4B9WA

Structure of extended tudor domain td3 from mouse tdrd1 in complex with mili peptide containing dimethylarginine 45.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
196
structure length
196
Chain Sequence
LEWTWVEFTVDETVDVVVCMMYSPGEFYCHFLKDDALEKLDDLNQSLADYCAQKPPNGFKAEIGRPCCAFFSGDGNWYRALVKEILPSGNVKVHFVDYGNVEEVTTDQLQAILPQFLLLPFQGMQCWLVDIQPPNKHWTKEATARFQACVVGLKLQARVVEITANGVGVELTDLSTPYPKIISDVLIREQLVLRCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The multiple Tudor domain-containing protein TDRD1 is a molecular scaffold for mouse Piwi proteins and piRNA biogenesis factors.
pubmed doi rcsb
source organism Mus musculus
molecule tags Replication
molecule keywords TUDOR DOMAIN-CONTAINING PROTEIN 1
total genus 46
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00567 TUDOR Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4b9wA02
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4b9wA01
5KCOA 4C5IA 1EY9A 1KAAA 5CR3A 5EGTA 2XK0A 5CC4A 1SNOA 3OYEA 2EY6A 1SYFA 2F0IA 2EYJA 1SYCA 2EQMA 1STYA 4HCZA 2F0FA 3SK6A 5D6WA 2EYFA 1NUCA 3QIIA 2EY2A 5KYLA 3DB4A 2KHSA 2LDMA 3C1FA 5IIFA 2M0OA 3S6WA 4KJNA 1KDAA 1OZ3A 1EYAA 2B8AA 3TP5A 4E7IA 4IKFA 4RKLA 2BUDA 4S3SA 5C3XA 4C5HA 3MZ5A 4K8JA 3SK8A 3LX0A 5C5MA 5I6WA 4N9PA 2DIGA 3LYIA 5C6SA 5C3WA 2PZWA 4BE1A 1RI0A 1JOQA 2F0PA 3ERQA 2RI5A 3ASKA 5JOBA 3P8DA 5IGFA 4QB4A 2JZ2A 4ME5A 4E7LA 2EFIA 5I6YA 3S3OA 2EKOA 4IUNA 4KD3A 1ENCA 2L8DA 1F2YA 1F2ZA 4IUVA 5KGUA 1SYDA 1WJQA 3D4DA 4BE0A 3OQ5A 3T16A 2MWPA 2F0HA 2R5AA 5IOCA 3OYMA 1WJRA 3S9WA 2G3RA 1G5VA 3QOLA 5J39A 3S3NA 3C4SA 4NP5A 4RKBA 2EYLA 1TT2A 2PYKA 2WACA 2RJDA 4NDXA 4EQNA 1JORA 4GY5A 2F0JA 1SNQA 3GOXA 5IGBA 2O4XA 3LGFA 3LH0A 1EYCA 4E7KA 3U9OA 3NTHA 3EVQA 3MHBA 5I9OA 3M9QA 2F0TA 3KUFA 4NMZA 3DB3A 1A3UA 5E1FA 3OYDA 3L2RA 2L89A 4WRDA 2M00A 4LAAA 5IGDA 2F0OA 3MVVA 2QQSA 2F0MA 5J1ZA 4IALA 3NUCA 4BE2A 1SSFA 4WORA 5IGCA 2K3XA 3SHLA 1STBA 3OYHA 4K6DA 4DFAA 3MO8A 4PNYA 5I9PA 5IAYA 3OA6A 2EXZA 1EY4A 3OS2A 2E5QA 5ISRA 2CKKA 2RHIA 3MEVA 4EDUA 2EY1A 4Z02A 2QQRA 4QW2A 1A3TA 2F3VA 5J22A 2R57A 3QJ6A 5C0MA 3OS1A 5IN1A 3MP1A 4IUUA 2NUCA 1NSNS 3HEJA 2NLUA 2F5KA 4KJOA 4F7XA 5DEHA 3NK9A 3PNWC 2GFUA 4K5WA 3QOJA 4N9TA 4DF7A 2X35A 1EY7A 3V2TA 4B9XA 4J1MA 5CV6A 2LVMA 4II1A 2F0VA 1N27A 4E7HA 4KHVA 4QVZA 3OYNA 1OI1A 3PMIA 4K5XA 5KE2A 2X4XA 1STGA 3ME9A 5CV4A 2OXPA 3NTKA 2M16A 3LGLA 4NKLA 3OYAA 1EYDA 2EQJA 3H8ZA 1EY0A 3TP6A 2RI3A 3O8VA 2QDBA 5KRUA 5D6XA 3P1HA 2JTFA 3L2QA 1EZ8A 4K2KA 3SD4A 1SNDA 3BDCA 4FU6A 5HGTA 3Q1JA 1WJSA 3P8HA 3PMTA 2RKSA 4EQOA 3SK4A 4PMBA 3OYGA 2F0QA 2EYOA 1EZ6A 3SR1A 3QBYA 2PW7A 1SNCA 4IURA 3NQTA 4NS5A 4IZ8A 4EQPA 4PL6A 1EY6A 4HMJA 1TR5A 2XDPA 2BIVA 3MP8A 3E5SA 2RI2A 2F0DA 4MIUA 4HTHA 2IG0A 3TP8A 5KEEA 1AEXA 2ENBA 2RBMA 4OL7A 3H6ZA 2LKVA 4PLLA 3FDRA 3META 3OYJA 2PQWA 4L59A 4KY7A 4BACA 1SNMA 3EROA 2D9TA 4BDZA 2F0KA 5C4ZA 4ZQ3A 1A3VA 5IGGA 5K5PA 3QKJA 2OEOA 4ID6A 4DGZA 5C5LA 3L2VA 5CV7A 5KYIA 3VA5A 4OVAA 1KHCA 2M1HA 3BDLA 3CEYA 2RJFA 3MEUA 1SYBA 3NXWA 5CV8A 2RJCA 2RDFA 3L2UA 4HMIA 3OYBA 2F0WA 3OS0A 3HZXA 2P0KA 2SOBA 4EVOA 1STAA 4BD3A 1IHZA 3EJIA 5C6AA 3OY9A 4IUPA 3UT1A 3L2WA 4IUTA 1TQOA 2F0EA 2EY5A 1ENAA 3D6CA 2E6NA 4F8MA 4IUQA 4KV6A 5KIXA 3LX7A 1JOOA 2GF7A 4A4HA 3MEAA 3DLMA 5KCHA 2RHZA 4KY5A 3TMEA 1U9RA 4E6IA 2DAQA 2BKDN 2K3YA 3MEWA 3FC3A 1EY5A 5FROA 3OYKA 3RUZA 4K5VA 4QF4A 5CGKA 3MP6A 1STNA 3FLGA 1EY8A 4CRIA 5NUCA 2PZUA 2R5MA 4C5EA 3OYFA 4RG2A 3ZEHA 4I65A 2F0NA 5EKKA 1KDBA 3NP8A 3C1EA 4K2LA 4KD4A 3LLRA 4ZUJA 4E7JA 4A4GA 4BDYA 2FHDA 3P75A 2F3WA 4G57A 3QB3A 3TP7A 4DU9A 5EKLA 4KTAA 5C4HA 1JOKA 2PW5A 4A4FA 4PMCA 5E3FA 4B9WA 1MHNA 3E9FA 5M9OA 4QQ6A 4QQDA 1OYXA 1A2UA 1OZ2A 4TRDA 4UC4A 2PZTA 2GFAA 3OWFA 5CV5A 5FRNA 3F70A 1EQVA 4ZUIA 4YIJA 2EQUA 1SNPA 1II3A 5CV9A 2DIQA 2LTOA 4QMGA 4LD6A 3OYLA 2SNSA 1F2MA 4FL6A 3MXPA 5JAVA 2MWOA 4N4IA 1KABA 2EYHA 3NTIA 1H3ZA 3ITPA 2OF1A 2X4WA 3SK5A 2L3RA 4X34A 4KY6A 5FRMA 3UWNA 4A4EA 3OSOA 3PMFA 5F2DA 3MEHA 3E9GA 2YRVA 5KE3A 4PLIA 1SYGA 4H7BA 2VYTA 4ZTJA 5DAUA 3DHQA 2F0GA 4K8IA 5J26A 3OMGA 1STHA 2RHXA 3DMUA 1WGSA 2HQXA 5CIUA 4R8NA 4K14A 2F0SA 2PQEA 3T13A 4QQGA 2EYPA 1A2TA 5KH6A 2RJEA 2O4XB 1SYEA 2KQ3A 2LCCA 2F0LA 2X4YA 4C5GA 2EYMA 2RHUA 2R58A 3S3MA 5D6YA 3PFSA 3OMCA 4N4GA 1KDCA 3OB9A 3R3OA 3D4WA 2SNMA 4ZTFA 1RKNA 3SXHA 2RHYA 4J6HA 1XNIA 5HURA 3OYIA 2LRQA 3OYCA 4ODGA 2RO0A 5IODA 3FEOA 4N4HA 2HQEA 3EAEA 3H6MA 3D8GA 2F0UA 5IGEA 4Q5WA 3NHHA 3L42A 2EQKA
chains in the Genus database with same CATH superfamily
