4B9WA

Structure of extended tudor domain td3 from mouse tdrd1 in complex with mili peptide containing dimethylarginine 45.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
196
structure length
196
Chain Sequence
b'LEWTWVEFTVDETVDVVVCMMYSPGEFYCHFLKDDALEKLDDLNQSLADYCAQKPPNGFKAEIGRPCCAFFSGDGNWYRALVKEILPSGNVKVHFVDYGNVEEVTTDQLQAILPQFLLLPFQGMQCWLVDIQPPNKHWTKEATARFQACVVGLKLQARVVEITANGVGVELTDLSTPYPKIISDVLIREQLVLRCG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TUDOR DOMAIN-CONTAINING PROTEIN 1
publication title The multiple Tudor domain-containing protein TDRD1 is a molecular scaffold for mouse Piwi proteins and piRNA biogenesis factors.
pubmed doi rcsb
source organism Mus musculus
molecule tags Replication
total genus 46
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00567 TUDOR Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4b9wA02
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4b9wA01
4BE0A 3QOJA 5CV6A 4QQDA 2ENBA 3Q1JA 3EVQA 2PQEA 2EQKA 4BE2A 3SXHA 2NUCA 3E9FA 4K2LA 2RJEA 3QB3A 2RKSA 2M16A 4II1A 3L42A 3L2RA 3OMCA 3MP6A 1U9RA 1EY8A 4KV6A 4N4GA 3MEHA 1ENCA 2PQWA 1KDAA 3P1HA 1KAAA 5CC4A 5KIXA 2YRVA 3P75A 2EYJA 2IG0A 5KCHA 2L89A 4IUUA 1JOOA 5J26A 2RJFA 4A4HA 3S9WA 3NHHA 2F0UA 2KQ3A 2SOBA 5E3FA 4EVOA 3OYGA 1TQOA 1F2YA 3SK4A 4KD4A 4IUTA 2F0LA 5HGTA 1KABA 3OYMA 4B9WA 1IHZA 2XDPA 2EY5A 5J22A 5JOBA 4ME5A 1WJQA 2X4WA 5C5MA 4ZUJA 3META 3ZEHA 1WJSA 5IGEA 3F70A 1SNDA 3OYAA 2F0IA 3MZ5A 2EQMA 4ID6A 4KHVA 5IGBA 4N4HA 3OB9A 3OYKA 4ODGA 1RI0A 3EROA 2RI3A 1SNQA 3S6WA 3NUCA 2F0HA 5D6WA 3E5SA 4NP5A 5JAVA 2EYFA 2EQJA 2L8DA 4N9PA 3VA5A 1JOQA 3MEVA 1JOKA 3DB3A 1SYCA 5KGUA 2PZUA 2RI5A 3HZXA 3EJIA 1EYAA 1SNOA 1F2ZA 5CIUA 5DEHA 2F0MA 3O8VA 2RBMA 4K5VA 1SYBA 4C5EA 5IAYA 1SYFA 4B9XA 3H6ZA 5CR3A 4J1MA 4C5GA 2DIQA 5EKKA 5CGKA 3MHBA 3DHQA 2PZWA 3SK8A 3OYIA 3NXWA 3SK5A 2GFAA 4LD6A 4C5HA 3LX7A 4E7IA 3NTKA 4KJOA 2RHYA 4J6HA 2EY6A 2L3RA 2F0DA 2X4XA 4HMIA 4QB4A 4IUQA 2F0GA 1SNPA 3TP6A 3L2VA 5EKLA 3OY9A 3H8ZA 1SNMA 2F0EA 4MIUA 2X4YA 4ZTFA 1EY9A 3OS0A 4HTHA 3H6MA 2EXZA 2JTFA 3MP8A 1EY6A 4BDZA 5J1ZA 1A2UA 1EY0A 3D4DA 2EYPA 4F8MA 2EYOA 2RHIA 4BE1A 2B8AA 2KHSA 3FEOA 3OS2A 1AEXA 1EZ8A 4QW2A 2F0QA 2DAQA 4DGZA 2OF1A 4KY5A 5CV4A 5C4HA 2R5MA 3DMUA 3UT1A 3PMTA 3T16A 3GOXA 3LYIA 2F0OA 2F0KA 2SNMA 5ISRA 3ERQA 1A3VA 2BUDA 4K5WA 4E7LA 2F0PA 4Q5WA 2F0WA 5C3WA 4LAAA 3OQ5A 1SSFA 3L2QA 5I9PA 5KRUA 4RKBA 1SNCA 4WORA 4E7KA 2OEOA 4K8IA 2JZ2A 3SR1A 2EYMA 4K5XA 4NDXA 2LDMA 2F0JA 5I6YA 1OI1A 4A4GA 3OYNA 3OYCA 2EYLA 2RHUA 4PL6A 4IUPA 3KUFA 4EQOA 4QQGA 3P8DA 4K8JA 4NKLA 4K2KA 2CKKA 3OS1A 5J39A 3TMEA 3HEJA 3P8HA 3ASKA 3DB4A 3BDCA 2RJCA 4ZUIA 2RI2A 1STAA 5CV8A 3LH0A 2GF7A 2R57A 3CEYA 2HQEA 1F2MA 2PW7A 4PMCA 4Z02A 3PMIA 1MHNA 2RO0A 4N9TA 4NMZA 3OYEA 3PMFA 1STNA 2LTOA 4WRDA 2FHDA 1WGSA 3C1FA 2F0SA 3MXPA 2DIGA 2F0NA 3U9OA 4UC4A 3LX0A 4IUVA 3NP8A 1OYXA 1JORA 2RDFA 2XK0A 2F3VA 2QQRA 4RG2A 5IGFA 3TP5A 1STGA 5F2DA 3V2TA 2LCCA 2HQXA 1KDBA 2SNSA 3D8GA 1EY5A 4X34A 4KTAA 1STBA 3QKJA 3SD4A 1A3TA 1STYA 1II3A 3UWNA 4I65A 4C5IA 5IGDA 5IGCA 2D9TA 5CV5A 3OMGA 2F3WA 2O4XA 3S3NA 2F0FA 2K3YA 3D6CA 4DU9A 1A3UA 2MWPA 3OYJA 2F0TA 2LKVA 5KCOA 5C3XA 1SYDA 5IN1A 2M0OA 3MEWA 4E6IA 4FU6A 2R5AA 1N27A 4RKLA 2E6NA 4PNYA 3SK6A 2PZTA 3QJ6A 1ENAA 1NUCA 2EFIA 1NSNS 3MP1A 5NUCA 4IALA 4BACA 5KYIA 5D6YA 4K14A 5IODA 4FL6A 3OYHA 1KDCA 3LGFA 3PFSA 3LGLA 3R3OA 2EQUA 5FROA 3S3MA 4R8NA 1EZ6A 2PW5A 3OYBA 4OVAA 4BDYA 4KY6A 5IIFA 3OA6A 5FRMA 2M00A 3L2WA 4E7HA 4H7BA 2R58A 4YIJA 3L2UA 3OYFA 4OL7A 3MEAA 3M9QA 3T13A 3FDRA 2F5KA 3LLRA 5KE2A 4GY5A 2RJDA 2MWOA 4A4FA 2RHXA 5FRNA 1TR5A 5HURA 1TT2A 1G5VA 3QIIA 5CV9A 3S3OA 3FLGA 1EY7A 3MEUA 3RUZA 4EQNA 4QF4A 5C0MA 5IOCA 5C6SA 3TP7A 4G57A 2RHZA 3NQTA 4CRIA 4IZ8A 3ITPA 3D4WA 5KE3A 4L59A 4IUNA 4KY7A 3OWFA 3C1EA 5I6WA 3SHLA 5C6AA 3NK9A 3ME9A 5KEEA 4KJNA 4PLIA 1EYDA 5EGTA 3OYDA 5C5LA 5K5PA 4TRDA 2GFUA 1EYCA 2WACA 2G3RA 1XNIA 2F0VA 4QMGA 5D6XA 4S3SA 4EQPA 2LRQA 3NTIA 3MO8A 3PNWC 3NTHA 4E7JA 4ZQ3A 2QQSA 2BIVA 2LVMA 2X35A 4A4EA 5M9OA 2EY2A 2VYTA 1SYEA 4ZTJA 4F7XA 1KHCA 2E5QA 3OYLA 3TP8A 1A2TA 5DAUA 5E1FA 1RKNA 1EY4A 2K3XA 1OZ2A 4K6DA 1H3ZA 2QDBA 3QBYA 5KH6A 3FC3A 1STHA 4BD3A 2EKOA 2PYKA 3EAEA 4KD3A 2OXPA 3E9GA 2BKDN 2O4XB 4HMJA 5IGGA 1EQVA 2EY1A 4QQ6A 4NS5A 4N4IA 3QOLA 4QVZA 1OZ3A 4DFAA 4EDUA 2NLUA 3DLMA 5KYLA 5I9OA 2P0KA 4PLLA 1WJRA 1SYGA 4HCZA 4IURA 5C4ZA 3MVVA 4DF7A 2M1HA 2EYHA 4PMBA 5CV7A 3OSOA 4IKFA 3BDLA 3C4SA
chains in the Genus database with same CATH superfamily
