4B9WA

Structure of extended tudor domain td3 from mouse tdrd1 in complex with mili peptide containing dimethylarginine 45.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
196
structure length
196
Chain Sequence
LEWTWVEFTVDETVDVVVCMMYSPGEFYCHFLKDDALEKLDDLNQSLADYCAQKPPNGFKAEIGRPCCAFFSGDGNWYRALVKEILPSGNVKVHFVDYGNVEEVTTDQLQAILPQFLLLPFQGMQCWLVDIQPPNKHWTKEATARFQACVVGLKLQARVVEITANGVGVELTDLSTPYPKIISDVLIREQLVLRCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The multiple Tudor domain-containing protein TDRD1 is a molecular scaffold for mouse Piwi proteins and piRNA biogenesis factors.
pubmed doi rcsb
source organism Mus musculus
molecule tags Replication
molecule keywords TUDOR DOMAIN-CONTAINING PROTEIN 1
total genus 46
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00567 TUDOR Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4b9wA02
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4b9wA01
3OS1A 3OMCA 1EY7A 2O4XB 2F0UA 2RO0A 1WJQA 3PMTA 2F0WA 3FDRA 3EROA 5DAUA 3ERQA 1EY6A 4IUQA 3S3MA 1JORA 2PZWA 3QB3A 2RHZA 4IUTA 1EY4A 3S6WA 2EYMA 4N9TA 5EGTA 4IZ8A 3P75A 4N4HA 5C4HA 2RI5A 3LGFA 5IGDA 5C0MA 4B9XA 3FC3A 4EQPA 2RI3A 1SNQA 2OF1A 3D4WA 5IODA 4IUVA 5IGEA 4RG2A 2YRVA 2F0IA 4BACA 5K5PA 1KAAA 1JOKA 2SOBA 2IG0A 2LVMA 2EFIA 1RKNA 5J22A 3LX7A 1AEXA 4X34A 3D6CA 4E7IA 4S3SA 3OSOA 5KRUA 2QDBA 3BDCA 3LGLA 2G3RA 5KEEA 4QQGA 3TP7A 4E7LA 5M9OA 3OY9A 4RKLA 4F8MA 5CC4A 5IGBA 3OMGA 2RI2A 2LRQA 4I65A 4DU9A 1WJRA 2F0GA 2XK0A 2P0KA 1A3UA 4TRDA 4BDYA 4E7KA 4K2LA 3META 4K5XA 2LDMA 2EY5A 4DGZA 4FL6A 4J6HA 2SNMA 3OYDA 2L3RA 4KY5A 2F0PA 3P8DA 4BE2A 3E9FA 4IUPA 5KE3A 5DEHA 2XDPA 2EKOA 1RI0A 1OYXA 2EY1A 2QQSA 3T13A 4C5IA 4B9WA 1STHA 1JOQA 4K8IA 4HCZA 4L59A 1II3A 1SSFA 4C5HA 1OZ2A 3OYNA 1SNMA 3T16A 3QIIA 1A2UA 3OQ5A 2F0SA 2LKVA 4FU6A 2JTFA 2F0TA 1SNCA 3H6ZA 3MVVA 4F7XA 4GY5A 4KV6A 5ISRA 3HEJA 4NP5A 5CV9A 2F3WA 2M00A 2GF7A 3DMUA 4K2KA 3O8VA 2BKDN 3E5SA 3NTKA 3MO8A 5CV4A 5CV7A 3NP8A 4LD6A 3OA6A 1SNOA 3OYJA 3OWFA 3LYIA 2RJDA 1A3VA 2EY6A 3NTIA 3OYFA 2F0KA 4KHVA 4PMCA 2RDFA 2PQWA 3ME9A 1EY5A 4KD4A 5CIUA 4MIUA 3OYKA 3OYBA 3CEYA 1F2ZA 5E3FA 4BE0A 5IIFA 1A2TA 2DIGA 4NKLA 3KUFA 1STBA 2R5AA 4UC4A 4K5VA 1OI1A 1NUCA 2F0OA 4HMIA 5KH6A 3V2TA 4A4GA 2M16A 3L2UA 2EYPA 3HZXA 2F0EA 2M1HA 3MXPA 3L2VA 1WGSA 2PYKA 3DHQA 2EQUA 3TP5A 2FHDA 2PW7A 2KHSA 1SYBA 1U9RA 1STAA 3MP6A 3NXWA 1EY0A 3FLGA 4EDUA 2NLUA 5D6WA 5C6AA 4K5WA 4Q5WA 1SYDA 4A4EA 1STGA 5IGCA 3L2RA 1TQOA 4H7BA 2R57A 4IUUA 2X4YA 2OXPA 4KTAA 4QF4A 2JZ2A 1ENCA 4WORA 4HMJA 4NDXA 3L2WA 3H6MA 4QB4A 5C4ZA 4BDZA 3SHLA 2F0JA 4QQDA 1XNIA 2F0QA 2PZTA 5J1ZA 3MEVA 4Z02A 4E7JA 1KDBA 4YIJA 2K3YA 3C1FA 2EYHA 1MHNA 4PL6A 1EYCA 5KYLA 1KABA 2F3VA 2K3XA 3GOXA 2D9TA 1EZ8A 4KY6A 3NHHA 4PMBA 4ME5A 4A4HA 3L2QA 4N9PA 5IGFA 5D6XA 5KYIA 3P1HA 1F2YA 3ITPA 1SNDA 2F5KA 2NUCA 3OYGA 3OYIA 2EY2A 3M9QA 5KE2A 4C5EA 5KCOA 2OEOA 3MEAA 1EY9A 5IAYA 1OZ3A 4DF7A 5C6SA 2EYFA 4ZQ3A 4N4IA 2DIQA 2EQJA 4ODGA 3LLRA 3MP8A 2HQEA 2BIVA 3NTHA 5JAVA 2EYJA 2KQ3A 4KJNA 1H3ZA 3QBYA 4J1MA 1SYGA 2MWPA 3H8ZA 4II1A 1KDAA 2WACA 4ID6A 1A3TA 3TMEA 4IKFA 4RKBA 3SK6A 2RBMA 3DB4A 2E5QA 4NS5A 2SNSA 2RJFA 5F2DA 3PMIA 1SYFA 4IUNA 3MEUA 3C1EA 3PFSA 5NUCA 5HGTA 2L8DA 5FRMA 3OS2A 3EVQA 4KD3A 2EQKA 1EY8A 2HQXA 1KHCA 4WRDA 4HTHA 3S3OA 2L89A 2RJEA 3BDLA 4EQOA 4ZUIA 4QQ6A 5J39A 3PNWC 4ZTFA 2LTOA 1STNA 4CRIA 3OYHA 2QQRA 3FEOA 3RUZA 5CR3A 3OS0A 1TR5A 4LAAA 3OYMA 3D4DA 2F0HA 4K8JA 1SYCA 4C5GA 3D8GA 5CV6A 2EQMA 2EYOA 4BD3A 2EYLA 4EVOA 5IN1A 5E1FA 4PNYA 3PMFA 1EYAA 2F0LA 3F70A 4E7HA 5D6YA 3QOLA 5C3XA 4K6DA 3S9WA 3EJIA 4OL7A 5C5LA 2O4XA 5I9OA 3MP1A 3LH0A 2DAQA 3VA5A 5C3WA 3OB9A 1N27A 5IGGA 4ZUJA 4BE1A 3SK5A 5KCHA 3OYEA 5HURA 5JOBA 3S3NA 4IURA 5J26A 4R8NA 2RHYA 3ZEHA 5I6WA 5KIXA 3OYCA 3TP8A 3OYAA 1G5VA 1WJSA 1JOOA 3DLMA 4PLIA 2RJCA 5CV5A 1EYDA 4IALA 2CKKA 2M0OA 3SXHA 4K14A 2PW5A 4QVZA 1EQVA 3MZ5A 5CGKA 2GFAA 1TT2A 2GFUA 2PQEA 2PZUA 3SK8A 2RHIA 5EKLA 5C5MA 2LCCA 3DB3A 2VYTA 3MHBA 4E6IA 3E9GA 5IOCA 2F0FA 4KY7A 2B8AA 3SR1A 3QJ6A 2R58A 4ZTJA 5I6YA 4OVAA 2RKSA 2RHUA 3SD4A 2F0MA 3L42A 3ASKA 4NMZA 3NQTA 4N4GA 3UT1A 5FRNA 2F0NA 1STYA 5KGUA 5I9PA 1ENAA 4EQNA 3NUCA 3P8HA 4QW2A 2X4XA 5EKKA 2MWOA 3UWNA 3C4SA 4DFAA 2EXZA 3QKJA 1IHZA 2R5MA 4A4FA 1SNPA 2F0VA 5CV8A 3NK9A 4G57A 2BUDA 1F2MA 3U9OA 1EZ6A 3EAEA 3MEHA 1KDCA 2RHXA 3OYLA 3TP6A 3Q1JA 3R3OA 3SK4A 2F0DA 2E6NA 2ENBA 3MEWA 2X4WA 4PLLA 4KJOA 5FROA 3LX0A 2X35A 1SYEA 3QOJA 1NSNS 4QMGA
chains in the Genus database with same CATH superfamily
