4B9UA

Structure of the high fidelity dna polymerase i with an oxidative formamidopyrimidine-dg dna lesion -da basepair in the post-insertion site.
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9uA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9uA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9uA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9uA01
4Z6DA 4F4KA 1JLGA 2OPPA 1U49A 8ICZA 2I9GA 1RDDA 2ZJ5A 5I3UA 2R7YA 1D9FA 1B22A 2IS3A 3DRPA 4KLFA 3NF9A 2ZUDA 8ICXA 4OKKA 2ITGA 1BI4A 4N56A 2RDIA 3OYFA 4DTRA 2D0CA 8ICPA 5DB9A 4ECTA 4F4WA 3FFIA 4OPJA 3H4BA 4IQTA 3SNNA 4WE1A 4F5RA 4I2QA 8ICJA 2HHSA 2G8UA 2F1IA 5J2BA 3HP9A 4LZDA 2H5XA 5JUMA 1YTAA 4YMMA 1S1XA 2O4IA 2UVRA 5IIOA 3MGIA 4O3NA 4CJRA 1ZETA 2W9BB 1JXLA 1S1WA 1A77A 2QKKA 3C23A 5BPCA 4GXKA 2HHVA 3HYFA 4M47A 4B9UA 1TL3A 8ICLA 1ZQUA 3JPSA 4O44A 1S10A 1KFTA 2XGQA 4ZTJA 4PPXA 3UPQA 4F4XA 4DOAA 4YD2A 1ZQGA 3O4NA 3JYTA 1LWCA 3PX6A 3GV5B 2P6UA 3KLHA 3OYNA 2KZZA 4I9LA 3QESA 4ECUA 3OYCA 2OA8A 3L3VA 1IXRA 3ZSWA 3HL8A 3HSTB 4M9LA 1WSIA 2FPKA 5HHIA 2FLNA 5KFAA 3QEBZ 2IDOA 1TAUA 4DSJA 1QHTA 2W9AA 4KLOA 5DBBA 4O9MA 4O5BA 3TFRA 1XC9A 8ICAA 4FJ5A 1B43A 2G8KA 3TAEA 4PHDA 4I7FA 1IH7A 4DL4A 3GIJA 3E01A 5DDMA 2BCRA 2ATQA 3C94A 3GIMA 1NK0A 3QERA 3QEWA 3LAMA 1BHLA 8ICSA 1UT8A 2BPGA 3QNOA 2DPJA 1JXEA 4M9HA 2IHMA 1X9MA 1RDAA 4DF4A 2KZMA 2YV0X 5CWRA 3NGZA 4B3OA 4O55A 2ZTDA 2C2RA 3ZSXA 9ICWA 3RWUA 2I1QA 3RBDA 8ICRA 4YG2A 4JS5A 5DK5A 4CJUA 4J2EA 1ZJMA 3C95A 3PO5A 4HUFA 1NJWA 4M6WA 1L3TA 1DTQA 4OLBA 1IM4A 4HUEA 8ICWA 2KTQA 3Q8QB 4JS4A 2R8GA 4AHSA 4Z0UA 1QSLA 2DFEA 1I39A 4GXJA 3GIKA 3AO2A 3P83D 5J2MA 4RZRA 5D49A 5EWGA 4QZDA 2OPSA 3THVA 5J1EA 4F3OA 3GDXA 2VG5A 2HNYA 4KLMA 4ICLA 3UXPA 2HHQA 1EXNA 4TQRA 5KFRA 2ZE2A 4W5RA 4LH5A 5KTQA 3OYJA 3MR5A 1ZBHA 4YCXA 4XUSA 3OJUA 4C8OA 3CM6A 3JPNA 4H4MA 2DTUA 3HO1A 2Z1GA 4E7JA 5DDYA 2RKIA 4ECWA 4OJRA 4DTMA 4RQ8A 4UB2A 3JPPA 3PW0A 1HQUA 4J9KA 4RQ4A 4ECYA 3TAQA 4RQ0A 4ECZA 7ICPA 2C28A 1YVUA 2ZTEA 4C8KA 3HW8A 1LWFA 3I0SA 2IBKA 2VWKA 1ZQVA 3AO4A 4EYHB 2E4LA 4KI6A 3KHLA 2DFLA 1XO1A 5KFFA 3VQ9A 2YNFA 3O3GA 2Z1HA 4QWBA 4ED2A 2ZTCA 4FLUA 9ICRA 5J0YA 2BCSA 2HHUA 3F73A 5L1JA 5KFXA 4BDPA 2Q3SA 4F93B 1NJXA 3RJGA 5KFTA 2RN2A 3M8RA 3MFIA 4ECVA 1ZQWA 3V81A 1JKHA 1NOYA 5HNKA 3BQ1A 4BWMA 3RB3A 1NKEA 4IG0A 2G8VA 2W9CA 3ISBA 3RH5A 5L1IA 3I8DA 3OHAA 3Q8MA 1EKEA 4E89A 4TUSA 4KITB 4M3UA 5J2NA 5DQIA 2J6UA 1VSMA 1KTQA 3LWMA 1X9WA 1FKOA 3NTUA 5KT4A 2WTFA 1HMVA 4ELTA 4KRFA 5CA7A 2UVWA 3K5LA 3C6UA 5DB6A 9ICAA 1ZQLA 4G1QA 3LP0A 4CHOA 2NRXA 3ZD8A 1JLEA 3KHRA 4TUPA 1X9SA 3KLGA 2HNZA 4CCHA 3D45A 8ICGA 1X1PA 2P1JA 5KFSA 4EBEA 3OYGA 4CF2A 3NE6A 1BPEA 3QZ8A 4YMOA 2XY7A 1I3AA 4Z4FA 4J9SA 1HJRA 3KIOA 2B5JA 1ZBUA 2VA8A 3LZJA 2BR0A 4PH5A 4EYIB 1VSHA 2VA2A 1T4GA 3MR6A 3VQ7A 1VSDA 4NLGA 2FLPA 1ZQEA 4M9JA 4JRQA 2BQRA 3IS9A 2D0BA 1ASVA 5DBAA 2EX3A 4ECXA 4CFAA 4OKEA 2JEFA 4HCBA 5J2IA 4UAZA 1B9FA 3UQ0A 4AHUA 4KLQA 1DLOA 5SWMA 2V4RA 1IKYA 2BHNA 1WAJA 2RDJA 2FBXA 4DWIA 2X6NA 1ZQYA 1NK9A 1W9HA 2W9BA 4P4OA 4CEAA 4IQWA 1ITGA 4CIFA 4IKFA 2KFNA 1T7PA 2ISPA 2HHWA 3HP6A 2HHXA 1SKSA 3K2PA 4J2DA 9ICJA 4QZCA 3H4DA 3OYEA 2BPCA 1SL1A 4NLNA 4Q8FA 1A5XA 1V9PA 5KFKA 1TKXA 5KG2A 3C1ZA 5CZ1A 4DLEA 1RTIA 2G8FA 7ICFA 1ZQQA 4FK2A 4RQ2A 3TAFA 1NK4A 4AILC 2PY5A 4I2HA 2M9NA 3H8WA 1Z00A 2Z1JA 3KLFA 4I2EA 3ORYA 3SV4A 2F8TA 1XU4A 5KI6A 1UAXA 3RMAA 3HK2A 2YNIA 4DFPA 1S0MA 5D46A 4O3OA 1CUKA 4FJMA 4R66A 1HRHA 3QZ7A 1RT6A 5CYQA 1ZBFA 4NY8A 4OVLA 3MR2A 4KB0A 4DTOA 1C0UA 1KVAA 2W42A 2AU0A 1EXQA 1ZBIA 9ICKA 3MEEA 3DLEA 3U3GA 3KHGA 2KN7A 4O3RA 3TFSA 3RMCA 4CF9A 4H8KA 3DLKA 4M3ZA 3OSNA 4FJKA 2X74A 4DTSA 3OYMA 3K58A 3VA3A 3V6JA 5CJ7A 4DS4A 5CB1A 3VQCA 1ASUA 4M3XA 3C1YA 3Q8RB 1T3NA 4J9QA 7ICNA 4JV1A 7ICOA 2W8LA 4RW7A 4P2HA 3HM9A 5KFHA 5IILA 4QZEA 3UXNA 5DGAA 4DOBA 8ICEA 9ICNA 2BCUA 3ALYA 3AO1A 3QNNA 3UXOA 2W9CB 4LSNA 4NLZA 3NF6A 3AA2A 4CJ3A 4IRDA 5HRSA 1TKDA 3C21A 4KLIA 4K4HA 7ICVA 3VQAA 1D8YA 2ZUBA 2XCPA 1RBVA 1CEZA 1JX4A 3RJKA 4ED6A 3RR7A 3VQPA 4UAWA 2FMSA 1L3UA 4UBCA 2XC9A 3RRHA 4XA5A 1BVSA 4NCBA 1ZQMA 1RTDA 4E3SA 1K1SA 1BGXT 3ISCA 3ZT2A 2JEGA 3OHBA 4I2IA 1TKZA 3LPUA 1VSKA 2V9WA 1SL2A 1BL3A 5KG6A 4F8RA 4CJSA 5KRSA 4FJGA 3V1QA 4H4OA 4I9QA 1C1AA 5KG7A 3B6OA 4F91B 3MXJA 3OS0A 4DEZA 4MF8A 9ICOA 7ICQA 1LV5A 4QWEA 3MECA 3DOKA 3TR8A 3PMLA 4FLXA 2XY8A 4FJLA 2XCAA 3OYDA 4R65A 4RW8A 1WAFA 2G8HA 3NGDA 3KJVA 4NCAA 4DS5A 4Z4EA 4FZXC 1ZQNA 3FDSA 4BXOA 3SQ4A 4CJEA 1BCMA 5HROA 1RPLA 3NGYA 3PV8A 1ZQOA 4FJ7A 5J2JA 3K5MA 5HRNA 1BPBA 4RT3A 3CQ8A 2WONA 5HMMA 2IHNA 3AA3A 4CEOA 2IMWP 4DSLA 5CY4A 4RPYA 3LPTA 4E7HA 3QINA 4N76A 3IRXA 3K5OA 1BIUA 4Z6EA 5KG4A 4PGYA 1ZQPA 4Y1DA 9ICFA 3ZDDA 2IA6A 7ICMA 8ICCA 4I2CA 3OYBA 2AQ0A 4KV8A 4Q0BA 3SUNA 5KFYA 3SYZA 3EZ5A 1J9AA 1RBUA 4ED7A 1ZQBA 4CGIA 1QSYA 3CFRA 4PGXA 3L2QA 5EWEA 5E41A 3TI0A 4EZ9A 3QE9Y 4GW6A 5J0RA 1ZQDA 4Q5VA 1U45A 5KFWA 2VA3A 1Y97A 4BE1A 3K59A 4FJ8A 3IHQB 4Z6CA 3F9KA 5DQHA 4M9NA 5JS2A 2Y1JA 1Q9YA 1WSFA 4CFDA 4DQPA 3MDAA 4IFVA 3LWLA 1HQEA 4UBBA 1MQ2A 7ICEA 1VRUA 1Z00B 1TV6A 