL 1DTUA 2BRQA 3GHPA 3L3OB 4APXA 3N85L 1OAQH 3K2KA 3QDJD 5D7JD 4JFUA 3HG3A 1HYSC 4WFGE 2YN3A 1NSNH 3ZT5A 1KCSH 4GRLB 5EEVA 1UYWL 3CX5J 1J1XH 3T9WA 5FHAL 3A4FA 3FT2A 1JF5A 2YQGA 3GMMB 3P3UA 4FNRA 2GJ6B 3WO3B 4GLRI 1OL0A 3BAXA 4BWWA 2CDEA 2CLVA 1ZHLA 3KEDA 4P04A 3WL9A 4GMSH 2OJZH 1F3RB 1JL8A 3MLWL 2OCCB 4N2NA 2W65B 3NCMA 1X7QB 1HXMA 3NVQA 4APQB 1KB5B 4UQAA 3GT6A 1LNUA 5I15L 2VJXA 4AGOA 4KQ4L 4R2GD 4JY5L 5ILTL 3ZDYF 5KSAB 1LO5B 1SBSH 1HQRB 1I4FB 3BDYL 3QUXD 4MLIA 5F1NA 5L2KD 1INQA 5E8DL 4HJSA 2J1ZA 3MJ8B 3WAKA 4GSUA 5ELIA 3C09C 1SUJA 4P3CH 3SCMD 5I73C 3GSOB 3G6DL 1M71B 3VI4B 3CXHK 4FJ6A 4ZS7H 2EIBA 3QCVL 3WIAA 1MI5D 1THAA 2NDFA 3QT2A 3TPKA 3FUHA 3NGBC 2JB6B 4U1HB 3PV7A 4QHUA 3VGBA 4DP6X 3U4EA 2YBGA 5A6LA 1RSFA 1RP8A 1WS8A 1OT1A 1R0AH 1IAKA 3CZNA 4K8RC 4KJWD 3I9AA 4LSSH 1UA6H 4UT6L 3L54A 4OLZL 1FFOB 5IJBC 1FO0H 1WCQA 4U6VL 5IB5A 1CDIA 3BJ91 3QIUB 4P5TB 4W6WB 3T8XB 2IAND 4F1ZA 2XZAH 3O8XB 3JTBA 5E1HB 2BSCA 2HLFC 1NDMB 5CJOL 3TWCL 1IJ9A 3D0LA 3C08L 4ZUUB 3MVSA 4P2RB 1TTAA 2ADJA 1YNTA 2PTVA 5EBLB 1UD5A 1G94A 4YFEA 5B39B 2A74B 2BIIA 4NHCH 2GSIB 5DHXB 1MEXH 1VZGA 1IKFH 1GTNA 1FGVH 4Z7UF 3SPGA 5EDSA 1JGDB 2GHWB 1W72H 4DEPC 2DOCA 4CADB 4MJHA 1IVTA 1S6NA 3T3MB 4ZUWB 3PU7A 1H3VA 1S7VA 4HXBH 2Y22A 1NMCC 1M1SA 2IDQA 2UY6A 3BKYH 3DX2A 2FSEB 1W72B 5DUJA 1IT9H 4P9HH 4QTHB 4QXGH 1RZKH 4I3SL 3IXAB 3VD5A 1NCGA 5ECGA 3L4TA 1NBCA 4GP8B 3LKOB 2DLHA 5I8CA 5AAMC 2VUYA 5JTWA 1DN0A 1RH8A 4FERA 3WLWC 1L0PA 5LNDA 4XXDA 3T3ME 1ITCA 2Q76B 1YDPA 4OAWA 4QO1A 4Y0GA 2RA1A 3EJQA 1EDHA 5AOMA 3KXFD 3Q1SL 4L4VB 4ODUA 3EFDL 4AYEC 1XMWA 2BVPA 2KPWA 1PZ5A 4UNIA 1IEBB 3RVWD 3VFSB 5IQ7L 1IGTB 2NY2B 1S7TA 1I1FA 5A7EA 1JV5B 1H6EA 4XP4L 2CIIB 1KJ2L 4LCIH 4KNTA 3D69B 1HH6B 1D7DA 1BZDA 1V05A 1RK7A 1ZHNB 3D05A 2V5MA 4HIHA 3KE0A 2A9NH 4ZTOL 2I07A 3H9SB 2O5NA 4G71B 2FVNA 4Z18A 3WUZA 1AXSA 4PBDA 4RFEB 4M5TA 2BSRB 3FTVA 4KI5C 4WWNA 5FV2A 3HPJA 4W9IC 1YYLH 1ZA6A 1YQ2A 5CBEA 1ZANH 5FGCB 3J7HA 1F58L 4JO4H 5I8OL 2AS5M 2VMDA 3X11A 4KI5D 2PO6B 4V1DE 3V6FA 3NFPA 1T04A 1NJ9A 1FP5A 2GITA 3S4SG 1RZGA 4N25A 1IGML 2J88H 2UXVA 3G5VA 4R8WL 2QLYA 4BKSC 3BH4A 3SDDC 5DQDH 5IOKA 2WOYA 5J1TC 5IMLB 3LKQA 1JYVA 1E42A 1DQQA 4G9FB 4I77H 1W8NA 1RUAL 4LE8A 3W9DB 2HRPH 3WNPA 4WHTB 1TCMA 3FFDA 4EXKA 3RVWC 3HRZA 3L3JA 4CU6A 1TNMA 4JGHA 3JWNG 4UMGA 3STZA 4I85A 1DVFD 4N86A 2G30A 5FYKL 1OD9A 1MJJB 5E2UH 4LSUH 1HJBC 4PLJC 3ARBB 3L81A 3O2WL 3OAWA 3C5XA 4EVNA 4O9HH 4RQQB 1EGJH 1Q9WA 4G43B 2CR0A 2E56A 1S7XB 4RISL 5EUOA 1YEIL 4HKJA 2P7TB 3P30H 4XE0A 1J5OH 3TYGL 2N0MA 2WWKT 4DJMA 4CVUA 2AEPL 2WP3O 1TJGL 1AQKH 4JDZA 3VYNA 4OLZH 1BIIB 2B77A 3LZRA 3B9DA 2R2HA 3RDTB 4XNAA 1X9QA 4JDVA 3T3PF 1OAXH 3KBEA 3P0YL 4FFZL 4YSRA 3LQMA 3U46A 5BS0E 5HY9B 4K9EL 3APMA 3QQNA 3QHZH 2ICEA 1NIFA 2OW7A 1CXHA 4CC4C 1ZA3B 3S9DB 1ETZB 2VM3A 1Y6MR 2X1OA 3FRPG 3NSDA 2UZYA 4LLUA 5A2KH 5D6CB 3PWJA 4ANVA 2JELH 6PAZA 3T4YA 5JW4N 1R3HA 1UM5H 4BRVA 2J73A 1BWWA 3TEZA 3MLSL 4Y9CA 3QUYA 2EE0A 3KH4A 3MC0A 1B9ZA 3UO1H 4Q4EA 4KBPA 5AYTA 3RTQD 2GUOB 4KMTH 1IC7L 3F2LA 1ZIAA 3QGVA 3QI9B 1J48A 4OLEA 5ACZA 3BKYL 4HEPA 1ORQB 3REVB 4FADA 2R4RL 3ILQD 2Q0ZX 2DLTA 2R51A 1QHPA 4JFFD 3V6ZB 1LO0H 2ED9A 3IFLH 3L3JB 4UAOC 5KSBF 