4AFQC 4C3HB 3EG1A 4IIMA 4RMFA 4X3UA 1V76A 1RD9D 3PMTA 1NPRA 2ZJPA 3EROA 1YJWA 3CKIB 4MDWA 5GAMd 5ELEA 2LZ6B 4M75F 4IUQA 1I6HH 3MXNA 1JORA 5JJIA 3QB3A 4C8QB 3FJ5A 4IUTA 5CQYA 1EY4A 3PT9A 1UE6A 3S6WA 1G3TA 2BA0A 1M4ZA 3HOUH 2A69D 5GMKm 5I4DA 3GTMH 1E6HA 4MN3A 2XGTA 4XDXA 1NE8A 4ELYC 4N4HA 4ZNXA 4CJ1B 2DL3A 2MCNA 2K1BA 2RHQB 1HNZQ 3C2PA 2HEQA 5GAMg 3CCQT 4JOIC 3HOWH 2HHHQ 4DA4A 2A8VA 3CC7T 1SNQA 3X3NA 3VA7A 1KTKA 3MHXA 4DUYQ 3S1QB 2C0OA 2DVJA 2E3IA 4LDUA 4M78A 1KQ1A 5C44H 1N9RA 3GTGB 1V1PB 1K0RA 2YRVA 1ZLMA 2I0QA 1UJYA 1BIBA 4LD9K 2JN4A 3I3CA 4YCUA 5ELBA 3NPPA 3CMAQ 1KAAA 1JOKA 2SOBA 2IG0A 2KNBB 4XQJA 1RKNA 2BH8A 2D0PA 5FKAC 4KGVB 3PQIA 3PO3G 1L2FA 3D6CA 3AFQA 4RTVA 1U0LA 2VB6A 1KJWA 1AT1B 2GQVA 1XMOQ 3DM3A 4RG8A 3EG9B 4YWKA 1IBKQ 5I22A 3X24B 1VIFA 3MTSA 2PCFB 1WHHA 1Y07A 1WI7A 2CUBA 5G3LF 4JI4L 1G3SA 1N5ZA 3JCMQ 3OY9A 3L0OA 5A2QL 1RAEB 4HKEA 2KRMA 4PJLA 2IW3A 5CC4A 2CP6A 3M4PA 4DR7Q 4A3CG 3DUZA 1WTQA 1IHWA 4JLIA 2A68C 5IYCG 1WHKA 1SJED 3G71A 2DBMA 3F8TA 2JN0A 3GPLA 4TRDA 2LJ1A 1YWOA 2NTTA 3M0QA 1HHVA 4P74A 4E7KA 2FL7A 2DMOA 1W3SA 2NWGA 3A56A 3NE5B 4CKBA 1IHVA 2R7ZB 2EY5A 4OIJA 1LTGD 2RK1A 2Q2IA 1QP3A 2DM1A 2K5QA 4LFAQ 2B63H 4OEMB 4DR5L 1D8LA 2MP1A 2UUCQ 4MHEA 3CCET 4P72A 2F0PA 4RUGA 4P2CB 1HNXL 2L3PA 1T0JA 5KE3A 2PVGB 1S72A 2OX7A 4A3MB 4BBSH 1GUSA 4JRKA 2FFKB 3KF6B 1IL8A 1QKWA 4IPCA 4FYXB 2Z6KC 1XNRL 3FRNA 3HPWA 3T13A 1K8OA 3HOZB 2CH4A 4ATOA 3GP7A 3CC2T 3HOXG 4OWXB 5I2YA 2GGRA 4B3RQ 1JOQA 4K8IA 1QP2A 1CA6A 4BA2I 1ET9A 4LJZC 1II3A 4J6WA 5GAN6 1B3AA 1H9RA 4PZ7A 1EEID 1FGBD 1JJGA 2B63G 4R4OA 3T16A 2DJFC 2G9DA 1A2UA 4A3JB 3VU3C 2JA7H 4JI8Q 3S1QH 2Q8RE 3I8ZA 2LKVA 4PQXA 2JTFA 2Y0SB 4BS9A 2F0TA 1ICFB 3GTKH 2K01A 1Q95G 2HKNA 1VQ6T 1IRXA 3M0RA 4JUVA 4X6AH 4BBSG 3I72A 3I73A 3R2TA 2QILA 5ISRA 3I70A 3JC66 5CV9A 1N9WA 1PG5B 2GF7A 2GTJA 3G6JB 2BKDN 1RL2A 2OCEA 3A54A 4CDEC 4KN7C 3M4QA 1TIID 2I46A 3NTKA 2VY3A 4FYVB 1AZEA 4M77C 1JR0D 3GNGA 5IYDH 2DD4A 5FU7C 1WJJA 5CV7A 3HHTB 4C0GA 4LUVA 2F69A 4J9EA 4LD6A 3OA6A 5GAOl 3QWXX 1AW7A 3LYIA 3TZDA 4F7UB 2RJDA 3TCJA 4RAUC 1GFDA 3OW7A 4Y7NH 4LFCL 3OPOA 4BBRB 1Z9QA 1TS4A 1I4GA 1YNND 2VQFQ 5CIUA 3S1MB 3HRSA 1MV3A 4MIUA 3QYHB 4N0AC 2UUAL 1NEBA 4F7UA 3OYBA 1F2ZA 1I1JA 2WKDA 1ABQA 4YTLA 5I2MA 2WB1G 1D0YA 2I5LX 2RQVA 4M78E 2R5AA 3RESA 2LXKA 2Y0SG 2X3WD 1ENFA 4BY7H 2Q2TA 1Q7YU 4DV3L 2O31A 4M78F 1Q86R 2EYXA 1KHIA 4MDXA 1SAPA 3V2TA 3HOYG 1U4RA 2E6ZA 2F2WA 5GAN2 3CP0A 1R0BG 4OGEA 4XAXB 5M3MB 2WSEE 4ZGJB 2PYKA 2K7AA 2E2HH 2EQUA 1CSKA 1GRIA 1BU1A 2PW7A 1JB3A 2A08A 2ABLA 2GN5A 5EC7A 2L0AA 3VR3A 5CKBA 2OQ0A 4AYBB 5LMNL 4C92G 1SYBA 1N36Q 1TVXA 4KHPQ 1SE4A 4QUCA 4DAMA 2NN6I 3G1JA 3RNJA 3NXWA 3H0IA 1D5MC 2JA6B 4EDUA 1TKWB 2DILA 6AT1B 3I55T 4A3MG 4OX9Q 2CZ0B 1WCMG 1SYDA 1VQ4A 4K0KL 4BY1H 3GTQH 4A4EA 1I50B 4JJBA 4IOAA 4X62L 2L3SA 1TQOA 3GTJH 4X65L 1KC8R 1H92A 3K80C 2OXPA 2OWOA 2P0PA 1YJWT 2IVWA 2F1LA 4DBQA 2M9VA 4HMJA 2DL4A 1V1CA 2UUAQ 3H6MA 4QB4A 2JYOA 4OMQA 2UXDQ 1ET6A 2NWMA 3A98A 3HGBA 1X3EA 4CDFC 2ICEC 4QQDA 1EFID 1QVGS 2H5XA 3HOWG 1B07A 1H3HA 1ZUKA 1KAWA 2DN8A 3TDQA 1QB5D 2PZTA 5BR8L 4OB3B 1Y96B 4Z02A 4E7JA 2DL5A 3P20A 4RFBA 3T1YQ 1CI3M 1KDBA 2EXDA 4BBSB 4YIJA 1SSOA 2K04A 1XMQQ 1YHQT 1OXUA 1MSGA 1RIPA 2EYHA 3CCMQ 1Y8PB 1QE6A 4JBJA 4BY1G 1GKHA 3BZKA 2OI3A 3ER0A 1E2WA 2V4DA 5FJ8G 2VKNA 2DXUA 2ZCFB 3H3VC 1VS0A 3RLNA 1J8IA 1VQ8Q 3GV3A 1JU5C 1B34A 1KABA 3HRTA 2QQ9A 3RLFA 1OPKA 4HJ5A 7AT1B 1PKTA 2K3XA 3GOXA 3JAMc 4FXDA 1HSQA 1DOKA 1VQPQ 3OS5A 2XNAC 4DV4Q 2X9HA 2FZKB 3MWYW 1AWOA 5M3FH 3VRYA 5LL6X 1W70A 1JB0E 1E3PA 3BVMA 1OULA 4XTVA 3I90A 1Q7YR 1M1KR 2RPNA 4A4HA 4LF4Q 3Q24A 1L1OC 3FEWX 1VQDA 4MTKA 2HT1A 2MJ8A 3T1HL 2EYYA 3OYIA 1HZAA 1XTCD 1WD1A 2WSCE 2K2MA 1PYBA 2GA4B 5GJWB 5KE2A 1R8OB 5KYWA 4JRQA 1LPLA 2O9VA 2FYKA 4KH1B 3WXMB 5FLXE 5LJ3g 1JXOA 2OEOA 3D31A 3K5NA 1VIEA 2A6ED 4A4IA 1UHFA 2CWAA 5GANg 4DF7A 1Q3LA 1SFOH 1HXYD 1JE4A 1T5XD 3NEMA 3NFCA 3RMQA 2DIQA 3JB9J 5DLQE 3HFZB 1JJCB 3AYHB 2BIVA 5C0XI 1Q1EA 3HKSA 4C8QD 4CJ2C 1ZBJA 1KNEA 2RVLA 4JI7Q 1JO8A 2IL8A 4B3RL 1L1OB 4DNRB 4NB3A 2RCFA 5M5XH 2HL3A 1SYGA 4X3SA 2M0YA 4X66Q 1SRMA 2KXDA 3H8ZA 1H95A 3JB9I 1KDAA 5IP9G 2VW9A 5EKIA 3FIFA 1HRJA 2RCNA 2Z9HA 1VQOA 1A3TA 4M75A 1KLGD 3SK6A 4GKJL 2OAUA 3DB4A 4AG2C 1YP5A 4ZCKA 1IL2A 3VS4A 3K6OA 5F2DA 1BUVT 1N33Q 3GIBA 4IUNA 3FP9A 4HIKA 4A3KB 4LF9Q 3MEUA 3PFSA 5NUCA 4PFOA 2VS1A 2QAZA 3SFMA 4HJ9A 3R2IA 1UEBA 2D8HA 3HP9A 1PZKD 3EVQA 2OJ2A 1MD2D 5IHNA 2EQKA 4EMKA 2PPBC 4P75A 1Y69U 1A8VA 2Y0SE 1AFPA 1I81A 1T3SA 3LH5A 2LJ3A 4ABNA 3TN2A 1U1SA 4ZUIA 3X26B 1Q86U 1X2KA 4ZN3A 2IHFA 4R4QA 3RERA 1STNA 4EMKB 4CRIA 1ML0D 2PNRC 4RGOS 1TU2B 1XPRA 2ED0A 2HD0A 3LGJA 2QQRA 3S1NB 3V8KA 3RUZA 4A93H 2K52A 1D1CA 4MZTA 1CKNB 3BU2A 3FMCA 3MCAB 3TS2A 1M9SA 1S72Q 3R6NA 1TY2A 4K8JA 2B29A 1TUDA 4C92B 1G51A 4F14A 2EYWA 2GTOA 1PZID 3B6YA 3UI2A 2NVTB 2EQMA 3AMUA 1HFNA 4BD3A 4M7AC 4EVOA 1K8AR 1HZ9A 1TWAH 4DV0Q 3SHWA 2NYZD 2EKHA 1PXUA 2K5DA 3PMFA 2BH2A 1H9JA 2CQOA 1JCKB 3F70A 3JB9H 1V29B 4OIKA 3HOYB 1C0AA 1K83H 2QGQA 3EFOB 5J3BA 4ELZC 1QUQB 4BB7A 5BR8Q 2LQ8A 4E47A 2HZYA 4OL7A 4DV1L 1VYTA 1ZQ1A 2E65A 2EWNA 3CCVA 1B9MA 2ZT9C 3KLSX 2E2JH 1EIYB 2D0NA 3OB9A 5I11A 1VQMT 1N27A 1LTAD 3T1HQ 4L6TB 2A68D 3SK5A 5KCHA 2QEJC 2UU9L 2K75A 1I6VC 1R77A 2L3QA 1I4K1 1HD3A 1YN8A 4M75D 2YTVA 1VQGA 1EIGA 4MMKA 2Q2UA 1PC0A 2JTMA 3LWHA 2RHYA 1Q82U 3STBC 5I6WA 5HK0A 2DA9A 1K3BC 4OMMA 1ASZA 3OYAA 1QWEA 5LMUQ 1Q81U 4OX9L 1M3AA 1ZA1B 1M8AA 4R4CA 1PWTA 1X65A 2GQIA 2QGGA 1JOOA 4O0AA 1I3QH 2HD3A 1WTVA 3HFOA 4XU3A 1DOMA 1PTOH 4PFPA 4RA8A 2P4TA 3M85A 2D6FA 2XIWA 4DK3C 3BZDB 1Q82C 1W4SA 1PH3A 3T9NA 2Z0WA 2D5DA 1W6KA 2ZTEA 3Q23A 4DR1L 1ICWA 2E12A 1EZZB 2FINB 2KY9A 1LV9A 1MI2A 3SXHA 1NLPC 1JRIA 1MJEA 2HQLA 2LQKA 4QVZA 2EPBA 2L0CA 3FKIB 3P7JA 2JMCA 