4B9KC

Pvhl-elob-eloc complex_(2s,4r)-1-(3-amino-2-methylbenzoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide bound
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
141
structure length
137
Chain Sequence
VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small-Molecule Inhibitors of the Interaction between the E3 Ligase Vhl and Hif1 Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
total genus 32
structure length 137
sequence length 141
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4b9kC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4b9kC01
3ZUNC 4W9EC 4W9CC 4AWJC 1LQBC 1LM8V 4B9KC 4B95C 4W9JC 4BKSC 4AJYV 1VCBC 4W9FC 4WQOA 3ZTCC 4W9HC 3ZRCC 4W9KC 4W9IC 4BKTC 4W9LC 3ZRFC 3ZTDC 4W9DC 4W9GC 5LLIC
chains in the Genus database with same CATH superfamily
4PRPA 1BXXA 2FX7L 1QSFD 1ZT1A 4GB9A 3QUXD 2AXFB 2VSDA 3Q3GB 4FTVD 5D5MA 2J2ZA 4GKZB 2FJGA 4YPGB 5K69A 3MRDB 3T2NH 2QLYA 4HJ0D 3VGEA 3MGOB 4BZ2A 1Q9OA 3BWAB 2E74C 3UTSB 1K8DB 1UM5H 2CCLA 1ET8A 5JW4N 3L1GA 1IFHL 1B4RA 4LCIL 4Y5XB 1BD2E 2OW6A 1R3LB 1IBGH 4HJ1A 2Z1PA 2Z34A 1EEUA 4PJIF 3VWJB 2GPZA 2VW6A 3GYRA 3PGDB 5I1IH 1PZUB 3FL7A 1R0AL 1KCLA 1VFBB 3HFMH 1XXDC 3R1GL 2KMWA 5LGJB 2C34A 3PNRB 2OQJA 3SOBL 3F7LA 2DQGL 1X5KA 2WYZA 5LBGA 2WNWA 1BOGA 1NMBH 4YHMH 4AGPA 3BYTA 4XH2B 5FUCE 1J8HD 1NGPL 3PWJA 4I48A 4PJHA 3WTSA 1WIPA 1ZIBA 3BZFA 4BQ9A 3TA4D 1MSPA 2GQHA 3GJEA 1M6OA 1S7TB 4KJYB 4U1HA 5B1KA 3TVMD 4ZAKD 1WK0A 4PGBB 4XCEA 2P8PB 1CF8L 4N5ED 3UP1A 4LARH 1A4JA 3ZSTA 2V3EA 3KL0A 3OKOB 1FYTE 3ZGIA 5KAQF 2WXPA 3ULVH 1GS8A 5DHDA 2H0EA 2CBMA 1WZ1L 2LHAA 5KANI 2FR4A 5EIVA 5F9JA 4LCVA 4NN7B 3UAJD 4AG4L 4OH2A 1IEHA 1T66D 1KN4L 5GGUA 1H5BC 4TSBL 2H26B 4GSDL 5HI4D 5ETUB 4EUPB 2YSSA 3WYRA 3EUUA 1NBYA 1QFUL 1UVQB 5K9JL 3FYIB 2X87A 2O6DA 1BX2B 3L9BA 4KJPC 2IGTA 4PP2B 3Q6GL 1NFIB 3LTVA 4PP1D 5IOPB 1W9XA 2K8QA 3JWOH 5CZXC 1RLBA 4ZUTB 3LEYL 1VDGA 2ERJB 2ZSVB 4JQXA 5E5UB 1N8OE 1TZHB 3FQWA 3QSKB 4JFXB 3V5DA 1ADQL 1I1YB 1XL6A 3K2MC 2D0HA 5A2KH 2X2IA 4IBZA 4UMSA 2FEDD 3MRBA 3VYNA 2BP5M 2P47B 1ND0B 1NGYB 4XVUC 3N43F 3RPBA 4G5ZH 4PRIA 1AANA 4Q97A 4MDIB 5DJDB 4NWTH 4PLJD 1T04B 1K4CA 4JZNA 3MV9A 1YECH 4JANA 2Y7QB 4HW6A 5ID0A 4GBXD 2GKIA 2V7NA 4JFUA 4NM8L 2P24A 2R23A 1HS6A 5ICZB 1U8PA 4JHUA 4WNQB 3V9EA 4IYKA 1ITBB 1PSKL 1IAIL 3F2LA 3UTQA 1MNUL 2Y5EA 2VLKD 1JXKA 4A55A 4JQIL 3RGVA 1FVDA 1DDHA 1NICA 4A37A 5KYXA 1WT5C 2CAKA 2H6PB 2W9DH 3LMJH 5E1GA 5IB4A 4N2LA 2FZ3A 1IU1A 3PWUA 4HJJL 4RWYH 3SDAB 3IAGC 1T7XA 4P23D 3QS2A 2WLZA 4R83A 4LLDA 2AJYL 5FC9A 2HMIC 5IJKC 4RETB 5D1XB 3RVUC 2NY3D 3WNLA 4POZD 1LJMA 1KFGA 4LNVA 3HI5H 2A6IA 2C3VB 2VQTA 2B14A 1DHKA 1BBJB 4JVUA 2CCWA 4MZRA 5BS0D 3QZBA 1A7RH 1WBXA 2J8OA 1JUFB 2WSDA 4U1JA 3SQOL 4BGDA 4XMWA 4OF7A 4OT1L 4Z7VE 3GZQA 4PGCB 3SDDC 2PN5A 3FO0H 4O02B 3P1VA 4RMQA 3ZBMA 3AREB 3WO3B 4DZBA 3KCWA 2YC1A 4LLMA 2EC9U 1S9YA 3IU4L 3WG7B 5F6IC 5D7LA 5IW1B 1JF6A 4EI6B 2PWHA 2AQNA 3RFZB 1MFVA 2XZCL 3DMMC 4JM4L 5T3XE 2WBXA 5FPIA 5L8JB 4PRID 2PXYA 2QELA 1QSVA 1IBYA 3DPDA 4NOFA 1GVIA 1QW9A 1A6TA 3ARVA 1L0PA 3QDMB 4LF3A 4QTIL 1UM6L 4AVHA 1MAML 1E9PB 3CFMA 1I3GH 2H3NB 2EKJA 1N9PA 2H9GB 4LCWA 1WA1X 1OHZA 4G6AD 2HRPH 1E4KC 4J6IA 3U79A 4JAMA 5EOCJ 2JF1A 2XN9E 3L3OA 3O6FB 5D70L 3UTTE 5JIPA 2ARJA 4S1DD 2J56A 3QAZC 2YD9A 3MA7A 1JPSH 1UENA 3SKMB 3EJUA 2AI0L 2W0LA 1K4DA 4XPTL 3N0PB 3OLGA 5DQJA 2MHAA 3SPVB 1CD1A 2XLLA 5DHMC 2GJPA 4F1SA 2WXMA 4M7ZC 3CN1A 4LLQA 3WHE1 3D25A 4WTZG 4HPHA 4P46B 2VDPL 3NG5A 1G7IA 5C0JB 1PAMA 2GK0B 4TNEA 1XCTB 2C9PA 3OMAB 2D7TL 4OUUB 5DZ9A 4U49A 3D8MA 4H8UA 2C7UA 4HGWA 2HFFB 4JRYA 1RXLA 3OLDA 5FGBC 3VFWA 5CF3A 1N10A 1HH9B 4OJFH 5HJ3A 1KOAA 5FUZL 2JI3A 3APNA 5GS3A 2X4SB 4MNQE 4PJBB 3F83A 4F33A 2ZOTA 1VPOL 4Z5RA 1G4MA 1GSKA 4ONHB 2AXWA 1UB5B 5HYJE 5C08B 5EOTB 1B90A 3MN8A 3HC4H 1OAZL 4AL8H 3B5TA 3FCTA 4XTRC 4M7KL 1BQHB 2YGOA 5GPRA 1LEIB 1ZJAA 2X2JA 1I4FA 4HPOL 2I9LB 2AK4D 4J2QA 3BAXA 5IVXF 3QJSB 3V0EA 1LLAA 5D1QC 2EDJA 1G7JB 1Z9SA 3TNNB 1A6PA 2AW2A 4L9LB 1SYVB 4IRJB 2CO3A 3SDCC 5FOBB 4ZOCA 4OTXH 3LH8A 1EXUB 1U30A 3T65B 2GUYA 2ZX9A 4PJAF 4P23C 1UZ6E 3NCEB 1KIUA 5JHDB 3N44F 1W8OA 4Y8AA 1KJ2H 4OCSL 3Q2VA 1J0JA 5ELIA 3WIIH 3KNBA 5T5FA 3ZOAA 3SYPA 4PBDA 3I3DA 1CN4A 3SD2A 2EADA 3GGWB 3GMMA 2XQYA 3K4ZA 3C09C 1L6ZA 4QCIA 4PJGF 1U36A 2IDUA 4IOIA 5EN2A 1JZJA 3T0DA 3LNDA 3QJVB 5AOZA 2BHZA 3ULAB 3ARGA 3QWOB 5LCVL 4G6JH 4LVEA 3SBWA 4D0BB 5B4MC 3P40A 5GRJH 3T2OA 3BVNA 1UGNA 4FXKB 3P73A 3Q9PA 4JPKH 4PJ7A 1FWXA 1BQRA 3BH8B 1NBQA 2M1KA 3IDNB 5AOIA 3RHWF 3HR5B 1LP9A 4ODTH 2MPAL 3QJFB 3U30B 4V1DD 2R1XA 1MIEL 4WWKA 2I60H 1IEAA 2XWEA 1PZBA 3U46A 4WWPA 4X6DE 2YAEA 1I1FA 1R5VB 5FFGA 4MAUH 2JXMB 2Q6WB 3G5XA 3JUZA 3KE0A 3SY0A 5C0GB 2YFOA 2NSMA 4P4KC 5FYJH 1OTUC 2ZE0A 1WAAF 4E5XA 5INCB 5T1KB 3IRPX 1H0DB 1BZQK 1EGJA 1F4WH 2F1BA 2IPTH 2C7FA 2NYZA 4H26B 4HHAB 3SDXF 2BSSA 4DFHA 1M2VA 4HQQL 5IEKB 5I8KH 2BVQB 1JGEB 5F7FA 5T33H 5CCHE 3X12B 1NFAA 2XETA 3MCLL 4KPHL 2QVKA 2VDQB 4HV8A 5CUSL 2VJXA 2DDQL 3B9KA 3FHAA 1A6WH 2GSMB 4Y88A 5KBLA 3QB7C 3RQ3A 1JHKL 1KJVB 3GUTB 5IQOA 3O6KL 1JYNA 3DYOA 