1FK9A 3BQTA 2AJQA 4F5OA 4HHTA 1KLNA 3EPIA 1L3SA 4B9SA 1RBSA 4OLAA 1NJZA 1S6PA 3G6YA 4MFCA 4KLGA 1UOCA 4RQ5A 3G10A 3FYHA 3V7JA 2HNDA 7ICKA 4M04A 2G8WA 3QEVA 4DSKA 5F9LA 1RT5A 2EHGA 4W5NA 8ICUA 1C1CA 2ZD1A 3OYHA 1KSPA 4IG3A 4AH9A 1NKBA 3ZDBA 2YNGA 4PHEA 7ICIA 4O3SA 3SUPA 3S9HA 3Q8LA 4W5QA 2QK9A 4M2YA 4RQ6A 8ICQA 4L8RB 4RQ3A 3PR4A 4EBDA 1ZQSA 4CGDA 1N48A 2UVVA 4DQRA 5HRPA 1XI1A 4FLZA 4JLHA 1U47A 1S97A 4FW1A 1EP4A 5C42A 3RMBA 4DOCA 1ZQCA 3K5NA 3V9XA 3OS1A 4KKOA 4QZ8A 3BQ2A 2P5OA 4KHNA 1UA0A 1U04A 2XGPA 3E2EA 3ZT3A 1S0VA 2KFZA 1SZPA 2C22A 4I2DA 1RCHA 3JPQA 1F21A 4PA1A 4CJKA 9ICEA 4NYNA 5KG3A 2YNHA 1WCLA 3RTVA 1ZQRA 3L2WA 1CXQA 1YTUA 4CEZA 1KFDA 5KFCA 1TVRA 2YKMA 2FPLA 1K1QA 2VG7A 2OZMA 8ICFA 2WOMA 3AVMA 4EP5A 8ICTA 3ZSZA 4RPXA 4GXIA 3VQBA 1GOAA 1KLMA 3T1AA 2GUIA 2P5GA 3K75D 4LY7A 4KLSA 4B9TA 3AA5X 5KGXA 4IR1A 4J9RA 2BGWA 4B8CA 3NGIA 4BE2A 4BXOB 2J6SA 1Z26A 4TSXA 4QW9A 4R64A 3GQCA 4KFBA 1D8LA 5KFBA 2FC0A 3QEXA 4QWCA 2ALZA 3PUFA 1A76A 3KD1E 2W8KA 2BCVA 2MUTB 4CEFA 3ZT1A 4OGEA 5J0PA 5KT6A 8ICMA 4KPYA 1LW2A 2YHBA 3BDPA 1WCNA 3NH2A 2HMIA 4ED1A 1S77D 4JWMA 1SV5A 2IC3A 3ASMA 3QIPA 7ICGA 1HNIA 2NRTA 4DL5A 5CZ2A 4CIGA 8ICIA 5KGWA 5KT2A 2AGQA 4CGHA 1ZQFA 4M3TA 5J0WA 4JRPA 1S1TA 3V1OA 2B4JA 3WNFA 4N47A 2VWJA 4QOZB 4R63A 4DMNA 5F9NA 5L9XA 4EBCA 4DTJA 1CZ9A 3OYKA 4DFMA 4UB3A 3GILA 9ICSA 1QLNA 4Y1CA 3RJEA 3BGRA 4B9VA 4KTQA 1BQNA 4O5EA 3P5JA 2B21A 4TURA 3WNHA 8ICVA 4M3RA 4O3PA 4DSFA 4YNQA 1TAQA 4YN4A 1RBTA 1C6VA 2JEJA 5KFMA 4QZBA 1AROP 3KK2A 4RT2A 4I2AA 4Z6FA 1HJPA 3JPTA 3DI6A 4CF0A 4C8LA 4J9MA 1RYRA 5BOMA 4F3TA 3NAEA 2Y1IA 2FMPA 1GOBA 3G0ZA 3MAQA 1ZQTA 4KHUA 2ATLA 4JK1A 3KK1A 3M8SA 4DQIA 4M3WA 3NH1A 1VSEA 3PW2A 4X5VA 3QEPA 3DLBA 4DO9A 3MGHA 1JLAA 4M3YA 1L3VA 4PWDA 1MC8A 4UB5A 2GBZA 1J5OA 3BJYA 4FXDA 2FMQA 2HVIA 3EW9A 3T5LA 2X78A 3PVXA 1VSIA 2PZSA 1CLQA 4FS1A 5HP1A 4QZIA 2XO7A 5KT3A 4QZAA 3K4GA 4PQUA 1FKPA 3NFAA 3V9UA 1DOQA 2A1JB 4CEBA 5KT5A 4CE9A 1QSSA 4KO0A 4N41A 5DB8A 4C8MA 4C8NA 3SJJA 4QZ9A 3C2MA 3HPGA 4BWJA 2GV9A 4LD0A 2YKNA 4YR2A 2AGPA 1DGSA 3NCIA 2OPRA 3Q8KA 1T05A 5D3GA 1QE1A 4NXZA 4JUZA 3CYMA 3QLHA 5J29A 4E7IA 3B0YA 5KRTA 3NF7A 4DTPA 4IQUA 4XRHA 2UVUA 4CJTA 3T5KA 2DFFA 1N6QA 3M8PA 1JL1A 4AHRA 2A1SA 2X6SA 3VA0A 1RBRA 4KAZA 3C5GA 5KFIA 4KLEA 1SL0A 4QAGA 4F2RA 5CYMA 3VQ6A 5KFLA 2F96A 4DFJA 3NBPA 2OWOA 5HLFA 5KFEA 2E6MA 3S3MA 4ZH4A 1VRTA 4B08A 3I0RA 4O4GA 3MBYA 4F2SA 1RZTA 4DQSA 2PYJA 2RF2A 1EX4A 4FLYA 3JPRA 1WSGA 4PHPA 5C24A 5CP2A 1KVBA 9ICPA 3H40A 4IDKA 3ZDCA 1KVCA 3O3FA 4CGJA 1RT2A 9ICMA 4F5PA 4FZYA 2PFPA 4TUQA 4E1NA 4QZHA 2V4QA 4M9GA 3MR3A 5KFOA 4DL3A 3UIQA 4ECRA 4PUOA 3V6HA 1ZJNA 1TV9A 1TVAA 3V9WA 5KFPA 3OJSA 3O3HA 4UB4A 1S0OA 4DTUA 4CJVA 3NHGA 4DSEA 4FBTA 2F1HA 1MU2A 4YXJA 2BANA 3M9MB 5J2EA 1NOMA 1QTMA 2PXIA 3AU6A 4F92B 3O4QA 3PMNA 3DLHA 4M41A 3L2VA 4GLXA 8ICNA 4ECSA 3KHHA 3ITHA 4B9MA 4NYFA 4FZZA 3SI6A 4I29A 3MEGA 3B6PA 2BQUA 2Q0ZX 1BPXA 3AVIA 3VN5A 3S3NA 4O5KA 4Z4CA 1D9DA 4LSLA 4KTZA 2HVHA 4JWNA 3PW7A 4B9LA 3KD5E 5HBMA 3LDSA 1O1WA 3SUOA 1QS4A 3PW5A 5HHHA 1LAVA 4UQGA 2MAXA 1C1BA 3LZIA 1JN3A 3T5HA 2JGUA 4FJHA 1Y88A 3H7IA 4MEYA 3RAQA 4G3IA 4RUAA 4OPKA 3L2RA 5J2FA 4KHYA 3TQ1A 1VSFA 5J2QA 5SZTA 3JSMA 3SV3A 1N5YA 4HTUA 4K4IA 4N5SA 2F8SA 4KLJA 5J2AA 2Z1IA 2P6RA 1LB2B 3RH4A 5DG8A 1HNVA 9ICQA 4F5QA 5CHGA 3GV8B 3QEAZ 4HUGA 2ASDA 3ULDA 4FLWA 3MABA 3AVKA 2C2DA 5J0TA 1VSLA 4HCCA 3HJFA 3Q8SB 4E7LA 4CHNA 1S9FA 1ZQXA 4ED0A 4DG1A 2ZQBA 3ZSQA 4CHZA 2DPIA 4RQ7A 4DF8A 3AVLA 4BGDA 3LALA 1WNSA 4HVJA 3L2UA 3G6XA 3C5FA 4JV0A 1S0NA 5C25A 2ASJA 1KFSA 4RQ1A 3VQ8A 2ZJAA 5KFJA 1Z25A 2IAJA 3C6TA 5J2CA 4F4ZA 4KB1A 5L1LA 4LVSA 3LP2A 1RYSA 4I28A 1TGOA 9ICHA 3VQ4A 3TAPA 3ZDEA 4Q43A 2NRVA 3T3FA 3D0PA 4YQWA 5FROA 2D0AA 1RXVA 3EY1A 4ED8A 4CERA 1S5JA 3AVFA 4CESA 4KLUA 4FJIA 3SI8A 4FM2A 4I2GA 9ICLA 4KHWA 5DG7A 3VQEA 4FJNA 4GVMA 1ZQIA 4CK3A 3RJJA 1VSJA 4DTXA 1TK8A 7ICRA 2ZJ8A 4MQ3A 4E0DA 1BPDA 2MUTA 3SPZA 3DM2A 1D5AA 2G8IA 4YFUA 3PX4A 2HB5A 3OYLA 4DL7A 4BE0A 1GOCA 1S6QA 4KLDA 4FJXA 5DLFA 2BDPA 1IKVA 5J0QA 1K6YA 5IIIA 3K57A 2ASLA 4FW2A 1ZBLA 2R8JA 4I2FA 3IM1A 4YR0A 4DFKA 3NDKA 2JZBB 5DMRA 3ZT0A 3RMDA 3SUQA 3RR8A 4IBNA 1KCFA 4UB1A 1LAWA 3OYIA 5IIJA 3V6DA 1ZQAA 4IQVA 3RB0A 4CF8A 5J2DA 4FBUA 4DQQA 2ISOA 8ICHA 4CK1A 1XSPA 1BIZA 3U3YA 3HPOA 2FBVA 1IG9A 3AVNA 3H08A 1JXBA 1L5UA 1UWBA 3HX0A 1WSEA 3PY8A 3TWHA 2D5RA 5KG5A 1LW0A 4CHPA 4DL2A 3CFPA 3TAMA 1RT1A 3PR5B 2JEIA 4F50A 1HYZA 3AVCA 4RW6A 2IOCA 2RPIA 1JMSA 3TABA 4CFBA 5HP4A 9ICXA 4DL6A 2DY4A 4R8UB 4FJ9A 3ZD9A 1UA1A 3AV9A 1ZQHA 3RB4A 7ICTA 1RDBA 1Z3EB 4P4PA 3RJFA 4UAYA 4KN7A 3AVJA 3T19A 3V1RA 5FDLA 9ICUA 2HHTA 2OYQA 2PFQA 4M42A 4DU3A 2OZSA 4P4MA 4K4GA 4NM1A 5EU7A 7ICJA 3OGUA 5J2GA 3M9NB 1S9EA 3T5JA 5DB7A 4AHTA 3VQDA 3DOLA 1C0TA 4KTWA 3NH0A 5FRMA 2ZUCA 2FBYA 1QQCA 2B6AA 2A1JA 2XY6A 9ICVA 2BKEA 2AGOA 2FLLA 8ICOA 4BACA 2KZ3A 3LAKA 3DYAA 1S76D 4YXMA 5HRRA 2FPMA 4CJPA 3DMJA 1JLCA 4KMUA 2R8HA 2P66A 4NLKA 5TZVA 2LYHA 3DRRA 4RNOA 2YHAA 5CR0A 2QXFA 2O4GA 2GWSA 4CJ5A 4QCLA 1C7YA 3AVGA 5JS1A 4MFAA 4FO6A 3HT3A 3HVTA 