1VQ4T 1TT2A 1PH5A 4DAPA 4C3IG 2XRSD 1WTXA 2DK3A 3CC4A 3E6ZX 1WA7A 4A3FG 1VQPT 2XDBA 2PZUA 3TSWA 2N3SA 3CRLC 4NL3A 4D8DA 1H641 1C4QA 2MGSA 4IJHA 3I4MG 5KNCA 1Q86C 2YRDA 1ZEQX 5IP7G 2B63B 3PO2B 2D1XA 4GOPB 2J05A 1WXBA 1BCPD 3SR1A 4JYAQ 4MTNA 4ZTJA 2VGNA 1VQOT 2COWA 3K5MA 3SD4A 1U1TA 1CT1D 1D1IA 4IQZA 3VS5A 2V8JA 3L42A 1NMGA 3R8BA 2KT8A 1PSEA 3S15H 4IFDH 2E5LQ 3V05A 5LMNQ 2DLPA 3QO3A 5KYYB 4MNOA 2CWPA 5BN5A 1ENAA 5M5YH 5LMUL 4Z8AA 3KLWA 4KGZB 1Y8OB 3P8HA 1WQWA 1EX4A 2QDLA 4LF8L 2LQWA 2RHSB 1IYVA 3KLSA 2CFMA 2DE0X 1JC7A 3H3VH 4JI2L 3QKJA 1VQ7A 3VR4A 1UGRB 2L55A 2R5MA 5TSSA 1SJHD 4A4FA 3EIVA 1OPLA 1X43A 2R7FA 4GLAC 4B3SQ 1Q81C 5IYCH 3NK9A 2ROTA 2JJQA 4J6XA 5EJWA 4G57A 2PI2E 2VVKA 1QWFA 2FMMA 3H0FA 2B86A 3M0SA 2A73B 3NMZC 1OXXK 4KGXB 2X69A 4UP8A 2R61A 5COYA 3OYLA 4C1NK 1EL0A 3R3OA 3TREA 1MHWC 3GTGH 2FB7A 2YUNA 3UF4A 4PLLA 1PRTC 4DOVA 2KCCA 2KVMA 4IJLA 1SROA 4YWMA 2JT4A 5FROA 2QDYB 1GHKA 3V8JA 4QMGA 3GTQB 3OS1A 1UNSA 2VQEL 1TY0A 2O4XB 1A0IA 2RO0A 1WJQA 1S72T 4J9GA 3V96A 2CT4A 5C4JH 1GUWA 3R6OA 1H9KA 2E5KA 3E0JA 2YLCA 4NOYA 4B6MA 3PV0A 2OTLA 4FVMA 1T3LA 3S3MA 1WYDA 5L8RE 3EFXD 3CPWS 1KG1A 1HFGA 2MQHA 2AWNA 2KR3A 3A1PA 5EGTA 2KROA 1VQEA 2LNVA 3CC4T 4HCCA 4GLXA 1RACB 1SHGA 4LF4L 4UP7A 4DXGA 3LGFA 2K57A 2P4RA 5C0MA 3FC3A 5GROA 2NUTB 1FJGL 4KRTA 2RI3A 4M7DF 3QIAA 4EMGA 3CXCS 5CK9A 2PU9B 4DR4L 5HK3A 1NMFA 5IODA 3H3VI 2C0IA 1HJDA 4M7DE 4IUVA 4XU1A 3J81j 4LF6Q 1WD0A 2NUPA 3G4SQ 5H1SE 4F04B 2QTVA 4BACA 1YITQ 3RLOA 2HQHA 1X01A 1XNRQ 4JBKA 1O7LA 2COZA 3RMHA 2LVMA 4WCIA 4XTUA 5GAN7 2MK5A 1PH9A 1U4LA 1PH6A 4DK1A 1HPCA 3EFOA 2W10A 3VYUA 4UDUC 2A6EC 1SBBB 2NUPB 2RM4A 2A19A 2A74C 4DQ2A 4DK0A 3RMSA 1D1KA 5KRUA 2DRMA 1I4RA 1I5OB 3KF8A 3BDCA 4JI6Q 3DXJC 1PNJA 3KBGA 1F9RA 1C0MA 2FEIA 2L5TA 3LGLA 4M7DB 2EJ9A 5HKCA 1K3RA 5IYDG 5KEEA 5JEAG 1WDXA 2A36A 4M77A 4E7LA 4FSXA 3HOUG 5JJKA 2EVBA 4Y7NB 2CKZB 4A93B 4XU2A 1YI2Q 3CCSA 3CRKC 4GS3A 4RKLA 5DM63 1Q12A 4QIWE 1YBYA 2PMZB 1EU3A 2X6GA 2J6KA 3H94A 3OMGA 2BDNA 2LRQA 1GUGA 1K9AA 1OQKA 1Y8NB 1AHJB 3VS3A 4WTOB 1XXGA 4DU9A 5GAN4 1WZOA 2XK0A 2P0KA 1A3UA 3G71Q 4RGTA 4LDYA 3PTAA 4BY7B 3CCEQ 3PIP3 3GV6A 1I4XA 1S4ZA 4K2LA 1AZPA 1GUTA 1JBMA 1HR0L 1Y57A 4K5XA 2LDMA 4OB1B 4JCVE 4DGZA 4FL6A 4GN4B 2WAQE 4J8QA 3PIO3 1PRMC 1LYLA 3J7ZC 3OYDA 2L3RA 4KY5A 3PO3H 4F87A 1UG1A 3S1RB 1BCPC 3JB9D 3MA2B 2DL7A 3E9FA 3QYGB 3LNNA 2EBPA 4R8IA 4POGA 4NXNQ 2JEBI 4B3ML 5DEHA 2MI6A 1NE3A 3S17H 1RCVD 5GAOn 5FOBB 1VQ8T 2YU9B 1NG2A 2MO0A 4YY3Q 2C5CA 3M59A 1IGUA 1OXSC 2QQSA 2P0QA 1FGUA 3I4MH 1KQSA 4C5IA 1KC8U 4A3JH 5A2QE 2KSSA 2AK5A 1GCPA 4PJOC 1BR9A 1VQ9A 1S5ED 4BUGA 3S16H 1OO9B 4PJOD 1TWHH 4L59A 5M5XB 5GMKh 3BFMA 4GOPA 2ES2A 1B53A 2A37A 4JVZA 1SSFA 2DNCA 2L1BA 5DNFA 1OZ2A 1HTLD 4F7UF 1YHQQ 2AKWB 4DR3Q 3RUXA 1J3TA 4DV0L 4LNQA 2JA8H 1HNWQ 2CQAA 2Z4HA 4JV5L 3CC4Q 4NXMQ 3WDNA 4AG1C 2M51A 3JCMX 4KMUC 1B3QA 1SRLA 1ILQA 1K0SA 3ULRB 1AE2A 5KYNA 1SNCA 1SMYD 3NELA 2AHOB 4UAIA 3TZUA 1X9NA 4BXXG 4C3IH 4LDVA 3MVVA 3CCJA 4F7XA 4GY5A 1B50A 3CCVQ 4DR6Q 3HEJA 3CBOA 1F1BB 4UY8C 1PA6A 2CW0D 3M56A 3TSZA 1UWVA 4L8JA 4LFAL 4DR4Q 2M00A 3DMUA 3L7ZC 4LF6L 1KIXA 4A3LG 4IOCA 3CMAT 3EG2A 3MO8A 2K79A 2KEAA 2KVQG 1NY4A 2KRNA 1PTOD 1ZSGA 1OEBA 2HDLA 2KCNA 3FRPB 4A3IB 4A3KG 1LTSD 5K36H 2BOSA 3I55Q 3EN2A 1IZ6A 4KI0A 2O01E 1UB4A 1TS9A 1G2TA 2QG9B 3QDFA 4H02A 1QVFA 1S5FD 3OYJA 5FO9B 1AE3A 3I35A 3K0XA 4A3IG 1S40A 1M90R 4M7AB 1VUBA 2J06A 1A3VA 1IBMQ 3NTIA 5GMKe 4KHVA 4M7AF 3H9NA 5A0DA 4A53A 4G4KA 4A3GH 4FXKC 1Y1VH 2VWFA 2PQWA 3IFTA 3PUVA 4ZRZA 3I4OA 1VQ7Q 1BNZA 1PFMA 5A35A 1RAAB 3I91A 1N9SA 3VS0A 4JW0A 1F2LA 2AKLA 3SWNB 1RTOA 9ATCB 4M7AD 2FMCA 4JI8L 1Y96A 2G6FX 5IIFA 3RIRA 1TTHB 2DIGA 4NKLA 3U58A 1BB9A 4DK6C 2B8FA 2RB6A 4UC4A 2DO3A 1A15A 1CQVA 1ZYRD 2Z1CA 3CPWA 4RH6A 4XQQA 2I2LA 1OI1A 1JWMD 2GCXA 3UA7A 4HMIA 2F52A 3SVMA 1M2VA 1BI2A 4APVA 4NW2A 1VQNQ 5GAEC 2XMFA 4A4GA 1CQFA 1IO6A 1ARKA 3GTOH 1LUZA 1TUCA 4O2DA 2ZM6L 1Y1WH 2FHTA 4GLMA 1WGSA 1EFNA 2RH2A 5JJZA 2FHDA 1RAFB 2AWOA 1I07A 4AQYQ 2KHSA 4DR5Q 2UUBL 3WVEB 4A76A 2JMAA 2OT2A 5CBAE 2YLBA 4RWSC 1HNXQ 5FWCA 2E1HA 3FLGA 3KUPA 4C1NI 2EDGA 1HXDA 3INZA 3AB9A 2CP3A 4M7AG 4K5WA 1YJNA 4TQUS 4PJOE 3MAQA 1KD1U 4TVRA 5IGCA 1STGA 3GTPB 2OAWA 5KYUA 4JI2Q 4H7BA 1WHJA 2R57A 4BI4A 3O13A 3U4ZA 3K59A 4HIMA 2BTTA 1EIHA 4HEDA 1CKMA 3I2ZA 1G3YA 1YJ9T 3A8IE 2E2IH 3L2WA 2JS0A 4DBRA 2ED1A 4BDZA 3SHLA 3IAYA 1XJWB 1XNIA 4FP5D 2D0QB 1C6VX 4KH0B 5J1ZA 2E3HA 1K8MA 1YITA 4DUZQ 3T1YL 3EG0A 1PCXA 1G83A 3C1FA 1MHNA 4JC0A 4RTTA 1WXUA 1IW7C 3M4OH 4DV3Q 4OMFB 1U5SA 2DX1A 2KRSA 2YTXA 1TWCH 3RZOB 2CREA 1A6XA 4DV6Q 2K6AA 2F3VA 1I6HB 2IX0A 1JQQA 1X6BA 4IPDA 1QILA 2FXQA 1WCMH 1E0BA 2CHBD 1IKLA 2D9TA 2J6FA 1IB8A 2DJGC 3A7AB 2DNUA 4C0DB 2LX7A 1EZ8A 5G3LD 4LF5Q 1NYGA 3J7YW 4XTWA 1EWHA 3T56B 2AKKA 4DAYA 4K0KQ 4JJDA 2NB0A 4K11A 2MNAA 2OTLQ 3L2QA 3CCJT 3VUBA 1A62A 4A3EG 1ZA2B 3P1HA 3C0CA 1TXYA 4HAEA 4TKOB 5KNDA 3ITPA 2B2WC 1CM9A 3I9QA 4C8QA 3A8HB 4J15A 4DBHA 3OIPA 1BXTA 1HQRD 2YXYA 1ZXTA 2JSOA 2EGEA 3M54A 5LJ5g 3RR6A 4C5EA 2KMTA 3J80E 5KCOA 2LXJA 4C2MB 1MNEA 3MEAA 5EG2A 3M3YB 2CP2A 4M77E 1ASYA 1X3GA 4FYDA 2UXBQ 5D65A 5D3IB 1BBZA 2V1RA 1E1TA 