3N06B 3N85L 5I15H 4NRZB 3W11C 1KGJA 3I6SA 1OCOB 2LVCA 3ML8A 2C4XA 4P3CH 1L5GB 1KYOK 3HMXH 4JG9A 1SLXA 3BVVA 3O81A 1HSAA 5GZOA 1ILSA 3O4LB 4PU2A 4HKJB 4NHUA 5L0QB 4WEBL 4PS7A 2MCAA 4ZUWB 1BVNT 1ZHNA 1XH0A 3RWEB 2YWYA 3AMLA 2X53A 2VLLB 4AUUA 2F2HA 4M3HA 3RJQB 2NNXA 4X83A 1KCUL 4CSPA 2TSBA 2WC7A 3GSNB 3AT8A 1Q9WA 1T4KB 3H55A 3ORJA 4IMLA 3RVXC 4HCRH 1KZYA 3BPNC 4JN1H 5BXFA 3UBXB 1INDL 1Z1WA 3G6AA 3CZFB 2JJTC 1A4AA 4OTXL 3R06A 2CDGB 4Z78B 1RZJH 3TV8A 4HPYH 1JAEA 4M62L 1IC0A 2XNAA 2WWMC 4XI5D 4HISA 4HWBH 3T1WA 3H2QA 1JS4A 3L48A 4MMXB 1MZZA 1DBAH 3VD7A 3W3BA 5J06A 5ACMA 3RIAK 1QSFB 5DZLA 5JOPD 1VACB 4CC0A 3VXTB 3KLSA 2A74C 3VMPA 4GW5B 3VG0L 1CVSC 4PRAA 2B0SH 3AU0A 1J1XL 3ECQA 4MHHG 4S1RL 4R4FL 4XRCA 3HHMA 2Y3NA 3DRQB 5E51A 1SF5A 3S36X 1DCLA 4NYLA 4TTDD 1AS6A 1ASQA 3MCLH 2F58L 3UROR 3CU1A 3ZK0A 1BFOB 4HT1H 1AGCA 5FIEA 1BD2D 3RZCA 1F3DH 2SEBB 1IM9A 1MCWM 4X5XA 2FR4B 3FUIA 4G70B 3EDEA 5E5RB 5H37G 3O3BA 3C5ZD 4MBRA 1UCBH 3IXTB 2ARJQ 1A7BA 2KHAA 3GSNL 4NXKA 1ZCRA 4EUPA 1JGLL 3MJWA 3FH8A 1OK8A 4YN3A 1JPEA 2RMNA 4Y19E 4N25A 2FT7A 5ANHA 3KPSB 1NMAL 2V2XA 4XMZA 3K6SA 2N56A 2EVHA 1BM3H 1F6AA 1RIHH 5I19L 1M7IB 5IMKA 2BVPA 3E6HB 4ISVB 2IJ0C 3CWGA 5GS1C 4GUOA 3MLRL 1PPIA 2GUOA 1CC3A 2D3JA 2DQDH 1INDH 5E9DA 1Q0EA 3FAWA 4ETQA 1FL5B 3I9GH 5B1JA 3LS5L 3HHSB 5C0RH 3SODB 4OFKA 4Y8DC 1NGYA 4OFDA 4MXWL 4L4TB 4ODSL 3GSXA 1R0AH 3CDGA 1CDYA 4DTGH 3F64A 3IDXL 5J11C 1CG9B 4KO5A 2Y7NA 1LMKA 4ZO8A 1QFWL 3AY4C 3VFSB 5KW9H 4JZNB 3QFGA 1I9RL 1OOAA 2RALA 3L3IB 4ACPA 5JQIB 2BW4A 4ZS6D 2PPCA 4QHLA 1J11A 3HI6H 3FT4A 3KWVA 3L5XH 3MKKA 4I18A 4FP8L 4KDWA 5CLYA 4JFEB 3F65A 1KTDB 5J1AA 3VNZA 4X5QA 2HTLD 1OQOA 4TN9A 3GIVB 4AXWA 2OTWB 3CC1A 4HC1H 4NNYA 3I02B 3WKMH 4PMFA 4QRUA 1QFUH 5K9JH 2PTVA 2DWTA 3RVWC 3S2AA 4EOWL 1OWWA 4FEMA 4GSDH 5DJ8A 5FKAB 4H5SB 5TD4A 1JGLH 4QLWA 3DBSA 2JCWA 1BQ5A 3FQYA 4P5RA 3SCMC 1ICTA 1XB6A 4U1SB 2PP7A 1N5AB 4U0QB 1MWAL 3EO9H 4OCXL 4PTTA 3IJEA 4FZ8L 1BVLB 4Q9CA 3LNEA 1YMHA 1DE4B 2CHZA 2GW5A 1JNLH 3HS0C 4RMSA 1XO8A 5D2LB 1RLWA 1SEQH 2R0WL 1QLFA 3BQUA 3H42H 1TO5A 3OAZH 2N01B 4WW1B 3WFBL 1S9XB 5C0RL 3OPZH 1RFDH 4J3TA 3WXVH 2A4EA 2VWEE 2GSGA 3RGVD 4UT6A 2C1PA 3D69A 2H1PL 2QBWA 4L3EA 4P5KB 4YDNA 3OR7B 4JFHD 5FR3A 3V4PL 1B0IA 1I8MB 1WFNA 4OFYA 4HCIA 5F7EL 3V4VB 2RAMA 4KXZI 2EZ0C 3KLKA 1BGXL 1AGEA 3VGAB 4A38A 4GBXA 4UV4L 4JB9L 1BZEA 5EORH 3SDCD 1XAUA 3SPIA 1RJLA 2R39A 3C2SA 2F74B 3VO0A 4N1EA 3HJEA 4NQEA 4N68A 4WFFD 2CMRL 4PTUB 4QRFA 5JYMA 2QQLH 1FO0A 4KTEL 4P2QD 4WUKL 3STLB 4D8PB 5HDOA 1U58A 1QA9B 4Z7UB 4BUGA 5IW3A 4LLUB 2GCYB 4ZFGL 1F58H 1LK3L 1YNLL 2H8PB 3E1F1 3FTYA 2HVJA 4PJ6A 4ZPVB 1PX4A 1MWAB 3PPSA 4OJEH 1EHLL 5IFJB 4B9CA 1ZTXH 3TFBA 1RZFH 1BD2A 2Y6SC 1TZ8A 4YHIA 4YUEH 4X0KB 3RZCD 2BFVL 5CXPA 3AMKA 1GZQB 3NJGA 2W95A 3KLLA 1GGTA 4HJTA 5HD8C 3TTSA 2W38A 4DTGL 1G7IB 1KBBA 4JPVH 4X6EA 3DX7B 4IBLT 4NUMA 4I18C 2YAOA 2NUTA 3NEOA 3G6DH 3S6CA 5J13B 3B6SB 1A1OB 2G5UA 12E8H 4M1GH 3SKNB 4K3DL 2WXFA 2JCCF 4M8QB 5F9WC 5E2WH 2E9WA 4MWFA 3DX4A 2X4SA 4PRBA 5HI3C 3IWVA 4UTBH 4G43B 4JL1A 4WI0A 3PWPB 5IB1A 2CO1A 2J4WH 3MRHB 5F9OH 5B39G 1XHHA 2FATL 4H8WH 32C2A 1H8LA 4ZDHB 3QXTA 1ZGLP 1PZ2A 3BZDA 4JM0A 1KTLA 1ZLWK 3UC0H 1QTSA 4PVMA 1WT5A 3S88H 2CLVB 4UIKL 3ZDYE 4N8PA 4YNYB 3SZKC 1JPST 3U1SL 1LEIA 4MD0A 1YUHB 3D7PA 4ACTA 3LZLA 1WWCA 1AS7A 3ATAA 1Q0XH 1ZK9A 1DQJA 2DIBA 4OF5A 2J73A 3FZUD 5AVUB 3UBHA 1BEYL 1RQ5A 1T2JA 5EO9B 1UACL 4N0CC 5TE7L 4EN3B 1I8KB 1WIUA 1MIML 3CSTA 1VA9A 4M6MH 1EK3A 3FB7B 5KOMC 2IGFH 1EFXD 1M3JA 5GJTH 3K74B 3DMMD 5ADOH 1VAHA 2X0VA 4K3JL 4XXDB 5JOPE 2WBKA 1OWRM 4UT6H 4MXVE 4Z23A 3UTPD 3GMMB 3QUGA 4EIUA 4NQVB 5T1MA 4XNQB 4KX9A 2IBGA 3QORD 5JXEC 4YGVB 4UV4H 4Z77B 4LZKA 3BHBB 3PHOA 1CTMA 3AC0A 4L9LC 3VG9C 4Y2OA 4DGYH 2O6CA 3X13B 1P7HL 4WAFA 4PCKA 1OTTC 3QQ4A 4JO3L 5DMKA 5BZDA 5I6XC 5DT1L 3V0FA 1PLGL 4X0NA 5EUOA 1TVHB 1EFQA 2EDWA 2HVKB 4YE4L 3VGGA 3FF7A 4QHKJ 1FFPB 1M1XA 2EZ0D 2CLZB 1JTPA 2XN2A 4NT6A 5EWIH 3GPSA 3NFNB 3QDME 6CGTA 3HI1A 4CW1A 1DLHA 4NZ8A 4YFLF 1A14H 3ETBJ 3ZHKA 4UT9A 4AEFA 4JPIA 4F9PC 1VENA 5KS9A 3GB7B 4JN2A 4H88H 5I1KL 4QXUH 2D31A 3GINA 3SY0B 4K94H 4OBRA 1QSED 4XP9L 4AMKL 1OAUL 4HUXA 2FL5B 5CP3A 4NQDA 1KN4H 1K85A 3FQ2A 4WJ5A 3ARDA 3NK4A 1MLCA 1EMTL 3U1PA 3ATEA 2JE8A 4U6VL 1KJ2L 4OCSH 3WIIL 5LDUA 4F7CB 2NXYB 3PV7A 3X12A 1KPUA 4H8PA 4PUBL 5IMLA 3UYOD 3U30C 3SO3B 5HI4C 4YSQA 3O4LD 4HV8B 4NZJA 1ZVYA 2ESVB 1AGBB 3VXRE 4H8WL 4Z7OB 5I17B 5CFHA 3CFQA 3HMWL 2PR4H 4YHYC 5D7KD 3UEZA 1F1DA 1OY3B 1KXVA 4K7PL 4XO9A 5DUPL 4QY8A 4P5SA 4EIGB 3EFOA 2HTKC 4G82A 3V7MA 2IADB 3AQYA 3A24A 4U0RB 3SGJA 3F05A 3T0EB 1TT6A 2TRHA 3L16A 3DRTB 1CFNB 5T3ZD 4U6XB 3L3HB 4JPKL 4G5ZL 2OTPA 2JB6A 1ZT1B 4ODHL 1GZPA 1MFBL 3GM8A 3I6GB 5GS0C 4U2ZA 1GKOA 4UDTA 1Q94B 3NSJA 1MY5A 4YPGA 2AQ3A 1BEYH 4BRJA 5D55A 3TCXA 4UNUA 3TO4C 5C09D 1OPOA 3VXUD 2BM3A 5I1EL 5HD8D 2DQEH 5C09B 4AQOA 5G4MA 4JZOA 5FO8A 3L3GA 4FTDA 4QRRA 1T1XB 2NY4D 2WXGA 5EU5B 3MRMA 2DPKA 1OTSD 2X4NB 4C57C 1BJ1J 1DO6A 3K2UL 1T0OA 2WKLA 5A6IA 4KRLB 1MCPH 1X5LA 1N67A 4H13C 1ED3A 5EZIH 3WFZA 4I48B 1ES0B 4N2NA 1U2HA 4M5YL 5SWZE 