4B9WA

Structure of extended tudor domain td3 from mouse tdrd1 in complex with mili peptide containing dimethylarginine 45.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
196
structure length
196
Chain Sequence
LEWTWVEFTVDETVDVVVCMMYSPGEFYCHFLKDDALEKLDDLNQSLADYCAQKPPNGFKAEIGRPCCAFFSGDGNWYRALVKEILPSGNVKVHFVDYGNVEEVTTDQLQAILPQFLLLPFQGMQCWLVDIQPPNKHWTKEATARFQACVVGLKLQARVVEITANGVGVELTDLSTPYPKIISDVLIREQLVLRCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TUDOR DOMAIN-CONTAINING PROTEIN 1
publication title The multiple Tudor domain-containing protein TDRD1 is a molecular scaffold for mouse Piwi proteins and piRNA biogenesis factors.
pubmed doi rcsb
source organism Mus musculus
molecule tags Replication
total genus 46
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00567 TUDOR Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4b9wA02
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4b9wA01
2X35A 2PZUA 4N4GA 3NTHA 1EYDA 3LH0A 1NSNS 4DF7A 4DGZA 4EQNA 2DIGA 3LYIA 4KJOA 4KY5A 2F0DA 2GF7A 3HZXA 5E3FA 4BE2A 1SSFA 4J1MA 1SNOA 2F0PA 1EYCA 4KD3A 4QW2A 5D6WA 5M9OA 1SNMA 5HURA 2F0QA 2B8AA 4IUVA 3SK8A 2SNSA 4L59A 1SYBA 4N9TA 3QBYA 1A2UA 3EROA 4OL7A 2EFIA 5IGFA 5IOCA 5C6AA 3DHQA 3R3OA 2IG0A 2OF1A 2L8DA 1KAAA 2F0OA 3H6ZA 4K8IA 1RI0A 2HQEA 2EYOA 2X4YA 3H6MA 2F0WA 4K5VA 1N27A 4B9WA 3QOJA 5KGUA 2GFAA 4IUNA 2LKVA 2RDFA 5IGCA 3L2VA 2RJEA 3L2QA 5C4ZA 3P8DA 1II3A 2LCCA 4IURA 5KCOA 4PMCA 3MEHA 2PZTA 3OYEA 4BE0A 2EYJA 4FU6A 4C5GA 5KEEA 3KUFA 4II1A 4EQPA 5D6YA 1STAA 1WJRA 2E6NA 4TRDA 2F5KA 1EY8A 1EY6A 2PQWA 2BUDA 4PMBA 3NUCA 4A4EA 2X4XA 4IUQA 2F0IA 2RI5A 4E7JA 2EYMA 3S3MA 3TP6A 3ERQA 4ODGA 3MEUA 3NXWA 4IUTA 2BIVA 3PMTA 4B9XA 2DAQA 4X34A 2DIQA 2E5QA 2M0OA 1OZ2A 5KIXA 3MP1A 3OB9A 5D6XA 2RHZA 2PW5A 4FL6A 2F0VA 4ZTJA 1F2MA 4KV6A 1TT2A 4HTHA 3OQ5A 2KQ3A 4KY7A 3NTIA 3TP5A 4NP5A 5IGEA 4IZ8A 5NUCA 2EQKA 2M00A 4KHVA 1SYDA 2R57A 2EQUA 3MEAA 5IODA 4PL6A 5C3WA 4BDZA 2LVMA 5K5PA 1A3TA 4IKFA 2XK0A 2F0LA 3M9QA 4PNYA 2R5MA 4Z02A 4EQOA 1JOOA 3MEWA 3L2WA 2EYLA 3ZEHA 3U9OA 5CIUA 5KE2A 4G57A 1SYEA 3S3NA 4K2LA 2K3YA 4C5EA 5CV8A 4ZUJA 2OXPA 4E7KA 1OZ3A 4A4HA 3MP8A 2YRVA 3FLGA 5J26A 1SNDA 5IAYA 1TR5A 3ITPA 3NTKA 4BACA 4J6HA 5JAVA 5CV4A 4ZUIA 4N9PA 2XDPA 2X4WA 5IIFA 3FDRA 4Q5WA 1WJSA 3QJ6A 2EQMA 3LLRA 3OYJA 3QIIA 3E5SA 4H7BA 4KD4A 4EVOA 1G5VA 1EYAA 4QQ6A 4K5XA 3Q1JA 2RBMA 4QQDA 3L2UA 3NQTA 1SNCA 1STNA 2RHUA 3P75A 4NKLA 5IGBA 1XNIA 2LDMA 1EZ6A 2EY6A 1SYFA 3C4SA 4HMJA 5C5MA 2F0KA 1JORA 3SHLA 3T16A 3LX7A 1KHCA 3O8VA 2F0HA 5E1FA 4NS5A 3D4DA 3OMCA 3D6CA 3QB3A 3F70A 3OYFA 4ME5A 4K8JA 5I6WA 5IN1A 2EYHA 1WJQA 3DLMA 3HEJA 4IALA 3SK4A 1JOKA 3OA6A 3PFSA 2NUCA 4QF4A 2LRQA 3L2RA 2EQJA 2BKDN 3CEYA 1A3VA 3BDCA 4F7XA 2EKOA 3SR1A 4QQGA 3RUZA 4DU9A 3ME9A 5EGTA 5IGDA 1STGA 2O4XA 2RI3A 5KE3A 1KDAA 2MWPA 3MP6A 2F0GA 2F3WA 1U9RA 2EXZA 4R8NA 2L3RA 5C5LA 1RKNA 4A4GA 4BDYA 2G3RA 1EQVA 1EY7A 4YIJA 1STHA 5HGTA 4ID6A 3DB3A 3OYIA 1WGSA 4C5HA 3MVVA 3UT1A 4LD6A 3T13A 3NK9A 4K5WA 2RJCA 3OYLA 1F2ZA 3QOLA 2OEOA 2RHXA 5CR3A 2L89A 4RKBA 2EY5A 5FRMA 4ZQ3A 5CGKA 4CRIA 3OS1A 3VA5A 1H3ZA 1NUCA 3SK5A 4BE1A 3OY9A 3MXPA 2R58A 5KRUA 4K6DA 4KTAA 1ENCA 4IUUA 5J22A 2RHIA 3C1FA 5CV9A 5KYLA 2F0FA 4UC4A 4RKLA 4OVAA 4WRDA 3QKJA 3OS0A 2ENBA 3PNWC 4EDUA 1SYCA 3S6WA 5CV7A 5F2DA 3ASKA 2RHYA 4DFAA 4N4IA 1EZ8A 3OYHA 1EY9A 5I6YA 4RG2A 4NDXA 1STBA 5C4HA 2JZ2A 1STYA 2NLUA 2F0SA 2SNMA 3EVQA 3TMEA 2PQEA 4QVZA 2P0KA 3D4WA 4I65A 3TP8A 2F0NA 3V2TA 1SNPA 1SYGA 2PW7A 2RO0A 3PMFA 4PLLA 4HCZA 2EY2A 2F0JA 3PMIA 2QQRA 5C3XA 3META 1KABA 5I9PA 1KDCA 3LGLA 2PYKA 2FHDA 2M16A 3OSOA 2RJFA 3LX0A 5C6SA 4A4FA 3NP8A 3NHHA 3OYGA 4E7HA 1A3UA 3FEOA 4S3SA 4WORA 1MHNA 5DAUA 3OYKA 3MZ5A 3C1EA 2GFUA 3MEVA 3OYAA 3MO8A 2EY1A 2EYFA 4BD3A 1AEXA 1EY0A 5FRNA 1ENAA 4N4HA 4QMGA 5J39A 2O4XB 3OWFA 1TQOA 5KCHA 4HMIA 3BDLA 3OYDA 2F0EA 4E7LA 5DEHA 5IGGA 3H8ZA 3EJIA 4GY5A 4ZTFA 5EKKA 2R5AA 5J1ZA 2RI2A 5I9OA 1SNQA 4NMZA 1JOQA 4MIUA 4C5IA 3OS2A 5ISRA 2RJDA 1OYXA 2KHSA 4IUPA 3OYMA 2QQSA 1EY4A 2F0UA 4LAAA 3D8GA 3SXHA 4QB4A 3GOXA 5CC4A 2QDBA 3SD4A 1OI1A 2M1HA 3E9GA 3L42A 3OMGA 2MWOA 3UWNA 1KDBA 2K3XA 3MHBA 3FC3A 3SK6A 4E6IA 5C0MA 5KH6A 4PLIA 2RKSA 2CKKA 3OYCA 2HQXA 2PZWA 5FROA 4E7IA 1A2TA 2F0MA 3S9WA 1EY5A 5KYIA 1IHZA 4K14A 4K2KA 3DMUA 3LGFA 4F8MA 3EAEA 5CV6A 2VYTA 2SOBA 3TP7A 4KJNA 2EYPA 3P1HA 5JOBA 3OYNA 3S3OA 2JTFA 3DB4A 2WACA 3P8HA 3OYBA 2F3VA 3E9FA 2LTOA 4KY6A 2D9TA 1F2YA 5EKLA 2F0TA 5CV5A
chains in the Genus database with same CATH superfamily
