4B9WA

Structure of extended tudor domain td3 from mouse tdrd1 in complex with mili peptide containing dimethylarginine 45.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
196
structure length
196
Chain Sequence
b'LEWTWVEFTVDETVDVVVCMMYSPGEFYCHFLKDDALEKLDDLNQSLADYCAQKPPNGFKAEIGRPCCAFFSGDGNWYRALVKEILPSGNVKVHFVDYGNVEEVTTDQLQAILPQFLLLPFQGMQCWLVDIQPPNKHWTKEATARFQACVVGLKLQARVVEITANGVGVELTDLSTPYPKIISDVLIREQLVLRCG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TUDOR DOMAIN-CONTAINING PROTEIN 1
publication title The multiple Tudor domain-containing protein TDRD1 is a molecular scaffold for mouse Piwi proteins and piRNA biogenesis factors.
pubmed doi rcsb
source organism Mus musculus
molecule tags Replication
total genus 46
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00567 TUDOR Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4b9wA02
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4b9wA01
2PQWA 2EYLA 2F5KA 2M1HA 5C5LA 1EYAA 1SYEA 4KY5A 2F0EA 4K2LA 2RI5A 4E7IA 3TP7A 5CGKA 3QOJA 4B9XA 4HMJA 2GF7A 3RUZA 4QQ6A 4A4GA 4N4GA 1EY0A 4KD4A 2MWOA 2KHSA 2F0PA 4IALA 1N27A 5KH6A 1JOKA 5CV5A 3OYFA 2F0IA 4IZ8A 1TT2A 5I6WA 4FU6A 1EQVA 4K5XA 2R57A 2EYFA 5IN1A 5EKLA 2F0KA 1U9RA 2F0FA 3OYNA 3SR1A 4PLLA 2PYKA 4WORA 4K8JA 5FRMA 2EYJA 3PNWC 3H6ZA 3MEAA 4NMZA 4E7JA 3DMUA 5D6XA 3E9FA 2EY2A 5IOCA 3SK4A 3SXHA 4HMIA 3SK8A 3MEHA 3V2TA 2RKSA 4Z02A 4GY5A 4IKFA 5C6AA 2F0JA 3SHLA 5I9OA 5KEEA 2R58A 3OS0A 1SNPA 4PL6A 5IIFA 4K5VA 2EKOA 5KGUA 2M0OA 4NDXA 2RHYA 2PZWA 5DAUA 1F2ZA 3OMCA 2EYOA 3OYAA 3PFSA 4A4HA 4HTHA 1TQOA 4UC4A 1EZ6A 4OL7A 2LTOA 1STBA 2NLUA 3PMTA 1A3UA 2JZ2A 2DAQA 1AEXA 1TR5A 4ODGA 5C3WA 4K6DA 3GOXA 3C4SA 4DFAA 1EYCA 2F0QA 1EZ8A 2EQJA 2B8AA 4KD3A 3SK6A 4YIJA 5I9PA 4DF7A 2EQUA 2EXZA 2VYTA 5J1ZA 4E7HA 4OVAA 1NUCA 4NP5A 4IURA 3MVVA 1WJSA 3L2UA 5IAYA 2EFIA 4BE1A 2BKDN 4DU9A 2GFAA 1H3ZA 3TP5A 3MZ5A 3EROA 1EYDA 2M00A 5C6SA 3HZXA 4K5WA 2F0HA 5CV6A 2X35A 3CEYA 1JORA 5FROA 4B9WA 3S3OA 5JAVA 4TRDA 3H6MA 3SK5A 3S3MA 4N9PA 1F2MA 2PW5A 4C5GA 1F2YA 5CV8A 3NTIA 4IUQA 1NSNS 2RI3A 3SD4A 3MHBA 3TP8A 3KUFA 2L89A 4N4IA 2RJCA 2XK0A 2EY1A 3NTHA 4KJOA 1IHZA 1EY4A 5IGCA 3EVQA 1EY9A 4C5IA 1KABA 4BDZA 4E7KA 3OYLA 4F7XA 4QW2A 2F3WA 5NUCA 5CV9A 1A2TA 3OYGA 2G3RA 1WGSA 5HGTA 1SNOA 3DB4A 2RHIA 2EQKA 4KJNA 2F0NA 2O4XB 4BD3A 3OYHA 1JOQA 4LAAA 1OZ2A 2BUDA 2RBMA 4A4EA 2OXPA 4DGZA 2M16A 5KIXA 4KY7A 3D4DA 3QBYA 4ME5A 4IUNA 5IODA 3LX7A 2DIQA 5KE3A 4EVOA 3P8HA 3BDCA 3FC3A 2QQSA 2F0OA 1SNMA 1WJRA 4PLIA 3MEUA 4ZUIA 3LX0A 4NS5A 1KHCA 2K3YA 1STGA 2OF1A 2JTFA 4QF4A 2LCCA 1OZ3A 3META 3LGFA 3QJ6A 2EYHA 1ENCA 3ME9A 2CKKA 5CV7A 5KYLA 3TP6A 3FDRA 3HEJA 4Q5WA 2P0KA 4EQPA 3OQ5A 2RHXA 2F0MA 1RI0A 4RKBA 4C5HA 1SYGA 5IGEA 3T13A 2WACA 4EQNA 2FHDA 5KRUA 1OI1A 4J1MA 3PMFA 3OA6A 4BE2A 3NHHA 2D9TA 3DHQA 1SYBA 4R8NA 3E5SA 1WJQA 3M9QA 1KDBA 5IGGA 3C1FA 4KV6A 3OYEA 3PMIA 4QB4A 5IGFA 4HCZA 3P8DA 1II3A 1EY8A 5CV4A 4K2KA 5DEHA 2R5MA 2SNSA 3FEOA 3MP1A 1OYXA 5JOBA 5D6YA 4RKLA 5F2DA 2QQRA 2EYPA 5KCHA 3EJIA 2RJFA 1SYFA 2EQMA 3D4WA 4KY6A 5CC4A 3MEVA 3L2VA 2RDFA 5HURA 3OYBA 3DB3A 2EYMA 3UT1A 5D6WA 4MIUA 5IGDA 2OEOA 4X34A 2YRVA 4CRIA 2LRQA 5K5PA 5EKKA 4LD6A 4ZQ3A 1SNDA 2MWPA 2SNMA 5E3FA 3MP8A 3S3NA 3D6CA 2R5AA 4IUVA 1A3TA 5KE2A 5C4HA 3P1HA 1SSFA 3L42A 3DLMA 4KHVA 2F0SA 3QB3A 3ASKA 3VA5A 3LGLA 2LKVA 4BE0A 3OYKA 4N4HA 3OSOA 2F3VA 3R3OA 5KYIA 3TMEA 2F0GA 4II1A 2EY6A 3T16A 4L59A 4C5EA 2F0UA 1A3VA 3P75A 2PZTA 3BDLA 2ENBA 3Q1JA 1SNQA 4ZTFA 2GFUA 5E1FA 3LYIA 2LVMA 2RO0A 1KDAA 2F0VA 1A2UA 2E6NA 2RJDA 3QKJA 4G57A 1G5VA 3OY9A 4ID6A 3OYJA 3OYCA 2HQXA 3OWFA 2PQEA 3MEWA 2F0DA 2LDMA 3ZEHA 3MO8A 3E9GA 2PZUA 3MP6A 3LH0A 5EGTA 4PMBA 2EY5A 2F0TA 3F70A 3OMGA 4ZUJA 2L8DA 1KDCA 2E5QA 3ERQA 3H8ZA 5C4ZA 5I6YA 2PW7A 2NUCA 2K3XA 2X4XA 2SOBA 4BDYA 4I65A 3OB9A 1XNIA 2DIGA 5C5MA 1STHA 4K14A 3NQTA 4KTAA 4ZTJA 3NTKA 5M9OA 2KQ3A 5C3XA 2X4WA 4QMGA 5KCOA 4N9TA 1RKNA 3O8VA 4NKLA 3OYMA 4K8IA 4E7LA 1SYDA 5C0MA 2O4XA 4E6IA 4IUUA 3OS2A 3NXWA 2BIVA 3L2WA 3OS1A 2L3RA 2RJEA 1EY6A 4EQOA 4QQDA 1EY7A 4PNYA 1ENAA 2F0WA 4RG2A 1STNA 3MXPA 3FLGA 4J6HA 4F8MA 2RHZA 5FRNA 1JOOA 2F0LA 4QQGA 3D8GA 2HQEA 3U9OA 3QIIA 3EAEA 2RHUA 1SNCA 5CR3A 3S9WA 5J39A 3OYDA 5ISRA 1SYCA 4S3SA 3NK9A 3S6WA 4QVZA 4WRDA 2IG0A 3L2QA 4FL6A 2QDBA 3NUCA 4H7BA 4IUTA 3LLRA 4A4FA 1STAA 3C1EA 5IGBA 1KAAA 2X4YA 3OYIA 4BACA 3UWNA 1EY5A 1MHNA 5CIUA 2XDPA 4IUPA 4EDUA 5J26A 4PMCA 3QOLA 3ITPA 5J22A 3L2RA 1STYA 2RI2A 3NP8A
chains in the Genus database with same CATH superfamily
