4B9KC

Pvhl-elob-eloc complex_(2s,4r)-1-(3-amino-2-methylbenzoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide bound
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
141
structure length
137
Chain Sequence
VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small-Molecule Inhibitors of the Interaction between the E3 Ligase Vhl and Hif1 Alpha
pubmed doi rcsb
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
molecule tags Ligase
source organism Homo sapiens
total genus 32
structure length 137
sequence length 141
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4b9kC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4b9kC01
4W9HC 4W9LC 4W9IC 3ZTDC 4BKTC 4W9KC 1VCBC 4W9CC 4W9DC 4BKSC 1LQBC 3ZRFC 4W9EC 4B95C 4WQOA 1LM8V 3ZRCC 4W9JC 5LLIC 3ZUNC 3ZTCC 4W9FC 4W9GC 4AWJC 4AJYV 4B9KC
chains in the Genus database with same CATH superfamily
3LNIA 1PZCA 4IBQA 4K71C 3ZKNC 3UL4A 5F7WC 3BSHA 3FUFA 3ZL4H 1I1AC 1FZOB 3ARXA 2IANE 2LOEA 3QAZC 4NRYA 3U79A 2EDQA 5IM7A 3QUML 1AIFA 2DKUA 1HHJB 3LDBB 4S1RL 5DJ8B 4IRSC 1RJLA 1PAZA 2BC4A 4NQXB 3ROLA 2NY1B 3MRMA 2QKIC 3VI3A 2EDXA 3LKNA 4JHAH 1VESA 3MJ9H 3KWTA 2OSXA 3QH3A 4F7MA 1OF2B 5B39B 1VACA 3D18B 2LW3A 1H3PH 2ICEB 1N5AA 2ZWYA 3E2HC 4JRXD 1E42A 2DLFH 4XODA 4XPHH 2I5YH 3VXMA 1EFXB 5LXVA 2R29A 3PHOB 4URTB 2W88A 1D2PA 4TQPA 1DL7L 1HSAB 5GZNC 3NZHH 1ZSDB 3T65A 2XYCA 2V7NA 4MA1C 5C8JB 3HMXH 2ZAIA 4QJ3B 3VXMD 4KZEH 1N2RB 1I7UB 1FE8L 4B95C 3GRWA 3QJVB 2VDLB 5JR1L 1XF1A 5DJ6B 4OCWL 5JA8B 2G9HA 4Y1TA 1G0XA 2IOMA 3SKOB 5F1KC 4ZW3A 4DVBA 1ZK5A 4LCIL 2JJTA 1CFTA 4FQQA 2VLRB 2GSGA 1PFOA 1UJ3C 2NY6C 4YE4H 4OTXL 1NJ9B 1QW8A 3FRUB 1MWAA 1PQZB 2XFXA 2ZCKH 3FT0A 1MQ8A 2EXYC 2JCCA 2TRHA 4BZYA 2B1AH 2X4TB 5F7EH 1QHOA 2J20A 1GW0A 2CJUL 4NUPA 3VU2A 3QYMA 3PDGA 1BGXL 2DM2A 3IFLH 3WXVH 5EUKA 5J12B 1OIOA 3LQZA 2ATAA 1J86A 2PN5A 1AHKA 1H19A 1T22A 4W4NA 2BIOA 3TJHC 1EVUA 1Z2KA 2NY2C 4Y5YB 2CLRB 3RX8A 4YWGH 5ACMA 1K85A 1SJHB 2EUVA 3V0EA 3LJ3A 5GHWL 5EEUA 1TVBB 3KYMA 4K7PH 5AG9A 4F24A 5GGVH 4CKQA 2NY5H 3SPCA 3N41F 3MV7B 2ZKYA 3BEVA 3PPSA 4M6MH 5AZ2L 2DQGH 2ERJB 1PSKH 1GSKA 1OP9A 2QVKA 3GI9L 1W0WB 1AMYA 3AB0C 3DUUB 5IW1A 2P52A 1SPDA 4WNQA 1KIQB 3MCKB 1Y1DA 4LCYB 4WFEE 2CK0L 3EFDH 1QVOB 5HYFA 1I7ZB 3AY2A 2NZ9C 3ROOA 1OQXA 4C47A 3OKMA 4YUEH 4OH2A 3ARQA 3WLWD 1F2XK 3AMKA 2EDWA 4JZJC 4LSTL 4YXLL 4A67A 5T1LB 5IMOA 3WXWH 1KCLA 2VXVH 1LE9B 1QSVA 2XZAH 2EADA 4JVUA 1QZNA 3VRIA 2FSDA 4XVTL 4W1TA 1GOHA 4ZMYA 4APQD 2CKBA 1G7MA 5I16B 3ULUH 3GGWA 4Z76B 2IG2H 5EEZA 3UPRB 3WNPA 4NC0B 3BWAA 3LNHA 1SEQH 5EOTB 4K9EL 1J0YA 4P05A 4PWIA 4XH2A 2VNCA 4ZYKA 3HFMH 3WSQH 2J8UA 3L2MA 3ETBJ 3QJFB 4KOCA 5AVQB 3V5DB 3K5SA 4E9LA 2FYYA 1MIMH 2KPNA 2VXSH 2X6BA 4ZX5A 2NUTB 5DUPL 4YHIA 3T71A 3VFMA 1WAEA 1MFDH 2LTQB 4AYEC 3S37L 3BCFA 3CU1A 1Q9KB 2FWLB 3QO0A 2DLHA 3TESA 2YWYA 1B4LA 3OAUH 4W70A 4KKNA 3RVXD 4OQTL 2CAKA 4NI6A 1MI5A 1C5BL 5K9JL 2BSRB 2VJ8A 3MRCB 2MHAB 1NKGA 5CJXA 2XQBH 4U1IB 2VTFA 2HVJA 1MQKH 3TF4A 3QIUC 4NKQB 4ZXBC 1ZEAH 1HKLL 5AAMA 3ZQWA 1GTNA 4XCYA 2KDYA 5L7XH 4LDOB 5GRUL 4WSJA 3VRJB 4TF4A 3MLSL 1GSMA 1S5IH 3VAEA 4OV5A 4KC3B 2ZCHH 5GRJH 4FA6A 4I48A 3V6FB 4WI8A 4OLXL 2Z7YA 5KJRH 1IM9A 4L4VB 4I4WB 5TE4H 4BQCA 3ZYIA 3FQ1A 1JAEA 1E4XH 1P5UC 4ZSOB 4GUOA 4ODWB 4XP9H 3TN0D 5F3BA 5JUEH 4IK6A 2GC7C 4FXKC 3VGBA 3MRIB 4OCNC 3P02A 1EXHA 4DK5A 1Q9WA 4ONHA 1NBZB 4JCMA 2EXTA 5GGQH 4KFZC 5JHLA 4FJ6A 4WAFA 1BAFH 4KRMB 1BOGB 1T5KA 1CGWA 4QLWA 5IB1A 1TQBC 2Z91A 3L4ZA 3U9PH 4WK2B 2OJEA 1AXSB 3MLRL 3QFJB 1NBQA 2G3XA 4TTDD 1BP3B 2B2XL 5EZOH 3T2NH 1BFVH 2VIRB 1LK3H 3EDDA 4XNUH 5IHZB 1YSOA 4D0DA 2RH0A 2G5UA 2QSTA 2DJSA 3P4LA 5GJTH 2K3TA 5KTEH 3LZPA 3H85A 1BVKA 1FL6B 3B34A 5J6HB 2GK0B 4L2YA 3QUXC 4PM1A 4FJYA 2VERN 3DX9B 3IMUA 2XWBB 2HVBA 3WFEH 5C92A 1OSZB 3DBXA 3EOTH 3ULVC 3MV8E 1WCBB 3UIYA 3LQAC 3CCHB 3WFHA 1RZ7H 1QSED 2RR3A 5D9SB 4UNIA 2RACA 1TCMA 3IK2A 3PV6A 3BFQG 1OF0A 4K3JH 4LNRB 3ZDXB 1M7UA 4TSCL 1BEYL 3MUY1 4JM4L 1U2CA 3VDCA 1NC2A 5B38B 5EO9B 2OK0L 4G8IB 1CYGA 4P9HL 2Y25A 4JZNA 2L7QA 1GZHA 2H8PA 3F6LA 4QR7A 5KYYA 1EJ8A 1KEGL 3JSSA 2MCG1 4RSVA 4PRHE 4FQXB 4RMUA 3ZHFA 4NAQA 4I9WD 1NCTA 4Z5RB 3JWDL 4HMCA 5CSGA 4EOWH 4RMSA 3VFUA 4EI6B 1S3KH 4YXKH 4UQ2B 3EO9H 5IHBA 2A77L 2G0KA 4NQEA 2APVA 4FJZA 2F53A 2H2PD 4BZ2L 4JFDE 4N5ED 3TBTB 2DI7A 4RAUA 5J1AA 1HH9A 2NQCA 4OCYL 1F4XL 2MQ0A 4LEBA 2W5PA 3RE0A 3CHXA 5CSZB 3II2A 4NQED 3ZHNA 4IDJL 1I3GH 4YVUA 2FJGA 3ARYA 3FN0H 1FRGH 2H4EA 4YGVB 1EBAA 1CFVH 2F5BL 2PXYD 4HPHA 5K59E 1M3JA 2OMUA 4P2OB 5K9QI 1J5CA 5DC9B 2A74C 1CI3M 3VGFA 1EEYA 1QKZH 2GAZB 3MCYA 2AJZA 5ERWB 5FOBB 5FHBL 5C0RH 4AYID 5JPNC 2GTWB 3NJJA 3WFCL 2WN2A 4RGNC 4UT6L 2FWOA 5FUCC 3QUMA 4X4XA 1BFOB 1BBJB 4ZTEA 1W6WA 5C08B 4WU7B 2EH8H 2IPTH 5F9JA 2VQ1A 4B41A 1H3VA 1KYUA 1Y18A 5HBBA 4JO3H 4E2OA 4GQRA 1VFUA 2XFGB 4Y9CA 3ZUCA 4CVXB 1TYJA 3GS4A 3RIAK 5IHUL 2VH5H 3GXPA 3FTVA 3NABL 1W0VB 2X1QA 1MEXH 2Z92B 4PJ7B 15C8H 1QA9A 3GRBA 4FZEL 1KXQA 3WEAA 5GGTH 1MY7A 5GZOD 3PL6C 1C7TA 3CFBB 1YUHB 5DZAA 1KT2A 1XL6A 1KJMB 3NA9H 2JI1A 4NT6A 3S36H 4DKFH 3QORC 1ITBB 4R7XA 3DYPA 4DP8X 