4B9UA

Structure of the high fidelity dna polymerase i with an oxidative formamidopyrimidine-dg dna lesion -da basepair in the post-insertion site.
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9uA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9uA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9uA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9uA01
4HCCA 4KLMA 3ZT4A 4CESA 4ECQA 4KLDA 1DTQA 1S1UA 8ICQA 2F1HA 4KLIA 1XWLA 4F5OA 2BCVA 2ATQA 2D0CA 3K59A 2RKIA 1SKWA 1SL2A 4IRCA 3D0PA 3ZSZA 1A76A 4UBBA 7ICLA 4TURA 8ICJA 2IDOA 3HT3A 4I2CA 9ICSA 2IS3A 4IRKA 4CCHA 4B8AB 3RJIA 1JL2A 3NH0A 3MXJA 3DLGA 4PH5A 4AHUA 4M6WB 5KFPA 3TARA 2R8KA 1XSPA 3MECA 4FJNA 5D46A 4DSKA 1C1AA 5KG2A 2JLEA 3M8RA 3RAQA 4CJFA 3QNNA 4PQUA 4EZ6A 4O5EA 3KD1E 4DSJA 3NF7A 2YNHA 4UQGA 2DPJA 4H4OA 2FBTA 4F5RA 4N41A 2X6NA 3RJKA 2BCRA 1ZQUA 9ICPA 5KFVA 1XHXA 1DLOA 2VWKA 4E3SA 2ZQBA 3M8PA 1LW2A 4O3OA 4NM2A 4QZEA 3ZSWA 4FJGA 2B4JA 4CEQA 5J2NA 2AQ0A 5C5JA 3O4NA 2G8UA 1BI4A 2BR0A 4O3QA 4JV1A 3LPTA 5KFTA 2F1IA 3LP3A 5JUMA 5KFZA 3Q8SB 9ICIA 1XHZA 1BCOA 4Z6DA 3OHAA 3Q8KA 2R8GA 1ZJNA 4FXDA 1WSGA 3OYCA 4M42A 1W9HA 4Q8EA 4MEXA 2B5JA 5L1IA 2HHQA 4OKEA 1UWBA 3QEXA 1X2IA 8ICRA 3UXNA 3RR7A 3GV5B 1QTMA 8ICKA 3KLIA 5DG9A 3HPHA 5F9NA 3C2LA 2ALZA 4DG1A 5HP1A 1NK8A 4FLTA 4KITB 2OPSA 4GC7A 4B8CA 4FM1A 4DTUA 2R7YA 4ID5A 1ZYQA 9ICAA 3QINA 2KTQA 4FW1A 2IMWP 2O4IA 4CJLA 1MSWD 4CK2A 3AA5X 8ICIA 3VN5A 3RTVA 4O0IA 4F4WA 4QWAA 1S77D 2ZTEA 3OGUA 4NCBA 3MEGA 3KHRA 5DDMA 3OVNA 4CJUA 2W9MA 1VSMA 4F4YA 2XO7A 2F1JA 3SUPA 1KVBA 1C0MA 3RMBA 1U04A 4YMNA 1ZQPA 3ITHA 4CEOA 3AVJA 4F2RA 2YV0X 1AROP 4DWIA 1Y97A 4YFKA 4ELUA 1UA1A 4CHPA 1NJWA 4C8MA 4W5QA 2NRVA 5L1JA 4GW6A 3AVFA 3NGYA 2DFHA 1S10A 2KQ2A 4O55A 1NJZA 4PPXA 4N47A 3D45A 3KLGA 3IM1A 1ZBUA 3L2WA 4RQ1A 4FM2A 3WNFA 3VQ8A 9ICOA 4R8UA 3O3GA 4G1QA 4CF2A 4FZYA 3H8SA 4FBUA 4DQRA 5KGWA 3KKRA 7ICIA 5KRTA 2Z1GA 3JPNA 3OYJA 3TAFA 2FMSA 4JRQA 3F9KA 2PXIA 4EZ9A 1HQUA 1ZQQA 4OVLA 5KT3A 5DG7A 4CE9A 8ICPA 1WSEA 4M3YA 3DRRA 4ZHRA 4F3OA 3EPIA 5FRNA 3AU6A 3RJHA 2I1QA 2NRXA 4ZTFA 4CJRA 1TGOA 3AO5A 4CJ3A 5DLGA 8ICAA 3G6XA 4DSLA 4ECZA 1ZQNA 5BOLA 5KTQA 1L3VA 3IAYA 3TAGA 1S9EA 3M9NB 3GILA 3T5JA 3RWUA 4QZHA 5J2CA 1JX4A 1ZQDA 9ICXA 3QETA 5CP2A 1PZNA 3U3GA 2M9NA 7ICMA 5J2GA 1VSFA 1WLJA 4GMJB 4BXOB 1RTDA 1NKEA 1REVA 2R8JA 1D9DA 3MXIA 1JXEA 4RQ8A 5KFFA 1LW0A 4KHYA 4DTRA 3H08A 2VG5A 1C0UA 4Q0BA 4RT2A 1K1QA 1WSFA 3O3FA 4YXMA 1TVAA 2W8KA 4P2HA 3GIKA 4I2GA 4OPJA 1MQ3A 1S0VA 3TANA 2IA6A 4EP5A 3V9SA 5KRSA 1T7PA 2HMIA 2ZUCA 4CF9A 4YNQA 3SCXA 4I2AA 4HCBA 3L2QA 3TAPA 4IRDA 4RQ3A 2EHGA 4RQ4A 4QZGA 4ELVA 1NK9A 3WNEA 3RB3A 3KLHA 1LWEA 3K57A 3BQ0A 4O3NA 1GOBA 4J2DA 7ICOA 4ED1A 4NXZA 4I2EA 4YXJA 7ICTA 1BISA 1GOCA 2BKEA 1RCHA 4DS5A 1SL1A 4BGDA 4NYFA 4I2IA 2VA3A 4Z4GA 3B6PA 1RBUA 1B9FA 2BCQA 3VA0A 1NJXA 1S1VA 3V72A 2R8IA 2KFNA 2XY6A 5JS2A 5J0RA 1ZQHA 1RTJA 1WNSA 5HRPA 4I2FA 1EKEA 5EWGA 3SYZA 2XC9A 4ECRA 2OPRA 1JL1A 4FJJA 3ZCMA 3NAEA 3T3FA 4B9MA 1NOMA 1UA0A 2HHSA 3V6KA 1UT8A 3N4MB 1U48A 3VQBA 4KHUA 2GBZA 4UB1A 1S0MA 4F92B 4DOAA 4BWJA 3G6VA 1VSKA 4NY8A 4M9GA 1X9WA 2Q0ZX 3VA3A 3QERA 3QO9A 4PWDA 4KN4A 1VRTA 4DEZA 4KN7A 3BQTA 3VQ7A 1L3SA 3DI6A 2XHBA 1HQEA 1ASWA 4M9LA 5L1LA 2W9BB 4DSFA 3NF9A 4MFBA 4N56A 4DTSA 2ASDA 1ITGA 3SQ2A 4FLZA 2AGOA 4BWMA 4NCGA 3E2EA 2FBYA 2GV9A 3JPPA 3HP6A 4J2AA 3QNOA 3CFPA 4IKFA 4R66A 1ZQYA 3QLHA 5L1KA 2IHNA 4CF8A 3MABA 4UAWA 4CHZA 1DOQA 2RDIA 3MEEA 4F93B 3DRSA 4KREA 5KFAA 5IIJA 7ICQA 1UOCA 3V81A 3V7KA 1LWCA 4J9SA 4EYHB 4IQWA 4CJ4A 4KLJA 1RXVA 4ICLA 5DK5A 3DOLA 2ISPA 2YNFA 3RRGA 4FJ5A 4KPYA 3KK1A 4JUZA 3TWHA 5J2IA 3O3HA 5J2PA 5I3UA 1S9FA 4N76A 4IG0A 4PUOA 3SQ4A 4JS4A 1YTAA 1C6VA 5DBCA 5KT7A 4FJ9A 2V9WA 2FPMA 2JGUA 3SV4A 4B9LA 5KFWA 2XGPA 3K5LA 4ECUA 5J2JA 2PFPA 5DQGA 3OS1A 4FLUA 5J0SA 4KLLA 4RQ7A 3VQAA 4KLEA 9ICTA 1CXUA 5IIKA 7ICVA 3ISNC 5EOZA 8ICEA 1TAUA 4O4GA 9ICJA 3T5HA 5DB6A 4DFJA 4Z4FA 2F8TA 3RJJA 1NK7A 3I0RA 2QKKA 5IIIA 4EEYA 2Q3SA 4Q45A 4E0DA 5CA7A 4WE1A 2AGPA 1KVAA 4CJWA 5KFMA 4KI4A 3EWAA 4CEAA 3TI0A 2PFOA 4YR0A 4CGJA 2XY7A 4AHTA 4E19A 3PR4A 4J9NA 4KTWA 1LWFA 3ZSQA 1KFDA 1HNIA 3HVTA 3RMCA 4F50A 1RT4A 3KLFA 1ZQXA 9ICCA 2W9BA 5IINA 4J9MA 4JS5A 2WTFA 9ICBA 4EP4A 3SQ0A 3K2PA 1BPZA 3ZDDA 3VQCA 4CHNA 2ASLA 2BCSA 9ICFA 7ICGA 5J2HA 4DL2A 3SJJA 3ISBA 4NCAA 3EPGA 3CYMA 1RT5A 3MEDA 4DTJA 4FJHA 3OHBA 4RPYA 1A77A 1EETA 4E7KA 3OYGA 4CK3A 4DU1A 1EP4A 8ICXA 4CJKA 3M8SA 4EBCA 1S0NA 4FK0A 1C0TA 1IG9A 3VQ9A 8ICOA 4UB4A 5HNKA 4CJPA 2MAXA 3OYEA 3H4DA 1IH7A 2W9AA 7ICSA 4Z4IA 5KT2A 5DB9A 5KT5A 4YN4A 1H38A 4KB1A 5CR0A 4Z4HA 1VSEA 1ZQZA 5KFBA 1VSDA 4FK2A 3KHGA 2HHVA 2C2EA 1ZQBA 3LAKA 4NLZA 1S9GA 2KZ3A 1BI4B 1BHLA 3CM6A 1T03A 4YD2A 2ATLA 3RJEA 3F73A 4BDYA 1HYSA 4KLFA 3MGHA 3NCIA 3DRPA 3H4BA 4KLUA 9ICHA 1WSHA 2P5GA 1BQNA 1J5OA 4PGXA 4Q44A 1RT3A 7ICRA 5JS1A 5CWRA 5K14A 4M9JA 4QWEA 1T05A 4J9KA 4MF2A 1FKOA 1IM4A 3OYMA 4QWCA 4I2PA 1BPEA 1NK0A 2C28A 3UPQA 3AO1A 4M6WA 4M47A 5FRMA 8ICVA 5IIOA 3LZIA 3MR2A 5DDYA 5KFHA 3ZT3A 3OSNA 1ZQJA 4KTZA 3OS2A 3B0YA 4PHEA 