4P73A 2VGMA 3QOJA 3S15B 2OX7A 4AYBG 4X62Q 2RN8A 3G4ST 2C35B 1QVGA 5HCKA 2UXDL 3EVQA 4J9FA 2E5KA 4L8JA 1U3OA 1CKNA 2BE9B 2QF7A 1K83H 2WKCA 3KJOA 1EFWA 4BS9A 2RK1A 1ZBXA 1O7YA 3RMSA 4BY6B 1QKWA 4F7UB 4HIDA 4OO1I 3CPFA 3GTLH 2RKSA 1A0IA 2LMJA 2EPDA 1U5KA 2L55A 4JI7Q 1SR3A 2WKDA 4YTLA 4HT9A 3AFPA 2BZ8A 3OMCA 3K7AH 1AZGB 2A28A 1A15A 1YJNT 1D1KA 2R61A 1BIBA 4M7DB 1ZXTA 1T3SA 5FK9C 5C4XG 2KXCA 2NUTB 3A7AB 1NE3A 3MEHA 3CCRQ 1ENCA 4C3JH 5ELCA 2MUYA 4DV5L 2PQWA 1KDAA 1PRTC 4FYXB 2O2LD 3GLXA 3P1HA 5IGFA 1FJGQ 1KAAA 4LDVA 1K83B 3DXJC 1V1PA 4RCOA 1Q81R 3G71Q 3I4NG 4WJ3M 4X1VA 2IG0A 4IUUA 5GAMd 1N5ZA 3GTLB 1AHJB 2Z9HA 2JN0A 3ULRB 2XSCA 2E1HA 3H3VC 4Y91A 2IL8A 3OYGA 1TQOA 1F2YA 2UUAL 2GVAA 4KD4A 4C8QB 1QMCA 5FO8B 3WXMB 1QVGP 1QNKA 3I4LA 1OX8A 1JJCB 2Q2HA 4HCEA 4DUYQ 2DVEA 2B2TC 2CQAA 4P71A 4C3JB 1HNXQ 4J6WA 3RZOH 8AT1B 1H3HA 3VS7A 2EY5A 2LQWA 4ME5A 2DNUA 3WDNA 3CMAA 2XRSD 3META 3HFNA 1Q7YR 5KYUB 3I56Q 4JOIC 2ZPGB 2OTLT 3EQLC 3T1YQ 4OGEA 1TH7A 1SPKA 1QZHA 4M7DD 4RG8A 4JS5A 1L0YB 4M77C 1WQWA 2CSIA 2KT1A 3OB9A 3OYKA 2ZJQA 1G51A 1QCNA 1Q82R 1D3BB 2I46A 4ODGA 4Y7NH 4PJOE 2JN4A 5JVH3 1A6XA 4KHPL 4LD9K 2CW0C 1SNQA 1EQQA 4BBSH 2E10A 1PLFA 4EGVA 1VF7A 2XI9A 3VS1A 1E22A 2LT4A 3RR6A 2K5HA 2R6GA 2ZPFB 3I2ZA 1CT1D 3RZOB 2JJ9A 5FU6B 2EYFA 1VQNT 2Y90A 3JCMe 5GJWB 1WOCA 3CD6A 2V4DA 2LNVA 1HFGA 4NW2A 1VQ5Q 3VA5A 5IHKA 2BH8A 1EQRA 1IBML 1JOKA 2MJ8A 3ERSX 5KGUA 2F4IA 2XMFA 1NYGA 3UDXA 2AT1B 2K5LA 2RI5A 3CBPA 1AZPA 4C8QD 1NLOC 2Q2TA 4OGQC 4A3JH 2ZAEA 1YWOA 1SNOA 5CIUA 5DEHA 3H15A 4Y7NB 2AQ3B 1TUGB 2F0MA 2CREA 1U4PA 2AZSA 2KAFA 2MI6A 4K5VA 2LX9A 4BBSB 4C5EA 5A35A 4O0AA 4JZ3A 2H5XA 2CZ7B 4Y28E 1BBWA 5I22A 1PH6A 4A3EH 2IW3A 2MP1A 4MMLA 4J1MA 1I4K1 2JA6H 2DXBA 3JCMc 1KD1C 2A74C 3PGZA 3KLSX 1M2OA 1QCOA 4K11A 1WTVA 3E3XA 3GO5A 4CJ2C 2PZWA 1YITQ 5FJ8H 3OYIA 3NXWA 4DV2Q 2FRWA 4LFCL 4OELB 2NUPB 1K73R 4B6MA 2L1BA 2DF6A 4LWCA 4OMLA 2DNEA 2DEUA 2I5HA 4A3JB 4M4ZA 2XIDA 2JOYA 2DXCA 2EY6A 1KRTA 1WTQA 1F77A 1MJCA 1XNQL 1PZJD 1PD1A 3A55A 1Q81U 2I5MX 4NXML 1U5SA 1GL5A 4B3SL 3QZ5B 4ESRA 4A3EB 4A93G 2X4XA 2A6EC 2B2UC 4PJOB 3M4QA 5FLMH 1B1ZA 3M85A 2JA6B 1JB7A 2KRNA 1ARKA 2YHTA 5EKLA 1HNZL 3CCLQ 3CBOA 3H8ZA 5M3FG 4AFQC 3CCUT 3G1JA 2F0EA 2YWWA 2YYZA 3CHBD 4DV7L 4OB1B 1AW7A 4A3LH 2DYIA 4GZYC 4PJJA 4ZTFA 2KEEA 4HTHA 2YU9H 1FMWA 1HSQA 3PIP3 3E9IA 2EXZA 3MFGA 3CCVT 4BDZA 3QO3A 1B70B 1T9HA 1N6AA 4DR1Q 1X75C 3R2TA 5GAEC 1VQJA 1M2VB 1A2UA 4DNTB 1TWAH 3JSCA 1ENFA 5DNFA 3TSWA 1B34A 2Y0SG 4M75A 4BE1A 2PTKA 2B8AA 2RCFA 3QDFA 4RTXA 4F88A 3FEOA 3RN2A 1T0JA 4PNOA 2VGNA 1EZ8A 4PKCC 3CCST 2F0QA 3BG3A 1N32Q 1PYBA 1U4RA 1X3PA 2A37A 1VQ8T 1MGQA 1VQ7A 3U4ZA 4JI0Q 3M0PA 3RLFA 3VJPA 1V29B 3UT1A 5CKDA 4CKBA 1Q82U 4KUIA 3LYIA 1VQOA 2A1AA 3CAMA 4KI0A 5C44G 2YU9B 4OMMA 2F0KA 2SNMA 4KT0E 4BI3A 1D7QA 3OIQA 5M5YH 1K76A 3BS1A 2BUDA 3PO2G 1TWAB 4K5WA 3NE5B 3EN2A 1QWEA 2HDLA 4H0LC 1S3OA 3HP3A 4PJOD 3MEFA 2JEAI 3FMCA 3X26B 3CCJA 1PXUA 4WORA 4E7KA 4K8IA 1FVIA 2KDSA 3SR1A 5KNCA 4E2FB 1C4QA 1E2VA 2G6FX 4M78E 3SWNA 1SMYC 4NDXA 3MC0B 1OV3A 1STEA 2C9OA 3J81c 3HOZG 2B2VC 2F0JA 2KUMA 1H95A 4FM4B 2EYLA 1YWPA 4CJ0B 1NJIC 4PL6A 3I3CA 1VQ6Q 1TS5A 1QKXA 3KUFA 1WYXA 5M5YB 3VRZA 1J5EQ 2AMCB 1JJGA 1JU5C 4ZN1A 3BVGA 1XXGA 5EPLA 5C6AA 2ZCFB 4K2KA 1O75A 5T1IA 4JI5L 3R93A 1IW7C 2CUBA 4R9WA 5A2QE 4JJNK 2D6FA 4KH0B 4FO2A 4IPDA 2QEJC 3TMEA 1M1KC 5FLXc 4M7AG 1SRLA 3W1BA 5GADC 4CKEA 1Y7XA 1YNJD 3A7LA 5DM63 2LCSA 4ME7A 3BDCA 3AB9A 2KENA 3UA6A 4K0KQ 1HJPA 4CI0C 4XTCS 3S1MH 1GO3E 3LH0A 4C1NK 4JW0A 2AWOA 3RDVA 1WPYA 3EGDA 1HXYD 4B3MQ 4L5SA 1F2MA 2HQEA 4O5VA 2PW7A 2K5WA 1YCSB 5COYA 2MYSA 3U9SA 2CZ6B 3PMIA 4KBMB 4FF3A 1SJHD 1UHCA 3FKIH 2EKHA 2AZVA 3KLSA 1W70A 1LOJA 2DY7A 1HK9A 2GN5A 2N3SA 2LTOA 4WRDA 2FHDA 4YWLA 4FVMA 2K6AA 1S5FD 3MXPA 2OTJT 2KNBB 1GCQA 2QQ9A 5GAOn 3JCMP 3CCET 1XMQQ 3HOUG 1JO8A 3IFDA 2Q8RE 1WCMH 3CCQT 1LABA 2NVTH 5BN5A 4X9CA 2WAQG 3LX0A 5C0XG 4IUVA 1AWWA 2NB0A 3S1MB 3QYGB 1TU0B 2D62A 3A54A 2R7ZH 4KKTA 4C0GA 4XQJA 4OX9Q 4IPCA 2EYZA 3E19A 4M78B 5ELDA 1A62A 2FO0A 2KROA 4GLKA 4R4QA 3SE0A 5IP9H 3T1HQ 1OPKA 1QWYA 1X54A 1ZYRD 3VR2A 2LQKA 5I2SA 3TP5A 1STGA 5F2DA 2AKKA 5CQYA 1EYGA 2M51A 2LCCA 1KDBA 4ZGDB 2SNSA 1M8MA 2DLPA 4X34A 2GNCA 1SROA 2LZ6B 2AUJD 1WCMB 5KYXA 3VYSA 2NVTB 1PRTF 2VASA 4EMKA 1RAHB 2JM9A 8ATCB 4LF8Q 2HBPA 1STYA 5LJ5e 5CKBA 1BYMA 3UA7A 1TS2A 2R7ZB 4P75A 4XU1A 1N9WA 1BXTA 5IYBG 2V1RA 1K8AR 3KDFB 4ZN3A 4NPSA 3WVDB 3TCJA 4A3GH 1RDPD 1NR4A 2CP7A 4V190 4OONA 3OMGA 5KYWB 1VQPQ 1FR3A 2RSOA 3D6CA 1GM5A 3ULPA 1UFFA 1X6OA 4OB0B 2LKVA 4LFBL 1PYSB 4AFZC 3VYHB 3JCMb 4XAXB 5IN1A 2DL4A 1VQAA 2M0OA 5G3LD 1KC8C 3F2BA 1X43A 1VQMQ 4RKLA 3A8KE 1NTGA 4HJAA 2QW7A 1YJ9Q 5EG2A 2F4VQ 3QSUA 4C1NI 4M78D 1WYDA 3JCMd 3CW2C 1QE6A 1NM7A 1NUCA 2A19A 1RLQC 4PJNA 1SE2A 2LP5A 3L9AX 2JE6I 2NN6I 3EG9A 3T9NA 3STBC 4A3GB 3Q22A 4LF6Q 3JCMh 3K80C 2HAXA 3BZDB 5D6YA 1UAPA 2FG0A 4K14A 1JMCA 1IGUA 2Q8IB 4M77F 2UXCQ 1LVKA 1M9SA 1GUSA 3LGFA 1K0SA 3RNJA 3C0CA 5AJ3L 1IREB 5JJKA 3S3MA 4R8NA 5CMDA 2CP5A 1M90C 2EDGA 1YJWA 1T5XD 2ZPBB 1EZ6A 2PW5A 4LF7L 4OVAA 5M5XH 1QLYA 1IYVA 3AHUA 3GD7A 2VKNA 2K28A 1D8LA 2D0NA 1Y71A 1QNUA 2YUQA 3L2WA 2DL7A 1N8RC 1X9NA 4ORZA 5GAMf 2A36A 4J9IA 3TEEA 1D0YA 2LC4A 2R58A 3SDZA 4RGMA 3A56A 4YIJA 1CKMA 3BZCA 5A0DA 5IYDH 1YJWT 1HD3A 1L0WA 5IXFA 3G6EQ 3T13A 3UATA 4OB2B 1JQYD 3FDRA 3HRSA 1J9OA 5AFWA 3QG1A 5JEAJ 1SLJA 4N8FA 2EQIA 2NUTA 2EAYA 3C2PA 2RJDA 2L5TA 1B8AA 3G4SQ 4D8KA 5HURA 1M3CA 5M5XB 1TT2A 2CS7A 3PQIA 2RQVA 1ABQA 1TWCH 1PH8A 3S3OA 1TWGH 4A4IA 3RD4A 3QJYA 2ATWA 3HOVG 2K05A 1DOKA 5IGDA 1L0XB 3L2PA 2JA8G 3CP0A 1KQSP 4EQNA 4LFAL 1HNWQ 4RMOA 2O31A 5C0MA 3MXGA 5C6SA 1BQQT 5IOCA 1QILA 2R92H 2F1LA 1A0NB 4G57A 4MHEA 3NQTA 3TP7A 1WI7A 4O1NA 3M58A 4FW1A 2D8JA 3BFMA 4Z8AA 1S72T 4AG1C 