2WXIA 1EHAA 1CCZA 3P02A 4JZJB 4JVWA 1NL0L 1QHQA 1IQDB 2OZNA 3Q8CA 4KUCF 5AVZB 4ODSL 4ZQTA 4ONHB 2OJEB 1ZIBA 2XPGB 3MA7A 3QCUL 5MEQA 1G7HB 2ZUSA 2F8IA 1K4DA 4WU5A 2VDNH 4YBQC 2I5YH 1PZUB 3EYSL 5IEKA 5LWYH 4CBZA 4E0RA 4PRPD 4HDIB 1WJ3A 4NUGH 2HT2D 1WDAA 3QRBA 3WMQA 4Z7QB 1WF5A 3S3CB 5FO8B 2KUTA 4MB3A 5E6YA 4O58L 1XZ0A 2RR3A 1NUDA 4UILL 1ULVA 5CD5C 3UERA 2WWMD 2Y07H 3ZIMA 5LGJA 5CEYA 5TF1H 5C08D 2PYEE 2X12A 3GMRA 3RIAK 1DDHB 3I50H 3MNDA 3WKYA 3GYRA 4K3EH 1Z0MA 2V9RA 2BVQB 3CQFA 5ANMA 4WI5A 3HLAA 4Z0XB 1Z9SB 3BGFB 2P42B 4NPKA 2X3CA 5JUEH 4WEBL 1W0WA 3VFNA 3D9AL 4XMTA 1K6QL 2HCZX 1N10A 3RVUC 3H9HB 2FECL 4LCCB 2LU5A 4LLWA 1HWWA 4I77L 3PWPA 2AKRB 2WKGA 1MDAA 2NXZB 1EFXB 1OP3K 5A6MA 2DW5A 1PEZA 1Z7JA 3OGCA 4P5TD 4R84A 1YMMA 4WEUD 5F97E 3MUUA 3SSGA 2VXVL 1TPXC 5DVKA 1QR1A 1UOWA 2BZDA 5INDB 5JO5A 5D2LF 5IOPB 3NCWA 3V5HB 1L9OA 1I8KB 4JFED 3QZLA 1RIUH 3U4AA 2LLLA 5CGBA 3BPLC 4K3JL 1D2PA 2Q86B 3FFCE 2WINB 3PHQA 1PW3A 5I5IA 1N64H 5K9KA 4N26A 2AJUL 2BHYA 4KVCL 2GBUA 2FO1A 5DJ2B 3O6LL 1XSOA 4JDEB 4HUNB 2YK1L 2XIDA 1TZAA 5C09B 1QSVA 1TVBA 2KH2B 1VCAA 2D3VA 3JV5A 1CFQB 3T1WA 2W5PA 3MJGX 5EBLA 3WGUB 3GGWB 3DV4A 1XGRA 3AXIA 4H8HA 2BY2A 4TNVF 4U6HB 3GSNL 5KG9B 3IWVA 2DWSA 3TBYB 4NZ8A 1JZ8A 4MCMA 3SY0A 4G8FA 2CO4A 4PJBF 2OSWA 1RZ7H 3OAUL 2YA2A 5AB0A 3WKPA 1LLAA 4JG9A 3W2DL 3MKKA 4D2NA 2J44A 5FV1L 5EIIB 3CVHB 3DXAA 1HVXA 5J3HC 2IANB 3IKKA 5BV7C 5DC0A 2Z8RA 4PTUA 4IJ3B 4OF6A 4PJAE 1A8ZA 4X4XB 4XXCA 4KDWA 2YPLA 3GZKA 3MOBL 3KCWA 1JUFB 1DLFL 2HFGL 3I3EA 1R5IA 1WAPA 4ZS6C 3QIBC 1KELH 5HPMA 8CGTA 4N85A 1JAEA 2L7QA 1SF5A 2O5XH 1OCOB 2XC8A 1KNOA 2WOBA 1TZIB 3FO2A 1NUNB 5TFSL 1UG9A 2VDMB 3QUKB 4NN7C 3V0VA 3NFNB 2MNJB 2I85A 4LSRH 5IT2H 5J8OA 2BSED 4RMSA 1WZ1H 3G6JE 5E94A 4L8CB 1QLRB 1AR1C 2AV7B 4KKAC 2WO4A 1G1KA 4YSPA 4B9IA 1U8IB 1IFHH 3B6SB 4FLOA 4YEEA 4N6QA 4HMDA 1WTGT 5DWPA 3D7PA 5ENWA 4L4VD 4MQ7A 3AC0A 2Y72A 2VC2H 1GAFL 1OE1A 1DFXA 1ETB1 3H2PA 4AQZA 3VWJB 1XZWA 5BZDA 1FYTE 5KN5B 4LIQH 5DUPH 1FNHA 2AK4B 4MYWB 3KNBB 3ME0B 1AI1H 1QOKA 1I1AA 1J10A 4Y16B 1BREA 2GEQA 3H7LA 1MDTA 2X9WA 2JH2A 3C8KA 4NYLB 3HS9A 3QUYD 1NCOA 3GK8L 3BP6B 4PS3A 4PHZA 3FQRA 4M1CD 4TUJA 1PGRB 2QVFB 4WI6A 4YVUA 4MBOA 5DVNA 5FO7B 1GZHC 5HD8C 2NYKA 4JZNB 1BFOB 3K72A 3OXSB 3RDTD 2D73A 4XTRC 4LSTH 3D3VD 4M6NL 4PD4J 5CLXA 1SHSA 5I8EB 2J43A 3F62A 3PHAA 2Y7SA 3G6JA 2VLKD 5FM4A 3D09A 3PNRB 2W91A 4F27A 1MWAA 3MROB 2GI0A 2YD0A 4LZKA 3NN8A 4HULB 4PQXA 5HDQL 3QIUD 3HFMH 2A99A 4XMPH 3R4RA 3CSGA 3OR6A 2YFOA 3PL6A 2WD0A 3OKEA 3LOWA 5IB4B 5KN5A 2X7LB 2V2WB 4NRZA 1D5IH 2Z7ZA 1F6AA 3GKZA 1ECZA 4NKDA 4AGLA 3SBPA 1AD9B 3ZDZE 5CR1A 1B4RA 3BPNC 3MV8E 3KH3A 5B4MC 1CXLA 2QQLL 5LJYH 2V9QA 4U1MA 4C47A 5KSBE 1MFEH 1JOIA 2ZKHH 3MLXL 1UZ6E 1XIWA 3HTLX 4K5OA 5GGSY 5C6PB 4MDIA 3WDIA 4K94L 1CLOL 4S2SA 1B2WH 3C8HA 4PWKA 3UAEA 3NQKA 3PWVA 1Y7VA 2R4RH 3VA2C 4LP8A 5E5MA 3SBRA 3B34A 5F7DA 3U9UA 3I6KA 4G1EB 3AQYA 1WICA 3CPLB 4EI0A 4P06A 1MELA 2E3VA 1AY1H 5F0JB 2RH0A 1FUNA 4YDMA 3VU2A 5DHEA 1MLBB 3U82B 3ECWA 5MENB 3FTGA 5DD5L 2IOOA 2ZWLT 1LE5A 1NAKL 5DQJB 3C60D 1R5IB 1UA6L 2OULB 1FZMA 3LEVH 4WLCA 3HUJE 1BZ7A 3GSXB 5EBWA 3WXVL 4AW7A 3BKML 1AXTH 5EU4A 4FQHA 4FNUA 4DOHB 4LVNC 1A6VH 