4A3EB 4HA8A 2EQJA 1TWCB 2A6HC 4V190 4GNXC 2KGTA 2HQEA 4IPHA 2D62A 2C35B 5CAIA 2ZTDA 1Y7XA 2H4OA 1GHJA 3HRZC 1H3ZA 3QBYA 3E19A 3E1SA 3OYYA 1EWIA 2FRWA 1C8CA 1W6JA 1W2BP 1VQ4Q 1XMQL 3VRZA 2EVRA 3AFPA 3K5OA 1EFWA 3VYHB 4II1A 1AWXA 2KI7A 1UEAB 4HCEA 3PE0A 3JB9F 1WFWA 2EJGA 4ID6A 3HOVH 4JI0L 1EUJA 4KBMB 4RKBA 2KEDA 3EG9A 3U9SA 3X3MA 3GTJB 5C44G 3M7NA 3CD6Q 2AHJB 1S5CD 1UAPA 2E5QA 1BI3A 4NS5A 1HZBA 1N32Q 1P16A 4ANJA 4NXML 2DZ9A 1SYFA 3QXEB 1B2TA 4AFUC 1SEMA 3QZ9B 4LUDA 5A0GA 3UE1A 5FRMA 1VF7A 2WB1E 5DM7R 5FJ8H 2F03A 2V8IA 1U4MA 3I56Q 1EY8A 1D5XC 5C4JB 2JTEA 1I5LA 1KHCA 2K5NA 1FVIA 2EZVA 4WRDA 3GTKB 3QZ5B 1WFQA 3S3OA 2AIRB 2VASA 1HH2P 3CMET 2RJEA 1FJGQ 2R92B 4EQOA 3G6ET 3E9HA 2IPKD 4JRPA 1N36L 1DJRD 4QQ6A 1H9SB 2ROLA 2LTOA 4PFZA 2F1MA 1M1KU 4H44C 1O7IA 4A3CH 1OU9A 3I4NB 1D1AA 1PD0A 2ZJRA 4LUOA 3W2DA 1TXQA 3D4DA 2F0HA 1GJXA 3VUZA 2EGCA 3RR5A 2ASBA 2DTHA 5CMDA 1LACA 4HJ7A 2XHCA 2ID0A 2VQEQ 2EYLA 2E74C 5GAOq 1HYOA 4O6JA 1RHPA 1E24A 4JI1L 3BW1A 2AUKA 2NVYB 3PO2G 3ULLA 2WIIB 2EGAA 4ILWA 1N32L 1G91A 4DBFA 1RF2D 3O5ZA 3JRZA 1G291 3EJIA 3EG3A 5C5LA 3S9WA 1QCNA 3M0PA 3MP1A 3GD7A 4ZAIA 5KYWB 5EPKA 2DAQA 2CGHA 1TS2A 4JS5A 1LCKA 3D3RA 3VA5A 2KAFA 5GAMe 1LO5D 3H41A 2X3XD 1O7YA 1YHBA 4BE1A 4ZUJA 4RTWA 2KE9A 3OYEA 2CS7A 2KHIA 2VUBA 1VQKQ 2SEBD 1KK7A 1CFMA 5HURA 4G7ZC 3S15B 2RQWA 4HIDA 3S3NA 5J26A 5FLXL 1X2QA 4PZ6A 3OIQA 2B2YA 3OOCA 3ZEHA 2QA4A 4DXFA 2CDTA 3OYCA 3THKA 1YCYA 3CCVT 1C7YA 2DXCA 4J9BA 4LF8Q 1MIUA 1WJSA 4DR2L 1OXVA 1XWEA 1GVPA 2R3ZA 3DM1A 2JA7G 3AU7A 2DKGA 2JA8B 1MMNA 1TWBA 5BN4A 2DJQA 1N8RC 4KULA 1W2BS 1GO3E 2FPEA 2D0OA 1PSFA 2NZOA 4IALA 4XT3B 1L0WA 2K28A 1KXLA 4J8OA 2FRYA 2M0OA 2XU8A 2H3JA 2BE5D 4OWTB 4X3KA 1AOJA 3JCMd 1VQLA 3S14B 4K14A 2XSCA 1FNVA 3OWEB 3MZ5A 3Q0AA 3N6RA 1JEGA 1TWHB 3KYHC 3FB9A 3S17B 4AFZC 3SK8A 1BO0A 3S2DB 1OU8A 4HCSA 1G8ZD 3QWNA 5EKLA 1JT8A 5C5MA 1X6GA 2LCCA 2DETA 1I3QB 3A8OB 4KKUA 4OONA 2K5LA 4PZ8A 3UDIA 4E6IA 1D2BA 3E9GA 5IOCA 1EQTA 3BDOA 5E4WC 2YU9H 2F0FA 2B8AA 1VQMA 1GBRA 2QW7A 2WB1B 1Q7YC 1N34L 2GVAA 3SB2A 4C3IB 1LT5D 5I6YA 2QA4Q 1BDOA 5GAN3 1M1GA 2CZ6B 3J7AF 2B2WA 2MMPA 1UGSB 3M4YA 2MAMA 2IJ0A 3NWTA 5LJ3f 1XOVA 2L9HA 3NQTA 4I7ZC 4KKTA 4KN4C 3UT1A 4NMZA 5GANh 1BBUA 4A3DB 5FRNA 5IE8A 5GANf 2F0NA 4AH6A 3A8JE 1MV0B 5KGUA 3NBHA 4C92A 5LJ3h 1QNKA 1RLQC 4HN7A 2ATCB 4O5VA 1A0NB 3MXNB 4LE9A 4D8KA 1GD7A 1PTOC 2E2HB 5KYXB 4F7UG 1HZCA 4EQ5A 3JAML 1HNZL 1J9OA 2IIMA 3G6EQ 4QW2A 2RQRA 3KLRA 1QNUA 2PUKB 2KHJA 3ZBDA 2RA4A 2FG0A 1X55A 4A4KA 4UP9A 2F4VL 2ZPIB 3S2HB 1KQSP 2TSSA 4N8X1 1DD2A 1FX7A 1BVSA 2KEEA 1IHZA 2L5QA 1VQBA 2A3LA 2DZCA 1NCVA 4AIMA 1PH2A 1XPUA 4J9FA 1SMYC 2BCOA 3E0EA 1CKNA 2M02A 3A7LA 2MPXC 4UPAA 5CCAA 4PNOA 2QF7A 3A8KE 3S2DH 1CHQD 3GO5A 2RK2A 3OBYA 5CKHA 2RQXA 3KK7A 3MEHA 3W1BA 1I8FA 2O2OA 4R56A 3Q1JA 3KOJA 5JPNC 4D6WA 4LF7Q 1UDLA 1D3BA 2E6NA 2RQUA 1WHLA 2FO0A 4BY6B 1EWCA 1R4PB 4HVWA 2PO4A 2CP7A 1X3FA 4KJOA 3TBIB 1YCSB 3SEBA 2FPFA 4FNFA 2VZAA 2XWJB 4CBVA 2ZXOA 1TS3A 3KJPA 1IBLL 1DXMA 1HUNA 3JCMc 4C92C 4DV7L 1WTRA 1ILPA 1TU0B 1F9QA 3JCMh 5DM73 1J5EQ 1EY7A 5FU6B 4BI3A 2F0UA 4M77F 1R9TB 2P5ZX 3FDRA 5DAUA 4AQYL 1EY6A 1FD7D 2MO1A 1M2OA 1MMDA 1WYXA 2RHZA 1VQLT 4GN5A 3HOXB 3G6EA 2XIDA 3RZOH 1N6AA 3OSSC 3JCMP 1W1FA 1BYMA 2EYMA 2I07B 4O42A 4OO1H 3D7SB 4N9TA 2ECZA 1AEYA 3P75A 2IPOB 4TSSA 4QVDA 4MZMA 4OB2B 1K76A 2OTJA 3JCMb 4DKAC 5C4HA 1DOLA 4LFBQ 2OF1A 3RN5A 2Z4IA 5IGEA 3CCQQ 3MJXA 3KDFB 4NXNL 4C0DC 1VQ6A 4L6V5 1X3PA 2F0IA 2B2UA 2Z6BA 1M27C 2BE9B 3CCRT 2HNIA 1CK1A 2KECA 5K5PA 5AJ3L 4DAVA 4MZ9A 4WF2A 3CCLA 1JE5A 5M3FG 1LTLA 2EIFA 2F2XA 3I5SA 4RTXA 4JDSA 2HIVA 4CDCC 1YNZA 1HK9A 3KDFA 4RGNA 5CKFA 3CC2Q 2PNHA 3OSOA 4HJ8A 1DCZA 2QDBA 3J81E 3F2BA 2H1EA 5ECAA 3RZDB 2RD1A 2G3RA 1KRTA 1RTNA 2XKOC 4KHZA 3I4NH 2DJZA 1L0YB 3AQQA 4ZGDB 4DPGA 1AP0A 1J5EL 1TOVA 5IHKA 2ZGWA 2ZZDA 5IGBA 4JI0Q 2LMJA 2QA4T 3VYRA 3J80c 3URYA 2RI2A 2JE6I 1EQQA 2HUGA 2B2VC 4I65A 5FO8B 3UATA 1EQRA 4M75B 1K9MR 1MGSA 2F0GA 3KFUA 3F2UA 1MUZA 5M3FB 2A0FB 2JW4A 4OHJA 1QVPA 1QKXA 4QGUA 4OO1I 4X1VA 2DERA 2V1QA 1I0CA 4C92E 3EFRA 3CMAA 1B70B 1Z9FA 3RD4A 2UXDL 2SNMA 1JICA 1KQ2A 4FCYA 4FW1A 3QUIA 1FYCA 2M2LA 1U3OA 3VV0A 2UXCQ 2B39A 3P8DA 1L0XB 3DEOA 5I21A 3CCLQ 5AJ3Q 2YDLA 4BE2A 3Q6SA 2KQWA 3L1AA 4HT8A 2I5MX 1KSWA 1GXIE 2XDPA 3MEFA 2XWBB 1PH1A 2V1CC 4I7AA 1OYXA 1RI0A 1IYUA 2EY1A 1VQKT 1C48A 2BE5C 2NN6H 3IQLA 1YIJA 4B9WA 2F4IA 2BE7D 1LVKA 2K33A 4B3TQ 1WPYA 1QVGP 2QXFA 1VQJA 3CCUQ 3G48A 1VOMA 4Q5VA 1O9SA 4E2FB 1SR3A 3SWNA 1QWYA 1QZHA 1KL9A 5JPMC 4HJAA 1RI9A 1HUMA 1J6QA 1G2SA 2NVQH 2JXMB 3V7RA 1YEZA 1GFCA 4C5HA 4WFN3 4A3BB 1JXMA 4P73A 4OELB 2HSEB 5BN3A 1YNJD 3I4MB 4DEYA 1M1FA 3OQ5A 1DJ7B 2EPDA 3K58A 4BY1B 4FU6A 3CMEA 2X4JA 1I50H 4JV5Q 1AH9A 3V7CA 4E7SA 1HA5A 3HS0C 3K0YA 4QKUA 3NBHB 4Q0FA 1GXDC 3RNUA 3H6ZA 4X64Q 3H0GG 2VUMB 4OB0B 2WINB 4KV6A 2BZYA 4XTZA 3RDVA 8AT1B 3IL8A 4NP5A 4X64L 2A5HA 2F3WA 2CUDA 2E76C 4K2KA 2OTLT 5GANe 2GVBA 2K5WA 2EW3A 2FZCB 2J4XA 3E5SA 4OMLA 3NHNA 4RMOA 1X54A 5AT1B 3K7UC 1OTCA 2MUYA 4B3MQ 3HOVB 5C3EG 2KK4A 2VB3X 2DGYA 4GLVB 2D8JA 2LMCB 3NP8A 4YWLA 2KCMA 2K05A 4J9HA 2E4HA 1SNOA 1PHJA 2EJGC 1SN8A 2E2JB 2V8KA 1O7ZA 