4B9UA

Structure of the high fidelity dna polymerase i with an oxidative formamidopyrimidine-dg dna lesion -da basepair in the post-insertion site.
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9uA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9uA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9uA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9uA01
4Z0UA 3JPTA 2C2RA 3DMJA 2C2EA 4EYHB 1W0HA 3V9SA 4EP5A 4O3QA 3O4NA 1XWLA 3T5LA 3JPSA 4I2EA 2JEGA 3QO9A 4HCBA 2FBTA 2OA8A 1TV6A 8ICRA 4Q0BA 4OGEA 1S1WA 1KTQA 1AROP 4YR2A 2D0BA 2JGUA 3RH6A 4DTXA 4CIEA 4RW8A 2R7YA 4CGFA 4FYDA 1JXEA 4AHCA 4E7LA 1ZQVA 3PMLA 2NRVA 1I3AA 3ZSRA 3AU2A 3TQ1A 4DTRA 2HVHA 5DQIA 4FJIA 3QEVA 4PGQA 2P5OA 4KLLA 3ZSWA 4JLHA 4F91B 3ZSVA 5DGBA 3G6XA 2B6AA 4RW9A 2P51A 3ORYA 2KZMA 3DLBA 1UOCA 3PW2A 2BANA 1ZQLA 4NLGA 2BCVA 2E6LA 5SWMA 3VQDA 5FRNA 9ICEA 1JL2A 3TAGA 3ZSZA 1WSHA 4I2AA 3RMAA 4RPYA 1BCOA 3SUQA 3QESA 4DFKA 5CZ2A 5KFLA 4RPXA 4CGDA 4TQRA 1IO2A 1D9FA 4QZ8A 3T1AA 1IKWA 4ECRA 4KMUA 4Z4CA 4HUFA 5KTQA 5I3UA 5J0SA 4CEOA 8ICKA 5KFFA 3AO2A 9ICTA 4YMNA 3QIOA 2W9BB 3QERA 1HMVA 4TURA 3PO4A 5J2NA 4M3UA 4K4IA 2NRWA 1L3VA 4DQPA 4RUCA 1J53A 3C2KA 4N41A 3QIPA 1RTHA 1EKEA 1WSJA 1F21A 5KT2A 4QWEA 1SV5A 1UAXA 2XRIA 1BCMA 5HP4A 5KFJA 2HHQA 9ICFA 4ZTFA 4O5BA 2BGGA 3WNGA 5KG7A 3MBYA 2FLNA 9ICHA 4CEQA 1FXXA 8ICGA 4F50A 3SV4A 2I1QA 1A76A 1RNHA 4I7FA 1XU4A 4GVMA 4RQ3A 3RJGA 5J2KA 5J0QA 4M04A 3N97B 4C8MA 4F5NA 3HL8A 5T7BA 4CE9A 1YTAA 2HHWA 1DLOA 3C94A 4E3SA 4DFJA 1A5XA 4DQRA 4UQGA 1VSHA 1D5AA 5BOLA 8ICBA 1ZQSA 2X74A 4CJQA 3SNNA 3V7LA 1CUKA 2HB5A 3JPQA 4E7IA 3MFIA 1Z3EB 3T5KA 1NK7A 3AVMA 1NK8A 4J9NA 4E7JA 3PX4A 4FLZA 3L2RA 4JS5A 4DFMA 2C2DA 3NH0A 2BPCA 9ICXA 3Q8MA 1RZTA 1HNIA 1Z00A 3NGIA 4OLAA 2IGIA 5EU7A 3NH2A 4E19A 4Q44A 1RDBA 1NOZA 4EEYA 4MFAA 5KFAA 3LP1A 2B5JA 3WNFA 3SQ2A 4C8NA 3HPHA 4JRQA 1ZQUA 5KFYA 4KFBA 3PUFA 2VANA 3OY9A 3KHGA 3G6VA 2IAJA 3KD1E 4W5TA 1ZJMA 1IKVA 2RPIA 3B6OA 4I2GA 4HHTA 1WAJA 5DDMA 4K8ZA 3PY8A 5KGXA 5HRSA 4NCAA 4O5EA 5K14A 2QKBA 2BPFA 1MU2A 2Z1IA 1R0AA 5L1KA 1TKXA 2BHNA 1ZBHA 7ICIA 3PX6A 1VRUA 4DO9A 4O3SA 4O3OA 5DB8A 2QKKA 3KJVA 3DLHA 4J9LA 3SQ4A 4O3RA 3Q8QB 2VA3A 1TKTA 4CJVA 1U4BA 2XC9A 4TQSA 1ASUA 4GW6A 2KTQA 9ICQA 1MQ2A 3OYNA 1UA1A 2FBVA 4YD2A 3G0ZA 4E7HA 1S0OA 4JK1A 4GC7A 3MR3A 3K75D 3OYGA 2ZJ8A 2MUTB 4DQQA 5J2JA 1H38A 1WAFA 3SI8A 3ALYA 4FJLA 1COOA 4QCLA 9ICSA 2X6NA 4FJMA 4MEYA 4KLJA 3NTUA 3VQPA 4CEZA 4DTOA 4HYKA 3AO1A 4ED8A 5KFEA 3DM2A 4F3TA 1JKHA 1LV5A 4BACA 4KLEA 4Q8EA 4QAGA 3BQ2A 4MFBA 5L1IA 3T5HA 4QZDA 2ZQBA 1I39A 4KHQA 3WNHA 3TR8A 1ZYQA 4QZIA 3GV8B 3UXOA 1T4GA 5IILA 1NK5A 3B6PA 5CWRA 5SZTA 4RU9A 1TV9A 3NGYA 4CJ4A 1TAUA 1VSKA 4BGDA 4GMJB 1T3NA 1ZBUA 1HNVA 3KLFA 4F4ZA 4RW6A 2AGOA 1FK9A 1RPLA 1LWEA 3KIOA 7ICTA 1B22A 3CFRA 3OSNA 1TGOA 3QEPA 1C1BA 4PPXA 1QE1A 4XRHA 2AQ4A 4KLDA 3V6DA 1WN7A 4FW1A 1BPXA 5J2EA 2KN7A 3L2UA 3TFSA 1A5VA 2ZUBA 1ITGA 4J9KA 4I2IA 1X9WA 3SI6A 2DFFA 5KG3A 3VQ6A 3HXMA 1ZQHA 5KFZA 4PQUA 4M9GA 3D0PA 3V9WA 9ICUA 3SUPA 4TSXA 2OWOA 2DTUA 3L3VA 9ICBA 9ICPA 1RYSA 4RQ8A 1IKXA 3T3FA 3RBEA 4NYFA 4Q5VA 2VG5A 2GBZA 3OS1A 5J0RA 4YMOA 9ICOA 1U45A 3H08A 4M3TA 2HHUA 4ED7A 4YR0A 3LWLA 5HP1A 4KHYA 3MXMA 2XO7A 2FPKA 4QZEA 2XGPA 3LZJA 4FLTA 4Z4HA 4KRFA 3OYMA 2V4RA 5J0UA 1T7PA 5KFPA 2J6TA 1NK9A 3OYEA 3FDSA 4RT2A 1LAWA 5IINA 4BE0A 3CFPA 4DG1A 3H4DA 3I0SA 3QNOA 3SUOA 1RT5A 1S9FA 1YT3A 4NM2A 1XSPA 5KGWA 1W9HA 2GUIA 4F5OA 1G15A 4NCBA 1TFRA 4QZCA 4HUGA 4I2CA 4YVZA 4ICLA 5KI6A 2Q0ZX 4DL6A 3EZ5A 3C21A 4H8KA 3H4BA 4M9JA 1C1CA 5J0XA 3KKSA 5D4BA 2HVIA 4AHVA 1RDDA 3TAQA 4CESA 3V9XA 4HUEA 3TAFA 3B0XA 2BCSA 1RBSA 5J29A 4ZTJA 3KLIA 2I9GA 3RB6A 3VQBA 4I2PA 4E1NA 4EP4A 3OYKA 1CLQA 3QETA 3VQ5A 1ZQKA 4LY7A 5TZVA 1DTQA 4P4MA 4O5KA 4FZYA 1JLBA 4Z6DA 1X2IA 3Q8KA 8ICFA 3HPGA 1HQEA 4IQWA 4QZAA 1WNSA 3ZSYA 1IXRA 1S0VA 5DLFA 4QOZB 1WSFA 4AHRA 4FCYA 5F9NA 4FLWA 3L2WA 3PMNA 1VSEA 3LALA 1JLFA 4M6WA 4OJRA 1K1QA 3LP3A 1JN3A 5J2HA 1SL0A 3LP0A 4XQ8A 5DDYA 4WE1A 2P6UA 4ELTA 3C1ZA 3FFIA 3ZCMA 4DLEA 4Q45A 1TVAA 1J5OA 7ICUA 3PR4A 2PYLA 4JWNA 3IG1A 4CHNA 1EP4A 5E41A 4J9QA 3UQ0A 1QSSA 4CEDA 4HTUA 2O4IA 4FXDA 3MEGA 1ASVA 1CEZA 4GXIA 1S0NA 2YNIA 7ICEA 7ICSA 3AVBA 5IIIA 4FJ5A 2NUBA 2Z1GA 3DOLA 4LH4A 3S9HA 3BJYA 4E0DA 1ZQCA 3MEEA 4I9LA 4DQSA 1YTUA 1HJRA 2IDOA 1B9DA 2ATQA 5KFWA 4QWCA 4M6WB 1LWCA 4FLVA 4CJFA 1HYVA 2LSNA 4BXOA 2ZJAA 3HPOA 4KTWA 3QEWA 2ETJA 3SPYA 4I29A 4ID1A 4FJGA 4RQ1A 4DL7A 4F8RA 1JLQA 3K5NA 1BQNA 4UAZA 3PW0A 7ICOA 3NH1A 3JPPA 3V6HA 3M9OB 3MGIA 3P83D 4LSLA 2FMQA 4DOCA 3ULDA 5DG7A 2IA6A 5J2AA 4RW7A 1BQMA 4PHPA 2F8TA 1RXWA 3LANA 3K2PA 3GV5B 2R8GA 3KTQA 3F9KA 5KFKA 2DFLA 2OPSA 3SZ2A 4UB4A 3OYHA 5KFHA 3RAXA 2E4LA 7ICRA 4I2QA 4CJ5A 1VSIA 1TKDA 8ICUA 4CFAA 1RYRA 9ICJA 2BDPA 4R65A 4FJ9A 4IQVA 4KLMA 9ICVA 1HRHA 3SCXA 1NOYA 1KSPA 4RUAA 1RT1A 5HMLA 2V4QA 4B9MA 2FC0A 3OHBA 4I27A 2BKEA 4CJTA 4J2BA 4OGCA 4CGGA 2PFOA 4IG0A 4CHZA 2ZJ5A 3N4MB 1ZQAA 2XY5A 1C0MA 4KI4A 3C6UA 1BPDA 4CGIA 4FK4A 1BHLA 3AU6A 4UAWA 3RMBA 5CA7A 2JZBA 3O3HA 3WNEA 5HNKA 1RT4A 1NJXA 