5KFQA 3V72A 5IIMA 1IKXA 4KREA 2BPFA 4ECQA 2VANA 5EOZA 3SQ0A 1RT7A 4DTNA 5J0UA 2PI4A 7ICLA 4RU9A 4FK0A 3PW4A 3LK9A 3KKRA 4CHYA 1RTHA 3C2LA 4GC7A 4J2AA 4M0AA 3MXIA 5J0OA 2HW3A 1MQ3A 3HXMA 4J9OA 4KLTA 4CEDA 7ICUA 9ICBA 4AHCA 3RJHA 4O3QA 9ICCA 2C2EA 4YR3A 3G6VA 1JL2A 4E19A 4DU1A 4Z4HA 1KRPA 5DQGA 4FK4A 5IIKA 3V4IA 4KHSA 2IGIA 4CGFA 1W0HA 4OGCA 4O5CA 4MFBA 4J9NA 1BI4B 2A1RA 1JLBA 3GIIA 4PHAA 4F4YA 3RRGA 4CECA 3HWTA 4YD1A 1TK0A 4XIUA 3SQ1A 2XY5A 3CM5A 4CJFA 3CFOA 1PZNA 1G15A 5DKWA 3C2KA 1S1VA 4CJWA 3KTQA 1Q8IA 4QW8A 4GC6A 3U6FA 1MSWD 4IRKA 3Q8PB 3A2FA 4I2PA 4FM0A 1NKCA 3QIOA 4CHQA 5KFVA 2I5JA 3S3OA 1R0AA 4R5PA 4CEQA 1IKWA 2PYLA 2AQ4A 3CG7A 1T03A 3VQ5A 5KFGA 5D4BA 1T8EA 1N56A 4Q8EA 2P51A 2NRZA 5J0SA 5J2KA 4FCYA 2R8KA 4O0IA 3PO4A 3AU2A 5KFUA 5KG1A 2R8IA 5KFDA 4FS2A 4I2BA 4CJLA 1BISA 1A5VA 1B9DA 5T7BA 4FM1A 9ICTA 4Z4IA 4K8XA 4IR9A 4CJQA 1A5WA 1SKWA 5DG9A 5KFZA 2PFOA 1H38A 1S1UA 5J2PA 3RB6A 4I27A 4QWAA 3GV7B 1RT4A 1X2IA 3V7LA 1BQMA 3JPOA 2XRIA 3SPYA 3RBEA 8ICYA 4MFFA 3V6KA 4KI4A 4ELUA 2VG6A 3M8QA 1CXUA 1RILA 4M45A 4CGGA 4FYDA 4RNNA 5DBCA 1U9LA 1XHXA 2BCQA 4RW9A 3RJIA 3N97B 1VK0A 5K14A 4KHQA 4CIEA 1TKTA 3ZCMA 1BPYA 3AUOA 2J6TA 9ICGA 3ZSYA 3KK3A 4O0JA 4OKJA 3QETA 3AA4A 1YT3A 4B9NA 2XHBA 3V9SA 1HUZA 1HPZA 1COOA 4HYKA 1DTTA 3BQ0A 2PFNA 4NM2A 3ZSRA 3SCXA 3RH6A 3KLEA 2JLEA 3IAYA 4J9PA 4YMNA 3IG1A 5BOLA 4FLVA 3N4MB 3LANA 3TARA 3L3UA 4RNMA 3ZT4A 3L8BA 2QKBA 9ICIA 4W5TA 4DSIA 4XQ8A 3WNGA 2NUBA 4DU4A 4J9LA 4ID1A 4M6WB 3MDCA 1WSJA 2E6LA 5C5JA 3MFHA 2LSNA 3ZSVA 4AHVA 3TAGA 3ZSOA 2JZBA 3EPGA 1XWLA 1LWEA 3WNEA 4E1MA 4ZHRA 8ICKA 1WN7A 2DFHA 3H8JA 4DLGA 4YVZA 3HVRA 3ISNC 3SQ2A 1NK8A 5DLGA 2KW4A 4CK2A 3P1GA 3AO5A 5IINA 5I42A 1XSLA 4FVMA 4YFKA 4RUCA 3DLRA 4W5OA 3RAXA 4JV2A 1JLQA 2F1JA 1SUQA 4R8UA 8ICBA 4I2JA 3H8SA 1CZBA 3LP3A 4TQSA 4PY5A 1NOZA 4MF2A 3AO3A 5FRNA 1RTJA 1FXXA 4BDZA 1SKRA 4J2BA 3DLGA 7ICHA 3DRSA 4CEEA 1TL1A 1HYSA 1NJYA 1S9GA 4YP3A 3TANA 4QZGA 4Q45A 4QWDA 4ED3A 4EZ6A 4MEXA 4NCGA 4B8AB 4KLHA 1REVA 4ZTFA 2PI5A 1TFRA 1JLFA 3OSPA 3HPHA 4RG8A 4BDYA 1ZQZA 5J0XA 1J53A 1XHZA 2W9MA 3PNCA 4LZGA 1B92A 1Q9XA 3AVHA 1ASWA 1HUOA 3V9ZA 4Z4GA 1WSHA 3PX0A 3SZ2A 3OS2A 1U48A 4K8ZA 1ZQJA 5HMLA 2FBTA 3ZDAA 3ETLA 1RXWA 3KKSA 5KT7A 7ICSA 2NRWA 1EETA 3LP1A 3VQQA 4ELVA 1BPZA 4EP4A 4E7KA 4CJ4A 4LH4A 4KN4A 4CFCA 4RW4A 4ID5A 1KEJA 4GMJB 4FJJA 1XSNA 3M9OB 2BQ3A 4KLLA 1NK6A 5DGBA 5EWFA 3OYAA 2BGGA 1ZYQA 2KQ2A 1J54A 3LDAA 1HYVA 1KDHA 1RNHA 3KLIA 3UQ2A 4PGQA 1NK7A 2ETJA 3B0XA 3EYZA 3OVNA 4RPZA 2BE2A 1IO2A 1NK5A 3EWAA 4IFYA 1TK5A 3OY9A 3QO9A 1U4BA 3QEIA 4FLTA 4QZFA 3ISDA 5KG0A 5J2HA 1BCOA 3AVBA 4F5NA 4IRCA 1WLJA 5KFNA 3MEDA 3V7KA 1RDCA 1ZQKA 2OPQA 1UT5A 3NF8A 4Q44A 1C0MA 3GFKB 3AVAA 1XS9D 5L1KA 3MXMA 1JIHA 4EEYA 1RT3A 4CF1A
chains in the Genus database with same CATH superfamily
3KZBA 5AIBA 2AH5A 3A5MC 2ALYB 4WKRA 2XI9A 5I3UA 2R7YA 1R59O 3DRPA 1S72S 3NF9A 2FVRA 3CC7S 2ZUDA 2Q66A 1NDLA 1RADB 4OKKA 1VBYA 1KN6A 1BI4A 2RDIA 3U26A 3OYFA 2KMDA 1Z2LA 3FFIA 2IOHA 2MGZA 1YITS 4IQTA 2QSFA 5AZIA 1IBKJ 3QU9A 1LXNA 3JAMU 3M30A 3ZLJA 2ZBCA 8ICJA 2G8UA 3EZUA 4GVBB 1U1RA 3DDHA 4LZDA 3EMTA 2V2KA 5JUMA 3TTFA 1S1XA 2UVRA 2J4RA 5IIOA 3KXDA 4CJRA 4B3SJ 3UKRB 5KOWA 1ZETA 3OTDA 1Q5VA 1A77A 5DZ6A 2FGCA 2QKKA 4GXKA 1RK8A 4M47A 4U67Q 2B4PA 8ICLA 5AM0A 2BJ3A 1FCAA 2H48B 4A48A 2XGQA 1ZM3A 2JZ5A 3UPQA 4F4XA 2RRAA 3O4NA 5GMKa 1QVFR 3D3BJ 1LWCA 1VAZA 1S4FA 3PX6A 2U1AA 2KJ8A 2P6UA 3GPAA 4YMEA 4A5BA 3P6YC 5CEHA 1OJ4A 4H0PA 5LMNJ 3N4WA 1OPIA 2JDJA 3KDOA 2HG4A 3G8SA 2VC1A 3D0IE 4ZVTB 2DR8A 3W5YA 3HSTB 3TEGA 3CI5A 3OLAA 5B5EU 2ADBA 3SXLA 2FPKA 4LF4K 2IDOA 3A4TA 3QEBZ 4QYZJ 1QHTA 2LI6A 2MKYA 4LF7K 1UZHA 2DCLA 2ES6A 2YNIB 3WUHA 5ETMA 4NXMK 3I4HX 4X64F 1KEKA 4DR3F 1FDAA 8ICAA 4WQ5C 1K8KA 4HTLA 3CC2N 4I7FA 1RT6B 2G2OA 4JP8A 4ZJQA 2HF4A 1AFJA 3GIJA 4ZP9A 4CD3A 3AA8A 4NLPA 4ZDNA 4JAXA 5AQKA 3IG5A 1FO4A 2RE1A 3QU4A 4NWIA 3IV6A 3GIMA 3QERA 3LAMA 1NM1A 1UT8A 1K0VA 3QNOA 3LO3A 1OXJA 4LR9A 1X9MA 2H3VA 4P6QA 3M7VA 3L7UA 2Z2ZA 4B3OA 3H6EA 4O55A 1KAZA 1NU4A 2EG2A 5D6GA 8ICRA 4YG2A 4J2EA 4OX9F 4ZKAA 3C95A 1BXNA 2R2TA 2FDNA 2KG0A 3Q8UA 4KH1B 4LSNB 2OCEA 3BGUA 4NYZA 3DDIA 2HIYA 4CDGA 1J2MA 4AHSA 4Z0UA 4CLZA 3PHEA 1I39A 1SQFA 5LT5A 2POKA 3CCUN 4QZDA 2OPSA 1VQ9N 3THVA 2NYVA 3GDXA 2O67A 2VG5A 4USAA 2HNYA 4KLMA 4ICLA 2HYIB 3GFYA 1LKZA 1URNA 3T9ZA 3M6ZA 2LA6A 4K59A 3MEDB 2WMMA 4W5RA 2ZH7A 2VPZB 4LH5A 5KTQA 4ZJOA 3TACB 1WELA 2KHOA 4YCXA 3OJUA 1CSJA 5ALQA 2P9UA 2KO1A 1F44A 5JMNA 4C8YA 3SFUA 4PL7A 2RKIA 4OJRA 4ZP7A 2MXYA 3OPKA 4RQ8A 1K8AT 2CWXA 2ZHBA 1TYQA 4WCEQ 5CZVA 4RQ4A 2K7KA 2KXHA 2DHHA 2EW9A 1RABB 4J90A 3A8IA 2V34A 5B0FA 2OSRA 2XYGB 2PT0A 2VWKA 3AO4A 1ED1A 5ALSA 2JFKA 5T14A 2DFLA 1GTEA 2EK6A 4OJPA 3GCXP 5CCMA 3W2VA 4DHVA 3H1QA 3DRXA 2ZTCA 4FLUA 5ETNA 3MM6A 2HAFA 3DHXA 1RAFB 2H9ZA 2PFDA 2E9RX 3K17A 3RJGA 3CJ3A 5KFTA 3IMQJ 2HEKA 2WB1F 3CCVS 2X51A 1JKHA 5E3AA 1IQTA 4JKGA 1NOYA 1RISA 5HNKA 3LGHA 3KLHB 1KVKA 4HDGA 4DX7A 2IM2A 4RQMA 3AT1B 1CJVA 4BRIA 2OTJS 4IG0A 4ES1A 1GXLA 4ITSA 1JROA 3CW2C 3M3ZA 1E6YA 3I8DA 