3EFSA 3MFGA 3H15A 1WTOA 4GBQA 4TVAB 3EQLC 2ZPEB 3K8AA 2NVTH 2RDFA 3H0GH 1PH8A 3ME9A 4J9CA 1EY5A 4JI1Q 3VR2A 1JJ2S 8ATCB 4KD4A 2ALYB 2D9UA 4OMOA 4V2SA 1P92A 4FYWB 4F7UE 1YHAA 2EQIA 3EH1A 3CEYA 3H0GB 3H91A 5E3FA 4PJJA 3A5UA 1LT3D 1ZSZB 3CPFA 3CAMA 2L15A 1STBA 1BCPB 3TS0A 1AVZC 1RAGB 1LABA 1JWSD 4EGVA 1NPPA 2QASA 5KH6A 4LXCA 4A3JG 1BF4A 3S1NH 4FM4B 2HIXA 3L2UA 2EYPA 4M8AA 3G7ZA 2M1HA 2F0EA 2ZXRA 3MXPA 1DZ1A 2G9HD 3L2VA 1KC8C 2LY7A 3FHWA 4PMWA 1M90U 3TP5A 2RF0A 2DXTA 1N34Q 1A63A 1KFZA 4C8QC 2HBWA 3A74A 2JM8A 4DV6L 3URGA 3NGPA 3HG9A 1IBKL 4FT4A 4C0FA 1MNDA 2L11A 1U06A 4J7IA 1STAA 1U9RA 3HOZG 1BKBA 3MP6A 2Q8TA 5CYUA 1EY0A 3M4OB 1K73R 4J9IA 1M5Q1 3T51B 1C1AA 2HAXA 4EIKA 1D5ZC 2NLUA 4OXPA 4LK1C 5C6AA 2QQAA 4A3FH 4AYBE 3CCSQ 1FR3A 1PD1A 2MF2A 1JWUD 1PMRA 3L2RA 1D6EC 2ESWA 3CCLT 4ZKCB 3HOVG 2RNAA 3DKMA 4KTAA 3K57A 4QF4A 2JZ2A 2MHVA 5IP7H 1OXTA 4WORA 2R7ZG 3EA6A 2A1AA 5LHY1 2XN9C 1D09B 3P8BB 1ESFA 2KA7A 2F0JA 2A6HD 2A7YA 2ZPHB 1YFNA 2F0QA 2JA5B 1XQHA 2UXCL 4JJNK 3UDGA 4JBWA 3OHXC 1IXDA 1VYUA 2HKQB 1EOVA 1U5KA 2PZ1A 3REAB 4R4TA 1Q81R 1XNQQ 2KCTA 1K73U 2Z6KA 3BZCA 2DXBA 4PL6A 4CI0C 3RKWA 3V7SA 3ZYYX 5KYLA 2EYZA 3G71T 3L2ZA 1V1PA 1XYIA 4JI4Q 3KJOA 3EGDA 4LDWA 1CKBA 1NJIR 1YZ6A 2D2CC 4BA1I 2R7ZH 3CCRQ 3SEMA 4P5NA 2HCKA 1Q1BA 3CQZB 1QJOA 3M55A 1HNWL 3NHHA 1GCQC 4PMBA 1I94L 1STEA 1WHMA 4N9PA 5IGFA 1UGVA 5KYIA 2YUOA 5EPLA 3I4NG 1F2YA 5FLMH 4XYQA 1WTWA 4XU0A 1SNDA 2F5KA 5LJ5e 2NUCA 3OYGA 3L2PA 4AT1B 4CC3A 1PVOA 1YNNC 4X62Q 1M8VA 2VQFL 1SKUB 3PO2H 1G6ZA 1TUGB 1YIJT 2P84A 4XQ3A 1Q46A 1M30A 1UECA 2NVYH 4F88A 1PYWD 1EY9A 5IAYA 1Q90A 1OZ3A 5CKEA 2R93H 5EBDA 1HA6A 2NUTA 4J9DA 2QQBA 4ZQ3A 4N4IA 1RAHB 1Z7TA 3GTLH 3CHBD 1TSFA 3LWEA 3LLRA 4ODGA 2AUJD 1JJ2P 3Q22A 2R93B 3NTHA 4M75G 2F2VA 1SPKA 1NR2A 2EYJA 1AWJA 4XT1B 4A3GB 1GBQA 4A75A 5LJ5d 5M5WB 3CBMA 3I55A 1YJNQ 3C94A 3JCMg 3GDEA 1ZUYA 3NBIA 5C44B 1F77A 4C92F 3S16B 4B3TL 4X9DA 1GUOA 2JK8A 4JOIA 1K73C 1XMOL 3A55A 3U4VA 3IKJA 3KF6A 1BCMA 4IIOA 4IKFA 4YCVA 5IT9c 5LMNW 3M53A 1S5DD 5CQXA 2RBMA 1D0ZA 3BYYB 3M58A 2NVXH 2CVRA 4LWCA 4DA2A 3CU7A 5EPJA 1WXTA 2RJFA 1OX9A 5LJ5h 1CSPA 4FO2A 3PMIA 3PO3B 1AD5A 3GP8A 3C1EA 1O75A 1FWZA 3QJYA 3I4LA 2J7IA 3HOXH 2X6LA 4F16A 5HGTA 2L8DA 1SMXA 3HFNA 2KYMA 4KD3A 2IHEA 2NBFA 2MPMA 3FJPA 1R9TH 1FYNA 2HQXA 4FXGC 2KXCA 1K9MC 3UDXA 4M75E 4HTHA 4M7AE 1VQ7T 4JI5Q 2L89A 1QVGA 4IO9A 4WJ4A 3T4AC 1OOTA 1SSHA 2DRKA 1XX8A 1UGPB 3BDUA 2AMCB 4QIWB 5JEAH 3F1ZA 3E2UA 3S24A 5FLXc 5EQ0A 4ZTFA 2K5FA 2LC4A 3JV3A 1MKHA 3CBPA 5HCKA 4M77G 3CCMA 3PGGA 1JQYD 4C8QE 1N8RR 1WCMB 2KOLA 3HKZE 4OF1A 3OYHA 5M3MH 4C0ZA 4L5TA 1HCZA 5CR3A 3OS0A 2LSSA 1TR5A 3OYMA 3TU4K 1VQ9T 4R4IA 1SYCA 4GOPC 4IFDI 2PUOB 4R9WA 2DVEA 1ONLA 3KFVA 5LJ5j 5FO7B 1X75C 5CR2A 2EOTA 2FVUA 4Y91A 3OW2S 1B4OA 2DY7A 2EYOA 4BBRH 4C56C 3J7A5 1EU4A 1Z47A 2COYA 2F5TX 4R1JA 2E64A 4KUDK 2K5HA 4PNYA 1B7TA 3GLXA 4GLKA 4C3HG 2F0LA 5FW9A 1OX8A 1WIEA 1AZQA 3PIOA 4DV1Q 1R4QB 3KBXA 2QK0A 1I4QA 2PQAA 4C3JB 5I9OA 2CZ1B 2ZM6Q 3LH0A 3BE3A 4RTYA 5IWAL 2XI9A 2KJXA 5IT9L 4PK4A 4CGYB 1T9HA 5GMKj 2RSOA 4MZPA 1SEBD 4Z89A 4RHRA 3G4ST 4A3DH 1D7QA 4ZKBB 1TWGH 1LT6D 3CW2C 4IURA 1VQKA 2PQAB 4P71A 3U23A 4JI3L 3OTOQ 1G6PA 4BBRG 4M78D 2O2LD 5KIXA 2CP5A 2K7VA 4YHHQ 3TP8A 2KYBA 1H8KA 2WP8J 2CYZB 2NZHA 1G5VA 3Q8DA 2JA8G 1MGQA 5IXFA 2CZ7B 3A8LB 2MOXA 1ZHIA 2JA7B 1QVCA 5GAOr 1PFBA 5ELDA 4JI7L 5C3EB 4A3BH 4M78B 4PLIA 2RJCA 1WTHA 5DLOA 1EYDA 2WAQB 1RABB 5T1GA 4XQNA 2JVVA 3RKYA 2SEMA 2CKKA 1YI2T 1QCBD 4WJWA 2AT1B 3EBEA 4J83A 3TVTA 4A3DG 2HHHL 2N88A 4VUBA 2N55A 4PJNA 4J5YA 1VQNT 2VUMG 1EQVA 3PIPA 3SDZA 2I0NA 2GFUA 4GZYC 2HCCA 3PUWA 2VV5A 3NSWA 2IY5B 1IGQA 2JA9A 3M0UA 2E2IB 3I5RA 3DB3A 1ZBXA 2DBKA 3BG3A 1KQSS 1B1ZA 3MHBA 3NWSA 5C4XH 4Z88A 1PRTF 4J6YA 3ZFJA 4DV2Q 1E6GA 4QY7A 2UU9Q 4A3BG 2FJ2A 2RDHA 3FPUB 2CW0C 1IYJB 2VNUD 3QJ6A 5JEAJ 2R58A 3TQ7P 1CA5A 3MKDA 4X66L 1QLYA 1FNWA 1M2VB 3BY7A 4OVAA 3QSUA 2RHUA 1Y1VG 4U68A 4JYAL 2ZPBB 5LJ5f 2NUZA 2F0MA 3I7FA 3ASKA 4KLKA 4K6LA 1EOTA 2B2YC 4QL5A 5IY0A 3OTOL 4JI3Q 4PV1C 1FMVA 2YYZA 1STYA 5FK9C 3C12A 4WJ3M 1YJ9Q 2PVDB 5I9PA 4RCBA 2AQ3B 1Y1WB 1HR0W 2RSNA 4PKCC 1GUNA 4FF4A 3PVLA 4JG2A 5EKKA 2MWOA 1B34B 2BZXA 1PDQA 1VQAA 2R6GA 1VQ5Q 1X56A 3C4SA 5GAOp 4HCBA 2ICIA 2EXZA 5IT9E 1O78A 2WFWA 2WV6D 5ELNA 1E7OA 5GMKl 1H9SA 4QJFA 4X65Q 3UA6A 3UDFA 3EHQA 4XYOA 1SNPA 2DNEA 5FLMG 1VQ5T 2K5VA 2F0VA 3RBBB 3VYGA 5C4XB 3C95A 3PVQA 1M3BA 2VXWA 2HSPA 2E70A 4DUZL 5GAHC 4G7HC 3U9OA 3VJPA 1Y71A 1EZ6A 1T0HA 1IXRA 3PGZA 4DUYL 3TP6A 3STBD 5GANj 2Q8IB 4RGMA 2JS2A 1XJVA 2X4WA 1VQIA 5I2XA 1GL5A 4QCLA 1ABOA 1SYEA 4A3IH 3EGUA 1NSNS 1EEFD 3ONAB 3OMCA 2QGFB 2DEUA 1VQ9Q 5C0XJ 4LF5L 2F0WA 1V43A 3ERQA 4XTYA 1YJ9A 1PTOB 1OV3A 4KUIA 2XD0A 1S1NA 2PZWA 2JQOA 1X6OA 4KK7A 3HRUA 3H0HA 4ME3A 4DNTB 1PFSA 3HTRA 3EGXB 3JCMf 3JAMi 1NAPA 2GNCA 1TG0A 4NPSA 4IZ8A 1K8AU 4DAYB 1NZ9A 2E2DC 4F17A 2RI5A 1KNAA 4J7FA 1QW1A 1VDZA 2N78A 5IGDA 2FPDA 4B9XA 2RA2A 1WI5A 4JBMA 1SE8A 2OTJQ 4EQPA 2R92H 3WOFA 3UDCA 2E8GA 3D4WA 3CCJQ 1LLRD 4R55A 3SGIA 1QQJA 1IKMA 5A0LA 2MFIA 3K5LA 5E4XA 2HBPA 4RG2A 1CKOA 4BY6C 2JJ9A 2CT3A 1JJ2A 4AMCA 3MXGA 3ULJA 1K83B 2EFIA 2NYSA 4C8QG 1AZGB 