2QYZA 3HG9A 3PUZA 4VUBA 2DXUA 3OWFA 2CP3A 5DLQE 1YJNQ 3HRZC 4OXPA 5I6WA 3SHLA 2PO4A 3ONAB 1X6GA 5KEEA 1PYWD 2K50A 4BY7G 1K8AU 3Q23A 1X3GA 3C94A 1TWCB 5C5LA 4JUVA 2OAUA 1NEGA 4RTTA 1TWGB 1IKLA 1BCOA 2WACA 2F0VA 2PCFB 4DR6L 4A63B 2LRQA 3NTIA 2UXDQ 3BJUA 4KN4C 3MO8A 3PNWC 2JA8B 2R92B 4M7DC 3IRBA 4IFDG 4ZNXA 1MKHA 3SB2A 1SRUA 1OQKA 1QP2A 4RTWA 2LVMA 1HR0W 4RGTA 2B3GA 2EY2A 4HSPA 4X9DA 4JI4L 1LV9A 3CPWA 1I94L 1UJ0A 2UU9Q 3AYHB 3HS0C 2VS1A 4BA1I 5AT1B 3A8LB 1XJVA 2KT8A 5GMKm 1QVFA 4GNXC 1YNND 2D0QB 3AEVA 4BY7B 1D1AA 1PH2A 3GTGH 4KMUC 4OMFB 3VA7A 1MMGA 1OZ2A 3HKSA 3HOXG 4BXXG 2HKQB 1LT6D 1I5OB 4DV5Q 2A6HC 2EE1A 3M4YA 2DPPB 2JMCA 4C8QC 1NEBA 2J0TD 2QDBA 2OTLQ 3I90A 1VIEA 3JV3A 3NENA 2CHBD 2VB3X 3DEOA 3H0GG 4DAYB 1STHA 3G48A 3C12A 3CC7T 3E9GA 4XDXA 4HMJA 4GLMA 2QQAA 3M0RA 5I2YA 4KH1B 1MV0B 2P5ZX 4P5NA 4QQ6A 4N8X1 4N4IA 3E2UA 3NGPA 1B44D 1OEBA 1CZGA 2UUAQ 5GAN8 1NNXA 1MD2D 3GTMH 3GTGB 3FJ5A 3QIAA 2OQ0A 1G6ZA 4DUZL 1JRIA 2ICIA 4DFAA 4EDUA 3H3VI 1I4HA 4RGNA 5KYLA 1D5MC 1JEGA 3FHWA 4LN2A 5FO7B 1XYIA 2WFWA 3CXCP 1LO5D 2NUPA 1RCVD 4I7AA 1SYGA 4HCZA 3CPWP 3B6YA 3E6ZX 4RHSA 2K75A 1ASYA 1B53A 3FPUB 5FU6C 4XQ3A 1Q86R 3UDFA 1CQFA 4KLKA 2ROTA 3NHNA 3OTOL 5I2XA 1PH3A 1QVFP 1GHKA 2YTVA 3MKDA 3L3OC 4UAIA 2R7DA 4UPAA 4BY1G 2SEBD 3JB9H 1T0HA 5GAMj 1G291 2BA0A 3K5LA 3GTMB 2QA4Q 2I5LX 3U4VA 1WTOA 2ENBA 1P92A 3P8BB 5CKFA 5M3MG 2K1BA 1VQ6A 4N0AC 4OWXB 3SXHA 2WSFE 4DR7Q 3C3LA 1J8IA 1VQ4T 3DUZA 5HY6A 2LX7A 2ZXRA 1M5Q1 1CQVA 1S40A 1UE9A 2E2HH 1VYUA 2M16A 4II1A 2IHFA 3V8KA 3M0QA 2EJGA 1TY0A 3A8GB 4CC7A 4DK0A 1TTHB 4AIMA 2R93G 4HAEA 1X3FA 4P72A 1RADB 2ZJPA 1IBKL 4QVDA 1SSHA 2IPOB 1N34L 4P2CB 1SDFA 2JSOA 3X28B 3DEPA 3GV3A 5EJWA 2RB6A 5LJ5d 1VQIA 3CCUQ 5CC4A 3BDUA 4WFN3 3OS5A 5KIXA 4AH6A 3MCAB 2RF4A 1K8MA 1HYOA 4NXNL 3QPHA 1YHQT 3KLWA 5BN3A 2DXTA 3I70A 1L2FA 3J81E 3CCVQ 5LJ5h 1TVXA 2E2HB 2LS01 2FPDA 1D1IA 3NHHA 2PPBC 4PJOC 5IWAL 3GQBA 2E75C 4YY3L 5GAGC 2SOBA 5E3FA 3V96A 2XTIA 4LFCQ 1Y1WB 3SK4A 4IUTA 2QEXA 3MWYW 4YWMA 1BU1A 3EGXA 1QUQA 5HGTA 4JJCA 3VV0A 4JZ4A 5GANd 2BDNA 1XNQQ 1TUDA 2DX1A 1G3WA 1VQ8Q 1ZSZC 2RH2A 5FLXE 1KABA 3KF8A 1IHVA 4B9WA 1HQMC 2DJQA 1MSHA 1AWJA 1WXUA 5LJ3g 2J7ZA 2F3IA 2RQXA 3GTQH 4DV1Q 2KECA 1KSWA 2X4WA 3PVQA 1G2BA 5GANh 1G3SA 3ZEHA 1WJSA 3HHTB 2CVRA 2EJGC 2K33A 3PCOB 4XT3B 3NMZC 3OYAA 2QG9B 1GFDA 1SNDA 5JJZA 4B3TL 4CDEC 3TBIB 1OXSC 1ABOA 3RKWA 1K3RA 4LDWA 2Q8TA 4KHVA 4DV7Q 2FZKB 4RKUE 1CI3M 5CKEA 3JB9D 1E1OA 3NELA 4GLXA 4FYVB 1KNEA 3KF6B 2ZGWA 3ZJYC 4EIKA 1V43A 1V8QA 1VYTA 2KCMA 2Z4HA 1QVPA 1WD1A 1RI0A 2HQHA 4C2MH 4CHTB 2N88A 2O5IC 3NUCA 3BVZA 2F0HA 5CYUA 3WOFA 4FIBA 1YBYA 1LTTD 2DYBA 3LNNA 2DETA 4NP5A 1V76A 1M8VA 2D0OA 4GN3B 3GTQB 4C0ZA 1QQJA 4FF4A 5IH2A 1UGQB 3IL8A 2KI7A 2XVSA 3J80c 1KFZA 2A08A 2F5TX 2EGCA 1BCMA 2LY7A 4BBRB 2NWGA 1WLPB 1VQPA 4N9PA 2EQSA 1K0RA 1UWVA 5EPKA 3EFOB 3RKXA 1VQ9T 1RAAB 3A0JA 2VUMG 1KQ2A 5M5WB 4ULLA 3HZXA 1B3AA 4MDWA 2COYA 2MHVA 3M3YH 1NBWA 3HP9A 3M54A 3EJIA 2KY9A 3JCMg 1VQMA 4JG2A 1F2ZA 1S5CD 4MZTA 5CORA 4GN5A 3O8VA 1QZGA 4LF9L 2B63H 4C2MB 5IAYA 2EVRA 3RMHA 1YI2A 1N33L 2HKNA 4DR2L 4B9XA 3H6ZA 1Q12A 5CR2A 3I55T 1CKAA 5CKHA 1LTLA 2A0FB 3UE0A 3QWNA 1TWFH 4MZPA 4AYBE 1G83A 1TXYA 2DK3A 2A73B 4DXGA 1EIYB 1ZYRC 3A5ZB 3DHQA 3S15H 3X24B 1ESRA 5DY9A 3TEHB 4CC3A 2YT6A 2D5DA 3LGJA 2GFAA 4LD6A 3H09A 4HJ9A 2YUOA 1BI1A 1NE8A 3RBBB 4LMQD 3J80L 1PA6A 1YVCA 4GOPA 1EZZB 3I4MG 3NTKA 3JCMJ 3R6NA 2RHYA 2OCEA 2L3RA 2ZTEA 2B63B 3HRTA 1VQFA 2OTJQ 3CCEQ 1PV4A 2F0DA 2RSNA 1U06A 5GMKj 4J15A 2ZM6L 4R55A 1UE5A 1MI2A 4J9EA 3STBD 2DJFC 1FGBD 4XU3A 3CCQQ 4FYDA 1JWSD 4E47A 1R77A 4QB4A 1TWFB 3K5OA 2F0GA 1KD1R 5E7NA 3T51B 4L63B 3TP6A 1SXTA 1FYNA 1HZCA 1SNMA 2K32A 2VB2X 2VXWA 1BBZA 2QASA 2C0OA 4KUDK 1VQDA 3OS0A 4LXCA 5KYWA 4DR6Q 3PV0A 2JEBI 1PSFA 4M7AC 2JTFA 3MP8A 1EY6A 1YNXA 3CC4T 3MXUA 3NBIA 3ZYYX 1JC7A 1TS3A 5J1ZA 1I3QH 1EY0A 5GQOA 4XTUA 1CKOA 2WV6D 2B2TA 1HQRD 5GAN6 5D3IB 2KHSA 4M78C 4F7UF 2CP0A 5FO9B 1IBLQ 5ECAA 4QW2A 1EL0A 1BO0A 4DGZA 4OEMB 2WIIB 3EBEA 4JOIA 4KY5A 5C4HA 3RIRA 1IL2A 1RF2D 2E6ZA 1VIFA 1FNWA 4DK3C 3T16A 2HL5C 5DLOA 1MBYA 4DV3L 2UUBQ 4M7DF 4M77A 1WHJA 5C4XH 2NVYH 4A3DG 2F0OA 2DBMA 1NY4A 4AYBB 4JJBA 1GXIE 2YSQA 5ISRA 1LTBD 3QO2A 1I3QB 2KRMA 3NQIA 4AFUC 3H91A 3VR5A 4LAAA 2CWAA 3ND9A 1AZEA 3OQ5A 4GOPC 1SSFA 3S1RH 4GNXB 3KFVA 5I9PA 2LJ3A 1LM0A 2NTSA 4WJ4A 2DBKA 2HMAA 5LJ3e 3I4OA 1GKHA 2H3JA 2LJ1A 4C3HG 1NZ9A 4DOVA 1YZ6A 5LMUL 1F9RA 1M3BA 5GAOp 4C8QF 1X55A 2H3EB 4PFPA 5C4XB 2ICEC 2NVYB 4MTKA 2B8FA 3TRZA 3KBXA 3DKMA 3EG3A 2RQTA 4QQGA 1FL0A 1XNRL 3VS6A 2KOLA 1HUMA 2CKKA 1EQTA 3LH5A 5I2MA 4FP5D 1PG5B 5J39A 2ZJRA 3S1RB 4ZGEB 1K1ZA 3I4NB 1UE1A 4JI2Q 4ILWA 4DBHA 1JE4A 3HEJA 2CT3A 2K7AA 2CDTA 3P8HA 2JJQA 3VYUA 4LFBQ 3DB4A 3I9QA 1WJJA 3J80i 3RLOA 2SDFA 3BYYB 4A3FG 3JCMX 1HCZA 3KJPA 4QJFA 2RI2A 1IKMA 4G4KA 4FCYA 2GF7A 3HTRA 1WHLA 5JVG3 3CMAT 1VQLQ 4GS3A 4PG3A 3CEYA 3OW2A 4JI6L 1NJIR 4PMCA 3K59A 4JRKA 1FMKA 5IT9L 2CP6A 4NMZA 1PD0A 4HVWA 3RESA 2D2CC 2C0IA 1I4RA 2HT1A 1BIAA 1MUZA 2HUGA 1KD1U 3C1FA 1U1TA 2QILA 4OWTB 2EVBA 3OOCA 4A3CG 1QG7A 1Y14B 3H0HA 2B2UA 2A6HD 2DNCA 1M1KR 1OXUA 1PFMA 1VQKA 3KBGA 4DV6L 2EWNA 