1QSLA 1U48A 4DU1A 9ICIA 4YXJA 1X9MA 1KFDA 4QWBA 7ICPA 5KFRA 1A77A 4RNMA 4CJPA 2FLLA 2KQ2A 3DRRA 1RT6A 5IIJA 3MXIA 2RKIA 4M9LA 4DLGA 2ZTCA 4IQUA 3CFOA 2ZD1A 5KT4A 5C5JA 5JS2A 4CHYA 4ECUA 3HX0A 3QEBZ 3HO1A 4KLQA 3P1GA 3RJIA 4RQ7A 4LZDA 4UBBA 1ZQBA 5FRMA 2HMIA 2BQRA 3KLGA 3IM1A 4QZBA 3AVCA 7ICVA 3V6JA 4QZFA 1D8LA 3H7IA 3ZDBA 2PZSA 7ICHA 2F1IA 3RWUA 3QZ8A 4I2JA 4OKKA 4L8RB 4BE1A 2H5XA 1DTTA 3RJHA 3VQAA 5DG8A 4DTNA 4BWMA 9ICRA 3AA3A 3O3GA 3OYCA 4LVSA 5KFIA 3E2EA 3ETLA 5I42A 2GWSA 3NCIA 1RTIA 4FJNA 4F4WA 3I0RA 3C2LA 3HP9A 5J2IA 2QK9A 4FS1A 3RRGA 9ICLA 4C8KA 4RQ0A 3AVAA 1IH7A 1KCFA 3AVIA 3MABA 5KFCA 1X9SA 1V9PA 2ASLA 2JZBB 3C1YA 5L1LA 2XY6A 2Y1JA 2ASDA 4MEXA 1N48A 1RBRA 7ICFA 4N76A 4KHSA 1C0UA 4DMNA 2D0AA 8ICOA 1RXVA 5CP2A 3BQ0A 3QEIA 3V72A 3GIMA 4IDKA 3ZD8A 1TL3A 4BDZA 1GOCA 3EPIA 2NRXA 3MAQA 1S10A 4RQ2A 4KLIA 3Q8LA 2ZTDA 7ICKA 4DOBA 3EY1A 4PA1A 2F1HA 4RZRA 4DSFA 8ICCA 4I9QA 5HMMA 1NKEA 3DOKA 1BVSA 3RR8A 2X78A 1DOQA 2YHBA 2IHMA 4DSEA 3AA2A 4CCHA 3L3UA 3QZ7A 4Z4EA 3ASMA 4F4KA 1HJPA 2ISPA 1Z26A 5FDLA 3ZT3A 3HVRA 4R8UA 2A1RA 1Q9YA 3KHLA 1KRPA 2YKMA 2V9WA 4F3OA 3EYZA 3SYZA 3CQ8A 3S3OA 1S0MA 3LDAA 2R8IA 3KLHA 1S1XA 5C24A 4FS2A 5C42A 2F8SA 1TAQA 4KN4A 3GDXA 4R66A 3KK3A 4PGYA 3K4GA 3VQ4A 1NJWA 8ICXA 2P6RA 3GILA 1LWFA 2Y1IA 2XY8A 3K57A 2UVVA 1ZQNA 4XIUA 1JL1A 1S9EA 2A1JA 2XY7A 3M9NB 2G8VA 1MSWD 4QW8A 5KT3A 3M8SA 1S1UA 3NF8A 3TAEA 4EZ9A 2XHBA 4DU3A 3VQ9A 3MDCA 4KB0A 4QWDA 3LAKA 8ICVA 4JV2A 1YVUA 3PV8A 2C28A 4DU4A 2WONA 1BPYA 4M47A 2JLEA 4MF2A 4DFPA 1JXBA 5DBCA 2IOCA 4CGHA 3T5JA 1U49A 1LW2A 3LWMA 1ZBLA 3ZD9A 1RCHA 1RBVA 4ECQA 2W8LA 3NF9A 4FBTA 4EBCA 1C6VA 1S77D 4RQ5A 2W9MA 4DL5A 4LH5A 5DLGA 3RBDA 5D46A 5CJ7A 1MC8A 1MQ3A 4FLYA 3K59A 3F73A 4C8OA 4LSNA 5HHHA 1GOBA 2MUTA 1C7YA 4OPKA 1KDHA 4Z6CA 2PI4A 3L2QA 3TARA 2O4GA 3PW5A 3BQ1A 4KLHA 1HPZA 4Q8FA 1QLNA 4CJLA 1WSGA 2W9AA 4PUOA 4ECTA 2FPLA 1EXQA 3JSMA 2E6MA 4YXMA 3P5JA 4JV1A 4I2BA 2AGQA 1S5JA 4PHEA 1WSIA 2YHAA 4ECZA 3HM9A 4O0JA 3BGRA 2F96A 4B3OA 5JS1A 1S6QA 2B4JA 1ZQTA 3RH4A 4DS5A 1VRTA 2G8WA 4IFVA 4DL3A 4CJEA 5KFGA 1WCLA 4M3XA 4M3YA 1S1TA 4ED6A 3ZT1A 3TAPA 2BE2A 9ICKA 2Z1HA 3PW4A 4O0IA 4CJRA 4FBUA 1L3TA 5L9XA 4IG3A 4IR9A 8ICEA 4E7KA 3UQ2A 4CK1A 4PH5A 1DGSA 3EWAA 4NY8A 2DFEA 3VQ8A 4IKFA 5J2BA 3DRSA 2ALZA 4OLBA 4NM1A 2PFPA 4ELUA 3VA3A 5KRTA 3LP2A 5CHGA 1Z00B 3AVFA 3VQ7A 1L5UA 3C2MA 2EHGA 4F5PA 4I2DA 1VSFA 2D0CA 4J9MA 4CHPA 3MR5A 3NF7A 1KLMA 9ICNA 4KTZA 2ASJA 8ICAA 4B9VA 1EXNA 1UT5A 1ZBIA 4CIGA 4IRCA 8ICJA 5DQGA 2FMSA 2IHNA 8ICSA 1BPZA 2YNHA 2A1JB 5KG0A 1JLEA 3LDSA 8ICPA 4IQTA 2KZZA 3GFKB 3PX0A 3PR5B 4DEZA 3C5FA 1ZQOA 1LAVA 1N5YA 3JYTA 3LZIA 3PNCA 5HBMA 4UB2A 4KHNA 3AO4A 3RB3A 3OHAA 4ID5A 4YFKA 3T19A 1NKBA 3M8PA 1QHTA 4EYIB 3RMDA 3BQTA 2IBKA 3D45A 3E01A 3KK2A 3PW7A 4NXZA 1ZQJA 7ICQA 3LK9A 2C22A 3I8DA 3TANA 4LD0A 4ED2A 1ZETA 1BI4B 1Q8IA 7ICNA 1L3SA 1QSYA 4CJWA 1K1SA 1VSDA 4B8CA 2FBXA 1Y88A 2R8HA 4KREA 4BXOB 3KD5E 3CM6A 1SUQA 1WLJA 2DY4A 2A1SA 2R8KA 4FM1A 5J2FA 3TABA 2M9NA 2HHSA 4FZZA 3OYLA 1S76D 3Q8RB 4QZHA 4FJ7A 1WCNA 1A5WA 3AUOA 5J0WA 4M9HA 1QQCA 1XSNA 5BPCA 2HNYA 4OKJA 3PO5A 4ECXA 2BCRA 4CJSA 2G8HA 5J0YA 3DLRA 1IG9A 5KFNA 3OYFA 1ZQIA 1U04A 3ZT0A 1U47A 4M0AA 2OPPA 4K4GA 4MFFA 3THVA 3ZDDA 1TKZA 3SUNA 4ECSA 4M3RA 4DSLA 2J6SA 1T03A 4GXKA 5KG1A 4G1QA 4CF1A 1ZQWA 2UVWA 1S9GA 4H4OA 4C8LA 2RN2A 8ICHA 4LZGA 4O44A 2Z1JA 3TAMA 1B92A 3AA5X 4QWAA 3HYFA 3JPOA 1HUOA 3DLEA 1RILA 2GV9A 2W9CB 5DG9A 1XHXA 3RJEA 3UXPA 3AO3A 3LPUA 2PFNA 1KEJA 9ICGA 4F92B 4JUZA 2VA8A 3RTVA 5KFOA 1K6YA 1N56A 1WSEA 2HNDA 3NGZA 1EX4A 3OVNA 4YNQA 3B0YA 2IC3A 4KLFA 2XCPA 3QNNA 3ZDAA 3KKRA 4M2YA 4IRKA 1JLAA 1J9AA 2F1JA 4N47A 1ZQZA 4M3WA 3TWHA 4CFCA 1JIHA 2LYHA 3RMCA 3HK2A 3OS2A 5KFMA 4G3IA 8ICTA 5HLFA 4B9TA 4BDPA 3LAMA 4QZ9A 4TUQA 3AVHA 1NK4A 8ICLA 3V1QA 5KFXA 4O4GA 3A2FA 1X1PA 5CY4A 3HP6A 4YR3A 1NJZA 3CM5A 5KRSA 2G8KA 5DKWA 4PWDA 4YN4A 4RQ4A 2JEFA 1O1WA 4UB5A 1TL1A 1KFSA 4DF8A 1SKRA 1TK5A 4DSIA 3OYAA 1T8EA 3M8RA 1S1VA 5J2DA 4PGXA 4Y1DA 4JS4A 3V4IA 2AGPA 4CK3A 3ISCA 4KKOA 4P2HA 4J2AA 5KFSA 4CF8A 4N5SA 4KHWA 3CG7A 2BCQA 4RNNA 3NDKA 3SQ1A 4KAZA 3NBPA 4QW9A 5BOMA 8ICMA 3K58A 4I28A 3RH5A 3UPQA 5DBAA 3TI0A 2P1JA 2VWKA 4DTSA 2BCUA 1BL3A 3GIJA 1ZQFA 8ICWA 4KHUA 3DLKA 4Z6FA 1KVAA 1ZQYA 3VA0A 4KN7A 2IMWP 4AHSA 2YNFA 1IM4A 4DTJA 2P5GA 5KFVA 4DWIA 1TK8A 4DTUA 4IR1A 4N56A 2G8UA 3OGUA 5KG4A 4CHQA 3V7KA 3K5OA 4J9RA 3ZSOA 2YKNA 4KLGA 3HSTB 2FPMA 1RDAA 9ICWA 1RDCA 3GV7B 4CERA 2RDJA 1Z25A 1GOAA 4FJ8A 3V6KA 4X5VA 3SV3A 5J2MA 5KFTA 2W9BA 4KLTA 2HHVA 5KT7A 3C23A 1FKOA 4RPZA 5IIMA 4K4HA 4ECYA 3EW9A 1B9FA 4CEBA 1S97A 4J2DA 4DSJA 4KTQA 1ZQQA 3M9MB 3ISBA 3U3GA 4F5QA 4Z6EA 5EOZA 4TUSA 3VN5A 4KPYA 1XC9A 2DPJA 4P4PA 4ECVA 3TFRA 4NLNA 2IS3A 5C25A 3L8BA 4IRDA 2BGWA 5J0TA 1XHZA 4DL2A 4HCCA 2RF2A 5J2PA 5KFBA 4NYNA 4FO6A 4CGJA 4DS4A 1CXUA 7ICJA 3DI6A 3KLEA 3NGDA 2W42A 3RRHA 1ZQMA 7ICGA 4CF9A 3RR7A 2BQUA 3HT3A 1RTDA 4O3PA 3CYMA 4CJKA 5DK5A 4CEEA 4NCGA 1BPBA 2FMPA 4R8UB 3RJFA 4DTPA 4FVMA 4JV0A 3K5LA 3KHHA 3OJUA 3G10A 2OZMA 2I5JA 1Y97A 3HVTA 5FROA 