3JCMe 5J22A 3LX7A 1AEXA 2EQSA 1JB7A 4QQBX 2XRQD 2EAYA 4X34A 4LMQD 3WWVA 4E7IA 5L37A 2L4NA 1NM7A 1Q8KA 1LNXA 3L9AX 4S3SA 2RF4A 2DTIA 5GAN5 1WTPA 3QWYA 3CCUT 4OMNA 3BYTB 1Z9ZA 4HSPA 4LW1A 4L5GA 3CXCP 2LS01 1F9PA 3HOUB 4QQGA 3TP7A 1VMCA 4KHPL 5T1IA 1QCFA 1U8RA 2YUPA 3AT1B 5M9OA 2DY8A 3CF5A 1E2ZA 3HSBA 1BBXC 4F8MA 1VQLQ 3DWQA 3GF5A 5D3DA 4JRIA 5IXBA 3RN2A 3VS2A 1WJRA 1RODA 4DR6L 3A8GB 1G8XA 1PH4A 4LFBL 4ZYSA 3ZJYC 3W1GA 1R0CB 2A69C 4C8QF 3VKIA 2PVOB 2HDAA 2PNIA 4BDYA 1CHPD 2PI2A 2Z0SA 1MMAA 1RDPD 3META 2YTYA 4V0BA 3H09A 4J6HA 4XTCS 5CORA 2LFNA 2JP1A 2B8GA 4X3TA 2JM9A 1X27A 2K9GA 2QEXT 4CJ0B 3IRBA 3QG1A 4IUPA 1NJIU 4OO1G 3W5OA 1F9SA 4RTZA 1HTPA 2EKOA 2NVQB 3X20B 4IFDJ 1W6XA 4HIOA 1RADB 1K8AC 3C46A 5GMKi 2J6OA 4X9CA 1QVFS 5FU7B 4XIGS 3J81L 2K3BA 1STHA 1ZUUA 2YHTA 4EMHA 2QTXA 5GAOm 1M90C 4M7AA 1PYSB 1SE3A 1YIJQ 2OQKA 5C0XH 1IBML 3HOZH 1PKSA 4HVVA 4HCZA 2XDDA 2CH4W 3G7LA 1XPOA 3CCUA 4FT2A 2PTKA 3OYNA 3JSCA 1SNMA 4DEXA 5AFWA 4M4ZA 2AQ2B 4DR7L 4QUFA 3QIIA 1K1ZA 3KXTA 4FSSA 2F0SA 1Z6HA 1I4PA 4YCWA 4LF9L 3CCQA 3GTPH 3J80L 1SFOB 1D0XA 2ZAEA 2JUFA 4HT9A 4ESRA 4E7ZA 2VUMH 1KD1R 2X51A 3PUYA 4DV5Q 2NVXB 1BOSA 2WKCA 3BS1A 3PUXA 2Q2HA 2BZ8A 4KKSA 2Y4YA 3G4SA 4PJOF 1CSQA 4FF2A 4UHVA 1G2BA 5C4XG 2JEAI 4M75C 3O8VA 5CKDA 4DV7Q 5ELCA 5CV4A 2YT6A 3BVZA 5JJLA 3WOEA 4U673 2HDMA 3EHRA 3OSVA 4ZGEB 2LP5A 3DLLA 3OWFA 3OBWA 3JCMJ 4CDDC 5EBCA 3LWIA 2EYQA 1VQ8A 2EY6A 1WNLA 3OYFA 2F0KA 4JJCA 2E75C 3ERSX 4OGQC 1VQOQ 4PMCA 4EX5A 4YY3L 5M5WH 1AN8A 1NYFA 4A3MH 1NEGA 2O5IC 3VS6A 2HL5C 3CD6T 1K28A 2Z8LA 4DR1Q 4NL2A 3HKZG 1UHCA 1BCOA 2LT1A 5GANd 2C06A 5IHIA 1UE5A 2PMZE 3MXUA 5JVG3 3CXCA 3OYKA 1SLJA 1MSHA 1RAIB 3FDTA 4BE0A 1WOCA 2ZTCA 2DD5A 1A2TA 2H3EB 2O9SA 3KUFA 4RKUE 3CC7Q 2XVSA 2UXBL 1GOZA 2M9UA 4RCCA 5I2SA 4K5VA 4DV2L 5GJVB 2AZSA 2IWHA 4M1UB 3J80i 2YWWA 3CCEA 1NUCA 2F0OA 2KDSA 4M78C 2DF6A 2C0TA 4AFSC 2NN6G 3J81c 1VQ6Q 4PG3A 2KT1A 2M16A 2R7DA 3PF5A 3HZXA 1KLUD 3EGXA 2KBNA 3DEPA 5JVH3 3DHQA 5M5YB 1MMGA 4ORZA 2VL6A 1BK2A 3E9IA 4IN3A 5GADC 5C3EH 1GCQA 1WQ7A 1PZJD 4CKEA 1HR0Q 2HCIA 3ND9A 1L1OA 1UUEA 3CC2A 1E7ZA 1M1KC 1NJIC 1X69A 2JNGA 4N8FA 1S3OA 1VQHA 4JS4A 3GTMB 3VS1A 4OWWB 3SE0A 1ACMB 2E41A 4RHSA 5D6WA 2QYZA 1K0XA 4CHTB 4Q5WA 2BA1A 4ULLA 2SDFA 1BIAA 1DM0B 4M78G 3CMEQ 4ZN1A 1QOHA 4LFCQ 4IUUA 3M57A 2X4YA 1BI0A 5KYXA 1PRLC 4HVUA 1X3QA 1ENCA 1YHQA 1YNJC 1PHTA 1VQ5A 1FMWA 2LJ0A 4NDXA 2DYBA 1LJOA 1W2BA 3WVDB 3VYTA 2FZGB 5C4ZA 1UE1A 1B9NA 3VR6A 2UUCL 2AZVA 4L5QA 2RMOA 1K8GA 3MEVA 1VCIA 3ND8A 1N8RU 3E3XA 4PJOA 1LT4D 2DL8A 3PUZA 3EH2A 1PRTD 2K3YA 2EJFC 4OP0A 2XTIA 4DV5L 3VYSA 1VF5C 2YV5A 2O88A 1NR4A 1SRUA 4C3JG 1H9MA 2IX3A 1EYCA 1ZSZC 2MYSA 2JA6H 3T53B 3TRZA 2ZPGB 3LWUA 3OW2A 1QUQA 3S2HH 5D7UA 1V1QA 5GAMj 3GQBA 4FF1A 1PLFA 2KUMA 4M7DG 3UE0A 4PJOB 1B8AA 2RQTA 3X28B 4CC7A 1TWFH 4Y92A 3N5BB 2LNHB 1VQPA 2CP0A 1I5FA 1YITT 1UJ0A 1T5EA 2UUBQ 4HXJA 4KY6A 1N33L 1E1OA 4EMKC 1RUWA 3PSIA 4ME5A 5ELOA 4DV4L 4GKJQ 1LTTD 2V26A 5D6XA 3CQTA 2YSQA 4OMPA 1WVLA 1CKAA 4M77B 4LUEA 1LTBD 1RJTA 4C3JH 2EY2A 2RN8A 2W0ZA 1D3BB 5C0XG 4M7DC 3QR8A 3HOYH 3M9QA 2F3IA 4HCKA 1Y0MA 5L23A 2B2TA 4GN3B 1TH7A 4FIBA 1V1OA 3K7AH 1TWFB 3LW5E 3A8MB 4DNIA 4B3SL 5C6SA 3OW2P 3JB9G 4BXXH 2EYFA 1VQNA 5CBEE 3K7AB 4ME7A 3MP8A 4C92D 3M0TA 3JAME 5JAVA 4EPCA 3D0FA 2WSFE 2KQ3A 2JA5H 5LJ3d 4KJNA 4JI6L 2ATWA 1EIFA 1JMCA 4J1MA 3FVQA 5ELFA 2MWPA 2EJMA 1G3WA 2A28A 3R93A 2ZJQA 1QCOA 1Q8IA 1X32A 3HP3A 4A63B 4PJOG 1V9PA 3VS7A 2QEXA 1LTRD 4Z9CB 2BDOA 3F2DA 3S14H 3ULPA 4A93G 2WACA 1SF9A 3TEHB 2R92G 3GTLB 1NLOC 5IYBG 3AEVA 3TMEA 2E10A 1VMPA 2I5HA 4OGCA 3W3AA 1IREB 3TQYA 3J7AV 3A0JA 4CKCA 3ZL7C 3VDYA 2VXFA 4ALPA 2SNSA 2VC8A 3M4GA 4M7DD 2L12A 4A3GG 2F4VQ 1NBWA 5GAGC 2K4KA 1ESRA 4FF3A 2R93G 3OS2A 1ZX6A 2Y4XA 1YNXA 1WX6A 4HSVA 3FPPA 3QPHA 4E6RA 4JI5L 4RCOA 1VQCA 3NQIA 4YHHL 2SRCA 3M5AA 1DGSA 5GAN8 4FDBA 1BCPF 3GTOB 2YUQA 3BDLA 2XICA 4H13C 2Y90A 4L5RC 3I56T 2HMAA 3NPFA 5LL6S 5J39A 4RCNA 1DONA 3PNWC 3UPUA 1PTOF 5HGQA 1CUKA 5EAYA 1S5BD 1Y1WG 1PRTB 4XK8E 1FL0A 3FEOA 1B44D 1EYGA 1BQQT 1IW7D 4LAAA 2NTSA 3U50C 4DOWA 4C5GA 5KYYA 2QEXQ 3SWNC 1I4HA 2QKIC 3D8GA 1Q82R 5CV6A 2DPPB 4MMLA 1O80A 1Y1VB 2G5DA 3D4RA 4A3LH 1C9OA 2KENA 3QHSA 5IN1A 5E1FA 3A5ZB 5LJ3e 4KT0E 3CCMT 2EE1A 1EYAA 5FWBA 2K2VA 4POFA 4A3KH 5K36G 3V8LA 4E7HA 5D6YA 1KRSA 3QOLA 4HR7B 5E7NA 4IFDG 5C3XA 4K6DA 1FNUA 2JXBA 2K4YA 2L2PA 2YRCA 2O4XA 1YVCA 2LCSA 2JOYA 3EGDB 1YWPA 5C3WA 1SG5A 1SE2A 2IT1A 4JZ4A 5IGGA 5DY9A 4FYYB 3BVGA 4M77D 1VA7A 3DWAA 3DWPA 1PM3A 3FKIG 4RTUA 3HL8A 4LNPA 2B2VA 3TSSA 1WHGA 2H8HA 3HOWB 3HKZB 3PCOB 3MPUB 1NBEB 1D1BA 2LCLA 1U4PA 3CPWP 4A54A 5JOBA 4G7OC 1IBLQ 1SXTA 1UGQB 4XTXA 2LT4A 5CVIA 2DFUA 3CQZH 4R8NA 4ZLTF 1VYVA 3M7GA 3RZDH 1UTIA 3JCMV 1KIKA 5KNBA 5IP9H 2RDGA 3RKXA 4BI8B 4GNXB 3IFDA 2LQNA 5CO7A 1PV4A 4FW2A 2ENMA 3QO2A 1I94Q 3CCRA 4CC2A 3DLMA 1CZGA 5CV5A 2LX9A 4GKKL 4Y52H 3TEEA 4PJMA 2DTOA 4C3HH 3MC0B 4GKKQ 1AWWA 2JA6G 1BI1A 1SHFA 1SDFA 3MFYA 4GNXA 3FKIH 1ZYRC 3K81C 3VR5A 4AYBG 3CD6A 4N0AA 3ICEA 1QMCA 2PW5A 3N52A 2K6DA 2OTJT 3QDRB 2GFAA 1YJNT 2B2TC 5CGKA 4A3EH 2TMPA 4DN4M 5KYUB 1UE7A 1VQFA 2PQEA 4B08A 1LM0A 4M7DA 5M3MG 2B3GA 3CCST 