1H92A 4BY1G 3DKMA 2RCFA 1IBLQ 4Q5VA 1WXTA 2EJGC 5EGTA 4NOYA 1ZYRD 1VQ6A 1SNOA 4BY1B 4AIMA 4DR7Q 5GMKm 1IHWA 2B29A 1NPRA 4PJJA 4PJNA 5GMKl 4AQYQ 1K8AC 2EYJA 4IO9A 2EQMA 1TY2A 3SK6A 4KULA 1HTPA 3HOZB 4R0KA 5AYFA 1C48A 4MHEA 3UI2A 3J80E 2DD5A 1UB4A 4QT7A 3I7FA 1J5EL 2KRSA 4QL5A 2JMCA 2A1AA 2BZXA 2LSSA 4PJOA 3C1FA 2M0OA 3DLLA 2P5ZX 3NBHA 2FO0A 3TQ7P 3GD7A 1OZ3A 1X65A 3GTQB 5KYWB 5CO7A 3CCSA 1GD7A 1NJIC 1CFMA 4GLVB 2CCZA 1ARKA 1C1AA 4RKLA 2IX1A 1GBQA 2QEJC 4S3SA 4M77C 3H3VH 4JI7L 3CMET 4C5HA 3CU7A 3MZ5A 3BZCA 4R4CA 5HCKA 4L5RC 5I6WA 2FXQA 2ZPFB 1I4XA 1QCOA 2KNBB 1VQ4T 1RI0A 3REBB 3HKZE 2EYQA 2F0PA 3QZ9B 1EWHA 2FG0A 5KYYA 1VMCA 3EIVA 1KQSA 1UGQB 1WVLA 4A3KG 1Z9FA 2KCMA 1NM7A 3L2ZA 4RG8A 4A3IB 4E7LA 4C3IG 3UF4A 2ED0A 5I6YA 4XTUA 1KXLA 2DILA 1VQ5A 2MJ8A 2JEBI 4KD3A 4K0KL 1CKBA 2A28A 3I5SA 1BXTA 1M2OA 1IBML 1SYDA 3X20B 4C8QG 3D4DA 4BE0A 3RD4A 5M5XH 5BN3A 2R61A 5M3MG 2RDHA 1ESFA 1RAFB 3A8GB 4LD9K 5GANg 1S3OA 2MWPA 2MCNA 4J9CA 4KHZA 5GAN6 5GAMh 5IOCA 1O75A 1HFNA 1WJRA 2TSSA 5FKAC 1Y1VH 3JCMQ 1K9MU 4Q0FA 4BXXG 4XT3B 4Z9CB 1WX6A 3S3NA 2XWBB 2OTJT 4NP5A 3PUYA 3DUZA 2XG8D 1D2BA 2WACA 1D3BB 3IFTA 4HJ8A 2F0JA 1FMKA 2FJ2A 1E7OA 2K5NA 2VUMH 1X54A 2EPDA 2LQWA 2AHJB 4JI1L 2E5LQ 2COZA 2DF6A 1WDXA 5J3BA 2KOLA 5FLXE 4DR1L 2FL7A 2B2TC 1NAPA 3U9OA 3SEBA 1DJRD 2BE5D 3CRKC 3CCJQ 1YJNT 4NMZA 1KSWA 2B2VA 1Q82R 3CXCA 2MPXC 4LAAA 3LWEA 3OBWA 1EWCA 3HGBA 2F0MA 5GMKj 4B3SL 2B2UA 2K1BA 4IALA 2CS7A 1LT3D 4WORA 2KROA 2JM9A 1YHQT 1FGUA 1SXTA 1ACMB 5LJ5h 3RR6A 3CC4A 3CXCS 5IP9G 1VOMA 4AG1C 1UUEA 4K6DA 2RQXA 4DFAA 3MO8A 5DM7R 2Z8LA 2X3XD 1GUWA 1PNJA 1I4PA 1O9SA 2E5QA 4FIBA 3W1BA 1TWAH 1XTDA 4L8JA 4WFN3 2RHIA 4EDUA 1PZJD 2FINB 2QQRA 1A3TA 2F3VA 2HCCA 1VQ4Q 4JCVE 1MHWC 3LW5E 3VYTA 2DERA 3GTMB 1B3QA 2F3IA 1UE7A 3CCJA 2N88A 1NSNS 3A1PA 4ELZC 3M53A 1Y1VG 2PI2A 3HEJA 4BXXH 3PTAA 4IFDH 2E64A 5GAMg 3I4OA 2A7YA 2DLPA 3MHXA 4KJOA 3PO2H 2VASA 3PO3G 1WNLA 3PNWC 4M4ZA 4OB2B 2GFUA 2HUGA 1ML0D 3TS0A 1Q7YU 2B2YA 4KKUA 4N9TA 3HOVH 4XAXB 1SPKA 4KN4C 1WTXA 5FO7B 3R8BA 4YTLA 4B9XA 2FVUA 2ZT9C 5FOBB 2LVMA 4X9DA 2VWFA 3CHBD 1I81A 1Y7XA 4C92D 4DV0L 1I6VC 1N33Q 2DXUA 2B8GA 3E6ZX 3ER0A 2NUTA 1Y96A 4JYAL 3P8BB 1KL9A 5KE2A 3EFSA 1G2SA 3TVTA 2EVBA 3DWAA 1VCIA 2M16A 4BI3A 3CCUT 4BY7H 2CH4W 3QWYA 4CC7A 4OWXB 4CKEA 3RLFA 1CUKA 2NWMA 1D1BA 3QYHB 2WKDA 1EY0A 3TP6A 1H641 3PSIA 3DWQA 4X9CA 3K5OA 2QDBA 1VF7A 3B6YA 1IXDA 1QOHA 1PXUA 5D6XA 4XDXA 4DUYQ 2HNIA 2KA7A 4PJOF 2Q8TA 1EZ8A 1RDPD 1KC8C 4DOWA 1B9NA 2J05A 2Z6KC 1SNDA 3KLWA 3HOXG 4FT2A 1ET6A 2UXBL 1M4VA 3BDCA 5KYYB 4FXKC 4DR5Q 4WF2A 1N33L 1PH4A 2F5TX 1XPRA 2A68D 3CCMT 3S1QB 3NPPA 2J7ZA 3JCMe 4UP8A 3PF5A 1CSKA 4PQXA 3UPUA 2DTIA 8AT1B 1YITQ 3WDNA 2HAXA 2NVXB 5A35A 1VQ9T 1O7IA 1LTAD 1HQRD 1MNDA 2HD0A 2GTJA 2E75C 1N32L 4MMLA 1LABA 2EYOA 2F0QA 3S14B 4DAYB 1WTQA 4QKUA 3VU3C 1D6EC 1SNCA 2AQ3B 2B2YC 3MXNB 1EIFA 5KNCA 1HRJA 4IZ8A 2K03A 4JI3L 4A93H 5IYCG 4D6WA 2CZ6B 2DL8A 1EY6A 3FIFA 2L12A 4IQZA 2G5DA 1PRTC 2KI7A 1PZID 1ZYRC 1K73R 3EFXD 4X3KA 1QWYA 1RLQC 4ZK9B 1FWZA 2A0FB 3UDCA 3F2UA 1WTHA 1SMYD 5GANe 2JUFA 2DRMA 2A19A 4N8X1 3K5LA 5AJ3Q 2HL3A 2N78A 3X3NA 2ENBA 4JI0Q 4BY1H 4GN5A 4UAIA 5FLXL 1N6AA 4B3TL 4IJHA 2LKVA 1AWWA 4J6WA 4Z8AA 5CYUA 2F4IA 4PLLA 3TDQA 3FDRA 5M3FG 2IPKD 2JN0A 1D1AA 3V7RA 3CCJT 1RI9A 1RL2A 3OHXC 4H02A 3GNFB 4CI0C 4BACA 1SNMA 3MKDA 4KY7A 2FPDA 2IVWA 1MGSA 3K5MA 4LDVA 5CBAE 3JAMc 3KF8A 4LF9L 2YU9H 4POGA 3HOVG 5C4ZA 1H95A 1K8GA 2JEAI 3DEPA 2EGEA 3SEMA 1GXIE 1Q7YR 4EGVA 2V8JA 1A3VA 4RFBA 2Z0WA 1RAAB 1TWBA 3EG9A 1VQ9Q 3EH1A 4R8IA 3JAME 2XKOC 3F8TA 4IFDI 3L2VA 2E70A 3SDZA 1G3YA 3JAML 4DR1Q 2LNHB 3A8KE 3VA5A 3QO3A 4A4KA 2FMCA 3ULLA 2K5DA 5LJ5f 1WD0A 3CEYA 3G71T 2UXBQ 2ZGWA 2NTTA 3MEUA 1SYBA 5K36G 4J7IA 1TH7A 4BS9A 4DUYL 2RJCA 5GAN5 1NE3A 3L2UA 2RDFA 4I7AA 2O2OA 4C3JB 1B2TA 2O9SA 1TU2B 1PH5A 3O5ZA 2H4OA 3GTKH 2LJ3A 3A8LB 3CCVQ 1FYCA 3RIRA 3JB9H 3GTPB 3KLRA 3JCMW 1VIFA 3STBC 5FK9C 4F87A 4DV3Q 2V1RA 3H15A 1TWFB 3EJIA 3FDTA 2RN8A 1S72T 5GROA 1EQQA 3M0RA 2HIVA 2CSQA 3WWVA 3GTQH 2R92G 3RLNA 3DM3A 1TQOA 3M54A 5KYXA 1V9PA 1OX8A 2L5QA 1YEZA 1UEAB 1ENAA 2K5FA 4HIMA 4KV6A 1OXVA 3A0JA 1YIJA 4BA2I 5C0XJ 2RQRA 4C8QD 1UNSA 1Z6HA 3DWPA 4M75G 2EW3A 1DYQA 1E3PA 2XVSA 2ID0A 2EDGA 3DLMA 1PHJA 1UUPA 3VDYA 1QJOA 4OF1A 1E7ZA 2ATCB 2AUKA 3J81i 1BBWA 4M7DB 5KCHA 1QQJA 4M77B 3GTOB 4YWKA 3W5OA 2D0QB 1TVXA 2NUPB 4D8KA 3H0GB 4H13C 4NL2A 1U9RA 1IYUA 2AQ2B 1HXDA 2CW0D 3R6NA 4OMQA 4KHPL 1YI2A 2DL3A 2LT1A 1CKMA 1VQMT 2V1CC 3G4ST 1PDQA 3KYHC 2A6EC 2RD1A 1AE2A 1SE8A 4JI8Q 3I55A 1QVFS 1KNEA 2NBFA 5C3EH 4A3EH 4QF4A 3I4MB 4M77G 1NNXA 3MP6A 2A6HC 2MI6A 2MQHA 1IRXA 3PCOB 4UDUC 3FLGA 4XTZA 5JEAG 1BCMA 1CKNA 5NUCA 4L6TB 4LJZC 2Y0SE 3GTMH 1HYOA 2L5TA 4JZ4A 4DAVA 2LFNA 1HUMA 4A3EB 3HRTA 4QUCA 2PVGB 2EOTA 2DY8A 3ULRB 5EKKA 2J6KA 1H3HA 3NP8A 4QIWB 2K50A 3C1EA 4K2LA 1VQFA 2R92B 4KD4A 5M3MH 1VQKA 1Q8IA 1I6HB 1NR4A 4J83A 3GTJH 1VQ7T 3BDOA 2A3LA 4ZUJA 3S15B 2KEAA 1CKNB 1M8MA 1WHKA 1GUOA 1RUWA 4GBQA 4A63B 4BUGA 1PYSB 3KLSX 3PGZA 2OTJQ 4BDYA 2KEEA 5E4WC 5M5WH 1ILPA 1M3AA 4O42A 1QW1A 2F3WA 4RA8A 3QB3A 2F1MA 1UE9A 3K80C 4JJNK 1HZ9A 1Q12A 1N9RA 2JYOA 2JJQA 3OBYA 2CP2A 3M58A 4C92F 1EYGA 4DR3Q 3MEFA 1ZSGA 1OXTA 4OMOA 4M77E 1TIID 2YTVA 4R56A 3PV0A 1L1OA 3AT1B 2EYZA 2A73B 1JOKA 4M75A 3JCMX 2KJXA 2B63G 2XDDA 4RAUC 2L3PA 1I8FA 4FYYB 1SSOA 2K6AA 3M4QA 4DV3L 1XPUA 3CMAQ 1KQ2A 5CKBA 2O88A 3E9FA 2D5DA 2ZPBB 4A93G 5M9OA 3RN5A 2GQVA 3RLOA 4XXEA 4JLGA 1PH1A 3JAMi 1S72A 2QCPX 3I72A 2ZJRA 1L0WA 4BY6C 2XN9C 4BB7A 4TRDA 2PZTA 2ATWA 1G6PA 4LDYA 2E41A 1M1KU 4R9WA 1B34B 3A5UA 5HK0A 4GKJQ 2XIWA 1K28A 1RTOA 2E4HA 2JA9A 1II3A 1SSHA 2DIQA 1B70B 1UAPA 4QMGA 4B3MQ 4A3CG 2JXMB 2O5IC 3HOXB 2MWOA 3QHSA 5I11A 1LT5D 1Q3LA 1D1KA 1M4ZA 3VUZA 2YT6A 1LTBD 3J81j 3D0FA 1GRIA 