5D3GA 1NOMA 3NE6A 4K8XA 1VSJA 3SJJA 3KHRA 4GLXA 1VK0A 3V9UA 5KT5A 4KLUA 4KO0A 4Q43A 1LB2B 2AU0A 4FM2A 5EWGA 4M42A 1UWBA 5KG2A 1PZNA 5D49A 4B9LA 1SKSA 1RBUA 4Y1CA 4XA5A 4QZGA 8ICZA 4DSKA 5J1EA 4J9SA 2HHXA 2DFHA 5F9LA 4FK2A 1JLCA 3S3NA 5DB9A 2ISOA 2X6SA 1CXQA 1XSLA 4DL4A 4KV8A 3MR2A 5DBBA 5DGAA 1JMSA 4CK2A 2WTFA 2PXIA 3RB0A 4PHAA 4YFUA 1UT8A 1D9DA 3Q8PB 3QE9Y 5CZ1A 4ECWA 8ICIA 5KT6A 1VSLA 1B43A 4JRPA 3AVKA 9ICAA 3AVGA 2XGQA 2YV0X 4FK0A 4FM0A 9ICCA 4E1MA 4TUPA 5HHIA 3ZSQA 4R64A 4NLKA 5J2QA 4YMMA 1ZQRA 4ED3A 3MDAA 2MAXA 4FJKA 5KG6A 2R8JA 4W5OA 4IFYA 5L1JA 1BIUA 4W5RA 4O55A 3AV9A 7ICMA 3RAQA 5KG5A 3GIKA 3GIIA 1ZQEA 3ZDCA 4CHOA 1N6QA 1XS9D 1QTMA 2PI5A 9ICMA 4AHUA 3SPZA 1ZJNA 3LPTA 4FJJA 4I2FA 3GQCA 3ZT4A 4JWMA 4CECA 1S6PA 3C6TA 3SQ0A 4AH9A 2JEJA 4FJHA 4J2EA 4RW4A 3OYIA 3HW8A 3O3FA 2BR0A 3ISNC 3EPGA 8ICYA 4KLSA 3MEDA 5KFDA 4CIFA 4YD1A 3IHQB 4DQIA 5J2CA 1BISA 4M3ZA 5CB1A 3C95A 2ZUCA 1BIZA 4GC6A 4R63A 2W8KA 1ZBFA 4M41A 2JEIA 2BQ3A 2ITGA 4CEFA 3NF6A 3QINA 3Q8SB 1NKCA 3H8WA 4F2SA 4O3NA 1JLGA 5CYMA 2NRTA 3UIQA 2ZTEA 3RB4A 1SL2A 4BWJA 2KFZA 1KVBA 2VG7A 2PFQA 1BGXT 5HRRA 4J9OA 1ZQGA 4B9UA 3HJFA 2WOMA 1HYSA 1JXLA 5KFQA 3MECA 4KLOA 2HHTA 3NFAA 3VQCA 4RNOA 4MFCA 1TVRA 2G8FA 2RDIA 1RTJA 1JX4A 1T05A 4CJUA 3MXJA 5EWEA 3V1OA 2Q3SA 4CJ3A 1HUZA 5DQHA 3VQQA 3OS0A 1Q9XA 4B8AB 4Z4IA 4OPJA 3V81A 4DOAA 3V9ZA 5IIOA 5HROA 4B08A 4Z4GA 3G6YA 1CZ9A 1UA0A 3AVNA 4O5CA 3MR6A 4O9MA 4W5QA 1RBTA 3H8JA 5CYQA 5IIKA 1REVA 3BDPA 3S3MA 5CR0A 3C5GA 5KFUA 1EETA 3M8QA 3IS9A 2VA2A 4RG8A 4CF0A 2DPIA 1NK0A 3OYBA 3ZT2A 2OZSA 3U3YA 2PYJA 5DB6A 3UXNA 3JPRA 4YQWA 4FJXA 4ZH4A 3V1RA 4OVLA 3AVJA 1ZQXA 4DTMA 2ATLA 4UBCA 3QEXA 2VWJA 1NK6A 3ISDA 4AILC 1HYZA 4ELVA 5HRPA 5HRNA 1ASWA 4PHDA 5EWFA 1RT3A 4FW2A 3VQEA 1XO1A 3RJKA 3DYAA 3AO5A 4KB1A 3JPNA 2KW4A 2QXFA 2HNZA 1U9LA 4YCXA 4F5RA 4EBEA 1FKPA 3OJSA 1BI4A 4OKEA 3IAYA 3KK1A 4FLXA 4B9NA 1BPEA 1LW0A 4FLUA 4J9PA 4UB1A 4I2HA 3H40A 5J2GA 3DRPA 1J54A 1D8YA 4F4XA 1XI1A 2KZ3A 1C1AA 4KITB 4MF8A 4F93B 1RT2A 4E89A 4YP3A 1KLNA 4EZ6A 2EX3A 2XCAA 1C0TA 2YNGA 2PY5A 4RT3A 2UVRA 1L3UA 4UAYA 4IBNA 5DMRA 4P4OA 2BPGA 4F4YA 1SKWA 3MFHA 3ZDEA 1KFTA 4W5NA 1ZQDA 2UVUA 4XUSA 3K5MA 4CFBA 3O4QA 1TK0A 4B9SA 3ITHA 2NRZA 8ICNA 3QLHA 3HWTA 8ICQA 4H4MA 1QS4A 4MQ3A 4EBDA 4GXJA 4HVJA 2OPQA 3L2VA 1ZQPA 5JUMA 3MGHA 3ZSXA 2FBYA 4BE2A 3OYJA 4DF4A 4RQ6A 3FYHA 2HW3A 4YG2A 4M45A 4KI6A 3PVXA 7ICLA 1KVCA 4F2RA 2OPRA 4Z4FA 4PY5A 4ZHRA 2W9CA 1NJYA 4NLZA 4FZXC 4UB3A 2AJQA 2G8IA 1VSMA 4ED0A 3QEAZ 3U6FA 3OYDA 2J6UA 3H8SA 5J0OA 4M9NA 2B21A 5DB7A 3NHGA 4ED1A 4BDYA 1SZPA 2KFNA 1IKYA 1SL1A 1CZBA 4CEAA 3NAEA 3V7JA 2OYQA 2VG6A 3OSPA 3RJJA 2P66A 1RT7A 4CFDA 3AA4A 4AHTA 2ZE2A 2FLPA 4R5PA 3DLGA 1HQUA 5J0PA 2AQ0A 3AVLA 3IRXA 2D5RA 4CF2A 2ZUDA
chains in the Genus database with same CATH superfamily
1U09A 2MSNA 2GMLA 3DMJA 2C2EA 4WQ5A 3P8BB 3PRDA 1XWLA 2KIVA 1KAYA 2FVPA 4KT0C 1KQSR 5ALFA 4HCBA 2OA8A 8ICRA 2M88A 3RVCA 1EB0A 2P6TA 4WIQA 1VR6A 3K17A 2KT5A 3TTFA 1EQMA 1FWLA 1TL7A 1RLDA 1OSCA 5JMNA 1E6VA 3QSYB 4CIEA 2M4MA 1AUSL 2CVEA 4WXOA 4CGFA 3ZNJ1 1TYQB 4CT9A 4E7LA 3QFUA 1ZQVA 3ZSRA 3AU2A 3QGHA 3TQ1A 2RF2B 3EWGA 5DQIA 1VJ5A 3QUBA 3NGKA 3TZWA 3ZSWA 3ZEUB 3THYA 2DNLA 1RBAA 1RWXB 3M6GA 2KZMA 1UOCA 3PW2A 4B3TF 1ZQLA 4NLGA 4CDGA 4ZCIA 3VQDA 1YWXA 5AQVA 1F9FA 2UUBK 3RSEB 1WWUA 2AX1A 2K2PA 2HBYB 2XI9A 3SUQA 1SZ2A 4RPXA 3JTPA 3GP9A 3CGIA 5IM0A 4QZ8A 2BUPA 4HH0A 3T1AA 2H3QA 4ECRA 1RP5A 4HUFA 2DXFA 1KLMB 2ZJQL 8ICKA 4QQBA 2YKNB 4DX7A 5KFFA 2UUCK 4IO1A 2IA0A 2R3VA 1KAXA 5J2NA 3KFWX 4M5DB 2NRWA 3I96A 3C2PA 3MN5A 2F8EX 1L3VA 5JVGQ 4DQPA 1QJHA 3BDEA 2NXNA 2CQ1A 1J53A 4NI2A 3KLIB 3VC8A 2VQFF 3MURP 3J8AA 1RTHA 1F21A 4QWEA 5MLCQ 2CPEA 4PL8A 1SV5A 5ETMA 4CO2A 1UFKA 2PKEA 5J1NA 5LL6d 1K8KB 1RAJA 2HHQA 2UUBJ 4HEA9 5LMUF 1TL3B 4ED5A 4O5BA 3HHLA 3B4DA 3D2WA 2N7YA 2L9DA 3QT8A 3SSRA 1Q5VA 4FF1A 4WYBA 2KICA 3CCMS 1CJUA 1JJ2M 1U0SA 4BR9A 4JI8J 3SV4A 1CI4A 2W40A 3KWGA 4JNEA 2ZBQA 2P9PA 4TY8B 1NI3A 3CCJN 3KMQA 1XU4A 1GNKA 1WHWA 5A6WA 5J2KA 3M30A 2QA4N 1YJ7A 3CDBA 4L72B 2I7NA 2J7KA 5T7BA 4CE9A 2HHWA 3QJJA 1DFDA 3PJXA 5TISU 4DFJA 5C7PA 4UQGA 1VSHA 4WK3A 1D5AA 2X74A 1U02A 3SEIA 5GAEI 1CJTA 2RQMA 4X62F 3SNNA 3UVJB 4DHVA 2DISA 5HN0A 1CUKA 4GVBB 3JPQA 2HB5A 1M5HA 1URRA 4KIAA 2AH5A 2Y8WA 2VQFJ 1NK8A 1TTHB 4WP3A 3DC2A 2E7VA 3QNWB 3IP4B 2KOBA 4IJAA 4DFMA 2JX2A 3DOMA 4U8VA 2ZM6K 9ICXA 1HQ2A 3BGLA 4X65F 2FLOA 2HBQB 3NBPB 5ALHA 1Q4RA 4E19A 3D1OA 2OO4A 3UVJA 4EEYA 3HI0A 1CQNA 4MFAA 3AN1A 3LP1A 1VCTA 2RHFA 2IM1A 4G1PA 3VF0B 3HPHA 5ALSA 1ZQUA 3PUFA 5ALVA 2DHXA 2FVQA 2C3MA 1S9GB 4H4OB 3CJSA 4QPTA 3VQTA 3D6JA 4W5TA 1ZJMA 1IKVA 1WAJA 5DDMA 4K8ZA 5LSOA 5KGXA 5HRSA 2DNMA 2QKBA 2B6GA 1P1LA 2UUAF 2Z1IA 1R0AA 3N6LA 1Q0NA 3ID6A 3MM6B 4TY8A 2E5LK 2BHNA 1XBWA 1HBMB 2CQCA 3PX6A 1NZ8A 3O5BA 4DO9A 3R9PA 3PJ9A 4O3OA 3KJVA 4J9LA 3SQ4A 4JKDA 4NLRA 1FX2A 5GTIU 2XC9A 5IT9U 1OY8A 3LF0A 3H3NO 9ICQA 3AA8A 3FZHA 2YPYA 1UA1A 4NASA 4W92B 1B7YB 2FBVA 1YJRA 2E1RA 5J1PA 4GC7A 1SPBP 3K75D 4DR6J 3OYGA 3J7ZT 2HMXA 4DQQA 3OBYA 1H38A 3BZKA 