2WIIA 2YPKA 1DSYA 4XRCB 4MAYC 4J39A 2BDNH 3A0OA 4NFCA 4OT1H 4CMMA 2FYYB 1JHKH 5E4EB 4PGEA 4HK3N 2ENSA 1AGCB 4WSKA 2R69H 4KH2A 3VNYA 5FYJD 3A23A 3QDGB 1GH7A 2V2WB 3L13A 4PJXE 5DZNA 4CKQA 5AYUL 3I75B 1LK2A 5FYKL 1G5GA 5D1ZI 1H8SA 4KV5E 1TTUA 4CN1A 3L3JB 4XAWH 1V27A 1UM4H 4P5TB 5HGHB 1Q1PA 3BEVB 3C8HA 4KX7A 4Q6IB 4WU5B 4A66A 5CJXA 1D7FA 4NQCB 5TTRA 4BZ2L 3WY1A 5HY9B 2WUCH 1I75A 2YGQA 4KVNH 4PJCB 3WFCL 2V5YA 1Q1JL 1QI5A 3FCSB 3EH5B 1JZ3A 1AJ7H 3L17A 1FJ1B 2J21A 3QZWA 4HBQA 4ETQB 4NQUA 3V9FA 2C3XA 3SPCA 1A9BB 3MV8B 3U0TA 3D07A 4WKXA 4DP1X 2E7LC 3QXDB 4MVBC 3BZ4A 4ZFOL 3MCKA 1IC7L 3O6FC 5ANME 1P7KA 1UQSB 3G04B 3P4MB 1CG9A 4MMYB 4S1QL 4XB7A 2NR6A 1JVOA 1X5ZA 2A6DB 5CINH 2HX7A 4YHKL 1U4EA 3MLYL 1BOGB 4JREB 1NH6A 3NIGB 2NY5L 2ALWA 2X4TA 3HS0B 1H3XA 2ZP8A 3FQRA 2X7LA 3SGKC 3MLTB 1B2YA 4PS8A 4Y9GA 3JV6A 4ZYKB 3TO4A 5KYYB 5IT2H 4L3CA 5KVFH 4YHPA 1CFQA 4BQBA 5I75C 1KTDA 1G9MH 1U0QA 2APXA 2Y2YA 5J1AB 3B9VA 1DVSA 4M1CC 3ZZSA 4TSAL 4F9LA 1WUZA 2MQ0A 5A2CA 5L6YL 1BQHG 1X4XA 4P2RE 2VL4A 5IESH 1S2EA 2EVJA 2OCCB 5E9DD 1T0PB 1H3PH 3OC5A 3SDAA 3F7QA 1U8NA 3M88A 1UZ8B 5GGUB 4ZX4A 3A3YB 5DVLA 5FM4A 2L7QA 4AX3A 3GD1C 1ECYA 1CQYA 5JA8B 2ISDA 3S34H 2WTRA 2YWZA 2X3AA 4Q9QH 5EU6E 3O2DH 2HLAA 1BM3L 5I19H 2Q10A 3MRGA 2C3VA 4GIOA 4YDIL 5JPMB 2EYRB 5FB8A 1WD9A 2ICEC 3LN4B 4PR5B 4HK0B 2ZUVA 1DE4A 3MRNA 3FU0A 4D0CB 2VLJD 4IHBA 1WBXB 2XZAL 3MXVL 4RX4A 4P06A 4PGCA 1CLOL 4FLSA 4KOCA 5AAWA 3SE8H 4C47A 4R7XA 3TJHC 4DZBB 2N0KA 1CT8B 1MXDA 1S9YB 4JHBA 1WFIA 1PLBA 3IDXH 1J5CA 1BP3B 3PDDA 5DJDA 3HW7A 1X6NA 5AVVB 2VDKH 4EI5A 4LMQI 3TVMB 2Z3FA 3OKNB 5E6ZA 3AS0A 3V10A 2Y3AA 3IK2A 2AGJH 5D1ZA 2HT3C 3IMUA 4HD9A 4LAJH 4YHNA 1UG9A 3LEVL 1E9OB 5DEFA 5F7HA 1H6EA 4JR9H 4BFIB 5DO8A 1WGVA 2JKWA 5D7LE 2GCYA 2A9NH 2H8PA 2ZYIA 3MOAL 5JIHA 4XE0A 3UTQB 1WYJA 3R0NA 2QSVA 3WJLA 2BSTA 3L3OB 3O6FA 4OZGA 4AQAB 1N5YL 1F4XL 4ZPVA 1I3UA 4M6OH 4WWNA 2DOCA 2Y1VA 3SKMA 3DJSA 2F1EA 2FZ3B 1TUPA 4KMTH 1CMOA 3OKEA 4QGTA 4L05A 1RKRA 4ZFFA 4TTGA 4QI3A 4EF3A 4KOBA 3MLVL 5ABAA 2WXNA 1DLFL 1SJMA 5CU5A 2X9ZA 3BIKB 5KTEL 2VYRE 2DJSA 5DWPA 1V3LA 3KR3L 2GK0A 4M7LL 3CFEA 1PKQA 1MFMA 2YBRB 2Y4SA 4LGPB 3TBSA 4AENB 3BRGC 2NNAA 3MRRA 3BT2L 4UYQA 5I0ZA 3CTTA 2X10A 1UH2A 1ACXA 4OIFA 4NFDA 3IU3A 3R7QA 4HUCA 4LEOB 4KI1A 4N6QA 1Y7VA 1R5IA 3WLWC 5E0FA 5C0IA 2FNBA 4PJBA 1PJ9A 3SDYL 4JFPB 2Z64C 2Q9OA 5EBWA 4NO2B 5CJBA 4X50A 3D06A 3T9WA 2RH0A 2WXQA 2IVFC 4OF8A 2P52A 3HB3D 5J5EA 2JKTM 1OGSA 1RZKL 1XQ4A 1Z9PA 2ZKWA 1EHNA 3EYVB 3SBRA 3L54A 3V4PB 1IUZA 1CL7I 3NDZE 3SQBA 1S5HA 2AJVL 3VJ6A 4PEEA 3BKJL 2X0UA 5K39B 1DUYB 2Y25A 3D6GA 5I1HL 4XMTA 3GXTA 5J7CC 4DKEL 5FEBA 4IBSA 2H3NA 1DQJB 3LIUA 3AU1B 4MDJA 4O51A 4LU5L 4A6YH 1S7QB 1KT2A 3EO0A 2FGZA 4MYPA 1NEUA 3N43B 3BJ91 1TU2B 4YC2B 1N5YH 5LQBL 1LE5B 4JRWA 1ASOA 2ENYA 1HNFA 5A6LA 2YLKA 5AVXB 4BSVB 4BWTA 3S3JA 3F84A 4XCYB 5E5LA 3ZKMC 3H53A 4WVRA 3BSZH 2Y7OA 2J8UF 4GQRA 4DP2X 2JKIS 4G7YH 1AS8A 3P0YL 3UZEC 4JJHA 5CD5D 5IR1A 4N2DA 1ORQB 4OU3A 5E1AA 2JKXA 3QP3A 1HN1A 3F5WB 3QCVH 1TQBC 2PPEA 4JUTA 1ZSDA 5ICXB 4JMNA 3T0AA 4KV5F 2HG5A 4TQ8A 2F7OA 2GI7A 3OGCA 2UX7A 3HC0B 2X6UA 3GXMA 3QGVA 1J9QA 1EZUA 2WK2A 2XY2A 4JO1H 1ROWA 1JI1A 3QI9D 5D71H 8PAZA 1QAWA 2K45A 5GRVK 3KH4A 4P2RB 4FFVD 5C9KA 3APMA 3D85B 5ID1A 2FHCA 1FYTB 5JDJA 3QXAB 4W9ZA 3EZJB 4U7KA 1IL1B 1NDGB 3NSXA 4F7TA 4IBYA 4XPBH 1E5UI 1L9TA 2PR9A 3F85A 4PJHE 3UTOA 3ZQXA 4OLXL 3MLVH 1VFOA 2R29H 4HUMB 3ASOB 4G71B 2NZIA 3TEUA 5HHXL 2Q6WA 5GS1A 3CH8A 2DYSB 5ACZB 5IROD 2R4SH 1OW0A 4TVPD 1C5DB 1MLCB 2WLMA 3ATFA 3FZUC 4X7TA 3KWXA 4I3SH 2ZOKA 5DZAA 3V4UL 4KNTA 4GAGH 4RDQG 3SQRA 3O8XD 4QT5B 4APQC 1MY7A 1YN6A 4ZNCD 3W9DB 1J87A 3FSWA 1HXMA 4F37F 1KCSL 2AK4B 3KPPA 3US0A 3FQUA 1F1GA 3PUCA 4ZQKB 4QF1A 2G4GA 2XY1A 1ZLUH 4UOQA 3NQKA 3GUTA 1VB9A 1CXLA 2NOYA 3QG7H 4IOIB 2IADA 1IILE 1I9RH 1I8LA 3AGWA 3IMSA 3WKYA 4KK5C 4MAYB 1Q38A 4N6RA 1A7NH 2DLTA 3OVUB 4HWNA 5I9QC 4RGNE 1OTTD 3QZLA 5KJ4A 4F80A 4RMWA 7PAZA 2QV4A 1BHGA 1FHGA 3VTMA 3BE1L 2IXQB 3E38A 1Y07A 3DROA 1IO4C 1PZCA 1AQDB 4FQHA 1CXKA 3UBXA 4W6XB 3IDNA 2WBJB 1ZLDA 4AQEA 3N9GL 3CFBB 3L95A 3OHXB 2FIKB 4IRJC 4ZD3L 5EEZA 2ZUYA 4GO8A 1KBWA 5C8JA 1MCRA 1XF5A 4UM9B 5KSBF 3DETC 5IHZB 2XNAB 4P46D 3QZMA 3X1EA 5C86A 3TT1L 5KG9A 5K59E 2XKNA 3U4AA 2GSIB 4J3WA 4NCC1 4IGBA 1CDGA 3OPUA 5DMGC 5C0GA 1N2RA 1ZA3A 3CSYA 3RPIA 1XR8B 4F7EB 5LBVA 3T5WA 3CVCA 3WAJA 3AABA 3WN5C 1MFDH 2J12B 5F96L 5EUOF 2GY7B 4F8LA 2G60L 2FYYA 3O45A 4EPSA 3ULUH 1R17A 1CXHA 1ETA1 2J8UB 4FQPA 4GLRH 4OLYL 1AQKL 3Q2CA 4W93A 4ZUVB 5A2LH 2Q8BL 5JORB 3LIZA 1HCYA 4D9RD 1NZRA 3L3JA 3KPOB 1L5GA 5DHVH 5SWSD 4OJYA 3FJTA 3EJZD 5FX3A 4TNWK 4NQCA 4XBGB 5HHNA 4I9WD 4DO4A 1EUTA 4HKJA 1PS3A 5B21A 2FO4A 5JHDE 4H44C 1HQ4A 4PJAB 2FWOB 3GMLB 2D4FA 4YHOH 5AWNL 3GSNA 4QXGL 5ABDE 4IKLA 4PIRF 2A0LD 2QFPA 5CJ5A 3SPHA 1L9QA 2CMRH 1YEIL 2ZX6A 3QPXL 2W91A 4JDVA 4XNZC 1SVZA 2APFA 4QTFA 3A6OA 4G11A 3DETD 1S5IL 4GRLB 2NY1D 3UTZA 4RA3A 1CTOA 1QTPA 2HUEA 1ZT7B 5F21B 1E65A 3FONA 4NWUL 4YSSA 4XAKD 1HHHA 2QMKA 2R8SL 4PV1C 4Q9RL 1XGRB 5HDQH 2GTQA 3MJ9A 2R1WB 4ORGB 4PRAB 3RIFF 4ZYKA 1XWVA 