3D0FA 4XTWA 3N6RA 2E41A 4M78E 2WSEE 3A8OB 1LT4D 1ZQ1A 4G7ZC 3D7SB 2F0EA 2FB7A 1OX9A 2QK0A 1BXTA 4E7IA 3H3VI 5IYBH 4B9XA 2DMOA 2GF7A 3RUZA 1EFWA 4XTYA 4FSXA 2FYKA 4A4GA 2DZCA 4N4GA 1E24A 2ID0A 2JVVA 4KKUA 4Z8AA 4IFDH 1NPPA 4C8QA 1Y7XA 2IVWA 3UPUA 4MDXA 2KHSA 4TKOB 1PRTD 4RCNA 1UJ0A 2DGYA 2DL4A 1IGQA 1OU9A 3MXUA 5IYCH 1ZUKA 4C1NK 5JJLA 1G3YA 3RUXA 1WXBA 2JA7B 3OBWA 2ZJQA 2DY8A 1LTGD 4QJFA 3UF4A 5IT9E 1HFNA 1ARKA 1TT2A 2E5LL 5I6WA 4M1UB 4A3EB 4M7DA 4J9EA 2QA4Q 3HOVB 2LJ3A 4PJOG 1VF7A 2KECA 2SEBD 4RWSC 2CT4A 1N6AA 5GAOn 4POGA 3S2HB 5GAOq 1PH8A 5IN1A 1DXMA 4AIMA 5L37A 3RR5A 5CBAE 2PQAB 3BS1A 4J8OA 2H8HA 4GN5A 3QZ5B 2BE7D 5JJZA 1VYTA 2FVUA 2LJ0A 1G8ZD 4A3IG 3JCMX 2EYJA 2OI3A 4FF1A 4E6RA 1V8QA 1E6GA 1K3RA 1K8MA 3I2ZA 4R1JA 4ZRZA 1W2BA 2KA7A 5EPJA 4IPGA 3DMUA 2MO0A 5D6XA 4NXNL 3EBEA 3M0SA 1GO3E 3SWNB 4A93H 1HTPA 4C92D 1HNXL 3SK8A 3WOEA 3JCMe 1O9SA 1VQJA 3TZDA 1DGSA 5JEAH 3M4GA 4GY5A 2NWMA 2SRCA 5GAN8 2RQXA 2GNCA 5I9OA 3VA7A 2NYSA 3C3LA 2R58A 1Y8OB 3GTLB 1KK7A 2BZXA 2P0QA 2JA8B 1N34L 2EKOA 2EGCA 1LTBD 1UE1A 4HIOA 2K1BA 1HR0Q 5FLMG 2VXEA 4X6AH 1VYVA 2RHYA 2PZWA 5DAUA 1F2ZA 4BY1G 2FFKB 1F9SA 3VUZA 2PVOB 1TS5A 4EMKC 1WQWA 4XXEA 2CP2A 4HXJA 4CC7A 2A28A 1PH9A 3I72A 1ZX6A 4DAYB 1HTLD 1TWFH 2VB2X 4UC4A 1EZ6A 3DEPA 4MTNA 1V9PA 5FOBB 1PFMA 1IBMQ 2NLUA 2COZA 1V1OA 3QDFA 1RL2A 3HOZG 1M8AA 3GTJH 2DAQA 2J0TD 1SMYC 1RD9D 3RESA 4X9DA 4P74A 1EUJA 3HOYG 4HCSA 4LXCA 2J4XA 2IW3A 1HXDA 4O42A 4ODGA 5AFWA 3ZL7C 3C4SA 2Y0SE 1EYCA 2K5IA 1WLPB 3VRZA 1R0CB 2Y90A 1EZ8A 4KD3A 1KAWA 1MJCA 4RTTA 4YIJA 2CZ6B 3V96A 4LN2A 4R4IA 1TWHH 5C44G 1C8CA 2FZCB 3CCJA 1MKHA 5J1ZA 2LNHB 4OB0B 3M4OB 4A53A 3X3NA 1HH2P 1NUCA 1HA5A 3JAME 3HKZG 2QAZA 3VS3A 3RLFA 3DUZA 1K0RA 2CP6A 3AU7A 1R9TH 2GA4B 3M0RA 1PTOF 4DU9A 4ATOA 2QXFA 3M57A 1U5SA 2GFAA 3J7ZC 3DM1A 2NVQH 5EQ0A 3OYYA 5C6SA 2B3GA 4FYWB 1JJCB 4R56A 4KKTA 3Q23A 2RQVA 2J7IA 1PTOC 1Q90A 2F0HA 2FO0A 2NB0A 1BBWA 5FU7C 2UXBL 3CEYA 1VQKA 5LJ3d 4LW1A 3GTQH 4B9WA 4RTVA 4OWTB 1VQPT 4MDWA 1KLGD 1D0ZA 1V29B 2K57A 4TQUS 3H6MA 4I7AA 1GUSA 1GXDC 4LK1C 1VQ5A 1F2YA 1HUMA 1R4PB 1X6BA 3NTIA 5C4XG 4XQNA 1W6JA 1I4QA 1YNNC 1X6OA 2I2LA 3I5RA 1A0IA 1GHJA 3QO3A 1X65A 2JTEA 3KUFA 3CKIB 2CS7A 4N4IA 1SRUA 2V8JA 1I4GA 2PMZE 4MHEA 2RJCA 2XK0A 1MNDA 2CYZB 1V1PA 2EY1A 3RKYA 1EY4A 4KJOA 5I2YA 1W2BP 1EY9A 5KYWB 2QGQA 3UI2A 1KABA 1XMQQ 1IBML 4E7KA 3M0UA 4L6V5 4QW2A 1UHFA 3QYGB 1KQ2A 3FKIH 1QNKA 1YI2T 4FXKC 5NUCA 3TDQA 5CV9A 1GOZA 4A3FG 2JQOA 4KH0B 1WTOA 2NUTB 2NZHA 2YV5A 1LOJA 5M3MG 2K03A 2PVDB 4GOPC 4WCIA 2X6GA 2EQKA 1SJED 1B3AA 4G7OC 1U3OA 3W1BA 2O4XB 2KCMA 4UAIA 2VB3X 3OYHA 1VQPQ 4LNPA 1Q8KA 4BB7A 3U50C 4OO1H 4DA4A 4LAAA 4AH6A 2B2YA 2K2VA 1GCQA 4HKEA 4DGZA 3GNFB 5LJ5e 3PO3H 4FIBA 1HRJA 3RBBB 1NLOC 4QUCA 4KY7A 3C94A 4NPSA 1PSEA 1BI0A 3QBYA 4ME5A 2LX9A 4XAXB 1HSQA 3CMAT 4IUNA 4M75B 2EYXA 2DVJA 2K52A 3FPPA 3BW1A 1QKXA 1EIGA 5GAN6 2XN9C 3KF8A 4KHZA 5I2MA 2EOTA 2L3QA 1Z7TA 3S14H 3VYSA 2RK2A 5C4JB 1SNMA 1SEMA 1WJRA 1JWSD 2A6HC 2A1AA 4ZUIA 2DEQA 4X64L 2YUPA 5IHIA 4ELZC 1YI2Q 1E1TA 4NS5A 3AQQA 4DBFA 1KHCA 2DUDA 2K3YA 3CXCA 4M75F 4JLIA 1K4US 2K28A 1KRSA 3RN5A 4EMHA 3URGA 2V1RA 2HD3A 5GAMh 2Q8RE 2QEXT 3GQBA 2CSIA 4P71A 4V2SA 3VJPA 3QJ6A 3M55A 4MZMA 3TQ7P 3J80E 5GAN2 1SE3A 3VS2A 1EWIA 1TWHB 1ONLA 1UHCA 5KYLA 4XQQA 1D3BA 4ORZA 1SN8A 1QE6A 4D8DA 3M58A 4XU2A 2Y0SG 2KRSA 3HEJA 4EQPA 2XIWA 4FSSA 3A8IE 4RKBA 4WJ4A 1SYGA 4JJDA 1PFNA 1XMQL 3S15H 1YITT 2YSQA 4DXGA 1D5XC 3EA6A 5EJWA 3HFNA 2DLPA 3CMAQ 4L8JA 1N9SA 2K4YA 2MQHA 1CKNA 2EAYA 2FHDA 2A73B 2K50A 4RGMA 5KRUA 2NVQB 2ZTCA 4BE2A 3JB9F 2XI9A 2A37A 3GF5A 3LW5E 2KR3A 1MMGA 4K11A 2CZ1B 3C1FA 1PDQA 1TXYA 3E3XA 3V05A 5IGGA 3PMIA 3GTQB 1X2QA 4J8QA 2X4JA 4O5VA 5CKFA 1K76A 1MSGA 3P8DA 4DBQA 2VB6A 3CCUT 3SB2A 1SMXA 1BI2A 2KNBB 2E70A 2L2PA 2EWNA 2QEXQ 1YNZA 3M4QA 3VR4A 2IPKD 1N36L 3OIQA 3NPPA 4JI0L 3CCLA 4L5QA 5D6YA 2L5TA 5A35A 1K0SA 1X69A 3CQZH 2EYPA 2PQAA 2R7ZG 2DNEA 1BB9A 3H0GG 1DJ7B 2KI7A 2D62A 2WAQB 2F1MA 4U68A 1PH7A 2C9OA 3PSIA 5J3BA 1TTHB 5CC4A 3JV3A 3HFOA 1YITQ 3D4RA 2HL3A 2H4OA 2R92H 4C3HH 4JW0A 2FMCA 3SWNA 3WXMB 5C3EG 2MOXA 1ZYRC 3UDXA 3L1AA 2CZ0B 4A3DB 2HDAA 1M1KU 2L0CA 1EYGA 2EE1A 1B07A 3S1MH 1JEGA 2F5TX 2OEOA 2Z4IA 1STEA 2I07B 2CUBA 4OELB 4WFN3 4JPBW 3CCET 1AZQA 1YZ6A 1ABOA 3A55A 3JAMi 3MPUB 1MIUA 2B63G 1CA6A 1SNDA 3WVEB 3CCUQ 1RI9A 1HK9A 2RVLA 1B2TA 3D6CA 2R5AA 2B86A 5K36H 1OXVA 4GKJL 4DAYA 2LZ6B 5LJ3g 1UEAB 2RB6A 4HVWA 3MJXA 2JP1A 3BYTB 1Y8NB 5KE2A 1N9WA 3EHQA 3R2IA 5C4HA 4LF7Q 1SSFA 2DL3A 3H9NA 5CKEA 1B70B 1CHPD 2K32A 1LT6D 1VMPA 4KHVA 4EIKA 3NHNA 1FD7D 3VA5A 3MFYA 1EQTA 3OYKA 1U4LA 2FZKB 3OSOA 2DXCA 4PG3A 3R3OA 2K5FA 3TMEA 2F0GA 2XRQD 2RQTA 2OWOA 4XTXA 2EY6A 3PO2B 1T3SA 4POFA 1C4QA 3MAQA 4A4KA 1JRIA 5L23A 2ATWA 1YNXA 5JJIA 3P75A 1IYUA 3M9BA 3BDLA 3CCEQ 1WD0A 2JM9A 1WTRA 1TS4A 1CZGA 4J15A 1UDLA 3HOXG 3BDOA 1GJXA 1NM7A 1ZSZC 2MMPA 1Q1EA 4YTLA 9ATCB 3Q22A 5BN3A 2JEBI 2LQ8A 1JXOA 3OY9A 1I50H 1G3TA 2P84A 3E19A 2VXFA 4ID6A 2VUMG 3J81L 2O9SA 2HQXA 5EAYA 4DV0Q 1Q95G 5BR8Q 2W10A 2I5LX 2NN6H 1CQVA 2EBPA 4PV1C 3ZJYC 3CRKC 2LDMA 3ZEHA 1B53A 2GQIA 2ZGWA 3O13A 4BBRG 2PZUA 1MD2D 3LH0A 1FX7A 3QUIA 1KC8C 2A6HD 5GAMf 1KG1A 2QDLA 4YCUA 1KC8R 2F0TA 2N49A 5FW9A 2IX0A 1G3WA 3BU2A 3CPWP 1TWGH 1GFCA 1VQ9T 4DPGA 3RD4A 2AMCB 2CP7A 2L8DA 1WA7A 4MN3A 2B39A 2OAWA 5LL6X 4LUZA 2MI6A 2A68D 5I6YA 5EKIA 4A3IB 1BQQT 2G5DA 2G9HD 3PUXA 1DONA 3I91A 4M75D 2D0QB 2X4XA 1PH2A 3WWVA 4LF7L 4CJ2C 4MZ9A 1U4PA 2MO1A 5KYWA 4RCOA 2Q8TA 4IJLA 2BE5C 1Q86C 3PUVA 1NMGA 4M77G 5C5MA 4RTWA 2RHSB 1Q86R 1I3QB 4KTAA 3CCST 3NTKA 5LJ3h 5M9OA 1KQ1A 2XWBB 2NUTA 4BI4A 2JXMB 5FK9C 2DKGA 4DAPA 3Q24A 1EQRA 3U4ZA 2E10A 1H8KA 3OYMA 3M7GA 4GNXB 4E7LA 1E22A 7AT1B 1V1CA 1M8MA 3RLNA 4OGCA 5KNBA 2O4XA 2K4KA 3J80i 2B2UA 3M56A 