4B9UA

Structure of the high fidelity dna polymerase i with an oxidative formamidopyrimidine-dg dna lesion -da basepair in the post-insertion site.
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9uA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9uA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9uA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9uA01
3M8QA 3AVMA 2LYHA 4DO9A 1FK9A 4E7IA 4QZ8A 7ICKA 2Z1JA 3K75D 3KLHA 2A1JA 2GV9A 4H4OA 4FJ9A 2G8WA 5KFCA 4LSNA 2YHAA 2W9BB 4CJQA 3EPIA 9ICWA 3SV4A 4UB3A 5KT6A 1WSEA 3QEVA 2BCRA 2J6SA 2WTFA 1ZQDA 4Q8FA 2XGPA 1RILA 4ECTA 1TL3A 4DL3A 4UBCA 4ECSA 4DSLA 2D0CA 4JUZA 3M9NB 1JLQA 4QZ9A 7ICPA 1YTAA 4QZBA 5KFFA 4YQWA 3VQCA 3WNFA 4AHUA 1GOBA 4CJLA 4DG1A 2W9BA 4CJ3A 3IAYA 4QZDA 3ISCA 4B9NA 1BQMA 5KT7A 4KLEA 3S3OA 1ITGA 4M2YA 3DI6A 2KZMA 4ZTFA 3QIOA 4KHQA 8ICTA 4AHCA 1S77D 8ICAA 1S0VA 1KFSA 4UB1A 3PW5A 2HVIA 4PPXA 2GBZA 1LAWA 3HSTB 4KLJA 2ZTDA 1YVUA 1TKXA 1NKEA 1H38A 1DGSA 4K8XA 1VSMA 4HVJA 2X6SA 3FDSA 1WCNA 1ZETA 9ICQA 4JWNA 1C1CA 2HHSA 3JYTA 3O3HA 4MFAA 4F2RA 1UAXA 3OYGA 3HO1A 4I2JA 5E41A 4EP4A 2AGOA 4E7KA 2XRIA 4CF0A 3HXMA 4I2BA 1TKZA 1RTHA 3SUNA 3OYCA 3ULDA 4IQWA 4DSIA 1D9FA 2F8SA 1A5VA 3I8DA 4FM1A 4RNMA 4CEOA 3OJSA 3AVCA 3LDAA 1ZQLA 4M3YA 4IFYA 4DU1A 4ELUA 2BR0A 4IBNA 5SWMA 4I2PA 3PUFA 1QQCA 4FJKA 2RDIA 4KLDA 4B3OA 4RW6A 4YN4A 3TFSA 3N4MB 9ICUA 9ICFA 3VQ8A 4EP5A 3TR8A 1VSDA 3TWHA 4R66A 4E7JA 4IG3A 5D49A 1DOQA 4X5VA 3C94A 4ICLA 4FLUA 5HP4A 1V9PA 2PYLA 4O3RA 1W9HA 2VA2A 4ZTJA 4O5KA 1LV5A 1Z26A 1WSJA 3DLRA 3Q8QB 1EKEA 4M45A 1NK6A 5DB8A 1MC8A 1XSNA 4RUAA 1ZQZA 4CGGA 4F2SA 1U4BA 5KFJA 1N56A 7ICFA 2KQ2A 4RZRA 3PR5B 4W5OA 4DSJA 2JEGA 3HPOA 2FLPA 4I2HA 4F50A 3RJHA 4MEXA 3L3UA 3ZD8A 5CYQA 2O4IA 4KI4A 3KLIA 5BOLA 8ICVA 4DL4A 4HCCA 3AO5A 2PZSA 3L2QA 1CXUA 4KLGA 2ZE2A 4EYIB 1TFRA 1BIZA 1SL2A 3P83D 4CIFA 1ZQJA 1KFDA 4CJ4A 1L3TA 3KJVA 4Z6FA 4KLQA 4G1QA 4UAWA 2D0AA 4GMJB 4DTPA 1LWEA 9ICKA 2XY8A 4BWJA 4KREA 5JS1A 1TV9A 4HUGA 1S1UA 1C6VA 1BCMA 4B08A 9ICEA 1A5WA 2NRVA 4PHAA 2JGUA 4Z6DA 2BKEA 3ETLA 2I5JA 7ICNA 3OYFA 1ZBIA 2KZ3A 3VQEA 3HT3A 4O0JA 4CJ5A 4MFCA 4YG2A 4M3RA 3ZSQA 4CFDA 4Q43A 3ZSOA 3AA2A 3LPTA 1FKOA 2OZSA 5L1KA 3MECA 3KHGA 4O44A 1REVA 4CERA 5HRNA 1NOMA 3PVXA 2VG7A 1W0HA 4KTQA 2ISOA 3NGIA 2DPJA 3BQ2A 2D5RA 9ICJA 3ZSRA 4OGEA 1FKPA 5J2NA 3LK9A 4RQ7A 1VSIA 4ECXA 9ICCA 1RDCA 4RQ5A 4RQ8A 3QZ8A 4RW9A 3ISDA 4KHYA 2HNYA 4CJTA 1ZQIA 1BCOA 3RB6A 3RB0A 1UA1A 4B8CA 4RQ3A 4M47A 2HHVA 8ICPA 3AVAA 4ECYA 1BPYA 2FLNA 4JV1A 1S76D 3Q8SB 3NAEA 4M3XA 3SV3A 2JLEA 3C5FA 5FROA 5J1EA 4CEBA 4LH4A 3K4GA 4PGYA 2P51A 3HP9A 2V4RA 1C0UA 3OY9A 3MFIA 5KRTA 1ZBUA 4ID1A 4DTJA 2OWOA 1UA0A 3OHAA 4PQUA 3PMLA 3T5HA 4O5BA 1KVBA 4N76A 2B4JA 4I27A 5HMLA 5KFTA 5K14A 1S9EA 4NLNA 4CJKA 4O9MA 5D46A 3PW7A 5HNKA 3AO1A 4DTXA 1S1TA 4QZCA 4AHRA 2X74A 3GIJA 1KLNA 2QXFA 3VQPA 3VN5A 2BPFA 3K57A 3EYZA 4FJIA 3EW9A 2XHBA 4HUFA 4FJJA 5HHIA 4OGCA 5KFXA 2YKMA 1SUQA 5KFEA 2YNGA 3KLFA 4ED8A 3VQ4A 4Y1DA 1ZQEA 2DFLA 4DLGA 3Q8PB 3L3VA 5KFNA 4RG8A 5HRSA 5KT4A 2KN7A 3NGYA 3QEBZ 1S0MA 3EZ5A 3CG7A 7ICUA 3NF6A 9ICRA 1YTUA 4NLGA 1KSPA 3OYDA 2BQ3A 5DBBA 1TK0A 2W8KA 3ZT3A 5IILA 5J0RA 5HMMA 2ETJA 2UVVA 3RBEA 1BPXA 2AQ4A 2FPKA 1RT4A 4QWEA 3DOKA 1RTJA 3HVRA 3MFHA 4QWBA 3CQ8A 1MU2A 1QSSA 3BQ1A 3V9UA 5KG1A 5KFBA 2XCAA 3O3GA 3VA0A 3RJGA 4F4ZA 4M3TA 2C2RA 3MBYA 4OPKA 4CESA 4NM1A 2XCPA 2F1JA 4YVZA 4GXKA 4C8NA 1QSLA 2FBTA 1XHZA 2VG5A 4C8KA 3EY1A 4Z6CA 4CF1A 4M9JA 4KTZA 3S3NA 2B21A 4BWMA 3KLEA 1NOYA 2F1IA 4M41A 3U3GA 5IIOA 4I2FA 3IS9A 1TK5A 5KFVA 4Q44A 4OPJA 3PX4A 3VQ5A 3OS2A 4KLTA 5C42A 3QEXA 5DB9A 2WOMA 3PO5A 5KT2A 3O4QA 4IQUA 3TAPA 4NYNA 3ZSXA 1CZBA 3LWLA 1NKCA 3FYHA 4Y1CA 1JN3A 1PZNA 5IIIA 1LB2B 2PXIA 1ASUA 4CJEA 1S0NA 2C2DA 2PFPA 5J2IA 2FLLA 3QINA 1WAJA 4CGFA 1VRUA 4FJNA 3RWUA 2HHTA 3S3MA 4KLHA 4F5RA 4DFMA 4KLMA 4KO0A 4W5QA 3QEAZ 3NGDA 3L2RA 3QNNA 4TUSA 3LDSA 1BHLA 5KG6A 2F1HA 1B43A 1ZQBA 1ZQYA 3OGUA 4FZZA 3ISNC 3GIMA 1TVAA 2KW4A 4FZXC 2J6UA 2ITGA 3JPTA 3H08A 4YR0A 5TZVA 1RT3A 3LP0A 4CHOA 2FMQA 5EOZA 2HHQA 2RDJA 1A5XA 4RNNA 7ICHA 2W8LA 1C1AA 1QSYA 1ZQVA 4DFKA 3D0PA 4FS2A 3JPNA 5DGBA 1ZQMA 1HUZA 4MEYA 3NTUA 5KG5A 2W9AA 5DQIA 3CFOA 3SQ0A 2NRWA 4RQ2A 1KLMA 4NCGA 2W42A 4JLHA 5BOMA 1J9AA 1U45A 2FBYA 4Z0UA 5KFGA 4FK4A 4TSXA 4LSLA 4ECWA 1D8LA 4ED1A 2J6TA 5KGXA 3HWTA 4J9RA 8ICFA 3LZIA 8ICKA 3TQ1A 4FJMA 4WE1A 1KTQA 4J2EA 2PFOA 4H4MA 3FFIA 1RDBA 2DFHA 4ID5A 3SZ2A 1BISA 1ASVA 2IS3A 4BE2A 1SKRA 4UAYA 3CFRA 2P5OA 2E6LA 1WAFA 1JXEA 2KTQA 4CK1A 2P5GA 1X1PA 4GW6A 2FMSA 5L1LA 3QEPA 3KD1E 3AO3A 4FJGA 3QE9Y 3UIQA 3F9KA 1T8EA 3EPGA 2ZD1A 1ZQKA 1ZQUA 3V1QA 1K1SA 3MXIA 3TAQA 3MGHA 2HHUA 4PHEA 7ICTA 4RW7A 4XUSA 4F5PA 1LAVA 3GDXA 2R8GA 1RTIA 4DL2A 4CGIA 5HROA 4JS5A 3V72A 4ED7A 1ZQOA 1XC9A 3ZT2A 4E1NA 1LW2A 2FPLA 4I2DA 2IC3A 3O4NA 3OS0A 4FJ7A 5J2HA 4CHQA 4M04A 9ICIA 3C2KA 3K5MA 5KFUA 4DL6A 2ISPA 3B6OA 3DLBA 4K8ZA 4B9SA 3N97B 7ICVA 4YMOA 8ICEA 1JLAA 3KIOA 4RW8A 2IDOA 3VQQA 4JV0A 3ZCMA 4CHYA 4F3TA 2RN2A 4O4GA 2X78A 5J0WA 3H4BA 3OYMA 2FBVA 2MUTB 1TVRA 2VA8A 