1TOXA 4GXUN 3DDFA 4WHTA 5SX5H 3MUZ1 3KZ8A 3EJRA 1I85A 3RZCB 1JXGA 4HWEL 2XVBA 4OLUH 5FUCC 3P3TA 1OHQA 1XGTB 3UIZA 2GFBB 4EDWH 5IUCA 1IGYA 1ZV9A 1R19A 4FCHA 3CZJA 5LAXB 1WA0X 3D2UD 1XF2A 1TQCC 3UO1L 1U8NB 1HX0A 1E4XL 4XO3A 3PFQA 2Q86A 3G6JE 2ILLA 2KUTA 2QPFA 1WWBX 2LLLA 4JHWH 5HHMB 1O7SA 2OFQA 1PD0A 3REVA 4GRLD 2PO6D 4TRPL 3VXME 2Z92A 2IANE 4KI5C 2PWFA 1E50A 1OOWA 4NN5B 3QFJB 4XT1C 4E68A 1KWKA 5I5MA 3S3DB 4PWJA 2MOVA 1YMHB 1AFVL 2WNXA 1QZNA 4NKOB 5CEZL 4I87A 5CNHA 4KTDH 3FMGH 2WYHA 3CBRA 1DO5A 3E6FB 1EQWA 5F97E 2DMCA 2DWYA 3PABA 3VFGH 4Y9CA 3FUNA 5IBTL 3BT0A 4L3EB 3V4VL 3MGTB 4MMZA 4XNUH 3WTYA 1KCVL 4JQVC 2AJUL 3HI6L 3JV4B 2NT0A 3GJFH 4GRWE 2I69A 3QFDB 3MBWA 2DV6A 5DJ6A 3D18A 1E30A 5DU7A 2RGSA 2A7BA 4Y1AD 4DP8X 3KL3A 3BO8B 2F7PA 1E9OA 4XHJC 3FQNB 4BDVA 4O02L 3Q05A 5DJXA 4BFIA 1FO0B 4NWTL 3FUMA 1ZTMA 4OJCA 5DJ2A 1KUMA 3C75A 4QRRE 4ZMOA 3UGUA 1E2WA 2F53E 4LLUA 5T1KD 3QIUA 4DKAA 4TSAH 4HKBA 1EDYA 1JNNL 3JQOB 1KBPA 3GIVA 3DUSA 3T4AB 5EZOH 3C6SB 4K55A 4PRHE 2IPKA 4L18A 4ZFFB 1OIOA 3E8UH 3BMVA 3WFDH 2GTWB 5CHNB 1BQLL 4DN3H 4UILL 2J6WA 2QZQA 4X6BA 3WS6A 5DJCB 1T03H 2CG9X 2OSWA 5C9JB 5F1KC 3EDKA 4U6YA 5AAMA 3LN9A 3CFEB 1SEQL 4FNUA 3AM8C 1MFUA 3IU3B 2NUPB 1BYPA 1NEZG 3ESPA 3BKCH 1WIOA 4G8GD 4YDKH 2NY0B 4Q58C 1D5IH 4B9IA 1UUNA 1Z0NA 3MRLA 4Z7OF 3GMRA 3MLUH 5I15L 3T0WA 4XNMA 3TWCH 4K5NA 2G0LA 3V5HB 1ZWIB 3EBHA 4C56E 1JZGA 3DOIA 4JHVA 5D93B 5GGRY 5CUSH 4IBWA 1FH5L 2ATKA 3SGJC 1Z5LB 1GXEA 1VJSA 1D3CA 4AJYV 5I24A 3JVGA 4YEFA 5T3XD 4RIRB 5F7MC 1LK3H 5KBNC 3PJLA 2JIXA 4JG1H 3NJHA 4TNVF 5E94B 1N8ZB 3H3KA 3H4HA 4N90E 4M56A 5BMFL 1FA4A 4AVIA 4MJ2A 3EO0B 3TT3H 2D03H 2NNCA 4KDVA 1GW6A 1ML0A 3ROOB 1UWEL 4HWBL 2MSPA 4R9HA 5HGAA 3ARBA 1OKEA 5JW3L 1A47A 1T3FB 4P57A 1RI8A 1SYSB 2OXGA 1F90L 1CE1H 1EO5A 3WDJA 1Z9MA 5EUOE 1NC4A 3GLAA 2ROYA 3IFPA 3UCRA 4QLRA 3ECBB 2AK1H 1WSST 4CDHA 2HKAA 1KJ3L 4R4ND 5CBAB 2OJZL 2BINA 3K2UH 5KTEH 2UV3A 1T7WA 1AG0A 4JFYB 1JPSL 1J9RA 5JPNB 2E9IA 1MCPL 5FO7A 1UXSB 3UBFA 3P30L 4FYSA 1XZ0A 1EEYA 1E5YA 1KIPA 4K94C 5CJOH 1E4KA 2Y2TA 4FABL 3CQQA 1J9CT 4I3RH 5E8EB 2QSQA 2XN0A 4E9WA 5GGTA 4K9JA 3SE4C 3X13A 1M9WA 1TTAA 2YD0A 3QQ4B 4HXBH 4HOMA 1Q72H 4POZC 4KVPA 4NJAL 3ZYZA 2N3JA 5DMKB 4PRBB 5EPMA 4U1MA 2FGWL 3QWNA 4IOSD 4MSWA 1C1EL 4QRPA 4YDJA 3EDJA 3JWOC 2R2BB 1MKFA 1DSFL 3KAAA 3U6RA 4IBVA 1QYGL 1U93B 1M1XB 2E4FA 3VI4E 5EZOL 3MV7A 1S7VA 3AWFA 4YDVB 1DLHB 3MRIB 1DVFA 3Q13A 5MP6L 5BZZA 4MJHA 5DMIH 5T8IA 1YUHA 2E6JA 2P46B 5C0CD 5KYWB 1WICA 2UYLB 5AYUH 3WKQA 8CGTA 1MI5B 2YD1A 4WHYG 1YMMA 5ACZA 2IFFL 4PJIE 4M7JH 1E2ZA 2XTJD 4FYTA 3GKWH 4LCCB 4WJ5B 2VLRB 3EBGA 1BAFL 1OB1B 3ZDZB 3T09A 43C9A 5J13C 4FQIH 1M53A 1CLCA 4K5LA 2BHYA 1NMBL 4KO9A 4YHML 4FNLH 5D7IB 4CSZA 1BMWA 5EV7A 4PLKC 3UJJL 4XMXA 3FQUB 3RDTB 1ADWA 4ZW5A 3C5SB 1U6AL 5H4ZA 3WTTA 2EE2A 4TNGA 4FA6A 2ZAHA 1YO4A 4QF1B 3QCUL 2QTVA 1DJZA 3FW6A 4FFWC 1OARL 2QL1A 4RISL 3OZ9L 2VSKB 3PP3K 5TDOB 4QY8B 1TLMA 3K2KA 4TUOB 1MCWW 4JY5H 4QOKD 5G4NA 4AZ8B 1S46A 3U9WA 2I9TA 4KHTL 3DMMB 2G2NA 2V9RA 2YZ8A 4PCYA 2MQGA 2Y6TE 4S1QH 5BZDB 3ZHLA 4KITB 3F12A 1GZPB 3ARBD 3I6GA 4NKIH 4RNRA 2VW7A 1B6UA 5MEQB 1OP4A 1Q94A 4LRNL 3VFRB 2WINA 4RSVA 5EUOB 1EJ8A 4NO3B 4X80H 4AQEB 2ICWB 4G8IA 3N1MC 5EF0A 4EN3C 1EZSA 4YPJA 2FIKA 3WD5L 4HP5A 5K9OA 1QSEA 4PJEA 4NT6B 5DC2A 1F90H 3RVTC 1XF5B 3CVHL 3NDYE 4UM9A 5FO8B 5L2KE 2XKUA 1SOXA 5EDSA 1J5IA 3RX5A 1UA7A 4ODXB 4KKRA 1CICB 4EOWH 4PYGA 1XIWA 2Z4QA 4CU7A 1TKWA 1QBAA 2DBLL 4E2OA 1CR9L 1XR8A 1JWMB 1F02I 1UADC 1TSRA 3IF1A 4OGQC 1BLNA 3WMPA 2WIIB 4AT6B 2QLVB 4J1UA 4NUQA 1P7QB 2OYLA 2DWSA 4Q0XL 1X7QB 1MG3C 3WDHA 2Z4TA 1MRDL 4P8QA 3DTXB 3UG4A 4O2EB 2ZXCA 5JORA 2CH8A 3GWJA 3QUMB 1OF2B 2DM4A 1JZ2A 1LVEA 3APCA 1XD1A 2DIEA 3B7RL 3MLSL 3QPKA 4UINL 5F3HA 3A21A 4UT7L 2DIAA 5I66B 4H2CA 2E4TA 1JZ7A 1F4AA 4RFEA 4A68A 4JDZB 1OSYA 5KUMA 2BNRA 4NDMA 5CILH 2Y5TB 2Z31A 3UADA 4GAJL 2ADJA 1L6PA 3BD4A 2JB6B 3N55A 3IPFA 1CFVH 2FECL 4JEGB 4PJAA 4LOVA 1QVOA 4EDXB 1R3JA 4AQ1A 1AGFA 4GQ9H 3WE6B 3QIBD 1HINH 3FHQA 2BK8A 4K9EH 3UFIA 1SZNA 4QAWA 3FH5A 4XN5A 3T2NL 3D85D 3Q1EA 2V3FA 1F42A 3U0TB 1WEJH 2MKLC 3L3GB 4QRRB 3C8KA 1KCUH 4NUJA 4P46C 2Y1YA 3QYCA 4E41E 3OKLB 5HJBA 2EKSA 3H9SA 1HKLH 2ODIA 1W72H 5CKGA 1I3VA 2VIRB 1G1KA 3NACH 1HHHB 5AD0B 1IGML 3VFPB 3KPMB 1ZT4A 4HS3B 5CCKL 1JMZA 2B9BA 1IQDB 1JZ5A 1FPTH 4G9FB 2R51A 1RUMH 5EU4B 2ZCKL 1EPFA 2ZCHH 4ETYA 1FH5H 2WW8A 4M7LH 4HIHA 2Q2EB 4Y16A 1IGYB 4FNQA 3QNYA 4B9YA 2D3NA 1HAUA 1OL0A 1YC7A 1I9JL 4M4PA 3ME0B 3QIBB 1S7UA 3HN3A 3ARYA 3OGOE 2EYSA 3H9HA 3FFCE 4N85A 4I9WE 1IM3D 2ZCLH 1T0MB 3SDDD 3B2VH 1DSWA 1Z9OA 5KJRL 1B4JH 2Z92B 4AIZA 4A7TA 3ZQWA 3FTSA 4P2RD 2MIZA 3TP4A 1N70A 2ZXAA 2PW1A 2R56H 2B8OT 5EO0A 2W65A 1QHPA 4OLVH 3HCVA 3LXBA 3CXHK 2EYRA 1MCHA 3O11B 1MWOA 2ED7A 3FU7A 3IRCA 2IC2A 4MB4A 4MJIA 4KQ4H 3U1QA 3H54A 1NTDA 2AITA 4V11A 1KB9J 3ZKJA 1TPXB 1HEZA 4G6KH 4O00A 3RIFK 1T1ZB 4ECNA 2KLSA 4G7SB 4YC2C 8FABA 2EINB 5F1OB 4YSDA 4KK6D 4OZIA 2WCPA 5IJVA 4WFGE 2CR6A 5SWQB 2A6DA 4IRSB 1SEBA 1OGAE 4Q52A 4UQIM 5E1HB 1LP9E 3U2IA 3CBKB 5E9NA 3BO8A 2JLPA 5FYLE 3W81A 4WUUE 3VGDA 