3I8ZA 1BYMA 4LF7L 1W4SA 2YUQA 3M3YB 1LCKA 2BE5C 1EFNA 1ZX6A 3NTIA 1PMRA 4O0AA 2X6GA 2OAUA 4M7AA 1D5XC 5BR8Q 1PV4A 4LF9Q 4PNOA 2KECA 2YLBA 2AWOA 2OF1A 1NTGA 1TXYA 2YV5A 2X4JA 3SK5A 1R9TB 5DLOA 1F9SA 1GOZA 3CW2C 3CCLT 4QJFA 1TU0B 3UWNA 3JC66 3KOJA 3UDIA 1UEBA 3E9GA 3BVMA 4ANJA 1K0XA 1EQTA 1LLRD 4DNTB 1Q8KA 2VYTA 4FCYA 5BR8L 3CC2A 4A3FH 1VQOQ 4JJDA 2RHQB 3BU2A 5J26A 4DV7Q 5GMKh 1STHA 4Y92A 2YTXA 2I5LX 2LCSA 5L8RE 4JZ3A 1ASZA 3U4VA 1YWOA 4A3MH 4CC2A 2ZXOA 1LM0A 3T13A 1KC8U 2QILA 4A3DB 1MI2A 1DD2A 1TKWB 1R8OB 3H0FA 1K9MR 3RESA 3HOWG 1QCNA 2JA8B 4GOPB 2ZPEB 2JE6I 2P84A 2RHUA 3TEEA 4ME3A 2M9UA 1HQMC 1BVSA 1I3QB 1OXUA 1FYNA 5IE8A 5GADC 5D6YA 1EUJA 1R77A 3CMAA 1KDCA 2EPBA 2PMZB 3KJPA 3MTSA 4AH6A 1WOCA 3D4WA 4TQUS 3S1QH 3MJXA 4DNRB 3SXHA 3OIPA 2RHYA 3MCAB 4J6HA 1XNIA 5HURA 1HJPA 1PTOF 2K5LA 2LRQA 1HXYD 5GANd 2E2IB 1Q82U 1HZBA 4TVAB 1UE5A 4FYDA 4ODGA 2LQNA 3MPUB 2EGCA 4DAYA 2DUDA 2K5WA 4N4HA 1QVPA 2HQEA 3EAEA 4CKBA 2ENMA 1Y8NB 2K33A 1YHBA 4JBWA 1XPOA 4KH1B 2LJ1A 2VVKA 2RK2A 4JOIA 3L42A 2MO1A 4M1UB 1QP3A 1STEA 3HFZB 2C0TA 1LTID 5KCOA 3C0CA 2ROLA 3I90A 2VB3X 5CC4A 2NVQB 3OYEA 1Y1VB 2Q8IB 3H41A 4P75A 5IYBH 4OWWB 3A8HB 1M1KR 4FVMA 3JRZA 2C9OA 3L3OC 1TWCB 5JEAH 2HDAA 1PTOH 5D6WA 1RAEB 1K73C 2P4RA 2EYFA 1NUCA 2IW3A 3OS5A 2ZPHB 3QIIA 4NXML 4Y28E 1W6JA 1NZ9A 4HVWA 3RMQA 5EBDA 1ZHIA 5CKFA 2PMZE 3EHQA 2UUCL 1A6XA 4OONA 4LNPA 4IN3A 2HBPA 1IKLA 1OULA 2E2DC 4C92E 5ELBA 4IOAA 2Z9HA 1D5ZC 3TP5A 3A54A 4JI4L 2HDLA 1WHGA 2CP3A 4NB3A 5JJLA 1NBEB 2OQ0A 3HS0C 5IYBG 3E3XA 5C44B 4M7DC 4GLKA 4GS3A 1IZ6A 1VYVA 4M78D 3SWNC 5C5MA 5GAN3 4N9PA 4JI6L 2O5JC 3LYIA 1VQOA 1XJWB 2K5VA 1WI5A 3G71A 5C3WA 4GLAC 3T1YQ 4L5GA 1TS2A 1JXOA 2F69A 4HIKA 3ZL7C 3ERQA 1B34A 3ASKA 1DOMA 1T9HA 1Y8OB 2VQEL 1Q81U 4KT0E 4V0BA 1NEBA 5IGFA 4HAEA 2JZ2A 4ME5A 4QGUA 3N5BB 4M7AD 2R92H 3T4AC 2A37A 2E65A 1XYIA 4KGXB 1EQRA 2E10A 4FW2A 1Y14B 3VR6A 1YJWA 4HIDA 2JXBA 1SN8A 3D7SB 1K9AA 4C3IB 5C4XH 2UXDL 2L8DA 1EEFD 1F2YA 2KYBA 2NTSA 4IUVA 4A3IG 4GZYC 1N8RU 2GN5A 4DKAC 3BY7A 5DY9A 4A3JH 2OCEA 4F7UE 1WJQA 2LMCB 4KK7A 3OTOQ 3S2DB 2D0NA 4A75A 4DV1Q 4POFA 4FF1A 5ELEA 2I0QA 4C3JH 2F0HA 1K0RA 3PIO3 2X6LA 1VQPQ 1MGQA 7AT1B 1W3SA 4A53A 1XMQQ 4PZ8A 2CT3A 1G5VA 2WV6D 1GHJA 3QOLA 4ALPA 3PE0A 2XHCA 3C4SA 1P16A 3M4OH 3F2BA 5IYDG 4HJAA 5A0GA 2CFMA 5JVH3 2HEQA 2RJDA 5GJWB 2NVTB 4ZYSA 4DBQA 1S1NA 4EQNA 3T1YL 1JORA 1HA5A 1UECA 3ERSX 2VKNA 5CORA 3NGPA 3FHWA 1Q7YC 2DJFC 1PD1A 3T1HL 4GLMA 3H91A 3NWSA 3BYYB 4JBJA 2ZJPA 4J15A 4A3KB 3EVQA 4X66L 1OX9A 2I5MX 3M9QA 2YUOA 3KUFA 5I9OA 2QTXA 1A3UA 4M8AA 2V8IA 1ZBXA 4WRDA 3UA7A 1PFNA 5IGDA 4R4OA 2EQSA 5GAHC 4OGCA 2OTLQ 1M8VA 2PQAB 3TRZA 2HT1A 1XJVA 4OMPA 4Y91A 1Q82C 1PYBA 1PRTD 2CVRA 2PCFB 1JXMA 1KQ1A 4NXMQ 1SE4A 4MMKA 4HVVA 3CCLQ 3VR3A 3AQQA 4A3BG 2D1XA 5IGCA 2ZM6Q 1BQQT 3MXGA 1VQMQ 2KMTA 2HDMA 1BKBA 3V7CA 1VQ7A 2LX9A 5HK3A 3A56A 1PH7A 4XU3A 2QW7A 5AFWA 5IYCH 5FLXc 5LMNW 2DZ9A 2H8HA 3WOEA 2NUPA 3SVMA 5HKCA 5ISRA 2JS2A 3K81C 2K2VA 3MEVA 2EY1A 1HZCA 2K28A 2V1QA 4Z02A 4M75B 1GJXA 3HOWB 2EJFC 1DCZA 1OXXK 1SBBB 5J22A 1J8IA 2DNCA 4AYBE 2DE0X 4ORZA 1YIJQ 1FVIA 3MFGA 1NEGA 3OS1A 4M7DG 4IPDA 3H3VI 4C1NK 2ASBA 1ET9A 4C2MB 1N8RR 4ZKCB 2NLUA 1SE3A 1JMCA 3KUPA 2JMAA 1S5FD 1N8RC 4C56C 4F7XA 4PJOD 1O7LA 4M77F 2EE1A 4K5WA 1AOJA 1B53A 3MXNA 1HR0Q 3QOJA 2B3GA 5H1SE 1M2VB 4JLIA 1I94Q 3CCUA 1N9WA 4J1MA 4II1A 1M30A 2A68C 2ZXRA 1KNAA 4BI8B 4EMKC 4DV6Q 2E76C 2K5HA 5DM73 4KHVA 1H9KA 1E1TA 5IHNA 1OI1A 1MV0B 2AMCB 3H3VC 2X4XA 1K8AR 1G3TA 1NR2A 3I91A 1VDZA 5CV4A 5T1GA 1N34Q 3F2CA 4LNQA 2CW0C 1ILQA 4AFZC 4PJOB 3LGLA 2DGYA 1AZGB 2IY5B 1IYVA 2WB1B 4F7UF 5CKEA 1VQ4A 2EQJA 1G6ZA 1GHKA 4HSVA 1KK7A 4K0KQ 2DXBA 1KIKA 1M90R 4DEYA 4J9GA 4RKUE 1CKOA 1HH2P 1X43A 1VMPA 2RQTA 5KRUA 3Q0AA 2PNRC 4L63B 3L2QA 3CC4Q 3M7GA 2L11A 5M3FB 3CCUQ 4HJ7A 4NL3A 1BO0A 1X3QA 3HOVB 3GTLH 4O5VA 4FU6A 5HGTA 2DXCA 3PO2G 5ECAA 1FGBD 4J5YA 5KNBA 2G6FX 5GAOr 1UFFA 1SR3A 1WJSA 5CKDA 4MTKA 1K83H 4OB1B 4EQOA 3J80i 3SK4A 3NEMA 3J80c 4DUZL 3I5RA 2E2JH 2BOSA 2M2LA 3K7AH 1TUDA 5LL6S 1EZ6A 1TUCA 1WTVA 4IURA 4ULLA 1LNXA 2GGRA 1HFGA 1WFWA 3NQTA 1C8CA 2B2WA 4PL6A 1FNWA 2KYMA 1JJ2P 5IP9H 1K9MC 2R6GA 4R55A 2J0TD 4X66Q 2RSOA 3E5SA 3G7LA 3ONAB 4FF2A 4RH6A 4C8QC 3HFNA 4MTNA 1CZGA 1J3TA 4G7HC 2O9VA 4C0GA 5IXBA 2F0DA 4BBRG 4MIUA 2IG0A 5FWCA 3RMHA 2WSFE 1PFMA 1AEXA 2K7AA 4KUDK 5EAYA 1SRUA 1HJDA 5IWAL 1B07A 3N6RA 3SB2A 3S14H 4PMWA 1SJHD 1IGUA 2SEBD 4C92A 2C5CA 2PQWA 5EKIA 1TY0A 4PFZA 3JCMP 2D62A 3PUXA 1VQPA 4KH0B 1QVGS 3C94A 3G71Q 2KHJA 4DA2A 2D9TA 3HKSA 4BDZA 3URYA 4CDCC 1JJCB 3P20A 4XQNA 3VYSA 4RCOA 2YRDA 2JS0A 2GVBA 1FNVA 2OEOA 4ID6A 4DGZA 1IHVA 4M78F 3OTOL 5BN5A 2R3ZA 1G8ZD 1LT6D 2PPBC 2HZYA 1QCFA 3UA6A 2VY3A 1PD0A 3K0YA 4OVAA 4C8QE 5EC7A 4JI1Q 3H0GG 4ZGEB 1MKHA 2D9UA 2V8KA 4M78G 4TKOB 1UGPB 2WP8J 3NXWA 3PUZA 5COYA 5CMDA 1ABQA 1A8VA 1E0BA 3GTJB 3S15H 1V8QA 5IHIA 1G2TA 4YHHL 4FDBA 2QEXA 2DYBA 1V1PA 2F0WA 2KCNA 4EMKA 2KUMA 3EN2A 2SOBA 3GBQA 4CC4B 4RGNA 4CJ2C 1STAA 1IHZA 2KHIA 2QYZA 2DN8A 4JI2L 1L0YB 5JJKA 5C6AA 3QXEB 3OY9A 3K5NA 3M0TA 3K7AB 2LP5A 3UT1A 3OSSC 3VS7A 1R4QB 1VQEA 4IUTA 3KF6B 2PI2E 3MWYW 2UUCQ 2UUBQ 2E12A 2F0EA 