2XIDA 3OS2A 2NUPB 2MFIA 5AJ3Q 2BIVA 4CDCC 3GTKH 1HZAA 2V1QA 3AHUA 4X3KA 1TWCH 3KLWA 2ROLA 3TRZA 2PUKB 1JC7A 3JB9D 1VQ9Q 2QI2A 4J9GA 1JICA 3RR6A 2YUOA 1NJIC 3ULRB 4R4TA 3HOZB 1DM0B 2LXJA 2FZGB 1NJIR 2GVAA 4M75A 2A6EC 5C0XJ 2KENA 2KROA 1RDPD 2EDGA 5LMNW 3PF4A 4C8QF 4DV0L 1Q3LA 2VGMA 1PG5B 1BUVT 1PZID 4D6WA 1N8RC 2WKDA 5DNFA 4A63B 5BR8L 2RHZA 1OPLA 1HJPA 2F03A 3EGDA 2F0LA 1SLJA 3F2CA 1N8RR 1SXTA 4F7UG 2MYSA 5GMKh 3FHWA 2D8HA 1LABA 1JBMA 3WOFA 2CZ7B 1SSHA 4C8QC 5GAEC 2E12A 3CCSQ 3QIIA 2DD4A 2RHUA 3STBD 5CCAA 3FEWX 5EPLA 2YRDA 2YU9B 2L4NA 2DO3A 2KE9A 4MMKA 4M7DF 3KK7A 4XTVA 3LWUA 2KSSA 5ISRA 4A3MG 1PLFA 4RUGA 1K73C 3S6WA 2PI2A 1XPUA 4DR6L 1NNXA 1M27C 1GVPA 1PVOA 1K73R 4B3RQ 3QPHA 4FL6A 4C0DB 5D3DA 1YJWA 3J7AF 4M7DC 1QJOA 3I90A 2JK8A 1STAA 4OB3B 5FJ8G 3WDNA 1KAAA 1EL0A 1IXDA 4UDUC 2E2HH 2WIIB 4VUBA 2A8VA 5GAN3 4GLXA 3K58A 4FW2A 4OMQA 1EY5A 2GCXA 4XYQA 1J5EQ 4IUPA 5KNDA 2OQKA 3PGGA 3TU4K 3QOLA 1PRTF 1S5DD 3K7UC 1STYA 1RAIB 4B6MA 2OXPA 3MFGA 3NP8A 3GTPH 4DEXA 3KBGA 3FPUB 3S1RH 3HOUH 1JWUD 2DM1A 1VMCA 2AK5A 3MCAB 4KUDK 4B3TQ 4A3GG 2XHCA 3I4LA 5H1SE 4FT2A 1JJ2A 4R4CA 1SYEA 3SGIA 1F77A 2HQHA 1G2SA 1PRTC 1RHPA 2RI5A 2RNAA 1I4PA 2K05A 5ELOA 5AJ3L 5BN5A 4G4KA 2FINB 4QQ6A 1L0YB 4JI1Q 4A3KH 4A93G 1JE5A 1GXIE 2MWOA 3CBMA 3G7LA 2NVTB 4DV5Q 2M9UA 2YT6A 2J6OA 1BCPB 3TEHB 2QGGA 3PUZA 3HRTA 4BBSG 1JOKA 1Y1WG 1YFNA 2CKZB 3I9QA 5CV5A 4A3FB 2A69D 2LQNA 2K5NA 3CCJT 5M3FG 4X66Q 3PT9A 1YP5A 3JCMh 4DBRA 4PZ6A 2PPBC 3M0TA 1Q7YC 4XQ3A 2NVXH 3KDFB 2KT8A 1D5MC 1Q7YR 2OTLT 2JA6G 1BCPF 2RSNA 2KBTA 2RSOA 1GHKA 2VVKA 1F2LA 2BH2A 2EW3A 1ABQA 2DRKA 1SE4A 2B2TA 4DR4Q 1U9RA 1M90C 3MC0B 4O1NA 2HUGA 4RGNA 3G6ET 1BU1A 4UPAA 3H94A 1K8GA 2KOLA 1M90R 3CCEA 5FRMA 5IP9H 4DUYQ 2I0QA 1HR0W 2CDTA 3S24A 5CQYA 4TSSA 4E7JA 1E7ZA 3UDFA 3CC2A 1AOJA 1VQKT 4AQYL 4DXFA 2KGTA 2KAFA 3V2TA 1TWCB 1MUZA 4UP8A 1RIPA 2AQ3B 2OAUA 3ONAB 1YIJA 2ECZA 1QVGA 1VQ5T 2DTHA 4Z9CB 4A3EH 2K6AA 3HOVH 4OWXB 4DV4Q 1SNPA 1HD3A 3CP0A 1J5EL 4QVDA 3KXTA 4RA8A 3E6ZX 1WVLA 5KGUA 2M0OA 3S2HH 2DNCA 2K01A 3CCJQ 4FP5D 5JVH3 1KRTA 1RJTA 1PH6A 5KYNA 1WHGA 4HJAA 4M7AB 3OYAA 4L5GA 5IXBA 4ABNA 4B3TL 5EBDA 1R77A 2C5CA 2OTLQ 2RCFA 3K7AB 3PVLA 5C0XH 5IT9c 2LTOA 1O7LA 1ET6A 1FYCA 4N8X1 1OXXK 4C3JG 3PMTA 4JI1L 4PFPA 2CCZA 1FNVA 1S4ZA 3G6EQ 1A3UA 4BA2I 1HHVA 4EQ5A 1C6VX 1N32Q 3OW2A 3C0CA 1M1GA 4M7AF 4DV5L 3NWTA 1UAPA 2MJ8A 2R7FA 5CORA 4OWWB 1U1SA 2ZXOA 2ZPFB 1LYLA 4CHTB 5C3WA 3CCQA 3LWHA 1WTPA 3GTLH 2B2VA 3MXGA 4DFAA 3UDCA 1VQKQ 3HRUA 4ZYSA 1PV4A 2JA8H 1TH7A 1QVFP 3K8AA 3M59A 3SK6A 3T4AC 1UGRB 1X43A 5GAMd 1Y8PB 2KCTA 4X66L 2EQUA 2EXZA 2VYTA 4JI6Q 1J6QA 4E7HA 2WSCE 1HZCA 3U9SA 1VQ5Q 2X6LA 2E2HB 4RTUA 2ICIA 3K59A 4QIWE 2VC8A 4E7SA 4NP5A 1JO8A 4IURA 5ELEA 4BI8B 2A6ED 3MVVA 1WJSA 2FHTA 1F9RA 1GUNA 5IAYA 4DR4L 1N9RA 1TUDA 2E76C 3TSSA 4DKAC 1KQSA 4DUYL 4F16A 1PZJD 3S1RB 3EH1A 2E2IB 1PH4A 1B1ZA 4C8QE 3EROA 3TQYA 2EGAA 3AB9A 3FVQA 4LUVA 4OGEA 4ZGDB 1G2BA 4DV3Q 4OB2B 2AHOB 2B2YC 2H5XA 2E2DC 1GCQC 1NBEB 4F14A 1NEBA 2DX1A 3A8MB 3X26B 4RTZA 1ICWA 2IL8A 4A3KB 2R7ZB 1JORA 3H0GB 1RTOA 5JAVA 1T0HA 3M4OH 4HCKA 3PUYA 3S3MA 4M7DE 3DM3A 1QQJA 4DV4L 2PW5A 4C5GA 2ASBA 5CV8A 4ZNXA 2VWFA 1NSNS 1EIHA 4RMFA 3FB9A 2AZVA 2PMZB 5C3EB 3PO3G 2XG8D 4F88A 3WVDB 2FXQA 2AQ1B 3EG0A 2HNIA 3CF5A 3M54A 4GKKQ 2L89A 3Q8DA 4ZKBB 2NVXB 3QJYA 3OBYA 4CGYB 2DXUA 2L3SA 1YHAA 1WX6A 1E2WA 4P73A 1L0XB 5IGCA 4A3BG 3BE3A 3E2UA 3S17B 1OXTA 1CKNB 5GANe 3EVQA 4GNXA 2R93G 3H09A 4C5IA 4DK6C 1WOCA 4BDZA 3OYLA 1P16A 4JI3Q 1E0BA 1TU0B 5DM63 3JAMc 2NUPA 1SRLA 1N32L 2E6ZA 2EVBA 1VQLA 4LDXA 1UWVA 4LUDA 3OHXC 1QVGP 2KHJA 1BO0A 2JN4A 2AKKA 1JQYD 3DB4A 2RHIA 4FT4A 4JI5Q 1SAPA 2KBNA 4KJNA 3G4SA 2F0NA 1NYGA 3J7AV 1ENFA 4FYYB 2M0YA 2RMOA 4BD3A 4JI6L 1QWYA 4DR2Q 2O31A 1JOQA 1D0XA 3JCMf 1OX8A 3VS7A 2ZXPA 4PJNA 2NYZD 2PZ1A 4OXPA 1X3PA 2M16A 5KIXA 3KLRA 3JCMc 4QGUA 3CD6Q 1B9NA 1IRXA 3CCLT 1S1NA 1Y1VH 1EU4A 3D4DA 1PRLC 1VQEA 1X55A 1BIAA 3RMQA 3H41A 1XOVA 1WI7A 1TY2A 5E4XA 3LX7A 5CKDA 5CK9A 8AT1B 5GAHC 4C0GA 5FLXE 3P8HA 1LT5D 4EVOA 4DOVA 4RKUE 1M2OA 1YBYA 3ZBDA 2AUJD 2R6GA 2RCNA 4PFOA 4DV3L 2KCNA 2F0OA 1ZUUA 4C92E 4PLIA 3HOXB 2JUFA 3I4NB 3H0FA 2M2LA 3LX0A 1FMWA 1ICFB 2UXBQ 4C0ZA 1VQOA 3S1NB 1BCPD 4LDYA 1GUGA 1STGA 3RMHA 2LQWA 1WHLA 2EGEA 2JTFA 2Z6BA 4QF4A 1U06A 1NCVA 2I5HA 5T1GA 3S1MB 3META 3PIP3 1QP2A 1WCMG 1Y71A 1Q82U 1KIXA 2EYHA 3V7CA 1FNWA 3K5OA 3V8LA 3ME9A 1VQDA 3P7JA 3T53B 2CKKA 4BBRB 4YHHQ 1W70A 5CV7A 4GKKL 2LNVA 4ZN3A 1W2BS 3M7NA 1QMCA 3FDRA 3GLXA 4GLKA 2J06A 3R2TA 3OQ5A 2RHXA 1FMKA 3SWNC 1K9MC 3I55A 2F0MA 2N3SA 2AZSA 2HSPA 3MKDA 3TCJA 4C5HA 3CCLQ 1QVCA 5C4JH 3QR8A 1K9MR 2WACA 4JI8L 1WDXA 4JI3L 4EQNA 4F87A 1C1AA 3X3MA 3QWXX 1UE7A 4Y28E 3OA6A 2K04A 3AT1B 1QW1A 2D6FA 2E75C 2G9DA 2M9VA 1S40A 2D9TA 2VQEQ 1PZKD 4R8NA 1I4RA 5AT1B 4JI5L 1IXRA 2QCPX 3M9QA 4RHRA 1WYXA 3OYEA 1Q1BA 2AUKA 4QY7A 4M77B 1TOVA 1UTIA 3A1PA 4EMGA 2CSQA 2ZXRA 4DR2L 2CUDA 3M4PA 2JEAI 1D1AA 3BZDB 4ESRA 2HDLA 2OX7A 3NPFA 3JB9H 4K2KA 1EQQA 3EN2A 1QCOA 1I4XA 2SNSA 4XT3B 3FEOA 3MP1A 2DETA 2OTLA 4M7AD 1TIID 1CM9A 2K7VA 5IHKA 3GV3A 3KDFA 1Y69U 2UUAQ 4JYAL 5F2DA 2ZCFB 4HVVA 2QG9B 3N5BB 1I4HA 4L6TB 