3EDEA 1LL1A 2Q7NA 3QS2A 4F8TA 2Z8VC 3O0RL 2Y5EA 3MV8B 3LPFA 4PJIA 3H53A 5KWYC 5F2FA 2HKFH 3CVHA 4A37A 4YHOL 5MENE 5CJ5A 4IU3A 1JBJA 5JHLH 4YHYC 3GSRA 3ZXAC 2AC0A 4BZ1L 4ACPA 4JFTA 3IF1B 4DN4L 5JHLA 1HIML 5ID1A 4I0KA 2WIIB 3WNOA 2PKDA 1A3ZA 2YQBA 4K7PY 1PG7W 4JGUA 4JN2A 1A02N 1GGBH 3NEEA 2NW2A 3FQNA 3TOPA 4BDVA 3K46A 2APSA 4WKZB 1B0RA 5B1CA 1J8HB 4GKSA 1KLUA 1T80A 1ZE3C 3CC5B 3GXIA 4YBLB 4AIOA 2Z8WC 3KYNB 3VXUA 4J27A 2C9AA 4IK7A 1ZY9A 3E8VA 1U8MB 3WO4B 1W8EA 4JDEA 1NCBL 2AFNA 5DJZB 2A83A 4JN1L 1S9VB 4RA0C 4Y4KD 5B38B 4QOKE 5KJ4A 5JOPE 5T1KD 4NFDA 4LIQL 4LLVB 5DUPL 2FH6A 2ZYRA 3Q6FB 4H20H 4KVNH 2FTAA 1LO3H 3AW5A 5I9QB 4DUXA 5K39B 3VDAA 3IJ8A 2ETWA 1FSKC 3L3OC 5DA0B 3ARBD 1K9TA 5ANHA 4NQTA 1RL1A 3ALXA 43C9A 2LGNA 7PCYA 5D70H 2VW7A 2ZP8A 4XZ4A 4JKLA 1CFSB 2WNGA 1BXUA 3I84A 3PHSA 4L4TE 1EBAA 4AVIA 1LM8V 1A64A 5I23A 1SGKA 2EDRA 3L4CA 2YZ1A 1FCCA 2WLJA 3ULUC 2EJ1A 3DYMA 3FQWB 4G8GA 3SDAD 1UXLA 3QFJD 4WIQA 1W0WB 3VFNB 1KPVB 1SYVB 2EADA 5AB1A 5EO0A 2XV6B 5C0BA 3NDZE 4JFFE 5JA8B 3FQYA 3N9GH 1DUZB 4QXVA 5CJQL 2MCPH 2NT1A 3QHZL 2VDOB 3GSNH 4KTDH 4OM0L 4XCNA 5CKGA 4R3SA 3H42L 5D9SB 1Q0XH 4HOWA 4HVBA 3KPNA 2BIPA 3KPQB 3PLYA 1JRHH 3S0PA 4CN6A 4H0GA 1LMIA 3K1KC 4XMPL 5GZOA 1U6AL 4HPOH 4MJIE 2C8NA 2GJRA 5E6UB 4X8JA 2MHAA 2PP9A 1UATA 5DI8B 1NCUA 4HC1H 3WN5B 5B1JA 5GPRA 3MRGB 4POZD 1FYHB 3FU3A 4PRNA 4R7XA 4WI2A 1I9IH 4LCWB 4R4NC 1L3WA 1HHIB 4BFFA 3KPLB 1GH7A 3QULA 2JFCA 4UANA 1VHPA 3A22A 3BKJH 5E2UL 3ESOA 4EIGB 3LAFA 4NO0B 1G9MH 3ARSA 1EO8H 2R69L 4WU5B 3G6JF 2H3NB 5CM1A 1H5BA 2OMXA 3QWOA 4GH7B 5EUKA 5K69A 1NOAA 4TUOB 2XN9B 1KYDA 3MRQA 2OYKA 1UWYA 2V2XB 4ABUA 3MLTA 4PJFB 3QUMA 5F1IA 1S2EA 3QDGA 5I17A 4F8QA 2Z3FA 1WBZB 4Q74A 4AM0B 3T1FB 3WTTA 2WAHA 5FA4A 2XQBH 2DYSB 2H3XC 5A16A 4JKNA 4OF7A 3ZMRA 1S5IL 3L1FA 3ZDXF 2NQCA 3LKSA 2XICA 3FB6B 2ADIA 3I9IA 5CINL 4IRZL 3FOMB 4NUJA 4MQSB 1WO2A 4MNGB 2HN7A 2Z9TA 3MV7B 2UYLB 4UOJA 4OD3H 2ZD0A 2ARJQ 4FQXA 2ATPB 1VZHA 5FF6B 1JWMA 3V9CA 4NLAA 3GTNA 3VQ1C 1RJZB 3CZJA 5C7ZA 3PJSA 2WVVB 1ACXA 1BBDH 1H3GA 3E38A 5J6HA 4YHIB 3WJLA 2XBZA 3CZGA 3LKRB 4X6FB 4JFHD 3FH5A 4JQVC 4W9FC 5DO2C 1KLGB 3NCCB 1U8HA 4KQ4H 4U0RB 3LSOB 2CDFB 3VG9C 2VXVH 4AKPA 2GJ6D 4ANXA 4NP4L 3QPXL 3RNKB 5KBPA 2DI8A 4U1IB 4FNQA 2CLZB 4ATTA 3GXDA 4J4PA 5HDQH 3EJRA 5DEGA 1D5ZB 2OMUA 3IB4A 3G5XB 2QMJA 3QXWA 1F11B 5DLLA 5E70A 1G9EA 5CP7B 4AJWA 1TO5A 2R2BB 4OZIE 4YSTA 3LCYA 5AW3B 1TSHA 3HIZA 1FFPB 5FGRA 3V5KB 1I7UA 4CVZA 3HAEA 3SDXA 5C0NC 3FCTB 2Z4TA 1WBZA 5DFAA 4KKZA 3BRFA 4JJOA 2A4CA 5IW3A 1ZE3H 3UO8B 3CFIC 3BGMB 3HC2A 5IGXL 3P69A 3GB7A 3PNWA 4BUQA 1OLLA 3QZMA 4UM9B 5CBEB 1HH9B 3DMMB 3MNVB 3SKJH 4PG2C 1X9LA 4WV1B 1P1ZA 2DQHH 2NQ3A 1U30A 3AAZA 3FQ2A 4B7IA 4JRYA 4PJ8A 4WU7A 4Q9RL 3CXDL 2K1MA 2VDKL 3EG9B 4UQCA 3RUGF 2FIKA 3RWIB 3UTTA 5C9JB 4PYGA 1UGNA 4WFFD 1DEDA 3MU3A 3UDWC 1JV5A 5T3XH 1LWJA 5DJ0B 3LPOA 1F4HA 3FTSA 3O4LE 5C0CD 2BRRL 4XP6L 4DESA 3MLRL 4QD2E 5SWSD 3VM7A 1YN6A 3SCMB 3TEUA 4P3CL 1FFQA 1TLMA 2DQMA 3LXBA 4I1PA 4DTGH 1WAAF 4QTFA 3P73A 1BQUA 2NLJA 5A7BA 2F8VA 2YPVL 3TA3D 4FEMA 3QPQD 4HH9B 2G4GA 5IQLA 2BSSB 3REWA 3DUUB 3GUTB 3O0RH 1VJSA 3B7RL 2CWRA 3U2JA 2X53A 2P5PA 4AL8H 3OD3A 4QXWA 4RZCA 1PSKL 4HT1L 