4AYBF 3GYXB 1KAZA 3ALYA 4IZ9A 1ITPA 2XLIA 4LQ9A 4FE3A 4RWWA 4LFAJ 4DTOA 3ETMA 5A8KA 4ED8A 2GJ2A 4F3TA 3VGTA 3RUBL 5AR0A 4BACA 2CJBA 2XM3A 4RQMA 1IBKF 4Q8EA 3M8QB 4C23A 3AB2B 1KWMA 4MFBA 3DGVA 2XI2A 1VK3A 3GLJA 4MO4A 1Q8KA 3AGKA 2ZJPL 4KHQA 2ZOGA 3TR8A 4QZIA 3GV8B 5IILA 4K0KF 1ZOLA 5CWRA 2WC9A 3MX2A 3HHEA 5SZTA 1XNRF 2O8CA 4YMEA 3NGYA 3ISZA 5AKIA 1TAUA 3NP5A 3PYDA 2J0QD 3K0JA 3EE9A 3MMAB 4P72A 4F4ZA 3AQOA 2AGOA 4WFZA 4NLUA 4L76A 2K8AA 1B22A 3CFRA 1HKGA 3CCVN 1QE1A 3C8YA 3KUGA 3K5PA 4K4WA 2YCHA 4Y3CA 3NUQA 2FGOA 2K8BB 2EI5A 1I94K 4P7VA 4HHHA 1D9AA 3T9NA 3Q8YA 3VHQA 1XERA 5KG3A 1N0UA 3AY0A 4CBWA 1VRUB 1D8ZA 3HRGA 3V9WA 1Q1KA 3SUPA 2JVRA 2YMPA 9ICBA 4NYPA 1OVYA 4H5VA 3ENBA 3M8YA 3DMJB 3QYPA 4USTA 5AQTA 4USKA 5AQGA 3CC7S 4YMOA 1NO8A 2BJ7A 2DNGA 9ICOA 1U45A 1GLDG 3DN9A 3VGSA 3MXMA 1X4EA 3LZJA 4Z4HA 4KRFA 2ZBPA 4E2FB 1NH8A 4FP9A 2VG6B 4RT2A 3FMBA 3CCMN 2DJWA 1CJVA 1NLKL 3K1ZA 4PWDB 1RT5A 2YKQA 1YT3A 4NM2A 1XSPA 2VG5B 3PEJA 2GA7A 2LYBA 2ZKUA 5CA5A 3ET6B 1HR0F 1NPKA 2GUIA 3ETRA 2XS5A 1NZAA 4QZCA 4HUGA 2W54A 4C4SA 2BJ1A 3KWMA 1YIJS 3H4BA 3D54A 1WTFA 1C1CA 2Q36A 1BG3A 4PG8A 1PBUA 4AP9A 4GKKK 4X4TA 1M1KO 4JI8K 1FDBA 3NS1A 2BCSA 4DV7J 5J29A 2I9GA 3RB6A 2CQGA 2NZTA 2WFBA 3SD7A 4EP4A 4LY7A 5TZVA 4KHPK 2E1EA 4FZYA 4Z6DA 3FR0A 1E4FT 1X2IA 3M05A 4QZAA 4KV8B 1WNSA 4GY2B 2YMLA 3ZSYA 1S0VA 4B1UB 2V8PA 2WAQC 2CWXA 2ZM6F 3JAMO 4DV3J 2Z56B 3BKFA 1WF1A 3D66A 2UXDF 2LM1A 4FCYA 3TZXA 4FLWA 3L2WA 1EO1A 1X42A 3WHIA 5KNIA 2W04A 1FKAF 4BRCA 3LALA 2Q3PA 4WK1A 5HP1B 1JN3A 5J2HA 3F2CA 4C9DA 2GS8A 3BH7B 4KR0B 5AZIB 5F8NA 3ZCMA 3WX8A 1TVAA 4Q45A 1J5OA 7ICUA 2QX0A 1ZC6A 1RYUA 2R18A 1FE0A 4Y2PA 5E41A 4DR7J 4HTUA 4CLLA 3WK7A 4Q7AA 3MEGA 7ICEA 3PM9A 3AVBA 5IIIA 3H6EA 3JS6A 3MGJA 2FD2A 3ZYYX 4LH4A 3BJYA 2Q31A 4E0DA 4PR6A 3CMAN 4RL1A 4I9LA 1YTUA 3H2VE 1HJRA 4LFBF 2ATQA 5KFWA 5ADZA 1G6BA 4QOTA 4FLVA 1SJFA 1SUQB 1HYVA 5HVGA 4HR2A 2QE5A 1LFWA 1H3DA 2ZOMA 4FJGA 4KPCA 1E6YA 4ID1A 3L0QA 1IR2A 4P74A 3VGVA 4F8RA 1BQNA 3BSNA 1F2HA 2H65B 2ROPA 1Q8BA 3KK2B 5GMKa 4WZMA 1RWMB 3M6ZA 4R5PB 2W1BA 3HI9A 3BP8A 1U2FA 4DOCA 4DQ8A 1BA0A 3GCXP 1BQMA 1RXWA 2PMZF 5GAGI 3K2PA 3DGPA 1KONA 3TQEA 2R8GA 2ZWOA 1FCAA 2HQDA 1FVSA 2KV2A 3SQGA 2QGFB 2QWOA 3HX9A 1JWWA 2GVZB 3OYHA 2GAHC 1BWVA 2E4LA 5CCMA 2D3ZA 7ICRA 4PXEA 4LR7A 4ZCKA 5ALQA 4TYBA 4KGZB 1CVJA 2ZIXA 2VPWB 1HRHA 5LMUK 2F7VA 1RT5B 2FC0A 4I27A 3NRBA 1YZ7A 2BKEA 5ALJA 3BGUA 4DPTA 4CJTA 4IDKB 1L3KA 1WUAA 3VEXA 2XY5A 1C0MA 4IJNA 2L3MA 4CGIA 2YKPA 2CNLB 3PIOL 3AU6A 2AXTU 2ZM6J 1MWYA 5CA7A 1TKXB 4BGAA 2JZBA 1S49A 2H5JB 3WNEA 1J5OB 1VQ6S 5HNKA 1BLUA 1FNMA 4NXMF 2D9PA 2DGVA 1X9MA 2CXEA 2XEXA 4A61A 4C4TA 4CJPA 2FLLA 4PRFA 5IIJA 4MN4C 3MXIA 2ZITA 2CG8A 3K9JA 3DJCA 1QM9A 5HANA 1HJOA 1C0TB 1KTVA 1KHWA 4KGKA 4IQUA 4DV7F 2ZD1A 2WVFA 4P10A 1RHRB 3TUZC 4HTJA 1R3NA 2COLA 4MHVA 3J7YI 4KLQA 4JHDB 2JXJA 2ZHBA 4RQ7A 1ZQBA 2CIMA 2H9ZA 2OGUA 1HQEB 5JU5A 4FFDA 3V6JA 4OHVA 4QZFA 5AM2A 3IM8A 3VF2A 1B0VA 4P9SA 5CHIA 4NLDA 1MA7A 4AQYK 1GXLA 2C2OB 3EDRB 4OKKA 4I2JA 3GJRB 3RJHA 5DG8A 5AKHA 3CCLS 3HBTA 2FDNA 4LBPA 1JJHA 1CJTB 1NBWA 2E5HA 5I42A 2OIHA 1I51B 4K7QA 5DZ6A 4JI5J 4FJNA 3C2LA 1FE4A 2D3O1 2UP1A 3PSPA 1DLOB 4KBOA 4K2JA 4QIWD 3SQOP 2EZXA 3U02A 2KKPA 9RUBA 3MABA 1X9SA 5LMNK 5IWAJ 3LPEA 4JI1F 1IR0A 4MFBB 4DKWA 1IBLK 4B3SK 2Y1JA 1WUUA 4MEXA 2CKWA 2CRXA 2H4WB 4MKBA 2YX8A 3GIMA 3ZD8A 1TL3A 3R2DJ 4FWKA 3FQLA 4K0KJ 3CJQA 1KD1O 2R7UA 3I8BA 4EU0A 1S10A 2MZSA 1JMTA 3Q8LA 4H5WA 2ZTDA 2ALYB 2KFYA 3CJKB 2P6SA 4QJFB 4PA1A 3Q8UA 2V8HA 1NKEA 1YJ9S 4PG6A 5AM4A 1M1KT 2X78A 3T1YK 1TL4A 4JI5K 2YHBA 4DSEA 3AA2A 4NLVA 1Q86T 2PFUA 3W9JA 2Z8QA 1N33J 3L3UA 5AQMA 2HHHF 3X3UA 4F4KA 4A8MP 3ZT3A 5AM0A 3HVRA 4R8UA 1KRPA 2YKMA 5AQNA 3CETA 5K8NA 1K8AO 3LDAA 5LSRA 2R8IA 1JLGB 1PK1B 2QFJA 5HR7A 1IG8A 3R5AA 4KN4A 3N6NA 1QE1B 1RLCL 4LF4F 3KK3A 3K4GA 4R0EA 2YWKA 2FHOB 1MG7A 3S7RA 2VICA 4JKEA 1LWFA 2M0GB 3K57A 3I55N 2PA3A 2YJFA 5ALXA 2KL8A 3NVMA 3WKEA 1S9EA 2A1JA 2XY7A 3NVVA 2L48A 4IC9A 2G8VA 4QW8A 1DTQB 2VD3A 1SWVA 2GMJA 2J0SD 3M8SA 4FKXA 3TO8A 4DU3A 5AK3A 1RJJA 1N60A 3NRWA 3OBWA 3KYLA 1FKOB 4JV2A 3PV8A 1F44A 2R7QA 1DJ0A 3AAPA 1HWUA 4M47A 2WF6A 5HO4A 1F5AA 3OA9A 2QLWA 3ADAC 4CGHA 4MKAA 1VLYA 1LW2A 3BR8A 3LWMA 1ZBLA 3MPYA 3UN3A 1RCHA 3O5TB 2MXYA 2E5GA 2FI1A 3NF9A 3VQSA 4FBTA 1WTBA 3D6RA 4EBCA 2KMDA 1WC1A 1F60B 1C6VA 2CJ9A 3D2QA 2RE1A 1FT8A 4LF6J 4JV5J 3DWLA 2W9MA 5DLGA 1OW5A 3ELHA 3R9KA 1MQ3A 4JI0J 4C8OA 2DGZA 3TX8A 5LSLA 3ZTRA 1C7YA 4OPKA 2PI4A 3H8MA 2RHQB 2N3OA 4X4OA 3W3DA 4J03A 2I38A 4PUOA 4CLPA 1DK3A 2Z2ZA 3P5JA 2AGQA 2WSFC 4QYRA 1S5JA 3MXHP 1WSIA 2YHAA 7AT1B 1EARA 4O0JA 3V5RA 2RP5A 2P9IA 2FF3B 2B4JA 1ZQTA 2R42A 2DR9A 5BR8F 1AFIA 2CPRA 3N28A 4IFVA 1N5TA 3WIVA 1RT7B 1HR0K 5GMDA 1RXOB 3SSSA 5KFGA 4DBQA 5KAIU 4NLTA 2E3TA 4ZLNA 4M3YA 2QXLA 4GO5X 3FGUA 1RTHB 2Z1HA 2C2MB 1UEVA 1HHQA 5K5MA 4E7KA 1L7OA 4NY8A 5HQ8A 3E51A 4OLBA 3CHWA 3VA3A 2MMYA 2Q1NA 5KRTA 4ILLA 3QPIA 3AVFA 3VTIA 4F5PA 1VSFA 2ASJA 3WEEB 3QLHB 3UCUP 1EXNA 2ZNYA 4CIGA 4HKQA 3QIDA 5ALEA 4YHHK 1X5OA 1BPZA 3AD7C 4ENOA 