3MF5A 1VRUB 1TL7A 1EKEA 1FK9B 3M2VB 2GVZB 4KITB 4M3UA 4DR1F 2J6UA 4ACOA 3LWMA 5E84A 2QWLA 1X9WA 3LDNA 3OTOK 3D6MB 1K73O 4JI8J 1U2FA 3C6UA 1RHJB 2QA1A 3ENHA 3E01B 3M8YA 4GNIA 9ICAA 5AQXA 4ILLA 4CHOA 3QSYB 3ZD8A 1JLEA 3KHRA 1N61A 4Z37A 4RX6A 2YNGB 1X9SA 4CCHA 4O8KA 1X1PA 4EBEA 4U9RA 3NE6A 1TUWA 5D4LA 3QZ8A 1TZ0A 3UFCX 5JVGQ 4IOAL 1H6KX 4LFAF 3RRKA 4CD1A 3KIOA 1CJUB 3P96A 5JVHQ 4PH5A 1YIJN 3MR6A 2ZOMA 3LPYA 3IA0A 4XH5A 1B99A 2HS4A 2ZZMA 1Z19A 2A2DA 3OQ2A 4NB4A 3VVUA 2PBDA 5KAKA 4JRQA 1LCUA 1H73A 4YOXA 1ASVA 4ECXA 2QEXS 1XNRJ 4UAZA 4KKOB 4KLQA 2VH7A 2V4RA 4LVOP 2BHNA 2F3NA 3HVWA 1WAJA 1VQSA 2SXLA 4LF8K 1NBEB 2F76X 3VGUA 3KDNA 3D1QA 2IOFK 4ZOSA 4FF3A 2A41A 1DQ8A 3DDNA 4FKXA 2KFNA 4NLTA 2ISPA 5LL6d 3JS6A 4LFBK 4C4SA 3CE8A 1K5OA 3I82A 4RKUC 3K2PA 9ICJA 3W3SA 3FZMA 2ZNYA 5KFKA 1V9PA 1YWXA 3C1ZA 1Q8BA 2CXYA 5CZ1A 2Q79A 1EQ0A 5A6PA 1ICEB 2HS0A 3VEOA 2ITMA 2MZJA 3PG9A 4OX7A 4FO0A 1B0VA 1KLMB 1VIXA 3MI7X 3KKFA 3UE2A 2Z1JA 4EAHD 3K8VA 5C7PA 2YNIA 4DUYJ 3CJ0A 1TL4A 5LJ3Y 1NGEA 4O3OA 4KFBB 2UU9F 3FRZA 1NPKA 3L4BC 4R66A 1TQLA 1GX6A 5CYQA 1RT6A 1ZBFA 1C0UA 3KD3A 2E8MA 9ICKA 4NL9A 4X64K 4DR3K 1X5OA 4Z94A 2KN7A 4UOCA 3P4IA 2H3QA 3RMCA 3ZZOA 3NVMA 2QL5B 3H8MA 2X74A 1VQNS 2HS3A 1F6TA 2PGCA 5JLHA 3OYMA 3OPXA 3K58A 2RIJA 2MU2A 3FLCO 5CJ7A 3UR3C 5CB1A 3VQCA 1NM2A 3ATVA 4M3XA 2W2MP 3Q8RB 2DNMA 7ICOA 2V8VA 2KG1A 1N32F 1NRKA 1QQNA 5AXKA 3GCWP 2C2MB 4TNOA 2NLWA 4QZEA 5EHHA 3UXNA 5DGAA 2A42A 4DOBA 4BGBA 3IXQA 1R8PA 3H3NO 3O0FA 9ICNA 2BCUA 4M1KA 1S59A 3AB4B 3QNNA 1WNEA 2W9CB 2GMHA 4LSNA 5AM4A 3LM9A 2EK1A 2FVSA 1S72N 1EX8A 3NF6A 5HATA 4OX9K 3CC7N 3L95X 3HF5A 4K4HA 7ICVA 4C0OC 3VQAA 3ELHA 3KK2B 2XLIA 3RJKA 2OEHA 1HW8A 3RR7A 3O4WA 4OHWA 2JWLA 1YBUA 4UBCA 2M88A 4OZ3A 3RRHA 1VHIA 4F26A 3HBTA 1BVSA 1ZQMA 3TJ9A 3ZX3A 4U7BA 2AKWB 3TA0A 4MN4C 3R7SB 4P73A 4I2IA 4K2JA 3KK1B 3M6UA 1HBUB 3VERA 2V9WA 4W90B 3C0BA 1BL3A 5AKHA 4C3KA 2VPYB 5U47A 1HIWA 1HKAA 4ZS6A 1C1AA 3OS0A 1VGYA 2CQBA 1J5OB 3QFUA 1CQNA 4WFNL 4QWEA 2FJEB 1V4TA 4CO2A 4E1JA 2NUUG 4R65A 5AQSA 4DR7F 2G8HA 4K7QA 4DCCA 2QMUB 2H3FA 3SQ4A 4CJEA 4K0KF 4KGXB 3R6MA 1WEXA 3QWUA 2XMTA 4FJ7A 5HRNA 2ZIVB 2OPRB 5JICA 3CQ8A 2VWBA 1TFWA 2N3OA 3AA3A 4CEOA 4DSLA 5CY4A 2DGUA 3LPTA 1RCXB 5B0EA 2HZCA 4EEKA 4I64A 5ALFA 1PILA 2NNWA 1ZZFA 3H7HB 1ZQPA 2K3IA 7ICMA 8ICCA 1P9QC 4I2CA 4A2AA 3OYBA 1N36J 4RBUA 3SYZA 2CADA 3EZ5A 1J9AA 3WEEB 4K8RA 1VRTB 4JI7F 5EWEA 3SSRA 5H9FK 4H0TB 2HDOA 2EQYA 3TI0A 3QE9Y 3P8BB 2MPUA 3AM9A 4K25A 1K44A 4BE1A 2MJNA 1WEZA 1RDRA 3IHQB 4Z6CA 1NU0A 1O8BA 1Q9YA 4DQPA 3MDAA 3CCTA 3CIMA 3AAQA 3CCQN 1KQSM 3VR1A 1BC6A 1VRUA 1Z00B 5DDQC 1FK9A 3M2VA 4IYQA 1XUPO 2AJQA 2C3UA 1KLNA 4WQ5A 2F8EX 3NGUA 1MU2B 1NJZA 1UCVA 3DCAA 4MFCA 3OTQA 1UOCA 2VC0A 3FYHA 3V7JA 2YY3A 1VJWA 1ITPA 2AMCB 4IO9Q 4NEZA 3D9BA 1PAEX 4B3RF 4JI4F 1CZAN 1WC0A 3MEEB 4PWUA 4W5NA 2BOPA 1GQEA 2YNGA 1AUSL 3J81O 1P8ZA 1VDVA 4O3SA 3F5AA 3IFEA 3SMPA 3P3DA 2AX1A 1QHAA 3MOJB 3Q8LA 1WOSA 5F8IA 4C97A 2JHEA 4AQYF 2QK9A 2DR5A 1V38A 3CSKA 3EGZA 4RQ3A 3PR4A 4CTAA 4CGDA 1N88A 2DEIA 1N5YB 3MWPA 4LFAK 1U47A 2OELA 4FW1A 3VENA 5EX0A 2VUGA 1HNVB 3C65A 3B9JA 1YHQN 5AKZA 1L7PA 1ZM9A 4KKOA 2W7PA 2QXLA 1KXPA 4KHNA 3IM9A 2GC8A 4X2BA 3ZT3A 5ETLA 4CO1A 3CIPA 3N6NA 4NPOA 4PA1A 3ADAC 1Q16B 3L2WA 2W43A 2LEPA 4ZCKA 1KFDA 5KFCA 3UDVA 1VQ6S 2GH1A 1M5KC 2FPLA 4ZITA 2VG7A 2NRRA 2IBOA 5C10A 3CERA 2H65B 3CJSA 3LP2B 2PN6A 2WOMA 2WBNA 1H2UX 2N3LA 1RAOA 3BV8A 5AKJA 5HMWA 2WF9A 4J7CA 1KLMA 1GOAA 3A0IX 4KYZA 3ENVA 4LY7A 2FUG9 2BGWA 3BN4A 2EFNA 3KJVB 1FXLA 2A0FB 2Z57B 4BE2A 2J6SA 2CPEA 4QW9A 3G86A 2VBWA 3HFKA 4KFBA 1N33F 5KFBA 3RZAA 2ALZA 1A76A 3S6JA 2OTJN 5LJVA 3PIOL 2GIFA 2O8FB 2EPIA 5J1NA 3D7EO 4KPYA 2E1PA 4BG9A 2UU9K 3BBFA 2QA4G 3AQOA 5D4OA 1A0PA 3P49B 4WF9Q 3MCAB 7ICGA 3PSTA 2BJ9A 2W4DA 2ZZNA 4BRFA 4DL5A 5CZ2A 2K8GA 5KT2A 5ITHA 4B3TJ 2P6TA 4C9DA 3J8AA 3V1OA 1ZRNA 3THTA 2ZXHA 4P74A 3M8ZA 3V6DB 4JK7A 3VTHA 4BRMA 1EO1A 4DMNA 1TMJA 5L9XA 4EBCA 3DN9A 3N6LA 4C2MA 4DTJA 3OYKA 2MRLA 2DNGA 5K8OA 4I67A 1DXSA 1GXTA 1IQZA 1DQAA 4KTQA 4JI6F 1FEZA 3MCOA 2CKWA 4O5EA 1Y9OA 1NDPA 4TURA 2AX0A 3WNHA 4A61A 4JKFA 1FWKA 1LW0B 3VGTA 1C6VA 1VQ5N 4IKAA 5KFMA 2COLA 5LMUK 1IR1A 3KK2A 5ALOA 4DI6A 3BO3A 4QIGA 1HJPA 4C0BA 5E3RA 1FDDA 4F3TA 3NAEA 3KG4A 5FPMA 2UUWA 3TSQA 3P4UB 1EKSA 2C3YA 2YJEA 3KK1A 1HBUA 1I51B 3SDEB 4AL5A 1VSEA 3PW2A 5FDLB 1CJKB 3QEPA 4DO9A 1HNWJ 4CLKA 3ICXA 5FP0A 4UB5A 1TP7A 1J5OA 2GBZA 3BJYA 3C46A 3HHLB 4NLCA 1P8GA 1VSIA 1CLQA 2O3DA 1OUQA 2NQPA 4HHJA 1RZMA 3S8SA 3R2DJ 3CCJS 1DOQA 2FJAB 3CCZA 4CE9A 2Y1LB 1GLAG 3K2YA 4N41A 4C8MA 3SJJA 3E66A 4LD0A 1HKCA 4GMKA 2ZIVA 3NCIA 4KGZB 3DYAB 5JLFA 2OPRA 1VLOA 2I2YA 5MAOA 1U0HB 4JUZA 3QLHA 1IBMF 1TELA 5J29A 4DV4F 3B0YA 3NF7A 4GVLA 4IQUA 4YOWA 3WXLA 1YUWA 1UJ4A 3RSEB 3DRRB 3T5KA 2FHOB 2QARB 2RH3A 4AHRA 2RILA 3RYLA 2GVDB 3VA0A 4KLEA 1SL0A 4CWBA 1FW6A 4GV3A 4QAGA 1O08A 5CYMA 2OWOA 5KFEA 1ZS6A 2H3GX 1N54B 3WEEA 4ZH4A 1RP5A 1VRTA 3HVTB 4N8NA 1IKXB 2UV8G 4DQSA 2PYJA 2BXJA 2WF8A 5HVHA 1N5XA 5KQDA 4FLYA 4ERDA 1VQNN 3D6FB 2RQCA 1WKJA 1Q53A 1UW9A 