1SKSA 1CXQA 5EWEA 3DRPA 4DU3A 3M8PA 1ZBHA 1N5YA 5L9XA 4RPXA 4EZ6A 5KFQA 2R8KA 2FC0A 4UBBA 2P6UA 1IXRA 4GXIA 2RPIA 1ZBLA 1ZQTA 3RMAA 3BDPA 4ELTA 4CEFA 3HPGA 3G6YA 4W5TA 3TAGA 4FJXA 5J2BA 2MUTA 8ICBA 1TGOA 1D8YA 2XO7A 1ZYQA 4CEEA 1I3AA 4KTWA 1TKDA 4OLBA 5F9NA 5DQGA 4KPYA 3B0YA 4CHZA 1TV6A 4CIGA 2HW3A 4B9UA 4LZDA 4NLKA 3SQ1A 2YNHA 4J9QA 4RW4A 5EU7A 3VQ6A 5J0YA 5C5JA 4OLAA 2GUIA 4ELVA 9ICVA 4NCAA 2P66A 4FBTA 3SQ4A 4PH5A 1NJZA 4I2IA 3ZSYA 5KRSA 4KHUA 3V6HA 4GXJA 2QKKA 5J0QA 3QO9A 4QOZB 3ZDAA 4RPYA 2Z1GA 3MR6A 4K4GA 5J2KA 4KLIA 3M9MB 3PW4A 4QZFA 4PHPA 3KTQA 3ITHA 2DPIA 3DLEA 5JS2A 2X6NA 1I39A 3TARA 4OKJA 3V1RA 1JLFA 4Z4IA 4JRQA 9ICTA 3VQBA 5L1JA 1VSEA 2BHNA 2YV0X 4RU9A 1NJXA 5J29A 4DQSA 4Z4GA 2Q0ZX 4CF2A 1CUKA 4DFPA 3ZT0A 3JPRA 1RDAA 4IG0A 4KAZA 2F96A 4ECVA 2Q3SA 2ASJA 5FRNA 1RCHA 4CE9A 9ICGA 8ICZA 5T7BA 3GQCA 3H8JA 1VSKA 5CB1A 3VQAA 4YFKA 4ECUA 8ICOA 3C2LA 2EHGA 2WONA 3RTVA 5IIKA 4ECZA 4DL7A 1LWFA 4QW8A 1D5AA 4IDKA 1SKWA 3KKSA 4CF8A 4FLYA 4RT3A 4F4YA 4NLZA 4FLXA 1QTMA 4UQGA 3KHLA 4DFJA 1G15A 3C6UA 1JLBA 1ZQPA 2HNZA 3AA4A 4DS4A 1ZJMA 2BGGA 3ALYA 1MQ3A 3ZSVA 4F4XA 4CCHA 5C24A 4TUPA 3SCXA 4QZIA 1FXXA 1RT5A 3ZDEA 1JL2A 4YR2A 3M8SA 2HB5A 3V6DA 3HK2A 3C21A 5C25A 4F92B 8ICWA 5IIJA 1R0AA 1NK0A 5HHHA 2IOCA 3EWAA 3LWMA 3O3FA 2UVRA 4FS1A 4PHDA 1XSPA 2B6AA 3C6TA 5DG8A 1EP4A 3MABA 1S1VA 5DG9A 4DOAA 2YKNA 2BPCA 3UPQA 2IBKA 5KG4A 5HRRA 1COOA 3ZSWA 2KFZA 4CGJA 3M8RA 3UXPA 1VSFA 2OZMA 4FO6A 4IFVA 4B9VA 2Z1IA 3H40A 4NYFA 3NCIA 4ZH4A 1ZBFA 2VA3A 4CK2A 5KFPA 4LY7A 3NFAA 3L2VA 3ZDDA 3JPQA 4JV2A 2IHNA 1LWCA 2UVWA 1XHXA 4RNOA 9ICXA 4J9KA 2NRTA 3C95A 3OYJA 1TK8A 3KHHA 2PY5A 3AA3A 4O3QA 4CGHA 4OVLA 3OYIA 1NK4A 9ICMA 3RH6A 4M9HA 2BE2A 4KKOA 3ZT4A 1VRTA 3IG1A 2OPRA 1T03A 3KK2A 3JPPA 4TQRA 3B6PA 8ICGA 5J0XA 4CF9A 4QWDA 3H4DA 3RMCA 5KT5A 4P4OA 1SZPA 2BQRA 2HHXA 1SL0A 5HBMA 3HM9A 1XWLA 4FW2A 1RXVA 4CHNA 4R8UA 2A1SA 1WNSA 3BQ0A 3KK3A 2W9CB 1JX4A 3E2EA 5KFHA 5J2AA 5J0TA 3TANA 3OSNA 4DEZA 2E4LA 4J2BA 1BGXT 2JZBB 4BDYA 4I2EA 4E3SA 3K5OA 4B8AB 9ICNA 4LH5A 1ZQQA 9ICAA 3SPZA 3VA3A 1BL3A 4I7FA 3LP3A 2XY7A 1RZTA 1HYSA 2B5JA 5DK5A 4UB2A 4ED0A 2W9CA 1ZQFA 3T5KA 1T05A 7ICEA 4XIUA 2PFNA 4QCLA 4Z4EA 2AQ0A 2P1JA 3Q8LA 3LANA 3TFRA 3M9OB 2ATQA 3BGRA 3IM1A 2R7YA 5J2JA 4BXOB 1EX4A 2JZBA 3V7LA 9ICHA 4XQ8A 4DOBA 4I28A 4RQ0A 3MR3A 5DKWA 3T19A 4M9LA 2JEJA 4O5CA 5FRMA 4BACA 4C8MA 4DS5A 4HUEA 4GVMA 1WCLA 4J9PA 1N6QA 3OYHA 1J5OA 4FLWA 3RB4A 2KZZA 4CHPA 1KVCA 3OS1A 4BXOA 5DB7A 5HLFA 4F3OA 1IM4A 3GV7B 3HPHA 3RB3A 2I9GA 1VSHA 1Q9XA 3C23A 3OYAA 1JXBA 4XRHA 2BDPA 4R65A 1RBRA 4R64A 1HMVA 4EBDA 4KMUA 3NHGA 4KI6A 2VANA 4PGQA 2ALZA 4NXZA 4QZHA 5CY4A 8ICJA 1BQNA 1O1WA 3H7IA 3LAMA 1RT6A 2R8HA 1KVAA 4HTUA 2VG6A 3QEWA 3NGZA 1J54A 2A1RA 7ICQA 3MDAA 3QNOA 1X9MA 3CM6A 3OYBA 4MFFA 3PW2A 4CJSA 4QZAA 3MDCA 3PW0A 4I2AA 3MXJA 3IRXA 4KB1A 4DQRA 3RRGA 5KG2A 3T3FA 4CEZA 4CFBA 1RXWA 2PI5A 2BQUA 1Y97A 3DYAA 4AHSA 1IKYA 1ZQNA 4IR1A 3VQ7A 2YHBA 1HYZA 3OYKA 1L3SA 2PI4A 4PUOA 3SUOA 3KKRA 4N41A 2NUBA 4J9SA 2G8VA 3OYEA 4OJRA 3NH0A 3LAKA 4B9LA 1RT2A 4KLSA 1JXLA 4AHTA 9ICSA 1CLQA 3B0XA 2OPPA 1GOCA 4KLLA 4FLVA 4YMMA 5IIMA 4C8LA 3NF9A 4QWCA 2ATLA 1S6QA 1A76A 2PYJA 3ZDCA 3DMJA 3CFPA 1ZQWA 5KFRA 2IMWP 4O0IA 4IKFA 5J0UA 4DTSA 3V6JA 5J2FA 2UVUA 4G3IA 4DF4A 1C0TA 5KT3A 5KG3A 4FLZA 1JMSA 3L2WA 4ECRA 4E1MA 5I3UA 2QKBA 4EBCA 3D45A 2V4QA 4CJFA 3V7JA 5HP1A 3QETA 3RJEA 3HX0A 5J2QA 3RRHA 3NF8A 4KV8A 1NJYA 4O5EA 2FPMA 1RBUA 3QIPA 4FM0A 4CJVA 1U49A 3ZT1A 7ICMA 1JIHA 7ICIA 1RBTA 3AVLA 1WSFA 2QK9A 3V9SA 2V9WA 4YXJA 4CJUA 4RQ4A 4E7HA 2IHMA 2XC9A 4YR3A 3GIIA 4TQSA 4B9TA 3KD5E 5EWFA 1VK0A 3LALA 4IQTA 1UT8A 4QZEA 1AROP 4KITB 4Q0BA 5J0SA 4GLXA 4YP3A 4F8RA 4CJPA 1NK9A 4KFBA 3SJJA 4CK3A 3MAQA 5J2GA 4DSKA 9ICLA 1X2IA 3K58A 4E7LA 4FM2A 1U04A 4CEQA 4KLUA 1BPZA 3GILA 1BI4B 3AVGA 5KI6A 3U6FA 4F91B 3RJKA 1B9DA 1DTQA 1SV5A 4F5NA 2HVHA 1IKWA 4IRKA 4LVSA 3V81A 1VSJA 3SUPA 1RNHA 1X9WA 4P4PA 1JLEA 3C2MA 9ICOA 2HHWA 1L5UA 3V4IA 3V7KA 1J53A 1S1WA 3OHBA 3P5JA 5J2EA 4CFAA 1BI4A 3V9ZA 3GFKB 4H8KA 4F93B 2C2EA 4MF8A 5CYMA 4EBEA 8ICQA 3KK1A 2OYQA 5KG7A 1S0OA 3TAEA 4KB0A 1B22A 3PY8A 3QLHA 5DQHA 1NK5A 3K2PA 4DMNA 5FDLA 4XA5A 5KFOA 5KFKA 4JK1A 3K59A 4M9NA 2Y1JA 3JSMA 4YD1A 3P1GA 1ZJNA 4BE1A 3OJUA 2C28A 3C1YA 1JKHA 3ASMA 5J2MA 1ZQXA 2Y1IA 2OPQA 4Z6EA 2NRZA 2F8TA 3NE6A 5DDYA 5DGAA 4PA1A 4I2CA 2JEIA 5KFAA 5CZ1A 3H8WA 2AGQA 4FYDA 4EZ9A 3GV8B 3VQ9A 4BGDA 2FBXA 1RYSA 1RT7A 2H5XA 1XI1A 4BDPA 4I9QA 3BQTA 2P6RA 2BPGA 2I1QA 3ZSZA 3LZJA 2D0BA 2HMIA 1IO2A 1S1XA 4O55A 5DB6A 3MEEA 2G8IA 3DOLA 4R5PA 1DLOA 4C8OA 1C0MA 5DBCA 4Q45A 3G0ZA 3RBDA 2PFQA 4ZHRA 2ZUDA 5CHGA 1T4GA 4JRPA 3JPSA 3MEGA 4NCBA 4OKEA 1UT5A 4M6WB 1JLGA 4JS4A 5DBAA 4Q8EA 8ICCA 4M3WA 5DLFA 1JLCA 5DMRA 1N48A 9ICPA 1RBVA 3L2UA 3V6KA 4NY8A 4IQVA 3UQ0A 5BPCA 3SI6A 2RKIA 3WNEA 5KFSA 2XY5A 3OYNA 2OA8A 4R63A 4DQPA 3I0RA 4UAZA 8ICSA 7ICRA 1HJRA 1B92A 4CJWA 3SPYA 1IH7A 3PR4A 3AVFA 3GV5B 1HRHA 4IRCA 4K4IA 3PX6A 3U3YA 1QS4A 2ZQBA 4GC6A 4M6WA 1YT3A 4YD2A 1S6PA 3WNHA 3G10A 3RH4A 4CEDA 3SUQA 7ICJA 3AV9A 