2VM3A 2WZ6A 1IGTB 1MVUA 3EIFA 3QR0A 1QZ1A 2IG2H 5D8JH 1B3IA 3GM0A 2J5LB 4PV9A 4TYUA 3UERA 3UX9B 5L0QC 3U0PA 2VLMD 3N42B 1ERNA 3QUZB 1NCDH 3T0BA 5C0EA 4DPRA 1QRNB 3S4SG 2CJUL 1EVUA 2YUVA 1RZPA 1C5BH 4IEFA 4Z7QE 3ALXA 5TF0A 1MPAH 1JK9A 5BW7A 3DC0A 5JO5B 4GP4B 2H41A 1PZDA 5FW7A 1I9IL 5KVGE 4JNXA 7FABL 2MNWA 4JFDE 3GZOA 1Q8MA 1GIGL 5DD5H 3C6EA 2GYSA 2QKIB 4X9HA 2GJZA 3T4AC 5G2NA 1QR1B 4PRHA 3ZE2E 5CWSB 2P3YA 3HE6D 3LX9A 3SYQA 2XHNA 3PAYA 1RUQH 1S78C 2BY0A 3ESOA 4NSKB 5D2NA 4JFPA 1K72A 3U0WH 1ZY9A 4XWGH 3ARFB 2F53A 1TZIB 1O6VA 1WCQA 4MD4B 4NQDE 4NAQA 4U4BA 4XMLH 3EAKA 1RV6X 5JW4R 1D5BA 2GJ6E 4U1NB 1E4HA 1RZJC 2UY6A 4ES8A 1IKNA 3KG5A 5TE6H 3PUUA 2WJ7A 4UQ2A 2DLFL 2A9NL 2OMTB 3LH9A 3MOAH 3RP1A 5E94A 4UZSA 3CZGA 1MFCH 3IEAA 1KENL 2BS9A 1R24A 4LHUD 2OMXA 1XR9A 2FB4L 1NCGA 4KMTL 5F70A 1GW0A 2BSTB 1JK8A 2XBTA 2IH3A 3K0WA 4HIXL 4MS8C 5I9QB 1ZLUK 1QPPA 3ARBB 4P57B 3D9AH 1FO0H 3UAAA 2HP4A 2WXLA 3FN3A 3QZNA 3NPSC 5MHSE 1NC4B 3EJZC 3SDDA 5TQ2H 3K8KA 2AQ2A 2EABA 4HQQH 5DD6B 4IS6B 1DBBH 1LO4H 2NZ1A 4WCYL 4PJ5A 3W39A 4NJ9L 1MRCL 2X1OA 1IARB 4R2GD 4WI4A 3LQZA 4FZEH 4BRVA 5DVMA 1AOHA 3FT2B 4U4IA 1AOZA 1HDMA 2G5BB 1W8EA 5AW7B 1WFTA 4C8XA 4IIQB 3RDTC 1D5RA 4M5YH 4ZUSB 3LKQB 1F11A 1XSKA 3X14B 3HNTL 2F1AA 1EX0A 1QFWI 1M2OA 1NBVL 2CGRL 1TQSA 2ZF8A 4GP8B 1PYWB 2K9UA 2UY7B 4ORZC 5M7QA 4X4XA 2HX8A 4UTAL 3MRFA 3TESA 4NM4L 2QDVA 3KXFB 1IL1A 5IOKA 5KVDE 2VN4A 1DVFB 1XB3A 4EZJA 5JA9A 2DW5A 3QUXB 5AKVA 3GBNH 4PIBA 3HPJA 4YAQB 1HOEA 4J8QA 5BO0D 1HINL 2BVOA 2MOQA 3ES6A 1M1SA 1HIMH 4MDJB 4DEPB 2W60A 4QXGH 1JVKA 5AAMC 3JWNH 3RL2B 5KSVB 2LLNA 2EEFA 3WY2A 1BZ7A 2FSDA 5DC9B 2YUXA 3DX1A 4U1IB 2YK1L 1GIGH 2JCCA 3OKYA 4NBXB 4UCFA 4X4YB 4G7YL 5C0FA 1DBKL 5C0NC 2WWOA 1MHPH 5IB2A 3SBWC 1F3JA 3LIZH 1OE2A 3EHBB 3VQ2C 1G7LB 1K2DA 1AC0A 1HVXA 3NJVA 2CNZA 1YEEH 3RU8L 4TS6A 4F8PA 5TDOA 4WI5A 1YEIH 3QPXH 1KY7A 2BFGA 3IETA 1BZ8A 3BMWA 4JKKA 3FO9B 2I9TB 4QRAA 1KTBA 4N3TA 4KZ0A 1U2CA 3TBTA 2Q1EA 3T04D 5HDLA 3Q06A 3B1UA 2XV2A 1YEFL 3GLEA 2P5EB 2L3BA 4H8VA 1HZHH 4WGWB 1LO5A 1OSPH 1YJDL 1DSFH 3MMEA 5C6PB 4FQHB 3UPCA 4HFWA 2HLFD 2Q3ZA 4HEMA 4LAQH 5ID1B 1U91A 4N0YL 5DQDL 2R29L 2D0GA 1VEMA 3QXAA 4M5ZH 3WIHH 5KEZA 3IFOA 4HUVB 5EEXA 5DK2A 3C5JB 4PWGA 5TQ0H 4NO5A 2VNCA 1MIEH 2FX9L 1A7OH 1BZ9B 3QQ3B 1HAWA 1TJIH 1KLUB 35C8H 1MRCH 1FC1A 1N2RB 1I82A 1XZWA 4HFUH 4Z95H 1P84J 3D09A 1ACZA 4MB3A 1P7QA 1T83C 5M95B 4K3GA 5CJQH 3CN4A 2NY5C 3CJJA 1C8QA 2FO8A 2NY0D 4PW3A 4O2EA 4RGOH 5I8OH 2WXKA 1TJHH 1FH2A 3L4TA 2VDPB 4G9FD 1A3ZA 2XCMC 4XCNA 3QQDA 3ARED 1YNTB 5CEYA 1DCEA 4XI5C 5A2IH 1OARH 3FO1B 4RISH 1EZLA 5KSAC 3WUWA 2BWIA 4QR7A 4Y9BA 3E3QE 2Y5TA 4ZJ9A 2P8MA 5T1JA 3PP4L 5IBTH 1P5UC 4C4KO 4GSQA 1TF4A 3C60C 4Y19D 4XNYH 4HZLA 1JHLL 5IVXB 3GS4A 3HBGA 4ZMNA 4WW2B 5IBUG 1TDQA 3IFNL 5AVRB 5KVGH 4EUPH 3WE6A 3CAFA 2YD6A 3NA9L 5D7JD 3AT9A 1CDHA 3DURB 3GBEA 3SIKA 4WU7B 1U3NA 1NUGA 2N0MA 2WUBL 3DGDA 2QJDA 2V6HA 4MCNA 3V6FB 4E42A 1QI4A 2X89D 2Q8AL 1HWGB 1HWHB 2JJSA 3CVHB 1JNLL 2DQCH 2EKSB 3H9SB 3GZKA 2H5UA 4CVZA 4IRZL 2WOBA 5HGGS 4Y2DC 2VIRA 4D2NA 1MEXL 3AFLA 1ZA3B 2DF3A 1Y0LA 2WXJA 3QUYB 3ZKXB 2ZPKL 1JZHA 1R47A 3EJCA 5EUKB 4N2CA 4FJYA 1WS7A 4AC4A 2B16A 4GT7A 3MRQB 3WAKA 4LXFA 4Y4HB 2KZKA 1A4JB 4XMLL 2P7TB 5IJBC 5I8OL 5DZVA 3VI3A 3VX0A 4LOUD 4NGHL 1JD7A 4Y16B 2BSRA 3UJIH 1HCZA 1SXNA 3PREA 2PYFA 3SDYH 5F9JB 3CQPA 4GAJH 3QIBA 1CU4H 5KSAD 2XA8H 1G1CA 1MFCL 2AQPA 4W9EC 5B1JC 4HOZA 3FU3A 3ULUF 1OT2A 5FYLL 3TEXA 4YFEA 1BVZA 5DJ0A 2C9XA 3DSNA 2FX9H 2HRHA 4O5LH 2FO4B 3F7KA 3NH7H 2PCPA 5IK3B 4HHGA 2Q7YA 3Q2LA 4L29B 4FQLH 4RFOL 3EJSA 5DRNB 1XBRA 1OP3K 1P69B 4YLQT 1RULH 1H3VA 2VWEC 3FU7B 3GHBH 5SWSB 3DVIA 1QSZA 1WFUA 1U3HD 4GMSL 5AW8B 4X7SL 2I07A 5LG1A 4HC1L 3WKML 4L48A 4OGZA 3UG5A 4ONGL 4R6UA 5KANG 1QD0A 1KJ3H 2EYTB 2UZXA 4AH2A 4OZIB 2DQHL 4PRIB 2UZYA 2ZSWA 2X0WA 4GKSB 3QNZA 4CADA 2WQSA 2AC0A 1A6VL 4IRJD 4KK9D 2YXMA 3JV4A 5GISH 4IRZA 3MUGA 2N4IA 3CLFH 3MBWB 1PNDA 5T5FH 2ITCA 4GW1A 3NIDB 3DV6A 4YHYB 4APQD 1TZGL 3ZU8A 3CLWA 1MCQA 2CE6A 3HZMA 5F7AA 4R4BB 5E6YA 4P3DB 4G42B 1U8PB 4F5CA 1S7RA 3BUYB 5CINL 4YHKH 1QASA 5D2LF 3FTZA 3WS3B 1FF5A 2ZWZA 3GHEH 3U0PB 1T22B 2PO6C 1F4YL 4D9LH 3BDYH 1DQQB 2IV8A 2GFBA 2OI9B 1NCTA 4WWKC 2VR4A 3I9AA 2OMZB 2BPBA 2KL6A 4JBSA 2L7EA 2R9HC 4WFEE 4HOXA 3BN9C 1HHJB 2HKHL 5HHXH 1MCKA 3SDXE 5E6SB 1ETZA 4DERA 4ODVH 1KIQA 1MF2L 5DMIL 4M1CD 3J7HA 3O4OB 4FFYA 3HKZA 3LEXB 1U8OA 3PWPE 4HEPA 2HTLC 4JFSA 4NZTH 3VFMB 2NY2D 4N4YB 5T1DL 1T21B 3C08H 5LXGL 4DIXA 4XCCH 3ARFD 2HT2C 3DVFA 4XVOA 2R15A 3FMGL 4R90H 3B9DA 2P80D 4XN7A 3H85A 5I71B 2Y5QA 1L4IA 4OCWL 5GRXG 1FBIH 3G5WA 3WKPA 3MFFA 5TGBB 2BMKA 2F68X 4XNMB 4M5SA 1TZIA 1ASPA 2RQEA 5CP3H 2EACA 4YSAA 3RFZA 2RA1A 4I5BB 5I1JL 1D5BB 3OAUH 4ZPTA 5AYTA 4PJ9C 5B7MA 4X6CF 3QFDA 1CXEA 3VCLB 5BUAA 3MGAA 2B1HH 4MVBD 5DJ6B 4TXVB 5E00A 4UQ2B 2PTTA 1DN0A 4QTHB 1XTLA 3WNOA 1WDAA 1V54B 4KXZH 1UJTA 1UATA 2V2TA 4BK4A 1NQBA 2DQFA 5MENE 5F3BB 4WV1B 2DN7A 2OMXB 1X9LA 4Y2LA 4JLRB 5ISZD 3L81A 3WNIA 2NW3B 4DZ8B 1AE6L 4W9HC 1EH9A 3QIUB 5ADPL 2IH3B 4PGDB 3EW3B 3ROOA 3ARDD 3GLZA 1UKQA 5HGBA 1LEKB 