4N0AA 2K1BA 3MTSA 4JCVE 2ZT9C 3JCMJ 2QEXT 2R92H 4JVZA 1KAWA 1PSEA 4EQNA 4AFZC 4EPCA 3JRZA 3KJPA 2ESWA 2B2YA 2WV6D 2ZTCA 1S5CD 3OTOL 2N8NA 3L9AX 2AZVA 4AG1C 1TS5A 5E3FA 4A3IH 1SNOA 1CKNB 1FGUA 3CMEA 2MIOA 3S14H 2WINB 4JG2A 4KD3A 4B3SL 1ACMB 5M9OA 4C2MB 2DTOA 1SNMA 1UE9A 4A75A 2O5IC 2C0IA 3PIP3 2F0QA 2F1MA 1WQ7A 1WD0A 4IUVA 2XHCA 3SK8A 1BR9A 5IYCH 4OB2B 1JC7A 1BCPB 2A6HC 3EFSA 4Q0FA 3RKXA 1SG5A 2YRCA 5FU7B 1PTOB 4DR2L 1QW1A 2GA4B 3O5ZA 3Q23A 1IKLA 3KDFB 4XU3A 1VYUA 2LCSA 3DHQA 3W1BA 3M85A 1LO5D 1IBLQ 2C06A 4BUGA 4C8QE 4X3UA 2CZ1B 2IG0A 1Q81R 1K4US 2R7ZB 2EJMA 1AZPA 2UU9Q 2K5QA 4X62L 4DUZL 4C2MH 1RI0A 2V4DA 5GAHC 3A8HB 2VUMB 2NUPB 3QWYA 4WCIA 5CO7A 3K5NA 1YCSB 2FXQA 5GAEC 4XDXA 2G6FX 2X4YA 2VNUD 3X28B 4M78G 3UI2A 2PO4A 3FEWX 3KOJA 5I21A 4R4TA 3R6OA 1Z9FA 2DX1A 4DAMA 1K0RA 4J9CA 4JRQA 2LCLA 1RJTA 5IGCA 3QDRB 2JN4A 3K6OA 4FYVB 2NVQB 3L2VA 2Z9HA 3VA7A 2ES2A 1B3QA 2RVLA 1QE6A 3G1JA 1WTQA 2E75C 4JI4L 4C1NK 2HQHA 2KNBB 3GTLB 4A4KA 2BZXA 2QTXA 4IURA 1LOJA 3MEHA 4DV4L 3REBB 3J7YW 2R7ZH 2ABLA 4F16A 1V1OA 3J7A5 3TQYA 3VYTA 1IBKQ 2BDOA 4X1VA 4CI0C 5KEEA 3KUFA 1VQ9Q 2VUMH 3J7AF 1X3FA 2Y0SE 4A3EB 1Y07A 2QQBA 4FF1A 4EQPA 3A55A 4FXKC 3K5OA 1AP0A 2E6NA 4O1NA 3HOWH 1K83B 1IKMA 1OULA 3VR6A 4X3SA 3SWNA 1KHIA 2KY9A 5CAIA 2KXCA 5GROA 2RQRA 2QEXA 2K2VA 4MHEA 4QCLA 1MV0B 2NVQH 1Y96A 5GAN5 3NUCA 4A4EA 1HXDA 4RHRA 2X4XA 4U673 2BH2A 3GTLH 3EG3A 2NBFA 4E7JA 1M3AA 2CZ6B 3TP6A 1KNEA 3IFDA 3V7RA 3KUPA 1UGVA 4IOCA 4JJCA 4M7DE 1R9TH 4ODGA 4PJOG 2I5MX 3MEUA 2NVYB 4XYOA 4YWLA 4C8QG 2SDFA 1KQSS 3OTOQ 2YU9B 3WVEB 2L5TA 3JB9F 2SEBD 4A3CG 1SN8A 1AW7A 1PH6A 1U1TA 2DIQA 2DKGA 4X34A 1STEA 4J15A 4A76A 4B3SQ 1I0CA 5GANh 4M77E 1S5BD 2E2DC 2OQKA 4L5SA 3PF4A 1R0CB 3OB9A 1VQ7Q 3EGUA 1X3QA 4KLKA 1K73R 2F0VA 4MN3A 3TP5A 1PKTA 1KTKA 4LDWA 1VQ5T 2R6GA 2FZKB 2QA4T 4DR2Q 4J7IA 3REAB 3GDEA 2NVYH 4M4ZA 4L5TA 3V96A 5IODA 2A8VA 3IRBA 2YU9H 2GVBA 4HJAA 4F87A 5CQXA 5C0XJ 1IB8A 3GV3A 2EYZA 2F0LA 1IL8A 3FHWA 4PNYA 4DUZQ 3HOVB 2EYLA 2G5DA 1QCBD 3F8TA 4RTWA 4GN3B 3U9OA 2JP1A 4G57A 2L12A 2M51A 4DBQA 2F1LA 4K2LA 3R2TA 1T0HA 2WFWA 2FFKB 3CCRT 3MJXA 2K3YA 4C92A 3CC7Q 2K57A 4A3MB 5IHKA 2OXPA 1JBMA 5EBCA 3E19A 1TU2B 3A56A 4A4HA 1D6EC 4A53A 1ILPA 1ZSGA 4E7ZA 4JI4Q 1H9KA 1VQBA 3IAYA 4JBKA 2LX9A 2NN6H 3M4YA 2JNGA 4DV4Q 2HNIA 2VKNA 4M7DG 3JCMb 3H09A 1GO3E 4N9PA 1XPRA 4BY7G 1J8IA 2B8GA 1R4PB 4IIMA 3OYYA 2XI9A 3CCEA 1WJSA 1TS3A 2RSOA 2JA6G 2CWAA 3MKDA 1M30A 3GTKH 1D3BB 3HHTB 3I5RA 4M77G 5GQOA 2COZA 3HKSA 1CTMA 1A6XA 1GXIE 3A54A 4IQZA 3CCJQ 2RHUA 5DM7R 2F2WA 3OIQA 3I9QA 3OS5A 1F9PA 1XNIA 1PVOA 4PKCC 1A0NB 3RIRA 2VB2X 4IFDJ 2JE6I 1SYFA 2EYQA 4ORZA 2ATWA 1D1AA 2CGHA 5GANj 5C5MA 1VQ4A 1MUZA 1YZ6A 1NYFA 1YFNA 3T16A 3LWUA 3EG2A 3JCMh 4QIWB 3P7JA 4UHVA 3K8AA 1KHCA 2KMTA 2JEBI 1PTOF 3G6ET 2HKQB 3URYA 1BCOA 2A37A 3F70A 1GL5A 3HKZB 1UEBA 3MFYA 3D7SB 1L0YB 1U0LA 1VQ5A 4K8JA 2QA4A 2DD4A 2N78A 1VQMQ 3PF5A 1WHHA 2EYYA 5IT9c 2R7FA 4AIMA 4JUVA 2JMCA 5IN1A 1LT6D 5M5YB 1UGPB 1CT1D 1Y1VG 4KN4C 4F7UF 1KFZA 1PHJA 5LJ5h 4M7AC 2LRQA 1B70B 3CRLC 1B9NA 3ULJA 2K79A 1VQKT 1YHQQ 2P4RA 1K73U 1LT5D 2K52A 3E6ZX 1J3TA 1IGUA 2BKDN 2QW7A 1NPPA 3GNGA 2RNAA 5GADC 1I5OB 1WA7A 3S2DH 2UUAL 1ZBXA 4QQGA 2BA1A 3RLFA 4BY6C 1GJXA 2D0NA 4A93H 3RUZA 2RM4A 3UDXA 1LTGD 5GMKl 4PNOA 4BBSB 1V9PA 1QUQA 2K5NA 3C3LA 1M8VA 1WIEA 1VQAA 2IPKD 4RTUA 4Y7NB 4IO9A 1YIJT 4AQYL 4Z88A 1VIEA 5GMKe 4BA2I 5FLMG 2EXZA 4R8NA 2L3PA 5HY6A 5C5LA 1XPOA 2O9SA 3MFGA 4OMOA 2JS2A 4C3HB 1D1CA 2XG8D 1EQVA 5JPMC 1EY7A 2WSFE 4JOIC 4CC7A 4EX5A 2B63G 3FRNA 1RL2A 1OU8A 2DVEA 2JA8H 2R61A 1KSWA 3I72A 1D2BA 3ZL7C 1WGSA 1LT4D 2OWOA 4C5HA 4GLXA 3HP9A 1BDOA 3QYHB 1Y8PB 5IT9E 3TU4K 2JJQA 3T13A 3NK9A 5I4DA 1BOSA 2Z8LA 4K5WA 4OF1A 5I2MA 4R1JA 4AFUC 1YWPA 2DL4A 1G2BA 4CBVA 1A63A 3OYLA 1F2ZA 3GP7A 3QOLA 2OEOA 1U3OA 2BZYA 3GF5A 2DYIA 1G291 1YJ9Q 2EY5A 4IJLA 4ZQ3A 1KK7A 3G6EA 3OS1A 1KQSA 3J81L 3JCMd 1I50B 4AYBE 1H3ZA 1YITQ 3MC0B 2K3BA 2KQWA 1QQJA 3OY9A 1SKUB 1G3TA 4BE1A 1LPLA 1B9MA 1T3SA 3JCMQ 3MXPA 4HN7A 2R58A 3WXMB 1ENCA 4HIKA 1FX7A 4A3KG 1SE8A 5E4XA 2PVGB 3BS1A 2KOLA 4CDEC 2DGYA 1IYJB 1JJ2P 4UC4A 2HZYA 4RKLA 1P8LA 3CCMT 2PZ1A 1VQKA 4CDCC 1CZGA 4TQUS 4LUEA 4MDWA 5LJ5d 1SYCA 4ZGDB 1TWGH 3V7SA 2BE9B 3FKIB 3A8KE 4WJ4A 1XYIA 1M2VB 3PGZA 3BVGA 3JV3A 1I3QH 1WOCA 2I5LX 4JRKA 5C0XI 4C8QB 1V29B 2SEMA 5JJKA 5AT1B 2AT1B 4KKTA 4J9IA 1JB7A 1Q7YC 1HRJA 2EDGA 3CCLQ 1I4K1 3OYHA 1EY9A 1HTLD 5I6YA 1S5FD 2L11A 4NDXA 3NMZC 2DTIA 2JZ2A 4K11A 1YIJA 1PXUA 1RCVD 1S72Q 2DBMA 3BG3A 1DOLA 2UUAQ 2NLUA 2F0SA 2L55A 1PYBA 3Q6SA 3SGIA 3PQIA 2VGMA 2DE0X 2EBPA 3CCQT 5CVIA 2ECZA 5FLXc 1C4QA 1AHJB 3D4WA 2Z4IA 3GTMH 4JZ4A 2XVSA 4BS9A 4AQYQ 5LMNQ 1N6AA 3OW2S 1UB4A 1MSHA 1IGQA 1QP2A 2K5HA 1PKSA 2K4YA 4JJBA 1SNPA 3V2TA 1RLPC 4MTKA 2RO0A 4A3CH 4HT8A 2ZXOA 3I4NG 2DRMA 1C48A 1TVXA 1VMPA 1KXLA 4FW1A 2CCZA 4RUGA 5IYBG 3GTOB 2XSCA 3PMIA 2Y0SB 3CBOA 3ZBDA 1EUJA 4AYBG 2PI2E 3META 2DTHA 2FMMA 4C92E 5DY9A 1WTRA 2NB0A 2PYKA 1SE3A 2FHDA 2M16A 4DA4A 3OSOA 3X3MA 4KBMB 2RJFA 2BDNA 2KVMA 3LX0A 4R0KA 4B6MA 3OYGA 1A3UA 4RMFA 3P20A 3S1RH 3FEOA 1I4PA 5KYWA 4WORA 4IFDI 3J81j 1S40A 3CD6T 1JWSD 1OXVA 4D8DA 4ANJA 4RTTA 3AT1B 2D0PA 4LNPA 5L37A 2DK3A 4I7AA 1Y0MA 3OYAA 4LF9L 2X69A 3CPWS 2VS1A 4BY7B 2EY1A 3GTOH 5LJ3h 3H3VI 1AEXA 1EY0A 5FRNA 1ENAA 4DAYA 3S1QH 4N4HA 3Q0AA 1TY2A 1T5XD 2R3ZA 4C3IG 2KT1A 4M77B 1W2BP 5DNFA 3CCMA 3NHNA 5KCHA 1CZWA 2Y90A 3OYDA 1K9MC 2G9DA 4ATOA 1JB0E 1VOMA 1E2WA 1L1OB 2IWHA 4DK0A 3AQQA 5IGGA 2QCPX 1IO6A 3EJIA 1K28A 3PO2G 4GY5A 6AT1B 3VR5A 4PZ6A 1M9SA 1LTAD 4M7AA 1CA5A 4F17A 3RZOH 1SNQA 1EFNA 1SHFA 3HRUA 4MIUA 1KJWA 4YCVA 4QKUA 2JA6H 1VQOA 1FWZA 3QSUA 4QGUA 2HCKA 3MCAB 3VDYA 3PO3G 1DONA 5ISRA 2RJDA 3JCMf 4G7OC 1CKMA 4IUPA 3H94A 3CCQA 1PMRA 4F7UE 3C0CA 2OTLQ 2QQSA 4M75D 