2XLKA 4D3HA 3OV7A 2FZCB 3OTOK 1WBBA 2KZZA 2Z2LA 4LRCA 3PX0A 2XTJP 1LAVA 5JLFA 4JD2B 2I8EA 2HBLA 5AXNA 2HG4A 4OZ2A 3OHAA 2FQQB 5DZ7A 2FJWA 1FO4A 1NKBA 4DZDA 2FE9A 4TU7A 1YJUA 4NXZA 3LH2S 2AZ1A 3EVWA 4B3TJ 5GADU 2H3IA 7ICNA 1H72C 2VASA 3LPYA 1QSYA 1IVZA 1ZBTA 5CZXA 3DRPB 3GTYX 3BSOA 2YKMB 1KD1T 4HI2A 2J7UA 5LXYA 1CQMA 4BXOB 4PKHA 1SWWA 1D8BA 2A1SA 2DY4A 4K4XA 2GQCA 1Q82O 3NL0A 1YKWA 2M9NA 1RDRA 3KJNB 1KW4A 5AXLA 4FZZA 3VAHA 2DKXA 3Q8RB 4P7TA 1TKTB 2NREA 2J9EA 1TE2A 1GLEG 4M9HA 2A1AA 2XMWA 1QQCA 1XR7A 5BPCA 2HNYA 3T6BA 3G6EN 4ECXA 2DR6A 4ID5B 3DLRA 3OYFA 8AT1B 5AQFA 2LYVA 2BRKA 4M0AA 3ZDDA 3O8MA 4NEYA 1JLFB 1S3XA 3UR0A 5ETSA 5KG1A 1NPPA 4DX8H 1ZQWA 4C8LA 3H0RB 3A1YG 4LZGA 4BR4A 3TAMA 3L5KA 5BYQA 4BX9C 4JI0F 2XULA 1HUOA 3DLEA 3WXKA 3AO3A 3FGVA 2I7PA 2IDLA 2XSJA 2F9WA 4OX9J 1FI4A 3AL0B 3RTVA 4USHA 4CZEA 1EZZB 1FEHA 4CRXA 2KHVA 4K5SA 2QMXA 3P45B 1VQSA 6FDRA 4NE9C 1EX4A 2NNWA 1N6QB 2IRUA 2J9CA 3ZZOA 3MEGB 5D4NA 3GFHA 2QSFA 3NGRA 1EP4B 3KKRA 4ID8A 3OW2M 4IRKA 1DGJA 1FRLA 1ZBSA 2WF5A 4N47A 2R7VA 2E66A 1NU0A 3QICA 4CFCA 2AEJA 2RRNA 1QQ6A 1DHMA 3U27A 3OTQA 3BYPA 4PXDA 2UXBK 4MYUA 4B9TA 4OI2A 3C7NB 3A2FA 5IQQA 2VZ9A 2GCFA 4LFCJ 2ESEA 4NL9A 2QEXS 4CF4A 4F04B 1T9VA 4YR3A 3CM5A 5DKWA 2WF9A 1GTHA 4RQ4A 2B4PA 2O8DA 4DG1B 3FZ2A 1TK5A 4DSIA 4GV3A 3OUYA 4DOZA 1S1VA 5J2DA 3MMBB 3EJMA 3HHKA 4JS4A 1RB0A 3RW6A 3KMSA 1XQIA 1HPZB 4KKOA 1Q5YA 2QO3A 2BCQA 4RNNA 3DXMB 4KAZA 4DV6J 5BOMA 3ZZTA 2HVZA 3W2WA 3K58A 4I28A 4UOCA 2KN4A 2R7OA 3FBEA 3N6MA 3UPQA 2P1JA 4KBIA 4Z37A 3NRZA 1QVGR 4CLTA 2BCUA 4NA1A 3FK4A 2P9LB 3DLKA 5E0OA 1R8AA 3VA0A 2IMWP 3CJ0A 3BR9A 3O9QA 5GADI 3HKZC 3MN7A 2F77X 2G8UA 3OGUA 4XDDA 3V7KA 3K5OA 2WW8A 3HSTB 1M5VC 2DIVA 2UUAK 1PYSB 1RDAA 9ICWA 1N5SA 4QIWF 4DR2J 4NLYA 2QWPA 1T02A 1M5OC 1PBAA 2VBWA 2Y3YA 2PC6A 1C1BB 1NB2A 1RWUA 2QLTA 3OVBA 1YJNN 2W9BA 1LKYB 2A6OA 4K4HA 4ECYA 1SAZA 3EW9A 3KDNA 5ALUA 4KTQA 1ZQQA 2HQIA 1HNVB 3QB0A 2DHSA 4U7UD 4JI0K 3U3GA 4F5QA 2IOFA 3Q2SC 2Q1LA 3VN5A 4UT4A 3J7AN 2DPJA 2GWKA 4NLNA 2G0IA 5J0TA 4HCCA 5KFBA 4CGJA 4DS4A 4Z7YA 3KLEA 2VB6A 4Y0WA 1KQFB 3U9DA 5D0GA 2HOQA 7ICGA 3GU0A 3U26A 4JI4J 4C0HA 4FZVA 1RTDA 5E79U 4O3PA 3EICA 4B3MK 1OIAA 1RA6A 1YITN 4CJKA 3NNHA 5DK5A 5EE3A 3GB0A 1KBUA 1RCOB 4NCGA 1TUVA 1BWEA 5IC4B 4DTPA 2HI0A 2DKOB 2JC0A 4FNHA 2GTDA 1DGKN 3HVTA 5LJWA 3NE6A 4UW2A 3SJJA 2P9LA 1E6VB 4CBXA 2KM8B 1CS4B 2FZGB 3G71N 2MHEA 3QMLA 1VISA 3UDCA 3VV2B 3D0IE 3BSAA 5M1PA 3FZBA 3MX5A 1UWBA 5KG2A 1IKWB 3CC2S 4B9LA 2QWRA 1RBUA 1ZRNA 4IOAQ 3IR7B 3EKUA 2R4FA 2OEMA 8ICZA 4FK2A 3FJ2A 2KSOB 1W7AA 1AFJA 1XSLA 4DL4A 3MR2A 2OTJS 2HVEA 5AQPA 3RZAA 3KZBA 4JI6F 5DGAA 2BJ9A 4CK2A 2WTFA 3GWCA 4PHAA 2WZ1A 4OZNA 3R7SB 3FSIA 3BPSP 1D9DA 2CQHA 3Q8PB 3OTOF 2ILZA 3PRVA 1RWNB 2G5HB 1P27B 2D1CA 5KT6A 1GT8A 5EE1A 3CJTA 4LVNP 5BXIA 4FM0A 5M1NA 1EX8A 3THWB 3MD1A 4TUPA 5HHIA 3D2FB 3QBXA 4ZK7M 4ED3A 3MDAA 2O8EB 2H51B 2MAXA 1T05B 2LMIA 5KG6A 2R8JA 2OSQA 4W5RA 2OP5A 3ICXA 1P6TA 4OI3A 7ICMA 3GIIA 4CHOA 2YPZA 1N6QA 2PI5A 5F1XA 2A6MA 4CTAB 3C66A 1HUXA 4IFVB 2BOAA 4EEKA 4DV5F 3LPTA 3ZLJA 3M5RA 3SCLE 3GQCA 4WCEQ 2HGLA 4YDXA 1XK8A 3MN6A 3C6TA 4KH1B 2JEJA 1BO5O 4CLWA 4J2EA 1B99A 4B1ZA 3MUTP 4PUOB 2KJWA 4DUYK 2KT2A 2F4VJ 1ELOA 4JI6K 2BR0A 2JWNA 1NMEB 4O4GB 3U4LA 1U8SA 2JZ5A 5KFDA 4CIFA 3S6EA 4YD1A 3W5XA 5CB1A 3C95A 2LVWA 2J8AA 3H8YA 4GC6A 4R63A 4YORA 5BRFA 4A47A 2W8KA 1ZBFA 4M41A 4CEFA 2HFUA 2M70A 1YZ6A 3H8WA 4F2SA 5CYMA 3UIQA 3SK3A 2ZTEA 3Q0AA 3OFGA 1TELA 4HT7A 4BWJA 2KFZA 1ZM4A 2VG7A 2CQ2A 1ZZFA 2XG8A 5CD4A 1VDVA 3CCWA 3BY5A 1XNRK 3CO9A 4B9UA 5LL6Z 3HJFA 1HYSA 1NNEA 2FHMA 4KLOA 3GSIA 4KQZA 2V2VA 3CVKA 1EQ0A 3BBCA 4MFCA 4FXVA 3I1YA 2DRAA 2JHEA 2FHJA 4CJ3A 3DRYA 1SXLA 4D3GA 1MLAA 3VQQA 1Q9XA 5B8HA 4ATNA 3L09A 3VAIA 4DV3F 2E8NA 4AM6A 4OPJA 2OPSB 3V81A 4O8UA 4BQZA 2V52B 4PZVA 3AVNA 4O5CA 3DLEB 3MM8A 4O9MA 3H8JA 2OPPB 4E8UA 4F71A 3R8YA 2OEHA 4OX9F 3S3MA 1EETA 5I3UB 4G1QB 3M8QA 5BR9A 2LU1A 2O8FB 2RQ5A 2OHDA 3GCWP 2IOHA 2N7CA 3ULEA 3OYBA 3PFOA 3HILA 1Z6RA 5DB6A 3QRRA 1FDDA 3MCSA 1XMOF 2BACA 3V1RA 4OJGA 3I0RB 4F0KA 1FTRA 3EMTA 5E3AA 1AUDA 3HFKA 3AVJA 4DTMA 4UBCA 1VQ4N 3ISDA 3HZEA 5HRPA 3TW0A 2LMRA 4PHDA 5EWFA 2KE7A 1PAEX 1RT3A 5E3PA 3D28A 3QGIA 1URJA 2B51A 5B0GA 4JKBA 3RJKA 4BR5A 1F1BB 4KB1A 4ED4A 1IN0A 2E7WA 2KW4A 2OEKA 3HJEA 2KJVA 3IAYA 1BQXA 3KK1A 4FLXA 1BPEA 2U2FA 2HZCA 2EBGA 4YHHF 4I2HA 3DRPA 4LIWA 2UYTA 2LQ8A 2DNZA 2GELA 4MF8A 4F93B 1RT2A 2AJ1A 1AQ6A 1KOOA 1R8HA 4EZ6A 2CPFA 5E26A 2XCAA 4H5NA 4RT3A 2E20A 1L3UA 1TFYA 4IBNA 3PFEA 2BPGA 2B4VA 1S4FA 2MTLA 5AM1A 1T6CA 2K7JA 5EVZA 3MFHA 2UVUA 4RTFD 4CFBA 4XO0A 1TK0A 4B9SA 2NRZA 2R7SA 3I82A 2X1AA 4CWBA 3W64A 1PKUA 3WKBA 1M5SA 2O3DA 9ATCB 3MCOA 1KEKA 1V38A 3MCAB 3L2VA 4BC7A 2E5SA 2RH3A 3ZSXA 3IWLA 5B0FA 4RQ6A 1I5OB 5CCLA 4OV6A 4I2PB 3HZ6A 3H5XA 2HLTA 4PWUA 2C3PA 4QYZK 1G7CB 2V8VA 1KVCA 4WFXA 1H73A 1WELA 2OPRA 1HNWJ 4GVBA 4PY5A 4LF8J 3N5FA 2E5LJ 2W9CA 1NJYA 2Q2RA 2YH0A 2QLBB 3CF5L 2WTUA 1IJFB 1WSRA 3H8SA 3HSDA 4ICLB 4BR2A 5J0OA 1IXKA 4BC3A 2MU2A 1B0XA 4NRUA 3NHGA 3S6JA 3QUCA 2JWLA 4WJBA 3UE5A 