1J5EQ 2EY5A 2K4KA 3V8KA 1OTCA 2E6NA 3QDFA 1C9OA 1K3BC 2QQ9A 5GAMf 5KIXA 1ENFA 3VYGA 1JOOA 5FJ8H 2HHHQ 1KFZA 2Z6BA 2GF7A 3EQLC 3HL8A 2D6FA 4N0AC 3E9IA 3J7ZC 3VS5A 3AHUA 2L15A 4IJLA 3TQYA 2C35B 2E1HA 1AE3A 2VXEA 1XTCD 4HT8A 1U4LA 1IBLL 3JCMg 2RQVA 4KY5A 1PTOD 3EG3A 3KBXA 5L37A 2KY9A 4ZKBB 2DAQA 2E2HB 3CQZB 5FLMH 1EY5A 5FROA 3TCJA 1V1OA 3QIAA 1GM5A 1R4PB 4LF6L 4M7AE 2AKLA 4LN2A 3I9QA 2BDOA 2H3JA 3HOYB 3G4SA 2VL6A 3KDFB 4JC0A 3INZA 1YNZA 1TWFH 2NVYB 2HQHA 1JJ2S 1WD1A 4AFUC 2WFWA 5T1IA 4DBRA 3OW2P 2KCCA 4I65A 2IIMA 2F0NA 1M1KC 4K11A 2A69D 5C4JB 5I21A 4FXDA 1AT1B 4RGTA 1YJNQ 2EYWA 4HCSA 4XTYA 4JK1C 4IPCA 3EFOA 2JA5G 1KTKA 1G3WA 5CK9A 3MXUA 2VB2X 4FNFA 3PUWA 3FJ5A 1PKSA 3GF5A 4L5SA 3E1SA 4E7JA 1HTLD 2JA6G 5DLQE 2ZXPA 2XSCA 1Z7TA 1NG2A 3QWXX 1KJWA 1X69A 3P75A 4OGQC 1QNKA 3D31A 3QUIA 1JQYD 4G57A 3W2DA 2DTHA 3TP7A 2DL5A 1LO5D 2PNHA 3CQTA 4XTVA 1BIAA 1U5KA 4KKTA 4A3LG 3RKXA 4KTAA 3VR4A 1B44D 1KQSS 2R7ZB 5EPJA 1KLUD 5KYXB 1S5BD 4ZGDB 2P0PA 3G6EQ 3S1RB 5C4HA 3AU7A 2K3BA 2QEXQ 1I50B 2B2TA 1MMGA 1RACB 2K2MA 2MP1A 4YWLA 1VQLT 1VS0A 4UP7A 4BBSH 1V29B 3M0QA 3BJUA 4B3TQ 3A98A 1VYUA 1DOKA 3O13A 3J80L 4C8QB 4QQBX 1TG0A 2I0NA 2J6FA 2DL7A 3KJOA 4OO1G 1YN8A 3PIOA 2QGFB 2QF7A 1UWVA 2TMPA 3NE5B 3A5ZB 1U4RA 4RCNA 2OAWA 4YY3Q 1XWEA 2VQEQ 1JT8A 1OYXA 1JE4A 2EZVA 3VRZA 2A74C 2PO4A 2C06A 4PK4A 1OZ2A 1WXUA 5GJVB 4UC4A 1B4OA 4XTCS 3OWFA 5CV5A 4X65Q 3RZOB 4FW1A 1IBKL 1DONA 5IY0A 2L0AA 2LCLA 4KUIA 1LTRD 5I2YA 1I5OB 4ZUIA 1F9QA 3K57A 5A0DA 1W1FA 2EQUA 4YIJA 5CQYA 4OO1I 4WTOB 5CV9A 1U1SA 4LD6A 4JPBW 2SNSA 3K7UC 4XU1A 3CMEQ 3I4LA 3CMEA 1A62A 1VQAA 1CHPD 1YITT 1QKXA 3EG9B 1KABA 2K9GA 4M78B 4C0DB 2EYHA 5D7UA 3CC7A 2BH8A 5LMUQ 4J8OA 1PRMC 1ZLMA 4LXCA 3IRBA 1RF2D 4DK1A 3QJYA 4RTUA 2RSNA 3M9BA 4U673 3KXTA 1UJ0A 4E47A 3I2ZA 3S16H 1S72Q 3VJPA 2IJ0A 3HOZH 1X6GA 3J7AV 5LMNQ 1E6GA 2NN6G 3PMFA 2HQLA 5F2DA 4A3BB 2CP6A 1VQ5T 2UU9L 1QVFP 1SYGA 5ELOA 1Z9ZA 4FF4A 4R4IA 3R93A 4ZTJA 1MNEA 2F0GA 4OIKA 3OMGA 2D0OA 2RHXA 2D8HA 1WGSA 2UXCL 2CUBA 4R4TA 4OIJA 4MZ9A 3VYHB 4M78A 1NYGA 2F0SA 2PQEA 3JB9J 4FYVB 1A2TA 2CKZB 3CPWA 5KH6A 4JBKA 2O4XB 2KE9A 1X3EA 2F0LA 2MMPA 3CXCP 2X4YA 4C5GA 1GUNA 1AZQA 1TWCH 2YU9B 1K3RA 3MA2B 2BTTA 2HIXA 4JI5L 2DX1A 3PFSA 3NQIA 2E2HH 2G9HD 1X75C 1YNJC 2CGHA 1U1TA 3OPOA 4F88A 1XNRQ 4ZTFA 3I55T 2VC8A 3S16B 1W2BA 3OYIA 5DM63 5TSSA 2EYYA 2ZZDA 4DOVA 3E9HA 1NLPC 4LF8Q 3S1MH 3FEOA 1XNQL 2QDLA 1DJ7B 1M1FA 1M2VA 5CVIA 4HKEA 1PTOC 3KLSA 5C44H 2N3SA 1UE6A 5I22A 3SHWA 1JJGA 3LWIA 4HR7B 4H0LC 1G291 1ZQ1A 1HNZL 1GO3E 2ED1A 1SFOB 4C5IA 3PF4A 3WVEB 3F1ZA 3V8LA 2AZVA 5CAIA 1HA6A 1PVOA 4LFBL 1YHQQ 3BYTB 2XTIA 1UGSB 4AFQC 4M77D 4ZRZA 1HPCA 1IGQA 2OT2A 1SYFA 4LW1A 3X24B 1X56A 4GNXA 2F0IA 2G9DA 4FM4B 2NYSA 1KD1U 2YUPA 1AN8A 2CWPA 1STYA 2QK0A 4HCZA 2F0FA 4GNXB 1BI3A 2K4YA 2K04A 1HNXQ 1ZKOA 5I2XA 2EY2A 5KYLA 2PQAA 3M85A 4RUGA 3DB4A 1KAWA 4DN4M 1VF5C 4F04B 5C4JH 2F2XA 2XNAC 1ZXTA 2D2CC 5D3IB 2F2VA 3U4ZA 1SLJA 2UXCQ 2A5HA 3S2DH 1G91A 2FFKB 1BBUA 4LF5Q 3CAMA 4E7IA 3JCMd 2EXDA 3JCMb 1H9RA 1GXDC 2Z1CA 4IKFA 3RERA 2MGSA 4BA1I 2VB6A 2QXFA 4OMLA 2BUDA 1VQ5Q 2FRWA 5C3XA 2RDGA 3EGUA 4JRIA 2DYIA 2I46A 3LX0A 3SK8A 4M78E 2DIGA 1RHPA 2F4VL 2MAMA 2PZWA 4DV4L 1XMOL 4JRQA 3CCVA 1H9JA 2RM4A 2RI5A 2COWA 1Y1WB 5JOBA 3P8DA 2YRCA 3PGGA 5GAEC 4O6JA 2SEMA 1SJED 4QB4A 1VUBA 4TVRA 3GV6A 4P74A 4KLKA 2EFIA 4J9FA 5ELDA 1GFCA 2E8GA 2PTKA 2LXJA 2EKOA 1N36Q 2FB7A 2J6OA 1A0IA 4IUNA 4RWSC 1ENCA 4N0AA 1F2ZA 4R1JA 5BN4A 5KGUA 5C3EB 1FR3A 4AFSC 1GBRA 3CCQA 4J9EA 2ICEC 3DXJC 4LK1C 2L3QA 4X65L 3OQ5A 2LXKA 3VV0A 3HP9A 1ZSZA 1BCPF 2BZYA 2KDSA 1FL0A 2ZJQA 2B2VC 3PO3H 3R2TA 3FVQA 4JJCA 4M78C 4YY3L 2E2JB 3VKIA 4X64Q 3U9SA 3G48A 1BBZA 1GVPA 3S9WA 3M4GA 3OW2A 5J39A 5JVG3 4A4IA 2FZCB 2GTOA 3J7YW 4DAMA 1QVFA 4FYXB 1ABOA 2COYA 2PYKA 1CKAA 4C0FA 1ASYA 1SNQA 3X25B 1MBYA 1PA6A 2LNVA 5IGBA 3LGFA 3LH0A 5LMUL 8ATCB 3BE3A 1AWJA 2JP1A 4C2MH 1VQCA 5HGQA 1L2FA 4A3GH 1JRIA 2AT1B 2O31A 3NBIA 2KXCA 2F0TA 4C3HH 3FP9A 3DB3A 1M90C 5E1FA 1ZSZB 3OYDA 2L89A 1ESRA 4NW2A 2M00A 2XGTA 2ICIA 1UGVA 4B3RQ 1BU1A 3MVVA 4P72A 3J81c 4UY8C 2KVQG 1YJ9T 5C4XB 1WHJA 3A74A 3LGJA 4FSSA 1PRLC 2QQSA 1O7ZA 5EBCA 2VW9A 5LJ5d 4WJ3M 3A8MB 1KQSP 1FMWA 1RD9D 1HD3A 3BZKA 1B8AA 1NY4A 5J1ZA 3Q24A 1CA5A 3IL8A 3NUCA 4DXFA 4BE2A 3L2PA 1N36L 1EOTA 1WTWA 2QGQA 2K3XA 3T53B 2R7ZG 3LWUA 4P2CB 4LF4Q 4BBSB 3TU4K 1STBA 2DKGA 5KYUA 3OYHA 2JSOA 4PNYA 1LTSD 5I9PA 2LQ8A 4OGEA 6AT1B 1EY4A 5E4XA 1HNWQ 2ZCFB 4GN4B 1TS9A 1MV3A 1C4QA 3HHTB 4MZPA 1HUNA 1JB0E 3W3AA 2BA0A 3FJPA 1SKUB 1H9SB 1SF9A 4LFCL 2R57A 3QJ6A 2JA6B 5C0MA 4CDDC 2WAQE 3RMSA 4A3JB 2B63B 3FPPA 1Y71A 5IN1A 3MP1A 2NUCA 4M75F 2QG9B 3EGDA 3I4NB 1SMXA 3AFQA 1NBWA 5LL6X 2F5KA 3QDRB 4F14A 1FJGL 5M5XB 3SFMA 3GLXA 1PFSA 4A3FB 1Q46A 3CCRQ 2NUZA 3HOWH 1I6HH 2KAFA 2X35A 2DD4A 2NYZD 3AFPA 1X27A 3T56B 4NPSA 3T9NA 1KC8R 3V2TA 4LF4L 5GAGC 3LNNA 1M27C 3BS1A 2LMJA 1KRSA 1XOVA 1UGRB 1BDOA 4E7HA 1XXGA 2KCTA 1BCOA 4EQ5A 2NVTH 4M75C 4QVZA 2KT8A 2FMMA 4ZN3A 3PMIA 3L9AX 3T51B 2OWOA 4V190 3ME9A 2DETA 2YHTA 1U4PA 3NTKA 4XIGS 5C0XI 1KHIA 4OEMB 1K8MA 2UUAQ 4J8QA 3OYAA 4NKLA 4IIMA 5GAOn 1Y69U 2KR3A 4FXGC 2CQAA 3KDFA 4VUBA 