2ZJAA 8ICRA 4FJ5A 4KRFA 3AVBA 5KFDA 5J2CA 4W5NA 1CZ9A 3QEIA 4K4HA 4IRDA 3QZ7A 3V9WA 2ASLA 4Q5VA 4FW1A 4DTMA 4GC7A 3RMBA 3KHRA 1Z25A 2NRXA 4CECA 3KLGA 1UOCA 2EX3A 3NF7A 1WSHA 1RTDA 5J0PA 3PNCA 4N47A 1L3UA 3HW8A 4F5QA 5KFMA 1Z3EB 3CYMA 4FJ8A 3SQ2A 4LD0A 3AVKA 1SL1A 3QESA 3RH5A 2BGWA 2KFNA 4AILC 4E0DA 3C1ZA 1Q8IA 4FXDA 1WSGA 4CFCA 1XO1A 4DL5A 4IR9A 3A2FA 1C1BA 5KFLA 4ED2A 5KTQA 5KFYA 3PV8A 1T3NA 9ICBA 8ICXA 5F9LA 3TAMA 4M42A 1NK8A 3DLHA 4HCBA 3HL8A 3SI8A 1L3VA 3L8BA 4RT2A 2XY6A 2IAJA 3WNGA 5I42A 4RUCA 1T7PA 7ICOA 1HJPA 3AU6A 4RQ6A 4PWDA 2ZUCA 1Y88A 4QWAA 4TUQA 1VSLA 2HNDA 5J0OA 5DG7A 4I2GA 3AVJA 3G6XA 1IKXA 1TL1A 4QW9A 3IHQB 1HUOA 4O3NA 1ZQCA 4DWIA 1HQEA 4FBUA 1K6YA 1B9FA 1EETA 3MR5A 1NJWA 1WLJA 1HNVA 1ZQAA 4J2AA 5D4BA 4YFUA 4MQ3A 4KN7A 4J2DA 4FJHA 3TI0A 4YMNA 4R8UB 2M9NA 8ICIA 3DRSA 4DU4A 3AO2A 3TAFA 1BPEA 2BCQA 4N5SA 5CWRA 4DQIA 1U48A 3DLKA 2BCVA 1K1QA 1NOZA 5CA7A 1ZQSA 2W9MA 3K5NA 4LZGA 3GIKA 5KFZA 4M3UA 4EEYA 3CM5A 4Z4HA 4KLOA 1S9GA 5KGWA 5IINA 5J2DA 4J9LA 3RMDA 4F5OA 5CR0A 2O4GA 3G6VA 4PGXA 4UB4A 2AGPA 1HYVA 4FCYA 5SZTA 3RJFA 1Z00B 1RBSA 4N56A 3MXMA 2E6MA 3RJIA 3LP2A 3ZD9A 1EXNA 3F73A 4P4MA 2ZTEA 3AO4A 3PMNA 2R8JA 4HYKA 4ED3A 5KFWA 5CJ7A 2MAXA 4J9NA 2DFFA 7ICSA 3AVHA 1RPLA 3ISBA 4W5RA 4P2HA 3V1OA 4CJRA 2BCUA 1QHTA 4PY5A 1NK7A 1XU4A 4UB5A 1UWBA 3Q8RB 1Z00A 3T5JA 1MSWD 4QAGA 1TAQA 3SYZA 4RQ1A 4FK2A 1F21A 3T1AA 3DRRA 4ECQA 3NH2A 4M0AA 4I29A 1DTTA 3LP1A 4KLFA 8ICUA 4FZYA 2VWJA 3OSPA 2DY4A 4L8RB 5DLGA 3AUOA 8ICYA 1RYRA 1QLNA 4DF8A 3V9XA 1ZQRA 4M3ZA 1WN7A 3RAXA 4RPZA 3AU2A 3DM2A 1S5JA 4FK0A 4AHVA 3MGIA 3BJYA 1HNIA 5D3GA 3S9HA 5HRPA 1XSLA 3JPOA 2GWSA 3E01A 2LSNA 3UQ2A 1U47A 4O3SA 8ICNA 4KHNA 3NH1A 4DQQA 3HP6A 1NKBA 3NBPA 3QERA 1HPZA 2YNFA 2ZJ5A 3T5LA 4MF2A 3PO4A 3PX0A 2ZJ8A 1KEJA 4DTRA 2R8IA 4I2QA 4YCXA 3LPUA 3VQDA 3THVA 2G8KA 2YNIA 4KHWA 7ICGA 4F4WA 1TKTA 2Z1HA 4FJLA 7ICLA 4ED6A 1S97A 4MFBA 1BVSA 4Z4CA 3SNNA 8ICMA 3RJJA 4J9OA 3RR7A 5L1IA 2VWKA 2RF2A 1U9LA 4O3PA 1A77A 4QZGA 1ZQGA 2OPSA 2XGQA 3UXOA 4I9LA 4E89A 1CEZA 4DLEA 2ASDA 3DLGA 4AH9A 2BANA 4O3OA 4NM2A 2IA6A 4FVMA 8ICHA 1Q9YA 1TAUA 4E19A 4FLTA 1BIUA 4DTOA 1ZQHA 4M9GA 4KHSA 4TURA 3HYFA 3OVNA 1IG9A 3AA5X 1GOAA 2DTUA 2C22A 1KFTA 3I0SA 5KG0A 2DFEA 1X9SA 3OYLA 4DTNA 1KCFA 1RT1A 1BPBA 4YNQA 3ZDBA 5JUMA 4B9MA 4F4KA 4KN4A 5CZ2A 4DOCA 4DSEA 1RDDA 4J9MA 3Q8MA 1XS9D 4DSFA 3AVNA 5EWGA 1C7YA 2ZTCA 1KDHA 2ZUBA 5DDMA 3HJFA 4BDZA 5CP2A 1MQ2A 4CIEA 1EXQA 3K5LA 5KFIA 1D9DA 3MR2A 3Q8KA 3RAQA 2G8HA 5J2PA 2AU0A 3AVIA 4Z4FA 3TABA 4EYHB 1KRPA 1JL1A 1HQUA 3C5GA 8ICLA 3RR8A 4JWMA 1ASWA 3H8SA 3MEDA 4DTUA 2A1JB 1WSIA 2BCSA 4CEAA 1LW0A 4OKKA 4BE0A 1BPDA 3HVTA 4YXMA 2AJQA 1S10A 2G8UA 3UXNA 2JEFA 2FMPA 2IGIA 4CGDA 4HHTA 1S9FA 1QE1A 3ORYA 3NDKA 1IKVA 2G8FA
chains in the Genus database with same CATH superfamily
1IJEB 2YKAA 5HI7A 2LYHA 3VR1A 4E7IA 3CCSN 1TFWA 4QZ8A 7ICKA 3TACB 4OHZA 3KLHA 4FJ9A 5KFCA 5IWAJ 4X62F 1IKWB 4DG1B 3IRUA 1KQSR 2B6GA 3EPIA 3UE5A 4UB3A 4BR5A 5G0RB 3QEVA 2WTFA 1OH8A 3SBMA 2W24A 3O1WA 2FHOB 4ECTA 4P0QA 3B9JA 2CH5A 4FWRA 4DL3A 2P9EA 4OLOA 1SJ3P 3KHYA 4DSLA 4QZ9A 2MZTA 2MKYA 3CJ3A 2PSZA 5T7LB 1O13A 3KK1B 4CJ3A 4B9NA 1TKXB 4KLEA 4HI2A 4M5MA 2KNJA 1ITGA 3DI6A 3CWJA 5HQLA 2XBPA 4KHQA 8ICTA 1S77D 1B99A 1VJWA 2GIQA 5J1PA 4H0VB 4GO5X 2HVZA 2PEHA 1X3MA 1IXKA 3HHLA 2LM1A 4UB1A 3M2UA 3F44A 1QDUB 2F44A 4BR2A 4JI5J 1ATNA 4X65J 1RTHB 3D9BA 2JWKA 2ZH4A 2AYMA 1DGSA 4HVJA 3K1RB 3T6BA 4YB5A 1WCNA 1ZETA 3BGUA 2EFVA 3EGVA 1C1CA 3OTCA 3GTYX 1BY9A 1NJIO 4WCEQ 3O3HA 4OYXA 1WACA 2IRXA 4JNEA 4H5NA 2AP6A 4EP4A 4NL9A 2QV6A 2HHPA 1F0XA 3AY9A 4ILLA 4CF0A 1TQLA 4RW6B 2RS8A 3ULDA 1Q53A 3M2RA 3ZZRA 4CZLA 3HX9A 1Q18A 3NY0A 4BRKA 3C46A 4NLBA 1FD2A 3LDAA 3R6GB 4B1YB 2VGMA 4DR1F 2KT5A 4IFYA 3CCRS 5GADI 4GY2B 4ELUA 1D8ZA 4PHTX 1JLCB 3BKTA 1QVFM 1TP7A 3CE8A 2RDIA 1FRXA 2KU7A 2UUWA 9ICFA 5IV3A 4KH5A 3ZTQA 4I56A 2DY1A 3I0RB 3ULEA 2DRAA 1RWNB 2DKZA 1RU1A 2BOAA 2EANA 2CNLB 3BGLA 3GU0A 4IO9Q 1ECWA 3J81j 3KNGA 2M2BA 3JQJA 5EUHA 2QM1A 1BE4A 1EKEA 3RSEA 4DV2K 3F2DA 2I9SA 2ZOMA 3WQPA 2DEJA 1XSNA 1CBKA 5A8KB 2RT3A 1ZQZA 4CGGA 4YOVA 1U4BA 1YAGA 5KFJA 1BOTO 4J7CA 2IDEA 7ICFA 4OYPA 2IMOA 2A5XA 4RZRA 1QTNB 3PG9A 4Y2PA 5ALSA 3PR5B 4W5OA 4NLTA 3S6EA 2WHEA 4JB3A 5AJ3F 4DHVA 1EB0A 1QQ5A 4I2HA 2O4IA 3R5GA 4KI4A 1B70B 3K1ZA 4HCCA 3AO5A 2ZE2A 1N8RT 4EYIB 1TFRA 3CCJS 5JU5A 3BR8A 2EG1A 5H9FK 2EKNA 3W66A 4Z6FA 5HATA 1RE1B 1EAYC 1JCFA 5BJRA 2KJWA 2A3ZA 4DTPA 1LWEA 5CA5A 4O44B 1REVB 3ILIA 5AXMA 2VG7B 1TV9A 1W97L 3ZX0A 4HUGA 1VJ5A 1S1UA 2LMIA 4MKAA 4K2XA 2FJEB 5J2NB 4GKJJ 3ETLA 4FO0A 2XHCA 3OYFA 4JI7F 1FJGJ 2BZ2A 4RW9B 1HI0P 1CJVB 3E9OA 4NXNF 3ZSQA 4Q43A 4TN2A 1FKOA 2KFYA 1XNQF 1IBMJ 2XEXA 1YZ7A 3MECA 4RQNA 4BY9C 4YY3K 4MIBA 2HIQA 3L4QA 2QL7B 4LFAF 3DLLL 1NOMA 5HVHA 1W0HA 3NGIA 3BQ2A 2D5RA 3ZSRA 2Z57B 1PCAA 1E6YA 2H3IA 1FKPA 2OO4A 4QS9A 4P52A 4ECXA 2GVZB 2JOQA 5AE1A 4EUVA 3SDEA 4QR1A 4KHYA 3AAQA 4D3HA 4FZLA 1OS5A 1UA1A 3BGFA 4RQ3A 2WAQF 4ECYA 1MWMA 1X4AA 2FLNA 3TA1A 4LR9A 4JV1A 4BR7A 4JI4J 3KMQA 1S9EB 5D8HB 4QS7A 4Z94A 