3BGRA 4ED8A 3N97B 3BQ2A 4QW8A 1TKZA 4KKOA 1TAQA 3MGIA 2PFNA 2B21A 3SPYA 5KG4A 3SI6A 1I39A 1Z26A 4TSXA 8ICTA 2LYHA 3Q8RB 2EX3A 2VANA 4H4MA 5CJ7A 1HUZA 3C6TA 4BE0A 1Q9XA 3HPGA 1RT1A 4W5OA 2Z1IA 3RBDA 3VQQA 3NF6A 5KT4A 4LSLA 4RW9A 2DPIA 2C22A 8ICMA 2ZJ5A 4OLBA 3HWTA 4UAYA 2BDPA 2HW3A 3K4GA 1RYSA 1X9SA 2UVUA 4M9HA 3QEBZ 4XA5A 1VK0A 2FLLA 3PNCA 3H8WA 2V4RA 4XIUA 1IKYA 3V4IA 1ZQGA 3PO4A 3NF8A 4CEDA 4W5TA 3C95A 1NJYA 4AH9A 2XRIA 3L3VA 4HVJA 3SQ1A 1HYVA 2MUTB 3SUQA 4UB5A 7ICPA 4IDKA 4B9SA 4F8RA 3HM9A 2JZBA 3JPOA 4I9LA 4I27A 1YT3A 5C42A 3V9XA 1HUOA 3V1RA 4KO0A 1KSPA 4JWMA 2P6UA 4RNNA 4RNMA 4B9TA 5D4BA 1ASVA 3Q8QB 3OYLA 4QZ9A 5J2BA 4LSNA 2MUTA 5KG5A 2FLPA 3ZT1A 3AA3A 2VG7A 3SV3A 5HMMA 4O5BA 3RB0A 4KLOA 1ZQIA 3MR3A 2AU0A 4RPZA 3Q8MA 1HYZA 2A1SA 4FCYA 3UXOA 1Z3EB 1JKHA 4ZTJA 4LZGA 1BGXT 4L8RB 3OYBA 7ICHA 1CUKA 3UIQA 2BQ3A 4K8XA 5FDLA 5J2FA 4O3SA 1U47A 3L3UA 2PFQA 3HK2A 4PHDA 4K8ZA 4BDZA 4CGIA 3NHGA 3ZSXA 4DOCA 3C6UA 4CHQA 1NKBA 3V6DA 1EXNA 4ED3A 5CHGA 4FJMA 2ZUDA 1BQMA 4FJLA 3LZJA 1N6QA 4ELTA 4E1MA 2YKNA 1TL3A 8ICCA 4KLGA 5I42A 4CIFA 1J53A 3P1GA 2Y1JA 5KFIA 3JYTA 3LANA 4FW2A 4CJ5A 3C2KA 2KZZA 4I7FA 5HRSA 3V9UA 4R8UB 3QEVA 4BE2A 1NK5A 1IKXA 5IIMA 1ZQMA 1SZPA 3AA4A 4CEZA 3MR5A 5DG8A 3P83D 3OY9A 2OPQA 4OKKA 3ZSVA 4DL4A 4ED6A 5KFEA 3HPOA 3S3MA 3AA2A 2W8LA 2BHNA 1WSIA 7ICUA 3JPTA 2B6AA 1RBSA 5DGBA 4IFVA 4CJSA 1A5WA 3SUNA 4CJQA 1HNVA 4E7JA 1T8EA 2OA8A 2A1JA 1Q8IA 3T1AA 1RYRA 4QAGA 3ZDBA 4Y1DA 3MAQA 4DQPA 1NK4A 3P5JA 4KI6A 4RW4A 2FBXA 3RRHA 4EBDA 4O5CA 4DF8A 3DLBA 1NOZA 3T19A 1LAWA 3AO4A 3C21A 1JN3A 2KW4A 5CZ1A 2I5JA 5KFNA 4DTMA 3RMAA 1ZQEA 2KFZA 2WONA 2XCPA 1HJRA 3LAMA 1VSLA 4YCXA 4ED2A 5KG1A 4Q43A 4J9PA 1ZQKA 4CECA 1ZETA 1TKTA 1FXXA 3I0SA 4CFAA 5HHIA 2DFEA 1W0HA 8ICZA 4KHQA 2AJQA 4M3UA 2BPCA 2C2RA 5KI6A 1U9LA 1U49A 1Q9YA 4B3OA 4DTNA 4KTQA 4C8KA 4PA1A 5KFRA 2GWSA 3DYAA 5KT6A 1BL3A 2JEFA 4IFYA 1LB2B 3QESA 4YMOA 5KG0A 2X78A 4CGDA 1C1CA 1J54A 3SNNA 3HL8A 4E1NA 5J2QA 4OGEA 4Z4EA 4CGFA 1D8LA 4Z6FA 2C2DA 3U3YA 5KFLA 4R5PA 4RT3A 4DL7A 3RB4A 3AVCA 1ZBIA 5KFYA 4BE1A 1LV5A 2NRZA 2IGIA 3WNGA 1S76D 1TV6A 4AHCA 1ZQFA 4FM0A 5HROA 3PMLA 3QIOA 1ZJMA 2PYJA 5HRRA 2ZJ8A 3PX6A 3HP9A 2IBKA 1JXLA 4UBCA 1HPZA 4K4IA 3OYHA 3KK3A 4DU4A 3LPUA 1SL0A 4R64A 4J9QA 1HRHA 4QZ8A 4NM1A 4AHSA 5J0PA 1BPXA 4CF0A 5DB7A 3RB6A 4UB2A 3QEPA 5CZ2A 4RPXA 1IO2A 2G8VA 4CFDA 4CEFA 9ICKA 4MQ3A 4I2HA 1UT5A 2AQ4A 4F4XA 1TKDA 2FMPA 3ULDA 3GIIA 1WN7A 3ZSOA 2JZBB 3IG1A 1K1SA 1QE1A 3BJYA 4KMUA 4JK1A 2BGGA 4QZFA 3CQ8A 1TFRA 2BE2A 1WSJA 2OYQA 3G6YA 3KIOA 1HJPA 2FMQA 3AVAA 3RR8A 4C8OA 1ZBFA 4Y1CA 1QSYA 5EWEA 4E7HA 2YNIA 4ECXA 4KAZA 3TAMA 3NH1A 5DBBA 1XC9A 4TUSA 2XCAA 4UB3A 4E89A 1KRPA 4J2BA 2J6UA 4CIGA 4MEYA 5J2EA 4FLYA 4P4PA 2A1JB 5DB8A 3ASMA 5C25A 1RZTA 4IR1A 1C1BA 2O4GA 3G10A 4M9NA 1D5AA 3C5FA 2BGWA 4YVZA 4O3PA 4KFBA 3FYHA 2ZTCA 1ZQCA 4DOBA 3DLRA 5KFDA 3ZT0A 4DS4A 1S5JA 1CLQA 4PGQA 2YNGA 2LSNA 3G0ZA 3B0XA 1VSHA 4GVMA 4RU9A 3GIJA 4F4KA 1XSNA 4KLHA 5KG3A 3DLKA 3AV9A 1DTTA 3ISDA 4CIEA 2FLNA 4DSEA 1KCFA 2XY5A 2G8FA 2AGQA 5J2MA 5TZVA 1GOAA 1SKRA 1D8YA 3V6JA 2ITGA 5BPCA 4PHPA 3RJGA 4LH5A 1IXRA 3JPQA 3ORYA 5SZTA 1ZBLA 4OPKA 3RAXA 4P4MA 3C23A 3NBPA 4YFUA 1RNHA 1X9MA 2OZMA 2F96A 4B9VA 3QZ8A 3LP1A 3L2VA 1VSIA 2X6SA 3VQEA 1S1TA 5E41A 4QCLA 1JLBA 2V4QA 5D3GA 2HB5A 3GV7B 4HHTA 1IKWA 4X5VA 3MBYA 4DL6A 4IG3A 5J0XA 1JLQA 4TUPA 1N48A 1KTQA 2P1JA 5T7BA 3H8JA 1MU2A 1U4BA 4Z6CA 5DGAA 2NUBA 4PGYA 4TQRA 5J0UA 3ZD8A 4GXKA 1FKPA 1K6YA 3V7LA 3RMDA 1YVUA 3HO1A 3RBEA 5HMLA 4DFKA 2IHMA 3DMJA 3K5NA 5J2KA 4OKJA 4I2BA 5DQIA 1S1WA 2P51A 5KFGA 5KFXA 2H5XA 4AHVA 1C7YA 3TAEA 3AO2A 5DLFA 1KDHA 3PW7A 4M3TA 4BDPA 4IR9A 1NOYA 2PY5A 4AHRA 4QZBA 1TKXA 4ED0A 4YD1A 1S6PA 4CFCA 4NLNA 4HYKA 5EWFA 4FLXA 3I8DA 4P4OA 3PX4A 5CYMA 4CK1A 1RILA 4NLGA 8ICFA 3BDPA 2RF2A 2PI5A 8ICHA 4RW7A 3ZSYA 2FPLA 4EYIB 3OYIA 5FROA 4FVMA 3QEIA 1TL1A 3AVGA 4DL5A 4J2EA 1WCLA 5IILA 4KV8A 3L8BA 1V9PA 3LP0A 3Q8PB 3ZDCA 4M04A 3U6FA 3HXMA 1X1PA 2VG6A 2ETJA 5CYQA 4FJ8A 3HX0A 4K4HA 3S9HA 4UAZA 2XGQA 4DU3A 4ED7A 1ZQSA 1ZQTA 9ICUA 3AVIA 4CHOA 5SWMA 4TQSA 1Y88A 1QSSA 5KFKA 1D9FA 4FO6A 3PR5B 4DF4A 2BPGA 5CB1A 3UXPA 4RW6A 4CF1A 1WCNA 4CGGA 4Z4CA 3OYFA 3OYDA 4DFMA 1WAJA 1EXQA 2E6MA 1DGSA 4AILC 4GC6A 3OS0A 1T4GA 4JRPA 1XU4A 4I2JA 2HVIA 4RZRA 3PW2A 4FLVA 4XRHA 1B43A 4Z6EA 4E7LA 2ZTDA 1UAXA 4IQTA 1ZQAA 1JXBA 3NDKA 3OYKA 1S97A 1WAFA 1BIUA 1RBTA 2Z1HA 4DQSA 1A5VA 2KN7A 1O1WA 3WNHA 2YKMA 2HNDA 3C94A 4ECSA 8ICSA 4YR3A 1VSJA 2QXFA 1ASUA 3QEAZ 3LALA 4QZCA 5KG7A 2DY4A 2D0AA 8ICWA 4DMNA 3V6HA 1SUQA 4O44A 1NK6A 3T5LA 1S0OA 3IRXA 2ZUBA 3KLEA 3PW4A 1J9AA 8ICNA 4PHAA 3K5OA 5C24A 3S3OA 5J2AA 4RQ0A 1RDBA 5KFSA 3HW8A 3AVMA 3VQ4A 4M41A 1EX4A 3ZSRA 3MFIA 1ZQVA 2JEJA 4BXOA 1KLMA 3V1OA 4FYDA 4YG2A 4QZIA 1RT6A 4NYNA 4IQVA 1A5XA 3TFRA 3HJFA 3BQ1A 4ECVA 4YQWA 3THVA 1I3AA 3LK9A 3PV8A 4EBEA 5J1EA 3NE6A 4DL3A 1B92A 3VQPA 1RBVA 1COOA 2XY8A 3LP2A 1G15A 3C1ZA 5KFJA 3AVBA 4QZDA 2G8IA 1CXQA 4QWDA 1Z00B 4B9UA 3TAQA 1JLCA 2FC0A 2YHBA 2HVHA 8ICUA 3PO5A 1L3UA 3EY1A 4KLQA 4KRFA 1S1XA 4E7IA 