1IEAA 4AMXA 3VXPA 4QHLB 1Z1WA 4DVRL 1FIGL 2CXGA 1WIUA 3BAIA 4MAUL 3T3ME 2WQXA 1WS7A 2D7TH 1D6VH 2GVYA 3T1FA 4PY7B 4ESKA 1V7NH 1WO2A 1ILUA 4JFQA 2ADFH 2WXOA 2R8SL 5E6IA 1F1AA 1KCRH 2DY2A 2E9GA 2I69A 3TIEB 2I5YL 3P4NB 4LASH 4K7FA 2PPEA 3MCLH 1QNIA 1Q94A 3HA0A 4G71B 3L3GA 1KENH 1K4DB 3WL9B 2FWSA 2VXQL 3M8OL 4M7LT 4OIBA 2NOYA 5E6ID 3FKUS 3PNWA 1DZ0A 3MX0B 4PPTA 4AG4H 3VFVB 4DZBB 4AQ1A 1JZGA 3RWEB 3TWYA 2VW7A 5FFOA 2XG4B 3Q01A 2LFEA 5IQ7H 1ZLUK 5A2FA 3COOA 4GLRH 1S5HB 4JBSA 5C0FB 2HH0L 1CICB 1RMFL 3KWWA 5C1MB 1A7OH 2DI9A 1OXYA 1WVZA 3BIBX 5FYJE 1NC4D 2IH8A 5LGKA 1K3IA 2WZAA 3D34A 1YG9A 1CLOL 3KPOA 4HIEB 3X11B 1NFDE 3LEVH 3Q1SH 5J6GA 2WBJD 4XO9A 5E2UL 4H0LC 4B3EA 3V4PB 4UV7L 2MNJB 3O9WC 3QNXB 2DYPD 7TAAA 1DUZB 2WQRA 2L7EA 1C12A 4UNTA 4LL4A 2ZWNA 3RHWK 3WXVL 4M5ZL 1BAGA 1QQDA 3K6FA 4N1EA 4YSPA 3GZPA 1RIUH 4F5CE 4L3AA 4YWGL 5GGRA 4KMTH 4XNZC 3HUJE 4WWPA 1E4JA 5FDYA 3KBHE 5SWSB 2MCPL 2VXUH 2BZ7A 5GGVL 4IBSA 4KV5E 5KVFL 2BS9A 3ARBA 4GRLA 4KNQA 2Q7AA 4KO6A 4M6ML 4MB1A 3O45A 5I18L 2PPCA 4DN4L 3X13A 2DQGL 1RJZB 1B0GB 1U95B 1S46A 5F89B 2VLKA 1NCBL 4MJID 4R4BB 2UWEE 3GM0A 4QF1A 1CDHA 1AO7D 3Q06A 1B0IA 2A6KB 4GRLD 4KK8D 1XAKA 4F15C 2PABA 1YEGH 2X1WL 3QYCA 1TPXC 4YDMA 4AT6B 4ZS6D 3D33A 2WLIA 2VLKD 4PR5A 4ILDA 3CVHB 4I2XE 5DVKA 4O5LL 5EWIH 4R90L 3UADA 3VO0A 4A2HA 3Q8EA 1QABA 4LCUA 1EJOH 1H6TA 4IJTA 4QO1B 2B15A 1OVZA 5E94A 5TF0A 1ZT4A 4HOZA 1QPKA 4UAHA 5FA4B 3KM2A 2H1PH 4H26A 4QXUL 2BIMA 2P9RA 2OMYB 2GITB 3ML9A 5SX5K 4GI8A 1AR1D 4OQTA 5F9WB 3RWDB 3ILEA 1R3HB 3KHQA 3K6OA 3ULUL 3C6LB 3KDPB 2BSSA 2IG2L 2O6FA 4HJIA 1KJVB 1T2XA 2ESVB 4G6FB 2CD0A 2RTTA 4WTXA 5D6DA 4MXWH 2YC1A 1D3CA 3HRZA 4GKNA 4X6BA 5FF6A 4POZD 3IDNB 3LIZH 3I02B 5DHXB 3HFML 2ADIB 1N64L 5CGYD 4P06A 3GPSA 1WAPA 1KTDA 2HG0A 4G8GA 4AL8C 3U1SH 4ORGA 1NLDH 1YEHL 2X7LA 1IJ9A 1B2YA 1NUNB 4HJJL 2VR5A 4AYGA 5HHVH 1MFDL 3KYNB 4IOFD 4XMKH 2WINA 3EKCA 4OLWH 4OCRH 1ZT7A 5DGRA 4PGCB 4B9FA 4DGIH 2E0PA 3LS5L 3T2QA 1EEQA 3AS2A 3GHEH 4OV6F 5I1EH 2F54E 5LG6A 3VFTB 3IFPB 5DZJA 2QV4A 2HPTA 3VGAB 4HS3B 2R1WB 1FVCB 4Q9RH 2XQBL 1EMTH 1UWGH 3LZOA 5ID0B 3ET9F 3NP4A 4I0PD 5B39G 1QRNE 2NX5E 4EI0A 4OZFA 1TMQA 3BAXA 3DYMA 2VC2H 2CMRL 4X5QA 1AS7A 1QLFB 4KRPB 3MA7A 4G9DA 4U1HA 4XO8A 5ESVA 5L7XL 4FZ8L 4OFYD 2GEQA 3L4XA 1L5GA 3BN9D 3KLKA 3OHMB 4WHCA 5I1CH 1S5IL 2HYMA 3WHXA 1M7DA 3ARFB 1OY3B 3KPSB 2APFA 2ITCA 3OGOE 4P4KB 4JKMA 3BAEL 4QI3A 3ETBF 4NKIL 5I8KL 1XT5A 2DQHH 3SIKA 5TE4L 1SRDA 2LT9A 5FK9A 1OP3H 3GMRA 2ZE0A 3OBAA 5B8CB 2CO2A 3LZFH 1LO4H 3QCVH 4YDLB 4XP9L 5LBVA 4HHAB 4X99B 5HHOB 5IT2H 3CFKA 1CL7I 5I1DA 3B9KB 4FFTA 3Q6FA 5GGQL 4CN1A 4QOKA 1T4KA 2Q8BH 5HYJE 1BAFL 4AYDC 4Z7IA 3VMOA 1R3IH 3NSFA 4AYBA 3WHE0 4OT1L 2N56A 1S7SA 4MMZA 5DRWA 3EZJB 1FFTB 4FI6A 4QOKD 5C0IA 2GEEA 3O6FB 3F7YA 2B8OT 1BFVL 3SN6N 2RCSH 1UJTA 3P40A 1ZIBA 4PHXA 3IVKB 4W9IC 3TP4A 4HUWB 4IBZA 4PLOB 3EJYD 5INDA 4R2GB 5GJTL 3B37A 2PCPB 5JHDE 4MNQD 4JG1L 3OKLB 3LV3B 2G5BB 4F3FA 1ADQH 4EO5A 4GAYB 1BJMA 1O6SA 3SQBA 2H2SD 4N5UA 2Y06L 3D2UA 3IDYC 3S8GB 2GTZA 3HI6L 1B6DA 4OAWB 5IF0A 1BD2A 2QSCH 1HOEA 3HLAB 5KSAB 3T3MF 5MENB 4BZ2A 3W39B 3EBGA 4Q7DA 5JIMA 2DBJA 3TA4D 1KG0A 4K3JL 3AM8C 5CCHE 2C1OB 2YBRB 1MOEA 2EXWD 5L88L 2ARJB 2YGOA 5D7HA 4BQ9A 4U6HA 4LARH 1ZLSL 2VDML 4JO2H 4NIKB 3RVWD 5LN8A 4BCZA 1YPZE 2B20A 3QEQE 2XA8H 5FCUH 3NIFF 3BKCL 1JFQL 4Y4KA 1FVDA 4XP6H 3TH4T 5JW3L 1A6PA 1TEGA 2NXZB 4Y2LA 1MAMH 4QXWA 3VH8B 1SXAA 4PP1C 4TUJA 3PWUA 1SJEB 2YAFA 1U2YA 4E68A 2HN7A 2I9TB 1IU1A 4UT6A 5HGDA 4Y2DC 5MERB 1ETZA 3QJUB 2VLME 3D07A 4GY4A 4RMVA 4RSYA 1S8DB 5E2JA 5EZLA 3RZCD 3EOAA 3BT0A 1FG9C 5DQDH 4P2YA 2CR0A 2AQPA 1A1MA 1D6EB 1USQA 4MDRA 5DURB 5CUSH 1CDYA 1D7FA 4R0LC 4Y4FD 1IBGL 3PDOB 1DO6A 4CC4C 1EXGA 1BG9A 1AE6H 4O58L 4ZW7A 1DQIA 1AAJA 1AZVA 2PPAA 4LKXA 1JYVA 3PWPB 4NJ9L 2BIQA 3I50L 2FECI 3BJ91 3T0AA 3FN0L 1C08B 2UZXB 4A1RA 2Q3AA 1E6JH 1CFVL 5HVHC 5C6TL 4N0FB 4JJOA 2L4OA 3BSZH 1QKZL 4O2FB 5E08H 4RFNB 4F8NA 4JY5L 5B7FA 1OD9A 2J43A 4QY8B 1R24B 4IKNA 1WZ1L 2X2IA 4NQVB 3KXFB 4OGQC 1DQLH 1NFAA 2JSFA 2A5UA 3F6IA 4NKMB 5KG9A 4XWGL 4BGLA 1QBAA 1YDPA 4K7PY 3KPNB 4PJ9B 2R59A 5I1GH 2EH8L 1EXUA 3CFNA 2XX0A 1LMIA 1ZY9A 4PGDB 1DDHB 5MEQB 4OVUA 2EVGA 2R56L 2QQQA 5IB5B 2HJFB 1N0LB 4X83A 5ALBL 1TTBA 3KPRA 5CN1A 5ANMB 2F5AL 1NPUA 5E9DB 4BK4A 1MRFL 4QRSA 4XN7A 3R18A 5KS9A 3DOSB 3FHAA 5TJWK 4PW3A 4Q2ZB 2VXQA 3FQWA 3L3IA 3F7RA 3WUWB 3JTSA 1P69B 2C4FT 1BZ8A 3QS2A 1YRKA 5K9KB 3NA9L 1PFCA 4NN6B 4F7EB 4ZUTB 3G5WA 2NYYC 4OFIA 4Y19B 1S7VB 4BGDA 1S7RB 3C5JA 4O9HH 5I8EB 3WIAA 3FB8A 3M07A 2B3RA 2C3XA 1KJ2A 2D7TL 4N4YB 4E9SA 3VFSB 5HPOA 1X5YA 1ET5A 3FBKA 5D2LE 1UTDA 2HXAA 2ADFL 1Z7JA 2G9KA 3QW9A 2JVUA 4HPOH 3NAAH 4IGBC 5ABZA 2YGPA 4LASL 4O51A 2JTDA 3MCLL 2FRGP 3OF6D 2JIXD 4F7TA 1AGBB 4NO0D 2W95A 2JKJA 2X3AA 4Y9FA 4D0BB 4LPWA 1J9TA 1SEBB 2APTA 4HIHA 4I5BA 3VXUD 4AYSA 4Y2OB 3AS0A 1OSPH 4M1DH 3G6DH 2TRYA 4NZ8A 4N26A 5HDBF 1REIA 2I9LB 3MLUH 3NPSC 5H2BB 2XWRA 4KJYA 4N8CL 5IQ7L 2NCEA 5DO8A 3BIKA 2XSKA 3HEIB 1FORH 2I24N 1H15B 3CLWA 3K80A 3NCXA 4GKZB 1RZQA 1CXHA 2FJFA 3GO1H 5AKSA 3DO7B 5KOVC 1CZ8H 1N3NA 1XEUA 2VDNH 