3D1QA 2OEMA 1W7WA 3U9ZA 3FZ2A 3W9IA 1Y64A 5J1EA 1S1TB 3MMAA 4PGYA 3HP9A 4LVOP 2DR8A 5AKGA 1ZBTA 3OY9A 3MFIA 4ISGA 3FZLA 4NLPA 4ID1A 5IM0A 2OWOA 4HH1A 3OHAA 1NM2A 1N62A 2M0NA 3V2UC 3T5HA 4TVAB 2V51B 1YJTA 4RWTA 4GRSA 5K14A 2DGUA 4NLNA 1MLAA 5D46A 3PW7A 3ONQA 2G0JA 3GSDA 4DTXA 2Z2LA 3BZCA 4RLEA 1O08A 1KAYA 4OX9J 4NLOA 5I3QA 3DXKB 5ALGA 3GIJA 2FVPA 1XR5A 2QXFA 4DV0K 3VN5A 4MK8A 3UPFA 3GWCA 5L38A 3AGRA 3EYZA 1SPBP 4DB3A 4FJIA 2XHBA 4FJJA 2CJYB 2YKMA 1SUQA 2CQGA 3FK4A 4M1KA 2XNRA 3HSCA 1CJTA 3VQ4A 4OZLA 4Y1DA 6AT1B 3KWMA 1RT4B 4DLGA 2F9JA 3PDNA 3UVJB 3L3VA 5HRSA 1H1VA 1SJQA 4KRWA 4CBUA 1S0MA 1N0VC 3EZ5A 4RQMA 3O9UA 3OLBA 2MZ1A 2LKYA 1P6TA 4NLGA 1MN7A 1HKGA 4LREA 4LF4F 2V94A 2UUAJ 4JKDA 3W0LA 2Y9TA 5J0RA 4PJ0U 2VG5B 3RBEA 2FPKA 1TL5A 3BV8A 2O8BA 2YNIB 1R8PA 3MFHA 4QWBA 4NL5A 4DUZF 3EE8A 1MU2A 3KLEB 1QSSA 3KXDA 2AJ1A 1R0BG 3OW2M 2M88A 3MMCA 3VA0A 4F0HA 4ZITA 1UEUA 4PG7A 4CESA 2XCPA 2J8SA 3HF5A 3CD0A 5EE3A 3M8ZA 3ETMA 3BZQA 4GXKA 3QU7A 2FBTA 4UUXA 1XHZA 1Z2LA 4KTZA 1SXEA 2B21A 2CGJA 4DV3K 2RE2A 1WORA 4NOHA 1T11A 1SCJB 1FRIA 2QA4S 5IIOA 3IS9A 2K4EA 4LF8K 4NWBA 3IR6B 4OHVA 4OPJA 4FPIA 3OTQA 4F0MA 3AHPA 1FTCA 4H5VA 4KLTA 5C42A 3MMBA 3OS2A 5BPLA 1KKXA 3BSCA 3OR1B 4J5OA 2YQ0A 4ILHA 2WOMA 3PO5A 3R5JB 2R2RA 1GLEG 2BE7D 4NYNA 2M4MA 3VMFB 3LWLA 1NKCA 3FYHA 3TJAA 1BA1A 1EZZB 1LB2B 2PXIA 1HNZF 1RWOB 1VQ6N 1S0NA 3LUYA 2C2DA 4IOCL 3LP0B 3FNNA 5J2IA 2FLLA 3QINA 4JI2F 3AH6A 4UTGA 1S7HA 2A2DA 4OI6A 4KO0A 1V97A 3JAMU 3CMAN 4W5QA 4BC2A 2XYHB 3L2RA 3QNNA 4BRPA 5LL6d 7FDRA 3HVWA 4Y6IA 4M95A 3OGUA 1TUWA 1GK8A 2KW4A 2J6UA 3JPTA 4BRNA 5TZVA 4LSLB 4H03B 4HDHA 2WUSA 4BRGA 4RNNA 7ICHA 1YSJA 5CXTA 1QSYA 2K3KA 3EZUA 1IBLK 4WXWA 4DFKA 4FS2A 4WE1B 3JPNA 1KAZA 1ZQMA 2JR5A 4H4MB 3D2FA 1MDUB 3MAAA 1YJ9S 4MEYA 2W9AA 1FRLA 3SQ0A 2QW9A 2D8CA 4ZVHA 4RQ2A 1KLMA 3NGSA 4PG4A 4YDDB 4HHHA 4BQLA 1R8CA 2MGZA 2QB0A 4ED1A 2J6TA 5KGXA 8ICFA 1QQ6A 3EGWB 2QZ8A 4FOEA 2W4PA 4FJMA 1K8KB 1F6TA 1KTQA 2PFOA 1GTEA 4CDGA 2ZD1B 3DXMA 1PIEA 2NO4A 1WTFA 4ID5A 4YHHK 3THWB 1YWXA 3TADC 3ED5A 1JLQB 2Y1RI 4ZCKA 2V68A 3QJPA 1NWKA 3CFRA 4FF3A 1JXEA 4P2XA 2UV8G 2M0GB 4RBTA 4LRCA 3QU5A 1X1PA 4C97A 3QT7A 4EGLA 3AO3A 3CF5L 5FPNA 1F2HA 1T8EA 4OYIA 5EX0A 4RBVA 1UTAA 1RWXB 1WHWA 1KKHA 1CS4A 3NOCA 2FHMA 3M6VA 4RW7A 5CR4A 3QWPA 2I7NA 3G8SA 1ZBSA 5DDPC 2IHR1 2CNNB 4DL2A 4CGIA 4JS5A 2CQ1A 1ZQOA 2F76X 1LW2A 2MXYA 2IC3A 5J2HA 4DXLA 5IT9U 4M04A 3BQ7A 9ICIA 4YOYA 3DRPB 4TNOA 1MMLA 2KHCA 1BWVA 1N5SA 4ETXA 2BJ3A 2XIDA 4OI2A 3OTOK 3N97B 1X9XA 3M32A 4YMOA 8ICEA 3KIOA 3SMVA 3VQQA 2N3OA 3ZCMA 2HURA 1NGFA 5AT1B 4NLRA 2BJDA 2WF5A 2IIHA 3N5FA 3MM5B 4CZMA 2NQPA 1FESA 1WC1A 2GO7A 5AM0A 4EIAA 1ZPWX 4EZ6A 2A0FB 2VFTA 2R8KA 4UBBA 1FT8A 2P6UA 4TLQA 2JC0A 2C1EB 4B3OB 1XMQK 4ELTA 4CEFA 4W5TA 3G6YA 2VFVA 4OO1J 2DWQA 5HAOA 8ICBA 1D8YA 4I4BA 4WKYA 4ICLB 3M2VB 3ICLA 4KPYA 3MX5A 4CHZA 5A2QU 2HW3A 4XH5A 4HI1A 3SQ1A 1Q95G 3VQ6A 3H46O 1MROB 3IUCA 1KS2A 4WIQA 1PYSB 3IM8A 2P66A 1R89A 2RVJA 4FBTA 3Q23A 4UAUA 4I2IA 2JRSA 4TYBA 3ZSYA 3HJVA 4O23A 4ED4A 1YUWA 3LTOA 4GXJA 5DJBA 1HHTP 5DM6Q 5CYQB 1DRZA 3PJ9A 3WC2A 4G9BA 3W7BA 3M4XA 2LXFA 3OHRA 4NXMK 1HBNA 4LFCK 3THPA 5GADU 5M1KA 5G5GA 3M9MB 5ELZA 1WWUA 1VQNN 2DPIA 2F8LA 3DLEA 3SEIA 2AD9A 5L8RC 1FI4A 3PLAA 5JS2A 1BUXA 1T9TA 3WQTA 1VISA 2KG5A 4OPHA 5M2UA 3CXCM 3ATUA 1S72S 1I94F 2E2PA 2H5EA 2ZH8A 2WONB 1ESVA 4Z37A 2KKZA 4ETZA 2Q0ZX 1OWXA 1F0MA 1UVNA 1WI8A 3H25A 4IG0A 4KAZA 3AAWB 3KOAA 3PFEA 3VPZA 2HNZB 1JMTA 3MC1A 3OPKA 4JBCA 2ZIVA 3D6FB 8ICZA 5T7BA 3GQCA 1BXNA 2IJFA 3HHLD 3H8JA 4DV0J 4ECUA 8ICOA 4FN5A 1LKZA 1NDCA 1NH8A 3C15A 3ZZYA 4PKHA 3VEYA 3H1QA 4JI8K 1KQKA 1DY3A 1A9NB 1SKWA 3H5YA 1NZ8A 1R0AB 4NLZA 4FLXA 2DL0A 2K7KA 1A7GE 3C6UA 1HIYA 2UP1A 1ZC6A 3AA4A 1IR2A 2W2OP 1PJ6A 3G96A 4QZIA 2P9UA 1UMJA 1F5CA 1NXIA 1JL2A 1D4XA 1PG5B 3M8SA 1XIQA 2OHFA 3HK2A 3KZXA 5F3ZA 4EO6A 2YN4A 3FEYB 1NK0A 2BJ8A 2IOCA 1OPIA 3LWMA 3O3FA 3MN5A 4FS1A 3FBBA 1UWAA 3CCUS 3QU4A 3C6TA 1EP4A 3J7YP 2BM1A 4AXIA 5K8NA 3R5CA 3MABA 1S1VA 4PQUB 5M2RA 5CZVA 3UPQA 2D6FC 2IBKA 3FCVA 5HRRA 3ZSWA 2KFZA 1VBZA 3CJTA 1OY9A 4Y0WA 3OR2A 2KDOA 5LY3A 4IFVA 1V9OA 2LBOA 3H40A 2E5LJ 1Q8LA 4ZVGA 2VA3A 1XQSC 2RHQB 5LMUF 4JV2A 1XHXA 3AJ1A 5JMVA 4RNOA 3I82A 4GMKA 3VGUA 4LF8J 4J9KA 2CUYA 3KHHA 4X64K 3AA3A 1DAXA 4USJC 1IV0A 5K8PA 3IDHA 5ETMA 3ID8A 1CPZA 4C48A 3A4TA 3Q2SC 3OYIA 9ICMA 3CJ8A 3ZT4A 1VRTA 2XHWA 3Q7BA 3HHKA 1T03A 3PSIA 3KK2A 2WB1C 8ICGA 1RWPB 1RADB 1RXOB 2E66A 5A6WA 3IFEA 1PK1A 2BDUA 2XSJB 4P7VA 2BQRA 2HGNA 4WPAA 2YVSA 1COKA 3IAS9 1RXVA 4FW2A 2JMGA 3J7ZT 1OKJA 4FP9A 3CD7A 1SIZA 3BQ0A 1WNSA 1UHUA 3JTNA 3J81O 3BH7B 1WB9A 1XN9A 5BYSA 5J0TA 3TANA 1RGVA 4J2BA 5EX5A 1JJCB 4BDYA 4WFZA 3DDNA 4E3SA 4K42A 4B8AB 1C4CA 4NEYA 3R3LA 3J80O 4UW9A 2M3DA 3R1HA 3J7ZO 3CCES 1Z4NA 3O2IA 2XO6A 2B5JA 5DK5A 5AQTA 2JFKA 4IO8A 4MN4C 3T5KA 1Y00A 7ICEA 4XIUA 4WXOA 2MZRA 2KJ5A 3EWGA 1FRHA 2KVCA 4KGKA 1J6ZA 3L7OA 2ATQA 1V85A 3IM1A 1O8BA 1EX4A 4C0BA 5HLFB 3ZX2A 2DPNA 1U24A 4XQ8A 3EGNA 1GMVA 2EAMA 4B3TF 2XMMA 3TSQA 3BN4A 2OANA 4YOUA 4M9LA 2JEJA 1UCVA 