4XPFL 1J9SA 5HGAB 1U8JB 3C6SA 5EULV 4HEME 4NIKB 2K6ZA 4TM9A 3P11H 3CZEA 1CD1B 1XDTT 3ZR6A 5BUGA 5HHVL 4U1GC 2ZYRA 4XGZB 4IS6A 4WDIB 4ZFOB 2X9YA 1MPAL 1PF3A 5BVPH 2A74A 3MBXH 1DUZB 4JKPH 4JFYA 5FO9B 2FIRT 2N1KA 2DBLH 4F15C 5BQ7A 3V52H 3NCMA 5GRUH 3QEGL 3ENEA 4EI0A 3JTTB 2G3MA 1G7HA 3VFWB 4IIQA 1WLHA 4Q0XH 4Y5YC 1EAPA 3MRLB 1T89A 4M6AA 3G5YB 5IQ7H 4LIQH 1JPFA 3OKDB 4U1MB 1KCRH 3KGUA 5EBMB 3U4BL 4CNIA 5BS0A 1GGUA 2AKRA 2WQWA 5E1IA 4G8GB 5F6HJ 5MHSD 4L8SB 3ULUC 3EYSL 1GGCH 2F19L 3IJHB 3W56A 4MZ2A 2YMOA 3QIWD 3GNML 3WTUA 1BFSA 3W2DH 4ABVA 3EOBB 2LVEA 5TE6L 2UXTA 3OG4B 1JDDA 4M8RA 1ZXKA 3NEXA 2EEXA 4R97B 4BCYA 1A1MA 4DUXA 4AC2A 4R0LC 3J8F7 3NYKA 2JH2A 4XC3H 2MMXA 2L7JA 3WEAA 4N1CA 4XCCL 5LWYH 5J4MA 2K78A 1NCJA 4NM8H 3VXSE 3PS6A 5KBKA 5KSVA 5ALBH 3BVDB 3QO0A 3GI8L 4KAQL 3ABLB 5DFVD 2XYCA 3FRPB 4FQCH 1KB5L 4ZS6C 2WM0A 2WO4A 4M8VA 1XCQB 4ZO9A 1IRAY 2NR6D 2X1PA 2ZWNA 5EZIL 5IWLA 3LZOA 3X3GH 1NGQL 1RCYA 2L0DA 5A2BA 1RIUH 2ICEB 3V6OE 3K0YA 4NQCD 1K2DB 2IQ9L 3OB0H 1A7PL 3AB0B 4FA7B 5F8QC 3RYMA 4X5LA 4R7LA 3OAUL 2LFEA 1MELA 5B3NA 2XV3A 5JPNA 2BW5A 4OGYL 2AEQL 4GKOA 4PLKD 3O3EB 4Y1AE 1R3KA 1OE3A 1YEWA 4MMXC 3ZDYF 4D9QD 4WI7A 3DBXB 2X70A 3ZUCA 1ZA6A 4XX5A 3FSVA 5D1QD 4BK8A 3FT3B 4PN6A 4QEGA 3F12B 1KEGL 3L9YA 3CLEL 1MCJA 1N0LA 4I77L 25C8L 2WINB 5DHEA 3OJ2C 4BZ2H 1JZIA 1D5XA 2BRRL 4U6HA 5HVFB 4OGXL 1I1CA 1SLVA 2EDTA 2GITA 3QULB 3QK0A 4IJ3B 5KSAB 4G8IB 3VSUA 2JI1A 5D6CB 1LEGA 4Y2NA 3TBWA 4R84A 5E7FA 4PM1A 4D0DB 4FI6A 3C5ZC 3RGVC 5L7XL 4U3XA 3OSVA 4LHUG 1D9KB 2ZUUA 4F7PA 2UUDH 3RTQD 1H15B 4LOUC 2KT6A 4TVPH 4P4RA 1SFHA 1IJNA 3MAWA 4OCYL 4Y89A 3MJ9L 4KFZC 4NC1E 3FB8B 4MJIE 5IHBA 1TIUA 1FLTX 1OV8A 1YEGH 4AT6A 2P5WD 4KQ4L 5C2UB 2VR7A 3K4AA 1MHPL 3L4YA 3X1GA 1A4KB 4G2AA 4FP8H 4S2SA 5JZ7D 3RDTA 5DI8B 3IE9A 4NPYB 3HPLB 2FX8L 4DK3A 3KEHA 3E8VA 3QG6A 4YR6B 1U3HB 2FEDC 4M5TA 1O9WA 3WJJA 2NY2B 4NZFA 3VXPA 5F3HB 5C6TL 1E3FA 2PYEA 5C92A 4W6WB 2A1WH 3FBKA 4A2EA 3Q1SL 3PHQB 1PMYA 3TF7C 4K5MA 4X5RA 4ADGA 1CZ8L 1NFDF 4OZFG 3DWTA 3BAKA 3DIDA 1HI6B 2QHRH 3BP4A 4HUWB 1SBSH 3T1FB 4EBQL 5IVXA 1Z66A 2NXYD 4MAYD 3SDCB 4EDXA 1Q9WB 1T4KA 4I4WB 1AGFB 2MTAA 5KYNA 2VE6B 3RA7H 2KI6A 3M1CA 5AVSB 4Z3TA 2XG5B 3CHPA 1GPOH 3NIFE 3MRJB 3RGBA 4Z78A 2KQMA 4JRFA 2X4PA 5DJAA 1TQUA 3QEQE 5I1EH 3TYFA 1CR9H 2EAEA 3AS1A 2OMVB 3DDGA 1HTYA 1Z7JA 2EO9A 4DCQA 1A7QH 3ERXA 2VDLB 3H2WA 4TNWF 2BSBA 4XOAA 5CJQL 3L3KB 4HPOH 3D2UB 3VI4A 4LEXH 4G5AA 3RWDB 5IQMA 4BE6A 2B1AH 3F7PC 4NQDD 5FGSA 3FOLB 3MRQA 3DV4B 3IF1B 4LSSL 4J1UB 5J9PB 1P0SE 3W1ZA 3DUUB 1E67A 4G9FA 4JO4L 4MJJA 1JYWA 5D6DC 2F08A 2YMXL 1Q9KB 5FECA 4P9HL 5BVJB 4N2KA 4XZUB 4A1RA 4JDTH 3ABKB 2DKSA 5KVMC 2WLIB 3V0AC 5JTWA 4ZO6A 1EBPA 1Y1DA 1NGWA 3FKUS 2WZAA 1MI5D 3IXTA 5KN5B 3QORB 4GKNB 2YXFA 4O2FA 2WSPA 3ET9F 3JWNE 1G84A 1NCCH 3L5HA 1QUNA 5LXVA 4ODBD 1AHWA 4IK7A 1T5WB 3VFVB 2GTZA 4HZ1A 4PD4J 2N1TE 5I5RA 1T0NA 3B2DC 5DA4A 3VRIB 2C3WA 1A21A 3G08A 1NCWH 2HH0H 5DRNA 1QVOB 4NXSA 3V8OA 2FB4H 4WFED 5IMKB 1R3JB 5F7DB 4BM7A 4FRWA 4QPEA 4KVCH 4PREB 5C97A 1Q1JH 1KMGA 1QG3A 1GYCA 3IAPA 3IN2A 4L5FE 5AZEL 5T5NF 3BT2H 1RP9A 4OD1H 2UZXB 4JCLA 1DANT 2XT1B 3BN9D 3NAAL 3VMNA 3EF7A 1I7UA 4HSCX 3UEQA 3QR2A 3BVXA 3RTLA 4AL8C 2DS4A 1EJ6A 3L1OL 4PJIA 5AD0A 1OD7A 3QJHB 1NDMA 5EOCL 2GY5A 2EC9T 3ZKND 4JQXC 4JFFB 4O2CA 1JV2B 3HEIB 3LRSA 4C83A 2DL2A 4H0LC 2FK9A 1GYVA 3NJXA 4QRBA 5D1XC 4NJ9H 1MCNA 3L4WA 2CQVA 4DESA 2H0JA 1WTLA 4FQXA 3H8NA 3U2SB 3QC5X 3NPZB 3KXFD 1E6JH 5ISZE 1KBGL 2ZP0T 5J6SA 5JDSB 4JVWA 4MGXA 1AZZC 3S3SA 3VUAA 5MEND 2A99A 4YOKA 5E2TH 3QO1A 2ZXEB 4TVPE 3RKDD 4FNTA 3D33A 1W80A 2ZTBA 4I0CC 4AM0B 4QRSB 2WAQA 4PWHA 1LQBC 3BSZL 1EXHA 2CIKB 4YL4A 5I75B 2ZD0A 3ZDXF 5DHVA 1C12B 4HX1A 4OF0A 1Q4NX 5A2JH 5TPWL 2GT9B 2W5PA 2IAMA 5CM1A 5DT1H 5J89A 1QR1A 2OJEA 2VLRE 3VB8A 1PLGH 3P54A 5FM5M 1T66C 1RZJL 3UDWC 3O6LL 1LDPH 3UJJH 2CBTA 4P2CG 3ARFA 3TBCA 1JRHI 4POYA 4F9LC 4QMEA 4IRSA 3NQIA 1CLVA 4YSCA 4ZOEA 2FQFA 3EHBC 2BNUB 2GEEA 4HS6A 2X6BA 4HWZA 5E2WL 4Z1PA 4NN6B 2CKNA 5JR1H 1KC5L 1RZIA 3HZVB 3N41B 3GXPA 5FGBA 1A6ZA 1EJOH 3ARWA 4M93C 1PG7X 3HZKA 4JLRA 2VUKA 5F0PB 4S0SD 3HUJB 1RUPH 4UDUA 2ZJSL 2HVJB 1OAJA 3Q44A 5C0EB 1MF2H 4W9GC 2R4SL 1FN4B 4TSBH 1VFAA 3MR9A 3BAIA 3FUHA 3LPFA 3QQXA 1EEZB 5C0BB 4Y2DD 5AEAA 1RK1B 3KLHD 4I0KA 2MTPA 3E80A 5IMOB 4L4VD 2FEEL 2L8AA 2CU9A 4HCGA 4X6EB 1ZSHA 1RUKH 1BAWA 5FO9A 4RCAA 2J72A 2EDDA 2NUTB 4BFEA 2F54E 3WL9A 3IWUA 4ZW6A 4PJHF 1MCEA 3JTTA 4FJ6A 4MA8H 4OZHF 4PRPB 2Q5BA 1HU8A 4QHMA 4YK4B 5FDYA 4XWGL 2DAVA 3LAFA 2AXFA 4JB9H 5TDPB 3RWHA 4FNSA 4AITA 3VD4A 3OV6A 1JF5A 3PWPA 4YHLH 5BS0B 2ZUWA 3MSPA 1MJJB 5BO1H 3MRHA 3UZVB 4NSKA 4W4OC 2CIIA 3UTSA 2FLMA 2OCFD 4U1LB 5FYKE 2HRLA 3ZYOA 2QPEB 5IV2B 4PJ9D 4XMKH 3EOBA 3TCLA 4WK2B 1P5UA 3PGDA 1SBSL 2CLVA 5E5MA 4EBQH 4FFYL 2FNWA 2OCJA 2BC4B 4P23B 5EA0L 3IPEA 1HK6A 4GQ9L 3P4NA 4LIQE 4Z7WF 1R24B 4ANVA 2R7EB 4PJHB 5DDHA 1YJDC 4YXHH 3RL2A 4KKAC 4GMTH 3C60B 4PRNB 4UZGA 1DJIA 3MBEC 3UYRH 3DVGB 5MI0B 1C5CL 1W0WA 2VQ4A 2ZXGA 2MNJB 4FDWA 2G60H 3LRMA 4LL4A 3O6LH 5DJZA 3MV01 3PXJA 4CAGA 3SGDI 5AYQA 1XSOA 1AQ8A 1HZLA 4KGLA 