4HXJA 5AJ3Q 4AMCA 1DM0B 4X65Q 2QCPX 3MXNB 1SE3A 1AVZC 3R8BA 4LF7Q 1ZA1B 3CD6T 2RQWA 4TVRA 2A8VA 4RUGA 3T4AC 2C06A 2FINB 3HSBA 4F04B 1KTKA 2XD0A 3SGIA 3S14H 2E3IA 4UP7A 1UG1A 1U0LA 1B7TA 2RA2A 2QQBA 3QZ9B 4RG2A 3C46A 1KQSS 4EQ5A 6AT1B 2EJFA 1C48A 3EFSA 1D1CA 4FSSA 2L15A 2B86A 2QA4A 4JLGA 2VY3A 1YNNC 3M56A 4FF1A 3UI2A 2GVBA 3FDTA 1G3TA 2Y0SE 2ZTDA 4KTAA 2QI2A 2HIVA 1B3QA 1Y0MA 3OW2P 3BU2A 4DR3Q 1K8GA 2IX1A 4AG2C 1WTRA 2PI2A 3CU7A 4MNOA 2YUNA 4C5IA 4BBRH 3M4OH 1PKSA 4KKSA 5IGCA 2QDYB 3FPPA 5GMKi 1RUWA 4A93H 3S14B 1ILPA 2M2LA 1JR0D 4LFAQ 4PJOF 4Z89A 1J3TA 3S3NA 4A75A 4A3MG 2WSCE 1PRMC 4JRIA 4JBKA 5LJ5g 1A3UA 1VDZA 2C0TA 4I7ZC 5M3FH 3QWYA 5AYFA 3NWSA 4DNIA 1FYCA 1SYDA 3X25B 1BR9A 2XG8D 1SEMA 1PHTA 2NN6G 2NVXH 1M1GA 3ND8A 3UDGA 2NYSA 1ZX6A 1ZSZB 1N27A 2R5AA 4FU6A 2E6NA 1O80A 3MAQA 4UP9A 2HZYA 5A0GA 2B2VA 2P0PA 4FXGC 4OIJA 2PZTA 3SK6A 1BVSA 2Z6KC 3P7JA 4JYAL 3PUVA 2QAZA 2FRYA 1ENAA 2IJ0A 3IQLA 4JDSA 2EJFC 3K58A 1Q7YU 3HOWG 1BCPB 4A3IG 3M4OB 4KKUA 1SEBD 5NUCA 3DWQA 3JAML 4BACA 4A93B 1X3QA 3CC7Q 4YWKA 5GANg 4GN4B 1UGVA 1KNAA 4H13C 3J7ZC 4FL6A 1KDCA 4CDCC 2CSQA 1LTGD 5M3FB 2E8GA 2NVXB 1M27C 2EQUA 2JS2A 5FROA 2JXMB 4RTZA 1KC8R 1H9SB 5C44H 4JI4Q 1NJIU 3F8TA 4LK1C 5GAOl 3OYBA 3J7A5 4EPCA 1XPRA 5TSSA 3PIOA 4M7AE 3PO2H 2GGRA 1C8CA 1VQ7T 1Q8IA 4IPGA 4KY6A 2IPKD 1IGQA 2Y0SB 1OU9A 4IO9A 4E7HA 2JS0A 3J7YW 4ZLTF 1OXVA 4HCBA 2NWMA 1VQOT 3L2UA 1OULA 1NCVA 3HRUA 4DV0Q 1M1KU 2KE9A 3OYFA 3CMEA 4X6AH 2PMZE 1UEBA 2G9HD 1F2LA 4D6WA 3M9QA 4R1JA 2CKZB 4CBVA 1YHAA 3CXCS 1MJEA 2CP2A 4DR5L 3HOZH 5KE2A 4XTVA 3CPWS 4UY8C 5C44B 1LUZA 1M90R 3NFCA 4KGXB 2F1MA 2XRQD 1Y57A 1AD5A 2AKWB 4OIKA 4IOCA 2HHHQ 3CCJT 4A4FA 2RHXA 1TXQA 2VQEL 1GUGA 3QIIA 1QVFS 5CV9A 3PO2B 3CRLC 4QVCA 1EY7A 1N8RR 1X6BA 1IHWA 1HNWL 2JXBA 1VQ4Q 2WAQE 1ZUYA 4R0KA 2ID0A 4QF4A 1Y96B 1KLGD 2V26A 2JP1A 2DM1A 4MN3A 1K73U 4IZ8A 1B9NA 3D4WA 2CT4A 2VQFQ 4IUNA 4QCLA 3HOZB 4WTOB 3C1EA 3S16H 1WHKA 1Q46A 1BDOA 2KEAA 5KYNA 3CCMA 4C92G 4KJNA 4RTUA 4Q0FA 5JEAG 3CC2A 4PLIA 1EYDA 1B50A 3PGGA 2GFUA 4JRQA 3TQYA 2F2VA 2G3RA 1GCPA 1M4ZA 2MK5A 2L2PA 4RGOS 4JV5Q 1YHQQ 4EQPA 2Q2UA 2ABLA 1SE4A 2EPBA 3Q0AA 3J80E 4M7AB 1E6HA 1GUTA 3HOUH 4Y52H 3RERA 1AN8A 1WQ7A 4M7AF 1YIJQ 5H1SE 1UNSA 2HSEB 3I7FA 1HXDA 1XMOQ 5C0XH 2E12A 2EGEA 3L2ZA 3CC2T 5I11A 4ZTJA 3FKIG 2VWFA 3OWEB 5G3LF 1W2BA 3S16B 1U4MA 2PMZB 3JAMi 4FW2A 4ATOA 4M78F 1VS0A 3AT1B 3W2DA 5LJ3d 3M7NA 2X6GA 2XU8A 5ELEA 1EY4A 1ESFA 2K3XA 1O7IA 4IJHA 4AQYQ 1IBKQ 2X6LA 3VU3C 2PQAB 5LJ3h 3HOUB 1AFPA 2RK2A 1WZOA 4X66L 3EHRA 3GIBA 2MMPA 1KC8U 2K5DA 4BD3A 2EKOA 5CCAA 2PYKA 1I50H 2HDMA 2JA5G 2R3ZA 4NXNQ 3KXTA 2WAQB 2K5FA 4HJ5A 3J7AV 4GLAC 5JJLA 2N8NA 1I4QA 3H41A 1R9TH 2JTMA 1KRSA 2KRSA 5IWAQ 1BI3A 4YY3Q 5IYBH 4A3KG 4NS5A 1EUJA 4LF4Q 1G8XA 1L1OB 1SSOA 2EYQA 2X4JA 3VUZA 2K79A 4M7AD 1Q90A 2CH4A 2B39A 1I4XA 3CCRA 2RQRA 1WA7A 2AK5A 1SF9A 2DA9A 1FD7D 3DLMA 4ANJA 2G9DA 4XYQA 5I4DA 1VQ9Q 4XQQA 1DOMA 3GPLA 1VQCA 2ZZDA 5I9OA 2A3LA 3DLLA 4JI3Q 3G71A 5GANe 1M90U 5ELBA 2NUZA 1I50B 1UB4A 2AHOB 4KK7A 4JK1C 1W2BP 2K03A 3GTOH 4JI8Q 4UP8A 1IL8A 4M77G 5GAOr 2PU9B 4PMBA 1R9TB 2JTEA 5JPMC 4HT8A 1HR0L 1N8RU 3OSOA 4IKFA 5D14A 2YLCA 1KQSA 1EWCA 3C4SA 4DA2A 1IYJB 4BE0A 3I55Q 2AHJB 1CKNB 4LW1A 1K3BC 2UXBL 3KOJA 2PQEA 4DN4M 2WB1E 4ALPA 1YN8A 4BE2A 2GCXA 3UF4A 2NZOA 3URGA 1WTWA 1LTRD 1WTPA 5A0LA 1GD7A 2ROLA 1KK7A 2RJEA 3I56A 3QB3A 3S17H 3TZUA 5GROA 5IY0A 3GTOB 1QCBD 2H4OA 5C3EG 1OXXK 3L42A 1YCYA 1T5EA 2A5HA 3TVTA 3H94A 5D3DA 4F7UA 2K5QA 3M55A 3EG2A 5CVIA 2FMMA 3A8JE 1UGPB 2YUPA 4G7OC 1QCFA 5CQXA 1C0AA 1DONA 2OI3A 2V8JA 1EY8A 4KV6A 1V1PB 4LF9Q 1VQLA 1R4PB 4QKUA 5LHY1 1N33Q 2CQOA 2B2WC 1P8LA 4DR2Q 4M7DA 4J83A 1Q8KA 3PF4A 1PCXA 1XX8A 1E7OA 4JBWA 5EBDA 2YRVA 5IT9E 4A76A 2EYJA 2FEIA 2CZ1B 5KCHA 2L89A 1AWXA 1VQ5A 5EPJA 2VUBA 3CC4Q 4V0BA 3S17B 1JT8A 2L9HA 3SEMA 3S9WA 3HOVH 2MOXA 2F0UA 5K36G 2KQ3A 4RCCA 3AMUA 3GTJH 1TIID 4DPGA 2X69A 2E3HA 1C7YA 4GNXA 2JA8H 3V7RA 2D1XA 4UHVA 1OPLA 1AZQA 2F0LA 1B2TA 4J9DA 2KCNA 3F2UA 1Y1VG 2SEMA 1RTNA 1VQ5T 1DJ7B 3OYMA 4C8QA 1IHZA 2ZM6Q 5LMNW 4IOAA 3THKA 3L7ZC 5J22A 5JOBA 5L8RE 2B29A 1SMXA 4ZUJA 3TSSA 5IGEA 2VV5A 2F0IA 1OX9A 3EH2A 5FWBA 2KCCA 4OP0A 3MZ5A 4R4CA 2EQMA 1IZ6A 1QJOA 3WOEA 4BY7H 1MIUA 3HOVB 1SKUB 1YITA 2E2IH 5IGBA 5KYUA 4N4HA 1C0MA 3GTJB 4DBRA 1VQBA 2K5IA 3G6JB 2JQOA 1RODA 4XTXA 2NTTA 4KRTA 3QR8A 4L6TB 4M1UB 4IFDH 3S6WA 1HH2P 3TU4K 3CXCA 1V1OA 2EW3A 4DR1L 1D3BA 5D6WA 1B9MA 3NPFA 1A63A 1X69A 2L8DA 4C3IG 5CK9A 2X3WD 3GNFB 4M75E 3CCLA 3BVMA 2KR3A 1M8AA 5IP7G 1SYCA 2HSPA 2K3BA 3FIFA 1CZWA 1SAPA 4FYYB 2XN9C 3RR5A 2FB7A 1PDQA 3V05A 3W5OA 2E2IB 1TSFA 2K2MA 1BKBA 2DO3A 3K5MA 3EFRA 1EYAA 3HOXH 4A54A 3UDIA 1I5FA 4ZK9B 4BXXH 4DK6C 2ZXOA 1X2QA 5E4XA 2K7VA 1DXMA 2RBMA 1ZUKA 2FZCB 2DJGC 1SYBA 4X64L 1PWTA 2J6OA 3H9NA 2D0PA 2RA4A 3H0GH 4HEDA 4QIWE 4RH6A 3K57A 4QGUA 4N0AA 3MXNA 2CYZB 4OMOA 2R7FA 5CR3A 1WI5A 1SFOH 1WVLA 1GFCA 5EKKA 4E6RA 2W10A 3MHBA 2WB1G 3GNGA 4WJWA 2XICA 3HOYG 5IYCG 1Z9QA 1VQNQ 3SK5A 5LMUQ 5EC7A 4M75G 4ZGJB 3TQ7P 3KFUA 1M4VA 3LX7A 4E7IA 2YTYA 3HOXB 2XDDA 4POGA 3M0UA 4KJOA 2FXQA 3PIO3 4G7ZC 4QY7A 2UUCL 4Z88A 2YXYA 1XNRQ 4FDBA 4L6V5 3H0GB 