1C5DB 4N6RB 5JZ7D 1J5IA 1J0JA 4M7ZC 3NPZB 2NY0C 3QSKB 2XN2A 2VYRE 3TA3D 3NEEA 5C7ZA 5EU6B 3RDTC 2APXA 1HE8A 2NNRA 1L9OA 3G6AA 2XZCH 4XPGH 3WV0A 1DZBA 3TFBA 3VD9A 2CGZA 3HN8A 2AJ3A 4UNVA 3E9UA 4FE9A 3BUYA 2NY4D 2EAEA 3L13A 4KMTL 1D5RA 1AXTH 4LAQH 3I9PA 4X50A 3MV9E 3RJQB 3AREA 2VLJE 3EJPA 1WBZA 2VXUL 5F3FA 2WVTA 1MAKA 5DO2C 2I60H 4EDWH 4TLKA 4JZOB 4PJEA 4R7DA 1DFBH 1FO0L 2O5XL 3HVDA 1JV2A 2OQJA 3PV7A 5BS0A 4YIQB 4PP2B 4IM8A 4Y4HC 4FTVB 2VSDA 3EYOA 3FO1A 4MAYD 5AUMB 4X8GA 5GS1C 1MVUA 4J2XA 4K3EL 2BVOB 2X89D 4GAJL 4HK0A 5HGGS 4ZW8A 2AK4D 3NSYA 2ZX6A 4LCCA 3ULUD 2BWQA 1XB8A 3BGFB 3D0LA 3S5LA 5EU7C 3IJ7A 3EBHA 4EKXA 4J4PA 2BSBA 3ATEA 4N86A 4YEEA 2GTQA 5C0ND 2BIPA 2WWKO 2P3YA 3CFQA 1PG7H 3EOYG 5AVWB 2H1PL 4JY6B 3Q05A 5KBLA 1O7SA 2F8XC 1BW8A 1YNTF 2WVUA 1JHLH 4J4PD 4GSQA 5IR1B 4XBPA 4TNVF 4OZIF 3TBYA 3X12B 4BWUA 4TOYL 3H42H 1WUNT 1AKJB 1A5FH 2RHEA 2AVGA 1PD0A 4GG6E 3QEUB 2OP4H 4MB3A 3CH1B 3B3IB 1J9CT 3J8F7 4MXWL 2B9AA 4NNYA 3V0IA 5DEGA 3TBSA 3LIZL 3VDAA 1CFQA 3M1BB 1ZA3B 2CLZB 2CU9A 4KUZH 1JRHI 2P8MA 2APBA 3B8YA 3W82A 4ZTPL 2Y3AA 3I6SA 5T3ZH 5JMRA 2DWYA 6TAAA 5HHVL 4HEPA 2DM7A 4XWOC 4DERA 3ARGD 4WHYH 1EZVX 1YEEL 1YPZF 3K1KC 1WJ3A 4S1QH 3T4YB 1I1CA 1P53A 4DGIL 5I1EL 4XMZA 1KCKA 3GMOA 3H55A 1IARB 1DJYA 4FI8A 5KYWB 4LCWD 2NW3A 2XKNB 4XTRC 2AK1H 1EMTL 1U6AL 3HCVB 3BPOB 2BOBA 2Z8WC 3LH8A 1X4XA 2V37A 4XMXA 1A6TB 1LD9A 2V8MA 5LG1A 3ESVF 2FK9A 4JLRA 2NNFA 3MRRA 4RCAA 2VISB 3VXTB 3WDHA 3GSWB 1U8NB 3L48A 3IDXL 5CJ8A 5C0AA 1SFHA 2DIJA 1KB5H 3TEYA 4NDMA 1NWPA 3B7UX 2ENPA 4L0PB 4LLVB 2H3KA 1ZTXE 3IE9A 4KAQL 4ODBD 5AZEH 2QTEA 1YECH 2DJ4A 1N59B 5IT2L 1CXLA 4IMKC 4N2HA 1UB6A 3RHWF 1CGSH 4IIQC 3T3PE 4BFGA 4EI5C 1ODAA 1TQCC 4NEHB 1SVBA 3WJJC 2BNQA 1AD0B 2IAMC 3FFCA 2D2CC 2NXYD 4AMKL 1P1ZB 1JOIA 2P4AB 3PS6A 2WK2A 5DYOB 1LO5B 3ASWA 3EBIA 1YMHB 4Z95L 3RTQD 1YUKB 1G5AA 5E56A 1C8PA 3RFZB 1HYSD 2B1HH 1QFWM 1JGIA 2FLRT 4EZLA 1J87A 1BXAA 4H20H 1KNOA 1FNEB 2JI3A 3U30C 5C0EB 1XTLA 3LKPA 2YAPA 4GH7B 4ATWA 3QULB 2OI9C 2TAAA 4OZGE 4C58B 4TL4A 2DMBA 2WBKA 3FUMA 5C0BA 1J1PL 4QAWA 2WO3B 3SGKA 3VSUA 4HVBA 2YMOA 2V17L 1I7RA 3HN5A 4A55A 3O3AB 4Y2NA 3B83A 4F2MB 1HHKA 3TFKD 3L7FB 2IGFL 2GJ6B 2BP5M 3GSVB 3IMBA 5TQ0H 4JPIA 3V4VB 1IBFA 3FQRA 5C0BD 4XVJL 1PW3A 2R7EA 4GINA 4QCIB 5DVNA 5BRPA 4UQ3A 3CG8A 1GGCH 2YGVA 3E1F1 4MJ6A 4G72B 4P59H 2J88L 2QT6A 4UILH 5CJQH 5D2LF 3CQQA 3UAEA 1PU0A 4RGMC 4YC2B 4LARL 2Q8AH 3MACH 4JO2L 4BWTA 2AS5M 4NIYE 4Z3FA 3LXUX 5FCUL 5GJSL 4GRMB 2Z64C 1BIIB 2X6AA 2W59A 1OTTD 3POHA 3WJLC 4Q0XH 2CO3A 1RUML 4KX9A 3O4OC 2YGQA 5JW4Q 1NCHA 2K70A 5DHYB 3SDAA 1XH0A 4AC2A 1ADWA 1NGPL 2G4EA 3MRNA 4ZUWB 4R5VA 4YDJA 2BZDA 3J07A 3OVUB 2WLLB 1A4KA 1KTBA 1JYNA 4HGWB 5I74C 1J88A 1T7VA 3NFPA 1E9PA 3I3BA 3QQ3B 4H2CA 3OR6B 5LAXB 5MEOB 2X0VA 4X6EA 5D7JA 1QNZL 3ZXAC 1XH3B 4R84A 5F21B 4EN3C 3U0WH 1AE6L 2X05A 2R2BA 3VM7A 1HINH 3VJ6A 4HKXB 5A2JH 2NW2A 5AB9A 2BFGA 5D8JH 1ZLDA 2D31A 3D2TA 4PW9A 3TVMA 5HI3D 4P46B 3HG3A 1JZ5A 1P5VB 3AADB 5DC4B 1E6JL 2XKSA 1PY4A 3AU1B 2X4UB 3MOQA 1N5YH 5DVOA 4WI9A 2BSTA 4HUNB 2BIIA 5A6LA 2WB7A 5DDHA 3WELA 3T0EA 1I3UA 4HHGA 4AM0A 5L2JB 1G7QA 1S4IA 2HLEB 3U7YH 3RYMA 5I1GL 1DJSA 3DJZA 5D93B 1USZA 1CE1L 3V6OA 4QRRB 5T5NG 4NKOA 2ROYA 4JDEA 1XF2B 3RIFK 2BP3A 1SYVB 2BY3A 2XWDA 4V1DD 3F8UB 3QXTA 1CFNA 3UMNA 4GXVH 1YQVH 2BFVH 4WU5B 2EEDA 1KIPA 4UTAH 4XOBA 5EU4B 5I15H 4N28A 3NSCA 4M43H 2ZUUA 1EH9A 5AOMA 3RBSA 3FO0H 3EYVA 4RFEB 4CSPA 4RDQF 2C4XA 3L95A 2BINA 4HISA 2BHZA 4GEIA 1HH6A 1DJGA 2F18A 2ZUYA 3FZUD 3ULVH 1P7QA 2HFEB 3LQAH 1FYTA 5E8EA 1NTDA 3PHQA 2VM4A 1J8HE 4FL4C 5DRNB 5BZWB 5E6YA 5EZPA 3O4LA 3CFIC 3ZE0E 5D1ZI 1XR9B 2C8NA 3FSWA 3WY4A 5LBSH 3OC8A 4FCAA 3U82B 4PRPD 2JTYA 4RQQA 1FYTD 2G2RA 2AKRB 5DJZA 3RG1C 4HPOL 1K8DA 3NAAL 4LP5A 4X0KB 4LXFA 4OD3H 4GG6F 4WUKH 5AEAA 2WVVB 5CZKA 3ZOAA 3QIBB 4PRIA 3DMMD 4TSBL 3QA3A 5IVZA 2ADYA 4K3DH 4Y1AE 1PNDA 2MOGA 3NIFB 1D5MA 4M48L 2J7LA 3DV4B 5KVGL 1JCKA 4KDVA 4QRTA 3G6DL 2ZJSL 1E30A 3SE8H 1UHVA 4AENB 4KTEL 3QZWG 5F1IA 4M29A 5T5FL 3RUGE 2A6JB 1FFNB 4NPYB 5E0QA 3LX9A 3UFIA 4QDGA 2EYTA 4TKWA 3GJFK 2YSTA 1BQRA 4RRPG 3UO1H 4MAZA 3I84A 1AVAA 2PETA 4XXCC 1FO0A 1F4YL 2DRUA 1LEKA 3QI9A 1ZRUA 4KK5C 3G5XB 4WO4C 5GGSY 3CPUA 1IGFH 3U4AA 5I5IA 5IJCC 1K2DA 1M6OB 3UBXI 3VMPA 1B4TA 3P69A 4XCNB 4F57L 3FU5A 3GBEA 4XPGL 5L0QB 2JMRA 5EIIA 1SBSL 1QWUA 1G0YR 3HI1B 4KXZH 1Z9SB 3ATFA 5DZVA 4AUUA 4L8SB 5CEXB 1MRCL 2EYRB 4WQOA 3MYJA 3DXAB 4JFVA 1R3LB 1ET8A 1F13A 1OE2A 4LAQL 4XNYH 4XCCL 1R4XA 3U7WL 4QYOB 4H4NA 4E36A 5E00B 3VXRB 4EMZA 1BZ9B 1AI1H 1SM3H 3MTRA 2DL2A 3N1FC 2I60L 4Y7MA 4EDWL 2GIXA 1OAUL 1U3NA 1Y0LA 1LO3H 2YGNA 1DFBL 1BDYA 1NDGB 3WN5B 5D55A 5IHHA 4B50A 2DQFB 3QCUL 3QUZC 3QARA 3RWFB 3S7GA 3UZQA 1QLEL 2V3FA 1PKQA 1EGJL 3WEXB 1TZ8A 5E1AB 3DRTB 4H5SB 5CIPH 1I31A 1U8OA 1Y6MR 1YYML 3BD4A 3ZN6A 4G42A 3LN5B 1GJWA 4X6CA 5C07A 2UV3A 1FCCA 1TO4A 3UTSD 1PG7L 2WTPA 3IKCA 3NIDF 4K8RL 4P99A 3S37X 4BUHA 1FNGA 3ZMEA 2OL3B 1OM3L 1VFBA 2DS4A 2KZWA 4M8QA 4JANA 4HJUA 2BLFA 1GGBH 1NBYA 4G9FD 2ZXGA 5EEVA 4I77L 5F7DB 1L3NA 1S9YA 4OU3A 4TL5A 4ODHH 2OMXA 4QXGH 4OIAA 1MCWW 