1SL1A 4O3MA 4Y2AA 2Y0BB 1JCEA 1S12A 2YMQA 3OSPA 2B3TB 3NVWA 4DV2F 2P66A 4DV0J 1RT7A 4CFDA 4AXIA 3T1HJ 5AI5A 5KL8B 2P9NA 2OM6A 1HNXF 3DLGA 4NLWA 1BD6A 2F65A 5GAEU 5AKLA 3QU2A 4Z0UA 3SJHA 4G6VB 1IUJA 4HDHA 3BS5A 2Y1LB 3V9SA 3WZ0A 1A0PA 1OYEA 1JB0C 2WB1D 2PAVA 5G5HA 2XMMA 4I2EA 3MCNA 1X5TA 1W97L 3O9UA 1NHUA 4MKVA 1MWQA 5H1SQ 2CQBA 2AX0A 3HHLB 1PK1A 1ZM3A 1PYTA 1KTQA 3LDLA 2D0BA 5ALRA 4FL9A 1RGVA 4OYZA 1XUPO 4TU9A 1M90O 3HSGA 2LI6A 2ZFHA 3KK1B 1JXEA 1VBXA 3HHLD 2RHKA 2NRVA 2YNIB 5AKXA 2N82B 4PEOA 1P9QC 1WOQA 2HVHA 1OH6A 4KLLA 1YUWA 2YB1A 1YJNS 4JLHA 3BQ7A 3WK9A 1T9WA 1RWPB 2B6AA 2GEMA 1OJ4A 1YX2A 4RW9A 3ORYA 2EWHA 1HD0A 1UJ4A 1SBRA 3FUYA 4FKYA 1FK9B 2NS1B 3MK6A 2NRHA 2E1AA 3VF4A 4A5BA 3UD5A 2XMJA 2VV5A 3ZSZA 1BCOA 5CZ2A 4CGDA 4TQRA 3UNYA 4DV4K 3W60A 1IKWA 1EETB 5I3UA 3VESA 2Q0UA 3FZMA 3C14A 2F5GA 3AO2A 4WQ5C 9ICTA 3QIOA 1JLBB 1V3ZA 4LIRA 3NMAA 4M3UA 4K4IA 4B3TK 3PHTA 3RJMB 2UV8A 5T14A 2JR5A 7FDRA 1EKEA 1N36F 3IUCA 3L7OA 3KJQB 1HKAA 3D2SA 1RWKB 4DCPB 3A8JA 2NZ4A 1N34J 1UAXA 2XRIA 3P31A 1Y9OA 1BCMA 2OELA 2JHDA 4OCZA 2K3IA 2W43A 4ILRA 5EX3A 1U1LA 2FC8A 2BEFA 3Q89A 3WNGA 3EVOA 5KG7A 2PEBA 5GMEA 4ZJLA 1VQ7S 9ICHA 1TUWA 1FXXA 5G0RA 1HLWA 1XR5A 3KXDA 2I1QA 2W4CA 4I6WA 1A76A 1UQVA 3WK6A 4B02A 2CQ4A 2MKYA 3ILLA 4LF5F 2E9ZA 3IBFB 3P4IA 1RQ0A 2ZH3A 4F26A 5J0QA 4M04A 3Q7CA 1PVRA 4Y2YA 1PGZA 5THWA 1C2PA 1YTAA 4E3SA 1A5XA 4L74A 5HBMB 2WUSA 4KFBB 5BOLA 2NSBA 4DV6K 2ZH2A 4ANDA 4W4MA 4U7BA 4KHPF 3EXYA 3SBGA 3R97A 1C1CB 4EUVA 4C11B 5K8PA 3T5KA 2Z4PA 1NK7A 2D0OA 3AVMA 4A57A 4RUBA 2VONA 3BS7A 2C2DA 1DARA 3Q8MA 1RZTA 4EK2A 5L39A 3NGIA 2XZDB 3ETOA 1RBOB 1RK8A 3V6DB 4S0MA 4DPWA 3IBCB 1T6DA 1WEYA 2W4DA 4BC5A 5FP0A 4PKGA 3VCBA 2B5JA 2DQNB 2FVSA 1N8RO 1PSDA 3KHGA 4CLKA 1H7XA 2AYMA 5LY3A 3KD1E 2F4FA 1VQPN 1UEKA 2RPIA 3GIRA 2UU9K 3VERA 4HHTA 1XC3A 3OTEA 4JI3J 1T0TV 5K14A 5KL1B 4CO1A 3LDNA 5AFUA 1VC6A 1OH5A 4M5JA 7ICIA 1KVIA 3AODA 1X6IA 1WI8A 3PKYA 1YJVA 2XWXA 4O3SA 4QR2A 3OHRA 4NEZA 3UKUB 1RAEB 4O3RA 2VA3A 2F44A 4YOUA 1TKTA 4CJVA 3SMPA 1U4BA 3HD2A 1AW0A 1UW4A 4ZVPB 5IS2A 2QG9B 2RDDA 4GW6A 2KTQA 3OYNA 4LF4K 5RUBA 1LW0B 2XNRA 5H2FU 3TR5A 4CO3A 4IO8A 4WCEL 2GIQA 1H7WA 1S0OA 3GJTB 4JK1A 2HHHK 2MUTB 5A0LA 5J2JA 3RGIA 1WAFA 2L9WA 3SI8A 2FXUA 3O1BA 1WC0A 2R2TA 4LF5K 1LXNA 2HURA 4A5AA 4AL6A 1RDUA 3G8QA 3VQPA 4CEZA 1X31C 1X40A 2DTJA 2KYXA 3D68A 3O1LA 4LF5J 1IQZA 3A8YA 1HNZK 1LV5A 4DL0C 4KLEA 2VQEJ 1M1HA 1WKJA 3CJ4A 2A3VA 3AOAA 5DDRC 3MMVA 3MMCB 1ZYQA 3L6QA 3ZTOA 2NUHA 2PT0A 4ZLPA 1TV9A 3WK8A 4O4RA 2V4JA 4CJ4A 2A1BA 4H0VB 3L9ZA 2ABYA 5F8GA 3IAS9 2CZVC 3CCRS 5A8KB 3KLFA 1ZD5A 3JSYA 4RW6A 3W63A 1FK9A 5IT9Y 1X6JA 2E5LF 4Y2XA 1FIQA 2X1BA 3HF5A 3OSNA 2BE7D 4C3MA 4A8FA 3BKUA 1C1BA 2OD4A 3UCGA 5ALGA 1LK7A 1RAGB 1QVGM 1S1XB 1HKBA 1NMNA 5ALLA 1VQ6N 2GFFA 3MECB 4WKYA 4N77A 1N5QA 5BR8J 3GG4A 1ZXOA 1W2BR 5FPEA 1MROB 3UKRA 2YB4A 3SI6A 2CZ9A 2DFFA 3HXMA 3VQ6A 3NS5A 4WZQA 5F3ZA 3EGWB 9ICUA 2WVDA 2BDUA 4TSXA 4QIVA 4LF2A 2QM1A 2V2ZA 3LO3A 4Q0BB 3F9MA 5AE2A 3W1YC 4DV7K 3N5BA 2VG5A 4F02A 4QJVA 2GBZA 3CJ1A 1RABB 3AOCA 5AQOA 5JVGL 4KH6A 4URQU 1AT1B 1RU1A 4FLTA 4JYAK 5AM5A 1O0PA 2V4RA 5J0UA 2J6TA 3FVYA 4PG5A 3JQJA 3RAMA 3FDSA 1FA0A 2P9NB 4DR1K 4XTTA 2EZYA 1FJGJ 4V19J 4DG1A 4C1NK 3PHEA 3WEEA 3QNOA 3OW2R 3VR1A 4C7QA 3C6AA 1DRGA 1KC8T 2HVDA 3PG9A 2PFDA 3KZXA 2Q0ZX 3EZ5A 3C21A 5DM7Q 5ALYA 5EY4A 4DCOB 1BNOA 2LKZA 2KVIA 5J0XA 3X1LB 3KKSA 4C7YA 2HVIA 3KBBA 4CESA 3V9XA 3TAFA 2NV3A 2AEMA 4OHXA 4PYAA 1RBSA 2P5VA 1V4SA 4I2PA 1RCXB 1V9OA 3OYKA 1CLQA 1A6SA 2CJQA 1ZAWA 4N8NA 4P4MA 4WTYA 1SIZA 2W2PP 4ILJA 3AHPA 5AI0A 2I0XA 4IQWA 1EQYA 1TUYA 4FWNA 3G4SN 3QRQA 4U7CA 2K7KA 4AHRA 3IM9A 4OJ3A 4U8YA 5J1EB 5EUHA 2HRUA 2VHGA 2ZVIA 5AK6A 2GGPA 4J7CA 1FJ7A 1VSEA 1K1QA 3IFEA 3LP3A 1WWVA 2ZH5A 2ASYA 2ZC4A 4LSNB 4XQ8A 1NRKA 1VI7A 4WE1A 2ZJPQ 2QA4G 5C15A 2IJRA 4RPFA 4ILMA 1J2VA 3H0LB 4DN0A 1U6FA 2V5HG 3KKFA 4FXDA 1ASVA 2X51A 1T95A 1S0NA 2OYYA 2YNIA 4K4VA 3ZETB 3O6QA 1ZQCA 2G06A 3MEEA 2OLWA 4R25A 2IDOA 2IYGA 4X64F 3ZTQA 4Y65A 2RUGA 4BRLA 4X4QA 4FOEA 1S5ZA 4LRDA 3ZX2A 5L8RC 4P0PB 1CSJA 2QL9B 4JK9A 1O8BA 1RAFB 4WU2A 1U1PA 4DR7F 3HPOA 3VAJA 2O8FA 1JLQA 1SJRA 1VQON 4ZN3A 3NH1A 4JI5F 3V6HA 1HIWA 4AD6A 2LA6A 4DV6F 1HBMA 3IGVA 4LSLA 4CZHA 4RW7A 1JJ2R 2HEKA 2RUSA 3UW1A 2I9SA 3A12A 2HFZA 5ELZA 5FLXY 2ZHOA 2WRMA 4NOHA 3H90A 4OX7A 3MCPA 3F9KA 1WHVA 3NKYA 2DFLA 3D0GE 2LDYA 2FJAB 3SFUA 4U67Q 3BF1A 5KFHA 3BGOP 4I2QA 4WFBQ 3A0BU 3N7SC 1OVQA 1DXSA 5MLCV 2F4VK 9ICJA 3AXKA 2DHHA 2KRBA 3C6HA 3I9ZA 3C28A 3HM8A 4R65A 1JCFA 3FZFA 1HNIB 3DXBA 2EKNA 3RYLA 3SCXA 4B9MA 2SXLA 4J2BA 1VYAA 2MZQA 4H54A 2KHOA 3LDQA 4IG0A 1W26A 1YTYA 2EVZA 2V6AA 2ZJ5A 2E8AA 3MM9A 5A8WB 2HOFA 1FX4A 5DM6Q 2UUTA 4KI4A 3C6UA 5KPRA 3FBBA 2CGKA 4IYQA 5DM7L 3M8PB 1R0CB 5FJ4A 1ZOTA 4UAWA 3TSPA 3RMBA 3ID8A 4NLBA 1W2IA 4P2SA 2KXNB 3RBXA 2PMZC 4JEPA 2A40A 5BPMA 1NJXA 2K89A 2L41A 1N5YB 5G5GA 3CJBA 1OKJA 1FDAA 3NGTA 4TLRA 5KFRA 5JXSA 1H2UX 4AQYF 5D4PA 2KQ2A 4AT1B 4KX3A 3P5BP 4DLGA 3FCHA 1R0AB 1VIXA 1TU0B 5KT4A 3NVYA 2KEYA 1RT2B 4CHYA 5HLFB 4ECUA 2YWHA 