4HVVA 4C92G 3TZUA 1ZX6A 1JXMA 5LMUL 3LH5A 1UE5A 3GOXA 1H9MA 1HQMC 3AU7A 3GBQA 5EKIA 3K81C 5M5WB 2CZ0B 3SD4A 2ED1A 1WTHA 5BN3A 2M1HA 3SVMA 2AKLA 2NUZA 4QVCA 2ZZDA 3HPWA 4M78F 3R6NA 1E3PA 1NMFA 4O0AA 4KGZB 5LJ5f 1RF2D 1OXTA 1H9SB 2R7DA 2K3XA 2AIRB 3CQTA 4K0KQ 3MHBA 3W2DA 4J6WA 2MO0A 2K05A 3SK6A 2DXCA 4J8OA 3GO5A 4GOPC 3ULLA 2PQAA 1EIHA 5KYYB 2Z6BA 3TS0A 1XMQL 2E2IB 3NSWA 1UJ0A 1NPRA 1U4PA 2B8FA 3LWEA 5I2YA 2X3WD 4EMHA 1U5SA 1YJWQ 2O88A 3S9WA 1YI2T 1Y1VH 1AOJA 5M5WH 1VQ8T 5C3EG 2OAWA 3VR4A 5HK0A 3GTGH 5LJ3j 1WXUA 4LUDA 4GLKA 4BI4A 4HCCA 5AFWA 2GNCA 4ULLA 1JQYD 2B63B 3IQLA 1ESRA 2JTFA 1VQLQ 3DB4A 3QWNA 1Q7YU 3M0TA 1GCPA 4M75B 3RNUA 2QGGA 2LNVA 2HDLA 4LF9Q 3VYHB 3H0IA 2TMPA 3LWHA 2E2IH 4KY6A 1XQHA 2N55A 2B29A 4IN3A 2JN0A 2K03A 5ELBA 4D6WA 3PUXA 1K3BC 2IX1A 2SRCA 3KK7A 3TCJA 3E9IA 4PJOF 5FLMH 1HHVA 3I90A 1HJPA 4DOWA 4C8QF 3ULRB 2KVQG 2X9HA 3CCVQ 1B44D 1VIFA 2GVAA 1H95A 2QG9B 3EG1A 2B63H 3RMQA 3VKIA 1EYDA 1L2FA 1TUDA 3OIPA 1AFPA 2DIGA 3LYIA 2CP0A 2NVXB 3ER0A 3SB2A 2YXYA 2ZPBB 1OQKA 2F0DA 1GUSA 1MNDA 4BE2A 3CP0A 4J1MA 2F0PA 3U4VA 1QP3A 1EYCA 2PCFB 4DAVA 3ULPA 3GIBA 4QW2A 1QKXA 1TG0A 2D0QB 4A3KB 2UXBL 2CH4A 2RQUA 4C0DB 1M1GA 1IHVA 2H3JA 2PNRC 1LNXA 4HR7B 1NZ9A 1EWCA 1I8FA 4KKSA 1O9SA 3L2ZA 1WI5A 1ARKA 1X01A 5LMUQ 4L59A 2C0OA 3RESA 4LDYA 5CBEE 1BK2A 4XQJA 3QBYA 1A2UA 3OW2A 4YY3L 2NTTA 2EFIA 4FSXA 2NVXH 3H0GG 1N9WA 4QVDA 2WKDA 1UECA 4OIKA 1X3PA 1GUGA 3UDFA 3J80c 2L8DA 2MHVA 3VS1A 3C94A 5A35A 2F0OA 4A3KH 3G71Q 1V1QA 4K8IA 4Z89A 1YI2A 4JRIA 4O5VA 4HIOA 2ZAEA 1VQ8A 4CDFC 3G7LA 1A15A 1HK9A 1K9MU 1PG5B 4HCKA 1IZ6A 1ABQA 3HS0C 5CKDA 4HJ9A 4B9WA 5KGUA 4M7DF 3A8GB 1I4HA 1Y8OB 1FYNA 3UE1A 3K59A 3I4MH 4AFSC 1ZBJA 3HTRA 1JWUD 2L4NA 3X25B 2D2CC 1RUWA 2HSEB 2X6LA 5GAN4 1II3A 1EOVA 1YHBA 5KCOA 3CPWA 2ASBA 4OMQA 2ROTA 2K75A 4M77F 2PZTA 2VXWA 4BE0A 2EYJA 1GCQC 3FB9A 1C8CA 4AYBB 1XJVA 3J80i 1B7TA 4XTVA 5COYA 1PH5A 3SWNB 2RA2A 1J6QA 4J9HA 2C9OA 4EMKC 1LTRD 2DUDA 1W1FA 4RCBA 3NELA 4LJZC 1RAIB 2K9GA 5EC7A 5JEAG 1BI2A 2XD0A 4TRDA 3S2HB 1GRIA 4ZCKA 4BBRB 4ABNA 2HL3A 3JB9J 1LTTD 1B4OA 3KLWA 4LUOA 3TSSA 3DWQA 2BUDA 1SE2A 3I4LA 4ZNXA 5EAYA 2UXDL 1NTGA 4IUQA 5CR2A 1F9QA 1I81A 5EBDA 3PUWA 4X64L 3A8MB 4JLIA 3I4NH 2DJZA 3RZDB 3HOXG 5C4XB 3S3MA 1W2BA 5IYBH 2CP5A 2E2HB 3CPFA 4RA8A 3J80E 2HAXA 1QB5D 3J7ZC 4CHTB 4A3DG 1UE1A 1VQPT 3HOUB 2MI6A 4C0GA 2PMZE 1HR0W 4OO1G 2BIVA 3WOFA 1PH7A 1K8OA 4LWCA 2E5QA 2CT4A 2M0OA 1G91A 4G7ZC 1WNLA 1QG7A 2J06A 1O75A 1QNUA 3HRTA 4POGA 2UXBQ 1N33L 2ZTDA 3GTQH 2I2LA 3MP1A 3I7FA 1ZSZB 4JV5L 2XKOC 3KF8A 2KCMA 2EKHA 2XWBB 4RFBA 2A19A 4DV5L 1GVPA 2DEQA 2YDLA 1TT2A 4M7AE 5CQYA 4FNFA 1D1BA 1QVFS 1XTDA 2EQKA 1SYDA 1N9RA 2R57A 2PNIA 4HT9A 4YY3Q 1D0XA 2P0QA 4CGYB 1GUWA 2RQTA 4AMCA 4DBRA 1CHQD 4PL6A 4JLGA 5C3WA 4BDZA 4C3IH 3PO3B 1Q12A 4J9GA 3OBYA 4MZTA 3F2DA 1MI2A 2D8JA 2LVMA 1BCPD 1GBRA 2Z0SA 5K5PA 4A3IB 4IKFA 2XK0A 4GOPA 5FU6C 3HFOA 2CP2A 3M9QA 1PTOD 1ZQ1A 1G6ZA 2R5MA 4Z02A 1JOOA 3MEWA 4M78E 3CC4Q 1M4VA 4R55A 4WJWA 3P8BB 3PO2H 3S3NA 2OAUA 2I07B 2YV5A 2F4IA 2CP6A 2BE7D 1NLPC 3M0UA 3EIVA 1EL0A 3VS4A 4A93G 4J8QA 2K5FA 3GTGB 5CKEA 2RF0A 3VS0A 3PO3H 3M54A 5IAYA 1TR5A 3VS6A 3NTKA 3CCJT 4BACA 1DGSA 3BZDB 5CV4A 4UP9A 2X4WA 4RTXA 4HXJA 3CC2T 1PDQA 2H8HA 4Q5WA 5FWBA 4ZGJB 3FP9A 3QJ6A 3C46A 2Y4XA 2EQMA 1E6GA 2EE1A 5FJ8G 3H15A 2DPPB 3THKA 2AMCB 3OYJA 1VQNA 3G4SQ 3E5SA 5C3EB 2Z4HA 2JA8G 3TEEA 3NWSA 1PFMA 1U4MA 1HZAA 4JBMA 1HJDA 4QQ6A 2A1AA 3Q1JA 2OT2A 3L2UA 1VQPA 2J6KA 1RTNA 1ASYA 3L2PA 2UXDQ 4M7AG 1IW7D 4IPHA 1KC8C 1BCPC 1DJ7B 2O01E 4NKLA 4X64Q 4OWTB 2MOXA 5FU7C 1EZ6A 1PTOC 3M7GA 4PJOE 2ZCFB 4JI6L 1DZ1A 4KUIA 4N8FA 4GZYC 1Q82C 3LX7A 4FP5D 2F0HA 1WFWA 4F7UB 4NS5A 1YHQT 3D4DA 2MPXC 5C3EH 4H0LC 2N49A 1TWAB 4ME5A 3HOWB 4E6RA 1NM7A 1N33Q 2M9VA 2FO0A 4JV5Q 4GBQA 1JE4A 2I5HA 3CAMA 1WJQA 2CSIA 3A0JA 3HEJA 4IALA 3SK4A 4DV5Q 2A08A 4LXCA 1QVPA 1HR0L 1ZUUA 4KHZA 2NUCA 3PFSA 2J0TD 4P71A 4P73A 2ZPGB 2AUJD 5EG2A 1EQQA 1D0ZA 1QZGA 2LNHB 4HA8A 5KNCA 4DV2L 5EQ0A 3E0EA 4V2SA 1R9TB 4A3GG 3QZ5B 3BDCA 2LX7A 1NY4A 5GJWB 4DUYL 1UHCA 1HZ9A 3SR1A 4NXML 1KC8R 4VUBA 3H0HA 1M90C 1TWAH 4L63B 3MXNA 5IT9L 3ME9A 5EGTA 1STGA 3VYRA 2O4XA 2JA7G 3JCMW 5KE3A 1KQSP 4OWXB 5A0GA 2F0GA 1RDPD 1U9RA 1WHKA 1PYWD 2JS0A 3CCJA 2YUOA 2L3RA 5CCAA 1O7LA 2OX7A 4DV3L 1T3LA 2JSOA 1J9OA 3CC2A 4RCNA 5ELNA 4ILWA 1N34L 1JWMD 3PVQA 2RK2A 3MAQA 5KYUA 1TSFA 2KCNA 2EJGC 1RADB 3PV0A 1SPKA 3JB9I 1X6GA 3INZA 1Y1WB 1TS9A 3C12A 1Q8KA 3NBHA 2EGAA 2F4VL 3I73A 3MVVA 2K33A 3UT1A 1Q1BA 1YITT 2OTJT 1VMCA 1G51A 1S4ZA 1TKWB 4TKOB 4XTZA 3R2IA 4HKEA 3H0GH 1JT8A 5GAMe 3SEMA 3MXGA 2DRKA 3BU2A 3M9BA 2RHXA 5CR3A 3BYYB 4DR3L 2YYZA 5JEAJ 5K36G 2LP5A 3V05A 1WTPA 2RH2A 1M90R 2CW0D 3IKJA 3UA6A 4XQQA 4C56C 3T1HL 4NOYA 1YHQA 3URGA 1ENFA 2HT1A 1XMOL 5CKBA 3CMEQ 1NUCA 3SK5A 1B34B 1BBZA 4FSSA 4LDXA 5LMNW 4JI6Q 2K7VA 2F2VA 4BY1G 3CXCS 2Y4YA 4JK1C 1TXYA 1SFOH 1X32A 4HCSA 5KRUA 3V8KA 3X20B 2ZXPA 1X54A 2COYA 1WFQA 4K6DA 4KTAA 1BB9A 2E3IA 2HSPA 3E1SA 1X65A 4LF8L 3CCLT 4FXDA 1WHJA 5E7NA 4FYDA 4TVAB 4IUUA 2CT3A 2RB6A 2RHIA 3WWVA 1U5KA 5KYLA 3V7CA 1HZCA 1YEZA 4UPAA 3GTKB 3NGPA 1QVFA 4GNXB 3QKJA 3OS0A 5JJLA 4OGEA 3DWAA 