1QCNA 3G6EA 2RD1A 1CKOA 4BS9A 2RJFA 2ZZDA 1I6VC 2EQMA 3J80c 2MPXC 3K5MA 3D4WA 5GJVB 2GQVA 1I8FA 4CI0C 3MEVA 1D5ZC 3L2VA 1XTCD 4KY6A 1I81A 3FDTA 2EYMA 4GLAC 5GAMg 2WFWA 2J05A 4DR1Q 4X64Q 4X1VA 3I4OA 4M78G 5KYUB 2DJQA 2Q2IA 4MIUA 3INZA 4PJMA 3VDYA 5IGDA 2O2OA 4X34A 2VW9A 1M4ZA 4CRIA 2XKOC 5ELNA 1C0MA 4F7UB 3R93A 4YHHL 2VQFQ 1L1OB 2EPDA 3RMSA 4FF2A 4J9DA 4ZQ3A 2DL8A 1S3OA 5ELBA 3CCVA 4IN3A 3JRZA 2EVRA 3MP8A 4A3MB 1BI1A 4M7AA 2QKIC 1Y1VB 5IYDG 1ILQA 4J83A 1LACA 4ZKCB 4JJBA 3L42A 2Z0WA 4FW1A 4RTXA 1PXUA 4KULA 4AFUC 1BYMA 2F0SA 5IP7H 1RAEB 1EEFD 1H9SA 2VQEL 2ABLA 2PNIA 4HIDA 4A3DH 3LGLA 2LKVA 2CH4A 2DK3A 2OTJA 2HQLA 5DM7R 2F3VA 5KYIA 2H1EA 4AYBB 4TVAB 1VOMA 1HPCA 4II1A 4KGXB 3P8BB 4RH6A 2A3LA 2DPPB 3T16A 3A8JE 2BA0A 1NAPA 4L59A 1PMRA 1VIFA 4C92G 3EG1A 2BDOA 2F3IA 2ICEC 2N55A 3W5OA 1NE8A 3NWSA 2E2JH 1MV0B 2AKLA 4LD9K 3FMCA 2PZTA 3OPOA 4LDVA 2DJFC 1XQHA 4X65L 3QWYA 1DZ1A 1N36Q 2UUAL 2P0PA 3OTOQ 4LFAQ 4PMWA 2LVMA 1E6HA 5M5YH 1KDAA 1CFMA 2KUMA 4I7ZC 2HKQB 1QP3A 4AFQC 3BZKA 1ZHIA 4AFSC 1ZA1B 4KN4C 3EH2A 1VQBA 2CQAA 1N5ZA 1SEBD 2PU9B 2K6DA 1MSHA 3A8KE 4JBKA 5D14A 2DZ9A 2V26A 5I4DA 2OJ2A 3EGDB 1X9NA 1MMNA 4DK3C 2NZOA 2B2UC 4DR1L 1B4OA 3C95A 2PQEA 1ESRA 4BBSB 2F0DA 4NB3A 1Y1WB 3PO2H 1X2KA 1XX8A 1G6ZA 3MP6A 2V1CC 4N8FA 5EGTA 1NR4A 4V0BA 2EJGA 5FO9B 2EQSA 1G2TA 3HL8A 1ZSGA 1TY0A 4LUEA 2A68C 3CD6A 1O80A 2VQFL 3H0IA 4M75C 1OOTA 2JA6B 4YWLA 4ZUJA 2CQOA 3SFMA 4RHSA 4B08A 1AN8A 4CC3A 1DOMA 3GTOB 4C3IG 3DWQA 1PA6A 3ERQA 1AFPA 5I2XA 1OPKA 2YYZA 1YJWT 2KEAA 1V76A 4JRQA 1IZ6A 1IKMA 4Z89A 4KGVB 2SOBA 2KQWA 4RGOS 3B6YA 5GANj 2JSOA 3OB9A 3CMEA 3W3AA 4O0AA 1XNIA 2K5LA 1C48A 1J9OA 1RODA 2L5QA 2CHBD 3JCMd 4K14A 4JI7Q 3HOWG 1RAHB 4QUFA 2OT2A 3NQTA 4ZTJA 2NWGA 5C3XA 4BXXG 4B3ML 4AG1C 5KCOA 1XJWB 3T9NA 1XMOQ 1VQ6A 2B29A 3L3OC 3O8VA 4PZ8A 2VNUD 3V8JA 2XDBA 4RG8A 4OIKA 1FXXA 1SYDA 2A36A 2XD0A 3GP7A 2RF4A 4IUUA 5HKCA 3SVMA 1IYVA 3A5ZB 4U673 1HA6A 2C35B 4HCBA 1CSPA 3L2WA 3OS1A 4A3IH 1PH1A 2L3RA 2VGNA 3EHRA 2FRYA 1Y0MA 3OTOL 4LFAL 4EQOA 2JYOA 3CHBD 3TS0A 4HN7A 1BCMA 3SHWA 1IHVA 1LO5D 2HL5C 3BFMA 3I5SA 4A3LG 1IREB 4C3JB 2ATCB 1YJWQ 1PFSA 4RG2A 2RQWA 2LXKA 5GMKi 2CP3A 3FLGA 2Z8LA 4J6HA 1C0AA 2XU8A 1E2VA 1I3QH 4BY7G 4J9HA 2SEMA 3STBC 4O6JA 3UA6A 2H3JA 2RM4A 3KUPA 5M5WB 2UU9Q 4QQGA 4HCEA 1G291 1Y96B 3CPWS 1B3QA 3JSCA 5KYYB 4J9FA 4BY6B 4M77D 2RN8A 3U9OA 5FLMH 4LFCQ 1KTKA 5CR3A 2L9HA 4GZYC 1G91A 2A7YA 1HZBA 1RAFB 1K8AC 4K6LA 5GQOA 4OMLA 4DNIA 3G1JA 1K8AR 1SYCA 4S3SA 3K0YA 5CAIA 2ES2A 3CC2T 2KRNA 4BA1I 2IG0A 5CR2A 1GCPA 4IOAA 2E2JB 3DWPA 1IYJB 2ZPIB 3NUCA 3HOZH 2WKCA 4A4FA 1NJIU 4P72A 1YIJT 4RAUC 5M5XB 3JCMP 3C1EA 3K0XA 2NTTA 5M5YB 1O7IA 3OYIA 4BACA 3X28B 2B2TC 2VY3A 3GTGB 4LDUA 3UWNA 4JI7L 1UUPA 3G48A 5LMUQ 4ZN1A 4G7HC 2CGHA 1BF4A 1MHNA 3HKSA 3CXCP 3H3VH 2F1LA 3V7SA 2W0ZA 3HP9A 4PMCA 1A0NB 2AIRB 2ZJRA 2YU9H 1XMOL 3X25B 1OU8A 1Z9ZA 2KJXA 3C46A 3I4MG 2GVBA 1X3FA 3M3YB 3VUBA 4IPDA 4L63B 2F5KA 5FWCA 2M1HA 1S5BD 1U4MA 3A7AB 1EYAA 4M77A 2Q8IB 1B34B 2JOYA 2RA4A 4DNTB 4K2LA 3TP7A 1W4SA 3QOJA 4L5TA 1K73U 2DEUA 4HMJA 2L0AA 2DYIA 3A74A 4A3JG 1WHKA 1HXYD 1HQRD 2A69C 2JA7G 3EFSA 4A3BB 2KXDA 3KLSX 4P5NA 4JBWA 2JT4A 2F0PA 2HT1A 3GBQA 3CW2C 2R93B 3CCQT 3CC2Q 3JCMJ 1X54A 2KEDA 1BI3A 1P92A 1N27A 2HZYA 4P2CB 2K3BA 4DR5Q 2ZAEA 5JJKA 1JU5C 3AFQA 3RN2A 1YIJQ 1XNRQ 3OYFA 1U8RA 2F0IA 4IZ8A 5DLQE 4IFDI 2UU9L 1PC0A 1M3BA 4X9CA 4K5XA 1FNUA 2EYFA 5KYUA 2ZPHB 4LFCL 1VQAA 2V8KA 2F0KA 1EZZB 4LWCA 2F0FA 5GAOp 3SR1A 2B2VC 5GANg 4PLLA 4PJOB 4K8JA 2BZ8A 1NY4A 4JCVE 4UP7A 1WTXA 4J9CA 2CVRA 4DR6Q 3H6ZA 3MEAA 4F7UA 4JZ4A 4UY8C 1XTDA 4NMZA 1L1OA 2IY5B 1L2FA 3E9FA 2EY2A 1PKTA 4J6XA 4M75E 4NL3A 3SK4A 4LF5Q 4HT8A 1DYQA 1RAAB 2DERA 3SXHA 1AWJA 2PUOB 4JS5A 4HMIA 2VZAA 4FDBA 4A3FH 2JA8G 1HNZQ 3REAB 4PJOF 2IX1A 5C6AA 2F0JA 3BG3A 3SHLA 5M3MH 3CCQQ 5KEEA 1QWFA 1CQFA 5LMUL 1I4K1 4PL6A 3IFDA 1WPYA 4JG2A 4PZ7A 1YJNA 5IIFA 2MF2A 3KOJA 1VQHA 5CKBA 1Q7YU 1CK1A 3E0EA 4NDXA 2XMFA 2VASA 3BVGA 3S1QB 4C0FA 3OMCA 2EYOA 1RAGB 3NBIA 4ZCKA 1AWXA 3I56A 4GLVB 3PFSA 1WFQA 2PI2E 1AVZC 3TN2A 1LM0A 1BR9A 1M90U 3BY7A 4HTHA 1SJHD 1WI5A 2CFMA 2JA5G 1IL2A 4OL7A 5GMKm 4NXMQ 4JV5Q 1STBA 1OQKA 4BY1B 1PH5A 3G7ZA 2RA2A 2F2VA 1WTHA 1FMVA 2ZPGB 1VQLT 2K33A 5LJ5j 3SE0A 5D3IB 3J81E 1VQFA 4HJ8A 3J7YW 4HA8A 4LF8Q 1TUGB 3JCMg 2O5IC 4GN4B 3RZOB 2C0OA 4K6DA 2FPFA 3GOXA 1SDFA 2EQIA 4IO9A 2O9VA 4DR5L 2EQJA 2B8AA 3G4ST 5I11A 3K57A 4X62Q 2FPDA 1XNRL 2COWA 2F52A 4BI3A 3HOYB 2Z9HA 2X3WD 1FGBD 4YWMA 4GNXC 1HNWL 2Q2HA 4OVAA 4XIGS 2F2WA 2VUBA 1VIEA 1GBQA 3M4YA 1OXUA 2HD0A 4HT9A 3K7AH 1H3HA 5C44B 1B7YB 4K0KL 4BE1A 4HCCA 1RABB 1MV3A 2BKDN 2XRSD 1UG1A 5IYBG 1ML0D 4OONA 3R8BA 1M30A 5ECAA 3G71A 3HKZB 2DXBA 1Q81C 1M3AA 3MTSA 2MUYA 1EYDA 3HZXA 2VS1A 1Q81R 4K5WA 3ND9A 2KDSA 4L5SA 4IFDG 3L2ZA 1JXMA 2B8FA 1RLPC 2LT1A 3C12A 2ED1A 5CQXA 5CV6A 4J7IA 3EGUA 5A0DA 2X35A 2KEEA 1CA5A 3QHSA 4OMNA 5GANh 5IYCG 1KNEA 2K5QA 4AQYQ 1VQOT 3RZDH 1HNZL 4GN3B 3TZUA 1VQLQ 4EPCA 2WAQE 3VS0A 2YUNA 4AG2C 4QCLA 3GV6A 2YUQA 4PFZA 1FVIA 1DJRD 4TRDA 3H3VC 3QXEB 2Y4XA 4FO2A 1GRIA 1IGUA 1TXQA 4IUQA 2CWAA 1OULA 2AT1B 4M78B 3G4SQ 3RIRA 3TP8A 1U1TA 2ZPEB 1KSWA 5GAOl 