2ZD1A 4QWBA 2DFLA 5HLFA 2BPFA 9ICEA 2G8HA 1JMSA 2DTUA 3DLHA 1MC8A 4KHWA 3DM2A 4OGCA 3LDAA 3B6OA 3HVRA 4I2DA 2ASJA 1SV5A 2D5RA 4H8KA 4R65A 4HUGA 4KB0A 4ECTA 1N5YA 3AVNA 2RDJA 4M45A 2WOMA 4GXJA 1Z25A 3DLEA 4JV2A 4LZDA 3Q8LA 2GUIA 3NH2A 5J0WA 3RH6A 4YR2A 1JIHA 3K75D 3M8QA 3TFSA 2IOCA 1JLGA 3MXMA 1KLNA 8ICYA 3AO3A 1XO1A 4F2SA 3NGDA 3MDCA 3JSMA 3OJUA 2KZMA 2VA2A 4LD0A 2HHWA 3CG7A 4YMMA 4MF8A 5EU7A 2QK9A 1CEZA 3K58A 4ID1A 4Q5VA 2PYLA 4FJ7A 4MFFA 1QQCA 4DQIA 4O0JA 2UVVA 3AUOA 4ECWA 4JLHA 3T5KA 2ZJAA 4F5PA 3PW0A 5HBMA 4HTUA 4DQQA 4O5KA 4QZAA 4CJVA 1ZBHA 3LWLA 2A1RA 4G3IA 4CJEA 4FJKA 1KEJA 1BVSA 1QSLA 4IQUA 3SPZA 4MFCA 1RDCA 4DTPA 3OYAA 2NRTA 2J6TA 2OWOA 1L3TA 4I2QA 2BCUA 3GIMA 4LH4A 2ZE2A 4DLEA 4XUSA 4DTXA 4M3WA 1JLFA 2PZSA 1SKSA 3KHHA 3AVKA 1R0AA 2NRWA 3GV8B 1LAVA 4K4GA 4F5NA 3TQ1A 3HSTB 7ICEA 2HHTA 3A2FA 3ZDEA 3EYZA 3LWMA 4RUAA 3V1QA 3E01A 2HHUA 1RT2A 4DSIA 1TK0A 9ICQA 5J0OA 4RG8A 3VQ6A 3KTQA 4YP3A 4FZXC 1KFTA 3PY8A 4M3RA 2D0BA 4HUEA 3CFRA 5J0YA 4I28A 3OYNA 3KD5E 1RPLA 2JEGA 4O9MA 1S6QA 3QEWA 4CJTA 3MDAA 1RT7A 3AU2A 1TVRA 4O3RA 1CZ9A 5DMRA 1ZQLA 2QKBA 2FPKA 3V7JA 4J9RA 4FBTA 5KGXA 5L9XA 3LDSA 4FZZA 1JLEA 3ZT2A 4CERA 4B08A 4J9OA 8ICBA 3PVXA 4TUQA 3VQDA 5CY4A 4NLKA 1RDAA 2E6LA 5DQHA 2HHXA 3SI8A 4F5QA 3KK2A 4RUCA 1TV9A 2UVWA 3H7IA 2Z1JA 2W9CB 2G8KA 3OSPA 8ICLA 4DLGA 2JEIA 1FK9A 3GFKB 3MR6A 1ZQRA 7ICFA 3KHLA 2OZSA 4CFBA 4Q8FA 3L2RA 1TK8A 4KHNA 1XSLA 3FFIA 1BCMA 3SZ2A 4I9QA 3NGZA 5J29A 3GDXA 1YTUA 3QE9Y 4XQ8A 3IHQB 4CEBA 1Z00A 3PUFA 5KFQA 3IS9A 2J6SA 7ICNA 1JLAA 1RBRA 1F21A 1XI1A 5DKWA 3VQ5A 2FBVA 3JPRA 2VWJA 4LY7A 3KKSA 4W5RA 3JPSA 5HHHA 4MFAA 3K5MA 4DTOA 1ZQWA 4R63A 1IKVA 4CGHA 4DO9A 2ISOA 1RTHA 4PY5A 9ICGA 1RXWA 2HNYA 4F4ZA 1L5UA 4KHSA 1QHTA 3ETLA 3AVHA 9ICRA 3CFOA 1KVCA 2BQUA 5J0QA 4RQ6A 3ISCA 3MFHA 2R8HA 1XS9D 2P66A 9ICMA 9ICVA 4F3TA 4N5SA 4BACA 2I9GA 2RN2A 1NKCA 5J2DA 1BIZA 3PX0A 4IBNA 1B9DA 1QS4A 4ZH4A 2RPIA 2HNZA 3AVLA 4JV0A 3UQ0A 3RH4A 2E4LA 1CZBA 4M3XA 4RQ2A 4FJXA 3V9WA 4RW8A 1RDDA 1VRUA 4CHYA 2W9CA 2P6RA 3C2MA 3RH5A 1RTIA 1N56A 2UVRA 4J9LA 4M0AA 3SUOA 3GQCA 3C5GA 5KFUA 2IC3A 3L2UA 5KFCA 4FK4A 5F9LA 4OLAA 1ZQOA 3PMNA 3EW9A 4M3ZA 3QIPA 5D49A 4B9NA 3TR8A 2YHAA 4CEEA 4M2YA 3ZDAA 9ICNA 2P5OA 2BQRA 2IAJA 4JWNA 5HRNA 3KJVA 4OJRA 3RJFA 5KFOA 3O4QA 1KFSA 3OJSA 4C8NA 1B22A 1BPYA 4RQ5A 2PI4A 3QZ7A 2G8WA 4HUFA 7ICJA 1BPBA 4C8LA 2F8SA 2X74A 3V9ZA 4LVSA 3FDSA 4RNOA 7ICKA 2DFFA 4F91B 2VA8A 3DOKA 1MQ2A 2W42A 4FS1A 1U45A 4FS2A 3H40A 5BOMA 3NFAA 3HYFA 3UQ2A 5HP4A 4FLWA 4ECYA 4FJIA 3ALYA 4W5NA 1TK5A 5J0TA 4QOZB 4DFPA 9ICLA 2BANA 4GXIA 1T3NA 5DBAA 4GLXA 3C1YA 3CM5A 3M9OB 5KG6A 3ZD9A 3EZ5A 2OPPA 3NGIA 4KLSA 4QW9A 4KLTA 4Z0UA 3M9MB 4I29A 3S3NA 8ICGA 1HMVA 3NTUA 2Y1IA 3TABA 3PW5A 9ICWA 1BPDA 1QLNA
chains in the Genus database with same CATH superfamily
3CPEA 4HCCA 3TEGA 4ECQA 3I4PA 3TVKA 3MX2A 2CQGA 4KLIA 1XWLA 1EZZB 4C4TA 4JI3F 1LEOA 2KDOA 1J5EF 1FNXH 2CPRA 2D41A 3K59A 2RKIA 2D0CA 2VU5A 2V94A 2E7XA 2XNQA 3D0PA 3SENA 3DN9A 4TURA 1JLQB 2ZFHA 4LBIA 1XR7A 4IRKA 4CCHA 3CJRA 3RJIA 3THYA 2HQ3A 2ZNZA 4AHUA 4M6WB 2EFPA 2R8KA 1XSPA 4DSKA 3P38A 3M8RA 3RAQA 4CJFA 4PQUA 4O5EA 2KG1A 3TQEA 1HBUA 4UZBA 2OXOA 2DPJA 5J2NB 1KQKA 3ZX0A 4DL0C 4N41A 2NYHA 3RJKA 2X6NA 1ZQUA 9ICPA 3ZXWA 4P0QA 4HTJA 2JRSA 3OTBA 3H0RB 2VWKA 4E3SA 2CRXA 3M8PA 2WW8A 4O3OA 4QZEA 3ZSWA 3FC4A 2HBMA 2QA4S 2B4JA 3J80O 5C5JA 2MKJA 3ONQA 4TNOA 3RW7A 3NCQA 4IO9Q 4XK8C 2F1IA 1LCUA 3ETMA 4QPTA 5KFZA 1QVGM 5IT9Y 1DTTB 2DCUB 3OHAA 2R8GA 4CLSA 2QLBB 4FXDA 1WSGA 1JXVA 3D0HE 2B5JA 2A6MA 5AT1B 2CG4A 4KT0C 5L1IA 1MROB 4KJIA 4OKEA 2OPPB 1UWBA 1X2IA 3WQTA 1NB7A 4ZVHA 5IC6B 1QTMA 8ICKA 3J7ZO 1D4XA 3DI6B 2VODA 2F44A 2FYXA 2OPSA 4GC7A 3GR1A 2XNRA 4B8CA 4LR7A 3SCLE 1ZYQA 1R43A 2WVFA 2KTQA 2VD3A 4FW1A 4KH0B 5D4NA 3WBZA 4CJLA 1O5JA 1M1HA 2BABA 3VN5A 2Q6BA 3HZ6A 4F4WA 1GLEG 2ZTEA 2HWIA 3OGUA 4HACA 4CJUA 5AQRA 2W9MA 4X4OA 2V7ZA 4F4YA 3K89A 1ZQPA 3BH7B 1X5TA 2DEIA 2E5IA 1QQNA 3K2YA 4CEOA 2W6KA 4HDHA 4C3MA 1NGEA 2YV0X 4OX6A 5HL7Q 4ZPDA 4BRAA 5AXKA 2CJKA 4FOEA 1SB3C 3VF0B 4DCHA 1UA1A 4CHPA 1NJWA 3DDIA 3CCJS 5M2UA 2QB1A 1Q8BA 5JLHA 2HBRB 5L1JA 3MM5A 4ZCLA 3EVMA 3CMAS 4GW6A 2PFDA 3VAFA 4JI7K 4OZLA 5GAGU 4PPXA 3GG4A 4N47A 3I32A 3KLGA 2ZGYA 1VQMN 4Y65A 2MQPA 3RVCA 1AFJA 3LH2S 3D7SB 2ZIWB 2WAQF 1IR1A 3DNCA 5LM7E 3OLAA 1PCAA 1N36F 2ABYA 4G1QA 4CF2A 1HWIA 5D77A 1TKTB 3H8SA 2ZBQA 1Y0HA 1TL1B 7ICIA 3H8MA 3TAFA 2LDIA 2ZGZA 1MWQA 1REVB 3KKFA 1IR0A 3MAHA 2MA1A 2YY6A 2DH9A 2W24A 4HT5A 5KT3A 4MJKA 4Y2IA 3WKAA 3VVTA 4M3YA 1DK3A 3CCRS 4NLCA 3EPIA 4ID8A 1ZAVA 2AZ1A 3HRDD 4UZCA 2NRXA 6FD1A 3OR1A 1KN6A 1TGOA 3P4UB 3G6XA 4ECZA 3KOAA 3IAYA 1S9EA 3R1XA 3GILA 3T5JA 4DR7F 4WZQA 3FJ2A 9ICXA 3QETA 1KWMA 3U3GA 5J2GA 5J2MB 5ALLA 4GMJB 5GVQA 1NKEA 2W2NP 2R8JA 2NZCA 1HNIB 3HVTB 1CJKA 4MKBA 2ZNYA 2KYZA 4JI1J 4KHYA 5GTHU 3LPYA 4RBUA 4WK3A 1WSFA 3O3FA 3K9KA 1VRQC 3LDQA 3R1LA 3HULA 1MQ3A 3TANA 1UZHA 4JV5F 3WK7A 4IWVA 1OYDA 4O44B 1VQKS 2I5JB 5I42B 3JB9k 2B4UA 4CF9A 4RBVA 3EDRB 3H2LA 2FHJA 4DDFA 3OL6A 3UR3C 1Y11A 2QMUB 4LFCK 