2B2UC 1LOJA 2RHIA 4QT7A 4JLGA 1CTMA 4O1NA 3M3YH 1BBWA 5IWAQ 5GAMf 1NTGA 3I56A 1V8QA 3CC7A 2VYTA 1E2VA 3S1RH 1QZGA 1TS5A 4CC4B 1XNQL 2CSIA 3JCMW 4JK1C 4QVCA 4KY7A 1CZWA 4A3FB 2GBQA 2CSQA 4C2MH 2N49A 3D6WA 4RG1A 2RKSA 2K50A 4H0LC 1TWGB 4N4GA 1MJCA 3L3OC 4L5SA 3KF8B 1M8MA 1HJPA 4DR2Q 1MBYA 1ZKOA 5FU6C 1HQMC 4JPBW 5GQOA 2AQ1B 1YJWQ 2K14A 4ZK9B 2CCZA 2E5LL 1UFFA 4EQNA 2WAQG 3NUCA 2XG8D 3PF4A 1ZSZA 2X4XA 1K9MU 2NZ1D 1XTDA 2DYIA 2QCPX 1M3CA 4LN2A 3GBQA 3UWNA 1QG7A 2JA5G 4Y28E 4DFAA 5HY6A 1WLPB 2VXEA 4LUZA 3J81i 1UE9A 2K5IA 4LDXA 1FMKA 3BJUA 5GAMh 1YI2A 3X25B 1NNXA 4BWGB 2QI2A 1TWAB 3REBB 3C3LA 4DR3L 4BY7G 5CV8A 3AHUA 5IH2A 1FXXA 1UUPA 4R0KA 2K03A 5D14A 2O5JC 2VGMA 5IYBH 2EJFA 2J0TD 2C9OA 2BUDA 3S1MH 2KBTA 1F2MA 1VQMQ 3EAEA 3NENA 1KDCA 2N8NA 2RHXA 3F2CA 2MIOA 1PFNA 3SK4A 2J7ZA 4XXEA 4JZ3A 1RLPC 2F0DA 1DYQA 4IPGA 3MEWA 5LJ3j 1KD1C 1Y14B 2ENBA 2DEQA 1M4VA 2K32A 4LF7L 2IX1A 3M9BA 4L63B 1QVFP 1LTID 2ZXPA 2X35A 1B7YB 3GNFB 1E22A 1P8LA 5AYFA 2VB2X 3LX0A 2DUDA 1PH7A 1GM5A 3QOJA 1K4US 2ZPFB
chains in the Genus database with same CATH topology
4C3HB 4X3UA 1RD9D 3PMTA 1NPRA 3EROA 1YJWA 3CKIB 4MDWA 5GAMd 5ELEA 4M75F 4IUQA 1JORA 3MXNA 3QB3A 4C8QB 4IUTA 5CQYA 1EY4A 3PT9A 3S6WA 1G3TA 2BA0A 1M4ZA 2A69D 5GMKm 5I4DA 4MN3A 4XDXA 1NE8A 4ELYC 4N4HA 4CJ1B 2K1BA 3C2PA 5GAMg 3CCQT 4DA4A 3CC7T 1SNQA 3X3NA 3VA7A 1KTKA 3MHXA 3S1QB 4LDUA 4M78A 3GTGB 1KQ1A 1N9RA 1V1PB 2YRVA 1BIBA 4LD9K 3I3CA 5ELBA 3NPPA 1KAAA 1JOKA 2SOBA 2IG0A 4XQJA 1RKNA 5FKAC 3D6CA 2GQVA 4RG8A 3X24B 1VIFA 3MTSA 2PCFB 5G3LF 1Y07A 1G3SA 3JCMQ 3OY9A 5A2QL 4HKEA 5CC4A 2IW3A 3DUZA 1WTQA 4JLIA 2A68C 1SJED 3G71A 2JN0A 3GPLA 4TRDA 2NTTA 1HHVA 4E7KA 2FL7A 2NWGA 3A56A 3NE5B 4CKBA 2R7ZB 2EY5A 4OIJA 1LTGD 2RK1A 1QP3A 2K5QA 2MP1A 4MHEA 3CCET 2F0PA 4P2CB 5KE3A 2PVGB 1S72A 4A3MB 1GUSA 4JRKA 2FFKB 1IL8A 3FRNA 3HPWA 3T13A 1K8OA 3HOZB 4ATOA 3GP7A 3CC2T 5I2YA 1JOQA 4K8IA 1QP2A 1CA6A 4BA2I 1ET9A 4LJZC 1II3A 4J6WA 5GAN6 1B3AA 1H9RA 1EEID 1FGBD 3T16A 4A3JB 2G9DA 1A2UA 3VU3C 2Q8RE 3I8ZA 2LKVA 4PQXA 2JTFA 2Y0SB 4BS9A 2F0TA 2K01A 1VQ6T 4JUVA 3I72A 3I73A 3R2TA 2QILA 5ISRA 3I70A 5CV9A 2GF7A 3G6JB 2BKDN 1RL2A 3A54A 4KN7C 1TIID 2I46A 3NTKA 4M77C 1JR0D 3GNGA 2DD4A 5FU7C 5CV7A 3HHTB 4C0GA 2F69A 4LD6A 3OA6A 5GAOl 1AW7A 3LYIA 3TZDA 4F7UB 2RJDA 3TCJA 4RAUC 3OW7A 3OPOA 4BBRB 1TS4A 1I4GA 1YNND 5CIUA 3S1MB 3HRSA 4MIUA 3QYHB 4N0AC 4F7UA 3OYBA 2WKDA 1F2ZA 4YTLA 5I2MA 4M78E 2R5AA 3RESA 1ENFA 1Q7YU 4M78F 1KHIA 4MDXA 1SAPA 3V2TA 1U4RA 2E6ZA 5GAN2 4OGEA 4XAXB 5M3MB 2WSEE 4ZGJB 2PYKA 2EQUA 2PW7A 1JB3A 3VR3A 5CKBA 4AYBB 4C92G 1SYBA 1TVXA 1SE4A 4QUCA 2NN6I 3NXWA 1D5MC 2JA6B 4EDUA 1TKWB 3I55T 2CZ0B 1SYDA 1VQ4A 4A4EA 1I50B 1TQOA 2OXPA 2P0PA 1YJWT 2IVWA 2M9VA 4HMJA 3H6MA 4QB4A 2JYOA 1ET6A 3HGBA 2ICEC 4QQDA 1EFID 1QVGS 2DN8A 3TDQA 1QB5D 2PZTA 4OB3B 1Y96B 4Z02A 4E7JA 3P20A 4RFBA 1CI3M 1KDBA 4BBSB 4YIJA 1SSOA 2K04A 1YHQT 1OXUA 1MSGA 2EYHA 1Y8PB 1QE6A 3ER0A 1E2WA 2V4DA 3H3VC 2DXUA 2ZCFB 1J8IA 3GV3A 1B34A 1KABA 3HRTA 2QQ9A 3RLFA 2K3XA 3GOXA 4FXDA 1DOKA 2XNAC 3OS5A 3MWYW 5LL6X 1JB0E 3BVMA 3I90A 4XTVA 4A4HA 3Q24A 3FEWX 2MJ8A 3OYIA 1XTCD 1WD1A 2WSCE 2GA4B 5KE2A 1R8OB 4JRQA 5LJ3g 2FYKA 3WXMB 5FLXE 2OEOA 3D31A 3K5NA 1VIEA 2A6ED 5GANg 4DF7A 1Q3LA 1HXYD 1JE4A 1T5XD 3NFCA 3RMQA 2DIQA 3JB9J 5DLQE 2BIVA 5C0XI 1Q1EA 3HKSA 4C8QD 4CJ2C 1KNEA 2RVLA 2IL8A 4DNRB 1SYGA 4X3SA 3H8ZA 3JB9I 1KDAA 5EKIA 3FIFA 1HRJA 1VQOA 1A3TA 4M75A 1KLGD 3SK6A 2OAUA 3DB4A 3K6OA 5F2DA 1BUVT 3GIBA 4IUNA 3MEUA 3PFSA 5NUCA 3SFMA 3R2IA 1UEBA 3HP9A 1PZKD 3EVQA 1MD2D 2EQKA 4EMKA 2PPBC 1Y69U 1AFPA 1I81A 4ABNA 3TN2A 1U1SA 4ZUIA 3X26B 1Q86U 4ZN3A 3RERA 1STNA 4EMKB 4CRIA 1ML0D 4RGOS 1TU2B 2HD0A 3S1NB 2QQRA 3V8KA 3RUZA 4MZTA 3FMCA 3MCAB 1M9SA 1TY2A 4K8JA 4C92B 1PZID 3UI2A 2NVTB 2EQMA 3AMUA 1HFNA 4BD3A 4M7AC 4EVOA 2NYZD 1PXUA 2K5DA 3PMFA 1H9JA 1JCKB 3F70A 3JB9H 1V29B 4OIKA 3HOYB 5J3BA 4ELZC 4BB7A 2LQ8A 4E47A 4OL7A 3KLSX 1ZQ1A 2E65A 2EWNA 3CCVA 1B9MA 2ZT9C 3OB9A 1VQMT 1N27A 1LTAD 4L6TB 2A68D 3SK5A 5KCHA 2QEJC 1I6VC 1I4K1 4M75D 1EIGA 4MMKA 2JTMA 3LWHA 2RHYA 1Q82U 5I6WA 5HK0A 3OYAA 1Q81U 1M8AA 1WTVA 1JOOA 3HFOA 4XU3A 1DOMA 1PTOH 4RA8A 2P4TA 3M85A 2D6FA 2XIWA 3BZDB 1Q82C 1W4SA 3T9NA 2D5DA 1W6KA 3Q23A 1ICWA 2E12A 2FINB 2KY9A 1LV9A 1MI2A 3SXHA 1JRIA 2LQKA 4QVZA 2EPBA 2L0CA 3FKIB 3P7JA 1VQ4T 1TT2A 4DAPA 4C3IG 2XRSD 1WTXA 2DK3A 3CC4A 3E6ZX 1VQPT 2XDBA 2PZUA 3CRLC 4NL3A 1H641 1C4QA 2MGSA 5KNCA 1Q86C 3PO2B 1ZEQX 2B63B 1BCPD 3SR1A 4ZTJA 2VGNA 1VQOT 3K5MA 1D1IA 1U1TA 1CT1D 3SD4A 4IQZA 2V8JA 3L42A 3R8BA 1PSEA 4IFDH 3V05A 3QO3A 5BN5A 1ENAA 1Y8OB 3P8HA 1WQWA 1IYVA 3KLSA 1JC7A 3QKJA 1VQ7A 3VR4A 1UGRB 2L55A 2R5MA 5TSSA 1SJHD 4A4FA 1Q81C 3NK9A 5EJWA 4J6XA 4G57A 2FMMA 2A73B 1OXXK 2X69A 5COYA 2R61A 3OYLA 4C1NK 1EL0A 3R3OA 3TREA 2FB7A 1PRTC 4PLLA 2KCCA 4DOVA 2KVMA 5FROA 2QDYB 1GHKA 3V8JA 4QMGA 3GTQB 3OS1A 1UNSA 1TY0A 2O4XB 3V96A 2RO0A 1WJQA 1S72T 1GUWA 3R6OA 1H9KA 3E0JA 2YLCA 4NOYA 3PV0A 4FVMA 2OTLA 3S3MA 5L8RE 3EFXD 3CPWS 1HFGA 1KG1A 2AWNA 5EGTA 2LNVA 3CC4T 4HCCA 4DXGA 3LGFA 2K57A 5C0MA 3FC3A 2RI3A 4M7DF 3QIAA 4EMGA 3CXCS 5CK9A 2PU9B 5HK3A 5IODA 4M7DE 4IUVA 4XU1A 1WD0A 4BACA 