2EDRA 5E03A 1DDTA 5IVNA 4NLAA 1I9EA 4P4KA 1RUML 3BWSA 1C16B 5FS5A 2HZHA 4K73A 2IMMA 4Z3GA 1KTJA 1SMDA 2VDLH 1QEWA 5AB9A 1S3KL 1XEDA 4ZUSA 1IM3A 2VDMB 3WFCH 3GPEA 2UWEB 1OQXA 3H42L 1DQTA 4P9MH 5EZPA 1U8MB 2NXZC 3UG3A 4K5OA 4YXLH 1U91B 4ZMWA 3DKHA 1BM7A 1Y1UA 2FQEA 2VXTH 2MOGA 2F7IA 3ESMA 4EZKA 1ND0A 5E08L 5JQ6L 1UWXK 1NUDA 3GB7A 4JN2B 1D9KA 1M56B 1A3LH 3EO1A 1WUNT 2JJVA 4PBVC 5I76B 1MJ7H 3BGFB 3HVDA 2EP6A 3RIAF 3MV9B 4AVKA 3LQAC 4AYGA 3A6BH 5BRPA 1B4JL 2Y7QA 3CDCA 2WY3B 3FB8A 5ALBL 3OKMB 3M1BA 2VKWA 4XP1L 1P1ZA 4L1DA 3RVVC 4GP5B 4RBPH 4ZFGH 1KB3A 4GQZA 4B96A 3HZYA 1SN0A 2QV2A 2ZOOA 4ALAL 4GUPB 4JG0L 1M05B 3X3GL 5FGCE 3BRFA 4IIQC 3KM2A 3QFJE 5T3ZH 4FHKA 4GRWH 3HPLA 3RGVB 5LLIC 1ZTXL 3CNKA 4XCNB 1MQ8A 4YR6A 4V2BA 1DL7L 4AEEA 4KXBA 5F1IA 3CV5A 4G8FA 4KRPB 3T2QA 3PHAA 1KACB 3O6FD 4L1HA 2Y9RT 3BKYH 3G5ZB 3GUFA 3FTGB 2XRAH 1QBLL 4PJFB 3H9SD 2HJKB 4IMKA 4RZCA 2XX1A 2BVUA 3OLIA 4XC1L 1TNMA 4HZLB 1CUOA 4JM2F 4ZBJA 2EDNA 2HWZH 1N6QL 1GOFA 2P26A 5DO2C 3ZE1E 3NN8A 2AEPH 3HLAB 4ZI8A 2Z93B 2PWGA 2MCG1 3ZTNH 3IFOB 2X4PB 4O02A 5DJAB 2YC1B 4LLMB 1WJ3A 5L7XH 2Y7LA 1W0YT 3DXAD 3OF6D 2WVVA 4DGVL 4EI6A 5DQ9A 4RMTA 3D3VB 4YO0B 1VRSA 3K91A 2D3VA 2O61A 3TT1H 2PP9A 4N2IA 4XO5A 1P4BH 2ZUQC 2OR7A 3DO4A 1J8RA 3VG0H 1K5NB 4MS8D 4JHZA 3L5WB 2JQMA 3BIAX 4LDEB 5I1CL 1QHQA 3L3DA 4HH9B 1G9NL 4N3UA 4S1SL 3KYMB 1JNJA 4IHOB 2F6AA 5DMGD 3MYJB 1NANI 3OQ3B 4U3HA 2H3KA 4JAMB 1WBZB 4XZUA 5AW6B 4DW2L 1ZHBA 3MRPB 2BSRB 4PJ9A 1QPXA 3MA7B 4CBPA 3RGHA 1S7SA 2NZ9D 4W68A 2DTML 2XWJB 2YD3A 1BVKB 2JSFA 3CSFA 3K1KC 1QBLH 1PD1A 2NY6D 5IW6B 5DJ0B 5JHDD 3L6FB 4K7PY 3S37X 3VRIA 5GRJL 2WIMA 3M07A 4PJCA 3CFKB 1E4WH 3TVMC 4XWOC 2PCFB 1NLBH 4JO3H 4CVUA 1U8QA 2K1MA 3QHFL 3P2BA 4MJ6B 3QZWB 5H4YA 4UB0H 1P9MC 3F7VA 4OD2A 5HGDA 3MREA 1HOCB 1MH5B 2IOMA 1CFVL 3FFOA 3DX8A 2APVA 4HUKB 2IPUK 4ONHA 2BJMH 3QAQA 1GGIH 5EN3A 1DQDL 1V7MH 4LLVA 5AKRA 4QD2E 1EDHA 5HVWA 2EDQA 5LGHH 4J3OD 2G9KA 4RQQB 4KZEH 5FLVA 3GZPA 4H88L 1UCBL 2QR0A 2APTA 3AJ7A 1EUUA 4PJIB 1T2QL 1Y0LB 1MHHA 1ZE3C 2IPTL 5EUKA 4WFGD 4GW1B 3LKRB 3H9SE 1I4FB 2J6EH 1CLOH 3CHQA 2IBZY 3STZB 5FFOA 1CL7H 1B9ZA 2IWKA 3SCMB 1CQKA 2EECA 3RX9A 2AJ3B 5JHLL 1AZCA 5IQLA 4YIQB 5GRUL 1DQQA 2GHWB 4K71C 3VFGL 3QFJD 4UIMB 1L7IL 1YEJL 2WP3T 5DRZB 3VRLF 2HFGL 4YDLB 1BLIA 4HWEH 1KXTB 1OP5K 4NX0A 3BH9A 3ZUNC 4R7NA 1A6AA 1G0DA 5DUPH 2YO3A 2DQJL 2VZ1A 1HNGA 4L5FH 4XR8C 2DLEA 4TV3A 2VDNL 3CK0L 5IREA 4JGNA 2VXQA 5EN2B 2KZBA 2QHLA 1ZVSB 1A4BA 2DYPB 5E8OB 2ZOLA 3TYGL 2X2UA 2ORBL 3NZSA 2Z65C 3QWOA 1BVOA 3D34A 3VGAC 3IMRA 3QEHB 4B6ZA 2CXGA 1GYAA 4OD1L 3MUUA 4H1LG 1FIEA 3MFFB 2H6UA 3KL5A 2XXGA 2AANA 2DI9A 3D05A 4JY4A 4KTDL 4NB7A 5G5DA 2DEXX 3N3EA 5JW5B 5EZJA 3LIZL 4P5TC 1QFHA 3RWFA 3ZKMD 1VESA 2L7UA 3MJ7B 3UC2A 4EI5B 3OR6B 4GPVA 1HILB 4J28A 3MUGB 1JERA 5I8EB 1AO7D 1S3KH 2YRPA 1ZJBA 5A16B 1I7TB 1TETL 3CFNA 3DOSA 1VCAA 4PSRA 3BZEB 1E9QA 4TLKA 2VTFA 3DV6B 2J44A 2IQ9H 5CLTA 1G7QB 1L3NA 4K3EH 3V7AE 3VX1A 1EFXA 4HIIB 3VD1A 3VH8A 3ZHFA 1UB6A 3V6OC 25C8H 1BIIB 1SDDB 4K8RC 1MDAA 4CA4A 4JKWA 5C09E 4QJ5B 2AQRA 2BVQA 3KBHE 3QHZL 5H35B 2K8MA 4MNGE 3WUZA 2DKMA 4MDRA 5CU9A 3EJPA 1TJIL 4YUEL 1QBMH 4PCSA 4QOKB 4AGMA 4ZMVA 4WJKB 1L0XA 3EXJA 2QQKL 3PXLA 4QXTA 3VFMA 1IIIA 1W6LA 2HSIA 4MCZA 1QLEH 4ANKA 4N0RA 5CO1A 2ZKXA 3JWDL 3AG4B 3K71B 4X8CA 3VQ1C 1G6RA 5JQHC 4ZXBA 2E59A 4JPWL 2X38A 5F7YC 4JHAL 3RWGA 4PJBF 5MI0C 3GBLA 4JPQA 1IT9H 3IB4A 3IT8D 2EC8A 2BX5A 3CD4A 3PYCA 1ZLSL 3VE0A 4MZ3A 4D8OA 2VABB 1GYWA 4Z8FH 4JFEE 3CDYA 1NIBA 2EH7L 3ML9A 2WXHA 1I1RA 4ZNEA 1WG3A 4CC4C 2V33A 3WJJC 4G8GA 1BYNA 4YX2H 5FHAH 4OKVB 4Z3IA 5KW9L 4FE9A 1H5BA 4NP9A 1XAKA 2CDGA 4Y5XA 1XF3A 4P3WA 3C12A 4FLRA 5L4JA 1S5HB 4L1LA 5AB0A 4KKLD 4UIKH 4Q4IA 3V0HA 3RX8A 2X4OA 1SY6A 2TAAA 4MXVF 5C0CE 4TTDC 2V2TB 2DQFB 1JN6A 2OQJB 2DQUL 1QSFA 1UD8A 1CPUA 1UJ3B 3H0TB 2W81C 1SXBA 4QO1B 1A0QL 2NXZB 3ZKSD 3PWJB 4H20L 3VFNA 4LDOB 1L9RA 3TM6A 3C60A 4DP4X 2TSAA 4GFXA 1KLFB 3QJUB 4NO0B 1IBBA 1AI1L 4H4NA 5GSVA 5E9DE 3THMH 3GS0A 3DXAB 2EE3A 3WTVA 3S35H 3LZNA 1IKNC 2W07A 2HMID 2RCSH 2WQXA 2OA9A 4R5VA 4AM0Q 4KY1L 3RG1C 1SN5A 1MWAH 2YGVA 2EIDA 3VDAA 1BQUA 3UDWA 2A74B 3LPWA 1PG7L 4ZO7A 2E7LA 3UC0L 1ZSDB 4W9JC 1C16A 2J8HA 1NANH 1SNRA 2KLTA 3D08A 4TPRL 5GIRB 5IHLB 2KS0A 3LB6C 4UU9A 3G6JB 3VGBA 3HC0A 4XBEH 5B8CB 1GOGA 5SV4A 1QATA 1DBMH 4YHLL 1HYRC 2VR3A 1J0HA 4H8WC 2OYPA 3ZMNA 2CKBL 3AITA 3QNXB 3QZOA 2FVNA 3HJ0A 3QULA 4L0ZA 1FYTA 1UXMA 3L4ZA 1PW3A 2FLBT 1KXVC 4TUJA 3V5DB 5D6CA 1RZ8A 1OO2A 1MREH 4PJGA 1WITA 4XN1A 5B7FA 1N3NB 3LNHA 4OGAD 3HE7B 5F6HI 3FRUB 4OF3A 4BHUI 4HOWA 3EFFB 1N4XL 3S37H 2BCKB 3C6LC 4TLUA 1E8ZA 2J43A 3NEEA 1K4CB 4KMLB 4HXAL 3R4RA 2FAUA 2NLJB 2H1XA 5FV2A 4H20H 1ET7A 5HDQL 2EUVA 2O30A 3T6VA 4PJEE 4KKAD 5BRZB 4R2GB 4XMPH 5ID0B 4A39A 1TSHA 3P77A 1TPXC 4WWID 2PUQT 4PVLA 1RULL 5IEHA 2LR4A 1A4KA 1A6VH 3GSQA 5EIIA 3N2JA 4JM2A 4F9PA 5IHHA 1BYOA 1SHSA 5GGVH 1DDHB 1J05A 4CMHC 3SKJL 1TG8A 2JV6A 1KN2L 4EXKA 3SDXB 2YPVH 2DI7A 1NSNL 2Z7UA 3X1FA 5CD3A 5C07E 5TFSL 1DVZA 3IU4H 1FCCA 2IDCA 5C3IA 1LWHA 1XEUA 5DK0B 5D1XA 5HHQB 4HETA 3FU9A 4JKMA 3QT2A 