1TWHH 1OXTA 3NWTA 4DNRB 2O5JC 1Q3LA 4X3KA 2KXDA 1SNPA 3K81C 1N36L 3L2VA 2E74C 1SFOB 1H9RA 2HD3A 3OY9A 1W6XA 1IXDA 2O2OA 1LNXA 5KYYB 4PJOA 2I07B 2P84A 5HK3A 4MIUA 4OO1G 4BI4A 4KHPQ 4JI6Q 1NLPC 1B34B 1PH5A 3MPUB 4K0KL 5M3MH 2PNRC 2I0NA 1JWUD 1K8OA 1I81A 2E5LL 2XIWA 1LTSD 1WIEA 2XGTA 3INZA 1DGSA 2EYPA 4YHHL 1I07A 2FPFA 4F8MA 1VUBA 1OU8A 1ZSZA 4FNFA 4DAVA 3PO3G 3EG0A 1TWHB 1M2VA 1S5BD 4K6LA 3RNUA 2CGHA 1IBMQ 4DAMA 4OF1A 3HL8A 1RAGB 3VS5A 2DAQA 1D0XA 1I1JA 1Y1WH 4DV6Q 1VQ6T 2OF1A 2GTOA 4QIWB 5CV4A 2R5MA 3DMUA 3RKYA 1D1BA 4BY1B 3GOXA 2B2YC 2R93H 3OW2S 3JB9F 1BK2A 3HKZE 2O9VA 2ALYB 4HIMA 3TSZA 1KG1A 2ES2A 5M3MB 1DOLA 2E70A 1U4LA 4O42A 1A3VA 3RN5A 1ZQ1A 2HBWA 2J7IA 3TS2A 1ZHIA 2N78A 3D31A 4Q5WA 3OSVA 2F0WA 4OX9L 1CSKA 1VA7A 2CWPA 3TZDA 3L2QA 3T1HL 3BW1A 3SWNB 5LMNL 3S1QB 4BUGA 1SNCA 4OMNA 5D65A 1ML0D 1PH7A 2EGAA 2DRKA 1PTOH 4APVA 2E64A 3W3AA 3V7SA 2IIMA 1X32A 1HTLD 4QT7A 3CRKC 2J06A 5I6YA 1OI1A 4JRPA 2R93B 1ZSGA 4A4GA 3CCSQ 1DZ1A 1LJOA 2ZPHB 1NPPA 1JJ2P 4ZKBB 1G8ZD 1Z7TA 4EQOA 2IX3A 4B3SQ 3P8DA 4LF8L 4K8JA 4NKLA 3EIVA 2WP8J 1WXTA 3OS1A 1HNZQ 1KHIA 2QEXT 1BCPC 5M5WH 1LT3D 5T1GA 3SHWA 2DL3A 2EYWA 2JA7G 2BTTA 4KGVB 2NBFA 3EGDB 4IIMA 1PTOB 2YV5A 1TOVA 1VQ7Q 4L5QA 2KHIA 2RJCA 3PUWA 1HUNA 1D6EC 1D5ZC 3MTSA 1K4US 4CC2A 4EMGA 2R57A 1HJDA 2AIRB 1VQOQ 4JYAQ 5CBEE 1JB3A 2WSEE 1VQEA 3TREA 3OIPA 3DWAA 1ICFB 4N9TA 1WXBA 2HDAA 5JPNC 1Q86U 4H02A 2EOTA 4A3BG 1STNA 1CM9A 4ZYSA 1WGSA 1U8RA 3HKZB 3M7GA 5LL6X 4JI1L 5IXBA 5I21A 2LXJA 1GUOA 2JM8A 3E1SA 2RPNA 2VUMH 4HKEA 4ABNA 2UXCL 3LWHA 1C6VX 1JB0E 2RCNA 1I0CA 3RMQA 5J3BA 1YJ9A 1JE5A 2DTOA 4M7AA 1VQPT 1LCKA 5EKIA 2HCCA 2ZTCA 2AWNA 5FKAC 1FNVA 3VYGA 2QQRA 2DTHA 4HSVA 5A2QL 1VQMT 4HCSA 4M78A 1FNUA 1RAIB 2XHCA 1PTOD 2EXDA 2K4KA 5KYXB 2HQXA 3D8GA 1YI2T 1EY5A 3URYA 2VUMB 4EMKB 2DILA 2L5QA 1R8OB 3OHXC 4DR5Q 3TN2A 1TS4A 4LF5L 1KAWA 2L11A 5GMKe 1ILQA 3I4MH 1MSGA 1VQGA 4NB3A 1E3PA 4IQZA 3H0IA 3S2DH 2VQEQ 4JI5Q 1BI2A 3A8MB 3UPUA 3UWNA 1LPLA 4EMHA 3JCMf 3JB9J 1FMVA 1PZID 1UE6A 3PSIA 4BB7A 1H9JA 1RABB 2ECZA 3N5BB 4XTYA 2FJ2A 1KL9A 3W1GA 4GKJL 3I73A 3ULJA 1KIXA 1KLUD 2PVOB 2K3YA 3V8LA 1PZKD 2A69D 1J6QA 2PUKB 3KDFA 2RHQB 1X2KA 2MWPA 2DERA 1K9MC 3G6EA 5KCOA 4U68A 3VRYA 2VL6A 5FWCA 3GF5A 1M3AA 1OTCA 3VKIA 3WWVA 1GRIA 4DQ2A 5BR8L 4KULA 1HA5A 3UDCA 4F7UG 1QOHA 4PNYA 7AT1B 2IHEA 2A7YA 3EG9B 3I4MB 2KGTA 2LJ0A 2J6KA 2JK8A 3G4SA 5CO7A 4FXKC 2E2JH 1P16A 1AE2A 2LMCB 3S2DB 1RLPC 5IHNA 4LUVA 1AP0A 2JA9A 1SHFA 1JCKB 4OHJA 3UE1A 3VYRA 1CA5A 1EIGA 2AUKA 1E2WA 2LQNA 3N52A 4M7DG 4HR7B 4RWSC 4ZAIA 4C92C 1IRXA 2M9UA 2QDLA 1RD9D 1PSEA 2YRDA 4DOWA 3U58A 2HQLA 3X3MA 3PFSA 2KMTA 1WNLA 2K57A 3PE0A 4AFSC 1XTDA 1X01A 2LXKA 3R3OA 4A3DH 1YJNA 1BOSA 3JB9I 2Z8LA 5EQ0A 1PNJA 1ZLMA 4KGZB 2E2JB 3I5RA 3I4NH 2DTIA 5FRMA 2UU9L 3PUYA 5L23A 2BDOA 3LWUA 3EHQA 3JCMW 2DE0X 4C8QG 4RCBA 2P0QA 3SFMA 1L1OC 4ME3A 1FXXA 4OL7A 5IT9c 3MEAA 2RVLA 1RAEB 4C3JG 4X66Q 4C3HH 3I8ZA 2A68D 1ET6A 1G2TA 2N49A 4XK8E 1MNEA 1YNZA 2AKLA 4GY5A 1SG5A 1W2BS 4DEXA 2HCIA 4A3DB 4QL5A 1Z47A 1EFID 1GUWA 1QP3A 5GAN3 3G7LA 1VF5C 3ER0A 4UDUC 1G5VA 2IT1A 2DVJA 1E6GA 2KA7A 5CAIA 3I91A 2F2WA 3OBWA 5EAYA 1E24A 4FSXA 1MGSA 3RZDH 3RUZA 4HJ8A 1VOMA 1LTAD 4MTNA 5GAMh 3K7AB 1Z9FA 2OTLA 4A3FH 5LJ3j 4XT1B 4C3HB 2DZCA 2JMAA 5KE3A 1JQQA 1MHWC 3VS0A 4LDUA 2O01E 1YJWQ 4PZ7A 4LUOA 2H8HA 3PVLA 4JBJA 3X3NA 1T3LA 2X51A 1E2ZA 4LNPA 3ME9A 1BBUA 2K04A 4JJDA 2L4NA 2N55A 3EFXD 2BH2A 3OSSC 1LLRD 5EGTA 3OYDA 3K0XA 4TRDA 1EYCA 4A3CH 1Q1EA 5D6XA 1VQNA 1NMFA 4OB3B 3RZDB 2UXBQ 4BBSG 1E1TA 4ZQ3A 1DCZA 3F2DA 4A3FB 1WTXA 2D9UA 2QQSA 2BIVA 3M59A 5M9OA 3VUBA 2FPEA 1SYEA 2L0CA 3A74A 1B07A 2MNAA 1KHCA 4DR7L 3QUIA 1UDLA 3JC66 2E5QA 3OYLA 1CSQA 1N9RA 3I5SA 1VQKT 4J9CA 1S72Q 2Z6KA 2ZT9C 4O2DA 5KNBA 1EOTA 2JT4A 1I5LA 1S4ZA 3TP8A 2ED1A 1W6JA 1MNDA 2XNAC 3U50C 4ELZC 5DAUA 5E1FA 4FXDA 4AT1B 1RKNA 4A3JG 4XTWA 2F52A 5DM7R 4CC4B 1H3ZA 3KLRA 3BE3A 1OOTA 2QTVA 1S5DD 1I6VC 2RD1A 1Q95G 4C0FA 3JAMc 3FC3A 2YDLA 3LW5E 1HZ9A 3S24A 1CA6A 4RTYA 3EAEA 4A3EG 4KD3A 4HIKA 2OXPA 1NYFA 4PJOG 2JA6G 1CKBA 4DAYA 2NVQH 1HA6A 2BKDN 2O4XB 2QA4T 4JS4A 1CUKA 2DRMA 2EY1A 4MZ9A 1PRLC 3ULLA 2K2VA 3CF5A 2XKOC 2IX0A 1EEID 3OBYA 1JWMD 2CH4W 3D7SB 5FJ8G 3GTPH 2RQUA 1ZEQX 4A3MH 3L0OA 3M4PA 3MA2B 3IAYA 3BYTB 2KSSA 4L5GA 5GAHC 4RCNA 2NLUA 2ASBA 1MMAA 2NN6H 1NG2A 1TG0A 3CCUA 1RACB 4J8OA 3REAB 3VR3A 2L3QA 5E4WC 2P0KA 2HD0A 2E65A 1JXMA 1B7YB 3MVVA 2K5NA 3CCVA 1EU3A 2JW4A 3O13A 2DMOA 4DV1L 1Y8PB 5FLMG 2NVQB 3K5NA 2EYHA 1MV3A 4XYOA 1TY2A 4XIGS 5CV7A 3A5UA 5CBAE 4A3IH 1BCPF 3HOWH 4DR4L 2COWA 1E7ZA 1TWBA 3BDLA 4A3LG 3C95A 5IHIA 4PV1C 3GTPB 1GVPA 5CV6A 2O88A 4A3MB 1VMPA 5IE8A 4QQDA 3CCSA 3Q1JA 4J6XA 1XOVA 1UUEA 4XU0A 1CSPA 1VQ8A 2EQKA 5KYYA 4R4OA 1Q81C 2NUCA 1I94Q 4L5RC 5LJ5f 3NBHB 3T56B 4PFOA 4RG1A 2RF0A 1W1FA 3E9FA 4K2LA 4X3UA 1RL2A 1E0BA 1UEAB 3L2RA 1X65A 4FYWB 1RIPA 3K6OA 3HOWB 3K8AA 2FMCA 2Q2IA 1D2BA 2MPMA 3KK7A 1VMCA 4ZCKA 4A3IB 5FU7B 4JBMA 4JC0A 3MP6A 2KBTA 1TS9A 4PJMA 4C0DB 1EEFD 1U9RA 4TSSA 4BA2I 1WFQA 1C9OA 2BZXA 4N4GA 1ACMB 2LFNA 2LCLA 3M9BA 4J9GA 2DL5A 4C92E 4JPBW 3J81j 1OO9B 4GKKL 5GANf 1WX6A 4E7SA 1PM3A 2EIFA 2OAWA 5GMKh 5GAOm 