3S6WA 1HR0Q 3L7ZC 4C92F 4FT4A 3QDFA 3U50C 3M4OH 5JEAH 2GQIA 3U4ZA 1EU3A 1EWHA 2YTYA 3A7AB 3BDOA 2RHYA 1UUEA 4DNRB 3A98A 1UGSB 4DV2Q 4PMWA 2YRDA 1NNXA 2A5HA 4RG2A 1CUKA 1STBA 3HOZG 2L3SA 2KJXA 2IY5B 2RMOA 3HRZC 3PSIA 2DN8A 2HCCA 4DUYQ 4HIDA 4NXMQ 1K9AA 1E24A 3TMEA 1K76A 4XTYA 1KL9A 1PC0A 3HOXH 4HEDA 2ICIA 2HIXA 4ZGEB 2B2UA 4FF2A 4QVZA 4A3DH 1AZEA 1KC8U 1AZQA 1EWIA 1WYXA 2BA0A 4DNIA 4JI1L 1VS0A 1F9SA 4R56A 2F0NA 4OO1H 4Y52H 2KROA 1JR0D 1JMCA 3VJPA 4DV3Q 4L5RC 1LLRD 2E65A 2GCXA 1N9SA 1OX8A 4RCCA 1ZUKA 3I56T 2KYMA 3QR8A 1Q82U 1YITA 1N34Q 4A3BG 2OTJA 3CCST 2GQVA 5GAMg 1BBWA 1XMQQ 2YTXA 4LNQA 2DERA 1G8ZD 2QDLA 2MPMA 5KYWB 1KDCA 1CKNA 5HKCA 3LGLA 1X6OA 1VQJA 3M4QA 2QEXQ 4ZK9B 1XNQL 3S2DB 4DEYA 2F4VQ 3NP8A 4J6XA 5C6SA 1YWOA 2AQ2B 1TTHB 3CCUQ 3RD4A 4A93B 3J7AV 2CP3A 1D09B 3UDGA 4S3SA 2KEEA 1RABB 3FVQA 3H3VC 4DR6Q 3MZ5A 4ZRZA 2PUKB 3C1EA 4P5NA 3BJUA 1BNZA 2WB1E 4YWKA 4BXXG 2QKIC 1V1CA 3EH1A 4DR3Q 3A8LB 1YCYA 2PMZB 1PFBA 4BD3A 1M27C 3T1HQ 2LMCB 1R77A 3MHXA 1PSFA 1XMOQ 1MV3A 5J39A 1Z7TA 2KHJA 1G2SA 4DV7L 1M90U 4ZKBB 3CCRA 1FYCA 2JA8B 2JUFA 4J7FA 4E47A 3AB9A 3EHRA 1VUBA 3W3AA 2F0EA 4HMIA 5TSSA 1OPLA 2GTJA 2NUPA 4LF8Q 1E2VA 5DEHA 3E0JA 1BCMA 5FOBB 3QJYA 5IHNA 2E12A 4OB0B 4M7AB 4QY7A 1BF4A 1C0AA 1U4RA 5CORA 5LMNL 2EGCA 1HUNA 1PH8A 4J83A 1A62A 2FMCA 1IHWA 1PV4A 1AE2A 5J1ZA 1YNJD 3K7AH 4GLAC 2XDDA 1SE4A 1M2OA 1NBEB 2B39A 5FJ8H 2K6DA 5CYUA 1TS2A 4GN4B 3S1NH 2ED0A 1SSOA 4BA1I 2NYSA 1SRLA 2VQEL 4TSSA 1CM9A 2DNCA 1IBML 4M78B 1EFWA 3RR6A 4G7HC 3FJPA 2L1BA 4LDVA 3OSVA 4JBJA 3SEBA 1KQ2A 4C8QD 1X55A 1ICFB 2Z0WA 2JMAA 4K0KL 1SMYD 2DEUA 2BE5D 1WXBA 1JU5C 1B3AA 4FF4A 2R93G 1BYMA 2QDBA 1WHMA 2L2PA 3I56A 5D3IB 2EIFA 4YWMA 1OI1A 4XTCS 3EFOB 2KBTA 2K4KA 5GMKm 3CCSA 1W6KA 2P5ZX 4XU2A 2DZ9A 1TWGB 4O6JA 2PQAB 2MWOA 3UWNA 2WB1G 3VS5A 1KDBA 4JI1Q 4DPGA 5D65A 2W10A 1BUVT 1I3QB 3UPUA 4A3GB 2E2JB 1PRMC 1YJNT 4A54A 3BY7A 5CKFA 5C0MA 5KH6A 3CCEQ 2EJGA 4HSPA 1N8RC 5D14A 3RN2A 3UDCA 3H9NA 2LQNA 5GAN3 1G83A 2HQXA 2JA7B 1A2TA 1ZYRD 1X9NA 4H13C 2ROLA 5ELEA 1MSGA 2WKCA 4BI8B 1UUPA 1I4XA 1XNQQ 5LJ5j 1HFGA 2ZPFB 5A0LA 4K14A 4ALPA 1YNJC 3DMUA 3E9HA 3LGFA 4JI5L 1SMXA 4DQ2A 2JOYA 2NN6I 1NEGA 1CFMA 2LJ3A 4L5GA 3CBMA 1DOKA 3D4RA 1RACB 1NBWA 1P16A 5JOBA 3GTMB 3I4MG 4PJOB 3GTJH 2M02A 2E2JH 4A3GH 4OGCA 3JCMV 1VQ4Q 3P8HA 3KBXA 3R8BA 2GBQA 4C0FA 1GUOA 4XT1B 2UUCL 4OMMA 3CXCA 4C8QC 2F3VA 1PFNA 1VDZA 4Z9CB 2LTOA 2XNAC 1X43A 4OB3B 5GAOl 1SMYC 2BE5C 2Z6KC 2JA7H 3PUZA 3OW2P 2FZCB 2D9TA 4JRPA 5EKLA 1OXXK 4DV7Q 1DD2A 1UEAB 5G3LF 1VQ5Q 2E1HA 2QA4Q 2Q8IB 1BO0A 3QYGB 1CQFA 1JRIA 4MZ9A 5CBAE 1G3SA 3CQZB 2MGSA 1ZLMA 2YSQA 1LV9A 2VWFA 2NYZD 2PZUA 4C0ZA 3FDTA 4R4IA 3ND9A 1BXTA 3S1RB 4UY8C 2J7IA 4N4GA 2D0OA 4DR5L 2MMPA 1Z6HA 4DA2A 2E41A 4M77D 3A8IE 1FL0A 3EGXA 2GF7A 5ELDA 3BFMA 2DJQA 1ZYRC 1DM0B 3AHUA 1PLFA 2B2WC 2J6FA 4OMFB 3JSCA 3S1QB 1D7QA 1OXSC 3M0PA 2EYXA 2VQEQ 1HA6A 2O2LD 1WDXA 3CPWP 1ABOA 1ZHIA 2YTVA 3KLRA 2JTEA 1NE8A 5IY0A 2IVWA 1O7ZA 1IBMQ 3CQZH 5K36H 1LTSD 4A3FG 4J9BA 3M59A 1Q7YR 3AFPA 4RGOS 1D3BA 1HQRD 2IT1A 4HCBA 1F77A 3NWTA 4N9TA 4OL7A 4CKBA 1G2TA 1YNND 1YJNA 2KBNA 5I22A 5C6AA 1BI0A 3SDZA 5A2QE 3R3OA 1J5EL 4J9FA 2JM9A 2LJ0A 2DLPA 2VV5A 4M7DB 4BY1H 2X4JA 1FGBD 2OF1A 1D5MC 1KAAA 3OHXC 4MZPA 3RZOB 2EQIA 2O5JC 1FD7D 2XRQD 2G9HD 1DYQA 2HQEA 2JA6B 1CSPA 1Q3LA 1TWBA 1V1PB 5C44G 2QK0A 2VVKA 4LUZA 1HNXL 2NWMA 2E5KA 2E64A 1MBYA 2HD0A 3H6MA 1HFNA 2WP8J 1KD1C 1NR4A 1VYVA 2DJFC 2F0WA 3QOJA 1JO8A 4RMOA 4LUVA 5FLXE 2EW3A 4M77C 4H02A 1FNVA 2I46A 2LKVA 2RDFA 2P84A 3WVDB 2RJEA 3L2QA 1ICWA 5C4ZA 1IRXA 2EGEA 1OXUA 3FPPA 1G6PA 1L1OC 1WZOA 1H3HA 1MIUA 2WIIB 1RAAB 4JI5Q 1PRLC 2LCCA 3L0OA 3T4AC 2BTTA 5M3FG 1L0WA 3OYEA 2JT4A 3J80L 3G6EQ 1D0YA 1H641 4OMPA 1E22A 4C5GA 4DR1L 4OELB 3HOZH 1SEMA 2HL5C 3I2ZA 3QPHA 4LE9A 2A28A 4II1A 2V8IA 4M7AF 1SR3A 2XGTA 2UUCQ 3I3CA 4DBHA 5D6YA 1QWYA 4IIOA 2L5QA 2EJFC 2HBWA 1YNNC 3NEMA 2QASA 2ZJRA 2YUNA 2PQWA 2CH4W 1EY6A 2DL3A 4IPCA 4XU1A 1M1KC 1VQKQ 1D5ZC 3UATA 3AYHB 2AZSA 1AT1B 2QAZA 1HH2P 1HTPA 1AWWA 2J6OA 1BIBA 1TH7A 2CZ7B 5GANe 2XDBA 1MJCA 1Y1VB 2A73B 2CHBD 2EYMA 2F0IA 2VY3A 4L8JA 2V26A 3BDUA 2JVVA 1X56A 2OQ0A 3MXUA 4P75A 4JI3L 3STBD 3KJOA 3K5LA 4A3BH 3A5UA 4DR5Q 5IYDG 2JM8A 1KD1R 8AT1B 2WAQG 3ERQA 4DAPA 4IPGA 1K9MR 3AEVA 3NXWA 1IYUA 4JOIA 4IUTA 4XT3B 1N8RU 2JK8A 1B2TA 3PMTA 4CKCA 4FIBA 1YIJQ 2MO1A 4DR7L 3EGDB 1QVGS 3TVTA 1CKAA 2DM1A 4RG8A 4LD9K 1OZ2A 3I55T 3I91A 1MD2D 1Q46A 3DM3A 2YLCA 1WPYA 2QDYB 3CD6A 2IX0A 4QL5A 2B2TC 2PW5A 3VS7A 4BXXH 4FL6A 2DXUA 2HDAA 1F2MA 3CC4T 4C3JG 4HTHA 4LMQD 4CDDC 4DK1A 3A1PA 1X27A 4KY7A 3NTIA 5IGEA 3WDNA 4IZ8A 1VQ6T 1I4QA 5NUCA 1FMVA 5M5XH 2VB6A 4KHVA 2JXBA 4FM4B 1FJGL 3GNFB 2UXCL 4Y28E 3E3XA 2EQUA 1PRTB 2LMJA 3NPPA 4ELZC 2DA9A 4QUFA 3W5OA 4R4OA 5AJ3L 1QLYA 1J5EQ 3LW5E 4OIJA 3NPFA 3GQBA 1MMNA 2E10A 4M75C 3KF6A 1A3TA 3PUVA 2E4HA 4RCOA 2EZVA 3PIOA 3QHSA 4KN7C 3EG9A 4EQOA 3G48A 4PQXA 3L2WA 3BVMA 2CP7A 5CIUA 5KE2A 1HNXQ 1MGSA 2YWWA 1SYEA 3RMHA 4EQ5A 1EFID 2R93B 2B2VC 4RGNA 4FYYB 5M3MH 4C5EA 2N3SA 5CV8A 1VF5C 1QILA 2YHTA 1CSQA 4WF2A 4LFCL 2BZ8A 4QUCA 3G4ST 2XTIA 2ZJPA 2WB1B 1AWXA 2I0QA 4JI7L 3M0QA 2DNEA 3RUXA 5EPJA 