5HVGA 3C6HA 3MM6A 2BUPA 5BPMA 3GBTA 3NAHA 3D2WA 2UXCK 4LF1A 4J9PA 1N6QA 1FVQA 2P2CB 2VG6B 3VF4A 2KZZA 4YHHJ 1IM4A 3AM9A 3GV7B 3A8KA 2I9GA 4IQMA 1MA9B 3FBFA 1RZMA 1HBOA 4WZMA 3C23A 1ILYA 1SJFA 4F3QA 5HQMA 2BDPA 1RBRA 4R64A 3FC9A 1HMVA 1F44A 4EBDA 4M94A 1MWYA 4H54A 4PGQA 4NXZA 4QZHA 3T1HF 2P9NB 3RFAA 1BQNA 3H7IA 1KVAA 3HKZF 4HTUA 2Q6CA 3QEWA 5IS2A 2VBWA 3CQXA 2A42A 3OUYB 2VJ4A 4V19J 5HJYA 4C1NK 2XLIA 3PW0A 3HILA 2B0GA 1HNWK 1RT2B 4DV7K 3FFKB 5ALQA 4GIBA 1Q78A 4ZMMA 1RXWA 2PI5A 4BLGA 1Y97A 4QIEA 4AHSA 1IKYA 2NNWA 1PK3A 3AN1A 4IR1A 3VQ7A 2G2YA 4MLEA 3IMXA 1L3SA 2GUPA 1T9YA 2Y0SD 4CW7B 1HD0A 3OTOJ 5ALMA 3IGNA 3JS9A 2GJFA 2GHPA 1WKJA 2CWXA 3A3OB 2MKKA 3UDCA 2UXDF 4BQZA 2CNOB 4NX9A 1WUUA 2XMJA 3LAKA 4CO2A 4OI4A 4HHUA 1JXLA 2EBEA 5FLXU 4FNHA 2KSOB 4G6VB 1HX1A 2OPPA 2CIMA 5B0CA 2E2QA 4YDUA 1S6QA 2Q1LA 1NNEA 1BWEA 4E2FB 4X62K 5KFRA 3R1LA 1U2VB 5J0UA 1BUPA 4PPDA 2MQLA 1SWVA 1WJ9A 4DF4A 3SEOA 4QS8A 5KG3A 4FLZA 1JMSA 2F40A 2H4WB 4ECRA 5IT0A 3P31A 3WXMB 1XO0A 5CD4A 1O0PA 5BN9A 1U1PA 4CJFA 2I7PA 1LK5A 4DPXA 1RBUA 1QCKA 2OHDA 7ICMA 1KWMA 5JVHL 3GZFA 1XUPO 2WVFA 1FNOA 3M6UA 2EFNA 2ES6A 4NI2B 4RQ4A 1N34F 3C29A 3GIIA 4B9TA 2HHHF 3KWGA 3GU3A 3LALA 4IQTA 1WF0A 4NYPA 2A2CA 1AROP 2NXNA 2P6SA 3ZNUA 2QLFB 2O01C 1NSKL 4EWTA 1U8SA 4CJPA 2ZIUA 3OD2A 4KFBA 4QIWF 4QIVA 2H48B 3GG0A 3V4IB 3AOBA 4A59A 3BKFA 4ZPDA 1TVRB 3ENWA 4KLUA 4LMZA 3GILA 2FI1A 2P9IB 1YI2S 1B9DA 1RQLA 4F5NA 2HVHA 1N32K 1IKWA 3UCZP 5IC6B 1MN8A 4NLQA 1CG2A 1UVIA 2P9LA 3A3PB 4P4PA 1YGYA 1KAXA 4HAIA 9ICOA 1WNEA 2OYYA 4AQYK 4BS2A 2C3UA 4NA1A 3V7KA 3AXMA 1J53A 1NMDA 3O1LA 4DR1K 2D3O1 1PUZA 4P7TA 3GFKB 2CQIA 2ZUGA 3B78A 4Y2AA 4MF8A 5CYMA 4QNLA 1JKHB 3KK1A 2FGCA 1YVFA 4FZNA 4IJAA 3PTWA 3TAEA 1B22A 2YNHB 3A5NC 4ZPAA 1WKKA 5DQHA 3K8WA 5AM4A 5J8YA 3KFWX 4DR5K 3K2PA 3DRYA 1H6KX 5IOLA 4WQ4C 4C4RA 1YLXA 4EX7A 3K59A 4M9NA 5KAKA 1KNZA 4YD1A 3C6AA 4BE1A 1S1XB 2RHSB 2C28A 2LYAA 1ZQXA 2Y1IA 3DOLB 4Z6EA 3DDHA 1DLOB 2MSTA 2Z2YB 2JEIA 4LUBA 3T1YF 3TUPA 4BGDA 2FBXA 4BC4A 2MMYA 4YEAA 4JV5J 1XI1A 2H3FA 1JLFB 2E5IA 3G82B 1FEHA 2P6RA 2P35A 2JVRA 1IO2A 3GJTB 2H3GX 1VQPN 5DB6A 4CBXA 2G0CA 2DR5A 2KL8A 4DCJB 5FP0A 4C8OA 4DV4K 4ZJQA 3WX8A 4P10A 2A6AA 2XMUA 4Q45A 3W5YA 5AFUH 2HBMA 2PFQA 3U26A 2QTWA 4ZHRA 2ZUDA 5CHGA 2VDHA 2X3GA 4P74A 4NCBA 3OVSA 3VERA 1P1LA 2J0SD 4JS4A 3M8WA 2OMOA 8ICCA 2Q36A 1JLCA 2G1HA 2YTCA 4B3SJ 4I6YA 2BA9A 3L2UA 4IEEA 3UQ0A 2RKIA 3VESA 2XY5A 2GCFA 4OV1A 4JI7K 4FVCA 4OX6A 3I0RA 1Q7LB 3GCXP 1B92A 4CJWA 3VENA 3A13A 1OYEA 4NXNK 4HTIA 1I51B 1PSDA 4ZIVA 3TZXA 1B0TA 4EO8A 3U3YA 3FBEA 2OKQA 2AEFA 4GC6A 1YIJN 4YD2A 1S6PA 4O0NA 1WI6A 1SS6A 1TR0A 1XK8A 3RH4A 3CCMN 4OZ1A 7ICJA 3H1VX 3V6DB 2VIXA 4DU8A 5AK5A 4FJ5A 2QMWA 5LXYA 3B6BA 4FKXA 4W5NA 2AV5A 2JHEA 4LBPA 2CZ4A 2XWXA 2YXLA 3V9WA 2JX2A 2JC1A 3D0IE 4GC7A 4E8UA 2DBYA 2NRXA 3HD1A 4E98A 2A3JA 5LXRA 3SIPB 1UOCA 2EX3A 3NF7A 2MHEA 3DOMA 5J0PA 3PNCA 1N88A 3EKSA 4KX3A 3FSYA 4Y28C 3M1VA 1FA0A 1NDPA 1IUJA 2B9YA 1Z3EB 2YI1A 3CYMA 5I42B 4Q7AA 2OIHA 3RH5A 2KFNA 4AILC 4C4SA 1TELA 4IOCQ 2HNDB 1LWCB 1XO1A 3MPWA 4RKUC 1IKXB 4JKGB 1DGKN 3CCLN 3J81Y 1HQEB 2W3RA 3A2FA 5KFLA 2WF8A 4ED2A 3PV8A 1T3NA 4LQ3A 2MZSA 5F9LA 2QC3A 2IVOA 2FY1A 4XK8C 2V5HG 3HL8A 2HZCA 1PJ7A 1NGGA 1NPPA 2XY6A 2BE2B 3J80Y 1HJPA 5HJXA 1PVPA 3AU6A 1Y5IB 4PWDA 3PRVA 5J0OA 4I2GA 1ZQCA 2CQ4A 1EWQA 2L9WA 5IXUA 1QQ7A 5AQQA 2RHFA 3MR5A 3R1XA 5D4BA 1NCLA 5A8WA 1GX5A 1SWWA 4YFUA 4MQ3A 4KN7A 3CVKA 5ALIA 3TI0A 3DRSA 4R8UB 3MHYA 4CZEA 2DKXA 3TAFA 1BPEA 3Q8YA 4RUHA 4TU8A 2VL1A 1K1QA 1T3QA 6FD1A 2K60A 3UD5A 4PZOA 3EDRB 1X66A 2HGMA 3QYPA 4WQ5C 4KLOA 1RA6A 1OH7A 5J2DA 1QJHA 4OI3A 3G6VA 2AGPA 1HYVA 2LQ9A 1T05B 1SC4B 4BUGA 1ZOLA 2YH1A 3LP2A 3F73A 1R0CB 3FGVA 4ED3A 3A12A 1A6LA 3D2QA 1ZM2A 3AVHA 3CC7S 4WTYA 4ZPVR 1J2MA 3P5TL 3ISBA 4P2HA 1IBKF 4CJRA 2C2ZB 5M1QA 2EKYA 3DKDA 4PY5A 3W9HA 1V4SA 4UB5A 3D3BJ 1U6ZA 3F5TA 1Z00A 1MSWD 1TAQA 4RQ1A 1J5OB 5K4LA 2FUG9 4M0AA 1RCXB 3CO0P 4KLFA 8ICUA 2ZC4A 2R9LA 1G1XA 4L8RB 1N0UA 4NZ0A 3UB5A 2VOOA 4X62J 3V9XA 4DF8A 3G6ES 3LDNA 1LNQA 3A8YA 4L6V3 3IBFB 3LM9A 1VQLS 2JWNA 3TO8A 3BJYA 4TYAA 3NCQA 1TKTB 3M7VA 4CIOA 2DGVA 1RT6B 1N4LA 4OPAA 1DBDA 3F2CA 2J5AA 8ICNA 2UUTA 3WDOA 3LVVA 3HP6A 1NKBA 4A8WA 1UKUA 2W54A 4MF2A 1ZOTA 3ADAC 3PX0A 2CQ2A 2LI6A 4DTRA 2EAPA 4ZP7A 4QBUA 2E3TA 2YWGA 4QIGA 3LPUA 2OPSB 3Q86A 5FD1A 3I96A 5LSLA 2YNIA 2BW2A 4F4WA 3AB4B 3MN6A 2HI0A 4LRFA 1IR0A 2F1FA 2H65B 3FJ2A 2FHJA 1S97A 3GLJA 2YX4A 3F0NA 1JI7A 3SNNA 3M3ZA 1Q1KA 4J9OA 2VWKA 4H0PA 1F9HA 1RQNA 3HZ6A 4X4PA 5ETTA 1A77A 4X66F 4QZGA 2E7XA 1OYDA 2MLZA 4I9LA 1RHMB 2B7CB 4DLEA 2NXEA 3RW7A 4AH9A 2FZGB 2OELA 4NM2A 3AQPA 1SV0C 5KAIU 8ICHA 3CC2S 1TAUA 3O3LA 2MZQA 1HI8A 2E1FA 4M9GA 1SIWB 3KD3A 2E1MC 4WU3A 4TURA 4NA2A 2MZJA 1NSPA 2A41A 1GOAA 3AA5X 4EHUA 4NRUA 4ZP8A 1VQKS 3AD7C 2C22A 3OR1A 1KFTA 4DR2K 2VFUA 4AQYJ 3OYLA 1KCFA 5AQZA 4YNQA 2NXCA 4FWQA 2LQ8A 4B9MA 5JUMA 4DOCA 4DR1J 5AK3A 4DSFA 3SD7A 5B5EU 4HT7A 1LWXA 2RSQA 2WMMA 2W40A 2YX1A 4WFNL 3MF5A 4U8YA 3KVGA 4FVUA 2F3NA 4CIEA 3QUTA 2K4HA 3QUCA 1SVDA 2J7WA 4V1Ak 3QAEA 