2J05A 2K52A 3AQQA 3P75A 1Q7YC 1BCPD 4MMKA 4B3RL 1JOOA 3I35A 2VZAA 5J26A 4GBQA 3CMET 2RJFA 4A4HA 4DV4L 1HTPA 1RHPA 1BB9A 1RJTA 3EGXB 1AWOA 1QUQB 2DUDA 2BE5D 3I72A 4EVOA 2RHSB 4DUZQ 1UECA 4RHRA 1ET9A 2PVGB 1Q82C 3KF8B 3FP9A 1ICWA 2FYKA 1W4SA 1Y07A 1AT1B 2Z0SA 4U673 3PUXA 2UUCQ 4LDYA 4M75C 3EA6A 4WCIA 2XDPA 2RMOA 1WJQA 1EOVA 2EYYA 5C5MA 2L0AA 1ZKOA 1GOZA 2QGQA 3OTOQ 2E4HA 1N36Q 1AH9A 3F70A 4LJZC 5JEAH 2COZA 3VYTA 4PK4A 2KEDA 4ID6A 4V2SA 3GP8A 2BA1A 2EJ9A 3BZKA 1SRMA 3PTAA 2HEQA 1D5XC 2FVUA 1XWEA 2RNAA 1B4OA 4CDFC 4M8AA 3EROA 4X62L 2RI3A 2AQ2B 4Q5VA 3CCMT 2E5LQ 4YHHQ 2OTJA 2VNUD 4M78G 3CCEA 4HCCA 1R4QB 3KF6A 3S2HH 1BF4A 3E5SA 3E0EA 1I8FA 2KQWA 3CCQA 5JAVA 2TSSA 1GBQA 2EQJA 3EGUA 3JRZA 3J81L 1O9SA 2PUOB 3SEBA 1JOQA 2J6FA 3AFQA 1IBLL 3SWNC 4C92B 3MEVA 3DB3A 1G6PA 2PZUA 4JI7L 4C92F 4HIOA 1WCMG 1K73C 1N34Q 3EFOA 2KYMA 2QEXQ 4LE9A 2UUBL 1JJ2S 4A53A 1TKWB 3D0FA 3MJXA 4J5YA 4MDXA 1BBXC 2R7ZG 5EBCA 4M77E 1Y8OB 2NZHA 5FLXL 1SYFA 1FJGL 4PMWA 1PVOA 4DK1A 4LUZA 2JA5H 3S2HB 5IP9G 5FW9A 2WINB 4IIOA 2KVMA 1CHQD 4MZMA 4C5GA 3FKIB 5LMNQ 2DEQA 3H3VH 1VQHA 4IJLA 2DIQA 5CGKA 2E41A 3M4GA 4A3KH 2GTJA 2BE7D 1LYLA 1JBMA 2FHTA 4GOPB 2K14A 3SK8A 4RFBA 2E76C 1XTCD 4F16A 1PTOC 4C5HA 2C5CA 4WF2A 1SN8A 4TKOB 3CBMA 1TU2B 1PRTB 4OWWB 2LT1A 3OW7A 4J6HA 1PHJA 4QQBX 3TS0A 3S1NH 1LACA 4DUYL 1W3SA 2J4XA 3M0SA 2B2WA 4X64Q 4POFA 1HNXL 1HR0Q 1R0CB 2JA5B 4A3GG 4B3TQ 2BZYA 5LJ5j 3M57A 4IUQA 4HMIA 4C92D 3CCRT 2MCNA 1GCQC 2CFMA 1HHVA 1RAFB 3SVMA 4YCUA 3T1YL 4A3KB 4JI2L 1KQ1A 4RTVA 4PQXA 3FRPB 2X4YA 4CKCA 3G71T 1EY9A 1IO6A 2M02A 2A69C 2GQIA 2OJ2A 4DEYA 4ELYC 5GAN4 2LQ8A 4OGCA 3H6MA 3R6OA 5GAMg 1WTHA 2G5DA 1Y69U 2VW9A 2ZXPA 1PFSA 3D4DA 3MHXA 2ED0A 2F2XA 3S1NB 1YI2Q 3CQTA 2RHIA 2EYOA 4A4KA 5GANj 4J9BA 1MMNA 1YP5A 3OS2A 4JI1Q 3DWPA 1NMGA 1AEXA 2DD4A 2XWBB 1LT5D 5C3EH 4YCVA 4M77B 2TMPA 4JCVE 4IN3A 2RDGA 3PMTA 1AEYA 1PRTD 3FJPA 1MMDA 1EIHA 4EMKC 1PH9A 4OMQA 2EBPA 3A8IE 3I56T 2XDBA 5HK0A 3KYHC 3ZFJA 2RM4A 2X3XD 4PJLA 3ERQA 4X65L 4DBFA 3NPPA 4Z9CB 4E7LA 1D09B 2F0PA 3J81i 1ZBJA 3JCMV 4OMPA 5C3WA 1EIFA 1XPUA 2CUDA 1ASZA 2MIOA 1K9AA 3K0YA 3F1ZA 3T53B 5KRUA 1WDXA 1I4PA 4RKBA 2FFKB 4F87A 1YHBA 3DM1A 1VQLT 3FEWX 2OEOA 5IYDG 5C3EB 2JZ2A 5K36H 4NXMQ 2EYMA 4K5XA 3Q6SA 3GDEA 2Z1CA 4LF5Q 2KK4A 4R4TA 4DV2L 2LDMA 4X3TA 4IPHA 3OYCA 1NBEB 3OYNA 1RI9A 1CK1A 2RHUA 2AQ1B 1R0BG 1M30A 1GJXA 4IUPA 1Y1VH 2A68C 2Z0WA 3RLNA 5D7UA 2QXFA 1WHGA 4R8IA 4DR3L 4HN7A 2PZ1A 4J6YA 1K0XA 1GXDC 1S72A 2LSSA 1BNZA 2JYOA 3BDOA 1M1FA 3GP7A 4GKJQ 3OPOA 5GJVB 2PI2E 2QGGA 2DKGA 2DY8A 9ATCB 4M77D 3NSWA 1WD0A 1QWFA 2GA4B 4F14A 4PFZA 4LUEA 2MO0A 3FVQA 2R92G 4J9HA 3ASKA 2PNHA 5C0XJ 2CW0D 1WFWA 3HFOA 2DL8A 4ZUIA 4J7FA 1STAA 2B8GA 5BR8Q 5L37A 5CV8A 2L12A 1XPOA 1H641 3A8OB 3CKIB 4YCWA 1F9PA 1JICA 1LTID 4Z02A 4B08A 2Y4YA 3VS3A 1Y1VB 3HFZB 3P20A 4DA4A 1EWIA 4LUDA 1MHNA 1YITT 1GHJA 1IXRA 2RO0A 3EH1A 4BY6C 2KCTA 3OYEA 2OT2A 3ZBDA 1EX4A 1NAPA 5GMKl 3NEMA 3PMFA 4RMFA 1X3EA 4C3IH 1KIKA 3GBQA 2F03A 2VXEA 4R56A 2F0SA 1N32L 3VR6A 3HGBA 2MPXC 5IP7H 4DV3Q 2JNGA 4CDDC 4BWGB 4JI0L 2DIGA 2F0NA 4RAUC 1O7LA 3U9OA 4UC4A 3NP8A 1F9SA 2NYZD 1I6HH 4XU2A 3CCLT 1XQHA 1OYXA 2ATCB 1JORA 1W6KA 2XK0A 2RDFA 4DAPA 2MF2A 1K8AC 4F17A 1UGRB 1UJYA 2F3VA 1EU4A 1H9MA 2ZPEB 1H8KA 2DD5A 4Y92A 3JAME 3BY7A 3CMAQ 3CC7A 3E0JA 2IWHA 3V2TA 4C3IB 1SHGA 3J7AF 1CTMA 4XXEA 1IB8A 3HPWA 1UUPA 1F1BB 2MGSA 5KNDA 1PH4A 1QVGS 4DV0L 2VVKA 2V8IA 3HOYH 3EG1A 3A8HB 2EYXA 3H0FA 4CGYB 5IYCH 3FRNA 2QTXA 2V1QA 5GAOq 1STBA 2XWJB 4ZRZA 3WVEB 3QKJA 2B2YA 3SD4A 1I6HB 1A3TA 4H44C 1HFNA 2A6ED 1II3A 4I65A 1J5EL 2HHHL 2DFUA 1AOJA 4BI8B 1FGUA 2X9HA 2JA7B 2Z4IA 3REBB 2DZ9A 1WHHA 1DJRD 2IY5B 5GAMe 2D9TA 5CV5A 3CD6Q 2F3WA 3GTKH 2O4XA 2F0FA 5DM73 4C56C 1K28A 1TUCA 1KJWA 4DU9A 3OYJA 2F0TA 3IKJA 4BY1H 1VQKQ 2WB1B 5C3XA 2I2LA 2FL7A 3HOYB 4OO1H 3MEWA 3X20B 3F2CA 4E6IA 5GAN5 3A98A 3O5ZA 4M75B 1JJ2A 2VQFL 4B3ML 4M75F 2HIXA 4GLVB 1V1QA 3DM3A 1RTOA 3QJ6A 3V7CA 4J8QA 1I4GA 2EFIA 1X56A 2MQHA 5LL6S 1NSNS 5ELNA 4G7HC 2DGYA 4D8DA 2V1CC 2OWOA 3PO3H 3E9HA 3S1QH 3MP1A 1VQ4A 4ZKCB 4IALA 2K9GA 5KYIA 2CZ0B 3JB9G 3LWEA 1UTIA 2LNHB 2O9SA 5IODA 3GTKB 1UHFA 2QGFB 4DXFA 4JV5L 2HL3A 3OYHA 2L3SA 1V1CA 2DN8A 1ZUUA 1K9MR 1NR2A 1Q1BA 1XMQL 2GQVA 3LGLA 2K5VA 1A8VA 2ENMA 1PC0A 1XMOL 2KYBA 3N6RA 1BUVT 1YFNA 3QDRB 4BDYA 5C0XI 1H9SA 3GV6A 1D0ZA 4CJ1B 1DD2A 5IIFA 3OA6A 2IVWA 2K4YA 2M00A 4HCKA 3NBHA 5FOBB 3PO3B 3D4RA 4H7BA 4NOYA 1SMYD 2Y4XA 4NL3A 2KVQG 1YHQA 1VCIA 1Y1WG 1U1SA 3A1PA 2YLBA 3PF5A 2M9VA 3QWXX 2OQKA 4PZ8A 4TQUS 1N9SA 3Q8DA 2P4TA 2VXFA 4AQYL 1YIJA 4M75D 3VDYA 2ESWA 2SRCA 2F5KA 3LLRA 5ELFA 2P4RA 3M5AA 4NL2A 3PIPA 1IW7D 2MWOA 1GUNA 1EWHA 1WHMA 5FRNA 1TR5A 2QK0A 1G2SA 3R2IA 2KJXA 2L3PA 3FLGA 1Y8NB 2VB6A 1YIJT 3CQZH 2YRCA 3MEUA 4IFDJ 1PKTA 4LF4L 1O7ZA 1QB5D 3VS4A 2F69A 2JA7H 1ZA2B 2JUFA 1S5ED 3MFYA 5BN4A 4J7IA 2BE5C 1FX7A 2RHZA 1IYUA 1H9KA 1PTOF 5HGQA 4CRIA 1HRJA 4LDXA 3ITPA 3V8JA 3PT9A 1AE3A 1Y96A 2DJZA 4L59A 1HZBA 4KY7A 3ICEA 4DKAC 4JI3L 2ZPIB 2F4VL 4KN7C 4BBRG 2E2DC 2HNIA 2MFIA 4X3SA 3NK9A 3TDQA 1C1AA 1O78A 3QHSA 2QKIC 3KUPA 4JI8L 4DR4Q 2EZVA 3D6WA 2W0ZA 5K5PA 4A3BH 2RDHA 1CHPD 1QW1A 1XNIA 