4P72A 1MGQA 2YRVA 5J26A 1SNDA 4A3JG 1EIYB 2K5WA 3ITPA 4ZKCB 1MJEA 3V8JA 1M2VA 4J6HA 4ZUIA 1HYOA 2YLBA 1QOHA 4UP8A 5JAVA 3E2UA 1UGRB 2AK5A 4FW2A 4DR1Q 1X2KA 2NUTA 5GANg 5GAN8 2Z6KA 3CCMQ 1GFCA 2IPOB 2Z1CA 1TXQA 3TQ7P 2R93H 4H44C 3QXEB 1KRSA 3CHBD 3UA7A 5CK9A 4TVRA 1I07A 2CQOA 1QCFA 2O2OA 5HK3A 4H7BA 2ZJQA 4KD4A 4C0DC 1NJIC 1K8GA 2LZ6B 4EVOA 1WCMH 1C0MA 1EYAA 4DV6L 1PH2A 5AYFA 4K5XA 3M3YB 1SF9A 4LDUA 4QQDA 2RBMA 3I4MB 1STNA 2XRSD 2VXFA 1F1BB 3P75A 4GS3A 5IGBA 2OI3A 4KMUC 2EY6A 3C4SA 4JI3Q 3QO3A 1NEBA 2FL7A 2F0KA 3HOYH 4X9DA 2DZCA 1VQOQ 3KLSX 1JORA 3I55A 1B53A 1FNWA 4GLMA 3JB9D 2Q2UA 4DNTB 3O8VA 4HJ5A 2B2WA 3CCQQ 4HCEA 1LTID 1IREB 1KD1U 3D6CA 3QB3A 3QUIA 2A7YA 4DR7Q 4RHSA 5EJWA 1VQ6A 3DM1A 3ND8A 1VQ9T 4BB7A 2V1CC 4PFOA 1JQQA 4J6YA 3M3YH 1LUZA 5LL6X 1JEGA 5CKHA 4MZMA 2EYHA 3I8ZA 3DLMA 3Q8DA 4LN2A 1V43A 3T53B 2KSSA 4F04B 2KUMA 4A4IA 1QCNA 1GD7A 1JOKA 2ENMA 5EPLA 4QF4A 1WTVA 1GUTA 1TIID 1JB3A 3VU3C 3I4NB 2UXCQ 2I0NA 2Q8RE 2YUPA 3K80C 3L2RA 1FJGQ 4JI0L 1C1AA 1AVZC 5LL6S 2EQJA 3DLLA 5GAMd 3MXNB 2AQ1B 1A3VA 5KYXA 5AJ3Q 2A0FB 2KYBA 3A7LA 1V8QA 5GAN2 3HSBA 1Y96B 3EG0A 2L3QA 2XMFA 4ME7A 2GN5A 1I4GA 1VQDA 1M1KU 4RGMA 1QZHA 3S16B 2RI3A 2MK5A 4M77A 1H9RA 1KDAA 1MHWC 2QGFB 4K6LA 4XXEA 4B08A 3AMUA 3RLOA 3GTQB 2KCCA 4F14A 4EGVA 5HGQA 2A36A 5KYUB 1L1OA 3IL8A 4C92D 1ZA1B 4CJ0B 4LFCQ 2F2XA 1VQ7T 4BDYA 1I6HH 2G3RA 4RTZA 4YIJA 4JI7Q 2CQAA 1STHA 5FO7B 2LJ1A 1WJJA 1BBUA 3JCMg 1M3BA 1PZJD 3LNNA 2P0PA 4M8AA 5C4JH 1FMKA 4C3IB 4CJ2C 1QVFP 5D7UA 1HCZA 4HSVA 4X65L 3OYIA 5GMKh 1UAPA 3M4PA 4A3FH 5ELCA 3JAMc 3S16H 3NBIA 3HKZE 3HOVG 2EJFA 3U58A 1KLUD 2KI7A 4RG1A 2J7ZA 3PO2B 4GKJL 3D31A 3I4OA 4X6AH 2BH8A 1AZGB 1ZSZC 4A3MG 1O7YA 3K7UC 2F69A 4D8KA 4DV6Q 5LJ5g 2L89A 1BVSA 3VV0A 5M3FB 1LM0A 3EHQA 2JQOA 2DILA 2QTVA 5DLOA 3CC7T 1S5ED 4NW2A 2K5IA 5CGKA 5IXFA 4GKKL 3VA5A 2D5DA 2JTMA 5C44H 2D1XA 1K1ZA 2JW4A 4XTWA 1Y69U 1BI1A 1F2LA 4KT0E 1KG1A 5KYNA 3X26B 1VQ9A 1HZBA 1YNXA 2AHOB 1EYGA 1QVGA 3F2CA 4IPDA 3TBIB 4C92B 2L0CA 5GAOp 4Q5VA 3JAMi 1OX9A 2EWNA 2EXDA 5IHIA 2QQAA 1Z9ZA 5KYYA 2NVTH 1PRTF 1SAPA 3C1FA 2LQKA 2CVRA 1CKOA 4PJJA 4O2DA 5I2XA 4YHHL 5M3FH 1FR3A 3N52A 3I70A 1KLGD 2ENBA 3DEOA 3KXTA 4ZYSA 2MJ8A 5CV7A 1IYVA 3TDQA 2LT4A 2M9UA 1AWOA 3BZCA 3JCMX 5F2DA 2FZGB 2PU9B 4HVUA 3PIO3 4JI0Q 4RWSC 1YI2Q 3JAME 4M75A 5GAN6 4IFDG 3S17B 2YUQA 1Y1WH 2ZXRA 1KRTA 1STYA 2KRMA 1Q81C 1NJIU 3EVQA 4KKUA 4YCUA 3HKZG 4KHPL 4RKUE 1VQ7A 2B2VA 1G8XA 1R0BG 2VC8A 1K3RA 3T9NA 1FVIA 2ZM6L 1X2QA 4HJ8A 5IH2A 3D6WA 1UE6A 5IYDH 1QCOA 4I65A 3TP8A 2FPFA 4OGQC 4RGTA 3CCUT 2L0AA 1Z47A 2KECA 1VQMT 4ZN1A 2PW7A 1ET9A 5GMKj 1S5DD 1O78A 4HCZA 3PT9A 1OO9B 1SROA 2RHQB 1RHPA 3S17H 2ATCB 1VQFA 1LTBD 1KABA 5GAMf 5I9PA 2FINB 1NYGA 1NLOC 3JC66 4QJFA 2B86A 1S1NA 3DKMA 4C3JH 4IOAA 5LJ3e 4X65Q 3HRSA 3PGGA 4A4FA 1UDLA 3A8OB 4E7HA 4BBSG 4A3LH 1XJWB 4E7SA 3CC7A 1RAEB 2FYKA 3HP3A 2OJ2A 3OYKA 1WXTA 4GKJQ 3M5AA 4JJDA 3CMAQ 4A3JB 2GFUA 2GGRA 4ESRA 4PJMA 4G4KA 2JJ9A 2VZAA 3MO8A 4C3HG 4L6V5 2EYFA 1I6VC 5IE8A 3Q24A 2IL8A 4GKKQ 1C7YA 2DY7A 2IJ0A 2CFMA 3M55A 2EQSA 1RLQC 5GAGC 1QUQB 5HCKA 3OWFA 3RDVA 3NENA 3KLSA 1UNSA 4KULA 4B3TL 1PYSB 4E7LA 5L8RE 1IW7C 1QKWA 1PTOH 1DCZA 2FHTA 1NCVA 2RDGA 5BR8L 1R4QB 3S1MB 1W6JA 5JVH3 4RTYA 3CU7A 4A3JH 4BI3A 5ELFA 1Q82R 1EEID 3H0GB 5EPKA 4YHHQ 2R5AA 3K58A 1EQTA 4B3ML 2QQ9A 3HG9A 2RI2A 3U23A 2MFIA 4OEMB 2PUOB 5I9OA 3M0SA 4NMZA 5L23A 1K73C 3MPUB 1GCQA 3T56B 1PH9A 1JOQA 3D3RA 4C5IA 1SEBD 3OS2A 1PA6A 1YJ9T 4LF5L 1YNZA 2DMOA 1OYXA 2KR3A 2L15A 1PFSA 4EMKA 3OYMA 3RBBB 1I1JA 2K04A 5G3LD 5GMKi 2C5CA 2F0UA 1SFOB 3S15B 2K6AA 3CCET 1QJOA 3D8GA 2K50A 3CCUA 4QB4A 2KRNA 1K8MA 3S1MH 1VQMA 2VL6A 2NWGA 5CC4A 4DR6L 4KHPQ 4MMKA 4NL3A 4NL2A 3CXCP 2ZM6Q 2JYOA 3K5MA 2NZOA 4JYAL 3E9GA 3GPLA 1R8OB 2ALYB 1EEFD 3FKIG 3OMGA 4XQ3A 5LJ3g 5JJZA 4XU0A 4HIMA 2DVJA 1Y57A 3CW2C 4KGVB 2ICEC 3M4OB 4A3EH 1SXTA 2CREA 1EX4A 1JCKB 4E6IA 4PLIA 4E2FB 1K83H 4Y92A 2RKSA 1WHGA 2CKKA 1VQ4T 3OYCA 2Q2HA 1E7OA 5FROA 1VQNQ 4E7IA 2E6ZA 4FDBA 1UGQB 2V8JA 2ZPEB 3KFUA 3S15H 1VQIA 4WJ3M 4AG2C 5KYIA 1IHZA 4DKAC 1ZKOA 2PPBC 1TUCA 1VQPQ 1HPCA 3EAEA 2E8GA 3OPOA 5CV6A 1ZSZA 2SOBA 4F8MA 3HOXB 1S72T 3TP7A 1U8RA 1Y14B 4KI0A 2CSQA 3P1HA 4A3DB 3RLNA 4R8IA 3OYNA 3S3OA 2HHHL 4GNXC 4DV1L 4LK1C 2LFNA 3G6JB 2A68D 1SJED 3OYBA 1N5ZA 2Q2IA 3E9FA 3V8LA 2NZ1D 2B3GA 1A0IA 4X62Q 1Y7XA 2Y0SG 5FKAC 2IW3A 2EPBA 2KEDA 4P2CB 1Q81U 1D5XC 2PVDB 1QVCA 1JXOA 2PI2A 3RERA 4OP0A 2MQHA 2PNHA 5CV5A 3GD7A 2RQVA 4B3TQ 2X35A 1VF7A 4X66L 2CW0C 3EGXB 1ZEQX 4DXGA 1UE7A 4O42A 3NTHA 1IXDA 3LH0A 1NSNS 5BR8Q 4DF7A 4DXFA 4DGZA 2KEAA 1PCXA 1L0XB 4JI2L 3FPUB 1YJ9A 2M0YA 1M3CA 2CYZB 1K0XA 3VS3A 4KJOA 2DXTA 4KY5A 2RHSB 5A2QL 3HZXA 4B3MQ 3C95A 3N5BB 1LT3D 3ZYYX 1SSFA 1TWHB 5GAN7 1AWJA 4M7AD 1PH1A 3HOVH 5C0XH 2LQWA 4YTLA 5D6WA 2K01A 5IP9G 4LF5Q 2FB7A 3M0RA 1M1FA 5HURA 1CHPD 2FJ2A 4A3MH 2D9UA 1T0JA 2B8AA 5FLXL 1BI3A 1ML0D 1WX6A 3EFXD 2MNAA 1Q86C 2SNSA 1WTOA 2A68C 1SYBA 4FXGC 3EROA 5IGFA 2K7AA 4M78D 3CC2Q 5IOCA 3TS2A 1MMAA 1M8AA 3VYSA 1C6VX 4DAYB 4XAXB 4JYAQ 2AHJB 4F88A 4M75E 3A74A 2VASA 1TWHH 2DD5A 1EU4A 1ONLA 2E3HA 1MMDA 3I5SA 2AWOA 1H9JA 2KRSA 3K0XA 3K7AB 2E70A 1BCPF 