1E6VB 2HHHK 3QAEA 4QZGA 2B5JB 4ELVA 2VBZA 1VMBA 1IG8A 4U8VA 4O3NA 2HAFA 1PAEX 4NXZA 2EC2A 4P7TA 7ICTA 3WK5A 1ZM2A 2BKEA 1SL1A 1N5SA 3IWNC 2F3NA 4Z4GA 4HTLA 1VQ7N 3B6PA 5C7PA 5BRDA 3VA0A 1R8BA 4JI6J 4FL9A 2XY6A 1XMOF 1RTJA 4UTGA 1R7IA 2MKHA 4B1XB 3HSZA 4I2FA 1EKEA 5EWGA 3SYZA 1EJ7L 4FJJA 1JL1A 3ZCMA 4C8YA 5L38A 4PJ0U 3CJKB 3SIPB 3T3FA 4KC5A 1NOMA 3TRGA 5ADXA 2QA4G 2NO5A 3N4MB 4KHUA 3VAKA 1UWBB 3WEEB 2W2OP 2L5YA 4YDDB 1IBMF 2D1CA 2Y3YA 3G6VA 4DV1K 3AJ2A 2RS8A 5HAOA 1BQXA 3F5TA 3ET6B 2IM0A 4OLOA 3KFWX 4DEZA 4DR4J 4KN7A 2LPEA 4UW9A 1HKAA 1XBWA 1HQEA 2DUYA 3J7AP 3UMGA 1T05B 5LOQA 2H4YB 1UETA 4K43A 4GNIA 3CO0P 4FLZA 2AGOA 1J6ZA 4NCGA 4PKGA 2HMXA 2XBPA 4IKFA 4R66A 2IHNA 4CF8A 4UAWA 5EX3A 2V6AA 4H0XB 2IRUA 3PHTA 3DRSA 4EK2A 5IIJA 4DCPB 2BM0A 3MPWA 5AK3A 4J9SA 4EYHB 3A1YG 1RXVA 4ICLA 5DK5A 3DOLA 2FSKA 1F0XA 3W9IA 5ETQA 1X4HA 2K3IA 3CD6N 7FDRA 2D6FC 2N3OA 3E51A 2CJYB 2VV5A 3CJ8A 1S9FA 1ZOTA 5K4LA 3EZWA 4PUOA 4JS4A 1YTAA 5DBCA 5KT7A 4FJ9A 2QJ3A 3OQ2A 2JGUA 2QEXS 1HPZB 3N4PA 5J2JA 2PFPA 1NLVA 5FIIA 4OJ1A 3CMES 5SUHA 5J0SA 1H0HB 3O1LA 1FJGK 2MHNA 3NOGA 1RDFA 4KLEA 3ISNC 3EGVA 3TO8A 2BEFA 1WC5A 3ID8A 4NYPA 5EHHA 1KVIA 4DFJA 2IOFK 3R9KA 5IIIA 5CA7A 3U8XA 2O1PA 4WE1A 3FSXA 2AZ3A 5KFMA 3DLLL 3TI0A 2MGZB 4DR2F 4IEIA 4K4TA 5HROB 1U6BA 1TUYA 4YR0A 2XY7A 1HNIA 3HVTA 2ZC4A 3RMCA 4F50A 2ZITA 3SFUA 1WB9A 1RT4A 4DV4K 3KLFA 4QR2A 1WG8A 4C3KA 5BR8J 2VBWA 4JS5A 3NS1A 3K2PA 3C0BA 5AJ3F 2RRAA 1X3MA 3CHWA 4ZJLA 3O80A 5DZ7A 3SMZA 5J2HA 3US5A 4PWUA 4GIBA 3GDQA 3M7VA 2KSOB 2EZYA 3N01A 4ATNA 1HNWJ 2XWYA 4NCAA 3EPGA 1U1KA 3CYMA 3IAM9 2A41A 2ESEA 1N52B 4PXCA 2ZIVB 3I82A 3S01A 4LC9B 5BYRA 3W0LA 1NNLA 3OHBA 4KGZB 1EETA 3JYTB 4CK3A 5EE9A 8ICXA 4CJKA 3M8SA 4EBCA 2BACA 4RUHA 4KH1B 1C0TA 4FK0A 8ICOA 3M6ZA 2DGSA 4IO1A 2ZXIA 3HILA 4PG6A 4X4TA 1IH7A 1NM1A 4L3QA 4U6PA 2HQCA 1O03A 4Z4IA 1C4CA 3DGPA 3M32B 1WELA 2YX8A 1RM6C 5DB9A 4KB1A 5CR0A 2P9IA 1ZQZA 5IV4A 3KG4A 3N5BA 1HYSB 3RSEB 4BR7A 1RWVB 2V69A 4B3RK 2C2EA 3LAKA 2E1CA 3CERA 4GMKA 3ULEA 1S9GA 1F2GA 3EE9A 3X3UA 4RTFD 8ATCB 4DUYK 4U7UK 2YNIB 1T03A 3RJMB 2ZHOA 3F73A 4BDYA 4KLFA 3AQPA 2L48A 1YKWA 2FHKA 1FI4A 4KLUA 1VLYA 2VDHA 1WSHA 2P5GA 1J5OA 2LQ8A 4PGXA 4AUKA 2PMZC 2M5YA 4LSNB 2OLWA 3JQJA 4JKBA 3OYMA 5A8RA 5IQQA 2ZHAA 1ECWA 4M6WA 4XAKA 1ZD2P 1J2VA 2E5LJ 5IIOA 3UD5A 2EI5A 3GFXA 4USHA 3MR2A 2ZH1A 4ERDA 2E1FA 2KSOA 2MSSA 2CIMA 4FWPA 3R5CA 3LOUA 3B0YA 3SCJE 4C4RA 2IIRA 4PYDA 7FD1A 3G82A 4KKOA 2A2DA 3MGIA 3H42A 1EQ0A 1Q7YO 3MX5A 5KG4A 5A8RB 3ETOA 3UO0A 3SI6A 4TSXA 4B1YB 2LYHA 4DOZA 3Q8RB 2EX3A 2KRRA 3QYYA 2ASMA 4DUTA 1SJFA 4BE0A 3HPGA 2BZFA 1U24A 2E2QA 3NVYA 3RBDA 4QJFB 1XN9A 5ALFA 3VQQA 4HH1A 2HI0A 1S1VB 1YBUA 4DBQA 4LF4F 3RZAA 4H4OB 3CJ9A 4LSLA 1IBKF 3UKRB 2DPIA 3DXBA 4IKAA 2BDPA 3CQXA 1RQNA 2IIHA 4BVOA 1T9WA 4EX7A 4M9HA 1N33F 1YJ7A 4ITSA 1VK0A 5LY3A 3TTCA 2K89A 1ZD3A 2LYAA 1CRXA 3R97A 1NJYA 5AZIB 4AH9A 1MU2B 1V4TA 3SQ1A 1NU0A 3L4QA 2I6WA 4I9LA 4I27A 1S1WB 5AQQA 1NHKL 1U2CA 2FGCA 1KSPA 5D0HA 4KIAA 2W54A 1VC5A 2ZBRA 1X4AA 3BZQA 2A3ZA 5D4BA 2CN1A 2NYIA 3T6JA 2DO4A 4Y00A 5J2BA 3C65A 4LSNA 4OX8A 2MUTA 3TVZA 2RH3A 2FLPA 2E1RA 3ZT1A 2CA9A 4NRUA 2VIXA 3RB0A 3CIPA 4RPZA 3KK1B 3Q8MA 4YB6A 3ZTOA 2D1KA 3UI3A 3PCOB 3UXOA 4ZP6A 1Z3EB 3G6ES 1JI7A 1ROFA 1RJJA 3DOMB 2BV3A 1FXRA 4A59A 1JUDA 2RNEA 3EXYA 4L8RB 4PQAA 1CUKA 2BQ3A 4K8XA 1SV0C 2V9KA 4NXNJ 3H6EA 5J2FA 3L3UA 2Y9UA 2PFQA 1NMDA 4V19X 4USAA 3NHGA 3ZSXA 3FZKA 3C6UA 3Q7CA 1NKBA 3V6DA 1U2VB 1EXNA 3LL3A 3EGWB 3NVZA 3X1LB 1BQMA 4FJLA 1SC6A 5D8HB 2HKEA 4K4YA 4ZK7M 2CQ4A 3WU2U 2K4PA 8ICCA 3JYTA 3LANA 1DURA 3WUHA 4DFDA 4HI2A 3N4WA 2D74B 2KJVA 2JOQA 5KQ8A 3RAMA 5C24B 2XLKA 1IKXA 2W4PA 1PJ5A 3D1OA 3DYAB 2CDQA 1SZPA 2LQBA 3P83D 5AQMA 4JI2K 3BF1A 4X4SA 2F4FA 2GHPA 3AA2A 3TACB 1MDUB 7ICUA 3JPTA 2J9DA 3WX4A 1DGKN 1WSIA 3D1QA 2ZVSA 2AX1A 1OH6A 2H4WB 3SUNA 3BZKA 4CJQA 1HNVA 2VPXB 1LKZA 1ULRA 3N6NA 4DQ8A 3KYLA 4DQPA 3D68A 4NLDA 2DKXA 3D5MA 1YJ9S 2FBXA 4EBDA 1CVJA 1NOZA 4IOXA 3T19A 4HDGA 5C12A 3ENHA 3AO4A 2I5JA 5KFNA 4CLFA 4LF8F 4IO9L 5C42B 4C7QA 3F53A 2XCPA 1BG3A 4YCXA 4ED2A 3WT0A 1ELOA 4IEEA 2DXFA 1HL6A 4UAVA 4J03A 1ZQKA 2WRMA 4CECA 5LMUF 2R2RA 3EWGA 2MKSA 2CQIA 4EX6A 3OFFA 4CFAA 5HHIA 1HKGA 3MN7A 4M3UA 1SIZA 4OMFG 4H5VA 2C2RA 1TL3B 3E9OA 1AZSB 1RXOB 3P39A 1FX4A 4C8KA 3PNIA 2NS1B 4PA1A 2ZZMA 2KE7A 4IFYA 2JR5A 5GADI 2RQ5A 1KQGB 3I9V9 5EVZA 3CCTA 1IJJA 5ALJA 4P10A 1J54A 2H9ZA 1A6SA 2CNOB 3BSAA 4B1WB 4CGFA 1LWXA 4WE1B 2HRUA 4FSVA 1JLFB 4G9BA 3BV8A 2C3PA 1GXLA 4R5PA 4R25A 1SI9A 2IDEA 3RB4A 3LQVA 1ZBIA 5KFYA 3QB0A 1TV6A 4HR2A 4NRTA 4DX8H 4YN3B 1BD6A 3QUTA 3QIOA 4P7VA 2ZJ8A 3N28A 2YNHB 3TSUA 3PX6A 4B1VA 3HP9A 3D2SA 4UBCA 1N88A 4MLHA 2DNKA 1F3VA 2CQ3A 4QJVA 5HMXA 1G3OA 4M63C 4BY9C 3KDNA 4DU4A 1SL0A 2ES6A 4R64A 4QZ8A 2XM3A 4AHSA 5J0PA 2NPFA 4BC7A 4OZJA 1RBAA 1PO6A 4I6MB 2RRNA 7AT1B 1VGYA 4RPXA 1IO2A 2O8EB 1ATSA 3ALRA 5AQTA 5IWAK 1WWUA 4OX7A 2DITA 4H0YB 4I2HA 1SC3B 2DO0A 3IN5A 3ULDA 3GIIA 2G5HB 4BGBA 1UZDA 3KZBA 4ILMA 3IG1A 5D4OA 4B3RJ 1RTZA 1RAGB 1HLWA 4AM6A 4J90A 4KMUA 3W66A 4QZFA 