4UOHA 3TP2A 4CGJA 4C1NI 9ICMA 4JI7K 2V4QA 4NZ6A 5KFOA 2GJIA 3E9PA 3ZZ0A 2AHOB 1KKXA 2B43A 1KONA 3OJSA 2JVRA 3A5OC 1I6JA 3L7OA 1YBTA 4BR5A 4CJVA 5F8JA 1S7HA 4FBTA 1MU2A 3M9MB 1ZXOA 3VALA 3AU6A 2DGQA 2LA4A 1FE0A 1WB9A 2E1MC 4F92B 1Y3KA 3O4QA 5GAEP 3DLHA 5ETVA 3KHHA 5F0UA 4B9MA 3CMQA 4FZZA 2M9KA 1HARA 4I29A 2DR7A 1LW2B 1NNDA 3KNGA 1XMQF 2YWKA 1EJ7L 5CE3A 2LQ9A 4Z4CA 1D9DA 2HMIB 5C12A 3IDWA 2HVHA 2F4VF 1NZPA 4B3RK 4JI4K 3KD5E 2HVDA 1O1WA 1HNIB 2MQQA 5AJ3J 1FTRA 2E8NA 1PK1A 3BR9A 3T5HA 3MMBB 2ABYA 4OX6A 2KV2A 3RAQA 2Y8YA 2KRRA 4RUAA 2Q6BA 4OPKA 4KHYA 1ZBTA 2VOOA 3W2WB 1N5YA 5IWAF 3EXYA 4PYDA 4N5SA 2Z1IA 5H1SQ 1HNVA 4IFEA 4JN4A 2Y3YA 1HHSA 1M6YA 5G0RB 3QEAZ 2GAGC 2KVCA 3QT7A 2CQCA 3J80U 5J0TA 4DV2F 1VSLA 4HCCA 5E5NA 2Z58B 4CO0A 4Y2IA 2QYCA 3ZSQA 1BA0A 1SXEA 2QA4S 2A6AA 1SIJA 1U26A 5J2PB 5FJ4A 4X4NA 2LM1A 1R27B 4HVJA 2ZHOA 3VMFB 2HOEA 3MPWA 4U6PA 3N4PA 2DGOA 4XAKA 2IA0A 1KFSA 2DYAA 1PJ7A 4RQ1A 3E9OA 1OSDA 2I9SA 4EMDA 5AE2A 3U1LA 5ALMA 3M8QB 1Z25A 3C6TA 4F3QA 1IUJA 5L1LA 3LP2A 3VCDA 2MJUA 4I28A 2FQQB 4RW9B 1TGOA 4BC3A 5AT1B 5LM7E 5AQFA 4Q43A 3T3FA 4YQWA 2MYFA 1JNRB 5FROA 3I1YA 3KK3B 1RXVA 4ZP8A 3W64A 3EY1A 3EUNA 4CERA 4JD2B 3CPEA 4RWXA 2EKYA 3UNGC 4FJIA 1X0FA 4FM2A 3BF4A 1DTTB 5DG7A 3LGMA 3VQEA 4FJNA 2GV1A 2UUAF 4CK3A 1DKGD 1VSJA 5ALTA 2O8FA 1PYSB 3FCVA 3CDUA 3FZ2A 1WF0A 2YPZA 3SPZA 1FJGJ 3H5XA 2H5JB 4E98A 1NMNA 2ERRA 1QQ7A 4YFUA 1T9WA 2HHHJ 5M1NA 1N33K 2VDHA 4KLDA 3D6JA 5HN0A 5DLFA 3DOMA 4EGLA 2ASLA 4FW2A 1GLBG 4IUFA 1S48A 2HCFA 3O9UA 3VEZA 1U6BA 4DFKA 3NDKA 4JI1F 1LWEB 1F9FA 3OYIA 3FAHA 4ZHRB 3V6DA 4K4SA 1ZQAA 4BRDA 1OY9A 1N2XA 2BJDA 3H3OB 4ILRA 1IJEB 5J2DA 1UW4A 4CNZA 1F60B 3DKDA 2MLZA 2FBVA 3HSGA 3AVNA 1JXBA 2J0QD 5ETOA 5T7LB 3HX0A 3PY8A 2X3GA 2D5RA 1YJNS 2E9TA 1REGX 1LW0A 2JLGA 4F50A 2KHDA 4FPIA 4JI6K 3BP8A 3NVZA 3HKZC 1SUQB 4G65A 1Q46A 2JOQA 1UA1A 3RB4A 4QU6A 3M1FA 1RDBA 2VPXB 3WXJA 4JV5J 2YX8A 4CZKA 3DLGB 3E8OA 4L6V3 1WC6A 3SDEA 1DHMA 3TSPA 4KN7A 3V1RA 5FDLA 2XLJA 2R7WA 1CJKA 2JR5A 2HHTA 1Y64A 4ZVRB 4M42A 4NCGB 4YHHK 3HHLA 5KAFU 3D1OA 3M9NB 5J2GA 3T5JA 3POTB 4UARA 2RU9A 5FRMA 4DR6F 1FNMA 3ETRA 4NRUA 4QIEA 1VFJA 3D2WA 2XBPA 3AAWB 2AGOA 4BACA 2LU2A 3QAUA 2PEBA 3DYAA 3FBBA 2ZM6K 3OFFA 1U0HA 5AQOA 2MQLA 1JJ4A 2XHWA 1HLUA 2V7YA 5IV3A 1FFSB 2OP5A 1EETB 4P52A 2A1AA 4DV0F 1UQVA 3RSEA 3DRRA 5EVZA 3PRDA 4XK8C 2YHAA 2QARA 3IP4B 1DGKN 5K8PA 1Y7PA 3CJ1A 2QXFA 2AEMA 2GVDA 4DV4K 5F2RA 5CHIA 4QCLA 2VQFF 3KLIB 3AVGA 2YH1A 5JS1A 1FRXA 1F5AA 5C25B 4LIWA 5AQHA 2GJ2A 3HVTA 3KG0A 3PRVA 4B17A 1IKXA 4X62K 3QO9B 2HFSA 3CJBA 3SQ0A 2ROPA 4DTNA 5J0UA 1N34F 7ICLA 1S6UA 4FXWA 1RDWX 4DR4F 3QIDA 4GV6A 3KKRA 3C2LA 5A0LA 4WJ3B 5J8YC 1NAQA 1KS2A 1CG2A 1MQ3A 4TU7A 2RHFA 2BX6A 1M1KO 7ICUA 1N0UA 2KOBA 1S5ZA 3UVJB 4YR3A 1NPRA 4Z4HA 4WBFA 3J7ZO 2ZIXB 4FK4A 1Y10A 3G82B 1SWVA 2V0NA 1H2TZ 2KG5A 4LF6J 2IGIA 5E3PA 1B64A 4Y2CA 2NO4A 4J9NA 4IJAA 2V50A 4PHAA 4F4YA 3RRGA 3CCSN 4CECA 2BKPA 3VF0B 4XIUA 3A8EA 4UZCA 3BZCA 4DV6F 2XY5A 2QL9B 2MSTA 1VCTA 1Q8IA 4OZNA 4U8YA 3R5AA 1WKKA 3KVGA 2YXLA 1JCFA 4IRKA 3Q8PB 3T41A 1YJTA 1XMQK 4FM0A 4ENOA 3S3OA 2F4VK 4CEQA 1IKWA 2IDLA 2L5YA 3BN7A 1I94K 2AQ4A 4JHDB 5I3QA 2FTRA 4DCOB 2ZF5O 3FBEA 2W2QP 4O44B 2DO4A 5D4BA 2KI2A 2ZBQA 5JRTA 1X8DA 1M90O 4I68A 5IWAK 4O0IA 2ZH3A 3AN1A 5KFDA 4FS2A 1IM6A 3CCJN 4CJLA 4OD0A 1Y5IB 9ICTA 3NVKA 3SBGA 5BREA 3BPSP 3MAAA 3N79A 1PC4A 2UUBF 5KFZA 4KSEB 5J2PA 4WP8A 5BYRA 3RB6A 4QWAA 3GV7B 1D1UA 5GAGP 5ALZA 3DRYA 1PVPA 1LK7A 1D9AA 5E2QA 2J7WA 1VLYA 3V6KA 4KI4A 2CDQA 3M8QA 4M95A 1RILA 4NMXA 4CGGA 1K9MO 5DBCA 3VGMA 4RW9A 2H4WB 1UAWA 5B08A 2UXBJ 1NB2A 3O1BA 4FWLA 3ZCMA 2J6TA 3BKUA 2JNJA 2KHVA 4DV7J 3KK3A 4C4WA 1U2VB 2QLWA 4JD2A 5BYQA 2XHBA 2F8HA 3V9SA 1RKJA 2MY7A 2LMIA 6AT1B 4WP9A 3DU6A 1DTTA 4DV1F 1R89A 3I76A 4O8UA 1UTAA 1Z4OA 4H03B 2NZ4A 3SCXA 3N5FA 5F8HA 2RHKA 1XQSC 5D8HB 3NS5A 3R2CJ 1UVLA 4YMNA 3DMJB 3TARA 2VYPA 4HH1A 3L3UA 4B1YB 1Q5YA 4CLLA 3L8BA 4DSIA 3MPYA 2PD1A 3M6XA 4RJVA 4M6WB 3I5AA 3E9LA 3AXKA 2ESEA 3CMAN 4KHPK 3V5RA 4RQNA 4IZ9A 2EFOA 4AHVA 4PG8A 1GMWA 3ZSOA 3EPGA 4X4PA 1LWEA 1LNQA 3K1ZA 3VESA 2LVWA 4ZHRA 4E1MA 4WTYA 3BKFA 2CUYA 1WN7A 3MGVA 2DFHA 3A5NC 4TKTA 2CH6A 3HI0A 2A3ZA 4DLGA 3ISZA 1T11A 1KHVA 1RBLA 3ISNC 2QA2A 3GJSB 2ZGYA 2ZE2B 2J0SD 1Q18A 3BSCA 2KH9A 3BS5A 3P1GA 1NBWA 3HOSA 3GR1A 4DU8A 5JU5A 4YDDB 1XSLA 4FVMA 5IV4A 4C1NK 3AEVA 4RUCA 3A3OB 3HJEA 3WKEA 1NH7A 1SUQA 1NOZA 5EX5A 2I0XA 1VQ8S 2J8SA 5E7OB 2UXCJ 1FX2A 3C29A 4OI1A 1AYEA 5AKIA 2HFVA 3WQUA 3DLGA 3DRSA 3LW5C 1I5OB 1VQPS 5HAOA 3L0QA 3MN6A 1MG7A 3N9UC 4Q45A 2GX8A 4U7UD 2BUPA 4ES3A 2QA4N 3K89A 3I0SB 3MK6A 3SAHA 4NCGA 4B8AB 4KLHA 1BU6O 2YNFB 4B3SK 1IV8A 3OSPA 3HPHA 3BGFA 5J0XA 1QZ5A 3POTA 3PZPA 3HHLD 3M2RB 3EWGA 2W9MA 2P5VA 3M32B 3TA1A 4ZLLA 2MQMA 4FVCA 3CQXA 3PX0A 5JMVA 4EU0A 3OS2A 3QDKA 3TW0A 3ZDAA 4DR6K 1RE1B 5AQQA 5LMNK 1EETA 3F53A 4EP4A 3ATUA 3ULEB 4CJ4A 1Y11A 3TADC 2FIUA 2E5LJ 4CFCA 1HLWA 4RW4A 4ZPTR 4FJJA 1XSNA 1KAYA 2BQ3A 4KLLA 4Y0WA 4QYZK 2GFFA 3QU7A 1HYVA 3AOCA 4KY3A 2HQIA 1KDHA 1RNHA 4DV0K 3KLIA 2LYAA 1IO2A 5J2NB 