4QMGA 5LJ3f 3CQZB 3CCJQ 4S3SA 4LF6L 3G7ZA 1SE8A 3IFTA 1UGSB 4PZ6A 2PVDB 5FU7C 1SJED 2BCOA 3NTHA 3JCMQ 1VYVA 3CMEQ 3LWIA 4C0DC 4E7JA 3D3RA 4HVVA 1VQ9A 1YNJC 4LNQA 3RUXA 4A4EA 5GAN7 2X35A 2HCKA 4XTZA 2KBNA 2VYTA 3QXEB 4O6JA 4HVUA 4F7XA 2JVVA 1H92A 2MO1A 3K7UC 2NZ1D 2KHJA 1BI0A 3M53A 1SBBB 1G3YA 2EJMA 1FWZA 4L5TA 4IFDI 4XQNA 1A2TA 5C4JH 4FF2A 1F9QA 5JJIA 3VR4A 2I0QA 5HKCA 3I55A 1HZAA 4A3BB 1YJ9T 2K01A 4F7UE 2D8HA 4K6DA 4EX5A 2BOSA 4C92A 1K9MU 1PMRA 2B63G 2VC8A 1KXLA 3QBYA 2CCZA 4GKKQ 5KH6A 1DYQA 1LT4D 4JLIA 1QVCA 2YTXA 1EFNA 3ZL7C 2V8KA 3L1AA 4HA8A 5GAN2 4JVZA 2PQAA 2FZGB 4M7DE 3AU7A 5ELOA 4B3RQ 2H1EA 1YEZA 1Q86C 1PH1A 5IGGA 4DV4Q 1EQVA 1XJWB 1G91A 4FT2A 3CCMQ 1PFNA 3QOLA 3Q24A 3CC2Q 5C4JB 1NPRA 1ONLA 4FT4A 1S1NA 1Z6HA 2MAMA 4TVAB 4KHZA 2PNIA 1UE7A 4QVZA 1OZ3A 3M3YB 4E7ZA 1L1OA 4P74A 2K6DA 1GBRA 2Z6BA 4R4IA 2GBQA 4QUFA 4QUCA 3FB9A 3M0TA 1JXOA 3VS2A 4PLLA 1WJRA 4IURA 5C4ZA 4DF7A 4C8QE 1PFBA 2M0YA 3OYYA 3CC4A 3HKZG 2M1HA 1CFMA 4HJ7A 1HPCA 3G6ET 4RA8A 1X27A 3U23A 1V9PA 3QYHB 1Z9ZA 4DBQA
chains in the Genus database with same CATH topology
2VGMA 3QOJA 3S15B 3G4ST 1QVGA 3EVQA 4L8JA 2QF7A 2WKCA 4BS9A 2RK1A 1ZBXA 1O7YA 3RMSA 4BY6B 4F7UB 4OO1I 3CPFA 2RKSA 2L55A 2WKDA 4YTLA 4HT9A 3OMCA 1A15A 2R61A 1YJNT 1D1KA 5FK9C 1BIBA 4M7DB 1ZXTA 3A7AB 3MEHA 1ENCA 5ELCA 2MUYA 2PQWA 1KDAA 1PRTC 2O2LD 3GLXA 3P1HA 1KAAA 4LDVA 1K83B 3DXJC 1V1PA 4RCOA 2IG0A 4IUUA 5GAMd 3GTLB 1AHJB 2JN0A 2XSCA 2E1HA 3H3VC 4Y91A 2IL8A 3OYGA 1TQOA 1F2YA 4KD4A 4C8QB 5FO8B 3WXMB 1QNKA 3I4LA 4HCEA 2DVEA 2B2TC 2CQAA 4C3JB 4J6WA 2EY5A 4ME5A 3WDNA 3CMAA 2XRSD 3META 3HFNA 2ZPGB 2OTLT 3EQLC 4OGEA 1TH7A 4M7DD 4RG8A 4JS5A 1L0YB 4M77C 1WQWA 3OB9A 3OYKA 2I46A 4ODGA 1D3BB 5JVH3 1A6XA 4PJOE 4LD9K 2CW0C 1SNQA 2E10A 1PLFA 4EGVA 1VF7A 2XI9A 2LT4A 2R6GA 2ZPFB 1CT1D 3RZOB 5FU6B 2EYFA 1VQNT 2Y90A 3JCMe 2V4DA 3CD6A 2LNVA 1HFGA 4NW2A 3VA5A 1JOKA 2MJ8A 5KGUA 2F4IA 2RI5A 2K5LA 3CBPA 1AZPA 4C8QD 4OGQC 1SNOA 5DEHA 5CIUA 4Y7NB 2AQ3B 2F0MA 1U4PA 2KAFA 4K5VA 2MI6A 4BBSB 2LX9A 4C5EA 5A35A 2CZ7B 4Y28E 2IW3A 2MP1A 4MMLA 4J1MA 1I4K1 2DXBA 3JCMc 1KD1C 2A74C 3KLSX 1WTVA 3GO5A 4CJ2C 2PZWA 3OYIA 3NXWA 2L1BA 4A3JB 2DNEA 2XIDA 2JOYA 2DXCA 2EY6A 1WTQA 1F77A 1PZJD 3A55A 1Q81U 3QZ5B 4A3EB 2X4XA 2A6EC 2B2UC 4PJOB 2JA6B 1B1ZA 3M85A 2YHTA 5EKLA 3CBOA 3H8ZA 3CCUT 2F0EA 2YYZA 3CHBD 4OB1B 1AW7A 4GZYC 4ZTFA 2KEEA 4HTHA 3PIP3 2EXZA 3MFGA 3CCVT 4BDZA 3QO3A 1N6AA 1X75C 3R2TA 1A2UA 4DNTB 3JSCA 1ENFA 5DNFA 1B34A 4M75A 4BE1A 2B8AA 4F88A 3FEOA 1EZ8A 4PNOA 2VGNA 4PKCC 3CCST 2F0QA 3BG3A 1U4RA 1X3PA 1VQ8T 1MGQA 1VQ7A 3RLFA 3VJPA 1V29B 3UT1A 5CKDA 4CKBA 1Q82U 4KUIA 3LYIA 1VQOA 2YU9B 4KI0A 2F0KA 2SNMA 4KT0E 4BI3A 3OIQA 3BS1A 2BUDA 1TWAB 4K5WA 3NE5B 2HDLA 4H0LC 3HP3A 4PJOD 2JEAI 3FMCA 3X26B 3CCJA 1PXUA 4WORA 4E7KA 4K8IA 3SR1A 2KDSA 5KNCA 1E2VA 1C4QA 4M78E 3SWNA 1SMYC 4NDXA 3MC0B 1STEA 2C9OA 2B2VC 2F0JA 2KUMA 4FM4B 2EYLA 4CJ0B 1NJIC 4PL6A 3I3CA 1TS5A 3KUFA 5M5YB 4ZN1A 3BVGA 1XXGA 5EPLA 2ZCFB 4K2KA 1O75A 5T1IA 3R93A 1IW7C 4R9WA 5A2QE 4JJNK 2D6FA 4FO2A 2QEJC 3TMEA 1M1KC 4M7AG 4CKEA 1Y7XA 1YNJD 3A7LA 5DM63 4ME7A 3BDCA 3AB9A 4CI0C 4XTCS 3LH0A 4C1NK 2AWOA 1WPYA 1HXYD 1F2MA 2HQEA 4O5VA 2PW7A 2K5WA 5COYA 3U9SA 2CZ6B 3PMIA 4KBMB 4FF3A 1SJHD 3KLSA 1LOJA 2DY7A 1HK9A 2LTOA 4WRDA 2FHDA 4FVMA 2K6AA 1S5FD 3MXPA 2OTJT 5GAOn 2QQ9A 3JCMP 3CCET 3IFDA 2Q8RE 3CCQT 1LABA 5BN5A 4X9CA 3LX0A 5C0XG 4IUVA 2NB0A 3S1MB 3QYGB 2D62A 3A54A 4KKTA 4C0GA 4XQJA 3E19A 4M78B 5ELDA 3SE0A 4GLKA 1QWYA 1ZYRD 3VR2A 2LQKA 5I2SA 3TP5A 1STGA 5F2DA 5CQYA 2LCCA 1KDBA 4ZGDB 2SNSA 4X34A 2AUJD 1WCMB 3VYSA 2NVTB 1PRTF 4EMKA 2HBPA 1STYA 5LJ5e 5CKBA 1BYMA 1TS2A 2R7ZB 4XU1A 1BXTA 4ZN3A 3WVDB 3TCJA 1RDPD 1NR4A 4V190 3OMGA 1FR3A 2RSOA 3D6CA 1X6OA 4OB0B 2LKVA 3VYHB 3JCMb 4XAXB 5IN1A 2M0OA 5G3LD 1KC8C 4RKLA 3A8KE 5EG2A 3QSUA 4C1NI 4M78D 3JCMd 1QE6A 1NUCA 1SE2A 3L9AX 2JE6I 2NN6I 3T9NA 4A3GB 3Q22A 3JCMh 2HAXA 3BZDB 5D6YA 1UAPA 4K14A 2Q8IB 4M77F 1M9SA 1GUSA 3LGFA 1IREB 3S3MA 4R8NA 5CMDA 1M90C 2EDGA 1YJWA 1T5XD 2ZPBB 1EZ6A 2PW5A 4OVAA 1IYVA 3AHUA 3GD7A 2K28A 1Y71A 1QNUA 3L2WA 1N8RC 5GAMf 4RGMA 3TEEA 3SDZA 2LC4A 2R58A 4YIJA 3A56A 5A0DA 1YJWT 3T13A 4OB2B 1JQYD 3FDRA 3HRSA 1J9OA 5AFWA 3QG1A 5JEAJ 2EAYA 3C2PA 2RJDA 2L5TA 5HURA 5M5XB 1TT2A 2CS7A 3S3OA 3RD4A 3QJYA 2K05A 1DOKA 1L0XB 4EQNA 4RMOA 5C0MA 3MXGA 5IOCA 5C6SA 1BQQT 1QILA 3TP7A 4G57A 4MHEA 3NQTA 4O1NA 3M58A 3BFMA 1S72T 3HG9A 3PUZA 4VUBA 2DXUA 3OWFA 5DLQE 5I6WA 3HRZC 3SHLA 2PO4A 3ONAB 5KEEA 1PYWD 1K8AU 3Q23A 3C94A 1TWCB 5C5LA 4JUVA 2OAUA 1TWGB 1IKLA 2WACA 2F0VA 2PCFB 2LRQA 3NTIA 4KN4C 3MO8A 3PNWC 2JA8B 2R92B 4M7DC 4IFDG 3SB2A 1QP2A 2LVMA 4RGTA 2EY2A 4HSPA 4X9DA 1LV9A 3CPWA 3HS0C 4BA1I 3A8LB 5GMKm 1QVFA 1YNND 2D0QB 4BY7B 4KMUC 4OMFB 3VA7A 3HKSA 1OZ2A 1LT6D 2A6HC 2EE1A 3M4YA 2DPPB 2J0TD 4C8QC 2QDBA 3I90A 1VIEA 2CHBD 2VB3X 3DEOA 1STHA 3C12A 3CC7T 3E9GA 4XDXA 4HMJA 2QQAA 5I2YA 4P5NA 4QQ6A 4N4IA 1B44D 1CZGA 5GAN8 1MD2D 3GTGB 3QIAA 1G6ZA 1JRIA 2ICIA 4DFAA 4EDUA 1I4HA 4RGNA 5KYLA 1D5MC 5FO7B 1XYIA 1LO5D 1RCVD 1SYGA 4HCZA 3E6ZX 4RHSA 1B53A 3FPUB 5FU6C 4XQ3A 1CQFA 5I2XA 1GHKA 3L3OC 4UAIA 2SEBD 3JB9H 5GAMj 2BA0A 1G291 