1TFRA 1HWKA 3G6YA 3KIOA 2CJXB 3AVAA 4C8OA 4OX9F 3HHNB 4C7YA 1HPMA 3MMCA 1QSYA 1U7LA 4E7HA 2EVZA 2O8FA 2YNIA 1ACMB 4ECXA 3M6GA 1OKJA 3VTIA 3CDAA 1XC9A 4I2QB 2DB1A 4UB3A 4E89A 2OSRA 1A0OB 1KRPA 4H5RA 4J2BA 2CJBA 3ENVA 4L3KA 4CIGA 1JJHA 2CH5A 1J27A 3S7RA 3GL1A 3ZYYX 2MDAA 3TR5A 5C25A 3TPQA 4IR1A 3FZFA 4ILRA 4HKQA 3G10A 2XS2A 1CZAN 5AQJA 5AQOA 2HG4A 3OFHA 1RTHB 1C0GA 1RWMB 3O9QA 1S5JA 1FF2A 1TUGB 1TKXB 3L4BC 4QIWF 2YI1A 3FRYA 3VF2A 2LSNA 2Z2YB 2IJFA 3K0SA 4DUYF 1XMBA 2EWSA 3AFGA 3CMEN 4RU9A 4XPEA 4BJQA 5KG3A 3MMJA 1Y5IB 3ISDA 4FZNA 3PEJA 4ZVEA 1KCFA 4DR6J 5TZVA 4DPTA 4BLGA 4ZPBA 1Y7PA 1KAZA 4PHPA 1N34F 3CCEN 3C66A 3R7BB 2PD1A 2E20A 4PEOA 3Q24A 4YFUA 5M1QA 4M5GA 4RQMA 5BN8A 3BKTA 5ETMA 2YTCA 4YOVA 3GLJA 1LQ9A 1WWHA 1NUEA 2XEXA 3THXA 1UTAA 1K5OA 1JLBA 5ALKA 1H2TZ 4DZDA 1Y5NB 4G9ZA 4DL6A 1FEEA 4DV5J 5J0XA 5AJ3J 1JLQA 3BM7A 2GOLA 2AHOB 3H8JA 4OJHA 1RACB 2ZJRL 5BREA 5DM7L 2L9NA 5GINA 1RWKB 2NUBA 2KNJA 3SMVA 5DGAA 1GAOA 4TQRA 1OPZA 2GVDB 3ZD8A 3PM9A 1K6YA 3V7LA 3RBEA 2AH5A 5HMLA 1QZ6A 2CPXA 2E3TA 4WFYA 2IHMA 4DV6J 3K5NA 2A42A 3F2KA 2CXYA 4PL1A 2W3SA 1URNA 2M7SA 4X66F 1C7YA 1RA6A 3B82A 3C14B 4LF6J 4HI1A 4GO7X 4JYAF 1HNXK 1MG7A 2G2OA 2L9WA 3FK4A 2MKIA 2B8QA 3PSIA 5M2PA 3DOLB 5A2QY 4HYKA 1FJGF 4MYUA 3TYTA 4DHVA 4ZLPA 2E7VA 2YWWA 3ELHA 1RILA 2O66A 1RWWB 4NZ0A 2PI5A 1VQ4N 2EH9A 2I8EA 5DM7Q 1WSRA 3H2UB 1V5IB 3QATA 2QLFB 4A46A 4XH4A 1TL1A 4DL5A 1CLFA 1U02A 5IILA 4WFBL 5AM5A 4ZHRB 3LP0A 4IOBA 2V4JB 2MY7A 3JQKA 3HXMA 2VG6A 3GE1A 5CYQA 5E5NA 1AB8A 4TU9A 5FPDA 1RGVA 3TOQA 4IG0B 4DU3A 2V0NA 5K14B 1T02A 3AVIA 4CHOA 5SWMA 1SIJA 1NZBA 1UVKA 2QYGA 1QJHA 1Y88A 1KQFB 5CCLA 5TKWA 3HLUA 1HBMB 1KS2A 3PR5B 4P2MA 3H8YA 3UXPA 4CF1A 4RW6A 1MW7A 4CNYA 1WCNA 3D2EA 1U1RA 4Z4CA 1Z1BA 1REGX 2E6MA 2FJAB 4K4XA 1MWKA 4GV3A 2VF3A 4DV3F 2A10A 2HVIA 1X31C 4XDCA 4FLVA 4FP9A 1M1KO 2LDYA 2BTFA 3NY0A 4NXNF 1JXBA 3BO2A 1D0EA 5A8WA 1WAFA 4A8MP 3WQPA 1RBTA 1TYQA 2Z1HA 4LFCJ 3WNHA 3C94A 4O5FA 4H0OA 8ICSA 4HTIA 2DY9A 4WF9L 3L3CA 1ASUA 3QEAZ 4QZCA 4OYXA 2D0AA 3NVKA 1JLCB 4DMNA 3V6HA 3IRXA 3H25A 3QJJA 5FPNA 3H1VX 3QFUA 4IUFA 1N33J 3IG8A 1J9AA 8ICNA 2HFZA 3A13A 3FZBA 2WC9A 3DHXA 4EMDA 3UM9A 3Q7BA 2UUBJ 2Q1LA 3HW8A 3AVMA 3S8SA 3ZETA 4JKDA 3ZSRA 3MTKA 3T1HF 3V1OA 1TMMA 1RT6A 5IC4B 1TUUA 2QV6A 4DPXA 2MJUA 3CJ5A 3TX8A 3BQ1A 4YQWA 2JX2A 2EPIA 2CXEA 5IM0B 1H1VA 1UCNA 4JKGA 3PJXA 1C1BB 4DL3A 1B92A 4JI2F 4F72A 2ZIUB 1G15A 2V52B 3C1ZA 3P3DA 5KFJA 3AVBA 1LW0B 4CZFA 4QWDA 2AKWB 2QX0A 2XMTA 1HLUA 5LJ3Y 3BPSP 1SGGA 2AYMA 3HOSA 4KLQA 3CCWA 1S1XA 2VGNA 2ZD1A 1WOPA 4WWSA 3AY9A 4YDXA 5HLFA 2VQFF 9ICEA 4CT9A 2E5JA 2O8BA 4F0KA 3QUCA 3Q8YA 5A6WA 3LDAA 1HNVB 1XR6A 3HVRA 4CYUB 3CDEA 1IBKJ 2ZM6K 4JI1K 2JL9A 2P35A 4ECTA 3PYDA 5ALGA 1Q7YT 4M45A 1Z25A 1T9UA 2QT7A 2W03A 2DD8S 1G2EA 1HUXA 2SXLA 4LZDA 3I0RB 2GUIA 5J0WA 1JIHA 4OO1J 3TFSA 2IOCA 2P9IB 3ID6A 3FCWA 3OTOF 1KLNA 2RMLA 5A8WB 1XO1A 1X0FA 3AAQA 3AAWB 1FNMA 3OTEA 2RILA 4TYBA 4NZ7A 3RW6A 1HJOA 2VA2A 4LD0A 4M94A 2HHWA 2P9SB 4ENOA 1X4EA 4YMMA 5M1OA 5AQUA 2QK9A 3BN7A 5H2FU 4F9OA 3WIUA 3O4WA 3UDEA 4P72A 1VQON 2G06A 3GG0A 4Y0WA 1A6LA 2K7JA 4CM2A 3ILLA 1ATNA 2IJRA 3PW0A 1ZBSA 1RDWX 1SV5B 1N34J 2BKNA 4NEZA 4C8ZA 1GK8A 2VG5B 4FJKA 5I3PA 3BY5A 3GYNA 1XMQJ 3OTOK 2MKYA 1BVSA 3PYEA 1HWJA 4A4JA 3IDHA 4PG8A 2NRTA 2J6TA 2OWOA 5HI7A 4I2QA 3HT0A 3N6MA 3AEVA 1DARA 3GIMA 1FTRA 2O8FB 4M3WA 3PIOL 3I5BA 1R0AA 2OELA 3KBBA 2IVMA 1YUWA 1P1TA 3TQ1A 4DUZJ 3A2FA 3IM9A 1RT2A 2F9DA 2QL7B 2HBLA 5J0OA 4YP3A 4LQ9A 3ZZ0A 4K41A 4HUEA 1GLBG 2FXUA 2IVNA 4C0OC 5E79U 5J0YA 3OR2A 1IKVB 3CF5L 2RUSA 3I0SB 5K8PA 2KVIA 1RPLA 4IC9A 4F3QA 3MTJA 3MDAA 1RT7A 1ZQLA 4BGAA 1IXKA 3OFGA 1RLCL 2CPEA 3OVBA 3H3NO 1Z2ZA 2A1AA 1I94J 5AKGA 1HW8A 4FZZA 2E1ZA 8ICBA 3D28A 4BC3A 4GFJA 5CYJA 4WFXA 2E6LA 3TX0A 3OUYA 4B6JA 4RUCA 2UVWA 2ZBCA 1B7FA 2JWKA 4CVNE 3GFKB 2GNKA 1HARA 5AQNA 3GR0A 1MMDA 1FNOA 2QM1A 1U1QA 1ZQRA 4DR3K 3FBCA 3T41A 5B7WA 2VL1A 3FFIA 4ZVOB 2HS0A 4CO4A 2ZD1B 5T7LB 2OTJS 3GDXA 1ZM3A 5BRFA 1RUSA 3PUFA 1RISA 2NXJA 1D3WA 5D0GA 3W1YC 1VBZA 1XI1A 5DKWA 3JPRA 4CZKA 1Q53A 2YQ3A 4MFAA 2CPDA 4CGHA 2PSZA 4ZMMA 2B9EA 4IDHA 2ISOA 4Y2RA 1RTHA 2CAJA 5LSLA 3OA9A 3GJRB 2R2UA 1RXWA 2L9DA 1HKBA 4FNIA 4DV4J 1WOSA 1QHTA 3AVHA 4ZPTR 4U67Q 3HHDA 5THWA 1KVCA 2XMKA 2DEJA 4NMXA 2ZWPA 3SCIE 1P8ZA 3B78A 4ZVRB 3MUMP 5AI6A 4YHHF 4BACA 2I9GA 1ZC6A 3JXUA 5LJ5Y 5E3AA 4IBNA 1XMOJ 1QS4A 2YWGA 5EDWA 3ZEUA 5FPEA 3AVLA 5B0GA 2R18A 4B3SF 2YHXA 5F3ZA 4RQ2A 4X66K 5AKYA 2BOAA 2P6RA 1PSDA 4JK9A 5ETNA 1KDNA 3D0IE 1O6XA 1KQSR 2DGWA 2OFGX 1Q3UA 4M0AA 3SUOA 3GQCA 2QWOA 4Y2AA 4ZP9A 4PUOB 4UOFA 1RE1B 1YVFA 2IC3A 3CJCA 1KL9A 4OLAA 3PMNA 1RWXB 2DGZA 4UF4A 2JVRA 2L41A 2MJNA 3QIPA 2KLAA 4H5TA 5HVHA 1AUDA 2E9TA 4CEEA 4K59A 2E2OA 3BSNA 9ICNA 1UPHA 4WZMA 2BQRA 2XYGB 4C1NI 4NPOA 2LECA 4X84A 3IO1A 4PPDA 3O4QA 3Q22A 3OJSA 2M4MA 1SV4A 2HMIB 1N5WA 4C8NA 4JI5J 2HFUA 7ICJA 3B4MA 5CD4H 4Q7AA 4PZNA 3TSPA 2FIUA 2F8SA 5A0LA 4RNOA 5B09A 2DHAA 1QUPA 4MK8A 1KBUA 1PYTA 2E66A 2LHTA 4JI6K 2F77X 3L4PA 1WC1A 3ATVA 2HVDA 1TK5A 2HGNA 4DFPA 3GU3A 5AKKA 2H1YA 