1GM5A 5DLQE 5GANd 1TU0B 3H6ZA 3CCLA 3KDFA 1D8LA 3PCOB 1I94L 2RN8A 2EYOA 2CKZB 3S1NB 4GN5A 3WOEA 4B3RL 2WSCE 3TZDA 1QWFA 5IWAL 4DV0L 4K5VA 1S72A 1N27A 2VB3X 2GFAA 4F7UA 1SBBB 2X6GA 2ID0A 2PTKA 4CC2A 1RD9D 4IUNA 1WD1A 4JBWA 1CA6A 3HGBA 3TRZA 2HDMA 1YN8A 3BZKA 2KHIA 2OTLT 3P8DA 4MTNA 2HCIA 2HEQA 1LJOA 4X9CA 1OTCA 3UE0A 1M5Q1 1ZA2B 5M3MG 4PMCA 2K5DA 3SE0A 2AWNA 1AN8A 4FU6A 2HHHQ 4FF3A 4IFDH 1RAGB 4DV1Q 1SRMA 1JJCB 1ZXTA 4BY6B 4FYWB 1Q86R 3ONAB 3TN2A 1N36L 1WTXA 4RTVA 1WJRA 2C0TA 1STAA 1DXMA 3H3VH 2F5KA 2F03A 2HBPA 3PUYA 2FEIA 4PJOD 1EY8A 4UAIA 4M78C 5M5YH 3VUBA 4J5YA 4PMBA 3UDIA 1AD5A 1X75C 4CC3A 3UF4A 3QG1A 1HXYD 4HVWA 1QMCA 2IHFA 4JI8L 4X66Q 3QO2A 2RI5A 3M53A 2Q8TA 2ZGWA 1RI9A 1TS4A 3X24B 1YJWT 5KNDA 2RQXA 2DL8A 2QI2A 4ZN3A 1V76A 1WCMG 2QF7A 4R4QA 4JI2Q 3TEHB 3LGJA 4GLVB 7AT1B 4LF6L 3GTJB 4M75G 1E2ZA 1SRUA 2C35B 1OEBA 1WTWA 2EOTA 1I5LA 2KK4A 2RA4A 1X69A 4B9XA 2DAQA 1VQLT 3T51B 2VQFL 3T1YL 4BBSH 3GTPB 5T1IA 3RR5A 4C1NI 3HOYG 1RTOA 4Y7NH 4X3KA 2EYWA 5KIXA 1G3YA 3H0FA 4OMNA 5D6XA 3TREA 1ESFA 4OONA 2RHZA 3D0FA 1OV3A 3VS2A 1XPUA 1TY0A 4ZTJA 4KV6A 3OQ5A 2KQ3A 4DN4M 1T9HA 4C3HH 2K14A 4NP5A 3GP8A 4AH6A 3I35A 2M00A 4LFAL 1PH4A 2A74C 3KF6B 4P74A 2DL7A 3MEAA 4DEXA 2QILA 3PVLA 3CCVT 4KRTA 4R4CA 4OX9L 3EG9B 1EOTA 5GAOq 2CDTA 1W6XA 2OTJQ 4PJOC 1IL2A 2RF4A 1TWFB 1Y71A 3N6RA 2DXBA 1BKBA 3GTPH 3C2PA 4Y91A 1PHTA 2QXFA 1XOVA 1I94Q 2FPDA 4DOVA 1B34A 1PD0A 3ZEHA 4AFQC 2OTLA 5H1SE 4R9WA 1ILQA 2KA7A 2LXJA 4M7DD 4B3RQ 5IWAQ 4DV0Q 1U4LA 2AQ3B 3BVZA 4OO1I 1I5FA 4ZUJA 2GTOA 1X6BA 5I11A 4E7KA 1DJRD 2IIMA 3SFMA 4XTUA 3TSWA 1OZ3A 3FRPB 2JXMB 4CKEA 3OBWA 3MP8A 1N8RR 1XWEA 4JC0A 4JDSA 1VCIA 2TSSA 3BYTB 2NUTB 1I50H 3FLGA 4GNXA 3OWEB 2VXEA 1B1ZA 2ZPHB 1TWFH 2FPEA 1NR2A 4BY1B 2LSSA 2XDPA 1JJ2S 1PH3A 1S3OA 5IIFA 3QZ9B 2HQLA 3FDRA 3JCMc 3CCRQ 3KYHC 1UG1A 1TOVA 4KK7A 2RCNA 1Q1EA 4KH1B 4LW1A 5GANf 1N36Q 1VQOT 3LLRA 3DXJC 3QIAA 3QIIA 2AUKA 1HD3A 3MA2B 3HFNA 1PNJA 3G71T 1YJWA 1Q86U 1I4RA 3U9SA 5GAOn 1RAFB 1G5VA 1VQGA 1I6HB 5GAOm 3FKIH 3NQTA 3RMSA 1SNCA 2RPNA 4JS5A 3A8JE 2QGQA 4JI8Q 3M4GA 2LDMA 1D1KA 1GHJA 1LYLA 2EVBA 1VQLA 2CUBA 2RDHA 2WAQE 2ZTEA 2LY7A 4HMJA 2K28A 4CJ1B 3VYUA 2X51A 3SHLA 2F52A 4M7DC 4LF6Q 2KCTA 3HOZB 2XIDA 4J9EA 1XNRL 1CSKA 5E1FA 2RCFA 3OMCA 3RN5A 1EZZB 1WYDA 1PD1A 5GJVB 3OYFA 4XIGS 2VQFQ 3T1YQ 1CI3M 1G3WA 3NFCA 2RD1A 1D1IA 4BBRG 1GUNA 1B8AA 2IX3A 1O7IA 2M2LA 1AE3A 3I56Q 4M1UB 5I6WA 2A69D 1UHFA 3CCVA 2JA5G 1UTIA 3A5ZB 2H3EB 3M56A 1TWCB 4DR4L 3JB9G 4EMGA 3CCSQ 1JICA 4PV1C 3OA6A 2VUBA 5KYXB 5CMDA 5C4XG 1ASZA 1SDFA 4LFAQ 4OXPA 1NMGA 4PFZA 1KIKA 2Q2TA 4A3BB 1CQVA 3CEYA 4OX9Q 3HOUG 2HMAA 1HNWL 2LQ8A 2PVOB 4JJNK 4F7XA 1W4SA 4UDUC 3R93A 2EKOA 1KIXA 2NTSA 3VRYA 4PZ7A 5J3BA 5IP7G 4DU9A 1SLJA 1PRTD 4X3TA 4OWWB 5IGDA 3NE5B 4BWGB 1HNZL 1Y8NB 1B7YB 2L9HA 2MWPA 1UJYA 3EFRA 3MP6A 1TWCH 2F3WA 3MWYW 1Y1WG 1C9OA 1X3EA 1VYTA 2DFUA 4N8X1 1BBXC 4BY7H 1QVGP 1RKNA 1U1SA 5DM63 1W2BS 4A4GA 1BIAA 1GOZA 3RNJA 5M5XB 1XX8A 3Q22A 9ATCB 5IP9H 1HA5A 2R92G 5HGTA 2FG0A 1NAPA 1RODA 4ID6A 3RKWA 2DF6A 3H41A 3J81c 3DB3A 1Q95G 2K2MA 3G71A 3KFVA 2BOSA 2HUGA 3KF8B 1PZKD 4A3IG 1WVLA 2DNUA 2D6FA 2A69C 4LD6A 2N88A 2KXDA 4KGXB 3VRZA 4Z8AA 2RJCA 2EVRA 4M78A 3EH2A 3VR2A 1ZUYA 2WSEE 4PG3A 4NPSA 5M3MB 1JJGA 3BE3A 1LACA 2ZPIB 3H91A 2XN9C 4RKBA 3HFZB 5IYCG 3PTAA 4A3LG 4L5QA 1CKBA 2KGTA 5FRMA 1E1OA 2V8KA 1FNUA 4GOPB 4CRIA 3EFOA 3S24A 3HL8A 2H1EA 1PRTC 1A8VA 2XWJB 3J81i 1E6HA 1M1KR 1QNKA 2OCEA 1VA7A 3JAML 5GAMh 4XQNA 2W0ZA 2DBKA 2E74C 3NQIA 3L3OC 1XNRQ 2DY8A 4LFBL 2P4TA 4OHJA 5J22A 1NG2A 2KT8A 3CKIB 4N0AC 1SSHA 2J05A 5CV9A 1XTCD 2F0FA 3DUZA 1T5EA 3STBC 3GV6A 4OVAA 3G7ZA 4LF7L 4FO2A 4WRDA 1LABA 3F2BA 3PNWC 4EDUA 1YJNQ 2LT1A 1WCMB 4POFA 5FO9B 1WHLA 4XK8E 1BU1A 5LJ3d 8ATCB 2RSNA 4DR4Q 2B2YC 3J81E 4HAEA 3ASKA 1AEYA 1U06A 3GLXA 1YP5A 2EPDA 3VYGA 2E76C 4DFAA 5KNBA 4N4IA 1EZ8A 4PJOA 1MMGA 1K8AC 4PJNA 1JE5A 4PZ8A 4V190 2R7ZG 4C8QA 4MNOA 3ZJYC 3HOYB 4QQBX 4EIKA 2UUBL 4ZLTF 1HNWQ 3SHWA 1PM3A 2F5TX 3VR3A 5C4HA 1X3GA 2JEAI 4F7UG 4WTOB 1IXRA 2VUMG 1Z9QA 2SNMA 1Q8IA 4FCYA 1WI7A 3PIPA 3EQLC 4FVMA 2H5XA 2DJGC 2V1RA 5FO8B 4LF4L 1NE3A 3JCMe 3HOWG 2PQEA 2P0KA 2FRYA 1HNZQ 1W70A 2LXKA 4NXNL 2CS7A 1H8KA 3FMCA 3K57A 1EIGA 2X3XD 1SYGA 5T1GA 1N32L 2VGNA 3PMFA 2CWPA 1JJ2A 4PLLA 3CMAT 4YCWA 2EY2A 2F0JA 2E5LL 5JJIA 2QQRA 2K32A 2KENA 5DM73 4JS4A 5C3XA 2DL5A 5LJ5e 1B50A 2KDSA 4OB1B 1LTLA 4A3EG 1AH9A 3CC4A 1YHAA 1QWEA 4FYXB 5LHY1 2AKWB 3ICEA 1KNAA 3KBGA 2HKNA 4APVA 3NHHA 3O13A 2D62A 3X3NA 5BN5A 5I2SA 1MHNA 5DAUA 1K8AR 2MP1A 4UP7A 4DBFA 3M7NA 1KQ1A 1YBYA 4KH0B 1M4ZA 1PWTA 1RAHB 2DYBA 2KAFA 1Q90A 1YVCA 3MEVA 2QEJC 2QYZA 5JPNC 3TSZA 2A3LA 1RIPA 5GAMj 3OW7A 4PJLA 3FJ5A 1GFDA 3F1ZA 1E7ZA 4A63B 3FIFA 2EAYA 1NJIR 4PK4A 2LS01 1F9RA 1SJHD 4M7DA 4I7ZC 4QMGA 4U68A 3L1AA 2O4XB 5C4JB 1GXDC 1TQOA 1HSQA 4ME3A 4AT1B 4KUDK 1CK1A 3SWNC 3DWPA 3EN2A 3LWIA 3F2UA 3MEFA 2EJ9A 4DK3C 4ZAIA 3BDLA 4L6TB 3CD6Q 3G4SA 4A3FB 1V1PA 4LFBQ 2XU8A 1H92A 2O9VA 3H8ZA 1PZID 2FVUA 4JPBW 3OOCA 4MMLA 2F3IA 4ZTFA 2DETA 2K5VA 1OU9A 5EKKA 1VQEA 4LF7Q 4OMLA 1MKHA 1OPKA 2A6ED 3B6YA 1GHKA 4EMKB 5BN4A 4HJ7A 1GBQA 1B07A 2KE9A 2H4OA 3BW1A 1VQHA 