5E8PB 1NCCL 2E4TA 4PVMA 1DUYA 4QRPA 3CLEH 4PREB 2R1YB 2H32B 4PJ8C 1DQQA 2FH6A 1ES0A 2X4RB 5D1XB 4J27A 1OHZA 2GUOA 1AGCA 4ZQKB 4EKJA 4HG4K 1ZTMA 2EEFA 3SO3C 1QFHA 2EDRA 3WTVA 1B0RB 2QJDA 3QUYB 3TCTA 4I18A 4QRPD 1A7QH 1EEZA 5JOFA 4NS0A 3OQ3B 5C9JB 1RH8A 2DH3A 4X6DB 5HDBB 3GLEA 3APFA 1GPOL 3T2PA 4NQDD 1SY6H 4G8EA 4U1KB 3FCTB 3QDJE 4FLRA 1WA2X 4P2CG 3UTQA 3I75B 3OGCA 3WNJA 5A1AA 3WS6A 2OZNA 4ODXA 4OLZH 4AQOA 5KSBE 1XB6A 4GAAA 1F8TH 3FMGH 3SGJA 2AK1L 2Y1YA 1DSWA 2ADJA 4BELD 3BO8A 3QG7H 5CJOH 5CHNA 2QR0B 3CN2A 5TGBB 5KOMC 1BQ5A 3FT2B 1B9KA 4J6RH 3KWUA 4ODTH 4PJIF 2O1AA 4UTBH 4BKLA 4CGUB 2C26A 2Z1PA 3QPQC 2VZVA 1HOCA 5F7NC 4ELMF 1YAIA 3FRPB 4G6MH 5E2TL 3DTDA 1KYAA 2NX5B 1GA2A 3MGTA 3ARDB 4NFCA 2BCMA 4HCIA 3VX0A 4JGJA 4Q8BA 1GZPB 2XN9D 5A16A 2HTKC 1XO8A 4IHBA 1S9XA 4DK3A 4MXVF 4HV8B 5LN4A 1FJ1A 4LMQI 5AZEL 1Q0YH 4S2SA 3L3JB 2F74B 1EZSA 3K3QA 4FNUA 4GJTB 1CGSL 1J05A 3ETTA 3NEXA 2PYED 2HFFA 1T21A 1NGYA 2CM5A 3HG1A 5AFAA 1RK0B 5IMLA 3ZDZE 3GBML 5F1NA 5IFJB 1TTCA 3ZMRA 3VFRA 5F3HA 4G1MB 1YN7A 4Y5VB 3NP3A 1JVOA 4H20L 5F0MB 4TQ8A 1T1YA 2Y5TB 3BP6A 4R97C 5ESAA 3ERXA 2K9UA 3DVGA 3REVA 3VG9C 4WWKB 2WKOA 3K7UA 4JAMB 3EJCA 1JZ6A 3EH3B 2XN1A 1FH2A 1CCZA 1A4CA 2QL1A 2BCKB 1WZAA 2YD8A 5ICZB 3B43A 1T03L 4YHLH 3VFGH 4QTFA 1KTLA 1YNTB 1RUQH 1E0OB 4WLCA 5GSRB 3D4GA 1OGSA 1P9MA 1OL0A 4DH2A 4OZIB 4Z7VA 5HGHA 5EEYA 4IBYA 3GINA 3C5ZD 1ZJAA 1KFAH 2QADC 2VO8A 2WLZA 2AQSA 3ZE0F 1XGTB 4TUKL 5I1AB 4XP1L 4NRZB 1F42A 3V2AR 3THMH 1YNLH 3OKKB 3SB3A 4CBPA 3AAZA 3CZKA 1OHQA 3SCMC 4ZMOA 4Z0BH 4WI6A 3ZQXA 4PY8J 1M05B 5T1DH 4GXUN 4Z7UB 2DICA 2J6EL 4MTMA 1ZLVH 2TSBA 2UYLA 2XI9A 3W11C 3OKNA 4OQ1A 3TO2A 4UUJA 3O8XB 1EHLH 4ANVA 3V9FA 1YPZB 1U21A 1V27A 3TONA 2Y6TE 5I1JL 1W8NA 1S7XA 1U2HA 1LP9E 3IEAA 3RUGF 4JM2D 5EC1B 5IMMA 2FZ3B 1DJIA 3KPMB 2CALA 3FXIC 4LP4A 1DQJA 5EZJB 1YY9D 2ZX8A 3WEMA 3QIWC 1FN4A 1BYPA 3KJ4B 1CXFA 3BPLB 4A66A 1UWXK 5D8JL 5CM1A 4UZUA 1AC6A 1BWWA 1RZJC 1SOQA 2DWXA 2EACA 3MMEB 3OKOB 1WZKA 3PJLA 4L2LA 1DBKH 5DFWH 3LN9A 3FB6A 1ULVA 3OD3A 3PGDA 4YFLI 5D72H 3W0WE 4PJXE 5I1LB 4JHZA 1F00I 2BM3A 1G9NC 1TJGL 3QUKA 4IU2A 1MW2A 4BE5A 1XSOA 1FZKA 4QHMA 4UTCA 2XIIA 4LSQH 4Q6IA 4XN1A 2BXZA 5I76A 2Z31D 4HOWA 5BZXA 1JZ7A 1M2VB 1TTFA 3STZB 3RPKA 4DFIA 2P43B 1SLXA 1X5FA 3FQUA 2DWEA 2VN7A 5FO8B 4UM9B 2WKLA 1IE5A 2L0DA 2H5UA 1CN4A 2VSKB 1OAYH 3QRGL 4LQFH 3KBEA 3VACA 2YPVL 3AC0A 2AXJA 3PGFH 3MOAH 2BVQB 2X3CA 5D96C 1OGAE 1F2QA 4L37B 4ADIA 1D9KD 1F6FB 1Z9LA 3PREA 3QO1B 4HGKC 3DETD 5I15L 5HPMA 4FABL 3FO0L 5DUJA 2WQ8A 4B97A 1FC1A 3O6KH 4XB8A 5E4IA 4FFWD 2CBOA 3SJVD 1IL1B 1E27B 1T83C 1BM3L 1YVLA 3N1QC 4JN2A 2P80D 2YSSA 4QRFA 4X7SH 5T5FA 5JTWA 2GT9B 3LQAL 4ZZFA 2V5MA 2X4SB 5IK3A 4BQ6A 2WAHA 2AANA 4NWUH 1B6UA 1E90A 4ENED 5LBSL 4XMPH 4AGQA 2R0WH 4FNTA 3MNWB 1BFTA 3U6RA 4D7BA 3U6RB 4JK0D 3QDMD 4IRZA 3H9HA 4I87A 2ITDA 3CBJB 4C56E 4OD3L 1E3FA 5JDSB 2MJWA 1EAQA 4LOFA 1INDH 1HHGB 2VO5A 3BYTA 2V5TA 4R3SA 4PJDE 3D39D 2OYKA 5BV7C 4U33A 2FO8A 2GFBB 4XOEA 2IH9A 5KAQF 1T6BX 5DJAB 3B6SA 2IV9A 2W92A 3W81A 5CF3A 3SE8L 5IOPB 1UGKA 4KNSA 3ARVA 4BINA 4PJHB 5I17B 4KHXL 5SWZA 1G6RB 4LGPB 2OMTB 4LSPL 4OGYH 4FA7B 3A6CL 3FFDB 2YLHA 1I8KA 5LXGL 4KROB 5D7IA 2WGNB 5DD0H 1FG2A 4FKEA 3OHXA 3R19A 2YPLD 4PBDA 4IKKA 5KSBF 3DWTA 3KH3A 1EGJA 4KXAA 1UH3A 1R19A 1F4HA 1NBVH 5FKAA 1FNSH 4JFSA 4POYA 5KANG 1TZGH 1F5WA 3FUIA 4P57B 1J9QA 3GMQA 2X0UA 2A1WH 5JLZA 2NY3C 3SYAA 4M5YL 5AKVA 5EV7A 3MODH 5I75C 2JCWA 1DLFL 1NBCA 4PLJC 5CZVH 4PRNB 5FHAH 2CE6A 2X70B 2KH2B 2C9VA 3B9EA 4PJFE 1FZOA 4AVIA 2FEEI 1GW6A 1NMBL 3FHQA 3FTWA 4LF3B 5CP7A 5F9DC 5IROA 3ZKND 1AS6A 5K93A 5F71A 1I1AD 4X9IA 4M93B 1HHJA 1SM3L 3DPBB 1RJYB 3MYZA 4OI8A 5DJ8A 4NQXA 4LSSL 4K8RD 4IRSD 1OF2A 1OTSC 5B39A 3D18A 2ICEA 4BDVB 2ZKWA 3EFFB 1EFXA 5BUPA 3PHOA 3IMRA 4WV1A 2JB6B 3B7SA 1HSAA 3QJZA 1ZSDA 2W9EH 3HE6C 5KUKA 3MJ7B 4OKVB 3RGVC 5C8JA 1IUZA 3EO1B 5IV2B 4OCSH 5GZND 4WGWB 4FQXC 4JFHE 3OZLA 4RWYH 4L05A 3ZKJA 1N2RA 3ZZQA 1I7UA 2J8HA 1ND0B 4LAJH 4EZMA 4AQAB 3QJOA 5DJ6A 3BQUB 4LGSB 1ZE3C 1WZLA 2QGDA 3SKOA 4AYFB 1GGBL 4LNVA 5T3ZD 3CMOH 1H3XA 1NSNH 5DF0A 1CE6B 5ITBL 1BZEA 1NJ9A 3EO0B 1IKOP 4GOSA 3FRUA 1PQZA 2NY6D 2EDEA 2X4TA 2YHGA 4IBTA 4MMYB 5C0CB 2PO6C 2C5DC 3D25B 4W6XB 2EXYD 1QI5A 4XBEL 4GG6B 5F6HJ 5KVEE 5J11B 1EVTC 4WW2F 2P8LB 3H3PL 4Y5YA 3IMVA 3KLSA 1EUUA 1SJHA 5TF1H 3UJTH 2CJ3A 3TJHD 4XMLH 1AQDB 1CLCA 2AEOA 2XZQL 1TVBA 4X4ME 2NY2D 4RX4D 4KGJA 5L8KB 4TS6A 1N8ZB 3SDDB 5AD0A 5J3HC 2ARWA 3MV7A 3PP4H 3KGSA 4JO1H 4YSRA 4YHZH 5HYIA 5DC2A 2IWKA 3H1ZA 1W0WA 1F8TL 4LLMB 3WNKA 5EOQH 4C83B 1INEL 1KIQA 3QG7L 3MCKA 1LP9F 2GBUA 4LCYA 1CVRA 1A0QH 1QVOA 4NQCD 2AQ1A 4QEGA 3A24A 3AZUA 1I7ZA 4JFOB 3L9EA 2FT7A 1X5KA 1HXYB 3FTXA 5A2IH 5GGUB 2D4DA 5GGRY 1M9SA 3SDCC 4A7GA 3Q2WA 5T1LA 4A7QA 2NZ9D 3R8BB 2I7OA 1YNKH 3D3VD 5L9DL 1UYWH 4ZAKB 1LE9A 4CJ1A 2HFGH 3FONB 1KIRB 3JUYA 1GRWA 3FH7A 4GSUA 4MD5B 2P5WB 1OAKH 4FMVA 4XOAA 5I16A 5A2CA 3N1GC 2V2WB 3UPRA 3RRQA 5EOTA 1MCOL 2KERA 4PH8A 3H9SB 2E7BA 3S88H 3GTVA 4UT9L 2XV3A 3P4MB 1P6WA 3CVHL 3MPCA 4LOVA 1LDPH 3OXRB 1IC5L 5D7LB 3HPLB 3MLTB 3OXSA 5E2VL 1ZSHA 3QJFA 