2JA5H 1QB5D 1H8KA 2A6ED 3H8ZA 3M0PA 3NWTA 4A76A 2RI3A 1QZGA 2QTVA 3O8VA 2YSQA 1S40A 4OMFB 1F9RA 3UDGA 4R4QA 1IKMA 1WYXA 1J9OA 1YZ6A 2JTMA 2AWNA 1ZUYA 3SWNB 3V7SA 4DR6Q 2DO3A 3EG0A 2OJ2A 2CHBD 4ESRA 4IPGA 2CUDA 3PT9A 3EG2A 3BW1A 4EIKA 4LMQD 5CR2A 2JN4A 2J4XA 4DA4A 1AZEA 1YJWT 5GQOA 3TSSA 4B3SQ 3I56T 1EIYB 4HJ9A 5A0LA 3P8HA 1YNNC 4X64L 2M0YA 1F2LA 3ULJA 1YVCA 4C92G 1CK1A 1VQJA 4HXJA 1I0CA 4JI5Q 3JV3A 2ZTCA 3HOXH 1QILA 3QBYA 1CSQA 4A3DH 3QYGB 4NS5A 2L0CA 4A54A 3C46A 1RAIB 1UHFA 4F16A 4F17A 3KF6A 1HR0W 2Y4YA 1BCPB 2E5LL 2AHOB 4G7OC 1JC7A 1TR5A 3JCMc 1HSQA 3MP8A 4JI2Q 1LTGD 2KK4A 2FEIA 1K73U 1QWFA 4C8QF 1UTIA 1YI2Q 5D3DA 1N9SA 5FJ8G 2DBMA 3C95A 1IB8A 1VQIA 4HTHA 3FRPB 4OHJA 5KEEA 2RK1A 4XTXA 1JICA 2CWAA 5LJ3h 3UDXA 4I7ZC 3H6ZA 1K8OA 1U0LA 3H0IA 4MDWA 1SMYC 1VQNQ 5LMNL 2F4VQ 3VS6A 3META 4CDFC 4BY7G 1OPKA 4QVCA 2H3EB 3JCMh 1W6XA 1D09B 2FRYA 1ZA2B 2WIIB 5LHY1 1IREB 1ONLA 1WPYA 1L0XB 5D65A 4B6MA 4CC3A 2IX3A 1BNZA 1NCVA 1D0YA 3CD6Q 1EIGA 1ICFB 5IGGA 5JPMC 2I5HA 5K5PA 5JPNC 1X32A 2EKHA 3K59A 4FYWB 5FO8B 4AT1B 5CV7A 4BBRB 1O80A 5EQ0A 1FMVA 3TSWA 2E3HA 2HL5C 2K6DA 2XICA 4MZMA 1BCPC 1M9SA 2XWJB 1P8LA 3RZOH 4YCWA 4OX9L 1KHCA 4F7UG 1D0XA 2M1HA 3DEOA 2UXDQ 3BDLA 1OXSC 2SRCA 1E22A 1T3LA 3TREA 2JOYA 2L2PA 1K4US 2RQUA 1EOVA 2KENA 3L7ZC 1IBKQ 4C3JG 1JWSD 3QR8A 4GKKL 1E6HA 1PSFA 1CQVA 3THKA 5CV8A 3TZDA 5C3EG 2LQKA 2XRQD 1JO8A 3S1NB 1Y1WH 1I4K1 1FXXA 1GKHA 4HMIA 1LTLA 2PNIA 3X28B 2EYXA 2P0KA 1NMGA 1C0MA 1VQHA 4EVOA 2HSEB 4PKCC 4BD3A 1DXMA 2I2LA 2CZ1B 1A15A 5IP7G 4GLXA 4IIOA 2XDBA 4M7AF 4JI6Q 3C3LA 1JB3A 3RBBB 3GTGH 3M5AA 2EQIA 2CP7A 3EG1A 5A2QE 2ALYB 2LX7A 3ZJYC 4JI7Q 4IPHA 2KQWA 4X1VA 1LV9A 1ZUKA 3D6CA 1N5ZA 4F8MA 5I2SA 3FMCA 4A3GB 1TS3A 3A55A 3WOFA 2K01A 2BE9B 2D0PA 4C3HB 4CJ0B 4ABNA 2L4NA 4DK6C 3CPFA 4RMOA 4DV6L 4C3HG 1BIBA 2DJQA 3MEAA 1UE1A 1WCMG 2H1EA 3FKIB 2FZKB 3A8IE 4X3TA 4A3GG 4KGVB 1QE6A 5EJWA 4JV5L 1LVKA 2HSPA 1S5DD 4DXGA 5M5YH 1CI3M 4M7DA 3HOUG 1QKWA 1VQDA 2AZSA 3P7JA 1YNJD 3RN2A 5IP7H 4OMMA 1AH9A 4AQYL 4E6IA 3STBD 1ZSZC 3M0UA 2Y4XA 4AYBG 1OU9A 2K3YA 3MEWA 3FC3A 1D1IA 2Y90A 1LJOA 4DR7L 3CBOA 4DV2L 2K14A 1LACA 2A36A 3RUZA 2ECZA 2CYZB 2VXFA 3CCEQ 5FW9A 1QG7A 3HOUB 5CGKA 2NB0A 3OW2S 3A7AB 4CDEC 1STNA 4LUOA 4CRIA 2OTJA 1PWTA 2R5MA 5ELFA 4LFAL 4Z89A 3ZEHA 2K52A 4M7DE 3E0EA 4N8FA 5FU7B 4HSPA 4F7UA 4JRPA 1YJWQ 2GCXA 1PZKD 4DV2Q 2DM1A 1LT4D 4JYAQ 5JEAJ 1G3SA 4NXNL 5M5WB 4KBMB 5IT9c 1P92A 1CQFA 1B1ZA 2Z6KA 2KBTA 3LLRA 3LH5A 1SAPA 4X62Q 1WTOA 4XQQA 1AZPA 2CDTA 2CP0A 2GVAA 1VQ6T 2JK8A 3WVDB 5GAOm 2RCNA 4HVUA 4ATOA 1I50H 4RTXA 2KEDA 1PM3A 2GQIA 4OB3B 1HR0L 2FHDA 4DBFA 5M3FH 3S2HB 4DR4L 1WIEA 4BY6B 2Z4IA 1MSGA 2F03A 3SE0A 1DGSA 2HHHL 2L9HA 5E7NA 3OWEB 4B3ML 4HN7A 4XT1B 2JA6H 2ZTEA 1K83B 4GKJL 3GDEA 3S2HH 1CZWA 3K6OA 1M1GA 3S17H 3JCMf 5KYIA 4DEXA 3KFVA 1KRTA 1U4MA 3R6OA 4A4FA 4LUDA 4ZAIA 4PMCA 5E3FA 1EIHA 4LDXA 5LJ3f 5ELCA 4BI4A 4V2SA 2OX7A 1XQHA 1VQPT 4M7AC 3RKYA 1K0SA 2N49A 3U58A 1M90U 1SROA 3URGA 5G3LD 4QQ6A 1AHJB 4GN3B 3G7ZA 4EMHA 3ZYYX 5FO9B 2LT4A 1S5ED 1JR0D 3IFDA 1A2UA 4HT9A 3OIQA 3HKZB 4X3UA 3PIP3 1NJIR 2GFAA 2Q2UA 2JA8G 3PO3B 2M02A 1Z47A 3F70A 3RZDH 2I07B 1YBYA 1SNPA 3RDVA 4XQJA 2LTOA 3CCEA 5KNDA 3M59A 4LF7Q 1NE8A 4FL6A 1F2MA 3BDUA 1JU5C 3VUBA 2RA4A 3MXPA 3UDFA 1LTTD 2B63H 4IFDJ 4N4IA 1SE2A 5A2QL 1X01A 4A3BH 5DNFA 2WINB 1V1QA 3CBMA 1D8LA 1H3ZA 2MFIA 4ME7A 1Q86U 1KIXA 4KI0A 2L3RA 5LJ5g 4KY6A 2W10A 3QZ5B 5FRMA 3H0HA 2IWHA 2DPPB 2VQFL 3FB9A 3GIBA 1ICWA 1UDLA 3CPWP 3AB9A 2HMAA 5GAMj 1M3BA 2YRVA 4JRKA 4AG2C 1Q81R 4H7BA 4G7ZC 3HP3A 3DHQA 4P5NA 4K8IA 4RCBA 2JA8H 1YI2T 3DMUA 2HQXA 4R8NA 3VYRA 5D14A 3NBHB 3UE0A 2EVRA 4K14A 1YWPA 4J9HA 1KD1C 4J6YA 1E24A 2MF2A 4AMCA 3DM1A 4JI8L 2RH2A 2LJ0A 2RJEA 4DR2L 1SYEA 2KQ3A 2LCCA 2NZHA 4EMKB 4KHPQ 2N55A 1I4RA 1RLPC 1EEID 1BOSA 3HTRA 2EYMA 1PLFA 2WB1E 2RNAA 4TSSA 4JJBA 3S3MA 3TEHB 4YCUA 1C7YA 5LJ5j 4CKCA 3R2IA 2KRMA 1U3OA 2K5QA 4A3JG 2QDYB 1HCZA 2SNMA 1V76A 1G83A 1RKNA 4EPCA 1C0AA 3JSCA 1YHQA 2DNEA 1J6QA 3CC4T 2DJGC 3Q6SA 5C0XH 3CD6A 4QCLA 2FHTA 2ES2A 2PZ1A 2C0IA 4YWMA 2R7ZH 3I3CA 4Q5WA 3E2UA 3NHHA 2IPOB 1E1OA 1TTHB 4ZNXA 3TSZA 4LFCQ 4XQ3A 3TS2A 3CCMQ 2PU9B 3FRNA 1EY9A 1PHTA 1KAAA 4DR4Q 2WSEE 2MO0A 4QIWE 1XNRL 5CR3A 2XK0A 1SG5A 2CT4A 1QUQB 3D4RA 5FU7C 2K57A 1QUQA 2B2WC 1KG1A 4RCCA 3SWNA 2EY6A 3I4NG 4JV5Q 3GNGA 2E3IA 3HOYG 4FSXA 1VQGA 1SYCA 3Q8DA 4C0DC 1JJ2A 4UPAA 4B08A 3MC0B 5IXFA 1YHAA 2FPEA 4A3EG 1BB9A 3CCET 1CA6A 3AEVA 4OO1H 1HHVA 2R93G 2KHSA 2LDMA 3GPLA 5IIFA 3S6WA 4KJNA 2CP5A 2P4TA 1KDAA 1AFPA 3V8JA 3KF8B 3S17B 1EYAA 2B8AA 4BBSG 1RADB 1LOJA 2HKQB 1VQLA 1GUGA 3JB9D 2XI9A 3D6WA 5IHKA 3M57A 1FJGQ 3CQZH 3EBEA 1OQKA 2K5IA 1BUVT 2UU9Q 3I4NH 1E2ZA 5GAMe 4Z88A 1MMDA 4K8JA 4HA8A 1MUZA 2VZAA 4ILWA 2F2WA 1B9MA 1QVCA 4CJ1B 3U23A 2VV5A 1JQQA 5C6SA 2RQWA 2DL4A 1V1PB 1RCVD 2DZCA 3J7A5 4BY7B 1QMCA 4DBHA 2HD3A 4ZGJB 3V05A 4BE1A 1X55A 3IAYA 3VS3A 4P71A 1Q1BA 3EA6A 5IWAQ 4GKKQ 1JOQA 1SRMA 1I3QH 2AUJD 5FU6B 3RNJA 3VS4A 1TWGB 1HNWL 2BDNA 2PVDB 2K05A 2JJ9A 1B7TA 2JT4A 4LUEA 4U68A 2AIRB 5IT9L 5GAN2 3NPFA 1OV3A 3NMZC 2WAQB 4APVA 1WTRA 1QWEA 2OTLA 2YLCA 1PSEA 5FWBA 3S3OA 3BVZA 1IW7D 1TWHH 5C0XG 