1I5FA 3LWEA 4KHPQ 2P5ZX 1A6XA 1SF9A 1CHQD 1LV9A 2E2IH 4KH1B 1WHHA 1NMFA 3GD7A 4C0DC 3I55T 5EC7A 1IHZA 1YCSB 4NXML 4JV5L 1K28A 4OEMB 2B8GA 4R4QA 2LCLA 2R7ZH 1UEBA 1Y14B 2VL6A 2L11A 1HYOA 3M5AA 4N0AA 3H0GH 1A2TA 4LF8L 1QVFS 1K1ZA 2JJ9A 5JEAG 2KK4A 1WGSA 2QQBA 2YXYA 2QGFB 1MHWC 1I5OB 1QUQB 3KLSA 3VR6A 1SNOA 4JRKA 1IL8A 2WB1E 3A8GB 4LF6Q 1VQ4A 1LTAD 3D6WA 4X62L 1CKBA 1VQOQ 3KBXA 2Q2UA 5C3EH 5IWAQ 2KY9A 1YVCA 5FO7B 1ZBXA 2LP5A 3CC7A 3ULLA 1OTCA 2BUDA 5M3MB 1AP0A 2EYZA 3CPFA 3D31A 4M75G 4XDXA 3ER0A 1S72A 3URYA 3S17H 1SG5A 5FU6B 1TU2B 4KT0E 1WTWA 1Y96A 3FP9A 1XWEA 2QTXA 1D1CA 4C92B 1RUWA 5KYYA 2R7DA 5IODA 4OO1I 3PGZA 4MZPA 2K5HA 1BCPC 2K5DA 3I55Q 3BDCA 3FC3A 3CC4Q 3UATA 3A98A 3PCOB 1TSFA 2V4DA 1QB5D 2MIOA 3MEUA 4ILWA 1D6EC 5EBCA 1EU3A 1EX4A 4LF9Q 4A3CH 1G83A 3HG9A 2OF1A 2E74C 2D0OA 1DCZA 1VYUA 1XPOA 1QNUA 1W1FA 4DUZQ 5FU6C 3VR5A 3E1SA 1H95A 4OMFB 2BCOA 2FJ2A 3JB9G 4KRTA 1E2ZA 4H02A 3JC66 1IHWA 5LJ5g 1Z47A 3E0JA 4IOCA 4JI4Q 4DNRB 4KHPL 1UJYA 1A62A 1YWPA 3CCVT 1EOVA 3ERSX 3NELA 3H91A 1M2VB 2DJZA 4IIOA 4Q5WA 1WD1A 2PNRC 3QSUA 3TVTA 1RI0A 3SEMA 4PJOD 2HCKA 1EOTA 3QWNA 5IGEA 3F2BA 1E1OA 2E1HA 3HOXH 2ED0A 1QVGS 1B34A 1HZ9A 1RF2D 1WTQA 2Y0SB 3I4NH 1H9SB 3S1NH 3PMFA 3MEFA 4JOIA 2RHQB 3DHQA 4JBMA 1AZGB 2EJ9A 1VDZA 5E7NA 1BOSA 4LF6L 3T1YL 2OTJT 3A5UA 1WJQA 3RZDB 4XQJA 3K5NA 3NFCA 5IWAL 3HOWB 2KHIA 4GBQA 4M7AC 2XGTA 3HSBA 4LUOA 4QB4A 1I1JA 5FLXc 4HCZA 3PQIA 2JMCA 1FL0A 4KN7C 2K79A 4BBRH 4AT1B 1EY8A 1PYSB 1GFDA 3NMZC 4HVUA 2CP0A 1LT3D 1QVPA 2MNAA 2BE9B 2EYWA 5FWBA 1KL9A 1JJ2P 4CJ1B 1GKHA 1LTTD 2Z4HA 4FYXB 2DL7A 4RMOA 2QQRA 4DK1A 3DXJC 4Y91A 1JT8A 1TG0A 3CCVQ 1NZ9A 1Z9FA 4FNFA 3FKIG 1CKAA 5KCHA 1YNJD 2DVEA 2MHVA 3S2DH 1RACB 5LJ3e 5GAN4 4PJOA 4M4ZA 4LMQD 3IRBA 1CT1D 1GUTA 4DV7Q 3GTMB 5HURA 3J81i 2FEIA 3OYBA 3DB3A 4LF9L 3UT1A 5GANf 3TREA 2ZTDA 1T5EA 1TS9A 1IKLA 3U23A 4JK1C 1GM5A 4QQBX 3DKMA 4J9BA 3GP8A 3A54A 1HUNA 1RADB 1SPKA 4DV2L 4OO1G 4BY7B 4ZGEB 4C2MH 4DUZL 2B2WA 1AH9A 1T3LA 1BVSA 1CTMA 5IT9L 4PK4A 2OTJQ 3CD6T 2LRQA 5K5PA 4CKCA 3VS5A 4JJCA 2HAXA 1X3EA 5EKKA 4LD6A 1H9JA 4JI4L 4KGZB 4JI0Q 1EEID 3MXNB 2EJFA 1FJGQ 5LMNQ 1M8VA 2IT1A 1VQMA 2MWPA 3HTRA 1NR2A 1UUEA 1M3CA 1K3BC 2SNMA 2WB1G 5E3FA 1ZUYA 5DLOA 4FXGC 5GAGC 1AZPA 4RCCA 3S3NA 3BJUA 2IIMA 4YCWA 5LJ5h 4IUVA 4ZAIA 3VR3A 1YHQA 2XSCA 4IPHA 4QT7A 1A3TA 4HJ9A 4IQZA 4C56C 2B63B 4CDFC 2EJGC 2IHFA 4JI8Q 3UDIA 3CMET 5HCKA 3X24B 5GMKe 1X56A 3BZCA 3CCRA 3DLMA 3EG3A 2LFNA 3MHXA 1D1KA 2YTVA 1VQ7T 2JE6I 1L0WA 3PE0A 2JTMA 2A19A 2EPBA 2V8IA 3JCMQ 3QB3A 5G3LD 3LGJA 1GUWA 4JBJA 4CDEC 3PVQA 4P75A 1BIBA 3VS4A 5T1IA 1VQ6T 2IPOB 3VV0A 1H92A 1KNAA 3SDZA 2DY7A 1PNJA 2DL5A 1EIYB 2DBMA 2QQAA 3V7RA 4JZ3A 4M78D 4C5EA 2UUCQ 5A0GA 2UXDQ 2L1BA 1TS3A 1A3VA 4A3MH 3I4MB 1JMCA 3RDVA 1AWOA 5LHY1 4DAMA 2ENBA 1YCYA 3Q1JA 3F2DA 4APVA 2ROTA 3EGXB 1KXLA 4ZTFA 2RF0A 5E1FA 3ULJA 4JYAQ 1S5FD 1PYBA 2QW7A 3I8ZA 2E5KA 3THKA 2E3IA 1A2UA 1CUKA 3O5ZA 5IE8A 1VA7A 3QKJA 3AFPA 3CAMA 1G5VA 1W3SA 1LUZA 3I73A 1O75A 3OW2P 4G57A 4A3JB 1BNZA 4QKUA 5FJ8H 1PD1A 3L9AX 4DV7L 4CBVA 3GDEA 3OYJA 4GS3A 1VQ8A 3OYCA 1ASYA 4JVZA 2CT3A 2K7AA 3CMEQ 3GNGA 5KYXB 1P8LA 4Z88A 3FJ5A 3MO8A 1VQ7Q 1KIKA 1SBBB 2KMTA 2VUMB 2I5MX 2GGRA 4O2DA 1SHGA 4ME7A 1QOHA 4XU0A 1Z6HA 2Z6KA 3IAYA 1R4QB 4PMBA 1VQ6Q 1WZOA 1BK2A 3H0HA 4B3SQ 3JAML 2HDMA 4A3GH 1KD1C 4HEDA 1FJGL 4F04B 1U0LA 5GAN5 4M78A 2NN6I 4DN4M 5LMNL 3NBHB 1KD1R 4MNOA 4EMKB 2CW0C 1KQSP 4E7ZA 4ELYC 4PJJA 3KFUA 4IJHA 1U4RA 2QASA 4WTOB 1AHJB 3C2PA 2BTTA 3CC4A 1ZEQX 3UA7A 2PW7A 4LJZC 1N33Q 4ZGJB 2K3XA 2N88A 2F4VQ 4I65A 1YN8A 4OGQC 2R92G 4C3HG 5DM73 3S2DB 3VR2A 4BBSH 4WF2A 1STHA 2E4HA 1Y1WH 3ND8A 5M3FH 2KQ3A 5JPMC 4M8AA 4A75A 1BDOA 1XXGA 2OCEA 1RKNA 1VCIA 4JUVA 1QUQA 4C8QG 1JB7A 2X9HA 3QO2A 4K8IA 2JA6H 1M1FA 5C0MA 3IL8A 4C2MB 3GTOH 2UUCL 4KUIA 3VYUA 2UXDL 2JN0A 1JB3A 3I35A 3NXWA 4M7AE 3EFOB 1I6HB 2F2XA 2O88A 4X65Q 1LPLA 2BA1A 3TSWA 4YWKA 5K36G 2JA5B 2EXDA 2WSFE 4XTCS 4M77F 4QQDA 1IBKQ 4M7DG 1S5CD 3A0JA 3CRLC 2IHEA 4C92A 1LTLA 4XU1A 1EWHA 3PIO3 3MXPA 1SKUB 3LWIA 1Y07A 1PTOB 3EIVA 2RDGA 1MGQA 4M77C 5FU7B 1D1IA 3BVMA 1UGPB 1M9SA 5FRNA 2CP5A 3OSVA 1RCVD 4FF3A 1WIEA 3BVZA 1XYIA 3NEMA 3EG9B 3HRZC 1UNSA 4OMOA 3EAEA 5C4XB 3S9WA 1A63A 1UFFA 2L55A 3OYDA 2MAMA 3CCMA 1MBYA 4B3SL 2IWHA 2K9GA 3UDGA 3NK9A 1NLPC 3F2UA 4QL5A 2NBFA 4RTYA 4PJLA 4WRDA 4C3JH 1OEBA 1DOKA 1RTNA 1BBUA 2QDBA 1M2VA 4H7BA 4IUTA 2O5JC 2UXCQ 1N33L 5LJ5f 2Z0SA 3K6OA 1XJVA 2N78A 4NW2A 3OIPA 2F4VL 3REBB 5IGBA 4F7UF 2X4YA 2QEJC 4DV1Q 1IW7C 2SDFA 1GL5A 1QILA 5M5WH 4FCYA 2NN6G 1YJNT 1AW7A 3T51B 5CIUA 2XDPA 2ALYB 4KLKA 4EDUA 2N8NA 1HR0L 4JDSA 4QVCA 1V43A 3CBOA 2X69A 3ITPA 5J22A 2P4TA 2XVSA 1L1OC 4GOPB 2KYBA 3L2RA 4B3MQ 5A0LA 5CKHA 2RI2A 2DILA 3I56T 3L2PA 5CMDA 2PQWA 1UGQB 2EYLA 5I21A 3QYHB 5C5LA 1FYNA 4R8IA 1K8AU 4HAEA 3J80L 1JJGA 4KY5A 5CGKA 1PRMC 4FM4B 2XICA 5DY9A 3JCMV 4MTKA 3W1GA 4CKEA 5HK0A 1DD2A 3I7FA 2AQ2B 5M5XH 1PM3A 2JMAA 4MZTA 1EY0A 4KD4A 5GANd 4A3GB 1IBKL 1WHMA 1Q8IA 2XDDA 3GTGH 3X20B 4IALA 5KH6A 4A93B 2DRMA 4D8KA 3M53A 5LJ3j 4HIMA 1TVXA 3HHTB 1K83H 3FRPB 1Q82C 1K9AA 2BZYA 4KK7A 2HCIA 4XTUA 4FU6A 1Q82R 3M3YH 8ATCB 4J5YA 1EQVA 1YJNQ 