3MAAB 2B43A 2KJ9A 2W55A 3M9OB 5AK6A 1WI6A 5KG6A 2WW4A 2HLUA 4JHDA 2I7PA 3AAPA 4KLSA 1WEZA 1Q82O 4ZJQA 8ICGA 1SH2A 1HMVA 1TV6B 3EKUA 2M9KA 4DXLA 1QLNA 1N2XA 3C8YA 2QWRA 4F71A 2FQQB 1WHWA 4CESA 3ZT4A 3M6XA 2XZTB 5IT4A 3UD4P 4NXNK 4LUBA 3ZZZA 4KLDA 1DTQA 3H20A 1S1UA 4IQXA 2OUGA 4Y2VA 2IRXA 4DV7J 2OM6A 1MLAA 1YVNA 2K4HA 4DX7A 3QU2A 3OXGA 1HR0K 4IDKB 2ATQA 2EW9A 3NWGA 3QT6A 3GCXP 1SKWA 4BROA 1SL2A 4IRCA 1NI3A 4NOHA 4UY8T 4ZVSB 1SQGA 4P74A 2IDOA 5ELZA 2FI1A 3I87A 3HT3A 1BNOA 9ICSA 3M6VA 4B8AB 1HHQA 1R8AA 1JL2A 3NH0A 3P31A 3MECA 4FJNA 4ZOSA 5D46A 1RWUA 5KG2A 4CZEA 3NWRA 3VQTA 3QNNA 1Q5VA 2UV8A 2F7TA 3TSQA 4H4OA 2JXJA 5KFVA 3C29A 2GMJA 3AH6A 3BUZB 1OH5A 2ZQBA 4G1IA 2R7QA 5HSPA 4CBXA 1HNZJ 2QWNA 4V19S 2CWKA 3NEKA 2VJVA 3CB4A 4QOTA 2G8UA 3ZTRA 2BR0A 2H51B 3UQSA 4RWTA 1J2NA 3CC7S 3LPTA 4EELA 3LP3A 3Q8SB 9ICIA 1NZPA 3P5TL 1XHZA 2B0GA 4LFBF 1AUSL 1G4CA 2G08A 3GBTA 5G5HA 2ZH6A 1FWLA 3N7RC 2FLOA 3RF9A 2Q0UA 4OJGA 3CSKA 5ALVA 2NCKL 3NGSA 2M2BA 1X66A 5M1PA 5LT5A 3LDOA 4YY3F 1X4FA 2JWNA 3U7JA 4ZPCA 4FM1A 1BA0A 2ZUAA 1UW9A 1T3VA 3QINA 4JI7J 1WBDA 2AIRB 4U9RA 1N63A 1UVMA 1SZ2A 1KC8O 1MSWD 5AK4A 5GAEI 1HIWA 3LDLA 2ZJQL 3HJEA 2JH1A 4OI6A 2RE1A 2WVBA 1JRPA 4O0IA 4QWAA 4U67L 2XYPB 4OZ2A 2UZAA 3MEGA 3DLJA 1YITN 3KHRA 2AXTU 3OVNA 2OD4A 3SLCA 4WBFA 1N0VC 4ZVPB 3I56N 4KFBB 4CRXA 3N0VA 2OPRB 3KWMA 1KVBA 3KVGA 2WF9A 1WKJA 4YOUA 3KLFB 2AD9A 3AVJA 2BJDA 1KQSM 4F2RA 1LWFB 3PJ9A 5KAKA 1V3ZA 3ISZA 4DV2F 4MKYA 1P9QC 2I0XA 3J81O 1Y00A 1VHIA 3IM8A 5AM4A 1IBMK 2ACYA 3OW2R 4A48A 4C23A 3SQOP 2DNPA 3ZFVA 3VWSA 4O55A 2QWLA 2V63A 3PZPA 1RAFB 4B3MJ 4X4PA 3CCZA 4RQ1A 2EFQA 1GLLO 4A61A 1NBEB 5ALRA 3O3GA 2KV2A 4FZYA 4FBUA 5G4DA 1XQSC 5KRTA 1TVRB 1IJFB 2Y9TA 2UUWA 1OSCA 2EDUA 3OYJA 4FE3A 4EZ9A 3U1LA 1VCTA 2JH3A 3THWA 2LMRA 4OVLA 3PRVA 4DR1F 4CE9A 8ICPA 2W43A 3RYLA 4PZVA 4Y6IA 4ZHRA 3NVVA 3D3BJ 4MIAA 4KV8B 5FRNA 4DR7K 1F60B 4G6VB 1RT5B 5GAHP 4ZTFA 4CJRA 1Q95G 2K8GA 2PC6A 4F3MA 3EZUA 1L3VA 2KKHA 2XIDA 3JSYA 3B8AX 1CC7A 4RO0A 4Y2JA 3ITHB 3AXKA 3PYGA 1ED1A 4WYBA 4QZHA 1NHVA 5GMDA 1ZQDA 3PHEA 1PZNA 4KHPF 4G1PA 4C48A 1REVA 2F4VF 2FVCA 1VRTB 1TQLA 1RA7A 1LW0A 2XS5A 4NE9C 2QTDA 2WHEA 3EJMA 3KMSA 1C0UA 1K1QA 3H46O 1TVAA 4CLKA 3GIKA 1JJ2R 4OYOA 4EO8A 4WFBQ 1BE4A 2HURA 4RNFA 1O08A 1JNZB 3O5BA 1L3KA 3NRZA 2HMIA 2ZUCA 3N5FA 3ENOA 1JLBB 4DHYA 3VGUA 2BRLA 4E1JA 4I2AA 1PJ6A 1MWMA 3G87A 4IRDA 4EGLA 2AP1A 2D0PA 2X1AA 1NK9A 3RB3A 3PSFA 1F2HA 5AKHA 1LWEA 4Y2XA 3BQ0A 7ICOA 4I2EA 1YQHA 4YXJA 1RFQA 3BH6B 2CNLB 3CQYA 2YKOA 3EO3A 3AD7C 4Y2PA 2KG5A 3CCRN 1HNWK 1RCHA 4DS5A 2WOMB 4OYZA 4NXMJ 4NYFA 1TAMA 1QY7A 2VA3A 4CZJA 4HLBA 4QS7A 2BCQA 4BRQA 5KOXA 4LBPA 3W3SA 4FWQA 1X9JA 2KJWA 1WSVA 5J0RA 1ZQHA 1YTYA 5HN0A 1K73O 3AT1B 4Y2SA 3B6BA 3D7EO 1LOUA 5HRPA 5L9NA 4NASA 5CA5A 4P73A 2OPRA 2DYAA 3NAEA 2KICA 4NLBA 4B9MA 4P0PB 4MN4C 3U1NA 4B1UB 1UA0A 2HHSA 5ALDA 3KMQA 3VQBA 4UB1A 2KVCA 2B4VA 4WP9A 3GZ7A 2Q0ZX 5ALPA 3R2DJ 4MDAA 4ISEA 1V38A 3VA3A 3QO9A 3D54A 1VQ9N 2QGFB 1WORA 4KN4A 2ZJRQ 5CR4A 3SSQA 4A5BA 4K4ZA 4OYPA 1L3SA 2VH7A 3CJKA 2YWKA 4M9LA 4MFBA 1VI7A 3LDNA 4DTSA 4R79A 3TW0A 4ANEA 3AQOA 2MLXA 3E2EA 2FBYA 1HHTP 2GV9A 4DPUA 3JPPA 4NLXA 3C6AA 2JHDA 4O3MA 2WHOA 3CFPA 3H59A 2YQEA 3EGZA 1XERA 1OYEA 5DDOC 3U9ZA 3ATUA 5CEHA 3M2VA 1K0TA 4CHZA 4DV1F 2RDIA 1RKIA 1QQ6A 4WPAA 4F93B 1F5AA 4QYZK 4KREA 1PBAA 4OI0A 1UOCA 3V7KA 1LWCA 3M5RA 2XTJP 3KFUF 4IQWA 1I51B 4KLJA 3SDEB 2UUAF 2YNFA 3P49B 4FJ5A 2YQ0A 5F8IA 5K20B 3MGVA 4BRIA 4RBTA 5HO4A 1N32K 3IBWA 2DPNA 4BRMA 5JMVA 3O3HA 4CM0A 5J2PA 4YB1P 4B3SK 1J97A 2HOQA 1ZAWA 5D4LA 2NYVA 3TA0A 4MTPA 4B9LA 5KFWA 2D9OA 4ZCKA 2XGPA 1YBAA 1VC0A 5DQGA 3HKZF 4I6MA 5L46A 1WF2A 2R7OA 2MKKA 2RB7A 1KKXA 5AHXA 4RQ7A 5C0YA 1CXUA 5IOLA 5IIKA 7ICVA 4ISFA 4O4GA 1S49A 3MUTP 5DB6A 4DV1J 2AT1B 1QDUB 3LGMA 4Q45A 3MHYA 3VETA 4FPAA 2UXBJ 4RW4B 1KVAA 1S79A 3ENBA 3HDSA 2DL0A 4KI4A 2GIRA 2EK6A 4CEAA 3O9UA 3THPA 3MN5A 2FJDB 4ER8A 3BGLA 4CGJA 4AHTA 3HHLA 1A0PA 3ZSQA 3ZLJA 1SS6A 1KFDA 1L7MA 2IRYA 2OTJN 5ETSA 2UU9J 2E5GA 5ALTA 2W41A 2PMWA 2W9BA 2WTFA 2N4CA 1S4FA 1N60A 3SQ0A 3OTOJ 3ZDDA 1VQ8S 1B3TA 4M95A 4CHNA 2BCSA 1UHUA 4CTAB 2UYTA 5A2QU 3QQCD 5AKLA 3PFOA 4MIBA 2VG7B 3NVMA 1UCVA 3MEDA 4DTJA 3GYGA 4FJHA 2JV3A 4RPYA 2X1GA 2EBEA 3NG8A 3OYGA 3LM9A 1S0NA 3HKZD 3VQ9A 4UB4A 3H5XA 4XO0A 5HNKA 4NA3A 4CJPA 2MAXA 2VBXA 1DQAA 3OYEA 1N5YB 1VIXA 4I56A 2N4DA 5TISU 7ICSA 3FAHA 1VK3A 3F56A 1VQ9S 1EARA 2RLTA 2MZTA 1KC8T 1H38A 4Z4HA 1BUXA 4WIQA 2UUTA 4FK2A 4QIWD 3ETRA 1ZQBA 1SXLA 1Y5LB 3FBEA 2Q66A 1NGFA 2KZ3A 4KHRA 3JTOA 3UCUP 3CCLS 1L8OA 2FUG9 2CH6A 3QU7A 1WHXA 3ZZYA 3Q2SC 4ICAA 4DB3A 4TN2A 1K47A 3NCIA 2PMZF 2KRBA 3DRPA 4AL6A 4JP8A 1Q46A 9ICHA 1HBNB 1BQNA 3M1YA 3IV6A 2M8HA 5CWRA 4M9JA 2B6AB 1N61A 4RL1A 1AXQA 2ASOA 1BXNA 4UATA 3KDOA 4CBUA 1UEKA 5FRMA 4YY3J 3LZIA 1PGZA 3OV7A 3WK6A 5DDYA 5KFHA 3UVJB 2FY1A 3SR6A 2KT2A 2ZH8A 4KTZA 4HVZA 2ZBIA 4CZIA 2LYBA 5CAAA 3NNHA 3CD5A 1GXTA 1FFVA 2J0XA 1G6BA 1TAQA 2PFNA 3Q8UA 3QX7A 4U7UD 1BO5O 1RG6A 3ICXA 4RNHA 1VOMA 2ZM6J 1IBKK 2VANA 2XG8A 3I1YA 1NGJA 2NLXA 2P9NA 4LRFA 