2X51A 1IL2A 2NZOA 2FZGB 2EWNA 3F2DA 1YIJT 1O78A 1X3GA 3CC7Q 4UP9A 4BWGB 3CC7T 2P0QA 3JB9G 1JEGA 3S24A 4JI3Q 1BK2A 2XD0A 3GV3A 4PZ6A 4IOCA 2MNAA 2JM8A 2DMOA 2HKNA 1VQ9A 1IYJB 1Y1WG 1AWXA 4L6V5 1L1OB 4QUFA 4B3RL 4DK3C 1N32Q 3CCQT 1YFNA 2XRSD 1V43A 2R93B 3I55Q 3T16A 2A69C 3RKWA 3PIPA 2R5AA 5GMKi 3OYMA 1PYWD 3X3MA 4Y7NB 2D8JA 1VQKQ 2G3RA 4HCCA 4YCVA 1TOVA 3T1HQ 2MUYA 4JBMA 4A3DG 2NVQH 3KFUA 2E2IH 3M0SA 2B86A 1NPPA 1TT2A 2EYLA 4J7FA 4RG1A 4RKBA 5EPKA 1JBMA 5LJ5e 2R7DA 2MPMA 2DVEA 1WZOA 3I35A 3H94A 4K6LA 2N8NA 4NDXA 4O1NA 1WA7A 2QGGA 4GY5A 4RTZA 5ELNA 4DV5L 3CD6T 3GOXA 4RGMA 4DR3L 2JA7B 2O4XA 1BBXC 1DZ1A 2Y0SG 4JW0A 1YJNA 2EAYA 4KGZB 1O7YA 1EYCA 2QAZA 3HRUA 1X3PA 4E7KA 2YTYA 3A7LA 4CHTB 5FLMG 1QVGA 3NENA 4E6RA 3NTHA 1SRLA 3MHBA 4LUZA 4GNXC 4OB0B 3PO2B 1MMAA 1MMNA 4M75E 3L2RA 1VQNT 1CHQD 2WKCA 4DV1L 3BZDB 2A6HD 3VS0A 2F0OA 1Y96B 1OU8A 1N34L 3GTOH 3TBIB 1TUGB 4EX5A 2HCKA 4HCKA 2VUMB 2B8FA 1FD7D 1YJ9A 1YCYA 3RNUA 4PJLA 3GTLB 1SSFA 2FPFA 4DAPA 1MSHA 3QSUA 2AKWB 3SHLA 1CSPA 1WXBA 1K76A 2X69A 5GANf 2WB1G 1RTNA 3ULPA 2BCOA 3QG1A 4WJ4A 4FP5D 5IAYA 4PJOG 3OA6A 3CCRA 2EXZA 1BF4A 3OS2A 1X6OA 4DR5L 1YP5A 5GANj 4ZCKA 3FKIG 4RTYA 2CKKA 3OSVA 2QI2A 4QW2A 2IHFA 2DTOA 1GCQC 1WHLA 1WLPB 4DPGA 2NVYH 1CT1D 2UUAL 1AWOA 2DRKA 2QA4T 2CZ7B 2Z4HA 4OXPA 4IUUA 4XU2A 2VGMA 2K75A 4A93B 3CPWS 1RJTA 4JOIC 5DEHA 3CCQQ 4JI4Q 3NK9A 3H0GH 2XMFA 2RB6A 2Q8RE 4DF7A 1VQOT 1VQBA 1E2WA 2NVXH 1EY7A 4XYOA 1YITA 5CV6A 1WHHA 2OTLT 2ZM6L 2F0VA 1N27A 1M8AA 5IT9E 3JCMJ 1PH8A 1Y0MA 2EJFA 3CP0A 1VQ6Q 1RABB 5GAN8 4DV0Q 2QEXT 1JCKB 3OYNA 3FPUB 4JUVA 4DK0A 2DEQA 2PUOB 1G8XA 2RF0A 3JB9I 4JS5A 1YNND 4K5XA 1STGA 2UUBL 1EFID 4F7UB 2IL8A 4M7AB 3M4YA 1R0CB 2OXPA 1BI0A 5C4XG 1TXQA 3J81E 1M5Q1 3EFRA 3M55A 1LPLA 3WXMB 2IHEA 1EYDA 3TZUA 1Q95G 3HOZG 1SHGA 1WYDA 4LDUA 1HNZQ 4E7ZA 2IX0A 3CKIB 4UHVA 5CKHA 3M56A 4YHHQ 5GAOq 3CCVT 3M4PA 1ZA1B 3ND8A 2VGNA 1X2QA 2EJGA 3MAQA 2KXDA 2VUBA 1I4QA 2RVLA 3K58A 4DQ2A 3E19A 3HKZG 2JA7H 3P1HA 1XNQQ 2JTEA 2JTFA 2MIOA 4K2KA 1CTMA 4LF8L 3SD4A 4Y52H 4XU0A 2WAQG 4JDSA 2VQFQ 4P73A 3Q23A 3Q1JA 2RA2A 3K0XA 5M5YB 1BI1A 3I4MG 1JWMD 1K1ZA 3NSWA 1I4GA 1JB7A 2ZAEA 3M7NA 3PMTA 4MN3A 2J7IA 5I2MA 1PH6A 1VA7A 2RKSA 1GUSA 4MNOA 2OI3A 1D5MC 4RMFA 1WI7A 4PFOA 1X3FA 3OYGA 3G1JA 4PMBA 4FT4A 3L0OA 3SR1A 2PW7A 2MYSA 2R93H 1IBMQ 5CCAA 3OYYA 4A3MB 4EQPA 4KKSA 1I4HA 3CCMA 2LC4A 2MHVA 3HOUH 4PZ7A 4HMJA 2XDPA 2BIVA 3REAB 1D1CA 2ROTA 3HOYH 1XMQL 2SDFA 2BH2A 1BCPD 4PJOE 2BA1A 4M7DD 1TWHB 5LJ3g 4XYQA 3S1NH 1GUTA 1H9SA 1PFBA 2RI2A 1EL0A 5AJ3L 4RGOS 3HPWA 1SEBD 2Q2HA 1VQNA 1PRTF 4RTWA 1ZEQX 3KBGA 1W2BP 2KRNA 3QWNA 3TP8A 4H44C 1A63A 3HRSA 2DBKA 3GP7A 3NFCA 2L1BA 2RBMA 4OL7A 1I5FA 3BG3A 1VQ7Q 2CH4A 1E2VA 1TSFA 2JNGA 2L55A 3OYJA 5HY6A 1WQ7A 4L59A 4RTTA 1I07A 1YCSB 1IO6A 1AW7A 2E74C 3PQIA 4FO2A 1JE5A 3AMUA 3IQLA 5GAN7 4QVDA 3EROA 3BFMA 2YXYA 5KYNA 2F0KA 4ZQ3A 2KT1A 4JG2A 1I5LA 5AT1B 3U50C 5K36H 3QKJA 2DFUA 5C5LA 1AVZC 2L3SA 3A8OB 3Q22A 3UATA 4QY7A 1F9PA 5EG2A 3J7AF 1AEYA 1EU4A 2EIFA 2KSSA 3D3RA 4RHRA 4PJOC 1C6VX 4AYBB 2GBQA 5LJ3j 1U8RA 1PC0A 4C0ZA 2QA4A 2RJFA 4MDXA 2ZTDA 1QNUA 1Y07A 3EFOB 4J6XA 1Y57A 2K79A 3ZBDA 1D3BA 1PTOB 4M77A 2NUTB 4ZLTF 2DNUA 1RAGB 4C1NI 2DA9A 1FNUA 3OYBA 2XIDA 1KLGD 2K32A 4PJMA 2MOXA 2PVOB 2QA4Q 3OS0A 5L23A 1L1OC 3HZXA 3CCLA 3CF5A 4HIOA 4LFAQ 4G4KA 2LZ6B 1LUZA 1UG1A 4CBVA 1VQLQ 1YNXA 4LF5L 4A3FG 1NYFA 2JA5B 4IUPA 3L2WA 1SDFA 4C3IH 2HCIA 2VS1A 2VNUD 3VR2A 3CC2T 2OQKA 3CCSQ 4LF6Q 3CC2Q 4A3KH 3MFYA 4IUQA 3H09A 4GOPC 1PH9A 2Y0SB 2J06A 4O2DA 2V4DA 2EJ9A 3EH2A 1WFQA 2RHSB 3LX7A 4M7DF 3OOCA 1BR9A 2B2UC 1B3AA 2E5KA 5LJ3d 1PRTB 2EGAA 4A4HA 3HRZC 3HG9A 1U06A 2YWWA 5C44G 4A3CH 1Q86R 3VA7A 1NLOC 1MD2D 1R9TH 2XU8A 2DJZA 2RHZA 1YJ9Q 3VYUA 2ZPGB 3JB9F 1XX8A 3TMEA 1SFOH 3M4OB 3ZFJA 4DV4Q 1XMOQ 1VQMA 2AK5A 1FX7A 2BKDN 2Q2IA 5JJZA 2ZPIB 3E0JA 1W2BS 3OYKA 3VS2A 1T0HA 1G51A 1PKTA 1DM0B 2H5XA 1QZHA 4JVZA 4K5VA 1WJJA 3VS1A 2O2LD 1HZAA 4D8DA 4PG3A 2KBNA 5IYDH 1SHFA 2AKKA 1EY8A 4DV7L 2DXTA 2PZUA 3OYFA 4C5EA 2JVVA 4J9BA 5FU6C 3HFOA 3X26B 1ZBJA 4RG2A 4J9DA 2DY7A 3GTGB 1D0ZA 1KDBA 1LYLA 1PG5B 1U5SA 1HNXL 3UE1A 4E2FB 1I1JA 1EZZB 1S4ZA 4A3IH 1VQ8T 1PCXA 4JS4A 4HCBA 2AQ1B 5GMKe 1SEMA 3EHRA 2CQOA 3C2PA 1WHMA 2X3WD 3PVQA 1M3CA 3SGIA 4OMNA 2QQAA 1MJEA 1X6BA 2PUKB 4OX9Q 4LFBQ 2M9VA 4A4GA 2LY7A 4PV1C 3G6EA 2NN6H 2IT1A 2HBWA 4GOPA 2Q2TA 4LWCA 1OPLA 3S1RH 2O01E 3PVLA 1B50A 2EBPA 3KK7A 3JCMV 4PFPA 3ND9A 1VQKT 4DU9A 3H9NA 1OOTA 4RHSA 3EGDB 1Q1EA 2KVMA 4OELB 5EKLA 2WSCE 4BBRH 1Y8PB 4DR2Q 1F77A 1NMFA 2QKIC 2ESWA 4KRTA 1QLYA 5CQXA 2B39A 2YYZA 3CRLC 1PH3A 2RPNA 3N52A 1UHCA 5CBEE 4M7AG 1QCBD 1S5CD 4MZTA 4C92B 4E7SA 2PW5A 1Z9QA 2RF4A 3EGXA 4B9WA 1MHNA 1GCQA 4XK8E 4C8QA 2Z0SA 3EGXB 1MIUA 4WJWA 1OEBA 1CM9A 3VRYA 4IFDG 5KYUB 5LJ3e 3LWHA 1WQWA 1D7QA 5JJIA 2JQOA 1V1CA 1VYTA 2F52A 1BI2A 4QQDA 3CCRT 4CGYB 1X2KA 1IW7C 1T3SA 3AYHB 2RMOA 2EJMA 3W1GA 2F1LA 1MJCA 3M3YH 2CZ0B 1TS5A 1KD1R 2NWGA 1EU3A 1Q90A 2C0OA 4EMGA 4HJ5A 5FRNA 1EX4A 2YUNA 4OWTB 2BZ8A 3GO5A 1EQVA 4DNIA 1QVGP 2CREA 3I4MH 1GFDA 3PUVA 4X6AH 2W0ZA 3OYLA 1EWIA 3RR5A 3TN2A 4L5TA 1A0NB 1Q81C 1JWUD 5JAVA 1IL8A 1B7YB 2GNCA 2YDLA 4X3SA 