5EPKA 1YHBA 2TSSA 1YJ9T 4WJ3M 2R57A 5HY6A 1Z9QA 5M3FB 5EKLA 4F17A 1D7QA 1A8VA 1O7YA 5GAN7 3OYNA 3G71T 1OXSC 4OHJA 3ZFJA 3I56Q 3RKWA 2PYKA 4WORA 3UE1A 4ALPA 1WYDA 5ELCA 5JVG3 4A3BH 4E47A 3PNWC 1TWFB 2PO4A 1I0CA 2R93H 4IPCA 5D7UA 1ACMB 2VKNA 5KNCA 3MXNA 5IOCA 4AFZC 1ZA2B 2UXCL 1KHIA 4WJWA 3GTJB 3MEHA 1LCKA 2A5HA 2RKSA 4Z02A 1I07A 3CXCS 4IKFA 4DV1L 2CW0D 2RQUA 4HJ5A 1B7TA 3OS0A 4M7AG 1VQNT 1JWMD 2QA4A 1AE2A 5GMKj 4K5VA 3HGBA 3OW7A 1VQ7A 3L7ZC 1SSOA 1PCXA 4J6WA 1HJDA 1D0YA 2BDNA 2GTJA 1KC8U 4OP0A 2HIXA 4A4HA 3BDUA 2LSSA 1TQOA 1YJ9Q 3VKIA 1R9TB 1LTID 3G71Q 2JZ2A 1UGVA 1O7ZA 1AEXA 3VRYA 1PHJA 1TR5A 3EGXA 2MP1A 5JPNC 3OOCA 2E8GA 4X3TA 1VQ4T 2F0QA 5C0XI 2E65A 1CSKA 1M5Q1 3LH5A 1QG7A 1SMYD 3RLOA 4BUGA 3K5LA 3CC7T 1MI2A 1Q86U 4DF7A 5I9PA 2L3PA 1G6PA 3S1QH 4Q0FA 3H15A 1SROA 1GUOA 2J6FA 1WCMH 3HOUG 3R6OA 1S72T 1VQNQ 1BKBA 4M77E 4N0AC 4LNQA 1UE9A 3CPWA 1Q12A 2F4IA 3L2UA 5KYXA 2EFIA 1PFBA 4EX5A 4BY1H 1WXTA 3KF6B 1GBRA 1ET9A 4ZK9B 1H3ZA 3T1HQ 3M0QA 2LCSA 1NTGA 2KVQG 5CYUA 3TP5A 2C0TA 3EQLC 1VQIA 4DOWA 3MZ5A 2GN5A 1AEYA 2M00A 5IHNA 1ILPA 2C0IA 2XNAC 2QTVA 2PVGB 4DA2A 3RZOH 1UE6A 2ZJPA 4Q5VA 2ESWA 3NBHA 4EMKA 1JQQA 3FKIB 3S16H 5FROA 1WJJA 2L12A 3HOYH 3S3OA 2Q2TA 4LFBQ 4A76A 2JS0A 3SK5A 5IY0A 1PTOD 2DFUA 2CWPA 4BWGB 4N9PA 1F2MA 4BY6C 1D09B 1RLQC 1VQ4Q 4XT1B 1QCBD 4KKSA 1N8RU 2BOSA 5ELFA 4CC2A 2RI3A 3SD4A 1KFZA 4H0LC 3MHBA 2I46A 4Y92A 5A2QL 3J81c 2O01E 2LS01 3CC7Q 5GROA 5C44H 1H9MA 1K83B 3HP3A 1K8OA 2NTSA 1IW7D 1SHFA 2COYA 2PCFB 2J6KA 1S72Q 5IP9G 1MNEA 3U4VA 4F7UE 1YNND 4DAVA 3PO3B 1SFOH 3NTHA 1QKWA 1MJEA 1Q81U 3IFTA 4JI2Q 2XWJB 2K14A 3CU7A 1H641 3PV0A 1XPRA 4F7XA 2HHHQ 1B50A 2EKHA 2F3WA 1LLRD 3A8HB 2WB1B 3EFOA 2Y4YA 4CDDC 1X3QA 3OYGA 1ASZA 4A3CG 4GKJQ 1G8XA 2DBKA 2KT1A 4AMCA 3S14B 1ZSZB 1Y57A 2G3RA 4RCBA 4HJ7A 2J7ZA 5HGTA 1G3SA 2QQ9A 2JA9A 4A3EG 4JS4A 3HOVG 1JR0D 4DK0A 5CO7A 1LNXA 1YWOA 3KFVA 3KJOA 1AT1B 5IH2A 4HR7B 4FXDA 1CKMA 3QZ9B 5D65A 1NE3A 1OZ2A 1PKSA 1G51A 2RBMA 1HNWQ 2RDHA 4A4EA 4AYBE 4OX9Q 5L8RE 4JOIC 5COYA 4XTZA 2YTXA 1WNLA 4IIMA 3MWYW 1J8IA 2NVYH 5C0XG 4K0KQ 3EG9A 1OV3A 2LY7A 2IJ0A 3QG1A 1ZXTA 3VYTA 3T1HL 5LJ5d 2WINB 5KE3A 2DIQA 1M4VA 3G6JB 1PH3A 3I4NG 2WP8J 1IB8A 1YEZA 4TVRA 5IYDH 2A08A 2QQSA 1A15A 1C9OA 3PIPA 3S15B 4H44C 1PWTA 1ZBJA 2FG0A 3HPWA 1IBLQ 2HMAA 3I3CA 2FRWA 3FRNA 3M0PA 1EFID 3LNNA 5A2QE 2LMJA 4LFBL 5BN4A 3I70A 3QIAA 1X3GA 4FYVB 2P4RA 3UE0A 2NUZA 1VQPA 1SR3A 5GJWB 3BYYB 2LCCA 5GMKl 1OZ3A 2OQ0A 3LGFA 4ULLA 3JCMb 1TS2A 3U58A 2C06A 1ENCA 4PJOC 2QILA 3TP6A 1VQMT 1B44D 2WV6D 1WCMB 4GOPA 2FMMA 4YCVA 2LQKA 3A56A 2P0KA 2M02A 5FO8B 3OS5A 4OB1B 2A74C 2AWNA 1ZKOA 1YHQT 4JI2L 4UP9A 2B2WC 3T13A 2HHHL 2D1XA 3CQZB 2LX7A 4DV6Q 3CCRT 3TS2A 2D9UA 2K2MA 1OI1A 4J1MA 2D8JA 2Z1CA 1YI2A 4LE9A 4Y7NH 2HKNA 1QLYA 3VYHB 3NHHA 4YY3Q 5GAMe 3PTAA 2AWOA 1SYBA 2EJFC 2HBPA 1V1QA 3K81C 2CREA 2HIVA 3P20A 5GADC 4DR7Q 3E5SA 1AE3A 2R92B 4QIWB 4C3HB 2A0FB 1KDBA 2XTIA 1F1BB 1M1KC 3KYHC 4KV6A 4V190 5IGFA 3S16B 1E7OA 1FWZA 2ENMA 1M1KR 2MK5A 1II3A 2RK1A 1NYFA 4OMMA 3E9IA 5CV4A 4J9IA 2UUBQ 4L5RC 4CKBA 3GPLA 2VV5A 1YNJC 3Q0AA 2G6FX 4DQ2A 2R5MA 1JCKB 1FGUA 4E2FB 3PIOA 1K0XA 1S5ED 5DEHA 4HIKA 4OX9L 4C8QB 2YTYA 1T0JA 1YJ9A 1OYXA 5JOBA 2ZT9C 4RKLA 4LF5L 2CH4W 1TWBA 2GBQA 3RERA 4C3IH 4XU3A 3CMAA 2JNGA 1VQMQ 2FL7A 1UE5A 4RG1A 1R0BG 4LDWA 2ZTEA 3DLLA 3L0OA 1I94Q 2E3HA 1EIFA 1ZLMA 3EJIA 2EZVA 1SYFA 1SFOB 3JB9I 1KJWA 1YHQQ 2HCCA 1VQ8T 2BH8A 2DNUA 2RDFA 4M7DB 1IBLL 5I22A 2EYQA 3CCRQ 3HOWH 3RKXA 2YWWA 1CZWA 3IQLA 5D6WA 2AKWB 3TBIB 1B9MA 2HSEB 1X01A 2YLBA 4BXXH 2RQRA 2YRVA 3VU3C 3DWAA 1VQNA 3EFXD 5TSSA 2QEXA 1LTRD 3A7LA 4H13C 1X32A 3TSZA 2YDLA 3JCMW 1W6KA 1Y1VG 3RNUA 5G3LF 2JS2A 1ZYRD 1TWAH 2KVMA 3VYGA 4A54A 1BBZA 1NEGA 2KXCA 2YHTA 4DBHA 3V8KA 2FPEA 3CC4T 4X3UA 2DF6A 4A4IA 1JE4A 1PRTB 2HEQA 3TEEA 3GTMH 2O2LD 1BBXC 2NVYB 4M78F 3QDRB 2EJMA 4A3LH 4DV6L 1YITA 2Z6KC 3P1HA 2KYMA 4EGVA 1UB4A 2HBWA 3HRSA 1QZGA 2DJGC 1WHJA 4OMPA 4AYBG 1HQMC 4YY3L 1QVFA 4BY7H 3ASKA 1I50B 5FKAC 4DR7L 4M78C 2DTIA 2MPMA 1VQ8Q 1VF5C 4BE0A 3ICEA 2KCCA 4N4HA 3T1YQ 2DXTA 4PNOA 1CSQA 5GAOr 3NENA 2JW4A 4LF4Q 1LVKA 3N52A 2NZ1D 1EWCA 2RH2A 1JJ2S 2YRCA 2UUBL 3CCUA 2F0UA 1DOLA 5CVIA 4J6YA 3KJPA 3AMUA 1VQCA 4UHVA 1T9HA 3NQIA 3RNJA 2JM8A 1FR3A 1SNQA 1TWGB 2GFUA 1W6XA 1GD7A 3LYIA 4CC4B 2RO0A 3F1ZA 4OIJA 2B63H 1NPRA 2GTOA 1WQ7A 5GAOm 3DEOA 4KI0A 4ANJA 1I94L 2F0VA 4R0KA 4HSPA 2E6NA 3KF6A 1X27A 2RJDA 4C1NI 1VUBA 3M85A 1PYWD 3HFZB 2D2CC 2NVTH 3W2DA 1CI3M 1WTVA 1U5KA 2ZPBB 3FJPA 1VS0A 3SEBA 1H9RA 1Q46A 3OWFA 4IFDJ 1QCFA 4C92F 3MEWA 3VYRA 4Y7NB 3ULPA 3FIFA 4NOYA 4DV2Q 3E9GA 2YLCA 4DEYA 3PUWA 3AEVA 4J7FA 1HCZA 1PSFA 3CCMT 2K5WA 1SE8A 2EY5A 5CBEE 3I4MH 4C92C 4MMLA 3F70A 1JB0E 4DR3Q 3CQTA 1H9KA 3OMGA 1SRMA 4B3RL 4FF4A 1KDCA 2DYBA 2E5QA 3H8ZA 3PF5A 2L15A 5C4ZA 4A3JH 4PJOE 3GTKB 1PD0A 3K80C 4RFBA 1OO9B 2K5VA 4PKCC 3IKJA 2ZM6Q 2JA7H 2KRMA 2QYZA 5LL6S 1T5XD 2NUCA 5HGQA 2EIFA 4BDYA 1O78A 4C3IB 4RGTA 4HSVA 4X3SA 1VQGA 2PTKA 4JJNK 4GLMA 2DIGA 2DD5A 3HS0C 1F9QA 5AYFA 4FVMA 1QZHA 4PQXA 2VUMH 2I0NA 5LJ3f 3NSWA 2X4WA 1LTSD 1LJOA 4QMGA 3J81j 4N9TA 1ZSZA 2IX3A 1X6GA 2LT4A 5IXFA 4R55A 5ELDA 4LF4L 4FYDA 