3K5LA 3GTMB 1WTOA 2ENBA 1P92A 3P8BB 5CKFA 2K1BA 1VQ6A 4N0AC 3SXHA 2WSFE 3C3LA 1J8IA 1VQ4T 3DUZA 5HY6A 2ZXRA 1M5Q1 1CQVA 2M16A 4II1A 3V8KA 2EJGA 1TY0A 3A8GB 4DK0A 4HAEA 4QVDA 4P2CB 1SDFA 2JSOA 3X28B 3DEPA 3GV3A 5EJWA 2RB6A 5LJ5d 4WFN3 5CC4A 3BDUA 3OS5A 5KIXA 3MCAB 1K8MA 3QPHA 1YHQT 5BN3A 2DXTA 3I70A 3J81E 5LJ5h 1TVXA 2E2HB 2LS01 1D1IA 3NHHA 2PPBC 4PJOC 3GQBA 2E75C 2SOBA 5E3FA 3V96A 1Y1WB 3SK4A 4IUTA 2QEXA 3MWYW 5HGTA 3VV0A 5GANd 2BDNA 1G3WA 1KABA 2RH2A 5FLXE 3KF8A 2O5JC 4B9WA 1HQMC 1MSHA 2J7ZA 5LJ3g 2RQXA 2KECA 2X4WA 5EBCA 5GANh 1G3SA 3ZEHA 1WJSA 3HHTB 2CVRA 2EJGC 2K33A 4XT3B 3OYAA 1SNDA 5JJZA 3TBIB 1OXSC 3RKWA 2Q8TA 4LDWA 4KHVA 4RKUE 1CI3M 5CKEA 3JB9D 1KNEA 2ZGWA 1V43A 1V8QA 2Z4HA 1QVPA 1WD1A 1RI0A 4CHTB 2N88A 2O5IC 3NUCA 3BVZA 2F0HA 5CYUA 3WOFA 4FIBA 1YBYA 1LTTD 3LNNA 4NP5A 1M8VA 3GTQB 4C0ZA 4FF4A 1UGQB 3IL8A 2XVSA 2F5TX 2LY7A 4BBRB 2NWGA 1VQPA 4N9PA 5EPKA 3RKXA 1VQ9T 1KQ2A 5M5WB 4ULLA 3HZXA 1B3AA 4MDWA 2MHVA 3HP9A 3M54A 3EJIA 2KY9A 3JCMg 1VQMA 1F2ZA 1S5CD 4MZTA 5CORA 3O8VA 4C2MB 5IAYA 3RMHA 1YI2A 4B9XA 3H6ZA 1Q12A 5CR2A 3I55T 5CKHA 3QWNA 4MZPA 2DK3A 2A73B 4DXGA 1ZYRC 3A5ZB 3DHQA 3X24B 1ESRA 5DY9A 2D5DA 2GFAA 4LD6A 3H09A 3J80L 1BI1A 1NE8A 4LMQD 3NTKA 3JCMJ 2RHYA 2L3RA 2B63B 3HRTA 2F0DA 2RSNA 5GMKj 4R55A 1MI2A 1FGBD 4XU3A 4FYDA 1JWSD 4E47A 4QB4A 1TWFB 3K5OA 2F0GA 3TP6A 3T51B 4L63B 1SXTA 1SNMA 2K32A 2VB2X 2VXWA 4KUDK 3OS0A 3PV0A 2JEBI 1PSFA 4M7AC 2JTFA 1EY6A 3MP8A 3MXUA 3CC4T 3NBIA 3ZYYX 1JC7A 1TS3A 5J1ZA 1EY0A 4XTUA 2WV6D 2B2TA 1HQRD 5GAN6 5D3IB 2KHSA 4M78C 4F7UF 5FO9B 4QW2A 1EL0A 1BO0A 4DGZA 2WIIB 4KY5A 5C4HA 3RIRA 1RF2D 2E6ZA 1VIFA 1FNWA 3T16A 5DLOA 1MBYA 4M7DF 4M77A 2F0OA 4AYBB 1GXIE 5ISRA 1LTBD 3QO2A 1I3QB 3NQIA 3H91A 3VR5A 4LAAA 3ND9A 3OQ5A 1SSFA 5I9PA 2NTSA 5LJ3e 2H3JA 4C3HG 1NZ9A 4DOVA 1F9RA 5GAOp 4C8QF 5C4XB 2ICEC 2NVYB 2B8FA 3KBXA 3DKMA 4QQGA 2KOLA 1HUMA 2CKKA 1EQTA 5I2MA 4FP5D 5J39A 3I4NB 3S1RB 4ZGEB 4ILWA 1JE4A 3HEJA 3P8HA 3VYUA 3DB4A 2SDFA 3BYYB 3JCMX 1HCZA 2RI2A 1IKMA 4G4KA 2GF7A 5JVG3 3CMAT 3CEYA 3OW2A 4PMCA 3K59A 4JRKA 5IT9L 4NMZA 3RESA 2D2CC 1I4RA 1BIAA 2HUGA 1KD1U 3C1FA 1U1TA 2QILA 2EVBA 3OOCA 1QG7A 2B2UA 2A6HD 2DNCA 1OXUA 1PFMA 1VQKA 3KBGA 2EWNA 1DM0B 2QCPX 1SE3A 3R8BA 3CD6T 4TVRA 3T4AC 2C06A 2FINB 3HSBA 1KTKA 2XD0A 2RA2A 2QQBA 3QZ9B 4RG2A 3C46A 1KQSS 2EJFA 1C48A 3EFSA 2QA4A 4JLGA 1YNNC 3M56A 4FF1A 3UI2A 3FDTA 1G3TA 4KTAA 2QI2A 2IX1A 1WTRA 3CU7A 4C5IA 4KKSA 5IGCA 2QDYB 3FPPA 5GMKi 3S14B 1ILPA 2M2LA 1JR0D 4PJOF 3S3NA 2WSCE 4JRIA 5LJ5g 1A3UA 1VDZA 4I7ZC 3NWSA 5AYFA 1FYCA 1SYDA 3X25B 1BR9A 2XG8D 2NN6G 1M1GA 3ND8A 4FU6A 2R5AA 1N27A 1O80A 2E6NA 3MAQA 5A0GA 2B2VA 2P0PA 4FXGC 4OIJA 2PZTA 3SK6A 3P7JA 3PUVA 1ENAA 2IJ0A 4JDSA 2EJFC 3K58A 1Q7YU 1BCPB 3M4OB 4KKUA 1SEBD 5NUCA 3DWQA 3JAML 4BACA 4A93B 1X3QA 5GANg 1KNAA 4H13C 4FL6A 1KDCA 5M3FB 1LTGD 2NVXB 2EQUA 5FROA 2JXMB 1H9SB 1NJIU 4LK1C 5GAOl 3OYBA 4EPCA 5TSSA 3PIOA 4M7AE 1C8CA 1VQ7T 1Q8IA 4KY6A 2IPKD 2Y0SB 4E7HA 3J7YW 4ZLTF 1OXVA 4HCBA 1VQOT 3L2UA 1NCVA 3HRUA 1M1KU 3OYFA 3CMEA 1UEBA 2G9HD 1F2LA 4D6WA 3M9QA 4CBVA 3CXCS 5KE2A 4XTVA 3CPWS 5C44B 4OIKA 2XRQD 3NFCA 2F1MA 3CCJT 4A4FA 2RHXA 1GUGA 3QIIA 1QVFS 5CV9A 3PO2B 3CRLC 4QVCA 1EY7A 2ID0A 4QF4A 1Y96B 1KLGD 2JP1A 4MN3A 1K73U 4IZ8A 1B9NA 3D4WA 4IUNA 4QCLA 3HOZB 3C1EA 1BDOA 3CCMA 4C92G 4KJNA 4Q0FA 5JEAG 3CC2A 4PLIA 1EYDA 1B50A 3PGGA 2GFUA 4JRQA 2G3RA 1M4ZA 4RGOS 4EQPA 1SE4A 2EPBA 3Q0AA 3J80E 4M7AB 1GUTA 3RERA 1AN8A 1WQ7A 4M7AF 1UNSA 1HXDA 5C0XH 2E12A 3CC2T 3L2ZA 4ZTJA 3OWEB 5G3LF 1W2BA 3S16B 1U4MA 2PMZB 4ATOA 4M78F 3W2DA 5LJ3d 3M7NA 2X6GA 2XU8A 5ELEA 1EY4A 1ESFA 2K3XA 2X6LA 3VU3C 5LJ3h 3HOUB 1AFPA 2RK2A 3GIBA 2MMPA 1KC8U 2K5DA 4BD3A 2EKOA 5CCAA 2PYKA 2HDMA 2R3ZA 3KXTA 2WAQB 2K5FA 3J7AV 1I4QA 2JTMA 1BI3A 4NS5A 1SSOA 2EYQA 2X4JA 3VUZA 4M7AD 1Q90A 2B39A 1I4XA 3CCRA 1FD7D 3DLMA 2G9DA 4XYQA 5I4DA 4XQQA 1DOMA 3GPLA 5I9OA 2ZZDA 2A3LA 3DLLA 3G71A 5GANe 1M90U 5ELBA 4JK1C 1I50B 1UB4A 4KK7A 2K03A 1IL8A 4M77G 5GAOr 2PU9B 4PMBA 1R9TB 5JPMC 4HT8A 1N8RU 3OSOA 4IKFA 5D14A 2YLCA 1KQSA 1EWCA 3C4SA 4DA2A 4BE0A 2AHJB 2PQEA 4DN4M 4BE2A 2GCXA 3URGA 1WTWA 1LTRD 1WTPA 5A0LA 2RJEA 3I56A 3QB3A 3TZUA 3GTOB 1QCBD 2H4OA 1OXXK 3L42A 1YCYA 1T5EA 2A5HA 3H94A 5D3DA 4F7UA 2K5QA 3M55A 5CVIA 2FMMA 3A8JE 1UGPB 4G7OC 5CQXA 1DONA 2V8JA 1EY8A 4KV6A 1V1PB 1VQLA 1R4PB 5LHY1 2B2WC 4M7DA 4J83A 1XX8A 4JBWA 5EBDA 2YRVA 5IT9E 2EYJA 5KCHA 2CZ1B 2L89A 1VQ5A 5EPJA 2VUBA 4V0BA 3S17B 2L9HA 3S9WA 5K36G 2F0UA 2KQ3A 4RCCA 3AMUA 1TIID 2X69A 3V7RA 1AZQA 2F0LA 1B2TA 2KCNA 3F2UA 1RTNA 1VQ5T 1DJ7B 3OYMA 4C8QA 1IHZA 3L7ZC 5J22A 5JOBA 5L8RE 4ZUJA 3TSSA 5IGEA 2VV5A 2F0IA 2KCCA 4OP0A 3MZ5A 3WOEA 2EQMA 1IZ6A 1QJOA 3HOVB 1YITA 5IGBA 4N4HA 3GTJB 2K5IA 3G6JB 4L6TB 1RODA 4XTXA 2NTTA 4M1UB 4IFDH 3S6WA 3TU4K 3CXCA 1V1OA 1D3BA 5D6WA 1B9MA 2L8DA 4C3IG 5CK9A 3GNFB 4M75E 3CCLA 3BVMA 1M8AA 1SYCA 1CZWA 1SAPA 3FIFA 3V05A 2XN9C 2FB7A 1PDQA 2E2IB 1BKBA 2DO3A 3K5MA 3EFRA 1EYAA 4A54A 4ZK9B 2ZXOA 5E4XA 2K7VA 1DXMA 2RBMA 1SYBA 2RA4A 4HEDA 4RH6A 3K57A 4N0AA 3MXNA 2CYZB 5CR3A 1WVLA 5EKKA 3MHBA 3GNGA 4WJWA 2XICA 3SK5A 4M75G 4ZGJB 1M4VA 3LX7A 4E7IA 3HOXB 2XDDA 4KJOA 3PIO3