4IBLT 3V5DA 4XXWC 3DDGA 3JYCA 3E9TA 2ZWLT 5DMGC 2WCSA 2X88A 5IEHB 2EUZA 1MIEL 2VABB 1Q9KA 2WP3O 2XQYK 1BLNB 2J6EA 3NIDB 3RY6A 4OZHF 2CO7B 2FUTA 2QSQA 1PY0A 3I2CH 3TBWB 4BHUI 4YHLL 5ANHA 5F7BA 5MP6L 4ZXBA 4XBMA 1G87A 3A6BL 4DWHA 4U1IA 4LVEA 3FK3A 4LE8A 4D9LH 4PJGE 5FOJA 3NYKA 4KKCC 1WIOA 1Z66A 2F19H 4O4YH 4GUCA 5I71C 1A66A 3QIUD 4ZXBD 2PWFA 2WMPB 4N2OA 1G4MA 4QWWC 1F02I 4N0UB 3VRJA 4K5NA 4ZFGH 4EN2A 1C7SA 2IH1B 3FAXA 3HFFA 4JRXB 4AIXA 1JIBA 3V6FA 3VXUE 2BC4B 4ONOA 4L4VA 2GJPA 5T1DL 3BPCB 4F58H 1LEIB 3VSTA 1EHLL 4ZSOA 4NNXB 5CILH 5I6KA 4ODWA 3C9NB 3K2UL 2DTSA 4YMPA 3MRIA 4UDTB 4F2FA 4L4VD 5A6MA 4D9QE 1K9TA 2Y7NA 1NBZA 3Q2CA 1F6AA 1BZQK 1PDKB 1GC1H 2J72A 4EEEA 1KULA 2O5YL 1KF9B 1BOGA 2DQIH 2EEAA 4P2QE 1LQSR 3T8VA 4KVNH 5AOKA 4HCRH 3U9WA 4K9JA 1BJ8A 4XNXH 5D4HA 1CK0H 4PJIB 1C5CL 2YPVA 3QUHA 3WFZA 1AXSA 2F0CA 4YLBA 3VWKC 3QFJA 4C4BA 5L6YL 4ELMB 1HQRB 1FZMB 2VIRA 2VQ4A 4DVBB 4NJAL 2BDNH 1NM9A 5IHZA 3NTCH 2GSGB 1K72A 3S2AA 2HAZA 4F80A 4U4IA 3PWJB 3ZY7A 5JXAH 4HXBH 4R26L 1FL6A 3ISRA 5AOZA 5J6HA 5EF2A 2GK0A 3KH4A 2IWFA 4Q6YA 1XTMA 3DX9A 4PJAF 4TNWK 2XWBA 3HC4H 5J1SC 1OSZA 3NMEA 2ZWSA 4YHOH 1WCBA 5EDXA 1UXMA 3CCHA 3M88A 3TPKA 5D9SA 5AB1A 2XJKA 2QVFB 4I9XA 3ULVD 2ZP8A 4PVNA 4EF3A 4AI7A 5JW5A 4LQFL 3E1ZA 4LNRA 1CIUA 3KYMB 2NY7L 1IAII 3FRPG 1PTZA 3FU9A 5HD8C 5B38A 5EO9A 4AEEA 5FYKE 4G8IA 2YEQA 4LDLB 3MRQA 3CFUA 4TVPL 3S34H 4Q9BA 3UTPD 3BRDA 1XF4B 1BYOA 3I6LD 3S3SA 1XGQB 3PHAA 4Z5RA 4J1UB 1NIBA 3N06B 1RVFH 4OY9A 3TZVC 4EI6A 2CBPA 3ZMNA 2ARJQ 4I8DA 3RNKB 1E5CA 4DP6X 1IBDA 3AQDA 2X6UA 5J5EA 4OM0L 4G7QB 4B7IA 1A3RH 1FGNH 4N1HB 3B2MA 1J8HB 3QPXL 4F9LA 5IMOB 3TBTA 4APQB 2QV2A 4MB5A 2E6JA 4HK3J 3DK2A 5CSZA 4KDWA 1TOXA 4JFUA 5H94B 3Q6GL 2N1TE 5FAAA 3JV0A 2FAUA 1T0PB 2JJSA 5IJVB 4CMHB 4YGVA 3FT1A 4X42A 5EMYA 4P2OA 1YMMD 3FQYA 1IO4C 3P77B 3WKMH 4G11A 3D0AA 2GAZA 3GC3A 5ERWA 3B2VL 5FOBA 2WVSA 5F6IC 1ETA1 2A6IA 2GTWA 1EEUA 3OMNB 1NEPA 3W9DB 3F5WB 2J8UB 4JKPH 1BFOA 1BBJA 2DL9A 3DURB 1EDQA 1U3HC 2ZKHH 1DBAL 4RGND 4WU7A 3H56A 5FYLE 3IRZA 2BSED 1N4XL 3HZYA 4WGKA 1LJMA 1FVEB 1PD6A 1CR9H 2G60H 3P0YL 1K6QL 2ZXCA 3RU8H 4U6XA 1A7NL 2M2DA 4WCYH 4CVXA 2IDUA 4GQQA 3HZ3A 2VDQH 4L4TE 4PIBA 4UQIM 1NBVL 3OL2A 1W0VA 1FNSL 1IJNA 3IFOB 1TZGL 2K45A 3CVBA 4OJCA 2Z92A 4PJ7A 2A1WL 4ZUVB 3UMTA 3N40F 5HP5A 1JFHA 4A2GA 5F0PB 2FGWL 2BW4A 3MODL 1AD9B 3BQVA 3CFBA 1YUHA 2C4FU 2CK2A 1KJMA 4HETA 4HJGB 4Z3IA 4MQTB 3WDIA 1GH7A 3BD5A 4NUJB 3PL6D 3NESA 4KKLC 2DQCH 3DO3A 4UQEA 1KGYE 2C9RA 3IBOA 1E6OL 2E27L 2VDPB 4QHLA 3QORD 3MOBH 3V9CA 5FYKU 4FFYH 3UAJC 4KXDA 3PFUA 3UC0L 3RWCB 2MNUA 3N55A 3LB6C 4PY7A 4N2FA 3UG4A 4OV5B 2Q76B 2J8OA 3TN0B 3IDJB 3S35H 4POUB 2GJRA 5D5MF 3TIEA 4NN7C 3P4NA 5IFAL 3X1BA 1QZ1A 2E7HA 2OR8A 2WWOA 3L2NA 1K4DA 3WL9A 5DA0B 3O41B 4XPTL 1KBGL 3UYPB 2OBGA 2R2EB 1IGMH 1KWGA 4KQ3L 3VFVA 4DZBA 2J1KA 4JFYB 4RWYL 2BZCA 2APWA 3RWEA 3NGBC 5ALCH 2XG4A 3IRPX 5J13B 2YUZA 1S5HA 4JGHA 4BKTC 1TVHB 5C0FA 1CICA 5L8LB 3A23A 3ULSB 4PLNC 2X0WA 4HEME 3F01A 4HIEA 3BVTA 2O30A 3MSPA 4YK4C 2YN5A 2R39A 1DBBH 4TRPL 1S9KC 5DD1H 3FFOA 3QNXA 5A3IC 1DUZA 1XIWC 2E86A 2FBJH 1Q1JH 3MGOB 2YQ3A 3O9WD 1J18A 4GW5B 4ZJ9A 2J21A 1QSEB 2LU7A 2ZUQC 5DRZB 5LO7A 3SE9L 2D3NA 1EERB 4Z7WA 3CHPA 4W9LC 5CZXC 1TJHL 1A6UH 3B2PA 3QEGH 5HHQB 5F72S 2EVJA 5IKCB 3UJTL 1OO2A 1AH1A 5MI0B 5SWSA 1JBJA 5D1QE 1OP3K 3UBHA 3ZDYF 3PV6B 5C7XH 3BWUC 1AHWB 4MGXA 3AS1A 1RJZA 1B0GA 1U95A 5F89A 1DQDL 4R4BA 2DEXX 5LCVH 4PVBA 4FQIH 3LD8C 4M62H 3SD5A 2A6KA 5KYYB 2H8PB 3FULA 5FYJH 1JF1B 4AT6A 2GSMB 3SE4A 3FH5A 2WYTA 1BIHA 4NZUH 1TYEB 4UT9A 1TQSA 3CVHA 4HU2A 3QQ9C 1CYXA 3IB4A 3CTTA 4FEMA 3WTSA 3VI4E 2PWHA 5BVJB 5BO1H 3MRPB 4QO1A 4KZ0A 3UTTE 6PAZA 5ICYB 1RULH 4KX8A 1RFDH 5FA4A 4Z6AT 1RZ8B 1QYGL 3MKGA 5DJ0B 1SYSB 4FXLA 4NQEB 4GUQA 4EZJA 2HFGL 2H6UA 2GITA 2OMYA 3L3OB 3MRFB 5GS3A 5EOCJ 1H9VA 2Y23A 3SDXE 2PXYB 3RWDA 1D5IH 3SQOL 1QLRB 3O2VH 2EVHA 1MG2C 3ZE1F 3C6LA 3EHBC 1KJVA 3BMWA 3OLEA 2ESVA 1E8WA 3WIHL 3ZIYA 5K9QG 4N2NA 1X4ZA 1SHWA 4JM0A 1GGYA 4K5PA 2P42B 5CINH 3IDNA 5TE7L 4JHWL 1WAAA 1NANI 1OP4A 3I02A 2ADIA 4V1DE 5HDLA 1X9UA 5G2NA 1LDPL 5ADOH 4ZODA 5DJ2B 3CSYB 3VWJC 2I7SA 1HCVA 1JZEA 4X4XB 1RIHH 2F58H 5KVDH 3KYNA 4NC1E 4XX1E 2OXHB 3RBGA 5E6ZA 5F9JB 5H35B 2DD8H 4PGCA 1FBIL 4WFHE 3VB8A 2FB4L 2IF7A 3I2CL 1ZGLB 3VFTA 3IFPA 3FF8A 4QLRA 2CDFB 5IQOA 1WGVA 3S0PA 5C6PB 4HS3A 1Q4NX 3SKNB 3DGGB 4NWTH 2R1WA 1SN5A 1FVCA 2WNXA 3PHSA 1A3LH 5ID0A 4GIAA 2FH8A 4WUUE 1TG8A 4D9LL 5J1TC 1FSKB 2F19L 3WE6B 2QELA 1M3IA 3MLYL 4JNXA 4JFED 5L2KD 1QLFA 2RQ8A 1BPVA 2B3IA 3PYCA 5AW7B 2QPSA 1OTUC 1BA9A 1MPAH 4ZMQA 4CVZB 3ARFA 4WW2B 3KPSA 3UJJH 4X9GA 4P4KA 4LBAA 3UCRA 1KELL 5JPMC 1JWMB 3QDGE 4RDQG 1BHGA 2VL4A 4UIKH 5B1AB 5ELIA 2EQDA 5E6IB 4DP1X 5B8CA 1Q0EA 3ZKQD 1A14L 1OB0A 4HHAA 4X99A 5HHOA 1M71B 4J28A 2PR4H 1U91B 1R0AH 3B9KA 3WKPA 1TQUA 2L7UA 4TQEL 1HNGA 4JB9L 4V2BA 1GC1L 1MZYA 4IW4C 4BXVA 2XVKA 1FNAA 4PB0L 1F6LL 4NZTH 4OF3A 4QXVA 1NC4B 1LP9B 1T89C 2BNRD 4KVNL 1CU4H 3B9KD 4FHJA 2AXWA 2WBJB 2MIZA 5ID1B 1RAMA 3GKZA 3I9IA 4Z0XB 2DYPB 3O6FA 3GJFB 4DKEH 4EUPB 4F92B 4YAQB 2ZYSA 1ERNA 4OJAA 