4NQXB 4TS6A 3KBHE 1ETJA 5FGSA 4XCYB 4XNQA 3H7BB 4EI6B 5FW6A 1T1WB 4BFRA 1UXSB 4BZ1H 3VXRD 1OSZB 3ZTJH 2VDQL 1XL6A 1KZQA 1PS3A 3AG4B 3QA3B 5E23A 1NGPL 2EIKB 4EUPA 2WTRA 2XACC 1PBYA 2P47B 4JFEE 1GW6A 1ASOA 3ABLB 3O6MH 3O8XD 4I5BB 2K3HA 4BFOA 1FO0B 4AIXA 2F2HA 3L7EB 1MHEB 5B39A 3AM8A 5AVQB 1QASA 4PTTA 1N7MH 5KEZA 4FTVA 4TSBH 1H8NA 4NHCL 5AW9B 2GTQA 4WW2F 2XVKA 4KJQC 4WV1A 3A3YB 3RE0A 4LSPH 4DH2A 5DSCB 4U1SA 1HKLH 4BM7A 2XTJB 1AQDA 1CLZL 3TESA 2EIZB 4FHKA 2X89A 1VKXB 3NBNA 3HNVL 1RPUA 4JO2L 5LG1A 3B1UA 3TYFA 3JTTB 2D31A 5B38A 3SZKC 5KYWA 2B20A 3QIWA 4R7NA 3RZCB 4Y19A 1DQJB 2C1PB 2ZX5A 2D4FA 4LGPB 2R2BA 1CGTA 3NCYS 2IAAC 3QDJE 3IFNH 4GQZA 5EDXA 1MNUL 2R0LL 5INCA 2HXAA 3A4AA 3VSVA 3D3VB 4C57C 4GSDH 1WWCA 3W11D 4L1SA 1RHFA 1FFPA 1P7QD 1NQBA 3CPUA 1N68A 5GJSH 1ZT4A 4GT7A 3SDDD 2CPUA 1QTYT 2OPCA 3GXNA 3DO3A 4KNQA 4NUMA 1I4FA 5F1NB 4WY7L 4LLMB 1U8JA 3M1OA 2IAMA 4IU3B 4YPGA 4XP5H 2KDGA 3IMBA 2P44B 2R69A 2BNQA 2W8CA 2VSCA 4G7YL 3LMJH 2QGDA 25C8L 2V7HB 5DFWH 1FFRA 2FD6L 4LSDA 3KM2A 4AG4H 3HS0A 5H35B 5I1LB 4EIUA 2VABA 1G9MC 2A7BA 4TKWA 5D6DC 1AP2A 2VE6A 5HDBB 3WJLC 1MW2A 1ZS2A 3BUIA 5EC1B 2YSTA 4F9PA 2WMPA 1AS8A 5IM7A 3Q2LA 5KVGH 1BV8A 1NBZB 1IBFA 3ZL4L 5IB1B 3FQUA 4I0PC 4EMZA 3BUTA 3MOAH 3TA3C 1XF5A 5DHMC 1LDSA 4DZBA 4ENED 2VDKH 5D2NC 4K2UH 5SX4H 3EW3B 5C0JA 2OXHA 4IBVA 3LH2H 1ZVSA 5DD1L 1SLWA 2MTAA 2NCEA 1LE9B 4N2OA 4OY9A 5JYLA 4F15B 2GBTA 2FJUB 4ZSOE 2AGJH 3UH8A 4R0LB 4EAEA 4M3HA 2R59A 4CKQA 3WLWD 3DSNA 3Q5YA 1L7IL 3TA4D 3VACA 4HWNA 2J6WA 4EN3A 2JB5H 4A38A 3QQ4A 3D34A 4BUHA 1KCRL 4LSSL 2X2UA 3WLBA 4A6YL 2DI7A 2DJ4A 4A7QA 4QOKD 3T1FA 3WIHL 3DJZA 3UGEA 4Y4HB 1MAKA 1C9SA 5FKAB 5ID0A 5HGHB 3WYRA 5E6ZA 3QDMD 3GEFA 4G9DA 1P5UA 4H25B 2IDCA 5D5MB 4DFIA 1MXDA 1WAEA 2Z93B 3T3MF 3VJ6B 1AE6H 4JAMB 4XVTL 4QHNA 2J71A 4JO1H 4KROB 2MPVA 1KXTB 2K9UA 4ZTPL 3L3DB 1MFEL 4JFFB 1RPKA 2H2PD 3PABB 4PRHD 5L88L 1MHHA 3QCTL 2B4CH 1PKQE 3AQZA 4MD0B 1A6AA 1J8HD 3UC0H 2FRGP 5I26A 4ISVA 3O4OB 5HHVL 4B3VA 1MZZA 3U1QA 4B9ZA 1ML0A 2C9XA 2DDQH 3IGAA 3Q6GL 4F9LA 1KYFA 4PJCF 1EVUA 1FGVL 4IBSA 1ILSA 4Y5XA 3APNA 2GK0B 3QHFH 1OAYH 4GUPA 1R3KB 3IKCA 4C83B 1KIRA 5TF1L 3GSNB 4C8XA 5ES4B 2X9XA 4M7KL 5K5YA 3NRQA 4YL9A 2XV0A 3HLKA 3RQ3A 2BOBA 1HAWA 1U95A 2OS7A 1XBDA 1QA9A 4WW2B 1HE7A 2YC1B 4GFTB 1CLZH 3HZYA 1KIPB 2CQVA 2WXOA 3KPNB 2GTZB 4M5ZH 1LO2L 1CDGA 4HAGA 3T0AA 4X6CE 4Z7UA 5L2JA 3DTXB 3RIKA 3E80A 3U6XA 1DUZA 4PH8A 1TTFA 4R7DA 1S7RB 2BXYA 2ZKWA 3HR5B 5AYUL 2HX8A 3S36L 3GRBA 1IGYA 3AABA 5G55A 3JZYA 4JJHA 1KGCE 1EZUA 4K7FB 5FIEA 1AZBA 1EMTL 1H8SA 1XEUA 4HJ0C 2PLTA 4NZTH 5ACLA 3QIBB 3SQBB 1OE2A 4LAQH 4C56A 5B7MA 2JMRA 2ZCLL 3A6BL 1CICA 3V4VA 5F9AC 4EZKA 3DPBB 4MXQD 1CBVH 2OZ4H 4XGZA 4XP1H 3UAJD 3SKNB 5JQIB 3ZDYB 4AKQA 4Y5VB 3H6JA 5D1ZC 1N8ZA 1MJUH 2W9LA 5TQ2L 1U21A 2X3AA 1KIPA 2ITCB 4LLVA 2UY7B 4YWGL 1CDCA 2BNUB 3DK0A 1QA9B 4OZFG 1A7PH 5CP3A 2YXFA 4RRPM 3F7LA 2CMRL 2Z35A 3BT2H 3PPEA 4KKPA 4GRWF 3V95A 4JZOB 1J11A 1FE8H 3FU0A 3GSNA 1HSAA 4PW3A 3MNZA 4XHJD 1JZ3A 1KOAA 3BRDA 2OMZB 4NHUA 1LP9B 4X50A 1K6QH 2FQEA 3DVIA 4M3KB 2NXZC 3CFEB 1DL7L 4UQEA 1Q4NX 4O02L 3W81A 2NT0A 3PG2A 4NDMB 4FABL 5ALBL 1T7YA 1QZNA 4W70A 3U36A 2QMKA 5KG9A 3A6CL 4NCDA 4POZC 