1PH2A 1EFWA 2K7VA 3I73A 3CCST 4A3LH 4WCIA 3I56Q 4LDWA 3GTKB 1IXRA 3RUXA 3ITPA 3I70A 2X4WA 1UJYA 2QQBA 5IH2A 4X34A 1WCMH 1F1BB 1AD5A 2KGTA 4KN7C 4KMUC 4DV5Q 1X9NA 1T0JA 2NZ1D 2V26A 1TWAB 2DVJA 4A4EA 1NJIU 3QPHA 5I4DA 3OSOA 5EPLA 1W6KA 4L5QA 3MEHA 2CSIA 4DR6L 1VIEA 4HCEA 4JI0L 1R0BG 5KE3A 1WCMB 4PLIA 5GAOl 4Y7NH 2E6ZA 5DAUA 4FF3A 2VUMG 3J81L 3G4SQ 1VQ8Q 3IKJA 3I56A 3G6JB 1RAHB 5CIUA 5GAMd 3VR5A 3L1AA 2X9HA 2ABLA 3CBPA 3RZDB 1WTPA 3C12A 2A08A 1QP2A 2JW4A 2A8VA 4QQGA 4J9IA 1TS4A 2EYPA 2FYKA 1ZUUA 3GTPH 3V96A 1GCPA 5G3LF 1W70A 5GANh 3ICEA 1AP0A 1HK9A 2DEUA 1VQ8A 2JA7G 3S1MB 3CMAT 2R58A 1G2BA 3NHNA 4C92C 3QO2A 1RODA 5M3MB 4DUZQ 2GA4B 3OMCA 4M75D 4N4GA 3K8AA 3OB9A 3GQBA 3R3OA 3HSBA 1I94L 3G6ET 1TWGH 9ATCB 3OW7A 1OO9B 4A3MG 2R7FA 4HEDA 4X62L 4ELYC 4LE9A 5GAN4 3FEWX 3BVGA 4RTVA 3FKIH 3OYCA 1GL5A 2M51A 1T5XD 1T5EA 2NN6I 2RO0A 1Q86C 4NXNQ 5IODA 2BE7D 1H9MA 2VXWA 2MK5A 4ZN1A 1DOLA 3D8GA 4OP0A 3H6MA 3NELA 2F0UA 4LUVA 3A8JE 3GP8A 1K8AU 5IGEA 2QASA 4XTWA 5KYWA 2DK3A 2LS01 1RIPA 2EQKA 5GAOp
chains in the Genus database with same CATH topology
3DKMA 4Q5VA 2EJGC 5EGTA 4NOYA 1ZYRD 1VQ6A 1SNOA 4BY1B 5GMKm 1NPRA 5GMKl 1K8AC 2EYJA 2EQMA 1TY2A 3SK6A 4KULA 1HTPA 3HOZB 1C48A 5AYFA 4MHEA 3UI2A 3J80E 2DD5A 1UB4A 4PJOA 3C1FA 2M0OA 3DLLA 3NBHA 3GD7A 1OZ3A 3GTQB 5CO7A 3CCSA 1NJIC 1CFMA 2IX1A 4RKLA 2QEJC 4S3SA 4M77C 3CMET 4C5HA 3CU7A 3MZ5A 5I6WA 2ZPFB 1I4XA 1VQ4T 1RI0A 2EYQA 2F0PA 3QZ9B 1EWHA 1VMCA 1KQSA 1UGQB 1WVLA 3L2ZA 4RG8A 4A3IB 4E7LA 4C3IG 5I6YA 4XTUA 1VQ5A 2MJ8A 2JEBI 4KD3A 1BXTA 1SYDA 3X20B 4C8QG 3D4DA 4BE0A 3RD4A 5BN3A 2R61A 2RDHA 1ESFA 3A8GB 4LD9K 5GANg 2MWPA 4KHZA 5GAN6 5GAMh 5IOCA 1O75A 1HFNA 1WJRA 2TSSA 5FKAC 4Q0FA 3JCMQ 1K9MU 4XT3B 4Z9CB 3S3NA 2XWBB 2OTJT 4NP5A 3PUYA 3DUZA 2XG8D 1D2BA 2WACA 1D3BB 3IFTA 2F0JA 2FJ2A 2AHJB 2KOLA 5J3BA 5FLXE 2FL7A 2B2TC 1NAPA 3U9OA 3SEBA 1DJRD 2BE5D 3CRKC 1YJNT 4NMZA 2B2VA 3CXCA 4LAAA 3LWEA 3OBWA 1EWCA 3HGBA 2F0MA 5GMKj 2B2UA 2K1BA 4IALA 2CS7A 1LT3D 4WORA 1YHQT 1SXTA 5LJ5h 3CC4A 3CXCS 4K6DA 2RQXA 4DFAA 3MO8A 5DM7R 2Z8LA 1GUWA 1I4PA 1O9SA 2E5QA 4FIBA 4WFN3 1XTDA 4L8JA 2RHIA 4EDUA 1PZJD 2FINB 2QQRA 1A3TA 2F3VA 2HCCA 3LW5E 3VYTA 3GTMB 3CCJA 2N88A 1NSNS 3HEJA 4ELZC 3M53A 3PTAA 4IFDH 2E64A 5GAMg 2A7YA 4KJOA 3MHXA 1WNLA 3PNWC 2HUGA 4OB2B 2GFUA 1ML0D 1Q7YU 2B2YA 4KKUA 4N9TA 4XAXB 4KN4C 1WTXA 5FO7B 3R8BA 4YTLA 4B9XA 2FVUA 2ZT9C 5FOBB 2LVMA 4X9DA 3CHBD 1I81A 1Y7XA 4C92D 1I6VC 2DXUA 2B8GA 3E6ZX 3ER0A 1Y96A 3P8BB 5KE2A 3EFSA 1G2SA 2EVBA 3DWAA 1VCIA 2M16A 4BI3A 3CCUT 4CKEA 3RLFA 3QYHB 2WKDA 1EY0A 3TP6A 1H641 3DWQA 4X9CA 3K5OA 2QDBA 1VF7A 1QOHA 1PXUA 5D6XA 4XDXA 2HNIA 2KA7A 4PJOF 2Q8TA 1EZ8A 1RDPD 1KC8C 4DOWA 1B9NA 1SNDA 4FT2A 1ET6A 1M4VA 3BDCA 4FXKC 4WF2A 2F5TX 2A68D 3CCMT 3S1QB 3NPPA 2J7ZA 3JCMe 4PQXA 3UPUA 2DTIA 3WDNA 2NVXB 2HAXA 5A35A 1VQ9T 1LTAD 1HQRD 2HD0A 2E75C 4MMLA 1LABA 2EYOA 2F0QA 3S14B 1WTQA 3VU3C 1D6EC 1SNCA 5KNCA 2AQ3B 2B2YC 1HRJA 1EIFA 4IZ8A 2K03A 4D6WA 2CZ6B 1EY6A 3FIFA 2L12A 4IQZA 1PRTC 1PZID 1ZYRC 3EFXD 4X3KA 1QWYA 4ZK9B 1FWZA 3UDCA 3F2UA 1SMYD 5GANe 2JUFA 3K5LA 3X3NA 2ENBA 4UAIA 5FLXL 1N6AA 2LKVA 4J6WA 5CYUA 2F4IA 4PLLA 3TDQA 3FDRA 2IPKD 2JN0A 3CCJT 3V7RA 3OHXC 1RL2A 3GNFB 4CI0C 4BACA 1SNMA 4KY7A 2IVWA 1MGSA 3K5MA 4LDVA 5CBAE 3KF8A 5C4ZA 2JEAI 3DEPA 1GXIE 4EGVA 2V8JA 1A3VA 4RFBA 4R8IA 3JAME 2XKOC 4IFDI 3L2VA 2E70A 3SDZA 1G3YA 3JAML 3A8KE 3VA5A 3QO3A 4A4KA 2FMCA 2K5DA 5LJ5f 1WD0A 3CEYA 3G71T 2ZGWA 2NTTA 3MEUA 1SYBA 5K36G 4J7IA 1TH7A 4BS9A 2RJCA 5GAN5 2RDFA 3L2UA 1B2TA 4C3JB 1TU2B 2H4OA 3A8LB 1FYCA 3RIRA 3JB9H 3GTPB 3KLRA 3JCMW 1VIFA 5FK9C 4F87A 1TWFB 3EJIA 3FDTA 1S72T 1TQOA 3M54A 2L5QA 1UEAB 1ENAA 2K5FA 4KV6A 1OXVA 1YIJA 4BA2I 5C0XJ 4C8QD 1UNSA 1Z6HA 3DWPA 4M75G 1DYQA 2XVSA 2ID0A 2EDGA 3DLMA 1UUPA 1QJOA 4OF1A 2AUKA 4M7DB 5KCHA 4M77B 2D0QB 1TVXA 3H0GB 4H13C 4NL2A 1U9RA 1IYUA 2AQ2B 1HXDA 2CW0D 1YI2A 2LT1A 1VQMT 3G4ST 1PDQA 2A6EC 2RD1A 3I55A 1QVFS 1KNEA 2NBFA 4QF4A 3I4MB 4M77G 3MP6A 2A6HC 2MI6A 4UDUC 3FLGA 4XTZA 5JEAG 5NUCA 4L6TB 4LJZC 2L5TA 4DAVA 2LFNA 1HUMA 4A3EB 3HRTA 4QUCA 2PVGB 2EOTA 2DY8A 5EKKA 3NP8A 4QIWB 3C1EA 4K2LA 2R92B 4KD4A 1VQKA 1Q8IA 1I6HB 1NR4A 4J83A 3S15B 1VQ7T 3BDOA 2A3LA 4ZUJA 1GUOA 4BUGA 3KLSX 5E4WC 4BDYA 2KEEA 1ILPA 4O42A 1QW1A 2F3WA 4RA8A 3QB3A 2F1MA 4JJNK 1Q12A 1N9RA 2JYOA 3OBYA 3M58A 4C92F 1OXTA 4M77E 1TIID 4R56A 3PV0A 2A73B 1JOKA 4M75A 3JCMX 2KJXA 2XDDA 4RAUC 1SSOA 1I8FA 2K6AA 1KQ2A 5CKBA 2D5DA 3E9FA 2ZPBB 5M9OA 2GQVA 4XXEA 4JLGA 1S72A 2QCPX 3I72A 4BY6C 2XN9C 4BB7A 4TRDA 2PZTA 4LDYA 2E41A 1M1KU 4R9WA 1B34B 5HK0A 2XIWA 1RTOA 1II3A 2DIQA 4QMGA 1UAPA 2JXMB 2O5IC 3HOXB 1LT5D 1Q3LA 2MWOA 3QHSA 1D1KA 1M4ZA 3VUZA 1LTBD 3I8ZA 1BYMA 1W4SA 3M3YB 2BE5C 3NTIA 1PMRA 2X6GA 2OAUA 4M7AA 1D5XC 4PNOA 2KECA 2YLBA 2AWOA 2OF1A 2X4JA 3SK5A 1R9TB 5DLOA 1F9SA 1GOZA 3CCLT 3UWNA 1UEBA 3E9GA 3BVMA 1EQTA 1LLRD 4DNTB 2VYTA 3CC2A 5J26A 5GMKh 1STHA 5L8RE 2ZXOA 3T13A 1KC8U 2QILA 4A3DB 1MI2A 1DD2A 1TKWB 1R8OB 3RESA 2JA8B 2ZPEB 2JE6I 2RHUA 3TEEA 2M9UA 1HQMC 1I3QB 1OXUA 5D6YA 3CMAA 1KDCA 2EPBA 2PMZB 3MTSA 3D4WA 4TQUS 4DNRB 3SXHA 3OIPA 2RHYA 3MCAB 4J6HA 1XNIA 5HURA 1PTOF 2K5LA 2LRQA 