1NK5A 2F9WA 4FWQA 5K20B 1F0MA 4OZJA 3SIPB 3QO9A 5LSRA 2VGMA 1RWMB 1ILYA 4FLTA 3NNAA 3ISDA 5HMZA 4ISGA 2OHDA 1FEHA 4CI0B 2PMZD 2GMLA 2YX1A 4FFDA 3LP0B 1JIHA 4EEYA 2IIHA 2KHCA 1RT3A 1M5VC 1N34K 1VLBA 1XNQJ 2ZJQL 5ALWA 4DR4K 1L8LA 2MKHA 3UVJA 2E1CA 1ULRA 5HQ8A 8ICZA 2ZJ5A 3WU2U 3EE3A 4B3MJ 2ZIXA 1B22A 2IS3A 1FWPA 4RUHA 4K50A 2QN6B 3CPWM 1E4FT 2B5JB 8ICXA 3H8YA 4KB7A 3AL0B 4DTRA 2LKZA 5ALPA 3UD3P 5DB9A 1SH3A 1AFIA 4FYXB 4OPJA 3SNNA 2KN4A 4HTJA 1YRUA 2I38A 3OL6A 3J7Z5 3EJMA 1JWWA 2ZVSA 3IUCA 1VQLN 3T6BA 4CVNE 3ICLA 2GS8A 2F77X 4DV6K 1HBNB 3WX4A 1NZAA 3OVSA 4JHDA 4FZNA 2MDAA 1VIOA 2JL9A 1TL3A 1U8SA 1ZQUA 4O44A 2I6XA 1K73T 4ZTJA 4PPXA 2HRTA 1IJFB 1H98A 3KWIA 4BRLA 2MHEA 4WFYA 1V4SA 4ZPDA 3H2VE 1YKWA 5K8MA 4ECUA 3D0HE 3MM7B 2CGJA 1H0HB 2A40A 3QBCA 2OA8A 3HL8A 3KYLA 3D2QA 2PIIA 3HM8A 3QX7A 5L1MA 4OYPA 5HHIA 4CBWA 1DRGA 5KFAA 3KLFB 4J5OA 2VFVA 2E1YA 1WUAA 3L3FX 3HJVA 1KQFB 1TTHB 3HDSA 2L3MA 3E51A 2NYHA 2B0CA 3BS7A 1EB0A 3TZXA 1XC3A 3D2NA 3R6LB 1FRJA 3OD2A 3OL7A 1RWWB 2DXDA 2BCRA 3DLEB 2D0OA 4OHYA 5B0GA 3BZQA 3PSFA 1U2VA 2WVFA 1WBBA 3C94A 1BHLA 3RFAA 1QDUB 1ECWA 2Y0SD 4HT5A 3HILA 2DPJA 1JXEA 2IHMA 4CZMA 3NGTA 4PZOA 1RDAA 4DF4A 2YWWA 5CWRA 2AT1B 4BRAA 2ZTDA 2C2RA 4MK9A 3ZSXA 9ICWA 2JH3A 3RWUA 2I1QA 5ALYA 4OJGA 3UD5A 5DK5A 5BYSA 4W4MA 3NMRA 4JI2J 2QLJB 4M6WA 4CP5A 1L3TA 2LMRA 3OW2M 3CRXA 4BHQA 4C4RA 1IM4A 4DN0A 2EXUA 1YF5L 1BWVA 2QLBB 2KT3A 3J7A1 3DXSX 5AI6A 4DR5F 3PSPA 3KOOA 5F8MA 4JI8K 2P9CA 3GIKA 4M5DB 4RZRA 2HK2A 1HR0J 5ALLA 5GIOA 1VQOS 2VKQA 5DDOC 1CS4A 3RAMA 2KJVA 2Z2LA 2IY5B 2HHQA 5J8YA 1VBZA 4LF5J 4JI3F 4TQRA 5GAHP 3QFWA 3MXHP 2ZE2A 2E7XA 2BVZA 2MZSA 1N0VC 4I6AA 2B56A 2H3IA 4XDCA 3K5PA 4XUSA 2X1BA 5ALIA 3MN9A 3PEHA 1Y5NB 2YQ3A 3HO1A 2BE7D 4E7JA 1U1MA 1N60A 4ECWA 3DOKB 2E7WA 4DTMA 1YZ6A 1MA7A 3GFHA 3PW0A 1HW9A 4J9KA 2LDYA 2HSEB 1APSA 4ECYA 4WF9L 3IO1A 2D1CA 5HROB 2C28A 2ZTEA 1XNRK 3TO8A 4C8KA 5I9EB 3HW8A 3I0SA 3W65A 2WONB 1T02A 1XO1A 2K8BB 2YNFA 2ZG6A 5DDRC 2Q3PA 3OR1B 3OBYA 4ED2A 2M8HA 2BJ7A 3ZI4A 9ICRA 2BCSA 5IQ6A 3F73A 5L1JA 4QR1A 2P9PB 4OHZA 1YJWS 2E2PA 2KNJA 4NLXA 4KV8B 4Q0BB 3PIPL 3M8RA 3IBFB 4N77A 3MFIA 5CD4H 1VC0A 4ZN1A 1ZQWA 3NWGA 1VK3A 2KJ5A 2CJQA 3NS7B 3PLAA 3ULEA 4JNEA 2PA3A 1WKLA 4WZQA 3RB3A 3WC0A 2CJ9A 1HFEL 1NZBA 4BQZA 4NMLA 2JSXA 2G8VA 4AUKA 4IFVB 1R0BG 2P9EA 3RH5A 5L1IA 4UW9A 4JKCA 1R43A 3WKCA 3QPIA 1UFLA 5AKLA 5J2NA 3QT8A 5DQIA 3SQOP 3MX5A 1KTQA 4IH6A 3H25A 2UVWA 3K5LA 1SJQA 2JV3A 3H59A 5IT9U 4KRWA 3CD6S 1ZQLA 3VAIA 3LP0A 3SFGA 3FEXB 3QGIA 1WTBA 3DXKB 4CT9A 1SQEA 4KE5A 2QWPA 5AI4A 1Z1BA 1BPEA 2XIDA 1I3AA 4J9SA 1HJRA 2AJ1A 2ZH8A 2B5JA 3NGSA 2AJ2A 1ZBUA 2VA8A 4H0YB 2I6WA 2O01C 1VSDA 2GX9A 1FNXH 1ZQEA 2MZRA 2DNNA 3FM9A 4X4QA 5DBAA 3N7RC 1Q3UA 1B70B 3F9MA 4OKEA 4Y0FA 1RLCL 1B9FA 3SK3A 3KUHA 4RU2A 4CZLA 4IOAQ 2V2QA 1BQXA 5SWMA 3DDKA 2HGMA 1HBNA 1A0OB 1W9HA 4DPYA 1BWEA 1VQPN 1FKAF 4C7YA 4CEAA 1VQ7N 1OPZA 5AQUA 4CDIA 2MKCA 1KP6A 3R8YA 1NHKL 1HD1A 4A47A 4J2DA 3HD1A 1G2EA 1KQKA 2DKXA 2BPCA 4F71A 5EE9A 5AK5A 3ZZUA 1TUYA 4Q8FA 3AD8C 1Z1VA 3FZHA 4MAKA 2ZWPA 4RBTA 2RQ4A 3C14B 2QJ3A 4AILC 4PPDA 3MN7A 2DRAA 4HT7A 3KLFA 2QIFA 3BH6B 3ORYA 3SV4A 2WUSA 4E2FB 5J1PA 1S0MA 5D46A 2WCXA 1QUVA 1KNZA 1RQ0A 2CNLB 4MYUA 3PJ9A 3OBIA 3GG1A 3LYSA 4NY8A 3GWCA 2YWFA 3MDFA 2W42A 2AU0A 1ACMB 3S6EA 2FI1A 3DLEA 3HULA 1EZZB 3P5TL 1FJCA 1HL6A 1W2BM 3TFSA 4H8KA 3IGVA 3T1HF 5JJBA 3HKZF 2Y9TA 5M1OA 1N36K 2DGWA 2CQHA 1YBAA 4P0QB 4JI5F 4FKYA 3TVZA 4G1IA 4DS4A 4OLOA 3NAHA 4ANEA 4J9QA 2LECA 4OI4A 3I6PA 4JV1A 3BH7B 4BRNA 1GLLO 2RS2A 2V9KA 3DLLQ 3E58A 2XMUA 2BRKA 2DY1A 2RDDA 3UXOA 4JI0F 1HEKA 4NLZA 4NE9C 1X31C 5HRSA 1TKDA 2AWZA 1BDGA 2Y8WA 4KLIA 1XMOJ 1QVGR 2MLYA 3I32A 4Y2AA 2QGFB 2WHOA 1D8YA 2P9NB 2XCPA 2Q31A 4UAWA 4K4VA 1L3UA 4A8FA 2VCPA 2DPNA 4PHTX 2PKEA 4XA5A 4DR5K 2HQGA 1K1SA 3MM9B 3WKBA 3ISCA 5AICA 2JEGA 3C19A 3HHNB 1RFQA 5F3XB 4LRFA 5K8NA 1SL2A 5HI7A 5KG6A 3KLGB 4CJSA 2EAOA 4DJBA 3GZFA 5KRSA 4FJGA 3B6OA 1HI0P 1JLAB 1HNXJ 3CDAA 2HBYB 2V67A 1P6TA 3DOKA 4F04B 5CA5A 5IT4A 4FLXA 2XCAA 1VR6A 1FJEB 4RW8A 4US8A 4DS5A 1H2VZ 3FDSA 4BXOA 2PFUA 1OWXA 5HROA 4IL6U 4FL9A 4R0JA 3U1NA 3PEJA 1VQKS 3I5BA 2C2OB 3EVWA 2W1BA 2WONA 4WFAQ 1QE1B 2GUPA 2IHNA 4LR8A 4RPYA 4E7HA 2XNQA 3QINA 2D3OR 4WFNQ 4N76A 1PBAA 1DLOB 3OR1A 2W7OA 1IKYB 4YS2A 4NJ8A 3FKBA 5KG4A 1B4SA 5A8WA 9ICFA 2P9PA 1N6QB 3M8PB 5TISU 3BGLA 3ZDDA 2IA6A 2RUGA 3D67A 3CO9A 2AQ0A 4KV8A 4C6AA 4QIWD 4Q0BA 1FFUA 5KFYA 1QCKA 4ED7A 2J0XA 1ZQBA 4CGIA 2GOLA 4MLEA 4O4GB 1RYUA 3KWGA 4G1PA 2RF2B 1ZQDA 4TY9A 4NXNJ 4Q5VA 1T3QA 2VA3A 2JGAA 1X4HA 2HMXA 2D6FC 3J7YI 1RAIB 1RT2B 3F9KA 2J5AA 4PPZA 4IFVA 2HVEA 3LWLA 4CO5A 4A5AA 2VV5A 3UMCA 2CPXA 3HSJA 3SCKE 3TSUA 4FP9A 1QQ5A 4NI2B 4U96A 1X4AA 3EX7B 4F5OA 2KVQE 1WSVA 2OTLS 4USVA 3EPIA 1L3SA 1RI7A 2DH8A 5FPDA 4OLAA 3UN5A 3ZNUA 3JTNA 1G6BA 4RQ5A 2HNDA 7ICKA 2G8WA 4FOEA 2OXOA 1W26A 4P2SA 1RT5A 2UXDF 2EHGA 8ICUA 2JC0A 2DNRA 4DR2J 3WHIA 1KSPA 4IG3A 1FD8A 2C42A 1R3NA 4AH9A 1FE4A 4IH5A 4Y2PA 3THWB 4TXSA 3DXKA 5HBMB 2V68A 4USUA 4ZVFA 4OO1J 3NWRA 5BJRA 1NCLA 4B3TK 3J81U 