5CLTA 5CF3A 3QEQE 1NOFA 4QHNB 3AY4A 4V1DB 1XO8A 2XQYK 4LRNL 4BSWB 3DA0A 3H8NA 3SO3C 3W9EB 1YEJH 1T66D 2JJSA 3H4FA 1GS6X 4H8WH 3BZ4B 2OA9A 4GG6B 1VEPA 3CPLA 5KYXB 1NCCH 1IQWL 2AEPH 1BMWA 1NGWA 2FLBT 4XODA 4J3BA 4WHDA 3CH1A 1GSKA 1RP9A 1WUZA 2FATH 3S35X 1QAWA 4W68A 4P23D 3RPKA 3VGGA 1GZPB 4D8PA 1PU0A 5I1GL 3ZHLA 5A43C 4MCYA 4WTZG 4H5SA 2YPVA 4N8VB 1BZ9A 1SLUA 2WBJC 3DJTA 3RWFA 3X1FA 4XN1A 1CXFA 2LFEA 4HBQA 2IALA 4L3EB 1QPXA 4HGMA 2APWA 3H9HA 1ECYA 4LU5L 1AD0A 5C0AB 1AGCB 3MBXL 1PDKB 2ADFL 1HL5A 2EKSA 3S34L 3LS5L 5JXED 1E4HA 3K8MA 3FJTA 3T04D 1AI1L 1GGTA 3C9NA 3UZVA 5CEZH 5EOQL 2FCBA 2RCSL 2H2SD 4BA8A 5HYSA 4C54A 1GZQB 1OPOA 1QUPA 4GP4B 1A7NH 5EPMA 5IB4A 3X3FH 1BAFL 1GJWA 4N2GA 1DVFB 4UTBA 1MNUH 2R0LH 3HZYB 1A8JH 4ZAKA 1P53A 3EO9L 3VB9A 4JGMA 1T4WA 3ARRA 3M1BA 3MRFA 4UIMA 3JVGC 3H9YA 4AYBA 1PZBA 3TIEB 4PCSA 5DD3L 3P4NA 1U8JB 4UQ3B 4IRZH 1SXAA 4HUWB 4KGLA 5FYJD 1NCHA 2D3NA 1J1OL 4XO4A 4FG2A 2CCWA 2BY0A 2ARWA 3ZKXC 4G5ZH 3BIKA 4KROC 4MDRA 1J9RA 5DJAA 2QLVB 4QY8B 4PJCA 3A6BH 1S5HA 1X5JA 1IGMH 3VVVA 3IVKB 1IAOB 1G9NL 5ESVB 2OKMA 4D0CA 3F65A 3QPKA 4QXTB 3ZT6A 1BOGA 4Z7WB 4PSPA 3LRLA 4TQEL 3W56A 4Z78A 5KAQF 4XOAA 4LASH 3Q5TA 1BVNP 4OQTA 4NSKA 3Q3GB 3B3BA 4M1DH 1W91A 4P57B 1P5UC 5HDBF 2BP5M 3QI9D 1ES0B 3QO0B 1WD9A 3NABL 3MLRH 4X5WA 2VDMH 1NKOA 3BDXA 1O6SA 4IOIA 2Y7NA 3MRHA 2QR0A 4MAYB 3WHE0 2GIXA 3AMLA 3UG5A 4BZ2A 3DSNB 3Q0HA 5D6CA 3EFFA 1PAMA 4Q52A 3JWDH 4F93B 1UM6H 3UZQA 5KANI 4JY6A 1AQKL 4NJ9L 4EQ2A 4MD4B 5JW4Q 4NQCD 2QPUA 3RGVC 2BVYA 1EAPB 3QUKA 2DRUA 3QRGH 2ENQA 3IS0X 2A9AA 3HG2A 4NX0A 5CSBA 3O2DA 2WTOA 2WZ0A 4RGOL 3KVDD 3I6LD 4Y2DA 1T1XA 5DEFB 2OTPA 3VGDA 4XNDA 4PJFE 5L88H 4Y1TA 4JE0A 4ZTEA 4URTB 4P2AA 4FA7B 2VTFA 1YUHA 2Y5TB 4LGSB 4CRPA 1D5IL 2VE6B 1TJIH 2DM3A 3L9BA 4X6DF 1HNGA 4J1UB 1AHWC 2DQCL 5GISH 4IBZA 4YSOA 2BVOB 5PCYA 3CDFA 4QRQA 4PJXB 3BEVB 1UT1A 3MV7E 3CHRA 2VN3A 2X4QB 5F7EH 1MCRA 5IIEB 1NFDF 1UZ6F 3RWIA 3MZTA 4A6YA 3IN0A 4BH7A 2NY1B 4XP6H 3APFA 5TTRA 2AQ1A 1EAJA 1HL8A 4ZXBA 1G1YA 2MQ0A 1AHWB 3HN8A 2R2EB 1QZ1A 1XHHA 2HFGH 1OQXA 2JIXD 4PBXA 5KJRH 2A2QT 2YS4A 4O2CA 1E4WL 1A3LH 4UM9A 2BP0B 1F4WL 1SOKA 1MFAH 5MEND 2CO7A 4ZSOA 1XMEB 1OAUL 4M5ZL 4F58H 15C8L 4WJ5A 4PRBA 1T0NB 3LQAC 5IKCA 1EK3A 2E47A 5TFSH 2VQUA 1QRND 3EYQD 3BXNA 4S1QL 3LDBB 3BISA 4QWWC 1J9SA 4X8CA 1BAFH 1CGSH 1P4BL 4DK5A 3D2UD 4PV8B 2V37A 2KMWA 4KOBA 3S37H 5ABZA 3V5HA 2HT3D 4HPHA 1XF2B 4KK8C 1GYCA 2CIIA 1R34A 3T2NH 1QR1B 4Q8BA 4IBQA 4TSBL 3CQQA 4G5ZL 3RWDB 1YMMB 32C2A 2OTWA 2VR5A 3E2HC 3HLAB 5DJCB 5FFGA 2B9AA 4Z0XA 4F7PB 3D18B 3KR3L 4ZMZA 1JPSL 4OU3A 4BFIB 1X5LA 3BEWB 1W6WA 4ZXBC 1FL6B 3BT2L 3RJOA 5F3HA 1YUHB 2HLFD 4HYTB 5DZVA 1YDPB 1PKQB 4OAWB 4P46D 5KTEH 4R4BB 4MA7L 1EX0A 1GGCL 1GGUA 1QFWL 4NUPA 1HFUA 1WWWX 5IEHA 3LV3A 3QZWG 1MFCH 4RNRA 1C1EH 3CAFA 4IEFB 5DGRA 5C2BL 2VERN 1GOHA 1KACB 4R90L 5DD0L 3QIBD 4A63A 1F1DA 4JY5H 4HUUB 5ILTH 4Z0BH 4D7BA 4WI9A 3FB5A 4X9BA 3MMEA 2J4WL 1ZMYA 2VDLB 3WEXA 4J3XA 2ID5A 5FDYA 2HVKA 4IOFD 5HHQB 5KYYB 2JB5L 4I9WD 1DQIA 3VFPA 2CO6B 5H2BA 3ABZA 5GRUL 3AT9A 3FB6A 4XB3A 4N5ED 5GRYA 4X6CA 5I1AA 1ZJBA 3PABA 1ROWA 4X5WB 3WDHA 1OALA 3CZUB 3D39D 2WKOF 3BP7B 3A0OA 1A6ZA 2YAMA 3JWDL 4OQTH 3VXSB 