3IFTA 3NBHB 2LC4A 3PE0A 5C44B 5FW9A 2NZHA 4QIWE 2NN6G 1BQQT 2KHSA 2MAMA 1O80A 2V1QA 1E1TA 5E4WC 2UUBQ 5GAOr 1EY4A 1P92A 5ECAA 3CMET 3M58A 4IJHA 4LAAA 3SXHA 4WFN3 1HUMA 5C0XG 2HIVA 2JA5B 5FWCA 3CRKC 5FK9C 1LCKA 1VQNT 2NVTB 3K0YA 1FXXA 2XIWA 3OSSC 4LF4Q 4V0BA 2FRWA 3CMAA 3DEPA 1IBLL 1M8MA 4JZ3A 3L42A 4NXNQ 3W1GA 5ELOA 2UU9L 1FMWA 2D8HA 2XICA 4QT7A 2HD3A 2VW9A 5LJ3f 3FC3A 2MYSA 3EBEA 1N32Q 3VUZA 2MCNA 1LVKA 1EIFA 3S2HH 1ET6A 1H9SA 2K5LA 4BBRH 4CC4B 2E5LQ 1UFFA 2CUDA 2MF2A 2PZWA 1TUGB 4NB3A 2F0MA 1K0SA 1W3SA 2JA5H 3RKYA 3JB9H 4C92C 1EY5A 1MNEA 1OOTA 2DO3A 4J9DA 3EGDA 1VQCA 2COWA 2IHEA 4K2KA 2A6EC 4RH6A 5C4XH 3CF5A 3RZDH 2J4XA 2YT6A 4XTXA 2B2TA 5D3DA 2E2HH 2VYTA 2AKKA 4KJNA 3CBPA 1SHGA 3QWXX 4FT2A 2EYPA 3AFQA 3JCMP 1EQRA 2WAQB 1IBKL 3HOUH 2R92B 5JVG3 5A0DA 2A6HD 2WACA 2MUYA 4XYQA 5FU6B 3I55Q 1K8AU 1DOMA 1E0BA 2BCOA 4RAUC 2RK1A 3ERSX 1WLPB 4DK6C 5IP7H 1XXGA 2JA9A 4MDXA 3EA6A 3ZFJA 3S14B 1VQ8Q 1F2YA 1UWVA 2O31A 2F0TA 1GKHA 4JW0A 1VQ6Q 1WQWA 2RQWA 5IXBA 4M75F 4ELYC 2B2UC 4C3JB 4PFPA 3M57A
chains in the Genus database with same CATH topology
4N0AA 2K1BA 3MTSA 2ZT9C 3JCMJ 2QEXT 1PSEA 4EQNA 4EPCA 3JRZA 2B2YA 2WV6D 1S5CD 3L9AX 5E3FA 1TS5A 1SNOA 3CMEA 2WINB 4KD3A 5M9OA 4C2MB 2DTOA 1SNMA 2O5IC 3PIP3 2F0QA 2F1MA 1WQ7A 1WD0A 4IUVA 2XHCA 3SK8A 1BR9A 4OB2B 1JC7A 1BCPB 2A6HC 3EFSA 4Q0FA 3RKXA 5FU7B 1PTOB 1QW1A 2GA4B 3Q23A 1IKLA 3M85A 4XU3A 3DHQA 1LO5D 2C06A 4BUGA 4C8QE 4X3UA 2CZ1B 2IG0A 2R7ZB 2EJMA 1AZPA 2K5QA 1RI0A 2V4DA 2VUMB 3A8HB 5CO7A 3K5NA 2VNUD 4XDXA 2X4YA 3X28B 4M78G 3UI2A 2PO4A 3FEWX 5I21A 3R6OA 4JRQA 2LCLA 1RJTA 5IGCA 3QDRB 3K6OA 2NVQB 3L2VA 3VA7A 2RVLA 1QE6A 1WTQA 2E75C 4C1NK 3GTLB 4A4KA 2QTXA 4IURA 1LOJA 3MEHA 3J7YW 1V1OA 3VYTA 2BDOA 4CI0C 5KEEA 3KUFA 3J7AF 4A3EB 1Y07A 2QQBA 4FF1A 4EQPA 3A55A 4FXKC 3K5OA 1AP0A 2E6NA 4O1NA 1IKMA 1K83B 3VR6A 4X3SA 3SWNA 1KHIA 2KY9A 5CAIA 2QEXA 2K2VA 4MHEA 4QCLA 1Y96A 5GAN5 3NUCA 4A4EA 1HXDA 4RHRA 2X4XA 4U673 2NBFA 4E7JA 2CZ6B 3TP6A 1KNEA 3IFDA 3V7RA 3KUPA 4M7DE 4ODGA 4PJOG 3MEUA 2NVYB 4XYOA 4C8QG 2SDFA 1KQSS 2YU9B 3WVEB 2L5TA 3JB9F 2SEBD 1AW7A 1U1TA 2DIQA 2DKGA 4X34A 1STEA 5GANh 4M77E 1S5BD 2E2DC 3OB9A 1X3QA 2F0VA 4MN3A 3TP5A 1KTKA 4LDWA 1VQ5T 2R6GA 2QA4T 4J7IA 3V96A 5IODA 4F87A 5CQXA 5C0XJ 3GV3A 2F0LA 1IL8A 4PNYA 3HOVB 2EYLA 1QCBD 3U9OA 2JP1A 4G57A 2L12A 4K2LA 3R2TA 2FFKB 3CCRT 2K3YA 4C92A 4A3MB 2K57A 2OXPA 1JBMA 5EBCA 3E19A 1TU2B 3A56A 4A4HA 1D6EC 4A53A 1ILPA 1H9KA 3IAYA 2LX9A 2NN6H 3M4YA 2JNGA 2HNIA 4M7DG 3JCMb 3H09A 4N9PA 1J8IA 2B8GA 1R4PB 3OYYA 2XI9A 3CCEA 1WJSA 1TS3A 2RSOA 1D3BB 3HHTB 4M77G 3HKSA 1CTMA 1A6XA 1GXIE 3A54A 4IQZA 2RHUA 5DM7R 3OIQA 3OS5A 1F9PA 1XNIA 4PKCC 3RIRA 2VB2X 4IFDJ 2JE6I 1SYFA 2EYQA 2CGHA 5GANj 5C5MA 1VQ4A 3T16A 3LWUA 3JCMh 4QIWB 3P7JA 1KHCA 2KMTA 2JEBI 1PTOF 3G6ET 3URYA 3F70A 3HKZB 3MFYA 1UEBA 1L0YB 4K8JA 1VQ5A 2QA4A 2DD4A 4JUVA 1LT6D 5IN1A 5M5YB 1UGPB 1CT1D 4KN4C 4F7UF 5LJ5h 4M7AC 2LRQA 3CRLC 1B9NA 1VQKT 1LT5D 1K73U 3E6ZX 2BKDN 1NPPA 3GNGA 1ZBXA 4QQGA 2BA1A 3RLFA 4BY6C 1GJXA 3RUZA 2RM4A 1LTGD 5GMKl 4PNOA 4BBSB 3C3LA 1M8VA 4Y7NB 2IPKD 1YIJT 1VIEA 5GMKe 4BA2I 2EXZA 4R8NA 5HY6A 5C5LA 3MFGA 4C3HB 2XG8D 1EQVA 5JPMC 1EY7A 2WSFE 3FRNA 1RL2A 2DVEA 2R61A 3I72A 1D2BA 1WGSA 1LT4D 4C5HA 3HP9A 1BDOA 3QYHB 1Y8PB 5IT9E 3TU4K 3T13A 5I4DA 3NK9A 1BOSA 2Z8LA 4K5WA 4OF1A 5I2MA 4CBVA 3OYLA 1F2ZA 3GP7A 3QOLA 2OEOA 3GF5A 1G291 2EY5A 4ZQ3A 3G6EA 3OS1A 1KQSA 3J81L 3JCMd 1I50B 1H3ZA 3MC0B 2KQWA 4BE1A 3OY9A 1G3TA 1B9MA 3JCMQ 3MXPA 4HN7A 2R58A 3WXMB 1ENCA 1FX7A 5E4XA 2PVGB 3BS1A 2KOLA 4UC4A 4RKLA 3CCMT 1VQKA 1CZGA 4TQUS 4MDWA 5LJ5d 1SYCA 4ZGDB 3V7SA 3FKIB 3A8KE 1XYIA 3BVGA 4JRKA 5C0XI 4C8QB 1V29B 4KKTA 1Q7YC 1HRJA 2EDGA 1I4K1 3OYHA 1EY9A 1HTLD 5I6YA 1S5FD 2L11A 4NDXA 2DTIA 2JZ2A 1YIJA 1PXUA 1RCVD 3BG3A 1DOLA 2NLUA 2F0SA 2L55A 3Q6SA 2VGMA 3CCQT 5CVIA 1C4QA 1AHJB 3D4WA 2Z4IA 2XVSA 4BS9A 1N6AA 3OW2S 1UB4A 1MSHA 1QP2A 3V2TA 2K4YA 1SNPA 2RO0A 4HT8A 2ZXOA 1C48A 1TVXA 1VMPA 3GTOB 2XSCA 3PMIA 2Y0SB 3CBOA 3ZBDA 3META 2DTHA 2FMMA 4C92E 5DY9A 1WTRA 2NB0A 2PYKA 1SE3A 2FHDA 2M16A 4DA4A 3OSOA 3X3MA 4KBMB 2RJFA 2BDNA 2KVMA 3LX0A 3OYGA 1A3UA 3P20A 3FEOA 1I4PA 4WORA 4IFDI 3CD6T 1JWSD 1OXVA 2DK3A 3OYAA 2X69A 3CPWS 4BY7B 2EY1A 5LJ3h 1AEXA 1EY0A 5FRNA 1ENAA 4DAYA 4N4HA 3Q0AA 1TY2A 1T5XD 2R3ZA 4C3IG 4M77B 5DNFA 3CCMA 5KCHA 1CZWA 2Y90A 3OYDA 1K9MC 2G9DA 4ATOA 1JB0E 1E2WA 2IWHA 4DK0A 5IGGA 2QCPX 3EJIA 4GY5A 3VR5A 1M9SA 1LTAD 4M7AA 1CA5A 1SNQA 3HRUA 4MIUA 1VQOA 1FWZA 3QSUA 1DONA 3MCAB 5ISRA 2RJDA 3JCMf 4G7OC 4IUPA 3H94A 3CCQA 1PMRA 4F7UE 2QQSA 4M75D 4C92G 3TZUA 3GOXA 1H9MA 1HQMC 3AU7A 5EKIA 5M5WB 2CZ0B 3SD4A 5BN3A 2M1HA 3SVMA 4QVCA 2ZZDA 3HPWA 4M78F 5LJ5f 1RF2D 1OXTA 1H9SB 2K3XA 3MHBA 3W2DA 4J6WA 2K05A 3SK6A 2DXCA 4J8OA 3GO5A 1EIHA 2E2IB 3NSWA 1NPRA 1U4PA 2B8FA 3LWEA 5I2YA 4EMHA 3S9WA 1YI2T 1VQ8T 3VR4A 5HK0A 5LJ3j 4GLKA 4BI4A 4HCCA 5AFWA 4ULLA 1JQYD 2B63B 1ESRA 2JTFA 3DB4A 3QWNA 1Q7YU 4M75B 2LNVA 2HDLA 3VYHB 2TMPA 3LWHA 4KY6A 1XQHA 2N55A 4IN3A 2JN0A 2K03A 5ELBA 4D6WA 3PUXA 2IX1A 3KK7A 3TCJA 4PJOF 1HHVA 3I90A 4DOWA 4C8QF 2KVQG 1B44D 1VIFA 3RMQA 3VKIA 1EYDA 3OIPA 1AFPA 2DIGA 3LYIA 2NVXB 