3IVKA 4WI4A 2QDVA 5J6GB 4HUWA 4P8QA 2DYRB 2WANA 1MFEL 3O6FD 4I1NB 3LV3A 2G5BA 3QJSB 3TYGH 3VU1A 1C12B 1L9NA 2NCMA 4H8WL 4GAYA 1G94A 3ZHKA 2G0LA 3HG2A 4PJDF 1NCAH 3A47A 1E9QB 1H3GA 5FFGA 3MBEC 4OAWA 5KSAA 5DHVH 2D7PA 4HU8A 1C9SA 3HLAA 2YZ1A 2R2CA 1I8LA 5MENA 32C2A 2WXKA 3W39A 4K2UH 4MJIB 2C1OA 2YBRA 1NGWB 3P4OB 1AO7B 2ARJA 3T6WA 2WUBL 3BZFB 2VZTA 3FPYA 1TEFA 3FCGA 1S9WA 3AGWA 4K3GA 3UTSE 5FO9B 3KR3L 4MXQC 4YX2L 4E42B 1JV5B 3ATBA 1GIGH 5GRVL 1M56B 3VH8A 4OZHB 1LDSA 1SJEA 3MLXH 4TPRH 4KUCD 1X5IA 2I9TA 5MERA 3RTLA 4OM1H 1RVFL 4M56A 2NXZD 1HNFA 2YA1A 1S8DA 3K71B 4WHDA 3O3DB 3BPOC 4JKLA 3DK0A 2AQRA 4GRWE 4MVBC 5MHSE 2Y72A 3EJZC 1D6EA 1FGNL 1AR1B 3CX5K 2P5ED 2IBZX 4YHML 3L1EA 3KHOA 3PDOA 4HFUH 2V6HA 4Q9QH 3PWPA 2HT2C 2VWEE 2X40A 1TQVA 2EP6A 1C08A 2UZXA 3NIGE 3V6ZB 4JRYD 2R1XB 2XV6B 4N0FA 1VSCA 2J71A 5I19H 4M6OH 4O2FA 1AY1H 3PWPD 2OW6A 1R24A 4QY8A 4FFZH 4HDIB 3KXFA 4NQVA 4DGYH 3ULAB 2NR6C 4NKMA 1AQKH 4JKPL 4AQ8A 3PCYA 1KTDB 4YS4A 4Y9GA 4PJ9A 35C8H 1QBMH 4KKAD 1NDTA 2X1PA 4PGDA 2VMJA 1DDHA 5MEQA 5E6SB 1UM5H 1CR9L 2JXMB 1A7RH 4NUGL 2HJFA 5IB5A 3KEHA 1KZQA 4M61A 5C09D 3TO4C 4B3VA 2AI0L 3FSAA 4IS6B 1S7WB 5ANMA 1ZLUH 4NN5B 1RZJH 1CYWA 2FWUA 4I0PB 4PRAA 3O6MH 5E9DA 2VUOA 3GI8L 4MJ4A 4XC3L 3VFNB 1WD8A 3DARA 5G4MA 1ZPUA 3V0HA 3DOSA 2ZWZA 3HNVL 4Q2ZA 2O6PA 1G9NH 4P5KB 3WUWA 2KL6A 3AWEA 1U3YA 5E99L 1QRKA 5K9KA 2EYSA 5CNHA 4ANUA 5BNXD 4ZUTA 5FR3A 4Y19A 1S7VA 3E8VA 4LRIC 1S7RA 4HSAC 4U1HB 5I8EA 3RY5A 1FDLL 4M5SA 3OLGA 2NYYD 3D30A 4PJAB 4UQAA 1CLYH 3VFSA 3VI3E 1ZCRA 2IXQB 5DHMC 4RNRB 4Y1SA 3FQ4A 4PQXA 4ZBJA 4N2LA 1PYWB 5F96H 1L9QA 2OJZH 4LVNB 1L0XA 2IAND 2VT0A 3KL0A 4JQXC 4PWJA 5E8DH 3ZRSA 1AGBA 4D0BA 2AMUA 3CX5J 1SEBA 1IGML 3C2SA 1JNLH 4L8DB 4Y2OA 5I8OH 3MRBB 2H6PB 3HG5A 4L3EE 3TM6A 4AGMA 3Q6FB 5D1ZC 2I9LA 5ALCL 2DWDA 2Y5QA 2F8IA 4G7VH 4FQHB 3SYOA 3FU0A 1EO8L 4IKIA 1OW0A 4W6YB 4KY2A 4G2AA 5FFLA 3F04A 1H15A 3RWJB 1JHKH 4GKZA 4H0HB 2KKQA 5ACLA 4LLDB 5CLWA 2C9XA 3GKWL 3B3BA 4LSDA 4MMZB 5DRWB 5IQ9B 3DO7A 1KJ3L 2FQFA 1WBYB 1C5DA 4MNQB 3PPEA 4J3VA 4JUSA 4N6RA 3SY0A 3GF8A 4CNIB 2XIDA 5DD1L 4XMVA 3L3KB 2JCCE 2WCGA 3GQFA 5EU6A 3ZKXB 1LWRA 1Q1JL 2BRQA 2LGNA 5BV7H 4NBYB 4XBGA 1KBWA 2NY0D 5SX5H 6FABL 4M3HA 3RDTD 2H6OA 3HG0A 2N7BA 2ZSWA 4LVHC 3QEGL 2F8OA 3ZJAA 1A65A 3NN8B 5SWQB 1KXVC 5IF0B 1K3ZA 3EJSA 2F9BT 4KDTC 3DSFL 4HBQA 3SEPA 4M4PA 1JN6B 1G84A 3I6KB 4JZOA 4BYHA 1OPGH 1E40A 4YIQA 2OR7A 1KGWA 4PP2A 1W6LA 3SKJL 3WIHA 4FG0A 4YSUA 1P84K 4FQIL 4GP4B 5KJ7E 4FTVA 2DIBA 5AUMA 3P3SA 2BVOA 2XY2A 1KOAA 3RLSA 1NINA 1NAMH 4Y4HD 3RZCB 5DFTA 1SUJA 5KYNA 2KBGA 4MMXC 4Z7QF 2EILB 2R0LL 4YBLC 4Y4FB 3MRKB 1X5XA 5CU9A 5EUOE 2W07A 2PW1B 5AL8A 5DTFA 1NEZB 4QUOA 2QQLH 4E9YA 1UD4A 3T09A 4JY6A 2CGRL 2H1XA 4L5FL 5LBGA 1E5BA 1W72H 2BHFA 5I0VA 4M7JL 5IR1A 4WFED 3QR2A 1MHPH 4MZIA 3T4AC 3X12A 3X17A 4N0YH 5AENA 3P3YA 2DQUL 1AKJA 1WWBX 3LN4A 1Y7VA 5LKNA 3QEUA 3PXHA 1MCSA 3S98A 3CH1A 3B3IA 4J12A 4N20A 5CINL 3ZE2F 3N91A 3JUZA 5D5MB 3E0GA 1T5XB 1UM4H 4YQXL 1OKEA 4AEFA 1JE6A 2DJUA 3M1BA 3ELAT 3KPTA 1ZA3A 2CLZA 3LS4L 1B3IA 2KS0A 2W65B 1MFBL 1LO2H 3IWVA 1GYUA 2E74C 1ZE3H 1YDPB 1ZAGA 2EEXA 4NB7A 3TEZA 3IMSA 2A4EA 2HKHL 2MCMA 2F1BA 3CHSA 3T4YA 5C86A 4MX7B 4P3CH 4XWOD 4DO5A 3DX8B 3PAYA 5A7EA 1MI5E 2OAAA 5KYWA 3ILPB 4LEXH 3IAQA 1ZT1B 3N44B 5DGQA 3SGEH 4E5XB 4D7PA 3ZR6A 3FU6A 3HCVA 3FPXA 3QDME 1TO5A 3K6NA 2PYFB 4NUMA 4XTRD 1PNCA 1A6TA 5HGBB 2VMCA 4K5LA 4DIXA 4YDVB 4YSDA 2E5EA 2WOYA 2VISA 5E4EC 3VXTA 1E8YA 2O5ZL 3GSWA 1U8NA 3UJJL 4B9KC 1MW0A 4TNGA 5B4MC 5KYUB 4PV8B 2JIXB 3L4VA 2YARA 3IWUA 3BP7B 4NO0B 4LLVA 4PG2C 2Y9RT 4U1LB 2QMKA 4GAGL 3VXUB 3RILA 4D3CL 3ZDYB 1N59A 1WSST 3T04D 2VZSA 2PR4L 4OCXL 3MJ8B 1NLBH 4HUMB 1AD0A 2W81C 1P1ZA 2YPLE 2DQEH 4NM4L 2XRAL 4GQPH 1LO5A 3AT8A 4EI5D 4BFJA 1YMHA 2IAMD 4OF7A 1WA1X 1CU4L 4KJYB 3RFZA 1V54B 2WCPA 3O11B 5I1HH 1FNEA 1B4RA 5GS0C 4DKEL 5C0EA 2FJFB 3QXDB 3TA3B 2OMWB 3OAWA 5C0GA 4XVSH 1N0XL 3QULA 3DX2A 3IJEB 2N7AA 4RFOL 5HHME 1DSFH 1KXHA 1UUNA 3F12B 1FLRL 3KLQA 3O3AA 1KV3A 3HZVB 2A9BA 4XPBH 4F2MA 3HC3H 3OB0K 2XICA 3L7FA 4HD5A 1D5ZB 2GJ6A 2NY4B 3GSVA 4HSCX 3TYGL 1SMOA 1XSIA 1MCHA 4A6YH 4HWZB 1QSZA 3V4VA 1DCEA 4MA7H 1CTMA 4NERA 2ZWKA 4MASA 3DVNA 1ZTXH 4QCIA 3ZE1B 4Z3GA 2XZZA 1WFTA 4NP4L 2FE0A 2AJ3B 2G75A 4KTDH 3BUYB 2L8AA 5CP3H 4K2UL 1JXJA 4V33A 4DQOL 3ZRFC 2B39A 3NCWA 1MCKA 3MV01 1YA5A 4MAYB 2MOVA 2Y69B 2AK4B 3CVIL 4GRMA 4PW4A 1BIIA 3DECA 3MV8D 2BY1A 2FX7L 2IQ9L 3CLFH 3FQXB 4TN9A 1U8IA 3SPVB 5DHYA 5F0JB 3FC8A 4ZUWA 3MLXL 1MVUB 2B4CC 1LO0L 3AFLA 3ZYJA 2WLLA 4JREC 4FRWA 4BD4A 1KWKA 1A8ZA 4HGWA 2R9HC 3LMJH 3QQ3A 1QACA 2QMJA 5DK0B 1I85C 4GMSH 3OR6A 3QC6X 2F53E 5LAXA 2L3BA 4HALA 4J3XA 5MEOA 1SJVA 4PRHD 1XH3A 3LHPH 3BEWB 1DHKA 3HS0B 4TQHA 5KBNC 1WPCA 2BX5A 1PCSA 3ARDC 3Q8CA 3D6GA 3KCPB 3Q9PA 1KN2H 4EN3D 3MLVL 1BAWA 1KCUH 4P46A 2WXIA 4YH6A 4RMQA 1P5VA 4Z7OE 1XD0A 3IGAB 4U0RC 4HCFA 1E4HA 2QSVA 3AU1A 2X4UA 3G6JE 3TT1H 5I19L 5F2FA 1UXSB 5D2NC 2CO4A 3PY9A 4JO4H 4JFDD 4FFZL 5DEGB 4DGYL 3JYBA 3UZVB 4KNUA 3ARGB 5DFAA 5L2JA 3OV6A 4G83A 2H9GB 1LNUB 5IBUG 1ZXQA 1FGVH 1J8KA 4QRRA 2WXNA 3EBAA 3QHFH 