3C6TA 4LF2A 4OQJA 4K5SA 2QW9A 3UDVA 4C6AA 1CJKB 5KT4A 1UEVA 2XMJA 4F67A 3QU4A 1H7XA 2C22A 8ICMA 1PC4A 3HWTA 1CJTA 3CJ0A 2HW3A 3K4GA 3M8WA 1T0TV 2M8DB 3FMBA 1GLCG 1X9SA 1SBRA 2VKQA 1TKZB 3QEBZ 4XA5A 3VAMA 4CWBA 3H8WA 1IKYA 4NA2A 5L39A 3V4IA 1WNEA 4WFAL 2O8EA 3BZCA 4NJ8A 3NF8A 4DR6K 4MT1A 5IV3A 4W5TA 3C95A 4WK1A 3QU5A 4G1QB 3L6QA 1U8SA 4PXEA 3SUQA 2O8DB 4IDKA 4F8RA 3BPDA 3HM9A 2JZBA 3JPOA 5H9FK 4B3TF 1VQ5N 3V9XA 4X64F 4KO0A 4JWMA 1EP4B 1IQTA 2BKOA 1IBCB 3POTB 1MMNA 4RNNA 4JI0K 4RNMA 3UKUB 2PO4A 4GVBA 3FC9A 1ASVA 3C16A 2ZG6A 4UAUA 4USKA 2VKRA 1GMWD 5HMMA 1ITPA 4QU6A 2GV1A 2G2ZA 2KJ5A 4KB7A 2BE7D 2A1SA 3NL0A 2H3FA 5ALEA 4LF4J 4NWIA 4ZTJA 1SB6A 4LZGA 3MM6A 2KVSA 1T95A 2RF2B 1F9EB 2CPFA 4PABA 4AYBD 3OYBA 5D78A 1RQ0A 5FDLA 1MN9A 3T1YF 4O3SA 2P8IA 4UB6U 4K8ZA 1J5EK 2H48B 2CZ4A 2EFOA 4CHQA 5CHGA 1BOTO 4FJMA 4X4UA 2XI9A 2YKNA 2YXLA 4NEYA 3A4TA 1VJWA 1ZPVA 1N5QA 4OHVA 4CIFA 5E3CA 5G0RB 3IBCB 4ZPWR 2G0IA 3P1GA 2Y1JA 2KJ8A 4IJAA 1T44A 4I7FA 3AJ1A 2F4VK 3L7PA 4R8UB 3VC8A 2E88A 1NPRA 4TLRA 4A8QA 3FGUA 2OHFA 2NXEA 1P1LA 4NL9A 3R6GB 4CEZA 2IC3B 3F41A 2OPQA 1FO1A 4ILGB 1VQOS 3UE5A 2HWTA 1BLUA 2J8AA 4NLTA 4ED6A 2R2SA 1SIWB 2AYEA 3TAMB 5ETKA 4CO5A 4DV0J 2B6AA 2OKQA 1RBSA 4IJNA 5DGBA 3ENQA 4JAXA 3ZC4A 4CQ1A 1A5WA 4UY8O 1ZD4A 3O5TB 3L4IA 2OHDA 4LFCF 4ZLLA 1NRKA 1Q8IA 2R9LA 2KKPA 3T1AA 2Q31A 3QT5A 5E33A 4Y1DA 3BKUA 3FRZA 4K2JA 4YOTA 4EENA 1FRMA 3I31A 1CG2A 2HF4A 3PIOQ 1D1UA 1U09A 3DHWC 3DLBA 1CULA 3MEEB 1LAWA 4MIWA 3C3LA 3E0FA 3RMAA 1ZQEA 1SAZA 1HJRA 2YY3A 2HK3A 3WX8A 3AB2B 1GO3F 1Q7LB 3QNMA 4J9PA 4CD1A 2ROEA 1UP1A 4Q0BB 2XI3A 1YSJA 1S4EA 3D9BA 1B99A 2F5GA 3I0SA 1VQMS 1XMOK 1X5PA 5GAEU 1W0HA 8ICZA 1NH7A 2IVOA 2FHMA 1SWWA 2C3OA 1NDKA 4B3OA 2ZH2A 2VFUA 4CNQA 5KFRA 4FWMA 1YJVA 2DH7A 4Y2KA 5KT6A 2ZIVA 3V4MA 1T9VA 4I64A 3UN2A 4I7FB 1LB2B 3QESA 2QWMA 2X78A 4CGDA 5G0RA 4X62K 1SVDA 2P9GA 3C6TB 4CZGA 4E1NA 2HS3A 3CCVS 4Z4EA 1D8LA 4JK8A 1FRKA 3EN9A 4B1ZA 4O8UA 2HRYA 4RT3A 4CLZA 4DL7A 3OL7A 2CNKB 3AVCA 4BE1A 4DV7K 1OO0B 1S76D 1KHWA 3J7A1 4AHCA 2WVEA 4ZLNA 3OFEA 5CXTA 4FWOA 3PMLA 3TADC 4RKUC 3UVJA 5LL6d 4KQZA 4KHPJ 4ZVTB 4CZLA 4RCHA 1HPZA 2CGKA 3G8TA 3KK3A 1AFIA 2CNNB 2W2PP 2J0SD 3G71S 4FDFA 8AT1B 3LPUA 1WTBA 2F9TA 5BXIA 3QWPA 2RUGA 4J9QA 2F8HA 3PIPQ 4UY85 2YN4A 3DDNA 1M90T 4CF0A 1DY3A 2EC0A 5E26A 4UB2A 2AMCB 1QUVA 5CZ2A 3ZTPA 1HNXF 1FDNA 2P9KB 4CEFA 5GMEA 2MHEA 3D3CJ 5CABA 9ICKA 3ILOA 4F4XA 2DR6A 1X5SA 1VK8A 1WN7A 4NWBA 2HQFA 5ALWA 2GJFA 1NAQA 4WFNL 1NGBA 1NHUA 3H5YA 2C2MB 4YDUA 1QE1A 2VONA 4ZN1A 3BJYA 5F41A 4JK1A 3BBBA 3RUBL 3AY0A 4NO7A 3V4IB 1WSJA 2OYQA 1PG5B 4JK7A 3S41A 4AQYK 1Y3JA 3AA8A 3UR0A 1VQPN 4CH1A 5LMNJ 5EWEA 2ZZTA 4NXMF 1OSDA 4OPAA 4KAZA 3WK8A 2MSTA 3DRSB 5CZVA 3SAGA 4YEAA 2XCAA 1B0VA 2J6UA 3DLGB 3SSSA 2G0CA 1PBUA 1YHQN 4FLYA 3DOKB 3GWCA 1B0XA 2K8BB 2GQCA 2R7WA 3JAMU 4DV2J 4DR2K 2YJFA 3MM8B 4LVOP 1D5AA 1GX6A 4KFBA 5H9EK 4DOBA 1UWAA 3DLRA 2H3EB 3HSGA 2QKQA 2IJNA 4B3TJ 4JD2B 3GJTB 3I76A 1FRXA 3O1BA 1FE0A 2XO6A 1CLQA 2KXHA 1I94F 4DCOB 3B0XA 2W7AA 1QQ5A 2K4EA 1N5TA 4CP5A 1VSHA 2PMHA 4GVMA 2DGOA 1JLAB 3LPEA 1N36J 3GIJA 4LFBK 2G4BA 2KN4A 1XSNA 4H5WA 3DLKA 3AV9A 3R9PA 1DTTA 4JD2A 2NNWA 3V2UC 2XY5A 5B66U 2KH9A 3D67A 2R7XA 1OS5A 3RJGA 3K1RB 1LFPA 3M2RA 2IHR1 3A5LC 3QICA 5SZTA 1ZBLA 4DPWA 3DXMB 4LVNP 5ALIA 3W62A 3RAXA 3MN6A 3NBPA 2DJWA 1RNHA 2ZOGA 1X9MA 2BE2B 2F96A 2C2ZB 4B9VA 3QZ8A 3LP1A 4OIXA 3N79A 5JICA 2OD6A 2OEHA 1VSIA 2G5IB 3FGVA 2V8GA 4FFDA 3KG1A 3DDKA 5AKEA 5D3GA 4NL5A 5HMZA 4WP8A 3ZZTA 3L0QA 2HFNA 3R5JB 1N48A 2KT3A 1VDVA 3PKMA 1LXNA 3MMVA 4PGYA 3KJNB 2GO9A 4GXKA 4C98A 1FKPA 5EX5A 3RMDA 3IMQJ 5K8OA 5FJ4A 3NKYA 2F2AB 4EWTA 5J2KA 5DQIA 5KFGA 3I55S 5KFXA 1Y4ZB 3AO2A 4N77A 4EHTA 2BH1A 1KDHA 4M3TA 4XDDA 4BDPA 1IVZA 4LF7K 2PY5A 1R27B 4AHRA 1ZZFA 3IP0A 4ED0A 1UJ6A 3MD1A 2Q79A 4CFCA 4NLNA 1SUQB 1M5HA 2FJ6A 1FERA 3R9LA 8ICFA 2K8AA 5ETPA 2RF2A 4J8FA 3MM6B 4JI6F 2BJ8A 1VQYA 2PT0A 2HPUA 2OTLN 1PYOB 2QIFA 4M1KA 3UMCA 5F1XA 1XNSA 4HWIA 2DXEA 4KV8A 2CQ2A 1HFEL 4YORA 4RW7B 5IT0A 3M7DA 2D9PA 2GA7A 1AW0A 2CRLA 1X1PA 2QFIA 4V19J 1QQ7A 5AXNA 4OJ6A 3FCVA 3HX0A 4D3HA 1Z1ZA 4FPIA 2XGQA 1LKYA 1ZQTA 2DKOB 4MAKA 2ZJQQ 2XMVA 4DI6A 1QSSA 5KFKA 1D9FA 4IH7A 1VFJA 2Q2RA 5AFUH 3CWJA 2WZ1A 4DF4A 3HSJA 1QE1B 4ZOHC 5AQVA 3H1QA 2B6GA 3OYFA 3T1HJ 4JI5F 3OYDA 4DFMA 4B3OB 2KI2A 2FD2A 3OS0A 3CXCM 3DLEB 4GY2B 4DV4F 2FVQA 4I2JA 3QWUA 4JV5K 3I56S 3IRUA 1B43A 5EUHA 5MAOA 2DGQA 2DH8A 1UAXA 3QJLA 2MQQA 4C4WA 1S97A 2VQFJ 1KVJA 2CPYA 1DT9A 2CQDA 1HWLA 2I2YA 2AYBA 2E44A 1QAYA 3R27A 3GOIA 2HNDA 5B0AA 3CCLN 1N32J 1D09B 5KG7A 2H54B 1HW9A 4P71A 4QYRA 3TUPA 3CUNA 8ICWA 3WXMB 3VEXA 4AF1A 1KVKA 4LQ3A 3T5LA 1KD1T 1UFLA 2QSFA 1WOOA 2O6KA 4PHAA 3K5OA 5C24A 3S3OA 2ZKUA 3LP2B 4JI1F 2F9JA 4GKJK 2LM1A 5J2AA 8RUCA 4DV5K 2HQGA 1SJQA 1RDBA 2HSZA 2E1PA 3VQ4A 1U25A 4FN5A 3LTOA 1VQ6S 1ZQVA 2A40A 4BXOA 1KLMA 2ZZNA 2KXFA 2JGAA 4JEPA 4NYNA 4IQVA 1A5XA 3TFRA 3HJFA 4ECVA 1BWEA 1I3AA 4OD0A 4EBEA 5J1EA 5AICA 4ZIVA 3IR5B 4LJMA 2UP1A 1SC1B 3WIVA 1COOA 2XY8A 2MMYA 3LP2A 3QMLA 1KBRA 2YNGB 4U8YA 2OJ3A 