2Z93A 3VJ6A 3SGEH 1KG0A 1K4DB 1HEZA 2UXGA 4PJBB 1D9KD 2WYZA 3V4PH 1HSBA 1ZV2A 3QI9A 4G6FB 2VAAA 4JUSA 4QRBA 8FABA 4JJ5B 2FGZA 3O0LA 4FFYH 3PNWB 3WY3A 2H1LM 3S5LB 1A9EB 1TMCB 4MB4A 1T5XA 1P7KA 4M1GH 2ZAGA 3MSPA 4M8VA 4K2UL 2W94A 3P4LA 3KW7A 3RRQA 1IL1B 3VFOA 1H3PH 2YJQA 1T0OA 1OZTG 4R0LA 2B1AL 4PP2B 4A7SA 1KEMH 1AVAA 1TJIL 1J86A 5EEWA 4S10A 4DO6A 3MJ8A 3V0WL 1PD0A 3S2CA 4H44C 4P5TC 2YEVB 3G5XA 1RUQL 1H6FA 4IBYA 1SVZA 1RVFL 5FFOA 2MKWA 5MEOB 1J0ZA 2E75C 2ESVE 4U7KA 2PETA 2L0DA 2VXSH 1FLRH 4E9QA 4YS4A 4JDZB 4YDKL 3RVUD 4Z77B 2P7TA 3BD3A 5AVYB 5IMMA 3ULUE 1HX0A 2ZSWB 2WO3B 1F4WH 4P9HC 3LSOA 5D2LA 4ZDHA 1U8QB 2DPKA 1KLFA 4M48H 3ZDWA 15C8H 3QDJB 5F3BB 4L3FA 4MBRA 3LNGA 2WB7A 4K3HA 3TV3H 4CNIB 1ND0B 1PDKA 1JDDA 3B2VL 3NCXA 5E4OA 4R2GC 4S1SL 4UDUB 4YQXL 2B59A 2OI9C 3BQUC 2ENPA 3PJSB 1TETL 1CBVL 4PGBB 4U31A 3UYPB 4Q58C 4YHOH 2PNDA 4YDLC 3MFGB 4FQQB 4LP5A 1WITA 4HV8B 2RIKA 5C3TA 3PWUA 3MV7A 1SUHA 2X4SA 4H8VA 4MMZB 1M05B 2FLRT 4LCCC 2C3XA 3QJHB 5EORH 3NFPB 2A1WL 4A2LA 1UURA 3DROB 4YBQD 3EYFB 4GAGL 3JWOH 4DPBX 5GHWL 2QADC 2HX7A 2A83B 5A16B 4DN3H 4LSVH 4AM0A 1C1EL 3RJDA 2CJ3A 5LBGA 2H41A 3DX3A 5E8OA 4QRSB 3ETBF 3VRJB 3VXUB 1UXWB 3DJRA 3CZSA 1YUKB 2E7LC 3KGUA 1CXKA 4JM4L 2EVGA 4FXTA 2RHEA 1ZA6B 3DARA 4BH8A 3EO1A 2SODB 3CIAA 2BS71 3QUGA 4OJAA 3SE9H 2BSRA 2R9HD 3ULSB 1BF8A 4OLYH 1AR2A 1R3IH 4EEEA 3EH5B 3SGJA 3CUPB 2XU9A 3RTQC 5LUMA 2DQIL 1XFPA 3BSZA 4GAJL 1HEJC 3CFEA 4MJIA 3QISA 5IIEA 4RWHA 3EYVA 1DP0A 5C07E 3KPLA 2Q8AL 4N1HB 5DJ8A 2XZAL 5F1SA 4FTVE 3QRGL 4FJYA 3O4OC 2NY0C 5GGRY 3NZ8A 1MCDA 1U9KA 3NH7L 4NN6B 2DKMA 2J12B 2R1YA 4HX1A 2F6AA 3GZQA 4FQHB 4JFXB 1INEL 3L2NA 4HS6B 1CD1B 2GTWB 4XWOD 3DETC 3SYPA 5C0CB 1B3IA 1KIUB 1O7SA 1A4JB 5L6YL 4HCRH 1NGPH 1K5NB 2WNKA 3KCPA 3SKNA 3FCGA 3IDIB 2EYRA 2X4OA 4MXQC 2JQAA 1DVYA 2X40A 5LCVH 5BRQA 1YN6B 1PNCA 2ATKB 5LDSA 4N5EC 1IRAY 1EEQA 2J8HA 3D0VA 3D4ZA 1CF1A 5AL0A 1XSKA 5EO0B 5C0CE 1XCXA 4AQ1B 4QMEA 2P9RA 4WWPA 4DGVH 4D3CH 1NDMA 2KHAA 3ULVH 3LTVA 1CFBA 4NPYB 4HK0B 3LEVL 4RDBA 4YX2H 4HKZB 1OE3A 4TLUA 2OP4H 4IOIB 1I7ZA 1FFOA 5DFTA 1P1VA 1KB3A 3BKJL 3TN0D 4JRXA 1G9HA 4Y9FA 5L2JB 4MXWH 2JKSA 3VE0A 4OGAD 1ZPLA 1FZKB 2M83A 3DMMA 5D2NB 2HAZA 3MRJB 1C5CH 4KJYB 4LARL 2XQ0A 1U4EA 5IB5B 2VIRA 3IFNL 1WE5A 4JFZL 4NC0B 3WGVB 3ASNB 3I2CL 1S9VA 2BFVL 1E9QB 2BDNL 4BIKA 4Y2LA 4PV1C 4XP4H 3HNTL 2YXVA 3U4EB 1RZPA 4JHWL 2J6EL 3L48A 2F5BL 4PJ8C 5GGVY 7FABH 3DX9B 2YOAA 2J21A 5J9PA 3BAWA 4TF4A 4PLNC 2O6DA 4QUOA 1NCAH 1QRNE 1HWGB 3B7YA 2YJLA 2DM7A 3FQRB 4IRZA 1QFPA 2YMXH 3SD2A 1MHHB 1MFUA 5L4FA 1UWEH 5CU5A 1BMZA 2Y3NA 1VPOH 2G5RA 3IDYC 3P4NB 4UQ3A 4AV5A 5J06A 1HXKA 4NRYB 3B3IB 5D7KD 1HESA 1A22B 1S9XA 2VB5A 3F6IA 5BUPA 3QJOA 1YA5A 4JPWH 5KVFH 4YSAA 4MYPA 5CZXD 1V27A 1IM3A 2W65A 2B5IC 2GHZA 1AGBB 3L2LA 4K7PX 3B2PA 3DX7A 4HFUH 3U0TA 5CGYD 1RUAH 4H0HB 4FKHA 4G9FE 3SYQA 3AG2B 1RJZA 2H7WA 2BIHA 3ASWA 1LE5B 2A9MH 3KPRB 1U8IA 3R06A 5I30H 4P2OC 1T03H 2I60L 3KPOA 3ZDZB 1KCSL 1RV6X 1FZJB 5FB8B 1O6VA 3TFKC 1RSYA 4JFOB 3D52A 1AMYA 3B9KB 3EH2A 4Z9KB 4QAWA 3QNYA 4YDVB 5T3ZD 7TAAA 4K0OA 3FT1A 4HPYH 3HC0B 2VDQB 2Q8AH 3CFCL 1UB6A 3ZDXE 1E5AA 5E4EC 1PLGH 3I74A 3O6KH 5IG7A 1KF9B 3EBAA 3DVGA 4ODWA 1C12B 