1X01A 1O7LA 3RMHA 2LVMA 4XTUA 5GAN7 1U4LA 4DK1A 1HPCA 3VYUA 4UDUC 2A6EC 1SBBB 2RM4A 2A74C 4DQ2A 4DK0A 3RMSA 1D1KA 5KRUA 1I4RA 3KF8A 3BDCA 3DXJC 3KBGA 1F9RA 2PNRC 2L5TA 3LGLA 4M7DB 2EJ9A 5HKCA 5KEEA 5JEAG 4M77A 4E7LA 4FSXA 2EVBA 4Y7NB 4A93B 4XU2A 3CCSA 3CRKC 4RKLA 5DM63 1Q12A 1YBYA 2PMZB 1EU3A 2X6GA 3H94A 3OMGA 2BDNA 2LRQA 1GUGA 1Y8NB 4DU9A 1AHJB 1XXGA 5GAN4 2XK0A 2P0KA 1A3UA 4RGTA 4LDYA 3PTAA 4BY7B 3PIP3 3GV6A 1I4XA 1S4ZA 4K2LA 1AZPA 1GUTA 1JBMA 4K5XA 2LDMA 4OB1B 4DGZA 4FL6A 4J8QA 3PIO3 3OYDA 2L3RA 4KY5A 4F87A 3S1RB 1BCPC 3JB9D 3MA2B 3E9FA 3QYGB 3LNNA 4R8IA 2JEBI 5DEHA 2MI6A 1RCVD 5GAOn 5FOBB 1VQ8T 2YU9B 2C5CA 3M59A 1OXSC 2QQSA 2P0QA 1KQSA 4C5IA 1KC8U 5A2QE 2KSSA 4PJOC 1BR9A 1VQ9A 1S5ED 4BUGA 1OO9B 4PJOD 4L59A 5M5XB 5GMKh 3BFMA 1B53A 1SSFA 2DNCA 2L1BA 5DNFA 1OZ2A 1HTLD 4F7UF 3RUXA 2CQAA 2Z4HA 3WDNA 4KMUC 3JCMX 1ILQA 1SMYD 1SNCA 4UAIA 3TZUA 4LDVA 3MVVA 3CCJA 4F7XA 4GY5A 1B50A 3HEJA 3CBOA 2CW0D 3M56A 4L8JA 2M00A 3DMUA 3L7ZC 3CMAT 3MO8A 2HDLA 2KVQG 1PTOD 2KCNA 3FRPB 4A3IB 1LTSD 5K36H 2BOSA 1IZ6A 4KI0A 2O01E 1UB4A 1G2TA 1QVFA 1S5FD 3OYJA 5FO9B 4M7AB 1VUBA 1A3VA 3NTIA 5GMKe 4KHVA 4M7AF 5A0DA 4A53A 4G4KA 4FXKC 2PQWA 3IFTA 3PUVA 4ZRZA 1BNZA 1PFMA 5A35A 3I91A 1N9SA 1F2LA 1RTOA 3SWNB 4M7AD 2FMCA 1Y96A 5IIFA 3RIRA 2DIGA 4NKLA 2B8FA 2RB6A 4UC4A 2DO3A 1A15A 1CQVA 1ZYRD 2Z1CA 3CPWA 4RH6A 4XQQA 2I2LA 1OI1A 1JWMD 2GCXA 4HMIA 3SVMA 1BI2A 4NW2A 4A4GA 1CQFA 2FHTA 1WGSA 2RH2A 5JJZA 2FHDA 2AWOA 2KHSA 3WVEB 2OT2A 5CBAE 2YLBA 4RWSC 2E1HA 3FLGA 3KUPA 4C1NI 2EDGA 1HXDA 3INZA 3AB9A 4M7AG 4K5WA 1YJNA 4TQUS 4PJOE 3MAQA 1KD1U 4TVRA 5IGCA 1STGA 3GTPB 4H7BA 2R57A 4BI4A 3O13A 3K59A 1EIHA 4HEDA 1G3YA 1YJ9T 3A8IE 3L2WA 4BDZA 3SHLA 3IAYA 1XNIA 4FP5D 2D0QB 5J1ZA 1K8MA 1YITA 3C1FA 1MHNA 1IW7C 4OMFB 1A6XA 3RZOB 2K6AA 2F3VA 1I6HB 2IX0A 1QILA 1E0BA 2CHBD 1IKLA 2D9TA 3A7AB 4C0DB 1EZ8A 5G3LD 3J7YW 4XTWA 1EWHA 3T56B 4DAYA 2NB0A 3L2QA 3CCJT 3VUBA 3P1HA 4HAEA 4TKOB 5KNDA 3ITPA 2B2WC 1CM9A 4C8QA 3A8HB 3OIPA 1BXTA 1HQRD 1ZXTA 2JSOA 3M54A 5LJ5g 4C5EA 2KMTA 3J80E 5KCOA 4C2MB 3MEAA 5EG2A 3M3YB 4M77E 4FYDA 5D65A 5D3IB 4A3EB 4HA8A 2EQJA 1TWCB 2A6HC 4V190 2HQEA 2D62A 5CAIA 1Y7XA 2H4OA 1GHJA 3HRZC 1H3ZA 3QBYA 3E19A 3E1SA 3OYYA 1C8CA 1W6JA 3K5OA 3VYHB 4II1A 1UEAB 4HCEA 3JB9F 2EJGA 4ID6A 4KBMB 4RKBA 2KEDA 3M7NA 3U9SA 3X3MA 2AHJB 1S5CD 1UAPA 2E5QA 1BI3A 4NS5A 1B2TA 2DZ9A 1SYFA 3QXEB 3QZ9B 5A0GA 5FRMA 1VF7A 5DM7R 2F03A 2V8IA 1U4MA 1EY8A 1D5XC 5C4JB 1I5LA 1KHCA 2EZVA 3GTKB 4WRDA 3QZ5B 3S3OA 3CMET 2RJEA 4EQOA 3G6ET 2IPKD 4JRPA 1DJRD 4QQ6A 1H9SB 2LTOA 2F1MA 1M1KU 4H44C 3I4NB 3W2DA 1GJXA 3D4DA 2F0HA 3VUZA 2DTHA 5CMDA 1LACA 2XHCA 2ID0A 2EYLA 2E74C 5GAOq 4O6JA 1RHPA 3BW1A 2AUKA 2NVYB 2WIIB 1G91A 1RF2D 3S9WA 3JRZA 1G291 3EJIA 5C5LA 3MP1A 3GD7A 4ZAIA 5EPKA 2DAQA 2CGHA 1TS2A 4JS5A 3D3RA 3VA5A 2KAFA 5GAMe 1LO5D 1O7YA 4ZUJA 4BE1A 3OYEA 2CS7A 2SEBD 2VUBA 4G7ZC 3S15B 5HURA 1CFMA 3S3NA 5J26A 5FLXL 3OIQA 2B2YA 3OOCA 3ZEHA 2QA4A 4DXFA 3OYCA 1YCYA 3CCVT 2DXCA 1WJSA 1OXVA 1XWEA 2R3ZA 3DM1A 3AU7A 2DKGA 2JA8B 5BN4A 1N8RC 4KULA 1W2BS 1PSFA 4IALA 4XT3B 2K28A 4J8OA 2BE5D 2M0OA 2XU8A 2H3JA 4X3KA 3JCMd 1VQLA 3S14B 4K14A 2XSCA 1FNVA 3OWEB 3MZ5A 3Q0AA 3N6RA 1TWHB 3FB9A 3S17B 3SK8A 1BO0A 3S2DB 4HCSA 1G8ZD 3QWNA 5EKLA 5C5MA 4KKUA 2LCCA 1I3QB 3GTJB 3A8OB 2K5LA 1D2BA 4E6IA 3E9GA 5IOCA 1EQTA 3BDOA 5E4WC 2F0FA 2B8AA 1VQMA 2WB1B 1Q7YC 3SB2A 4C3IB 1LT5D 5I6YA 1BDOA 5GAN3 1M1GA 2CZ6B 3J7AF 2B2WA 2MMPA 1UGSB 3M4YA 2MAMA 2IJ0A 3NWTA 5LJ3f 1XOVA 2L9HA 3NQTA 4I7ZC 4KKTA 4KN4C 3UT1A 4NMZA 5GANh 4A3DB 5FRNA 5GANf 2F0NA 3A8JE 5KGUA 3NBHA 4C92A 5LJ3h 1QNKA 4HN7A 4O5VA 2E2HB 1PTOC 4F7UG 3JAML 1J9OA 4QW2A 3KLRA 1QNUA 2PUKB 2RA4A 3ZBDA 4A4KA 3S2HB 2ZPIB 2TSSA 1DD2A 1FX7A 2KEEA 1IHZA 2L5QA 2A3LA 2DZCA 1NCVA 2BCOA 1SMYC 3A7LA 5CCAA 4PNOA 2QF7A 3A8KE 1CHQD 3GO5A 2RK2A 3OBYA 5CKHA 2RQXA 3KK7A 3MEHA 5JPNC 1I8FA 4R56A 3Q1JA 4D6WA 1D3BA 2E6NA 4BY6B 1EWCA 1R4PB 2PO4A 4KJOA 3TBIB 3SEBA 4FNFA 2XWJB 4CBVA 2ZXOA 1TS3A 1HUNA 1DXMA 3JCMc 4C92C 1WTRA 1ILPA 1F9QA 3JCMh 5DM73 1EY7A 5FU6B 4BI3A 2F0UA 4M77F 1R9TB 3FDRA 5DAUA 1EY6A 1FD7D 2RHZA 1VQLT 3HOXB 3G6EA 2XIDA 1N6AA 3OSSC 3JCMP 1BYMA 2EYMA 2I07B 4O42A 4OO1H 4N9TA 3P75A 4TSSA 4QVDA 4MZMA 4OB2B 2OTJA 5C4HA 3JCMb 1DOLA 2OF1A 2Z4IA 5IGEA 4C0DC 1VQ6A 4L6V5 1X3PA 2F0IA 2B2UA 3CCRT 2KECA 2HNIA 1CK1A 5K5PA 4DAVA 4WF2A 3CCLA 2EIFA 4JDSA 1HK9A 4RGNA 5CKFA 3OSOA 1DCZA 2QDBA 3J81E 2H1EA 3RZDB 2RD1A 2G3RA 1RTNA 2XKOC 4KHZA 2DJZA 1L0YB 1AP0A 4ZGDB 2ZGWA 2ZZDA 5IGBA 2QA4T 3VYRA 3URYA 2RI2A 2JE6I 2HUGA 2B2VC 4I65A 5FO8B 4M75B 1MGSA 2F0GA 3F2UA 5M3FB 4OHJA 1QVPA 4OO1I 4C92E 3EFRA 3CMAA 3RD4A 2SNMA 1JICA 1KQ2A 3QUIA 1FYCA 2M2LA 3VV0A 2B39A 3P8DA 1L0XB 3DEOA 5I21A 4BE2A 3Q6SA 2KQWA 3L1AA 4HT8A 1GXIE 2XDPA 2XWBB 1OYXA 1RI0A 1IYUA 2EY1A 1VQKT 1C48A 2BE5C 2NN6H 1YIJA 4B9WA 2F4IA 2K33A 1WPYA 2QXFA 4Q5VA 1O9SA 3SWNA 1QWYA 5JPMC 1HUMA 1G2SA 2JXMB 3V7RA 4C5HA 4WFN3 4A3BB 5BN3A 1YNJD 3I4MB 1M1FA 3OQ5A 1DJ7B 3K58A 4BY1B 4FU6A 3CMEA 2X4JA 3V7CA 1HA5A 3HS0C 3K0YA 4Q0FA 1GXDC 3H6ZA 2VUMB 4OB0B 2WINB 4KV6A 4XTZA 4NP5A 3IL8A 2A5HA 2F3WA 2E76C 4K2KA 2OTLT 5GANe 2K5WA 2J4XA 3E5SA 4RMO