1QE1B 4ACOA 5AXLA 2BBEA 1CRXA 3MM7A 1KRPA 1JL1A 2LQJA 2VU5A 4DTUA 4NMXA 2Y3YA 4ERDA 1CQMA 1U0HA 1HKCA 2OTJN 2E20A 3FSXA 3DHWC 4HHTA 1S9FA 3GFXA 3KG0A 5AJ3J 4BGBA 2YMLA 4P71A 3OXGA 3R5AA 4DO9A 3QX7A 1JJ4A 4H4OA 2GV9A 5KNIA 1T95A 2RRBA 3SAGA 2WVDA 3VHQA 2YHYA 9ICWA 1XTZA 2CQBA 3CCSS 2BCRA 2IVFB 1S57A 3H20A 3OBYA 1ZQDA 4Q8FA 2XGPA 1RILA 2BRKA 1S1WB 4UBCA 3THWA 4ECSA 4JKAA 1JLQA 3I55N 3B82A 3IM9A 3HHLB 5KFFA 4YQWA 3M2UB 3R3TA 3WNFA 4AHUA 1GOBA 4A8MP 2W9BA 1FFGB 3K0JA 4JI7J 1J2NA 5A8RB 3VEOA 4M2YA 3OV7A 4B3MF 2B9EA 4NXNJ 2KZMA 4AHCA 1XNQJ 4K4XA 1FERA 2BH1A 1C1CB 1NPRA 4LFAJ 2G09A 3KBBA 3R97A 2EZZA 3POTA 1KFSA 3JSMB 3PW5A 2HVIA 3VETA 3WEEA 3CJ0A 3CNQP 4U67L 1NB7A 4O4RA 4KAIA 5J2MB 4U95A 3IWNC 1YVUA 1X4EA 3M2RB 4GVBA 5JJBA 1H38A 3WK8A 2E5JA 5GAEI 4HWIA 1T94A 1A6SA 2H9ZA 3GMGA 2X6SA 3FDSA 2HYIB 4JB8B 4UZCA 3JQKA 2V4JA 4IFYB 5KPRA 4CE6A 1F5SA 4UY8T 4MFAA 4F2RA 1UAXA 3QGIA 3HO1A 1R59O 1XBWA 1ZM4A 2AGOA 4U96A 4E7KA 3U1MA 3MEEB 3K0SA 4IQWA 4DSIA 4WBFA 2KRBA 1FHTA 2PO4A 1GLAG 3ULEB 2PA8D 4RNMA 4FM1A 3OJSA 2GMHA 4NPOA 4XAKA 2MRLA 1ZQLA 5EE0A 1FXRA 5BPNA 3G4SN 4DV6K 2Q3PA 3TUZC 2HGLA 3FBCA 5SWMA 3RSEB 2BJ7A 3O80A 4IZ9A 3EM1A 4FJKA 4B3OA 4KLDA 2RRDA 9ICUA 3CP8A 4G1IA 3LM2A 1V3RA 2IVNA 1RAJA 4WIIA 3I5CA 4IG3A 5D49A 2PMHA 1UL3A 4LFBK 4X5VA 4ICLA 3C94A 2DCUB 3M2VA 4O3RA 2FZCB 2VA2A 4CO0A 5K20B 1Z26A 4LJXA 3MURP 1R31A 2ZE2B 4EAHD 3ENAA 2FVQA 2ZBRA 3VAFA 2RQMA 4E1JA 3V4MA 3H6EA 4FSVA 5A76A 2XMVA 2OEJA 4PL2A 2GGPA 5AM2A 4EI2A 3HPOA 3S41A 4IH7A 3RJHA 1OQ3A 3L3UA 5CYQA 3L9ZA 4IS7A 4C9DA 2KG0A 1EWRA 1VMBA 4DL4A 2W7AA 1S1UB 1RFQA 2VIHA 4LF4J 1CXUA 2YKQA 3M6GA 4K41A 3L2QA 2UXBK 2J9EA 2PDAA 3MOJB 4ZCMA 1KFDA 4ES2A 3E66A 4JYAF 3P3DA 1KW4A 8ATCB 1L3TA 3PIOL 3BPDA 2CPXA 4K59A 1SGGA 4DUZJ 1FKOB 2NLWA 2CFXA 2G4BA 3IN5A 3ATVA 2H3VA 3H5UA 5AQWA 2XY8A 4BWJA 1UJ5A 4HL9A 4LF6F 1WKLA 2KE7A 4IWVA 1OMSA 4DV2F 3Q24A 1E6YB 3LGMA 5IQ6A 1KL9A 4ZDNA 2ZH5A 4Y2RA 2KZ3A 4US9A 1KEKA 3JQMA 1FO4A 3HT3A 3SDEB 3T6JA 4M3RA 1G7CB 2XB2D 4CFDA 4KQZA 5LMUK 2OZSA 4JD2A 1RAEB 1VBYA 2KK0A 2V7ZA 2J8AA 1XR6A 1LQ9A 1FIQA 1ZA2B 5BN8A 3FZHA 1QAXA 1N5QA 1O51A 4LIWA 2YX7A 3LK9A 3KUEA 1UW9A 4DFDA 4N8NA 2O3DA 5J1EB 2LU1A 1WG4A 4RQ5A 3TZYA 1GXUA 4YB7A 3W8PA 2AX1A 3DLKB 4UASA 5IM0B 3VCBA 3RB0A 4B8CA 2JFDA 5GMEA 1HNZJ 3AVAA 3Q0AA 4LJMA 2DEIA 2HCFA 2F77X 4URQU 1WWHA 3DRXA 3QPIA 1NMNA 2ZM6K 1HNXF 5K14B 1GEHA 3UCUP 4MK7A 3Q8SB 4JI2J 2JLEA 3C5FA 2KJ8A 4DBQA 2O5DA 2KJ9A 3K4GA 1I1GA 1ZRMA 3BSNA 2C3OA 4H0TB 3MTKA 2V4RA 4UW2A 3HI9A 1XC3A 1R8AA 4YY3F 3KDNA 4FPRA 2KXHA 4PQUA 4IOXA 1U7LA 5LT5A 4K5SA 3NOGA 2JH3A 2B4JA 4P9SA 5E3AA 1VBKA 4WCEL 5AQOA 2E5SA 3ZX3A 4ZVRB 1N60A 1SUQB 2JWLA 3E51A 4YUDA 3R9LA 2W7OA 3DC2A 1UWBB 1RHQB 1PYTA 3GJSB 4QZCA 3ZC4A 4OD0A 3SMPA 3DRRB 2PMZD 3VQPA 2N82B 4B3TK 3K57A 3C66A 4I67A 1T3OA 3PCOB 3EW9A 5HHIA 1RHRB 4FWKA 2KEYA 2YNGA 4KIAA 3KLFA 5CEHA 2HLTA 4FZMA 3CCEN 2O8BB 5B0BA 5HL7L 2QWQA 3Q8PB 1RBAA 5KFNA 5KT4A 3ENBA 1MU2B 2KN7A 3NGYA 2X1AA 3QEBZ 3CG7A 3MMCB 4IO9L 2G2OA 1YDLA 4BC9A 1XMOF 3QSIA 3TADA 2J0QD 5KOWA 2W8KA 4B1WB 5IILA 4PR6A 1D0EA 5GVQA 4ZA1A 3S8SA 3DXSX 1B0VA 1RTJA 2CXEA 3HVRA 2D4WA 4BR9A 1KTVA 2HS0A 4J9VA 3BQ1A 4Y2XA 5KG1A 3GB0A 3IS9B 4K50A 1GLLO 2VYPA 2ZC3A 3RJGA 1ED1A 1GMUA 5E3CA 4M3TA 2C2RA 4K2JA 4CH0S 4OPKA 3ZZUA 3HCXA 3MMBB 1ZD4A 2F1JA 2GLEA 1YJWN 4C8NA 1QSLA 2WOMB 2CRLA 2OD6A 4F26A 4M9JA 2QL9B 2KYXA 4ZLLA 4BWMA 4TKTA 3TUIC 5JICA 1RWVB 5M1PA 1CSJA 2XZWA 4M41A 3NNCA 1M5HA 3GDQA 2YWWA 4ZP9A 5KFVA 4Q44A 2DHXA 5A6PA 1CC8A 2UXDK 1X42A 3QEXA 2CPJA 5B0GA 3G9CA 4UOCA 4A2BA 3OTBA 1HFEL 4I6MA 1KVKA 3TAPA 4JP8A 3J7Z5 2MKSA 4LF7K 1JN3A 4UATA 1NHUA 2AT1B 5D0HA 5CHIA 3H0RB 1Y5LB 4A4JA 2HHTA 3TEGA 4KLHA 1M5VC 3S3MA 1RAIB 3LDOA 1VQ6S 3QEAZ 4DV3F 3D2FB 3MAAB 4TUSA 3R9PA 3LDSA 3C19A 1QUVA 1HQUB 1B43A 2XZDB 1K8AT 4FNIA 3OUYA 1ZTTA 2AZ1A 1KLMB 2VBXA 3TU5A 3ISNC 3O0FA 2Y1LB 1YJNN 4H5WA 3GIMA 3CMAS 2JGAA 2ITGA 3CD6N 2MGZB 2FMQA 5EOZA 5ADXA 2HHQA 3HSDA 2W8LA 3ZXWA 1ZQVA 3D0PA 3GOIA 2CG4A 1HUZA 4USHA 2R7RA 1WEZA 3DXMB 4U7UD 3NTUA 5KG5A 1K8AO 4ID5B 5DQIA 2HHHK 5AXKA 1R6VA 4D3GA 1J9AA 1F3VA 1NAQA 2CADA 2PE8A 2WVCA 5KFGA 4FK4A 2IIRA 3L3FX 1HI1A 1DQAA 4ECWA 2U1AA 5EX3A 4FPBA 3HWTA 1SC3B 5AK4A 4FKYA 1RP5A 2EC2A 3TQ1A 2QIFA 4DPOA 3VALA 4OX8A 2M5YA 3FFIA 4DX8H 3CDWA 1H73A 2DFHA 1I94J 3E9PA 1ASVA 1CS4B 1GH8A 3IFRA 3I6PA 4F67A 1SKRA 4RW7B 3PZPA 4ICAA 2P5OA 1U2VA 3ISZA 1IBLF 2NREA 3QJJA 2FMSA 3D6JA 5L1LA 4GNIA 3IP4B 1KD1T 1LW2B 2D69A 3F9KA 2IC3B 3EPGA 5ETRA 2VWBA 3V1QA 1K1SA 3MM8A 4EMDA 1K44A 2FHJD 4O8UA 2AJFE 3OQ2A 1FD8A 2Z30B 2DR9A 1UEVA 3MGHA 3IMQJ 1X0PA 3R8EA 5K9FA 1LAVA 3GDXA 5MLCQ 1URNA 3C16B 1RTIA 3PRDA 2V7YA 2AX0A 2Z7JA 3CQYA 2AXTU 4NI2A 3MUVP 2A6OA 3ZT2A 1FDBA 2FPLA 4CNZA 3HHNB 3OS0A 2DISA 1Z19A 3ELHA 3C2KA 4CF3A 4X84A 1SXLA 4GV6A 3RUBL 5HQ8A 1DT9A 4B9SA 1JLAA 3OLAA 5DRKA 2YHWA 4DPYA 5D6GA 3T1YK 2MTLA 5J0WA 2C2MB 1WUDA 2F9WA 4ZJLA 1TVRA 2VA8A 2NR0A 2WVEA 2Q0UA 5EWEA 4XH4A 4DU3A 1T9UA 3M8PA 2VC0A 3K8VA 4CLWA 3EZOA 5L9XA 4H0XB 4RPXA 2F65A 5ALXA 5D4NA 2CVIA 1F5AA 3BN7A 