2R61A 1V1PB 5JEAJ 2BE5D 2QDYB 1X75C 4NKLA 4R4OA 3Q6SA 2DE0X 4XYOA 4NL2A 4E6IA 1AD5A 3NE5B 2D0NA 2LJ1A 1KD1U 1F9PA 3CCMQ 4JLGA 1J3TA 3A8LB 2RPNA 4A3KG 5I2SA 4Y52H 1XNQL 1IO6A 2WAQG 2RJEA 3EG2A 3OW2S 1EY6A 1TWAB 3F8TA 4CJ0B 4PNYA 1EY7A 1MMAA 6AT1B 1K9MU 1ENAA 2F0WA 4XK8E 1NG2A 2TMPA 1D2BA 3AYHB 1STNA 1TKWB 1UECA 2D0PA 1NBWA 1TUCA 2X51A 5IP7G 1R8OB 2H3EB 4A3DG 2PNHA 3MA2B 4F8MA 3GO5A 1B8AA 2E64A 2LMCB 1C7YA 3OWEB 4JRPA 2E5LQ 1JOOA 2QF7A 3D3RA 1MMDA 2D5DA 1PHTA 4JRIA 2K75A 3D8GA 2HQEA 3VS1A 1SNCA 1ESFA 3J7A5 5J39A 4KMUC 4R9WA 5EG2A 3KF8B 2LC4A 1KQSS 3GTPB 2EYYA 3CBPA 4DR3L 3HOUB 1I6HH 3R6NA 1WXUA 3VS6A 2JA5H 2DA9A 2JJQA 2MCNA 1VQ9A 1XNQQ 3EFRA 4QVZA 2F69A 4KBMB 4C8QD 3NGPA 3JB9J 5E4WC 3GIBA 1E3PA 3L2QA 1AWWA 2R3ZA 4NXNQ 1QWEA 3HKZE 2MGSA 2ZM6L 1PTOH 2VXWA 3LLRA 1BCOA 1HNXQ 4ZLTF 5FLXL 1MGSA 1SE2A 2DTOA 5HK3A 1D8LA 2M51A 2QA4T 3OSSC 4M7DD 1WFWA 1I5LA 2DN8A 3PO2G 1KLUD 1N34Q 4OF1A 1AZEA 4ME3A 2JXBA 1EFNA 2AHJB 5J26A 2X3XD 1D3BB 3CCSA 1HFGA 1D1BA 1UGSB 3E9HA 4JC0A 3ZYYX 5C4XH 5GAMj 3T56B
chains in the Genus database with same CATH topology
4XTWA 3N6RA 2E41A 4M78E 2WSEE 3A8OB 1LT4D 1ZQ1A 4G7ZC 2F0EA 2FB7A 1BXTA 4E7IA 4B9XA 2GF7A 3RUZA 4XTYA 4FSXA 2FYKA 4A4GA 2DZCA 4N4GA 2ID0A 4KKUA 2JVVA 4IFDH 1NPPA 4C8QA 1Y7XA 2IVWA 3UPUA 4MDXA 2KHSA 4TKOB 1PRTD 4RCNA 3MXUA 4C1NK 1G3YA 3RUXA 2JA7B 3OBWA 2DY8A 1LTGD 5IT9E 1HFNA 1TT2A 5I6WA 4M1UB 4A3EB 4M7DA 3HOVB 4PJOG 1VF7A 2KECA 2SEBD 4RWSC 1N6AA 5GAOn 3S2HB 5GAOq 5IN1A 1DXMA 3BS1A 5CBAE 4J8OA 3QZ5B 5JJZA 2FVUA 1G8ZD 3JCMX 2EYJA 4FF1A 1V8QA 4ZRZA 1K8MA 1W2BA 2KA7A 5EPJA 3DMUA 5D6XA 3SWNB 1HTPA 4C92D 3SK8A 3WOEA 3JCMe 1O9SA 3TZDA 5JEAH 3M4GA 4GY5A 5GAN8 2RQXA 3VA7A 5I9OA 3C3LA 2R58A 1Y8OB 3GTLB 2P0QA 2JA8B 2EKOA 1LTBD 2K1BA 2VXEA 2RHYA 2PZWA 5DAUA 1F2ZA 2FFKB 1F9SA 3VUZA 2PVOB 1TS5A 4EMKC 1WQWA 4XXEA 3I72A 1HTLD 2VB2X 4UC4A 1EZ6A 3DEPA 5FOBB 1PFMA 2NLUA 1V1OA 1RL2A 1M8AA 2DAQA 2J0TD 1SMYC 1RD9D 3RESA 4X9DA 4HCSA 2J4XA 2IW3A 1HXDA 4O42A 4ODGA 5AFWA 3C4SA 1EYCA 2K5IA 1EZ8A 2Y90A 4KD3A 4YIJA 3V96A 2CZ6B 1C8CA 3CCJA 5J1ZA 3M4OB 4OB0B 4A53A 3X3NA 1NUCA 1HA5A 3JAME 3RLFA 3DUZA 3AU7A 2GA4B 1PTOF 4DU9A 4ATOA 2QXFA 3M57A 2GFAA 3DM1A 5EQ0A 3OYYA 5C6SA 4R56A 4KKTA 3Q23A 2F0HA 1PTOC 1Q90A 2NB0A 5FU7C 3CEYA 1VQKA 5LJ3d 4B9WA 1VQPT 4MDWA 1KLGD 2K57A 1V29B 4TQUS 3H6MA 1GUSA 1GXDC 4LK1C 1VQ5A 1F2YA 1HUMA 1R4PB 3NTIA 4XQNA 1W6JA 1I4QA 1YNNC 1X6OA 2I2LA 1GHJA 3QO3A 3KUFA 3CKIB 2CS7A 4N4IA 2V8JA 1I4GA 4MHEA 2RJCA 2XK0A 2CYZB 1V1PA 2EY1A 4KJOA 3RKYA 1EY4A 5I2YA 1EY9A 3UI2A 1KABA 4E7KA 4L6V5 4QW2A 3QYGB 1KQ2A 1QNKA 1YI2T 4FXKC 5NUCA 3TDQA 5CV9A 1GOZA 1WTOA 1LOJA 2K03A 2PVDB 2X6GA 2EQKA 1SJED 1B3AA 4G7OC 2O4XB 4UAIA 4OO1H 2VB3X 3OYHA 4BB7A 4DA4A 4LAAA 2B2YA 2K2VA 4DGZA 4HKEA 3GNFB 5LJ5e 4FIBA 1HRJA 4QUCA 4KY7A 3C94A 1PSEA 1BI0A 3QBYA 4ME5A 2LX9A 4XAXB 3CMAT 4IUNA 4M75B 3FPPA 3BW1A 1EIGA 5GAN6 2XN9C 3KF8A 4KHZA 5I2MA 2EOTA 1Z7TA 3VYSA 2RK2A 5C4JB 1SNMA 1WJRA 1JWSD 2A6HC 4ZUIA 2DEQA 4ELZC 4NS5A 1KHCA 2K3YA 3CXCA 4M75F 4JLIA 2K28A 4EMHA 3URGA 5GAMh 2Q8RE 2QEXT 3GQBA 4V2SA 3VJPA 3QJ6A 3M55A 4MZMA 3J80E 5GAN2 1SE3A 1TWHB 1ONLA 5KYLA 4XQQA 1D3BA 3HEJA 1QE6A 3M58A 4XU2A 4EQPA 2XIWA 3A8IE 4RKBA 1SYGA 1PFNA 1YITT 4DXGA 1D5XC 3EA6A 5EJWA 3HFNA 4L8JA 1N9SA 2K4YA 2FHDA 2EAYA 2A73B 4RGMA 5KRUA 2NVQB 4BE2A 3JB9F 2XI9A 3GF5A 3LW5E 5IGGA 2CZ1B 3C1FA 1PDQA 3V05A 3GTQB 3PMIA 4J8QA 2X4JA 4O5VA 5CKFA 1MSGA 3P8DA 3CCUT 3SB2A 1BI2A 2E70A 2EWNA 3VR4A 2IPKD 3OIQA 3NPPA 3CCLA 5D6YA 2L5TA 5A35A 2EYPA 2DNEA 1DJ7B 2D62A 2WAQB 2F1MA 4U68A 2C9OA 5J3BA 5CC4A 3D4RA 3HFOA 2H4OA 2FMCA 3SWNA 3WXMB 1ZYRC 3L1AA 2CZ0B 4A3DB 1M1KU 2L0CA 2EE1A 2F5TX 2OEOA 2Z4IA 1STEA 2I07B 4WFN3 3CCET 1AZQA 3A55A 1CA6A 1SNDA 3WVEB 1HK9A 2RVLA 1B2TA 3D6CA 2R5AA 5K36H 1OXVA 4DAYA 5LJ3g 1UEAB 2RB6A 2JP1A 3BYTB 1Y8NB 5KE2A 3R2IA 5C4HA 1SSFA 1CHPD 2K32A 5CKEA 4KHVA 1LT6D 1VMPA 1FD7D 3VA5A 3MFYA 1EQTA 3OYKA 1U4LA 3OSOA 2DXCA 3R3OA 2K5FA 3TMEA 2F0GA 2XRQD 4XTXA 2EY6A 3PO2B 1C4QA 3MAQA 4A4KA 1JRIA 3P75A 1IYUA 3BDLA 1WD0A 1WTRA 1TS4A 1CZGA 3BDOA 1GJXA 1Q1EA 2MMPA 3Q22A 4YTLA 5BN3A 2JEBI 2LQ8A 3OY9A 1G3TA 3E19A 2VXFA 4ID6A 3J81L 2HQXA 4PV1C 2NN6H 1CQVA 3CRKC 2LDMA 3ZEHA 1B53A 2ZGWA 3O13A 2PZUA 1MD2D 3LH0A 1FX7A 3QUIA 1KC8C 2A6HD 5GAMf 1KG1A 2F0TA 2IX0A 1G3WA 1VQ9T 3RD4A 2L8DA 4MN3A 2B39A 5LL6X 2MI6A 2A68D 5I6YA 5EKIA 4A3IB 1BQQT 2G9HD 3PUXA 1DONA 3I91A 4M75D 2D0QB 2X4XA 4CJ2C 1U4PA 4RCOA 2Q8TA 2BE5C 1Q86C 3PUVA 5C5MA 4M77G 1I3QB 4KTAA 3CCST 3NTKA 5LJ3h 5M9OA 1KQ1A 2XWBB 2JXMB 4BI4A 5FK9C 2DKGA 4DAPA 3Q24A 2E10A 3OYMA 3M7GA 4E7LA 4OGCA 5KNBA 2O4XA 2B2UA 3M56A 2XIDA 3OS2A 2BIVA 4X3KA 3AHUA 2PUKB 1JC7A 3JB9D 2QI2A 1JICA 1NJIC 3HOZB 1DM0B 5C0XJ 4M75A 2A6EC 1RDPD 2EDGA 4C8QF 1Q3LA 2VGMA 1BUVT 1PZID 5DNFA 4D6WA 1N8RC 2WKDA 2F03A 2RHZA 2F0LA 1SXTA 4F7UG 5GMKh 1LABA 1JBMA 3WOFA 2CZ7B 4C8QC 2E12A 3QIIA 2DD4A 2RHUA 5CCAA 3FEWX 5EPLA 2YU9B 2L4NA 2DO3A 4MMKA 3KK7A 4M7DF 3LWUA 4XTVA 2KSSA 5ISRA 1PLFA 1K73C 3S6WA 3QPHA 4FL6A 4C0DB 5D3DA 1YJWA 3J7AF 4M7DC 1QJOA 3I90A 1STAA 4OB3B 3WDNA 1KAAA 1EL0A 4UDUC 2WIIB 4VUBA 5GAN3 3K58A 1EY5A 2GCXA 4XYQA 4IUPA 5KNDA 3PGGA 