3ER0A 3SB2A 2ZPBB 2F0DA 1GUSA 4BE2A 4J1MA 2F0PA 1QP3A 1EYCA 2PCFB 4DAVA 3GIBA 4QW2A 4A3KB 2D0QB 4C0DB 1M1GA 2H3JA 2PNRC 1LNXA 4HR7B 1NZ9A 1EWCA 1I8FA 4KKSA 1O9SA 3L2ZA 1X01A 4L59A 3RESA 5CBEE 4LDYA 4XQJA 3QBYA 1A2UA 3OW2A 2NTTA 2EFIA 4FSXA 4QVDA 2WKDA 4OIKA 1X3PA 1GUGA 2L8DA 2MHVA 3C94A 5A35A 2F0OA 4K8IA 1YI2A 4JRIA 4O5VA 1VQ8A 3G7LA 1A15A 1HK9A 1K9MU 1IZ6A 3HS0C 5CKDA 4B9WA 5KGUA 4M7DF 3A8GB 1I4HA 1Y8OB 3K59A 1JWUD 2L4NA 3X25B 2D2CC 2X6LA 5GAN4 1II3A 5KCOA 3CPWA 2PZTA 4M77F 2VXWA 4BE0A 2EYJA 3FB9A 1C8CA 4AYBB 4XTVA 5COYA 3SWNB 2RA2A 5BN4A 2C9OA 4EMKC 1LTRD 5JEAG 2O5JC 4RCBA 4LJZC 1BI2A 2XD0A 4TRDA 3S2HB 4BBRB 4ABNA 3JB9J 1LTTD 1B4OA 3TSSA 3DWQA 2BUDA 1SE2A 3I4LA 4IUQA 5CR2A 1F9QA 1I81A 5EBDA 3PUWA 3A8MB 4JLIA 2DJZA 3RZDB 5C4XB 3S3MA 1W2BA 2E2HB 3CPFA 4RA8A 3J80E 2HAXA 1QB5D 4CHTB 1VQPT 3HOUB 2MI6A 4C0GA 4OO1G 2BIVA 3WOFA 1K8OA 2E5QA 2M0OA 1G91A 1WNLA 1QG7A 1QNUA 1O75A 3HRTA 2I2LA 3MP1A 2XKOC 3KF8A 2XWBB 4RFBA 2DEQA 1TT2A 4M7AE 5CQYA 4FNFA 1QVFS 1XTDA 2EQKA 1SYDA 1N9RA 2R57A 4HT9A 2P0QA 4CGYB 1GUWA 1CHQD 4PL6A 4JLGA 5C3WA 4BDZA 3PO3B 1Q12A 3OBYA 4MZTA 1MI2A 2LVMA 1BCPD 5K5PA 4A3IB 4IKFA 2XK0A 5FU6C 3HFOA 1PTOD 3M9QA 1ZQ1A 1G6ZA 2R5MA 4Z02A 1JOOA 3MEWA 4M78E 1M4VA 4R55A 4WJWA 3P8BB 3S3NA 2OAUA 2I07B 2F4IA 4J8QA 2K5FA 5CKEA 3M54A 5IAYA 1TR5A 3NTKA 3CCJT 4BACA 3BZDB 5CV4A 2X4WA 3CC2T 1PDQA 4Q5WA 4ZGJB 3C46A 3QJ6A 2Y4XA 2EQMA 2EE1A 2DPPB 3OYJA 1VQNA 3E5SA 5C3EB 2Z4HA 3TEEA 3NWSA 1PFMA 1U4MA 4QQ6A 3Q1JA 2OT2A 3L2UA 1VQPA 1RTNA 1IW7D 4M7AG 1KC8C 1BCPC 1DJ7B 2O01E 4NKLA 5FU7C 3M7GA 1EZ6A 1PTOC 4PJOE 2ZCFB 1DZ1A 4KUIA 4GZYC 1Q82C 3LX7A 4FP5D 2F0HA 4F7UB 4NS5A 1YHQT 3D4DA 4H0LC 1TWAB 4ME5A 3HOWB 2M9VA 1JE4A 3HEJA 1WJQA 3SK4A 4IALA 1QVPA 4KHZA 2NUCA 3PFSA 2J0TD 2ZPGB 2AUJD 5EG2A 4HA8A 5KNCA 5EQ0A 4V2SA 1R9TB 3QZ5B 3BDCA 3SR1A 4VUBA 1M90C 4L63B 3MXNA 5IT9L 3ME9A 5EGTA 1STGA 3VYRA 2O4XA 3JCMW 5KE3A 5A0GA 2F0GA 1RDPD 1U9RA 1PYWD 3CCJA 2L3RA 5CCAA 1O7LA 2JSOA 1J9OA 3CC2A 4RCNA 4ILWA 1JWMD 2RK2A 3MAQA 2KCNA 2EJGC 3PV0A 3JB9I 3INZA 3C12A 3NBHA 3I73A 3MVVA 2K33A 3UT1A 1Q1BA 1YITT 2OTJT 1VMCA 1S4ZA 1TKWB 4TKOB 4XTZA 3R2IA 4HKEA 5GAMe 3MXGA 2RHXA 5CR3A 3BYYB 2YYZA 5JEAJ 5K36G 3V05A 1WTPA 2RH2A 2CW0D 3IKJA 4C56C 4XQQA 4NOYA 1YHQA 3URGA 1ENFA 5CKBA 1NUCA 3SK5A 1B34B 4LDXA 2K7VA 3CXCS 2Y4YA 4JK1C 1X32A 4HCSA 5KRUA 3V8KA 3X20B 2ZXPA 4K6DA 4KTAA 3E1SA 3CCLT 4FXDA 4FYDA 4IUUA 2RB6A 2RHIA 5KYLA 3V7CA 3GTKB 1QVFA 3QKJA 3OS0A 4OGEA 3DWAA 3S6WA 3L7ZC 4C92F 4FT4A 5JEAH 1EU3A 1EWHA 3A7AB 3BDOA 2RHYA 4DNRB 1UGSB 4PMWA 2A5HA 4RG2A 1STBA 2KJXA 3HRZC 2DN8A 2HCCA 3TMEA 4XTYA 4HEDA 2ICIA 4ZGEB 2B2UA 4FF2A 4QVZA 1KC8U 1AZQA 2BA0A 2F0NA 1F9SA 4R56A 4OO1H 1JR0D 3VJPA 1LLRD 2E65A 2GCXA 1N9SA 4RCCA 3I56T 1Q82U 1YITA 2OTJA 3CCST 2GQVA 5GAMg 1G8ZD 2MPMA 1KDCA 5HKCA 3LGLA 1X6OA 4ZK9B 3S2DB 3NP8A 4J6XA 5C6SA 2AQ2B 4A93B 3RD4A 3J7AV 4S3SA 2KEEA 3FVQA 3H3VC 3MZ5A 4ZRZA 2PUKB 3C1EA 4P5NA 1BNZA 2QKIC 3A8LB 1YCYA 2PMZB 1PFBA 4BD3A 2LMCB 3MHXA 1PSFA 5J39A 1Z7TA 1G2SA 1M90U 4ZKBB 3CCRA 1FYCA 2JA8B 2JUFA 4J7FA 4E47A 3AB9A 1VUBA 3W3AA 2F0EA 4HMIA 5TSSA 1E2VA 5DEHA 3E0JA 5FOBB 3QJYA 2E12A 4OB0B 4M7AB 1BF4A 1U4RA 5CORA 1HUNA 4J83A 2FMCA 5J1ZA 1YNJD 2XDDA 1SE4A 2B39A 5CYUA 1TS2A 1SSOA 4BA1I 4TSSA 1CM9A 2DNCA 4M78B 4G7HC 3FJPA 2L1BA 4LDVA 3OSVA 3SEBA 1KQ2A 4C8QD 1SMYD 2BE5D 1B3AA 4FF4A 1BYMA 2QDBA 3I56A 5D3IB 2EIFA 1OI1A 4XTCS 5GMKm 3CCSA 1W6KA 4XU2A 2DZ9A 1TWGB 4O6JA 2MWOA 3UWNA 1KDBA 5D65A 1BUVT 1I3QB 3UPUA 4A3GB 2E2JB 1YJNT 4A54A 3BY7A 5CKFA 5C0MA 5KH6A 2EJGA 4HSPA 1N8RC 5D14A 3UDCA 5GAN3 2HQXA 2JA7B 1A2TA 1ZYRD 4H13C 5ELEA 1MSGA 2WKCA 4BI8B 1UUPA 1I4XA 5LJ5j 1HFGA 2ZPFB 5A0LA 4K14A 1YNJC 3DMUA 3LGFA 4DQ2A 2JOYA 2NN6I 1CFMA 4L5GA 3CBMA 1DOKA 3D4RA 5JOBA 3GTMB 4PJOB 4OGCA 3JCMV 3P8HA 3KBXA 3R8BA 4C0FA 1GUOA 4XT1B 3CXCA 4C8QC 2F3VA 1PFNA 1VDZA 4Z9CB 2LTOA 2XNAC 4OB3B 5GAOl 1SMYC 2BE5C 3PUZA 2D9TA 4JRPA 5EKLA 1OXXK 1DD2A 1UEAB 5G3LF 2E1HA 2Q8IB 1BO0A 1CQFA 3QYGB 1JRIA 5CBAE 1G3SA 3CQZB 2MGSA 2PZUA 1LV9A 2NYZD 3FDTA 4C0ZA 3ND9A 1BXTA 3S1RB 4N4GA 2MMPA 1Z6HA 4DA2A 2E41A 4M77D 3A8IE 2GF7A 5ELDA 3BFMA 1ZYRC 1DM0B 3AHUA 1PLFA 2B2WC 4OMFB 3JSCA 3S1QB 1OXSC 1HA6A 2O2LD 3KLRA 1ZHIA 1NE8A 2IVWA 1O7ZA 5K36H 1LTSD 3M59A 4RGOS 1D3BA 1HQRD 2IT1A 4HCBA 1F77A 3NWTA 4N9TA 4OL7A 4CKBA 1G2TA 1YNND 1YJNA 5C6AA 1BI0A 3SDZA 5A2QE 3R3OA 4M7DB 2VV5A 2X4JA 1FGBD 2OF1A 1D5MC 1KAAA 3OHXC 4MZPA 3RZOB 1FD7D 2XRQD 2G9HD 1DYQA 2HQEA 2JA6B 1Q3LA 1V1PB 2E64A 1MBYA 2HD0A 3H6MA 1HFNA 2WP8J 1KD1C 1NR4A 2F0WA 3QOJA 4RMOA 5FLXE 4M77C 1FNVA 2I46A 2LKVA 2RDFA 3WVDB 2RJEA 3L2QA 1ICWA 5C4ZA 1OXUA 3FPPA 2WIIB 2LCCA 3T4AC 3OYEA 3J80L 1H641 4C5GA 3QPHA 4II1A 2V8IA 4M7AF 3I3CA 5D6YA 1QWYA 2L5QA 2EJFC 1YNNC 1EY6A 2PQWA 4XU1A 1M1KC 1D5ZC 1HTPA 1Y1VB 4HSVA 1BIBA 1TH7A 2CZ7B 5GANe 2XDBA 2A73B 2CHBD 2EYMA 2F0IA 4L8JA 2PPBC 1EL0A 3GTGB 3BDUA 2JVVA 3MXUA 3K5LA 3ERQA 4DAPA 3NXWA 1IYUA 4XT3B 4IUTA 1B2TA 1N8RU 3PMTA 4CKCA 4FIBA 1QVGS 4RG8A 4LD9K 1OZ2A 3I55T 3I91A 1MD2D 2YLCA 1WPYA 2QDYB 3CD6A 2IX0A 2B2TC 2PW5A 4FL6A 2DXUA 1F2MA 4C3JG 3CC4T 4DK1A 4HTHA 4LMQD 4KY7A 3NTIA 5IGEA 3WDNA 4IZ8A 1VQ6T 1I4QA