3QEBZ 2DH8A 2OEJA 1JLAB 1UPMB 4X4SA 3JB9k 4LZDA 5I9EB 2KVCA 5FRMA 2HMIA 1DBDA 1CJUB 3QXGA 2BQRA 1UP1A 3AVCA 7ICVA 2NR0A 1D8LA 2ZIXB 3H7IA 3IP0A 3PYEA 5ETQA 1Z2LA 3PIPL 4OI0A 2ZG6A 1J2NA 1IQTA 2EWSA 1DQAA 4X66K 3AD9C 7ICHA 2F1IA 2RSQA 4O8KA 4L8RB 2H5XA 1HX1A 4BWMA 4ITSA 4DR5F 1WHYA 2GVZA 5AQXA 4JI2K 9ICRA 2CQDA 2MA1A 3OYCA 3PYGA 2J0WA 3M1VA 4LVSA 2BABA 3CO0P 5KFIA 1FRXA 3KZIU 3TPQA 2P9SB 1RTIA 4ES3A 1V97A 3I0RA 1WG8A 2HIQA 2X1FA 3SMSA 2N4DA 2AWZA 2AJFE 2FIUA 4DV5K 4RQ0A 3AVAA 4CZGA 5AFUH 2FHJD 4US9A 2VJUA 1FRIA 1KCFA 2P8IA 1SKUB 4M5KA 4UZCA 2ASLA 2IVPA 2ZBRA 3PRBA 2L5YA 2ASDA 5KAKA 1VK8A 1N48A 3TJAA 1RBRA 3CQXA 7ICFA 4N76A 1V5VA 1C0UA 1FEEA 5CP2A 3WXJA 2N4CA 2KHQA 3CRXA 2OKQA 3CCEN 3TEHB 1N5XA 1LWFB 1UVKA 4RQ2A 3PNIA 4KLIA 2UUCJ 1WEXA 1T3QA 3P38A 3S8SA 2HZAA 1S4EA 5CH7B 1IBKJ 2DBBA 1C20A 2D0PA 4IH6A 2VPZB 5C2FA 4DSFA 3R9LA 2KH9A 1NJIT 3DOKA 2OAUA 2GQQA 2MHNA 4G1IA 2DHAA 2K3KA 2IHMA 5SUHA 4IOXA 3DDNA 3M6XA 4Z4EA 5H1SV 4WKRA 3QATA 1HJPA 2DUYA 2ISPA 2A1RA 5EN1A 4FWOA 3KHLA 1GLCG 4YS2A 5GAEP 4F3OA 3EYZA 3SYZA 3ILOA 2IFXA 3C46A 1S72S 3C14B 2DNYA 1M90T 1S6UA 3KLHA 2AV5A 2ZWHA 4FS2A 4M5DA 5C42A 2F8SA 3GDXA 4R66A 4OV1A 3NASA 4PGYA 4LQ3A 3BZCA 2LLZA 5A8RB 4LFAK 1X5SA 3UMGA 4TYAA 3CCES 3GILA 1VQOS 4L3KA 2RVJA 1ZQNA 4XIUA 2PSZA 1S48A 1NH7A 1D09B 1LKYA 1JRPA 5HR6A 5CRXA 4OLOA 3M6KA 5KT3A 1S1UA 3NF8A 1HIYA 1B64A 4EZ9A 4F0HA 2XHBA 1BC6A 3VQ9A 4KB0A 4IUFA 4BRGA 4QWDA 4UY85 4G9BA 2ROEA 3QT7A 3MMCA 4DU4A 2ZJRQ 4NZ0A 1LCUA 2JLEA 2W6LA 1NHKL 3CCUN 3O1WA 1Q86O 3M8ZA 5B08A 3T5JA 1WC3A 1KBRA 1JKHB 1VRQC 3HFZB 2CQ0A 3LP2B 2DGSA 4NJ8A 1VHIA 3QMQA 1UPPA 4ECQA 1R31A 4WFYA 4ZVGA 3HSJA 4X4RA 3LGMA 4J9VA 3JXOA 2EAOA 4DV1F 2P9UB 4DL5A 4LH5A 3RBDA 5D46A 5CJ7A 3WIUA 3F73A 4NLQA 2CADA 1OYDA 1ZXIA 5AJ3J 2PGCA 3GR1A 3FEZA 3L2QA 3PW5A 4KLHA 1HPZA 1SC6A 2BXJA 4Q8FA 3BGRB 2H3ZA 2YQ3A 1RAOA 4DPYA 3MR7A 2HWTA 4BRQA 4Y2CA 1DRZA 1CC8A 1VRTB 4B6JA 4ECTA 3CCTA 3TUJC 3OL6A 1NZBA 4XEIA 2W2MP 3BEGB 3HM9A 1B0TA 2D4WA 2H5IB 2BH1A 1T11A 2GO9A 4CZIA 3ZX0A 2KSOA 4HWIA 2ZE2B 4AXJA 1NB7A 2HAFA 4CJEA 2A41A 2FJ6A 5KOWA 3TJ8A 3F2DA 2HDOA 2V50A 1K8AT 1SVDA 3OVAA 3Q8VA 4OYXA 4ED6A 3ZT1A 2BE2A 2KG1A 9ICKA 1YHQS 3BREA 4JBCA 4CJRA 5DRKA 4WF9L 4FBUA 2XHCA 5L9XA 4IG3A 4IR9A 2GX8A 8ICEA 2BV3A 2YWEA 2P9UA 3OPXA 3EWAA 2IM2A 4QIFA 4IKFA 5J2BA 3DRSA 4DUZK 1BDGA 3N4WA 5LJ5Y 2PFPA 4ELUA 2YBVA 3LP2A 5CHGA 2LCWA 1Z00B 2ZOFA 3VQ7A 5L38A 3C2MA 1L6NA 2EHGA 2D0CA 2DO0A 3DLLQ 2R7XA 3I0SB 1T9TA 2UXBF 2IYIA 4X62K 2VJVA 2B9XA 1OPIA 4IRCA 5HAOA 4I6YA 3EX7B 5DQGA 2YNHA 2O66A 2RKIB 1SIWB 2PEHA 1JLEA 1U6BA 8ICPA 3GFKB 2CA9A 2HCFA 4K8RA 3PR5B 1VLOA 1N5YA 2UUCF 3CD5A 4B3RK 5HBMA 4UB2A 2RMLA 4OYMA 4YB6A 3AO4A 1VQMN 3R27A 4ID5A 4KO0B 3F5TA 1RAHB 4EYIB 3BQTA 3MAAA 3KK2A 3CUNA 1ZQJA 2I5JB 2XLJA 5D3GB 4ED2A 1BI4B 1Q8IA 2W41A 1L3SA 3GJSB 2DRBA 5HMXA 4CJWA 2ZH6A 1WDDA 1YJTA 4HTLA 4BRIA 2QIFA 1Y88A 2DL0A 2EFQA 3OD2A 3FZLA 4KREA 3MM5A 3CM6A 3OL9A 3F41A 5J2FA 2W7OA 1HA1A 4ZPVR 2HBZB 3CJCA 2HHSA 3T9ZA 4X4VA 4CZJA 2EFOA 2V2QA 1Y3JA 3EE8A 4FJ7A 3RG6A 1WCNA 1VS3A 3TX0A 3AUOA 3TOQA 4QU7A 3A3OB 3QX7A 3ISND 3NG8A 2Q79A 3O0FA 1VQ9N 2RNEA 1VJQA 3NNAA 1SGGA 4OKJA 1RHJB 4DUZJ 4Z7CA 3U8XA 4U67L 2G8HA 5J0YA 1IG9A 1U47A 2HRTA 2OPPA 2VDHA 3NOGA 3THVA 3MM8B 4ZIWA 2AP1A 4YOTA 3SUNA 2H54B 2H4YB 2YQEA 3QBWA 5F3XB 4GXKA 2O8DB 2MZTA 2Q0RA 1S9GA 4H4OA 4JK7A 3UD3P 4JAXA 2Z1JA 3EN9A 3ENVA 5FD1A 3AA5X 4HACA 4IDHA 3JPOA 1FO1A 1GX5A 3WXLA 4NA3A 3GOIA 4DV0F 1LOUA 1XHXA 1RWOB 3UXPA 2OPRB 1WKKA 3LPUA 3NGSA 3C16B 2E1ZA 4Y2IA 9ICGA 4F92B 4NLCA 4BVOA 4H0TB 2VFSA 1N56A 4C8ZA 3B8HA 2LXIA 3CB4A 2HNDA 3OVNA 3UDLA 3DV9A 4KLFA 3I33A 2XCPA 2HMIB 4KGXB 4WJ3B 2K4IA 1GLJO 5C2CA 3DXKB 3A5NC 1P7DA 1X8DA 4Y28C 2DNOA 2F1JA 5JJBA 3UNGC 2GC8A 3I6PA 1I1GA 2Q66A 4QS7A 3BSCA 2LYHA 1C0GA 2ZIUB 3TYTA 3HK2A 5KFMA 8ICTA 3CJ2A 5JTIA 3O4WA 4BJQA 4B3OB 1NK4A 2DGOA 4PL1A 4O4GA 3IC1A 4C8YA 3CJRA 2LXFA 1QQNA 2VFUA 2BM1A 5CY4A 1Y4ZB 2FDRA 3HP6A 4PWDA 3TU5A 2G8KA 4ZITA 5HI7A 4UB5A 3H5YA 1KFSA 3TADC 3CQYA 2QI2A 1UZHA 2VBZA 1F0MA 5CE3A 4ER8A 1M5KC 4CK3A 4OJ6A 4F72A 4CF8A 2MDAA 2MPUA 4N5SA 4KHWA 2HPUA 2HNZB 3OTCA 3CG7A 2QARB 1RM6C 3O9TA 2O1PA 3CTRA 3SQ1A 3NBPA 4QW9A 4Y2SA 8ICMA 2WAQD 1KVJA 4DUTA 1XNQF 2WHOA 3AJ2A 4LF9J 3TI0A 2HGMA 5CD4H 4X4NA 1BL3A 3VGKA 1ZQFA 4KHUA 2JH1A 1ZQYA 1UMJA 1KVAA 2BMBA 1LW2B 1RU2A 4KN7A 4DTJA 2MQQA 3M6UA 4W98A 5B0EA 5KFVA 3DHXA 1L7NA 5KG4A 3I5CA 4I4BA 3BB5A 4J9RA 2QN6B 2YKNA 2RT3A 3I5AA 2BKNA 1T03B 2RDJA 3OL7A 3KK7A 1VQ5S 4FJ8A 3V6KA 4X5VA 1UKUA 3SV3A 5J2MA 3ZTSA 5KFTA 5KT7A 2ZC3A 4UQTA 4RPZA 5IIMA 5ALKA 3A4TA 3TJ9A 3KOAA 2W55A 1B9FA 3EO3A 4F25A 1S97A 1KS2A 4DSJA 4CIOA 3M9MB 1DKGD 4P2FA 3ZZUA 2QYCA 1QHAA 1H74A 2E2OA 2JJ4D 2V68A 1FRHA 2VFRA 4NXNK 4Y2TA 1N0VC 1JLCB 4ES2A 2LM4A 3L8BA 1XHZA 2RF2A 5J2PA 3TUPA 2MJNA 1IG6A 2W42A 3FFKB 4M63A 4JKFA 1FFWB 2Z0GA 3JTOA 3MM5B 4BR7A 4YEAA 3HLUA 4PPZA 3UFCX 2ZBIA 2A19A 3G82B 1BPBA 3EKSA 2FMPA 3H20A 1X4FA 2AP6A 2FSKA 4FVMA 2MKSA 4YB7A 3K5LA 3KHHA 3G10A 2HQFA 5FROA 4FWLA 2KVSA 4GLXA 2FY8A 4KO0A 4MO5A 