1G9NC 4UI2A 5EF3A 1KGUA 2FECI 4N22A 3TCLB 1YY8A 1TF4A 3C5ZC 4HS8L 4P2QD 2V33A 5LNGA 3HG1A 3LZLA 4U7SA 3ZGIA 3OKEB 5F72S 4M00A 3FB7A 3BE1L 3SPHA 1ZLUK 3G5YA 1JE6A 2KKQA 5GS1C 2XQYA 3FHQA 3OKMB 5TDNA 3VXSD 3DKHA 5I74C 3IAPA 4LLMA 1CO1A 1IAIL 4OKVA 2GB2A 3B5TA 5IUCA 2X88A 4WW1A 3G04B 3IFLL 4GW5A 5E51A 3V0WH 3RURA 3IFOB 4JDTL 1X5FA 3N40P 3KDPB 4I2XB 1MCEA 5CLYA 1XAKA 4Y8DC 1HAUA 4YHMH 2ZP9A 2VXTL 1UB6B 2IAMD 4WUUD 2XXMB 2QKIB 3SODB 5BXFB 1JP5A 4RCAA 4A67A 4AEFA 1M6OA 1FO0L 1G6RA 4OUOA 3T65A 2E4FA 1BD2B 5JHMA 5ERWA 5LAXA 2AJVH 5T3ZH 3W3BA 4E5XB 1V55B 1FZJA 1DO5A 1HNYA 1RIVL 3MUHL 2Z35B 5DJ2A 4ZUTA 5C08B 2IPTH 4UB0L 1CJYA 3JTTA 4Y7MA 2OMYB 4M9PA 3VD4A 1SQ2N 3UCQA 3V6BR 5JOEA 4ZFOL 3RX8A 3D85D 2YBRA 5DHYB 3D12B 2R1WA 4KROD 4JFDE 5E95B 2WXJA 4AITA 1JZDC 4XGZB 5G5DB 5GRVL 2X0WA 3V7MA 4XNZC 3L4XA 3EHBC 5IHZB 1Q94B 2FQFA 3EF4A 1BCIA 5AW2B 2CXKA 1YSOA 5KYUA 1I8AA 1QSEA 3VD9A 1TJXA 5J1AA 4PWEA 2WTRB 1IGYB 3ZBMA 2E9BA 3MRLB 5I19L 5CR8A 4L37A 3RIFF 2J4WH 3E1ZA 4GS7B 1KGYE 1R5WB 5T5NG 3PGFH 4JPWL 4PJAA 5KVFL 2FB4H 4AIZA 3FFOA 5DVLA 4RZCB 3DUHA 5J4MA 2VR6A 1YG9A 2R4SL 2RGSA 4FJZA 5CEYB 5LGJB 4EZJA 3RIFK 4YSDA 1J5DA 2CALA 5MP6H 4RWYH 2MPAH 1C8QA 2MNWA 3PP3K 5FO8A 2BVEA 1G7LB 2OX5B 5CAYB 4BXVA 1PFOA 1TQBC 2PW1A 3ZTCC 5A2LH 4U1KA 1GYUA 3WTSA 2IANA 2BWQA 2F1BA 3R0NA 4XH2B 2EVIA 1KCVH 3H85A 4X99B 4Y2DD 1U3NA 3AZUA 1I8IA 1D9KB 2W60A 3MXVL 3QWRA 4N3TA 5F7BA 3RWHA 3KJ6L 3UAJC 4PJIB 5BOZG 3OMNB 4MZ2A 2ZCKL 3GPEA 1CR9H 4AGQA 4K3EL 3PQYA 1TYRA 5DS2A 3UTTD 3CFCH 3FMGL 4M8QB 4BQBA 3BIBX 2LU3A 3AXLA 3TBTA 1HI6B 1VADB 1IAIM 1J5IA 3BVNB 4MS8C 2DD8L 3D33A 1SFHA 2DQFA 4YNYB 4Y4HA 1L9MA 1U8CB 2R83A 4L0ZA 5C0EB 1NMAH 3ZSSA 2FEEI 3MJ7A 2C5DC 2EXYC 4K94H 3PAYA 4X80H 4OF8A 2MTPA 3TEWA 4Z7WE 4PG2A 1B6UA 4DERA 5BO4A 4DT2A 1MCOH 1DLFH 3EH3B 1IC1A 2F74A 4BELD 3RZCD 1UACL 2NPLX 1OAZH 2BS9A 2L7EA 4KV5E 5F7AA 3GKWL 4TNWK 1AY1L 2YUXA 2E9GA 5H37G 1KCRH 4XN7A 2YD7A 4F7CB 3C5ZB 5F21B 3ML9A 4F92B 4L4TA 2CAKA 5AENA 2VL4A 3UDWA 3SBWA 3JYBA 3UYPA 4LQFL 1L7IH 4OBRA 1U2YA 2KBGA 2VLJB 2NNFA 4PJ7E 2VJ8A 2H26B 1GPOL 3EYVB 4POYA 3WXVH 1JPTL 3ECUA 1OCZB 1ZWIA 4QJ5B 2KI6A 3GRWH 3BMWA 4MCZB 4X8GA 5FECB 3VGHA 5EBMA 1WQVT 5IHWA 1BBJA 4TOYL 2ZX6A 1KLFB 3VNZA 2QHRL 3MACH 3QG6B 3C5JA 2BWIA 4FFVD 2W38A 1WFJA 4BH8B 3M1CA 3RNQA 2L3BA 4LSPL 1YEGH 1UM5L 3ESMA 3NZUA 5BQ7B 4ZAKD 1YNTF 4XX1E 1INDH 3GMLB 1NANH 2ATPA 4XN4A 2WANA 5KSBA 2F8OA 2WXGA 3KWXA 2XTLA 4X7TA 4GKZB 1AMXA 4G6JL 4K71C 5J11C 5FUOL 1G9NH 1E8ZA 5HYEA 1AO7D 5TH2B 2IOIA 2J1KA 1CD9B 3I6GB 4I3GA 4PRIB 2X4RA 4TQEH 1ODUA 4Y9GA 4YE4H 5TQ0L 2VLKB 1HHHB 2YLHA 4PJGA 3MLYL 5I17B 2GITB 4XPBH 4BFEA 1A7RL 3ME0A 3MRDB 1SXBA 5DDHA 3WMSA 1JXJA 5CWSA 3SOBH 2FEDD 3WFBH 4NNPL 4UAHA 2CA4A 4C56E 4HFUL 4ZX5A 2WM0A 5ALCL 3PWLA 2W07A 2VC2B 2FWOA 4UNVA 2B59B 3NYKA 3UYRL 1F4YH 4P23A 4RZKA 5E8EA 5HYSG 1M4KA 4LSRL 3L3GA 3DI3B 1RURL 1UFUA 3FQTB 1N59A 2IPKB 1XF4A 2F1EA 3B6SA 5IQMA 3T08A 1AQDB 3LZPA 2C4FU 1RUKL 3R1GH 1JTPA 1G7JA 2XZQH 4LSQH 4RWYL 1NGYB 2Q6WB 3UBGA 1GS8A 3O3AA 2PF6A 1X9RA 4OF0A 2XWBA 2FJSA 1CDHA 4MDJA 4ZFGL 2H2PC 1R3HB 1DJYA 4C59B 5EORL 5F0LB 4U6TA 3CFTA 3O81A 1MVFA 3CBKB 4FXKA 3NIFB 2JKRM 4NRXB 1ID2A 1ZS8A 3FUJA 