4OBRA 4AGLA 4LCWB 3ARPA 1XF2A 4JM2F 4NQCE 4C8XA 1SYVA 2BVEA 1JCVA 2WQSA 4Z1PA 2I07B 1ZA6B 3J7HA 4OJYA 4RAVB 1CL7H 4WU5A 4G6JL 1JNHB 3FB5B 4J3OC 4LU5H 5EU4A 3AMLA 2N59A 4PN6A 3EJTA 3S97C 1KXQE 4HXAH 4RFEA 3RY4A 4KQ4L 3D3VE 5DUML 2A83B 3P54A 5EUOF 1VFOA 3DBSA 2NLJA 3TBBA 2HFEA 1ZHKB 4ONGL 5DRNA 5BZWA 4Q52A 2JELH 4LFHG 4R8WL 3PRZA 1SXCA 2CJTA 1XR9A 2Z7WA 4HMDA 3CFCH 2YRPA 4OVVA 1CLYL 1SN0A 4PJDB 5E6UB 4FA8A 4QRAA 1IGCH 4HUUB 2AKRA 2RB8A 1A6VH 2NUPB 4KI1A 4OIFA 2ZF9A 1TITA 4MQSB 4J3SA 3N40P 3PUUA 2WVVA 5F96L 3DRQB 3PABB 2NXYB 3QIBA 3HMWL 3U4KA 4EUPG 1WT5C 1R5IB 2FEEL 2K0RA 4X6FB 4AIZB 2VMFA 3G08B 1MDAA 3RTQB 1JNLL 3DV4A 2DEYX 2D0FA 2JFCA 2Y36L 3MLZL 1IGTB 5DK2B 4AENA 5CCKH 2A99A 4G7VL 2A6JA 1FFNA 4JJ5B 4NPYA 4P23C 2ENYA 3U9UB 4IKJA 1I8MB 4BSJA 4UAOB 5BW7C 4FQLH 1JGEB 1YEFH 1DJZA 2J57A 3V0AC 1NMAH 4PFEA 2R69H 4R4FH 4MA3B 4NZFA 3UBGA 3O0RH 4X8JB 4TQIA 4XHQA 1B2WL 1IFGA 3G5XA 2DV6A 4JFZH 4L9LB 1OLLA 2O61B 1YEKH 4R4NC 5I28A 1I53A 3KGUA 1M6OA 5C0BB 1X6NA 4XCNA 1ZLWK 4KK5D 3BPNC 4WO4D 2NTSP 5DC0A 4PGZA 5CFHA 3CC5B 1IGIH 1WBXB 1HHKB 3HI1A 1Z9SA 2JQZA 3D1MC 3VCLB 3P2DA 4L8SA 4BV1A 5CEXA 2VSMB 5FYJD 2EYRA 3DXAA 4HFWB 3DJSA 1R3LA 4KOBA 1E4WL 2HG5B 4AQZA 5BRZD 4QYOA 5HHXL 1IVLA 5E00A 3VXRA 1BZ9A 3FU3A 3WFBL 2DTMH 5IWLA 1G6RL 4EBQH 1HT6A 2QVMA 4TULH 3CFMA 3ARRA 1OPGL 1NDGA 1XBDA 3WN5A 4EIUA 3A0OA 2VAAB 2ALWA 3ESPA 2DQFA 4JQVC 3RWFA 1IT9H 3RL2B 3MRHB 3IJHB 1QR1B 1N70A 2HLAB 5D1QC 3WEXA 4TVSa 1PLGH 1XGZA 3QUZD 2AJYL 5E1AA 1V3LA 3DRTA 4H5SA 4HJEA 4N22A 4KZDH 3DSNB 4I3RL 3QQNA 3LN5A 2AGJL 2LLNA 4J6IA 1QHPA 3C60C 2VW6A 4WFFE 4CSZA 5I73C 1ZANH 2ADGB 1RP8A 4NC2B 2D8KA 1VAHA 3QWRD 3WY2A 2OL3A 4C4KT 2A9NH 5AKRA 3AVEA 5HYQB 4IYKA 4JGUA 1TETH 3RVUC 3S4SG 3QNFA 2BVTA 2Y07H 5F7DA 2VL5B 4JG9A 1MFCL 2R2BB 1Q72L 3RA7L 2IBGA 4ZZKA 5E1QA 5I8CB 3F7VB 4L48A 2D31B 3ULVE 5E8PA 1NCJA 3NJGA 4PREA 5ADPH 2R1YA 4HT1L 2H32A 4X7FC 1UM4L 4BSWB 2X4RA 3EGDB 4ZQKA 3CSTA 4U1GB 5M95B 3NRQA 4LLYB 2A7BA 4G8GE 1WP6A 4PJ8D 4RMRA 2X2HA 1GYCA 5IVXE 1B0RA 3QUYA 4U49A 2B16A 1LO2L 1QSFE 4DOHB 4V1DB 2P45B 3Q7JA 3MO1A 2ZNWA 3UTPE 2R0KL 4G43B 4IRJC 1PEZA 4X6DA 3I6LE 2VKXA 3BUIA 1L7TH 2J55A 2HPOA 4U1KA 3SQRA 3FCTA 4DP2X 4MJ2A 3I75A 4P5TC 2D7QA 1WYJA 2P49B 4FXGC 4NC1C 2BP0B 1C8QA 2OYLA 2YPKB 2QR0A 2BY2A 5TGBA 4F8OA 3FT2A 1XEDA 4NM8H 4PVLA 1DBJL 3LH2L 4X8CA 4P3DA 2WZPA 2Z9TA 4PRPB 3LSOA 4WUUB 3U4EB 4DEWA 3FRPA 4V2CB 2OCFD 3INOA 5AVRB 3TLRA 2UUDK 1FYTB 3RWHB 2F54D 2CO6B 2NX5A 3PHQB 4ALAC 4AKQA 3GBNH 4L1HA 5JQ6H 3QPQD 1T7WA 4QTHB 4B9GA 1UXLA 5C2BH 3V6BR 2N3JA 8FABA 2VB5A 3HE7C 3KW8A 3QZMA 1GZPA 3DMMB 1QRND 2YA2A 4L18A 3F7PC 4RQQB 1ML0A 4XCFH 2W0PA 4Z7OF 5CJ5A 3L3JA 2F74A 4D8PB 3D5OF 3G6JF 5E9NA 1CTNA 3W1ZA 4JKWA 2O6CA 4RDBA 4X8XA 5FUCE 5CAYB 1AZUA 1KN4H 2EH7H 1XCTB 4X5RA 5CLTA 3RQ3A 2DQEL 4F8QA 1RK0A 3ALPA 2MCAA 2VZUA 4MS6A 3SBWC 1OT2A 5IFJA 4BCXA 4DPAX 5A7BA 1QBBA 4N8VB 5FUZH 5HJGA 5CLYA 2UX6A 4G1MA 2EYTB 4Y5VA 3IE4A 5ESQB 1ID5I 5ES4B 4KO5A 1CMOA 4Z7QB 2Y5TA 2RA1A 4P48A 4WWKA 4JAMA 1X5LA 2CCLA 4W4OA 4B7LA 2BCKA 5HYJD 5ICZA 4XPBL 1YNTA 2A9ML 1K2DB 3O6LH 3SSGA 2V4LA 3GM8A 3HHMA 3BH9A 4HBCH 3UZEC 5KBPA 3N2JA 5GSRA 2BOLA 2UVEA 3IM1A 3VW3L 5EF0A 1EAOA 1S7QB 3BKMH 4MA7L 4OZIA 4K3HA 1ZTXL 4Z77A 4FP8H 2CA4A 2DZEA 1LILA 4G59C 2H0JA 1BD2E 4KTDL 5TE6H 4OR1A 1KTJA 4FNLH 5AB2A 3M6DA 4KK9C 1TJIH 1XGTA 3IJSB 5I1AA 2QQNH 5JHAA 3ZE2B 3TIDB 4NRZA 1QMUA 4W9ZA 4AEHH 1NL0L 3OKKA 2HMIC 5JHDD 1T80A 1EHKB 1AZCA 3NJLA 3NBNA 2UXFA 1NEZG 1I4FB 3HS8A 3LVTA 4XPAH 5IJKA 1M05A 4QHUB 4P07A 3DX7B 5JLZB 3K8KA 2MKWA 4GLRI 2AJVH 3SCMD 4BIKA 3CLFL 2IALB 4WKXA 3WO4C 3O8XA 2HFTA 1YPZA 1YAZA 1G7LB 1PIFA 3ARSA 3W11D 4HS8H 4UQ9A 2ZCZA 2EICA 3UTSB 3NA4A 3FS9A 5DHDA 3ZU8A 1CXEA 5LWYH 3E3QC 2IIJA 4K23H 2MEJB 3QZNA 4GBXC 1TT6A 4G42B 2A9DA 5EC1A 3QEQD 2IFFH 3EGXB 1INQB 3W2DL 4GMSL 2FZ3A 2GY5A 5DJXB 3KPMA 3MBXL 3GK8L 2EE2A 4G9FB 4ZO6A 5E6RB 3MA9H 4AKPA 4ISVB 5CR8A 4YJZL 5EZJA 1ODUA 4P2AA 1KB3A 2Y1AA 3LHPL 3O81A 3RWIB 4YDKH 1KGUA 4NNPL 4YO0B 2YAQA 4M8QB 5EBWB 5F7AA 4XAWL 4UYPA 3QIWD 2VLMD 5F9OH 3MMEA 2CRIA 1QR4A 1THAA 4I3SH 4IJ3B 4XVUC 1DFXA 3NK4A 2F7OA 5I1LA 2FATH 4UB0H 5JOPD 2HLFC 2DQDH 3BGMB 4JO4L 4M6NH 4OF8A 1DUYB 2VC2B 3K6SB 4KHTL 2VWEC 1Z0NA 1F58H 2CIKB 4OD1L 1M2VA 3VB9A 3X1GA 2BW5A 3STZA 4BZ1H 1IC4L 4OFPA 4UM9A 4NQDB 3MU3A 3AGVA 4XC1H 2AEWA 5KEZA 3LY6A 3DA0A 1YJDL 4YGAB 1RP9A 5TDPB 3A67H 2Z0BA 2AJXH 3KPRE 3UCQA 2BVQA 4F37K 1X4YA 3MLWH 4X80H 4UM9D 3S6CA 4L37A 3QO1A 3MUZ1 5DJDA 5I6PA 3WNOA 2WSDA 1RQ5A 2ODIA 3LKQB 3QNYB 4JDTH 4ONFL 1RZKL 4CMMB 4JFFE 4AOFA 1IL1A 2R0ZH 3J27A 1E27A 1CD9B 1U36A 3ESUF 5TH2B 1QFUL 2GT9A 5JDJA 2X4SA 3TU6A 1BF8A 1WISA 2BERA 3RWGB 2HSIA 2X4OB 2XN9B 1MF2H 3CFCL 1CFBA 3FYEB 2MTAA 1VB9A 3MNWA 5IJDC 1PPIA 1IBZA 1HXMA 1A6VL 1EZUA 3N5AA 4G7YH 5DVPA 3LNEA 2PYEB 3ULVF 1OOWA 2VQTA 1CF8H 1HHGA 4S2SB 1LEGB 5JQIB 3WFDH 4IMLB 5FC9A 1PG7W 2GFBA 2ATPB 1MFAL 4WK4B 5DJAA 5H37G 1NMCB 5CCKL 3NT0A 2JJWA 2H3NB 1BECA 4WI3A 5IVXF 5IOPA 5IMLB 4PJHA 5I6LA 5I17A 1GGIL 1JNNL 2ICES 1A4BA 4S1DC 1G6RA 2OMTA 3FUHA 1EFQA 3FFDA 2F7RA 1J5OH 5J56B 2Q10A 