2AU0A 5IV3A 4M42A 1FFGB 5KPTA 1DQ9A 1WC4A 1B7FA 5B0DA 1WF0A 1FESA 3P96A 2V51B 1N32K 4YDUA 5J1EA 2CQIA 4WFNL 2HHXA 3K89A 1OMSA 1JLCA 4OJLA 2Z7JA 2X6SA 4LF1A 4FYYB 1UJ6A 3T1YF 5DBBA 2PXIA 3RB0A 2YWGA 4OFZA 2W7PA 2VODA 3ZEUA 1NGJA 2QEXN 4ECWA 4BS2A 1OO0B 3PSFA 4XPCA 1B43A 3DRSB 4AF1A 9ICAA 2GO8A 2V9KA 4H4KA 2XGQA 3SDEA 2JFKA 1GO3F 3MWBA 2VPXB 1NJIO 4E1MA 4PL2A 4IG3B 1L7MA 3H98A 3OTDA 3IKMA 4YMMA 1WG4A 2BE2B 2KI2A 3THWA 5AI8A 2P35A 4A8WA 4FJKA 4IFYA 5L1JA 4OJPA 1TVRB 4X64J 5KG5A 3ZDCA 2HKEA 2D9OA 1IV0A 3GZFA 2VC0A 2ATCB 1UEUA 2WOMB 1RUSA 1IBLJ 1F3FA 2J76E 3DAWA 3S1TA 4JKAA 2GUPA 4CECA 1S6PA 3N7PD 2W2QP 2AF6A 3MMBA 3OXLA 3R7NB 1R8BA 4LF9F 5AI9A 4JI2F 4DR5K 4YHHJ 4FZNA 4QYZJ 1QCKA 1J5EK 3BBFA 8ICYA 4MYTA 2K4PA 4KLSA 3MEDA 2YHWA 4DQIA 1BISA 4HAIA 4M3ZA 4RWTA 1ATSA 4TXSA 1BIZA 3EZUA 4P0QA 4QIWC 4RKUC 1Q3UA 3UMBA 4C98A 3QINA 4FZMA 1XTZA 1NKCA 3H1QA 5AZJA 3W9IA 3A0IX 4CLUA 3PCOB 1RG6A 4ZVHA 1VQ7N 5KOXA 4WQ4C 5C2DA 2QA2A 2I2YA 2RQKA 3JTNA 4J9OA 1XJWB 4DCJB 5AIBA 1U7LA 3L4QA 2G09A 3MECA 2MY7A 2H3FA 4NXMK 7FD1A 2HHTA 3NFAA 3UB5A 4J37A 4RUHA 4CE6A 1T05A 3I32A 3MXJA 5EWEA 2A2DA 2YMMA 3LDOA 1NGAA 3L3FX 3IXQA 5DQHA 3T1YJ 1YHQN 3OS0A 2PFFB 3LVWA 2WK4A 1WBDA 1X4AA 3I55S 3D3CJ 2J4RA 3G6YA 3S41A 1PILA 4IXCA 4W5QA 1RBTA 4NV0A 4ZKAA 5IIKA 5L1MA 1CPZA 2AKWB 1L7PA 4JOUA 4FNIA 4A8EA 4B3RF 1SIJA 2D74B 1ZM2A 5KFUA 3CMAS 5AJ3K 4WIIA 5IM0B 2VA2A 2JSXA 3VWSA 4CF0A 2DPIA 2YX7A 4Y00A 1NK0A 1SJ3P 2BUNA 2PYJA 4FDFA 3UXNA 2G9OA 4YQWA 4FJXA 2HYIB 4OVLA 2ZH8A 2RU3A 1N5WA 3TEGA 3THYB 3QEXA 1YJ9N 4DPXA 3QWPA 2GO7A 1X0PA 1GLFO 3OLBA 2EC0A 1HEKA 4USVA 3A3PB 4F5RA 4EBEA 1FKPA 3OJSA 3O6WA 4G65A 4PWWA 4UATA 4KKOB 3EGZA 4B9NA 1XMOK 3FLCO 3Q24A 1LW0A 4WQ4A 1JNRB 4USJC 4NLSA 4J9PA 4UB1A 4JI2J 3BV8A 1J54A 1D8YA 1XI1A 3BH6B 4L6V3 3AA9A 1KLNA 1VFJA 1C0TA 5GADP 1REVB 4OMFG 2Y0SD 2MEWA 4FWRA 2UVRA 3IRWP 3VZIA 1R43A 1IBLF 1RQNA 2XBPA 4TN2A 3M6VA 3ZDEA 1K47A 4UB6U 1HKCA 2CNKB 4XUSA 1Q81T 2NQPA 3O4QA 8ICNA 3QLHA 3HWTA 4PKIA 2PMHA 2BJEA 3MI7X 2IC3B 4EBDA 3MEKA 4LFCF 4DX5A 5HJYA 3VAMA 1J27A 1ZQPA 3IRUA 3THXA 2FBYA 4BE2A 4RX6A 4PHTX 4DF4A 5ETTA 3OYJA 2HW3A 2XWYA 4EHTA 2VKQA 3NWRA 4F4AA 1TFWA 2V69A 1COKA 4OHZA 1YQHA 2YQ1A 4RJVA 4K0KK 3A3NB 4ZHRA 4MDAA 2KO1A 3J7ZO 2BVZA 1NHVA 3KLVA 4NLZA 1GMVA 4J91A 3VZHA 3AD8C 1K0VA 2AJQA 3BGFA 1ZPWX 2HIYA 3QEAZ 4OYPA 4O44B 4PZNA 2J6UA 4K5RA 3F5AA 2B21A 1YVFA 4UTGA 1YBTA 4ED1A 4BDYA 1NWKA 3THXB 3A5LC 2YVSA 3NAEA 3V7JA 2OYQA 1N54B 2E1CA 4ANEA 1V5IB 3CC4N 3AA4A 5AIAA 4R5PA 1HQUA 4CW7B 3SCJE 5ADXA 2HNYB 2D5RA 2KKVA 2ZUDA 3GFYA 2RAQA 5AQJA 3JPTA 2QC3A 3TSUA 4EYHB 1W0HA 2JL9A 4EP5A 2YKOA 4O3QA 3N4QA 1PUZA 3T5LA 3GPAA 3NY0A 3JPSA 2JEGA 3QO9A 1XMQJ 1QUPA 4LBIA 4M63C 1J97A 4FPIA 3THTA 1DEJA 4OGEA 3MWPA 3CDAA 3DNCA 5GAGP 1S1WA 4DR6F 1RGIA 5IT9O 4CZKA 3QFPA 3KKAC 1AROP 4NA2A 3W8GA 4YR2A 5B7WA 3RH6A 1Y00A 1UTAA 4WBFA 3N0VA 4DTXA 4RW8A 2R7YA 4URGA 2FF6A 1NLVA 2A3ZA 4AHCA 1IWAA 1FJGF 3R5DA 4Y0FA 2A0FB 2OFGX 3AAWB 4FJIA 2D6FC 1RACB 2CNOB 3H25A 3I87A 4F91B 3AM9A 4FF4A 5DGBA 2EDUA 2G0JA 3G6XA 1YSJA 1YGYA 2P51A 2GIRA 3LP0B 1FF2A 3I76A 3MD3A 4MMOA 5I3QA 4K41A 1WSVA 3MTKA 2BANA 5E5NA 3CNHA 2BCVA 5FRNA 9ICEA 1JL2A 3TAGA 4ACOA 4BCAA 4I2AA 3MOZA 3KK3B 1TMJA 4RPYA 1NUEA 4WYLA 4DFKA 1UVJA 1IO2A 1D9FA 2NYHA 1RWVB 3C0BA 4A59A 4CNZA 1Y5NB 4CEOA 1GH8A 1B4FA 1ZD2P 1U2RA 3TNVA 3H59A 2W9BB 3UPFA 1HMVA 4G9ZA 1ROFA 5BYSA 2YQ0A 3KG4A 2K60A 5M2PA 1OY6A 1QAJA 4QU6A 3SENA 4DV2J 1P8ZA 2QA1A 3C2KA 1V4TA 5JVHQ 3QIPA 2DGUA 3CC4S 2ROGA 1NXIA 3EM1A 4RBUA 5AKYA 5AT1B 4GV9A 4KHPJ 5HQLA 4FXWA 2JGAA 3WK4A 5KFJA 3RU0A 4KAIA 9ICFA 3D9BA 3IWXA 2QWQA 3WKDA 1HBUB 4B1WB 2FLNA 4CEQA 1NDKA 3W2WB 4NO7A 1OSDA 8ICGA 3G87A 4F50A 1UCVA 3CEDA 4BRFA 3FC4A 1O51A 4ZP9A 4GVMA 3RJGA 3M7VA 1FW6A 1QD1A 4K25A 3N97B 3CC7N 4C8MA 5HVFA 2HQGA 4LFAF 4F5NA 4HHJA 1S1VB 5KQDA 4I1TA 1DLOA 3C94A 2QTDA 3ILIA 1XMBA 3MDFA 3K9KA 1FJGK 2CPJA 2ZGZA 3QUQA 3FSXA 1MA9B 3SQIA 1ZQSA 3GSDA 6AT1B 4A4JA 4ZPAA 2DXEA 3E9OA 4DR1J 1SC1B 4E7IA 5IWAF 4JI1J 4ZN1A 2DGTA 2KHCA 5CABA 1N32J 4J9NA 3PX4A 1TP7A 2JLFA 4QPXA 2LA4A 3FRYA 1FXRA 4JS5A 4FYVB 1X3MA 3NH0A 2KLAA 1DZ5A 1HNIA 1VQNS 1PVPA 2W3RA 3H7HB 3HULA 3J7YP 2ADCA 5M2RA 2BA9A 5EU7A 3WX4A 1O13A 1RDBA 1NOZA 3IGNA 4WTOB 4HACB 3WQUA 2ZKTA 3GR0A 1JNZB 4I2QB 1QZ6A 2YJEA 3SQ2A 2PA8D 2EZZA 1S9EB 2Y8YA 1NMDA 2EQYA 2VANA 3OY9A 5ADXH 5AKJA 2WB1C 3BEXA 3B6OA 5BN8A 4QZVB 1O03A 4I2GA 1AA1B 2RRBA 2EEYA 1KQSM 1XMQF 5EOYA 1VMBA 4O5EA 2IM0A 1S22A 2BPFA 1MU2A 1FRMA 5IT4A 2VPYB 1TKXA 1RT6B 3UD4P 3FEXB 1FHTA 1ZBHA 4C4WA 1KVKA 4PQUB 2WBNA 4BREA 4CT8A 4A62A 3O44A 2OH2A 2JRSA 5DB8A 2QKKA 3DLHA 3L4BC 1NAQA 1RT4B 1EHWA 1NDCA 1HBUA 3Q8QB 1Q7LB 2GQ2A 4EAHD 5AK5A 1Q95G 1UWAA 1SB3C 4TQSA 5FPDA 2G1DA 2VQFK 1FJEB 3BUZB 3H5SA 4YD2A 4DR1F 4E7HA 2ODGA 2XICA 3MR3A 1LWCB 3NCPA 2ZJ8A 3G8TA 8ATCB 4DB3A 4CZCA 3D2FA 3IG8A 5GVQA 4QCLA 9ICSA 5GAGU 2DKZA 4MLHA 1DURA 4KLJA 1APSA 4HYKA 3E01B 1M5PC 1KC8O 3CPWM 4YDDB 3DM2A 4LR8A 4AE5A 1BQMB 1HW8A 3P3DA 4JB3A 3BQ2A 4C3KA 2WBMA 3T5HA 2F8MA 1I39A 3KDOA 4C0BA 3WNHA 1D4XA