3TU4K 3QOLA 1PRTF 1S5DD 1STYA 2OXPA 3MFGA 3NP8A 3KBGA 3FPUB 1JWUD 1VMCA 3MCAB 4KUDK 2XHCA 3I4LA 4FT2A 1JJ2A 1SYEA 1F77A 1G2SA 2K05A 1PRTC 1RHPA 2RI5A 1I4PA 5BN5A 4G4KA 2FINB 4QQ6A 1L0YB 1GXIE 2MWOA 3CBMA 3G7LA 2M9UA 1BCPB 3PUZA 3HRTA 1JOKA 5CV5A 4A3FB 2A69D 3CCJT 3PT9A 2PPBC 3JCMh 1Q7YC 4XQ3A 1D5MC 2OTLT 1BCPF 2RSNA 2RSOA 1GHKA 1F2LA 1SE4A 2B2TA 1U9RA 1M90C 3MC0B 4O1NA 2HUGA 4RGNA 3G6ET 3H94A 2KOLA 3CCEA 5FRMA 5CQYA 4TSSA 4E7JA 3CC2A 1VQKT 4DXFA 2KAFA 3V2TA 1TWCB 2AQ3B 2OAUA 3ONAB 1YIJA 1QVGA 1VQ5T 2DTHA 4Z9CB 2K6AA 1SNPA 4QVDA 3KXTA 4RA8A 3E6ZX 1WVLA 5KGUA 2M0OA 2DNCA 2K01A 4FP5D 5JVH3 1RJTA 4M7AB 3OYAA 4L5GA 4ABNA 5EBDA 2C5CA 3K7AB 5C0XH 2LTOA 1O7LA 1ET6A 1FYCA 4C3JG 1OXXK 3PMTA 1FNVA 1S4ZA 1A3UA 4BA2I 1HHVA 3OW2A 4M7AF 1M1GA 3NWTA 1UAPA 2MJ8A 5CORA 1U1SA 2ZXOA 2ZPFB 4CHTB 5C3WA 3CCQA 3LWHA 1WTPA 2B2VA 3MXGA 4DFAA 3UDCA 3HRUA 4ZYSA 1TH7A 3SK6A 3M59A 3T4AC 1UGRB 5GAMd 1Y8PB 2EQUA 2EXZA 2VYTA 2E2HB 4E7HA 2WSCE 3U9SA 2X6LA 2ICIA 3K59A 2VC8A 4NP5A 4IURA 5ELEA 4BI8B 2A6ED 3MVVA 1WJSA 2FHTA 1F9RA 1GUNA 5IAYA 1N9RA 2E76C 3TSSA 1KQSA 3S1RB 1PZJD 2E2IB 1B1ZA 4C8QE 3EROA 3AB9A 3FVQA 4OGEA 4ZGDB 4OB2B 2B2YC 2E2DC 3A8MB 1ICWA 3X26B 2IL8A 4A3KB 2R7ZB 1JORA 3H0GB 1RTOA 5JAVA 3PUYA 3S3MA 4M7DE 2PW5A 4C5GA 5CV8A 1NSNS 1EIHA 3FB9A 2PMZB 5C3EB 2XG8D 4F88A 3WVDB 2AQ1B 2HNIA 3M54A 2L89A 2NVXB 4ZKBB 3QJYA 3OBYA 4CGYB 2DXUA 1E2WA 3S17B 1L0XB 5IGCA 1OXTA 3EVQA 5GANe 3H09A 4C5IA 4BDZA 3OYLA 1E0BA 5DM63 2E6ZA 2EVBA 1VQLA 4LDXA 3OHXC 1BO0A 1JQYD 3DB4A 2RHIA 4FT4A 1SAPA 4KJNA 3G4SA 2F0NA 3J7AV 1ENFA 4BD3A 1JOQA 1QWYA 3JCMf 2ZXPA 2NYZD 1X3PA 2M16A 5KIXA 3KLRA 3JCMc 1B9NA 3CCLT 1EU4A 3D4DA 1BIAA 3RMQA 1XOVA 1TY2A 5E4XA 3LX7A 5CKDA 5CK9A 4C0GA 5FLXE 3P8HA 1LT5D 4EVOA 4DOVA 4RKUE 3ZBDA 1YBYA 2AUJD 2R6GA 2KCNA 2F0OA 4C92E 4PLIA 3HOXB 2JUFA 3I4NB 2M2LA 3LX0A 4C0ZA 1VQOA 3S1NB 1BCPD 4LDYA 1GUGA 1STGA 3RMHA 2JTFA 4QF4A 1NCVA 5T1GA 3META 3PIP3 1QP2A 1Y71A 1Q82U 2EYHA 3V7CA 1FNWA 3K5OA 3V8LA 3ME9A 3T53B 3P7JA 2CKKA 4BBRB 5CV7A 2LNVA 4ZN3A 1W2BS 3M7NA 3FDRA 3GLXA 4GLKA 3R2TA 3OQ5A 2RHXA 3SWNC 1K9MC 3I55A 2F0MA 3TCJA 4C5HA 2WACA 4EQNA 4F87A 3X3MA 4Y28E 3OA6A 2K04A 1QW1A 2D6FA 2E75C 2G9DA 2M9VA 2D9TA 1PZKD 4R8NA 1I4RA 2QCPX 3M9QA 4RHRA 3OYEA 1Q1BA 2AUKA 4M77B 4EMGA 2ZXRA 2JEAI 3BZDB 2HDLA 3JB9H 4K2KA 1I4XA 2SNSA 4XT3B 3FEOA 3MP1A 2OTLA 1TIID 4M7AD 2K7VA 1CM9A 3GV3A 1Y69U 5F2DA 2ZCFB 3N5BB 1I4HA 4L6TB 3G6EA 2RD1A 4BS9A 2RJFA 2ZZDA 1I6VC 2EQMA 3K5MA 3D4WA 4KY6A 2GQVA 1I8FA 4CI0C 3MEVA 1D5ZC 3L2VA 1XTCD 1I81A 3FDTA 2EYMA 5GAMg 4M78G 4MIUA 3INZA 5IGDA 4X34A 1M4ZA 4CRIA 2XKOC 4F7UB 3R93A 3RMSA 4FF2A 4ZQ3A 5ELBA 3CCVA 4IN3A 3JRZA 3MP8A 4A3MB 1BI1A 4M7AA 2QKIC 1Y1VB 1ILQA 4J83A 1LACA 4ZKCB 3L42A 1PXUA 4KULA 1BYMA 2F0SA 1EEFD 1H9SA 3LGLA 2LKVA 2DK3A 2OTJA 5DM7R 2F3VA 5KYIA 2H1EA 4AYBB 1HPCA 4II1A 4RH6A 3P8BB 2A3LA 2DPPB 3T16A 3A8JE 2BA0A 1NAPA 4L59A 1PMRA 1VIFA 4C92G 2BDOA 2N55A 2ICEC 1NE8A 3NWSA 4LD9K 3FMCA 2PZTA 3OPOA 4LDVA 1XQHA 1DZ1A 2P0PA 4PMWA 2LVMA 1KDAA 1CFMA 2KUMA 4I7ZC 1QP3A 1ZHIA 4KN4C 2CQAA 1SEBD 2PU9B 1MSHA 3A8KE 5D14A 2DZ9A 5I4DA 2B2UC 1B4OA 3C95A 2PQEA 1ESRA 4BBSB 2F0DA 1Y1WB 1XX8A 1G6ZA 3MP6A 5EGTA 1NR4A 4V0BA 2EJGA 5FO9B 1G2TA 3HL8A 1TY0A 2A68C 3CD6A 1O80A 4M75C 2JA6B 4ZUJA 3SFMA 4RHSA 4B08A 1AN8A 1DOMA 3GTOB 4C3IG 3DWQA 3ERQA 1AFPA 5I2XA 2YYZA 1YJWT 4JRQA 1IZ6A 1IKMA 2SOBA 2KQWA 4RGOS 5GANj 2JSOA 3OB9A 3CMEA 3W3AA 1XNIA 2K5LA 1C48A 1J9OA 1RODA 2L5QA 2CHBD 3JCMd 4K14A 4QUFA 2OT2A 3NQTA 4ZTJA 2NWGA 5C3XA 5KCOA 3T9NA 1VQ6A 3L3OC 3O8VA 2VNUD 3V8JA 2XDBA 4RG8A 4OIKA 1FXXA 1SYDA 2XD0A 3GP7A 4IUUA 5HKCA 3SVMA 1IYVA 3A5ZB 4U673 1HA6A 4HCBA 3L2WA 3OS1A 2L3RA 2VGNA 4EQOA 2JYOA 3CHBD 4HN7A 1LO5D 3BFMA 1IREB 4C3JB 4RG2A 5GMKi 3FLGA 2Z8LA 4J6HA 2XU8A 1E2VA 4O6JA 2H3JA 2RM4A 3KUPA 5M5WB 4QQGA 4HCEA 1G291 1Y96B 3CPWS 3JSCA 4BY6B 4M77D 3U9OA 1KTKA 5CR3A 2L9HA 4GZYC 1G91A 2A7YA 1K8AC 4K6LA 1SYCA 4S3SA 3K0YA 5CAIA 3CC2T 4BA1I 2IG0A 5CR2A 2E2JB 3DWPA 2ZPIB 3NUCA 2WKCA 4A4FA 1NJIU 4RAUC 1YIJT 5M5XB 3JCMP 3C1EA 5M5YB 2NTTA 3OYIA 4BACA 3X28B 2B2TC 3GTGB 4LDUA 3UWNA 1UUPA 4ZN1A 4G7HC 2CGHA 1BF4A 1MHNA 3HKSA 3V7SA 3HP9A 4PMCA 3X25B 2KJXA 3C46A 3M3YB 3VUBA 4L63B 2F5KA 2M1HA 1S5BD 1U4MA 3A7AB 1EYAA 4M77A 2Q8IB 1B34B 2JOYA 2RA4A 4DNTB 4K2LA 3TP7A 1W4SA 3QOJA 1K73U 4HMJA 1HXYD 1HQRD 2A69C 3EFSA 4A3BB 3KLSX 4P5NA 4JBWA 2F0PA 2R93B 3CCQT 2KEDA 3JCMJ 1BI3A 1P92A 1N27A 4P2CB 3OYFA 1U8RA 2F0IA 4IZ8A 5DLQE 4IFDI 4X9CA 4K5XA 1FNUA 2EYFA 2ZPHB 2V8KA 2F0KA 2F0FA 5GAOp 3SR1A 2B2VC 5GANg 4PLLA 4PJOB 4K8JA 1WTXA 2CVRA 3H6ZA 3MEAA 4F7UA 1XTDA 4NMZA 3E9FA 2EY2A 4J6XA 4M75E 4NL3A 3SK4A 4HT8A 1DYQA 3SXHA 2PUOB 4JS5A 4HMIA 4PJOF 2IX1A 5C6AA 2F0JA 3BG3A 3SHLA 5KEEA 1CQFA 1I4K1 4PL6A 3IFDA 1WPYA 5IIFA 1YJNA 2MF2A 5CKBA 1Q7YU 1CK1A 4NDXA 3BVGA 3S1QB 4C0FA 3OMCA 2EYOA 3NBIA 3I56A 3PFSA 3TN2A 1BR9A 1M90U 3BY7A 4HTHA 1SJHD 4OL7A 5GMKm 1STBA 4BY1B 3G7ZA 2RA2A 2ZPGB 1VQLT 2K33A 5LJ5j 3SE0A 5D3IB 3J81E 3J7YW 4HA8A 3JCMg 2O5IC 3RZOB 4K6DA 3GOXA 1SDFA 2EQJA 2B8AA 3G4ST 3K57A 3HOYB 4BI3A 1FGBD 4OVAA 4XIGS 2VUBA 1VIEA 3M4YA 1OXUA 2HD0A 4HT9A 5C44B 4BE1A 4HCCA 2XRSD 2BKDN