1U8LB 3FO2B 3KBFA 3EYSH 1QI3A 3LZQA 3FQ2A 4JFZL 1TJMA 1YEKL 4M02A 1NCDL 3SDYL 5A2BA 5ISZD 4YBHA 3VNYA 3C5ZB 4HQQH 3U46B 2A2QT 4P57A 4AW4A 1ZHNB 2J4WH 4CC1A 2JJTC 4UINL 5JXEA 2NRDA 4DPRA 4PRNA 1J1OL 3QQXA 4YPGA 2X70A 1T3FB 2NY3D 4ELKB 2FIKB 4LF3A 3WNIA 1E5YA 5EZIH 4PLJD 1TSHA 3HI5H 3OR7B 4NOBA 3ESNA 2XVGA 4ZX4A 1RJYA 1SNRA 4J2QA 4EBQL 1ED3B 3BZ5A 2ENJA 4N9GB 3VXSE 1T2QH 1P4IL 3ZW3A 4HULB 1SQ2N 2VDRH 3BT2L 4E9WA 3D08A 2H7WA 3AAZB 3E8UH 1TNNA 4YDIH 5BS0E 1IT9L 3GMNB 3C8KB 3CE1A 4BDVA 4M3KB 3BZDA 3EFFA 1DP0A 3E38A 3EH2A 5DZOA 1OTSD 3PXJA 2JB6A 3MV9D 4JM2B 2ZG3A 2VLJD 4NKDA 1RZPA 3CN1A 5CMAB 4A7SA 3MJ7A 1MVFA 3EO1A 5IV2A 5DWUH 5GRWA 2N01B 3ZGIA 5L4JA 5JW4R 3HE6D 4K94L 3WIIH 4B60A 1UZ8B 3OTTA 4XZUB 3RGVD 3CV5A 1IKFH 4EQ3A 1ZANL 2E4FA 1G0DA 1ND0A 2IJ0C 4AQAA 1DYZA 1DEDA 4DGVH 2QQKL 3BQUA 1MCLA 5HDWA 4FFVC 3BUPA 3GSNH 1A6ZB 2A9NL 4JS7A 5EUOB 5AVSB 4AYFA 2Q86B 4OGXH 2Y07L 4X0NA 4ZS7H 1CE6A 5CEYB 4YPJA 2XPYA 3EO0A 3MNZB 4XZ4A 3DUSA 4UV4L 4HIPA 1UACL 4LLWB 4MMYA 3BGAA 1KDIA 4NZRH 2Z31B 4BE6A 3D25A 1YY8B 3PGDB 4OZ4B 1ROWA 3MZTA 3QHZH 4OIIH 4GG6A 2PO6D 2E6PA 3BRFA 2QHRL 1MFNA 2YWZA 5EF3A 3QZPA 1AQDA 2H0FA 2WYHA 3B5HA 4HAGA 3TEXA 4LHUD 2DWEB 3VGGA 3BVVA 1N8ZA 2X2JA 3SDDA 3CBRA 1D9KB 3KYOB 1L7TL 5DD5H 1NA8A 3F83A 4CL7A 3HIZA 5J3HD 3TBVB 4ZW6A 5HYEA 3SJVB 5LGHL 1IV8A 4LLMA 3RVTC 4ZX3A 3OX8B 5DRXB 3RAJH 4C83A 1BMWA 3KNBA 1LE5B 5IP4A 1Z3RA 1NAKL 4S0TD 1KCSL 2BJMH 5I6XB 4EDXB 5A6IA 2ZUSA 4JFOA 1Q9LB 2X4NB 2RAMA 1CS6A 2DWTA 1HXYA 3V52L 3QDMB 5CJXC 5GGUA 1F3JB 5LDUA 3CSGA 2CGYA 3GBNL 3HZKB 4KKPA 3UROR 5JQ6L 4Z8FL 4ZFOB 4JRYE 5E7FA 5DHEA 4CU8A 1EWHA 5KVEH 5C0AE 4ZAKA 1NH6A 4I85A 5IGXL 2EINB 5AAMC 4H1LH 3SDCD 3T0BA 3FONA 1BX2B 1KIRA 1COBA 2VDNB 3BDBA 4RISL 2YQBA 5EULV 5F9AC 1T5WB 4MBRA 4UU9A 3ZR5A 3D39B 4FLQA 4JN1L 4MD5A 2O6DA 2P5WA 4OFVA 1DDTA 4B5ZA 4KY1H 4QTIH 2G2NA 3HJEA 3QPKA 2V2WA 4YEFA 4PGBB 3OJMB 4MCNA 1UD3A 1EQWA 1EX0A 3O2DH 3H9SA 2RMNA 4Y5XB 1H5BB 2BNQE 3FFCE 4HIXL 3TV3H 2EH7L 1HE7A 2OCJA 3SE6A 3WKNA 5CD3B 3P4MA 5AZUA 3M46A 5C09E 3WD5H 2MH4A 5IEKB 4JR9L 2XQYG 2IMMA 5CP3A 3OXRA 3GHBH 5D7LA 2B14A 3HPLA 3MLTA 1TZOA 3L1OL 4G8AC 2YPLB 3B7YA 5A43C 1UA6L 1A6WH 5IEHA 5F7YC 2JH2A 4AYMC 3FSOA 2VABA 3ESOA 4M8VA 2WLKA 1BLNA 5DMGD 5EIVA 3VVVA 2CO7A 2Z0UA 4YXHH 2QPUA 2V9TA 3TBWA 2EIKB 3O6LL 3VD7A 4HBCL 2D0GA 1PEWA 5IFHH 5FKAB 5FM4A 2YKKA 4HWEL 3BKML 3QK0A 4K71B 5EA0L 3VQ1C 1M6UA 3I6GA 4B9IA 2WSPA 3ZYZA 2R51A 1I1AB 5T1MA 3K8MA 3DO4A 3QAZB 4FNLL 4KKCD 3SO5A 2WMPA 1X7SA 4N0UA 1WZMA 5H4ZA 5CP7B 1CG9B 3EH1A 4IRSB 4KH9A 2O5NA 2IH1A 4BFFA 2D73A 2HKFL 1IC7H 4JRXA 2QKIB 4QWWD 3GEFA 3PWVB 2AAAA 1HQ4B 4XPAL 2DH2A 1HHIB 1XXFC 3E2HB 2DYSB 3AG1B 3BPCA 1LEIA 1OARH 2WXHA 5DR5L 4NNXA 5IG7B 4NSKB 5DI8B 3GLZA 2PWEA 3C9NA 4HS8L 4LHJB 4LRNL 4WV1B 5HDQL 2CR6A 1GMIA 4UDTA 3FNKA 4MA1B 3BE1H 4UMGA 5E2WH 1JERA 1VGEH 4HOXA 1E3ZA 5HI5C 4MRCA 2VR3A 3QFDA 1GZHC 1PDKA 3CXDH 4ZDHB 1ICTA 1O5PA 1F90H 1MJJB 4FHBD 4HZAA 3MA9L 2YK1H 4Q4IA 1MREL 5J57B 3QRBA 4PJIA 4AXWB 4KZCA 2ATKB 3MRLA 4Q56A 4NCDA 1A4AA 1HQRA 4ELMA 1UJ3B 2NY6B 1FZMA 3BYYA 4MA8H 2CO1A 2C7UB 3GXNA 4X9HA 4I3SL 2EUWA 2COVD 4AV0A 3PWJA 3JWOL 4LSRL 4UB0L 5T5NF 4U3HA 1DLHB 3G9AB 1JK8B 4FKKA 2N0MA 4XX1G 4U05A 4IHOB 4DEUA 3T0EE 4WHTB 2NY2B 3G6JB 1Q0XH 1TENA 3WLBB 3BKJH 1N10A 2OCCB 5AQ0A 5JIPA 4U3CA 4PJCE 2WOBA 2AV7B 3NZSA 3PUCA 1A2YB 3V6OE 5KSVB 2BWIA 2X4PB 5GS0H 3APNA 1KB5B 3CFDB 4RZKA 3LPFA 3NUKA 4L23A 1UATA 2AJXL 5CZRA 1DBMH 1N6VA 3V55A 5AD0B 3KLHC 3NFSH 2CNZA 3MLWL 4Y8DC 1KGJA 1A9EB 3AB0B 3SZKC 3IFNH 4NQCB 5EU7E 3K6IA 3D85D 5H37H 4ZMPA 5AAPA 1JF6A 2OPCA 2MPAL 5BPPA 1XF4A 3ZBMA 5E4OA 4ECNA 3N9GH 1XGQA 5DD3H 3VYNA 1QTYT 4J1UA 4RGOH 2HWZH 3CZSA 4QRQB 8CGTA 3ECUA 4DEPC 3D3VB 3TF7C 3PWNB 4JPWH 4F2EA 2R23B 3O4LE 4JZJB 3RNKA 2Z8RA 4NXKA 3NRFA 3TZVD 2ZSVB 2QVIA 4GXFA 1J8HA 5DLML 4APQA 5T3XH 5IMKB 2B5IC 5AKTA 3UXFA 4N8VG 3W57A 5D4JA 1AANA 3SGDH 5H94A 3JV6B 1PZSA 4FN0A 1CF8L 3RZWA 1J8HD 5IJVA 1RU9H 3W38A 5A2AA 3WFDL 4PS8A 3WYRA 3KYAA 4YHPB 3P30L 2B4CH 3P77A 1ZVSB 3LQMA 5BMFH 5FYKH 4URKA 4ZD3H 1E9OB 1HNYA 3ABKB 1ZK9A 2QBWA 3W9DA 3F5WA 5D7SL 4DETA 1NKOA 5E1HB 3DURA 3OXSB 5DZ9A 4JPKH 1Z32X 1Y1UA 3Q8BA 3HZMB 4KUCF 1JZIA 2R2HB 5GPRA 4YZFE 4AQ1C 2B59B 1FVEA 4Y1AD 2DQJH 1U3HD 5T1KD 3DOHA 4OSUH 4XPFL 2V7HA 3P3UA 3P11L 4M7LL 4NGHL 3GSXB 4R7NB 2ENQA 1SUHA 1U4EA 3DIDA 1FWXA 25C8H 4HQQL 3Q5TA 3HC0A 3IFOA 5GISH 3VRLE 3W3BA 4Z3HA 2YAMA 4ZUVA 1JI1A 3VD3A 3QIUB 4ZXBB 1EDHA 4H44C 4FQ1H 3TL5A 1VENA 1AD9A 5I0WA 4HJGA 2ID5A 1D7CA 5CEZE 3CK0L 3D12B 3PF2A 4NUJA 3UX9B 2KT6A 4Z7NF 3G5ZB 2AXFB 5EZIL 1NQBA 4AV5A 5SV4A 3HI5L 2FJUB 1M2OA 3VDBA 3RX5A 1E3XA 4KKLD 2LFGA 3RPIB 3RWCA 2ENSA 4XP5H 1TKWB 3V5KB 3E8UL 1TFPA 2Q76A 3RGHA 3TN0A 3IDJA 4F7CB 2GKIA 1SLUA 1JTOA 5J6SA 4U6VL 3LB6D 4J3OH 1P5UB 1HU8A 1PKQE 2R27A 3L5JA 5FYLH 1G7JB 2P46B 3ARBC 4GRLC 2JKRM 1L7IH 4FXKB 4YHYC 4PUBH 3K6DA 4BFEA 3BVXA 3G04B 3B1TA 3TPUB 3O41A 3KS0H 3UYPA 5DWUL 2R2EA 1WFJA 3VG0H 4X6CE 1HZLA 5C07E 4JFYA 1F6AB 4K9EC 4J3UA 3WUZA 1I9IH 1TQBB 4YSOA 3GNMH 1PZ5B 1TVHA 3LNGA 3ULSA 5DYFA 1MXDA 4KRNA 2ZP9A 4JO5A 1G1YA