1HXYD 5GANd 2E2IB 1Q82U 4FYDA 4ODGA 4DAYA 2K5WA 4N4HA 1QVPA 2HQEA 3EAEA 4CKBA 1Y8NB 2K33A 4JBWA 2RK2A 3L42A 4M1UB 1QP3A 1STEA 1LTID 5KCOA 3I90A 2VB3X 5CC4A 2NVQB 3OYEA 1Y1VB 2Q8IB 3A8HB 4FVMA 3JRZA 2C9OA 3L3OC 1TWCB 5JEAH 1PTOH 5D6WA 1K73C 2EYFA 1NUCA 2IW3A 3OS5A 2ZPHB 3QIIA 4Y28E 1W6JA 1NZ9A 3RMQA 5EBDA 1ZHIA 5CKFA 4IN3A 2HBPA 1IKLA 2E2DC 4C92E 5ELBA 3TP5A 1D5ZC 3A54A 2HDLA 3HS0C 5C44B 4M7DC 4GLKA 1IZ6A 4M78D 3SWNC 5C5MA 5GAN3 4N9PA 2O5JC 3LYIA 1VQOA 3G71A 5C3WA 4L5GA 1TS2A 2F69A 3ERQA 1B34A 3ASKA 1DOMA 1Y8OB 1Q81U 4KT0E 4V0BA 5IGFA 4HAEA 2JZ2A 4ME5A 3N5BB 4M7AD 3T4AC 2E65A 1XYIA 2E10A 3VR6A 2B63B 1YJWA 4C3IB 2L8DA 1EEFD 1F2YA 2NTSA 4IUVA 4GZYC 1N8RU 3BY7A 5DY9A 4F7UE 1WJQA 2LMCB 4KK7A 3S2DB 4FF1A 5ELEA 2F0HA 3PIO3 2X6LA 1MGQA 4A53A 1G5VA 2WV6D 3QOLA 1GHJA 2XHCA 3C4SA 5A0GA 5JVH3 2RJDA 2NVTB 4ZYSA 4EQNA 1JORA 1HA5A 5CORA 1Q7YC 3H91A 3NWSA 3BYYB 4A3KB 3EVQA 5I9OA 3M9QA 3KUFA 2QTXA 1A3UA 4M8AA 2V8IA 1ZBXA 4WRDA 5IGDA 1PFNA 4OGCA 1M8VA 2CVRA 4Y91A 1Q82C 2PCFB 1PRTD 1KQ1A 1SE4A 4MMKA 3VR3A 5IGCA 1BQQT 3MXGA 2KMTA 2HDMA 1BKBA 3V7CA 1VQ7A 2LX9A 5HK3A 3A56A 4XU3A 5AFWA 2DZ9A 3WOEA 3SVMA 5HKCA 5ISRA 1GJXA 2K2VA 3MEVA 2EY1A 2K28A 4Z02A 4M75B 3HOWB 2EJFC 1DCZA 1OXXK 1SBBB 5J22A 1J8IA 2DNCA 3MFGA 3OS1A 4M7DG 4C1NK 1ET9A 4C2MB 4ZKCB 2NLUA 1SE3A 3KUPA 1S5FD 1N8RC 4C56C 4F7XA 4PJOD 1O7LA 4M77F 2EE1A 4K5WA 1B53A 3MXNA 3QOJA 4JLIA 3CCUA 4J1MA 4II1A 2A68C 2ZXRA 1KNAA 4BI8B 4EMKC 2E76C 5DM73 4KHVA 1H9KA 1OI1A 3H3VC 2X4XA 1G3TA 1NR2A 3I91A 1VDZA 5CV4A 5T1GA 2CW0C 1ILQA 4PJOB 3LGLA 1IYVA 2WB1B 4F7UF 5CKEA 1VQ4A 2EQJA 1G6ZA 1GHKA 4HSVA 2DXBA 4RKUE 1VMPA 5KRUA 3Q0AA 2PNRC 4L63B 3L2QA 3M7GA 2L11A 5M3FB 4NL3A 1BO0A 1X3QA 3HOVB 4O5VA 4FU6A 5HGTA 2DXCA 1FGBD 4J5YA 5KNBA 5GAOr 1WJSA 5CKDA 4OB1B 4EQOA 3SK4A 2BOSA 2M2LA 5LL6S 1EZ6A 1WTVA 4IURA 4ULLA 1LNXA 1HFGA 3NQTA 1C8CA 2B2WA 4PL6A 1FNWA 1K9MC 2R6GA 4R55A 2J0TD 2RSOA 3E5SA 3G7LA 3ONAB 4FF2A 4RH6A 4C8QC 3HFNA 1CZGA 4G7HC 4C0GA 2F0DA 4MIUA 2IG0A 3RMHA 2WSFE 1PFMA 1AEXA 4KUDK 3N6RA 3SB2A 4PMWA 1SJHD 2SEBD 4C92A 2C5CA 2PQWA 5EKIA 1TY0A 3JCMP 2D62A 3PUXA 1VQPA 1QVGS 3C94A 4DA2A 2D9TA 3HKSA 4BDZA 3URYA 3P20A 4XQNA 3VYSA 4RCOA 1FNVA 2OEOA 4ID6A 4DGZA 4M78F 5BN5A 2R3ZA 1G8ZD 1LT6D 2PPBC 3K0YA 4OVAA 4C8QE 4ZGEB 2D9UA 2V8KA 4M78G 4TKOB 1UGPB 2WP8J 3NXWA 3PUZA 5COYA 5CMDA 1E0BA 3GTJB 1V8QA 1G2TA 2QEXA 1V1PA 2F0WA 2KCNA 2KUMA 4EMKA 4RGNA 3S16B 2SOBA 4CJ2C 1STAA 1IHZA 2DN8A 1L0YB 5C6AA 3QXEB 3OY9A 3K5NA 3K7AB 3UT1A 3OSSC 1R4QB 4IUTA 3MWYW 2E12A 2F0EA 2EY5A 3V8KA 2E6NA 2QQ9A 5GAMf 5KIXA 1ENFA 3VYGA 1JOOA 3EQLC 2GF7A 3HL8A 2D6FA 4N0AC 3AHUA 2E1HA 2VXEA 1XTCD 4HT8A 1U4LA 3JCMg 4KY5A 1PTOD 3KBXA 2KY9A 4ZKBB 2DAQA 2E2HB 3CQZB 1EY5A 5FROA 3TCJA 1V1OA 3QIAA 1R4PB 4M7AE 2BDOA 2H3JA 3HOYB 3G4SA 3INZA 2NVYB 1JJ2S 1WD1A 5T1IA 2KCCA 4I65A 4FXDA 2F0NA 1M1KC 5C4JB 2A69D 5I21A 4RGTA 4HCSA 4XTYA 4JK1C 1KTKA 1G3WA 5CK9A 3MXUA 2VB2X 4FNFA 3PUWA 3GF5A 3E1SA 4E7JA 1HTLD 5DLQE 2ZXPA 2XSCA 1Z7TA 3P75A 4OGQC 1QNKA 3D31A 3QUIA 1JQYD 4G57A 3W2DA 2DTHA 3TP7A 1LO5D 4XTVA 1BIAA 4KKTA 3RKXA 4KTAA 3VR4A 1B44D 1KQSS 2R7ZB 5EPJA 1KLUD 1S5BD 4ZGDB 2P0PA 3S1RB 5C4HA 3AU7A 1I50B 2B2TA 2MP1A 1VQLT 1V29B 3O13A 1DOKA 3J80L 4C8QB 4OO1G 3PIOA 2QF7A 2TMPA 3NE5B 3A5ZB 1U4RA 4RCNA 1XWEA 1OYXA 1JE4A 2EZVA 2A74C 2PO4A 2C06A 1OZ2A 4UC4A 1B4OA 4XTCS 3OWFA 5CV5A 3RZOB 1DONA 2LCLA 4KUIA 1LTRD 5I2YA 4ZUIA 1F9QA 3K57A 5A0DA 4YIJA 2EQUA 4OO1I 5CQYA 5CV9A 1U1SA 4LD6A 2SNSA 4XU1A 3I4LA 3CMEA 1CHPD 1YITT 1KABA 4C0DB 4M78B 2EYHA 3CC7A 4J8OA 4DK1A 1RF2D 3QJYA 2RSNA 3KXTA 4E47A 3VJPA 2IJ0A 3J7AV 2NN6G 3PMFA 5F2DA 4A3BB 1VQ5T 1SYGA 4FF4A 3R93A 4ZTJA 2F0GA 4OIKA 3OMGA 2RHXA 1WGSA 4OIJA 3VYHB 4M78A 2F0SA 2PQEA 3JB9J 1A2TA 3CPWA 5KH6A 2O4XB 2F0LA 2MMPA 2X4YA 4C5GA 1GUNA 1AZQA 2YU9B 3MA2B 3PFSA 3NQIA 2G9HD 1X75C 1YNJC 2CGHA 1U1TA 3OPOA 4F88A 4ZTFA 3I55T 2VC8A 1W2BA 3OYIA 5DM63 5TSSA 2ZZDA 4DOVA 3FEOA 1DJ7B 1M1FA 5CVIA 4HKEA 1PTOC 3KLSA 3LWIA 4HR7B 4H0LC 1G291 1ZQ1A 1SFOB 4C5IA 3WVEB 3V8LA 5CAIA 1HA6A 3BYTB 1UGSB 4M77D 4ZRZA 1HPCA 2OT2A 1SYFA 3X24B 2F0IA 2G9DA 4FM4B 1KD1U 1AN8A 1STYA 4HCZA 2F0FA 1BI3A 2K4YA 2K04A 1ZKOA 5I2XA 2EY2A 5KYLA 3M85A 3DB4A 4DN4M 1VF5C 2XNAC 1ZXTA 2D2CC 5D3IB 2A5HA 1G91A 2FFKB 4E7IA 3JCMd 2Z1CA 1H9RA 3JCMb 1GXDC 4IKFA 3RERA 2MGSA 4BA1I 2QXFA 2BUDA 5C3XA 2RDGA 4JRIA 3SK8A 2I46A 3LX0A 4M78E 2DIGA 1RHPA 2MAMA 2PZWA 4JRQA 3CCVA 1H9JA 2RM4A 2RI5A 1Y1WB 5JOBA 3P8DA 3PGGA 4O6JA 1SJED 4QB4A 1VUBA 4TVRA 3GV6A 2EFIA 5ELDA 2EKOA 2FB7A 4IUNA 4RWSC 1ENCA 4N0AA 1F2ZA 5BN4A 5KGUA 5C3EB 1FR3A 3CCQA 2ICEC 3DXJC 4LK1C 3OQ5A 3VV0A 3HP9A 1BCPF 2KDSA 2B2VC 3R2TA 3FVQA 4M78C 2E2JB 3VKIA 3U9SA 3S9WA 3M4GA 3OW2A 5J39A 5JVG3 3J7YW 1QVFA 2PYKA 4C0FA 1SNQA 3X25B 1MBYA 2LNVA 5IGBA 3LGFA 3LH0A 2JP1A 1JRIA 3NBIA 2F0TA 3DB3A 1M90C 5E1FA 3OYDA 1ESRA 2L89A 4NW2A 2M00A 2ICIA 3MVVA 5C4XB 2KVQG 1YJ9T 5EBCA 2QQSA 1O7ZA 5LJ5d 3A8MB 1RD9D 5J1ZA 3Q24A 1CA5A 3IL8A 3NUCA 4DXFA 4BE2A 1EOTA 1WTWA 3T53B 2K3XA 3LWUA 4P2CB 4BBSB 3TU4K 1STBA 2DKGA 3OYHA 2JSOA 4PNYA 1LTSD 5I9PA 2LQ8A 4OGEA 1EY4A 5E4XA 2ZCFB 1C4QA 3HHTB 4MZPA 1HUNA 1JB0E 3W3AA 2BA0A 3FJPA 1H9S