5ERWA 5FOJA 2V5SA 4NNPH 4G6FD 3O8XB 3QWRA 4HGMA 4I4WA 4IU2A 3GTNA 1AR1B 4P9ML 2ZX7A 5CLXA 3I50L 4LOFA 5E6IA 3TV3L 3QXWA 5CGYD 1JUFA 2F53D 4IDLA 4WW1A 4FFTA 4Q9BA 2XG5A 4XPGH 1V3JA 3N1PC 1COBA 5T1DH 1AC6A 5IHZA 2J20A 4MRCA 2NZ9C 4IK6A 5DQ9B 1HEHC 2XKNB 5IFHL 3ULUD 2C4FU 4QRTA 3RI5F 5TDNA 1H15A 4DCQB 1OAKH 3AM8A 2AHIA 5AVQB 4AYEC 4F1ZA 4WEMB 4S0TD 1A6TB 3KVDD 1BQKA 1KPVA 1FQ9C 4TQHA 3NZHH 1S6NA 3US1A 3IN0A 1NBZA 4HH9A 2VDPH 4LRIC 4XBEL 2AP2A 4Z7UA 2Y2WA 4RAUB 1RURH 4J4PD 2D7TH 1DVYA 3SB3A 4NPYA 5A1AA 2FUQA 3IGFA 4DN4L 4AKOA 1JGDB 3CN3A 1TVBB 1W72A 3TEYA 5FW8A 3O2VL 3QH3A 4X0KA 3II2A 4RGOL 1MJUH 3ILDA 5JUEL 3ULVD 1Y18B 3EFDH 2X9WA 1OAYL 3H7LA 3MCYA 4HG4J 1T5WA 4N2HA 4P46A 3VFVA 1HI6A 3CFKA 2HWZL 1YPZF 3LN5A 3T1FA 2FWOA 4GQPH 3GMLA 1AXSB 3FFDA 1U8QB 1W0VA 1JWSB 2ZCKH 5TH2B 3SKNA 3UO8B 2ADIB 2PCXA 2VGLM 5IB3A 3T2LA 1QRNE 1YNKL 4HGKC 2BDNL 5LNDA 4L8CB 1ACYH 3N0AA 1BV8A 3MLUL 3UGEA 3SDAC 2Q3AA 5LN4A 2P80A 4QWWD 5JMRA 1MAKA 5B7EA 32C2B 4LEXL 3TH2T 3UPAA 3QEGH 4JPWH 3F01A 2G5RA 2KDGA 1I7UB 4PJFF 3MNVB 1KTRL 4LASL 5EC2A 1IV8A 3DO7A 5I1CH 1EMTH 1O5PA 4LCYB 4XP6H 3QDHA 3DV4A 1DQKA 1FYHB 3UTSE 4L2LA 4G6JL 1AQHA 5I8CA 2QFRA 1K3ZA 5DO2D 2IWGA 3K6NA 1JHTA 2W9EL 4TVUA 3SCMA 1NOFA 3B3BA 3S98A 3V79C 1G7JA 1FPTL 1D7DA 1Z9SB 4NNPL 2OK0H 2G75A 3RVUD 2ED8A 3MODL 4YXKL 2EEBA 5CBEB 2HJLA 1JWUB 2DQ6A 1X9UA 3KPRB 5L6YH 4MQSB 5LAXA 1QRND 4YK4C 5A3IC 1OCWH 3L4XA 2V17L 3NIDF 3UJTL 4TNFA 4F2FA 1BZDA 3BH9B 4O2FB 4QJ4B 2IAND 1RUAL 3ETTA 2E7HA 1PSKH 5GHWH 2HPTA 5KS9F 4O02H 1JXFA 1SJHB 1B88A 4DEPC 3ARPA 3SJVA 1HSBA 3P02A 1T0NB 3QISA 4GS7B 2DI8A 4IDJL 4WY7L 3EYUL 3QFJA 1J5OH 1BFVH 4DQOL 4NCDA 5HVHB 1DQLH 3NTCH 4J4PA 3M8OL 5DHVB 1UD5A 2IV9A 3SD5A 3ETSA 4FQ2L 1VZHA 1X5YA 2WB7A 4OJAA 4R0LA 1TR7A 4XN4A 1PL3A 4Y4KB 4JJ5A 2V3DA 2GT9A 2O6EA 1U4FA 2A9CA 4FQCL 4PJXA 1GRWA 3FB6B 5AW9B 3U9PH 2VQ1B 2K9FB 4PJ7B 4ZMPA 3D4GA 5I6KA 3HC2A 4X4KA 4ZOBA 2CLZA 4F27A 1GHFL 3WO4C 3RWIA 2W0FB 1O9ZA 3NCCB 2V7HB 3IJSA 3T4YA 5J1TC 1O7DE 5I8EA 2CGRH 3VG9B 5F71A 1O6SA 1FLRH 4XB3A 1FZKA 3EGSB 1D5IL 4X6CE 4Z6AT 2ZWSA 2FBRA 3C9NB 3GEFA 5HYQA 2AS5M 4MA3A 3JYBA 5KUKA 4XB8A 4P04A 1URLA 1I8LC 1IAMA 5DZOA 5G55A 1IGFL 1FDLH 1TYRA 4IKJA 1GCYA 3RX7A 3A6CL 1CURA 1KLGB 3POCA 2OMUA 4E41A 5T1KA 2QMJA 4FQXB 3VWKA 1KXQA 1QO3B 2VCOA 2AVGA 2CXKA 2FD6H 4L8DB 2LU4A 1DJXA 3S5LG 3ZZQA 2VDOL 3AXHA 4L5FL 3CDZB 3PFUA 2YEZA 4AYID 1LQSR 1E3XA 2JTDA 1SJXA 1NC2A 4J3OC 4RGND 4PWEA 2VXUL 1PBYA 5IMOA 5AAPA 5J6GB 4EIZC 4XODA 1G94A 3IKCB 5E4IA 5K9QI 3QRBA 3KYOA 1KJMA 1RERA 1ZVHA 2E9GA 3BUPA 4LASH 4F58L 4OD3L 3PDOB 4PJDE 3SOBH 2IH1A 4F2MB 2J5LC 2IQAB 2CK2A 4R3SB 3DRTA 3RWGB 2J1ZA 3Q01A 4PJ8D 1FZJB 4B9GA 1JP5A 4ZUWA 3PGFH 1N12A 1FAIL 1BQSA 4UDTB 3ZKXC 4X42A 4XO4A 2NY7H 4X9FA 5DVPA 2XIDA 2OXHB 5CEZD 2OJZH 2CO6B 4JFZH 2HVBA 4GUCA 2YQ3A 1ZGLM 2X4UB 4OZHB 1HQRB 1TQTA 4PGJA 1GHFH 1PZ5B 4JGHA 3BESR 4U0RC 2PETA 2FBOJ 5D7SL 3T0EC 5IV2A 3TH3T 4KK8C 1P5UB 3MRMB 1H3WM 1OE1A 3HE7D 1GJWA 4WKZA 5EF2A 3ARTA 4I85A 5J6HA 4NP4H 4LCWE 2K4AA 3IDJA 2A1WL 5HHOA 3BPCB 3P4NB 4JZJC 3QUML 3H0TA 4FYQA 3UAEA 3VTAA 1UFUA 3TPUA 2IOIA 1A3RL 3HUJA 3MLRH 3NJNA 2ZUTA 4GW5A 4FXGA 3VFOB 2A4CA 2P1YA 1YEHH 1OZUA 2J88L 1NDTA 2G2RB 2FWLB 4PGEB 1KG0A 1U8HB 2Z7YA 1QBML 2XVKA 5HYSA 5ITBL 1SLWA 1BFOA 3BKCL 4BZYA 1SOSA 3VM7A 3LY6A 4OFIA 3HG4A 5ESQB 3PWLA 2WQUA 3GK8H 3O3BB 4UINH 4G7QB 4XAKE 4HG4K 2Y06L 1S78D 1UXSA 1BFTA 4HJSA 5HGHA 5B38B 1UTDA 5K9KA 1XZ0B 2G3XA 4EEEA 1EEYB 3PE9A 3CFCL 5CGYC 1CICC 3O9WC 5B8CA 4XNAA 5BVPL 3KGSA 1QR4A 5IKCB 2OSXA 1F6AB 2JJWA 3NCXA 4R26L 43CAB 2ZUQB 1FDLL 1P4BL 2H2SC 2O6FA 2FRGP 2R0ZH 5I6OA 4NQSA 1SQMA 3CPLB 1A9BA 3V4VH 2XBZA 2ZWYA 2FD6L 4PPTA 4WO4C 2CZNA 4TOYL 2UXVA 2F15A 4KK8D 2EQDA 3WBDA 4JGUA 3CU7A 4YDVA 2W9DL 3LMJL 3MCKB 4Y1SA 5INDB 1UQSA 1LNUB 3G04A 3P4MA 2P42B 3LXUX 5FF6B 1MI5A 4KRPD 3VFSA 3AG3B 4ELDA 4F58H 4GRMA 3V7AG 3CIAA 1FG9C 4WI9A 4M48L 4DP6X 1DN2A 2AQTA 3HS0A 3BW9B 3RY6A 1P1ZB 3X3FH 3LD8C 1J1OH 2EO7A 2LAGB 2W1NA 1I7ZB 2R69A 2VDRB 5E8PA 2X1QA 3NFSL 4B3VA 4AQ8C 1M05A 2DM2A 5FCUH 3BP7B 1FC2D 4FZ8H 3ZMRA 1KWGA 2K7PA 1KB5H 5HYIA 2EIKB 3DIFB 5CLWA 1UZ8A 3OHXC 5K5YA 4MMZC 2OSLA 3JT0A 3DMMA 3RWCB 3WXWH 1OGAD 1CU4L 5ISZA 1N5AA 2PXYC 1U3YA 5K1VA 4BA8A 4Y19B 2XU9A 1IAKB 1OK0A 2X6VA 4XXWC 3AUWB 3Q8BA 5B39A 5JHLH 4FI8A 4X98A 5L8KB 4HK0A 3U6XS 5EBLA 5E2TL 2EE9A 4G72B 3HLAA 1CYGA 3J07A 3KYNB 4WV1C 3CC5B 4RRPA 2HLEB 1QSEB 1WISA 2Z93A 4M1DH 5GJSL 1KEGH 1UOWA 1WHPA 3DSFL 4LCUA 4J3VA 2YKLL 1YCSA 1UWFA 3E9TA 5AVTB 2XPGB 2XWTB 3CX2A 3ZE0B 4DQOH 2ADYA 1UA6H 4X6CB 3L2MA 5JW4M 4WHCA 4J3UA 3WEXA 1EERB 3A67H 3GMQA 2D9CA 4HMEA 2J1XA 4PJ8A 2EDLA 1SM3H 2H7WA 1K5NA 1BLNB 2VH5H 3V55A 1B0WA 2K3TA 2NPLX 1PEWA 5GISL 1FNAA 5KBMA 1RH8A 1EEQA 3HG0A 4PTUA 5DK3A 3STLA 4KUZL 3TS8A 4UQ3A 5FYJE 4DOHE 5JW3H 3EG9B 4OZFA 1BIHA 3HAEB 1FYTD 3EJQA 2IBZX 3T3PB 2B0SL 5FA4A 4Y4FD 5DTFA 3TURA 2RJMA 3KBPA 5DD3L 3EYFA 2JELL 2VAAA 4B9KC 4AOFA 2W0KA 5IFJA 3O3DA 1SHXA 4N1HB 4NZDA 1A1NA 1CGWA 3OJVC 1MEXH 4AG4H 3KM1A 2CKBB 3VXNA 2E5EA 4M6NH 1GSMA 2YBRA 3TBSB 2H6OA 2PCFA 2IALB 3S88L 1JWSA