2FC0A 2G2ZA 1HWUA 2RPIA 3O9RA 2F8KA 1VQ5N 3BF3A 3M8YA 3UFCX 4FOIA 2AEJA 3RMAA 3QXGA 3QNWB 4ZVOB 3EE3A 4C2MA 1T02A 2C2OB 5LMUJ 2MUTA 3D2NA 1Y3JA 1ZYQA 4CEEA 1MG7A 3M6XA 5GAEU 4UUWA 4KTWA 3WK5A 2HOEA 3QUBA 1TKDA 4LBIA 5F8MA 3QT5A 4Y2TA 2A6MA 1TV6A 4B9UA 4LZDA 2YNHA 4J9QA 4RW4A 4KH6A 1RB0A 2E1RA 4OLAA 2GUIA 9ICVA 4NCAA 1MWKA 4PH5A 1CLFA 5KRSA 1N5XA 3K5PA 2P5VA 4B3RK 2V8DA 2AYBA 2HRYA 5JLHA 1HHQA 3HZEA 3QO9A 3FAHA 3TX8A 4QOZB 4PABA 3ZDAA 4RPYA 1HWLA 3PACA 3KLIB 1VDHA 4P0PB 2Z58B 1E4FT 1W2IA 3TSUA 5B7WA 5KPZA 1VJQA 3IBCB 3PW4A 4QZFA 1XMQF 3IG8A 1BD6A 3MM9A 1VQSA 2ZIVB 4G1QB 3TARA 3E9LA 2ASOA 1JLFA 5KL1B 3G82A 5D15A 1VQNS 3VQBA 4Z4IA 4WJ3B 3OFEA 1N52B 4RNFA 2YV0X 3C15B 4RU9A 4IQXA 1SH2A 1BLUA 5ETVA 4Z4GA 1JXVA 4MKBA 5I4MA 3NVZA 4CF2A 4DFPA 3BB5A 1AB8A 3ZT0A 1PJ5A 3ZZPA 1HBMB 2F96A 4ECVA 2FVCA 4BRHA 1GLFO 3UMBA 1RCHA 4CE9A 5AI4A 1X60A 9ICGA 1XNRF 2KLAA 1ROFA 1C20A 5CB1A 4OZ2A 1J5EK 4B3TJ 1X5OA 2HAFA 1LWFA 1UVLA 4LFCF 3DDKA 4NXMF 3BS9A 2FD2A 2MU2A 3BO2A 4GKKF 1D5AA 4IDKA 4Y65A 3KKSA 1NZBA 3MMJA 4FLYA 4ZPWR 2F9TA 4Y2SA 1KQGB 1S12A 3CJ7A 4DS4A 5C7PA 2UUBK 3A5LC 5IT4A 4RX6A 1MQ3A 1DQ9A 4K7QA 1EP4B 2GOLA 4TUPA 3SCXA 2A3VA 4K4ZA 4CLTA 2ERRA 3BS7A 5AKXA 1PGZA 3CCVN 1O03A 2HB5A 1XNSA 1WC4A 3OR2B 3V6DA 4LF5K 3KYLA 8ICWA 4IFVB 5IIJA 3VGKA 3VV2B 4K4TA 3T1HJ 2V67A 5AI5A 4PHDA 4KB7A 2VQFF 1C0UB 1FJCA 2KOBA 3N5BA 1VI7A 3MCPA 1ATRA 4DCCA 2J0WA 5D4OA 1UVMA 3BEGB 1AUDA 1M0SA 4CGJA 4JI8F 3ZEUA 4NJ8A 1ATSA 3X3UA 2HFVA 2ASYA 4FO6A 2Z1IA 4NYFA 3NCIA 4H4KC 4CLKA 1YRTA 4CK2A 1T03B 3KK2B 4LY7A 4Y2UA 2DNLA 1LWCA 2UVWA 2GVDA 3MUMP 1PK1B 4JKGA 3P38A 1CULB 2IPOB 2FLOA 1TK8A 2UXDJ 4AXJA 1IBKK 1VIOA 5ETQA 4CGHA 4DUYK 3SAHA 4UQTA 2YQ3A 3PNIA 1NK4A 3SQGB 4M9HA 4XDCA 2BE2A 3GCWP 2OPRA 3UKRA 4TQRA 4I68A 1RWUA 3H3OB 1EKSA 1Q5YA 2Q0RA 1Q16B 4KR0B 3AL0B 3SJHA 1JJ2R 4GVLA 2H3EB 3O08A 4QR2A 1HLWA 3PXGa 1XWLA 3Q8VA 2NYIA 4R8UA 2FSKA 1UFLA 2A1SA 4CLSA 2B5JB 1JX4A 2ZHAA 4KC5A 2Q31A 4P72A 4FYXB 2NPFA 5E2QA 4Q2MA 2O8FA 3OSNA 2CRXA 5CAAA 5FJ4A 2R7XA 1BGXT 1ZM3A 2PA3A 2A1AA 1DHMA 1OO0B 3EUNA 1VLOA 3HJEA 4X4QA 3C65A 3TVKA 4R0JA 2KVQE 4X64F 9ICAA 2WAQC 3SPZA 3F2KA 3VA3A 2GV1A 5DM6L 4NRTA 1GX6A 4I7FA 3W63A 3N6LA 4V19S 3MM6B 3F5EA 4Y34A 1HYSA 2W9CA 1ZQFA 1T05A 4I1TA 2PFNA 5JVGL 1APSA 4OHXA 1N6QB 4WYBA 3Q8LA 5ALJA 3TFRA 3M9OB 1N34J 5J2JA 3NUQA 5E5NA 2O8EA 2JZBA 5K8MA 2HHHJ 2EH9A 3UDLA 1O5JA 9ICHA 2WW4A 2EZXA 1RISA 5SUHA 3KDOA 5LJ3Y 1HBOB 3HRDD 1M90T 1UFWA 5DKWA 1KBUA 3RRKA 5FRMA 4BRMA 4X66K 4KBIA 4U7UK 1BQNB 1TUVA 2E7WA 3VVTA 4NYOA 2VH7A 5AQYA 1J5OA 3ZZTA 1YHQS 4FLWA 3QBWA 1T9VA 4K4UA 5DB7A 4F3OA 3HPHA 3RB3A 1CC7A 4U67Q 2UV8A 2QWMA 3SLCA 1Q9XA 3JSRA 3OYAA 2YX6A 5AFUA 4R65A 4ITSA 2BACA 4PZVA 3SCJE 4UF4A 4KMUA 1QM9A 2CJXB 4CO1A 2ALZA 4RUBA 2HRUA 2ODGA 2AP1A 4A5BA 8ICJA 2DKOB 2HBJA 3EXCX 2UUCK 1VIXA 3LAMA 1RT6A 1X4CA 1IKYB 4ES3A 3W1YC 5ETLA 3QNOA 3FRZA 3IC1A 4X4VA 3CM6A 3DXBA 5D0RA 3SMSA 2RE1A 3MDCA 1GMWA 3F41A 1RT3B 3A5OC 3RZAA 3IRXA 4KB1A 3RRGA 2UXCF 5KG2A 2MHNA 4DU7A 4RNHA 4DPTA 1L7MA 2OPPB 5M1FA 2BQUA 3RBXA 1GLBG 3OYKA 1S6QB 2O66A 3SUOA 3KKRA 1FWLA 4N41A 3L0QA 1RLDA 1NI3A 3I56N 2G8VA 5IZHA 3OYEA 3T1YJ 1URJA 4JK9A 9ICSA 3BBBA 4MDBA 4ZKAA 3M1YA 4KLLA 3GP9A 4YMMA 1FFWB 3GFYA 2ATLA 3RU0A 1YZ6A 3HFVA 2H4YB 2F3JA 4HR2A 5EN1A 1WSVA 3KKFA 3ZDCA 3C14B 3CFPA 2CXYA 1HNWF 1NDKA 2D74B 2D41A 3K9JA 4DV7F 3V6JA 4RU2A 4G3IA 1Q3UA 4DMZA 5KT3A 3QATA 4ZLPA 3D2EA 4HHJA 2M70A 5I3UA 5CZXA 2KV2A 4EBCA 3M1FA 3CULA 2YH0A 3PHTA 5F8GA 5HP1A 2QEXN 1LFPA 3RJEA 4RPFA 5H9EJ 3ENOA 4O5EA 1VGYA 4P6QA 3H7HB 3H5XA 3LPYA 4CJVA 1CJKA 3PIOQ 7ICIA 3P8BB 2ZIUB 2DJWA 2LQ5A 4KFBB 2MQ8A 3D6HB 2QK9A 1AZSA 3NKYA 4B3MK 5HROB 1U2RA 3HVAA 4CJUA 1JB0C 4URSA 2KO1A 2IHMA 3J7YI 4Y0FA 4PXDA 3G25A 3BM7A 1XMBA 2HFOA 1J97A 3KD5E 1VK0A 1UT8A 2F8MA 4A8XA 2P9LB 3WC0A 4Q0BA 4GLXA 4F8RA 2I2YA 3TKAA 4JKCA 1HLUA 1NK9A 1NNLA 3UR0A 4CK3A 3JXUA 3QBCA 3K58A 2DQNB 1BPZA 2ZKTA 5ETKA 3U6FA 5EGYA 4DV5F 1HWJA 2APOA 1FNMA 1SV5A 4FWPA 5E84A 5CYMB 3V81A 1VSJA 2W03A 3SUPA 5CCMA 2COLA 4XTTA 3OFGA 1JLEA 1RU2A 3CJ5A 2OUGA 1TE2A 5L1MA 3H98A 3QFWA 4OHWA 2ZJPQ 2JRZA 1QVGR 4K4YA 4ATNA 4F36A 1WC6A 1ZD5A 1S1WA 3BKUA 1NSAA 3OHBA 2XI2A 2AF6A 4CFAA 1OVYA 4DV1F 1BI4A 3WXKA 3V9ZA 1K9MT 4H8KA 3B4DA 2C2EA 1SB6A 2Z2MA 4YMEA 4RTFD 2DNGA 2OYQA 1NGIA 1S5LU 1S0OA 3PY8A 5A8RA 4CD1A 1NK5A 4M5GA 4DDFA 1HKBA 1K73T 1OH6A 2O8DA 2GO8A 1VC6A 1TMJA 1YQHA 5KFOA 5KFKA 1C0GA 3JSMA 3CJAA 2G9OA 1N32F 3D0GE 3JSBA 3VC8A 1MW7A 2PT0A 5J2MA 2GWKA 4DOZA 3VZIA 2ZH9A 5DDYA 4AQYF 3D3CJ 4I2CA 4MYTA 1VS3A 1DKGD 3QU9A 2AGQA 4EZ9A 4NWIA 4ZHRB 3VQ9A 1RYSA 3DDIA 2F4FA 3T41A 4JI0K 2H5XA 4BDPA 1GLCG 4I9QA 4GV9A 4M63C 2BPGA 3O9TA 3TTCA 4K0KK 2JH7A 3MEEA 2G8IA 2RKIB 4R5PA 5HL7Q 4DR5F 3HBTA 5DBCA 2WHOA 4JYAK 3FZFA 1A0PA 1VQPS 4KH1B 4C0OC 2YHXA 3JPSA 9ATCB 4DR6K 2K8CB 1GXLA 4LF6K 4ES1A 1FRJA 4ZVQB 1S6PB 4Q8EA 2WSEC 1SJ4P 1NGCA 5DLFA 1P27B 4M3WA 4WZQA 3QRPA 3V6KA 2HMPA 3R6MA 1IBKJ 1ZPVA 3SI6A 4BX9C 3WNEA 5BR9A 2WBNA 2KM8C 1UEKA 2X1FA 4YOXA 4DQPA 4UAZA 8ICSA 1HJRA 2QTDA 3SPYA 5CHCB 1WC5A 