3FVYA 2BTFA 3SUPA 3S9HA 2NZTA 2GO7A 5AQZA 5F3TA 2DGSA 5EN1A 3L7PA 2CVIA 1Q8KA 1RWXB 2B4UA 4IXCA 8ICQA 2ASPA 5FPEA 2E88A 4A8YA 1ZQSA 4DQRA 4YUDA 1XI1A 2HMPA 1RU2A 3M4XA 4Y6IA 5A2QO 1S97A 1FA0A 5C42A 3LA0A 3G4SS 4CLTA 5AZJB 5LSOA 4EO6A 4BBYA 1COKA 1VYAA 2HIQA 1SXDA 5AM1A 2XGPA 1S0VA 1SZPA 2C22A 3P31A 1UMJA 3JPQA 3S1TA 4NYNA 2VD3A 1NWKA 2PMWA 3FRYA 4F25A 3AQEA 3QNWB 7FDRA 2R2UA 4HHHA 1J2NA 3L5KA 3WXIA 2LP4A 4NLOA 2BZFA 4X4OA 1MROB 1TKZB 1G99A 1Q0NA 1OVYA 3IN5A 2P9KA 2A10A 2EZYA 4H4OB 3VHQA 3C2PA 3WXKA 1YJWN 2OLWA 2YHWA 3ZSZA 2CJAA 3MECB 3VQBA 4NOHA 3T1AA 3QU5A 4KLSA 3GBTA 5IOLA 1YQHA 2P9SB 2IM1A 2ZH5A 4B1WB 3NGIA 1NNLA 1RAHB 4LF4J 1XBWA 4H5NA 3OXGA 4LF7J 3ZX0A 1BWFO 1RGVA 1D8LA 2WSFC 4NXMJ 4QWCA 4JEPA 3UKUB 4A8MP 5GTIU 3CD7A 3CQYA 4ZPAA 4PAAA 2OH2A 5KT6A 3UD4P 2QWNA 1S6QB 1FRKA 1WCNA 4RL1A 1IKVB 2VOPA 2JH1A 4P0QA 1S77D 4JWMA 4HR2A 4TYBA 6FD1A 4GKJJ 2E5JA 4CIGA 2UUCF 5KGWA 4O3MA 3ZTOA 2LPEA 2AJ0A 4M3TA 5J0WA 3CD6N 3T1HK 2AYBA 1S1TA 2B4JA 3BF3A 2VWJA 4UAUA 1IG6A 3MOZA 4JI5K 3JTPA 1WTFA 1CZ9A 4N7TA 2EZXA 4U8VA 2YQEA 3M2UB 1QLNA 1D09B 4X66F 1JNZB 1U09A 2B21A 1NNEA 4FWKA 3ED5A 4O3PA 4DSFA 3CJQA 3H0MB 1V9OA 3R7BB 3TAMB 1RBTA 2JEJA 1RT1B 2KFYA 2VPWB 1RWVB 3JSYA 4RT2A 2CH5A 4I2AA 3JPTA 1ZZNA 4C8LA 3HCXA 2QMXA 2ZH1A 1UPPA 1U2CA 2Y1IA 5H2FU 1YJRA 2J8AA 2FXUA 1J97A 3MM9A 1U1PA 3G0ZA 3MAQA 4DL0C 2OEJA 1YJ9N 3TPQA 5IC4B 4KHUA 2ATLA 4JK1A 2EBEA 4UAVA 2V8HA 1FX4A 3NH1A 1NSAA 3RBXA 2VKRA 3GLJA 2K2PA 2RUSA 1JLAA 4M3YA 2N4DA 1TUVA 2OD6A 4FXDA 2HVIA 4ZPVR 3EW9A 3E1YA 3PVXA 2D1KA 4FS1A 3KMQA 2XO7A 3F0NA 4WYWA 2QFIA 3DOLB 3EO3A 1JRPA 3NEKA 2E2QA 3NFAA 2XZDB 2FC8A 2A1JB 4CEBA 3OBWA 4HEA9 4FDFA 3HPGA 4V19J 2G1DA 2AGPA 4X84A 3KJFB 4DX5A 1J2VA 5D3GA 1QE1A 3ZO7A 2NPIA 3JS9A 5D0RA 1H7XA 4ZVOB 1CC8A 2HZAA 3W63A 2AXTU 3SSSA 4ER8A 3H0RB 4OIXA 2DKOB 4I6MB 2CJKA 1N6QA 3O8MA 3M8PA 1JL1A 4OV1A 4NLYA 4KAZA 5KFIA 4CZHA 1HD0A 3KJNB 2BACA 5KFLA 1A7GE 4DFJA 4MO5A 4JBCA 2HPUA 3RW7A 4B08A 2F4FA 4O4GA 4F2SA 3CP8A 2E1RA 2OANA 1PCAA 2RF2A 4PHPA 1OQ3A 4ZLNA 2JWKA 2VKZG 1KVCA 1RT2A 2PFPA 4C11A 4QZHA 1OW5A 4M9GA 3UIQA 1YVNA 3THPA 1SGGA 4DZ6A 4PUOA 5ALGA 1DBDA 3FBCA 1N4LA 5HQMA 3B6BA 4NI2A 1ZJNA 4KR0B 3V9WA 5KFPA 3QMLA 3O3HA 1S0OA 3VAHA 3CJKB 4YY3F 4DTUA 4V19X 3QBXA 3BO4A 4DSEA 1E4GT 5HVFA 3KFUF 1IJJA 3ZTQA 2PXIA 5D4NA 1FJGK 3OTOJ 2E5HA 3L2VA 4MFBB 5BR8J 3AMZA 3HRDD 3VAJA 2AEFA 3SI6A 3MEGA 2GGPB 3HKWA 2BQUA 2O8CB 2Q0ZX 4OYOA 1B7YB 4QS9A 5IM0B 3N01A 2ZH4A 5FD1A 4KTZA 3THWA 2KD1A 3PJXA 3PW7A 4B9LA 1SV5B 4PG7A 3QIPB 3QGHA 5HBMA 3VEYA 2UXDK 1S1VB 3SUOA 2B8QA 1LAVA 2MAXA 3CJ5A 2OFHX 3ID6A 1C1BA 3W9HA 3H7IA 3QXGA 4QS8A 3F44A 3K1RB 2MQOA 1RWKB 5J2FA 1G7CB 3TQ1A 1FRIA 4ZPWR 4H4KC 3FZFA 2DT9A 1RKIA 1T03B 4QR2A 3SD7A 4GFJA 3A8JA 3BGRB 2BW2A 2P6RA 2OEKA 3RH4A 3QICA 5DG8A 4BLGA 5AZJA 2X7IA 4C4TA 3G9CA 3GV8B 3ILOA 3K8WA 3BGOP 2ASDA 2KXFA 1KW4A 1MMNA 3MABA 2O5DA 3AVKA 1RWUA 3HJFA 3Q8SB 4LREA 3SSQA 3D0GE 1HA1A 1ZQXA 4ED0A 4BR2A 4C0HA 4DG1A 4ZVUB 2GO9A 2LYBA 4A59A 1M1KT 5M2RA 1Z1ZA 4RQ7A 1DZ5A 4BGDA 4MDBA 2VFSA 1VI7A 2WSEC 3HX9A 1WNSA 2WAQF 1X40A 3TZWA 3J7ZT 4DV5F 4JV0A 1SV0C 2KT5A 4GO7X 4DPXA 2ASJA 4LF9F 4C3MA 3THXB 3U27A 5KFJA 3ZZZA 2VG6B 5J2CA 4F4ZA 3MPDA 4LVSA 1RU1A 2B0GA 4X4UA 3FSIA 4QS7A 3VQ4A 4PWDB 3DU5A 1SH0A 3VAMA 3TAPA 1RDUA 3K7RA 2XSFA 2R42A 4WXOA 4CF5A 3CWJA 4CQ1A 2P9SA 1RGIA 1S5JA 1RDFA 1HNZF 1RUSA 3ZTRA 4KO0B 1HPZB 4WIIA 3RU0A 3RW6A 2HF3A 3BO2A 1SC1B 2FSJA 2I7NA 3NRBA 1Q7LB 4OPHA 3LOUA 3UKUA 4MQ3A 4UTGA 2BMBA 3DGPB 2ASYA 2KKHA 4LRBA 3CDWA 3GU3A 2FPHX 5D0HA 1M90T 2X1FA 4M5HA 4CLUA 2MKKA 1T9XA 4X64J 2Q1NA 4DR3J 4DL7A 1OY6A 4USKA 1S6QA 1GOCA 4ZK7M 2BDPA 5J0QA 1IKVA 1K6YA 3K57A 2Q0RA 4LF8F 1NMDA 4BC5A 3L4PA 2WVCA 5AQYA 4I2FA 2RHQB 2PE8A 2ZJRL 4KBIA 5DMRA 3ZT0A 4LFBF 3SUQA 3RR8A 3JXOA 1P90A 1PC5A 3DLJA 5CXTA 3K9JA 1P1TA 2UUCK 4QZVB 3M2UA 1XR7A 2CPYA 4CK1A 4A8EA 2L48A 5AI0A 3HT0A 1IG9A 3H08A 1K9MT 1L5UA 1E3MA 4IQMA 1FVQA 4K4TA 3TWHA 2D3ZA 1AA1B 2DGVA 3TAMA 1EIYB 1RT1A 3FNNA 4QIFA 3R3LA 4X66K 2JEIA 1AB8A 4PZVA 4YB7A 1HYZA 2E2NA 4B6JA 4OX9J 5I42B 3MCPA 1WC3A 2YH0A 3FMBA 1JMSA 3TABA 4GV9A 9ICXA 2D3DA 2DY4A 1LKYB 4K5RA 1F5SA 3NP5A 3ZD9A 4R79A 3IWNC 3EEQA 1BUXA 3AV9A 1ZQHA 2RQ5A 4BC9A 2DQNB 3W3DA 3H20A 3AXMA 5CRXA 1CJTA 4RBVA 2XMAA 2F7VA 1RG6A 1S9GB 2WBRA 9ICUA 2ASMA 3IAM9 2X1GA 2WZ1A 4DU3A 3R1XA 4M94A 4K4GA 2YX4A 4NM1A 4FWRA 1XR5A 7ICJA 3AHPA 3EZOA 4RNFA 3THYA 2LEBA 1N52B 3CCLS 3VQDA 3DOLA 3N0VA 3D68A 5KAIU 4KAIA 3LM2A 2R7UA 5J2QB 2A1JA 4D3GA 4Y2YA 3P5BP 3R6GB 3B4MA 2BKEA 2R7VA 2FLLA 3PRBA 4Q2MA 3W5ZA 2HVZA 5LJ5Y 3I31A 4CYUB 1VC6A 3US5A 4KMUA 2EAPA 1KWMA 2P66A 4UOGA 1UCNA 2RNEA 1X4CA 3KUEA 3I56S 1YZ7A 4RNOA 2XMJA 5CR0A 4XO0A 2UZAA 3FQLA 3QUTA 1D8BA 2GWSA 2CG4A 3CCES 4LFCF 3MN5A 2IYIA 4PKGA 1U1NA 3BSNA 4YOYA 2V2VA 3V72A 1C0GA 1ZAVA 4KREA 4IFYB 1GEHA 3W0LA 5ALHA 3KZIU 1KR4A 5AQJA 5EOZA 1UPHA 5D77A 5H9FJ 3TVKA 3R3TA 1Z2ZA 4AL6A 4LIRA 4KPCA 4DUZF 2C2KB 4MKBA 4CHYA 1RTHA 3ILIA 5FPNA 1IBLF 3G87A 4J9OA 3CJKA 4CEDA 5JTIA 5GIPA 1HKGA 2EH9A 2MZQA 1JLGB 2CRXA 4DDFA 9ICCA 