4Q2ZA 2DLIA 1TITA 2DB8A 4JO5A 1IBBA 2Y23A 5BO1H 3SE8L 2H0FA 5AKTA 2XBDA 3W38A 5TK2A 1NC4B 2YLKA 3QEGH 3GFUA 4BCYA 1YAZA 1V7MH 3B9KD 3S5YA 2ICES 3HB3D 3OLIA 2OSLB 3CDZA 3F7VA 3GJFH 5F6HI 4U33A 3CFDB 1AGFA 5FPIA 4X4XA 1ZLSL 4HQQL 4IEFA 1Z66A 3EYUH 2CR3A 1GKOA 4PTUB 1TEFA 2JLLA 1P69B 4OLYL 4YN3A 3JV6A 4NNYA 2Q20A 4FKEA 4HCIA 2XVGA 4X80L 4Y4FC 1NLDH 1QG3A 4OV5B 5LCVA 2K9FB 2X4UA 1VAHA 3L3KA 5HJBA 2CKBB 4KKLC 4H7VA 4KK6D 4LL4A 4DKDC 3NSCA 1MRCH 1BVLB 1DSFL 3WEAA 4S0HA 3O6LH 4DCQA 4DVRL 3BPCA 3UAJA 3BAJA 1U92B 3M8OH 3I2CH 1PLCA 3HE7B 4ZTPH 3A6CH 1EXUA 3E9TA 5ITBH 3RX5A 3L17A 4JRYB 1WC7A 4UM8A 3VXMA 1XGUB 2X2YA 1H3XA 3EJYC 5BS0D 1EZSA 2NY1D 3UAAA 1NCCL 9CGTA 4GW1B 1T21B 3KM1A 4BK4A 1T0NA 5IKCB 1KMGA 2WINA 3UIYA 2B0SL 3DX1A 2HVKB 4Z5RA 3EYOA 4PJFF 4XZUB 4ZX3A 5C97A 2PO6C 4ODVL 1DDTA 5EO9B 2DYRB 3K1DA 2J7LA 5DD6B 1HNFA 2FEJA 1OGAA 4HZLB 1LK2B 3ATFA 2ESVD 1XSJA 2HFEB 4ETQB 4ZUVB 1UA7A 2ZYHA 1COBA 1SRDA 4Y19D 3PDOA 3WS3A 1QSED 5F0MB 3W5MA 3GSRB 3AB0C 3MBXH 1O7VA 2V3DA 4K4KA 3W11C 2H0JA 2CLZA 4KK6C 3BEWA 4KKLD 5BZWA 3A4EA 4IKIA 3MODL 2NRDA 3NJIA 4N9GA 5C3LD 1MFCL 1BZOA 3B43A 3BKMH 1T3FA 1FA4A 2WUBL 1IBGH 2A73A 3O3AB 3P9LB 4KK9C 2IH3A 1CF8L 2AXJA 4PP1D 4PCYA 5E5UB 3KPRD 3QUML 3W0WE 1DVSA 2EEBA 1U33A 1SJVA 2WXLA 2HKFL 2Q2LA 2H9GA 3N42F 1Q94A 2FWLB 4N6RA 5AB2A 4KMLB 4AENA 4J3WA 4JHZA 4JGNA 4HEPG 1XB3A 3QR2A 5FHAH 1NIEA 5DZPA 1OGAB 2FWOB 2HTLD 4R6UA 4RH4A 5EZIH 4QRUA 5HDBE 3VXRA 3F6JA 2OZ4L 4XP1L 4YFLI 1Z3GL 3N9GL 4F37K 4XR8C 5IVXA 4MA1C 5TE6L 3QFDA 4DGUA 2JNZA 5IMKB 4PJGB 1M56B 3NJFA 4FQ1H 3H2WA 2PCFA 1NSNL 4WJG3 2HN7B 1LK3L 3VXPB 1X5IA 5ERWB 3TA3A 2OFQA 5KOVC 4HC1A 4WAFA 3FH8A 5C09E 4JMXA 4JVPA 4NN6C 3QJXA 4M43L 4ONOA 1FE8L 2OJEA 5FM5O 5E5RB 5E8NA 2JQMA 4OUUB 5SWSA 4ELKB 1A6WL 3HPLB 3D0LB 5L4JA 1K8IA 2OMVB 4JZJA 1FG2B 3HG1D 3SPIA 4PJGE 2HH0L 4YDLB 1S3RA 3NIDE 3FK3A 4XPFH 1T5WB 4L3ED 4U1LA 3KPSA 3MX0A 5EH1A 5B1BB 5AW8B 2NY5L 1BHGA 3NT0A 1FJ1A 5DO2D 4U3HA 4BKLB 4NQUA 3Q8EA 4AT6A 1PZDA 4JFQB 1HS6A 1UACH 4P4RB 5BV7B 1RVFH 1CBJA 4JRXE 1ZHBB 4M1CC 2CHXA 2NY0B 2H26A 1EDYA 4PGEB 4LHUG 3BCFA 4U7MA 4PRNB 4FFYA 4F7TA 4MLSA 5AG9A 4L23A 1T1YA 1OANA 4ZO7A 3K81A 3LIZA 3QE5A 5I76B 1ZD6A 2XXFA 4XO9A 3RDTA 3QJTB 2FR4B 5D7JB 1KGXA 2HKAA 4KXZH 4OLUH 5IJVB 4TNFA 2WV3A 2XRAH 4Z7OB 3K5SA 3AU1B 4XAKD 3OKNB 1PEWA 1Z9MA 2JCCA 3CSYA 1I82A 4HC1L 1IM3D 4H0IA 5EPMB 3BAYA 3BWAA 3ULUH 3IJHA 5IFJA 1B2WL 2NY5C 4P57A 4WWKC 5HI5D 1LGVA 1EDQA 3R06B 1MKFA 3Q3GA 1XF4B 4TUKL 4L1BA 4WW2C 5D5MF 5C0BB 4BD4A 2PPEA 4PM1A 3C09B 4ZMTA 5GGUB 2EKSB 5CLZA 3LKNB 3DGGA 1WT5A 4RAUB 3FFDB 4I4WB 4NQDE 5TQ0H 1HKLL 3KD4A 4KWUA 5E8PA 2VDRH 3PQYB 3QFGA 3NK3A 3NFNA 4LEEA 3U0WH 5JHDE 43C9B 4KFZC 2JE8A 3D87B 4UT9L 5D4IA 2EECA 1KJVA 4JPKH 4FZ8H 2ORBH 4L9LB 1P4IL 3NIGE 1G1OA 1F4YL 4F58L 1T1YB 2N1TE 3QEUA 1LHZA 1NBVL 1U58A 1A14H 3DUSB 1L9NA 3GHEL 4FGMA 1F4XL 3TBCA 1E4WH 5JW4R 2QGEA 4X7EC 4GKLA 4F3FB 4NM4L 2EEXA 1KJ2H 4LCIL 2HUHA 2YEZA 2QPDB 2DMCA 1GHFL 2ZCZA 3DMMD 5SWQA 5B3JE 5D1ZB 1XH2A 2EZ0C 1WISA 4QAMB 4B27A 4JL1A 3X3GH 4Z7NB 2Y24A 2YD3A 1BVKB 5BO0D 3O3EB 3ZTJG 4OI7A 3AADB 4NWUL 4X0NA 4XP5L 3MUGB 2XV2A 2BW4A 5IW1A 5EA0L 4HZAA 3DIFA 2GBVA 5ID1B 1JNLL 5DJXA