2DIVA 4FWKA 3KLEB 4B02A 2G8IA 3MPVA 2GGPA 2ODGA 3CW2C 3WZ0A 2YHBA 4PQUB 2HVHA 8ICUA 1L3UA 3U27A 2XICA 4QWBA 4WJ3B 4E8UA 4I4BA 4ILJA 5GADP 2HIQA 4O23A 2BXJA 4FYXB 3GSIA 2G8HA 2I7NA 3O0FA 4KHWA 1YIJN 1K9MT 2PDAA 5GAHU 1B0TA 2F76X 4I2DA 1Q16B 5F0XA 1SV5A 3D2WA 5B5EU 4KB0A 4ALZA 1DXSA 2DGUA 2GO7A 2OEKA 2ZF5O 2Y1LB 2RDJA 3AD8C 3OHRA 4C0HA 4IL6U 4H4KA 2YKAA 1A7GE 3C28A 3RH6A 1N54B 2AJ1A 2CYYA 1FK9B 3NGDA 2J8SA 3SCKE 1YBTA 2W40A 2N82B 3EE3A 2H3QA 3C16B 3T9NA 3QIDA 3CG7A 1HI0P 1FEHA 1YJRA 5EU7A 2W25A 3C15B 4EAHD 1HNXJ 2EAOA 4Q5VA 3EXCX 4PG5A 1F3FA 2V2QA 1LNQA 2ZH4A 4O0JA 1HNZK 2UVVA 4CDIA 3PYFA 4F5PA 2OANA 4HTUA 4QZAA 1RI7A 1ZRMA 2PA3A 2N7CA 4EO6A 2ZWHA 1QSLA 2D3UA 3SPZA 1YJ9N 2ASYA 5AE1A 4JI8J 3CTRA 1L3TA 3I8BA 2DT9A 2QC3A 3CJ3A 2KMDA 1FRLA 2PZSA 3TUIC 5AQSA 5A0YA 2B9XA 3AVKA 2P9EA 3GV8B 3UNGC 3W64A 5GIPA 4MMOA 3QGHA 5F8GA 1HNZF 3VF4A 2GWKA 3D6JA 3VZIA 1QZ5A 5BR9A 2PFUA 1Q86O 2WTUA 1B64A 3E01A 2HHUA 2JFKA 1PK1A 4W98A 3U4LA 5I4MA 1TK0A 9ICQA 4RG8A 3VQ6A 3KTQA 4M3RA 1UFKA 2IDLA 2QLWA 3HZGA 5CHIA 3OYNA 2DHSA 2NQPA 3WC2A 3DDHA 1S22A 4WF9Q 9ATCB 3T7ZA 4BRCA 2PN6A 2G09A 5EE3A 4WU2A 3FEZA 3I5AA 2UXCJ 1FX2A 4CT8A 1P90A 2LLZA 5L9XA 3LDSA 2B7CB 2ZUGA 3A8YA 1JLEA 4JI3K 4J9OA 2M52A 2E1YA 4TUQA 3VQDA 1YJTA 3G8QA 4NLKA 1WEYA 3RGIA 2FVRA 3SI8A 4ZVFA 3KK2A 2KO1A 2W9CB 3HOTA 2G8KA 2HNDB 3AN1A 8ICLA 4AQYF 1HKCA 3O08A 1LW2B 1FK9A 2KB2A 4USUA 3H2VE 1FRIA 7ICFA 3KHLA 5J1EB 4Q8FA 2ZDOA 3HHKA 5JU5A 4H4MB 4ZPAA 4KH4A 3VAIA 2NLWA 1S1XB 2KHQA 3NGZA 1ZAXA 2F8MA 1S1TB 2FF6A 1YTUA 5IXUA 3QE9Y 4XQ8A 1Z00A 2AX0A 3FR0A 2Q36A 4TY9A 1F21A 2JC0A 4I67A 4BVPA 2NZ4A 2VQEF 2FBVA 3CMAN 2BE9B 2VWJA 1NZAA 3AODA 1ILYA 3C14A 2I6XA 3JPSA 2QWPA 3W61A 3R6MA 2AEMA 1ZQWA 3WKEA 2WBNA 4DO9A 4K7QA 1H98A 3MM7B 3KWIA 2D7SA 4LR9A 5F8JA 2HNYA 3NMRA 1L5UA 1GLFO 4KHSA 4CF3A 3MMAB 4QIWC 2NUHA 2D3ZA 2OI2A 3BGUA 2WF7A 5AM2A 1RWOB 2JDJA 1VQNN 2ASPA 3ZNUA 3MFHA 1XS9D 2P66A 2DR9A 1I6JA 3PSTA 1ZM4A 5AQYA 5GAGP 3KXDA 4L6V3 3EUB2 1NKCA 1BIZA 3PX0A 3C46A 1B9DA 2JHEA 5KAFU 2NV3A 4JV0A 3UQ0A 3RH4A 3DRPB 4M3XA 3DKDA 2IBOA 3V9WA 4RW8A 2I38A 5A8KB 4CJ7A 2QARB 3EM1A 2IFXA 4QNLA 2MYFA 2GAHC 4HHJA 5FP0A 3ICLA 2UVRA 4J9LA 1EB0A 2UUBF 5I3QA 3C5GA 4HHUA 1V97A 5KFUA 1YHQS 2CVEA 1MWZA 3L2UA 5KFCA 2KHVA 5DZ6A 1OW5A 1ZQOA 5AKXA 1KXPA 5ALQA 1HBOB 3CC2S 3JQMA 5D49A 1N8RT 4B9NA 1ICEB 3TR8A 4DU8A 4M2YA 4PXBA 3ZDAA 2P5OA 2WFBA 3R5AA 4JWNA 1X4BA 5HRNA 3KJVA 4LF5J 4C1NK 1N33K 4OJRA 3IBPA 4WU3A 1B22A 1BPYA 1KAYA 4RQ5A 2H3ZA 2UV8G 2B9YA 4HUFA 1PK1B 4ED5A 1U8WA 4M5KA 5CQGA 3EL2A 3V9ZA 4DR1K 4F36A 1KD1O 7ICKA 2G0JA 4F91B 2VA8A 3DOKA 1QAIA 1I1GA 4OX9J 2CQCA 2W42A 3VR1A 5BOMA 1DHMA 5DJBA 3NFAA 3TKAA 2HNYB 4FLWA 2WMMA 2ZIXB 2VCPA 3GJQB 3M1VB 3UPFA 5AM1A 1QQOA 1T3NA 5HJYA 3C1YA 3CM5A 1WC3A 2I1RA 2COLA 3EZ5A 3I9ZA 2Y9HA 3CJ2A 3GMGA 4KLTA 3NGKA 3Q23A 1M1KT 3O9RA 1CJUA 4I29A 2GIFA 3S3NA 3PW5A 2Z57B 1BPDA 3JSMA 1S99A 2QI2A 3GCWP 4KLMA 2DRBA 3LDPA 3KZIU 1SH3A 1RAOA 3D66A 2Z2MA 3QMQA 1VBKA 2IOFA 4MLEA 4GO5X 4LFBJ 4PL7A 1NNEA 2JLFA 2BCVA 4OYWA 4GKKJ 2ZVIA 1QH9A 4QYZJ 2QLTA 3ZSZA 1A76A 1RKJA 2DVIA 3WKCA 3VALA 4B17A 3NBPB 2VC0A 2IS3A 3F2BA 4F0HA 2DQNB 3MXJA 1Z2LA 3DLGA 1KR4A 1H73A 1ZQ1C 1M5KC 5KFPA 3TARA 3S6EA 2IM3A 1MN8A 3CCES 1C1AA 2JLEA 3QRPA 3R3LA 2HBZB 2DR5A 1X8DA 3CJ1A 4DR5K 4DSJA 1RU2A 2YNHA 4UQGA 2FBTA 1DKGD 3MM5B 2F1FA 3W2VA 1PILA 4KGMA 3NXZA 4DV3K 4DPYA 4XTTA 2W7PA 1XHXA 2OTLS 1Q81O 4USIA 3VAGA 4BR9A 2VDIA 3G96A 2GJ2A 3GB0A 4FJGA 3CCJN 4CEQA 5J2NA 2V2ZA 1BI4A 4UQTA 2NR0A 4JV1A 2DGTA 2VOPA 5KFTA 2BMBA 1SH0A 2V8VA 1BCOA 4DV6K 5BYQA 2QFJA 3OTCA 1HEKA 1FRHA 5D0RA 1ZJNA 2W7OA 1W9HA 4Q8EA 4MEXA 4DR5J 4JKGB 3N7PD 1P6TA 3CETA 3QEXA 4GV6A 3IWXA 8ICRA 1CPZA 5F3XB 4EFHA 3RR7A 3VEVA 2N7YA 2J9EA 3OT9A 3P8BB 3KLIA 5DG9A 3HPHA 2GHWA 5F9NA 4YS2A 1TELA 5HP1A 1NK8A 3O44A 4KITB 4FLTA 2CG8A 3WDOA 4DTUA 2R7YA 9ICAA 5KOWA 4UASA 3BKFA 4KAIA 4IOCL 2O4IA 1UKUA 3MOJB 4A8YA 3VGKA 1JWWA 2WBMA 4USMA 4XPCA 4KMOB 1D8ZA 3DU6A 1S77D 3UW1A 4BC9A 2E5LK 3TNVA 1C4AA 2ATCB 4X4RA 2UXBK 4NCBA 2QTWA 2F1JA 1C0MA 1U04A 4YMNA 2YX7A 3ITHA 1KP6A 1QAXA 2R7TA 1AROP 5LMNK 2UU9F 3DXMA 4C8MA 4W5QA 4OJ3A 3MM9B 2K7KA 3H5UA 2Z30B 4ILLA 4ILHA 4JYAK 3AVFA 3NGYA 2GH1A 4OFZA 4FYYB 3J7ZT 2DFHA 1S10A 1M5SA 1PVPA 2DXDA 5LSRA 1NJZA 4WQ4A 1Q1KA 5E3RA 1ZBUA 1VQKN 2W2MP 3L2WA 2UU9K 4FM2A 1PVRA 4NLUA 3WNFA 9ICOA 3L7UA 4M5IA 4R8UA 4OJOA 4OJPA 2YQ1A 5BPLA 3BB5A 2Z1GA 1IV0A 3AQEA 1WHVA 2FMSA 3IG1B 4A47A 4JRQA 3F9KA 3KD3A 5E84A 4L3NA 1HQUA 4AXIA 3CIZA 1ZQQA 5KQDA 4ISGA 5DG7A 2X3DA 2B3TB 1WSEA 1KOHA 3DRRA 3SBGA 3MUVP 3AU6A 2YMPA 2WFAA 4JI4F 2JZ5A 2K1RA 4K25A 3K1ZA 1FFSB 2WAQC 4X65K 3AO5A 2AWZA 2D69A 4DSLA 3IBFB 3TZZA 2DY1A 1T6CA 2RHSB 4PRFA 3M9NB 2GO8A 3EKSA 1TL7A 3MGJA 5J2CA 1JX4A 1P27B 5CP2A 2M9NA 5J8YC 4QPXA 7ICMA 1VSFA 4X62J 1Y3KA 1WD6A 4BXOB 1KLMB 2YB4A 3AQFA 5J2QB 1RTDA 1YF5L 1D9DA 1JXEA 2V8PA 3AM9A 4DTRA 3H08A 2R7RA 4I6WA 4Q0BA 4LF1A 5HR6A 3GU0A 2P9PB 2VWBA 4P2HA 2QL5B 2MQNA 2ADCA 4B3MF 4IG3B 2IA6A 3V9SA 5KRSA 1T7PA 3BGFA 2XSFA 1N34K 4C0ZA 4CLYA 1UMJA 4Y2YA 3TAPA