1XJWB 4OFZA 3G6VA 4E19A 2LQBA 4OI3A 2Q43A 5BRDA 4KHMA 1WHWA 4KHSA 1FNOA 4YY3K 2B9YA 2CWKA 2C1EB 3Q2TC 4MFBA 1XNSA 1SC3B 4ATNA 3AAPA 2OD4A 4FWPA 2A1RA 3GIIA 5F8GA 2O8BB 2O8CA 4BRQA 2Q1LA 3VF6A 2ZEJA 1TK0A 3KG1A 4YB5A 4DR1J 5IM0A 2FHKA 1GK8A 2XSJA 1N5SA 4CJFA 4I2QB 4BG8A 2O8DB 2R18A 3CJ4A 3C2KA 1S1VA 4CJWA 4TVAB 5F1XA 2YQ1A 4TU9A 3U6FA 3A2FA 1WUUA 2F63A 3IMXA 1NKCA 3NVWA 2L9DA 2XWYA 1MN8A 5AQWA 4MJKA 2QO3A 4DQ8A 1CRXA 1S1WB 4AYBD 5H9EJ 1UL3A 1SQGA 2LQJA 2K1RA 2XI2A 1T03A 3VQ5A 3OA9A 1NG9A 1N56A 3IWXA 4Q8EA 4DV3J 4IEEA 3JYTB 1PUZA 4KC5A 5M2UA 3VV2B 4FCYA 5KFUA 5GADI 1BISA 1A5VA 5T7BA 3TKAA 4IR9A 4J03A 2DD8S 4CJQA 4BX9C 3CDBA 4CI6A 2KSOB 5DG9A 2PFOA 4JK8A 1MDUB 3VGSA 3W1YC 1RB0A 1HBMB 4KGMA 2DGZA 3SPYA 2A6MA 1HWKA 4ZMMA 4GKKF 4AM7A 2KJ9A 3THXA 3G6EN 2N1RA 2VG6A 4M45A 1FRMA 5A8RB 1GLCG 3I55S 1U9LA 2F1FA 5IT9O 3VC8A 3N97B 4RR5A 1VK0A 4DV5K 4OZLA 4LF9K 4CIEA 4I6YA 1O5JA 3BB5A 1BPYA 4TY8B 2EZZA 9ICGA 2WW4A 4TN2A 3U7JA 2O1PA 3QETA 4UATA 1CQMA 4B9NA 2B6AB 1HUZA 2M4MA 1HPZA 1COOA 4ID8A 4HYKA 2KU7A 1QUPA 2LCWA 3BQ0A 2VIXA 4NM2A 2JLEA 4A8XA 1R8AA 4J9PA 1HNZK 3OVBA 3DGPA 2E5IA 2ZBIA 3LANA 1JLCB 3ENOA 3QRRA 2ODGA 3GG4A 4YOVA 1W7WA 4O5FA 2BA9A 3TYTA 1D4XA 4W5TA 3UNYA 5LJWA 1QY7A 2F8MA 2UU9J 2NXCA 2XQCA 4MLHA 2E6LA 3CC4S 4GVBA 2LSNA 4DBQA 3O9RA 3O5TB 2RMLA 3WXMB 3TAGA 3A0BU 1R8HA 2ZOFA 3WNEA 3UKRA 2HQ3A 1Z05A 2VL1A 5B66U 1RT7B 5AIAA 4FZLA 5H1SV 3HVRA 2XNRA 3TUZC 3R9PA 2W3SA 2G2ZA 4CK2A 2OM6A 4NYOA 1N32J 3AO5A 2R3VA 2R7XA 4HWIA 5I42A 4YFKA 3GOIA 4ZPCA 4W5OA 1IN0A 4D3HA 4JV2A 1H7WA 1LKYA 1WOOA 5HMXA 2ADCA 2CVEA 3H8SA 3LP3A 1OQ6A 1Q95G 4P7VA 1HQUB 2H54B 1VQ4S 3TEHB 4BDZA 4PWWA 1SKRA 3PDNA 3MPUB 5HOOA 1S7IA 2N7YA 1HI1A 5C2CA 3R1LA 2XICA 1TMMA 1H74A 2N4CA 1SWWA 2CQ0A 3SQIA 1NLKL 1S9GA 4FOIA 4QZGA 2XYPB 1U02A 2YTUA 2CJBA 1LFWA 1Q82O 4ZTFA 2E1FA 3W62A 3FSXA 3DLLL 1TFRA 4C8ZA 2HSTA 3HHKA 2G09A 4KGKA 4ZVPB 1J53A 1NJIO 3UWTA 3GDQA 4H4KA 3GE1A 2RLTA 4LZGA 3AVHA 1ASWA 1HUOA 4MDAA 1JI7A 3V9ZA 4Z4GA 1WSHA 5E0OA 1R7IA 4FZVA 2KYXA 4DPTA 3CJTA 4K8ZA 2ZNZA 2FBTA 2RP5A 2D0PA 3V81B 4CYUA 3FFKB 1RXWA 5KT7A 7ICSA 4K5SA 4DR7J 4ELVA 1BPZA 3SAGA 4PKHA 4K0KJ 5IQQA 1N5QA 1QZ6A 3CJ8A 4GMJB 1WI6A 2HGLA 2BKOA 5LMUF 1VJQA 2BGGA 1RA6A 1ZYQA 2OO4A 1J54A 4WZMA 1RT4B 4M5MA 2YVSA 3GSDA 4DZDA 1SV0A 2YHYA 5LY3A 3B0XA 3EWAA 1HI8A 2A1BA 3UN2A 4IFYA 2ZUAA 3OY9A 1YITN 3K9KA 1FKOB 3F41A 1HWLA 1U4BA 3DGVA 3O9QA 5EXWA 3QEIA 3CCWA 4LFCK 3HSDA 3BYRA 5KG0A 2JJ4D 1IR0A 1Q7YT 1BCOA 3NMUA 1WLJA 2ZC3A 3L6QA 3MEDA 1TAMA 1RDCA 4G1QB 4EFAC 4F0HA 4DB3A 3GFKB 4JI7J 5DO2A 2JRZA 4DUZK 4Z6DA 4IOXA 4F36A 1JLGA 2CNNB 5EGYA 5DETA 4WFAL 2I9GA 1RDDA 3UE5A 1IBLK 3N7PD 1D9FA 3LVVA 3MM8B 3G96A 4N56A 3OTCA 4JI2K 4A8WA 8ICPA 5BXIA 4ECTA 1DGJA 3MZIA 3H4BA 4CZFA 2F40A 5HJXA 1XQIA 1TE2A 1SQKA 3IS9B 4F5RA 4I2QA 2ZJQQ 2O8DA 8ATCB 5J2BA 4B3RJ 2GQQA 4JI4J 3HP9A 1X4DA 1FEEA 3GTYX 3EE8A 1YTAA 2O4IA 5K9FA 3ILJA 1JXLA 1S1WA 1DARA 3TX8A 4YOTA 3D66A 4IO8A 1N5TA 3JPSA 1HNXF 1S10A 1KFTA 2J9CA 4Y00A 3NCPA 2V8PA 1RAAB 4DOAA 1URRA 3JYTA 4AQYJ 2JX2A 2FJXA 1PJ6A 2F44A 1RHKB 1NZ8A 4PXCA 4M7YA 1XR6A 3KLHA 1WDTA 4ZCLA 2RHSB 3QESA 2AF6A 3W5XA 4OZ5A 1RTIB 1N8RO 5C15A 3ZSWA 2KSOA 4M9LA 3QBWA 4EK2A 1TAUA 4DSJA 2W9AA 3RF9A 1HBMA 2GVZA 4O9MA 1UETA 2E8AA 2Z4PA 4O5BA 4FNHA 4X65F 3TFRA 3LPEA 3I56N 4FJ5A 1HYSB 4P0PB 3AODA 2KE7A 1B43A 3OFHA 3TAEA 5A8RA 5M2PA 2CJXB 4ANCA 1IH7A 2QI2A 4DL4A 1W7AA 3E01A 4GKKK 4DUTA 4TY8A 2R7OA 2R2SA 2P9IB 1IVZA 4NA3A 3QEWA 3DLKB 1JK9B 1YXQA 8ICSA 2HK3A 2YKOA 1SC6A 3GJRB 2D7SA 2YV0X 3HHLC 2VQEF 3NGRA 1UEVA 2DNOA 2FVPA 5BRFA 5AK6A 1CJUA 2ZWHA 3RBDA 1AT1B 1PJ5A 3VAGA 4PL1A 4CJUA 4HUFA 2ACYA 5K5MA 3CC2S 1N33J 3LDQA 5IFMA 3ZETB 4BQLA 1Y4ZB 4CO3A 3ZTPA 3BYPA 3C3LA 2XULA 3TUPA 2MZTA 3UCUP 2DRDA 1U1KA 8ICWA 1S4EA 2KTQA 2OMLA 3VZHA 2YBVA 1KL9A 5AKEA 2QG9B 3UCGA 2DFEA 4GXJA 3AO2A 3P83D 5D49A 2DIVA 5EWGA 4P72A 1Q8LA 2G08A 2VJ4A 1EXNA 4LR7A 3TJ8A 3LUYA 4YN3B 2I8EA 3HHDA 4P71A 1G3OA 5HJYA 2PMZC 3PSIA 3GYGA 2DTUA 1F2GA 4TLRA 5DDYA 2P8IA 4JI6J 3ENBA 1XO0A 3CCVN 3QGGA 4UB2A 3JPPA 1HQUA 1AW0A 2O66A 3TAQA 4P75A 2WRMA 3D1HA 3FFIB 2GQ2A 2G1HA 3A0HU 3CCUS 1VQ9S 3BREA 1KC8O 4K43A 5AZIB 2KLAA 1JXVA 3EUB2 2IBKA 2NREA 4KI6A 3KHLA 3PKYA 3VQ9A 2AEJA 3BBBA 2HOFA 2Z1HA 3AOAA 2BDUA 4QWBA 4PJ0U 3A3PB 3NS6A 2DITA 5J0YA 2HHUA 2DNQA 3CT9A 2N7CA 4BDPA 2RB7A 2IVNA 2Q3SA 5AFUH 3R5CA 2D69A 4MT1A 3I55N 3PCOB 4L72B 3W8PA 5IT9Y 2VZ9A 3MM5B 2RAQA 2FZGB 3V81A 4M8LA 4GIBA 3IG8A 3QUQA 4YOEA 2V7ZA 4K4ZA 4BWMA 3HD2A 1ZD3A 3HFZB 5HR7A 3GZ7A 2W9CA 1LXJA 1X0PA 4ES2A 1HQEB 3OHAA 1B4FA 1TV6B 3PIPQ 1IBMJ 1X42A 4HI2A 4TUSA 4DV4J 1LK5A 1BO5O 1KQQA 2EC0A 1VSMA 1FKOA 1HX1A 3D4JA 5CA7A 4I7FB 2OI2A 4LRCA 1Q78A 4P7TA 2OIHA 2QEXN 3CC4N 2L9NA 5DB6A 3VAKA 1WWVA 2UV8A 2LQ8A 4G1QA 4YHHF 1C1CB 2ZD1B 1HBOB 2E1AA 5D0EA 4M63C 5ALUA 5AKKA 1PGZA 2AA4A 3T7ZA 4DU7A 2J9DE 3D45A 8ICGA 3J7YU 5KFSA 3OYGA 4CF2A 1OIAA 2JLFA 3L9ZA 2HI0A 1SV4A 3IGNA 2XY7A 3GFZA 2MY8A 3MM8A 1BG3A 4B3OB 2OSQA 3MTKA 2CNKB 2Y0SC 2ZM6F 2BR0A 2VA2A 4K42A 4K4WA 1EHWA 2F5GA 4NLGA 1YJVA 4M9JA <