1SI9A 2QA4G 4BVPA 1HRHA 4USTA 4K4IA 3VAIA 2YY6A 2RLTA 2ZQBA 2Q2RA 3ZTOA 1HUXA 3DOMB 1RT5B 3ZTSA 3U7JA 3CCZA 3SUQA 1BQXA 2IOHA 1YJRA 2GAGC 4DV4F 3M1VB 5M2PA 4WWSA 2HFNA 2OGUA 2ZVSA 1YIJS 3QEIA 2B8PA 4PG8A 4NLVA 2HOIA 3CCMS 1Z1VA 1NGAA 2DNZA 3KHRA 3TPQA 4CECA 2W6LA 1N8RO 4UB6U 1P9QC 2DTJA 2HQFA 1HNXK 4N47A 3SXLA 1CQNA 3KJNB 2XWYA 2NZTA 1YJUA 4USIA 4PAAA 3GL1A 3HW8A 4F5QA 3UD3P 5F0UA 5DETA 2WF6A 4IJNA 5D78A 1REGX 1J27A 4LD0A 3QESA 1WDTA 2RILA 4PWDB 1C4AA 1WSGA 1WHYA 4CFCA 2ILYA 4DL5A 1JQGA 3R2CJ 4ANDA 3O9QA 1TUGB 3WT0A 4Y2KA 5KTQA 4JOUA 5A8WB 4M42A 3SCLE 2EWSA 5AK6A 3DRSB 4HCBA 4X66J 2NO5A 1G4CA 5F41A 3D4JA 3CCLS 1EO1A 2OM6A 4A47A 3GR1A 3C7NB 3L8BA 3I31A 4RT2A 4JAXA 3WNGA 4KKOB 4RUCA 7ICOA 2BTFA 5F0WA 5C15A 3GYGA 4Y2IA 4RQ6A 4OCZA 2ZUCA 1Y88A 2WB1D 4F0KA 1WBDA 3MXHP 4QW9A 1HUOA 4O3NA 5K5MA 4NLXA 2JSXA 1RAOA 1EETA 1WLJA 3QSYB 5B0FA 1SV0A 1H7XA 4LRDA 4ZPTR 2LP4A 5GINA 5E3QA 3RYLA 4DU4A 2C3MA 3CTRA 1OSCA 1HKAA 2E88A 3AO2A 3PJWA 4RWXA 2KVSA 2BCQA 4N5SA 5CWRA 3LP2B 1U48A 4B02A 3DLKA 1NOZA 4F9OA 2VASA 1ZQSA 5KFZA 4KYZA 3UWTA 4K4VA 1N36K 2O8CA 4NZ7A 1XMOK 3NLCA 4CQ1A 1PC4A 3U1NA 2P9GA 3PHEA 4CDIA 4FCYA 1Z00B 3R6LB 3S01A 1M5OC 3MXMA 1TFYA 1WEYA 3RJIA 2L9NA 3HOTA 3PMNA 2VPYB 3GPAA 4HYKA 2MAXA 2OTLN 3O44A 2DGSA 4KGMA 5KAFU 7ICSA 3M5RA 3IG5A 2ZOGA 3H5SA 4N8OA 2KHQA 1ACMB 4DCPB 1Q7YT 4W5RA 3V1OA 1QHTA 3QBXA 4QQBA 1UWBA 1M1KT 2DNPA 5L46A 3MAHA 2NSCA 3SYZA 4FK2A 4J03A 1YJ7A 2DCLA 3DRRA 3NH2A 2AIRB 4I29A 3LP1A 3OSPA 3AUOA 2OSQA 5AQIA 1BWFO 2LPEA 2F4VK 1QLNA 4Y2YA 1OPZA 4YOWA 3N01A 3FUYA 4MDAA 3VEWA 4XPCA 5JTIA 3DM2A 1M1KO 2AZ3A 3CEDA 1CVJA 4CNYA 4WP8A 3WK4A 3R2DJ 3L09A 1DEJA 3S9HA 3D7SB 3E01A 3MCMA 3UQ2A 3U27A 5ALLA 4Y3CA 5F3XB 4ZN3A 5BXIA 1GO3F 3QERA 1HPZA 1EQYA 2ZJ5A 3NGKA 3PO4A 3I5AA 2R8IA 3UMCA 1T44A 3SCKE 4B3MJ 3A8EA 3THVA 3PSFA 4WF9Q 2QLJB 2Q97A 2Y0SF 3CJKA 4RCHA 3T79A 3DYAB 3OBIA 4AYBC 3FZMA 5AI8A 7ICLA 3CO9A 4OYMA 4LF9K 2WBMA 4ED6A 4BRDA 2X7IA 1N5VA 1V4TA 2E5GA 8ICMA 3L4IA 4O3PA 2XGQA 4E89A 4MK9A 2ASDA 1QZ5A 2BXJA 4DQ8A 5A0YB 2BANA 4O3OA 1VC0A 3NGTA 3HSJA 4FLTA 2RRNA 1KHWA 1BIUA 2HBRB 4DUTA 4K25A 3Q7CA 3M30A 1DQ8A 3BR9A 1NNDA 1ZS6A 3HYFA 3EICA 2NZ4A 1IG9A 2OJ3A 3PFOA 3LO3A 5FIIA 5KG0A 3MR7A 1X0FA 4U9RA 3D28A 4F4KA 3MM7B 3QRQA 3TX0A 3AVNA 2EQYA 3WU2U 1C7YA 4M5HA 2JJ4D 2ZTCA 1KDHA 2ZUBA 5GAHP 2V2VA 5J2QB 1U0HB 3R7BB 5CP2A 4BDZA 2HVDA 1MQ2A 1EXQA 3AEVA 2CQCA 3LOUA 3QIPB 4IOBA 3K5LA 1D9DA 2ZUAA 3MR2A 5D0GA 1H2VZ 3KUHA 3L95X 3CCQS 2G8HA 5J2PA 2MQQA 2AU0A 4PL7A 3AVIA 3TJ9A 4Z4FA 2E9RX 4IEIA 5HR6A 3HKZC 1HQUA 3C5GA 8ICLA 3RR8A 2MSSA 4ZPCA 4JWMA 5AKZA 4H4OB 1AXQA 2YKPA 1K0TA 2NRHA 3LGHA 3HVTA 2DHSA 4YXMA 1R8HA 4DR2F 2OCEA 3UXNA 2MQOA 5AHXA 3CPWR 1RTZA 4H0YB 1RQ0A 1UAWA 3W2VB 3C28A 5F8NA 3SSRA 2XS2A 3OVBA 2OTJS 4OJGA 1OY6A 1MNEA 3AA9A 2M7SA 4JI3F 3O5TB 2E5HA 5ALDA 3A0HU 3BYPA 5DDQC 5ITHA 2YHAA 2W9BB 4M5LA 3WK7A 4Y2QA 2DNYA 1FE4A 2K7JA 4JYAJ 2K1RB 4F7VA 3QFUA 2QA2A 3THYA 3R5BA 4UOGA 4JUZA 4LF6J 2JVOA 7FD1A 3QJLA 1Y11A 3POTB 2IM3A 1GMWD 3J7YU 3L3CA 4DV2J 3WEEB 4F3MA 3LA0A 1NZAA 5ALVA 4OIXA 2W25A 4CT8A 4CJLA 2HRTA 3IAYA 3I55S 3PEJA 1BQMA 3PYEA 5KT7A 3S3OA 4GVBB 3QQCD 2MKJA 3QIOA 5FDLB 4BG8A 2EFPA 1YX2A 2YJEA 4O5FA 2V4JB 2JH1A 1NBEB 1KQFB 4Z7YA 1S0VA 4CM2A 2M52A 1LOUA 2AJ2A 1RG6A 1SBRA 3BY5A 4OJPA 1OXJA 2R3VA 1NBWA 2FB0A 2MLXA 1DRGA 3C16A 3KMSA 3T9ZA 3DGVA 5H9FJ 4KLJA 3HSTB 2ZTDA 2KHVA 2OPQB 2HWTA 1NKEA 1B7FA 1ZZFA 2ATCB 4PL1A 5B0EA 1FRMA 1RJJA 4DR7K 3JYTA 4CBWA 4U7CA 4FYVB 2MKIA 3OYGA 2BMBA 1R43A 1HNXJ 3TOQA 3HXMA 4I2BA 1TKZA 1S99A 3O8MA 3SUNA 2OAUA 3HD2A 2F8SA 1S8OA 1ZAWA 2KKVA 4QIWC 4CEOA 2C2KB 4YDUC 1YJVA 3AVCA 2EFOA 4AD6A 4IG3B 4YY3J 2AJ4A 4ZVSB 2QI2A 1BG3A 5ALNA 3WK9A 2KKPA 3I33A 4DU1A 1RDFA 2ABYA 1NG9A 1MWQA 2BR0A 2G0IA 3N0VA 4BR0A 1PVQA 4I2PA 2GMJA 5IWAK 3PUFA 4ILJA 3G4SS 1KC8T 1G99A 4YN4A 2VONA 2R18A 1H0HB 3D67A 2Y8WA 3MN9A 4EP5A 4AM6A 2GGPB 3TJ8A 4R66A 3TWHA 4E7JA 2N4DA 1XNRK 2Q4TA 3ID6A 5ALYA 4I64A 4FLUA 5HP4A 1V9PA 2QRRA 2VICA 2XVTA 3QU2A 2OP5A 1U2FA 3H8YA 2BEFA 3S6JA 2HPUA 1WSJA 1RI7A 3DLRA 3Q8QB 2ZJQQ 1NK6A 5I9EB 2MLYA 4B17A 5JVGQ 4I6AA 4GKKK 1MC8A 2BJ9A 2EFQA 4F2SA 3VZHA 1N56A 2EZYA 2DH8A 3W5ZA 4F72A 4DSJA 1BMQB 4F50A 2HFSA 5E7OB 4MEXA 2FE9A 4OYOA 3MOZA 4DV6F 2EG2A 2YWFA 3KLIA 2CVEA 5BOLA 4P0PA 8ICVA 1KOHA 2BKPA 2W4DA 3CDAA 2PZSA 2RAQA 1XMOJ 3H2UB 1RTDB 3H0MB 3AARA 1BIZA 1SL2A 1HQ2A 4JI5K 4FWLA 4CIFA 5C0YA 3KJVA 3VWSA 4G1QA 3O4WA 4MKYA 4UAWA 3GYXB 2D0AA 2I5HA 4GMJB 2VQFK 4LFBF 4ED5A 9ICKA 4JD2B 4KREA 5JS1A 4GV3A 2A1BA 3NGRA 5F1XA 5AZIB 2MJNA 2NRVA 3W2WA 2YY3A 2BKEA 4LIRA 3TAMB 1HBMA 7ICNA 4PRFA 3VQEA 2G5IB 5TISU 3GE1A 1FX2A 1M6YA 1Q4RA 5G4DA 3DFEA 2WBRA 1NU4A 3AA2A 3VQTA 3LPTA 1Q79A 5GMDA 3VF2A 3ZSOA 1FW6A 4PCQA 2CA9A 2R7UA 2MSNA 4CERA 1H2TZ 5L9NA 5E3PA 5BYRA 1EJ7L 3HMJG 1QD1A 2UXBF 1XQIA 5CD4H 5AQKA 4UARA 1HNVB 4RQ7A 2P9KA 3UNGC 1ULRA 3QGGA 1F2GA 4ISFA 3O5BA 3GE9A 3ISDA 1TU0B 2ILZA 2HNYA 2I6XA 4UB8U 4CJTA 1HEKA 3SBTA 4TU9A 1BCOA 3RB6A 2GQ2A 1IQZA 1KBRA 4M47A 1BPYA 2ZH1A 3M05A 2E7VA 3CCWA 4K8RA 3WKEA 2F8EX