4B9XA

Structure of extended tudor domain td3 from mouse tdrd1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
196
structure length
194
Chain Sequence
LEWTWVEFTVDETVDVVVCMMYSPGEFYCHFLKDDALEKLDDLNQSLADYCAQKPPFKAEIGRPCCAFFSGDGNWYRALVKEILPSGNVKVHFVDYGNVEEVTTDQLQAILPQFLLLPFQGMQCWLVDIQPPNKHWTKEATARFQACVVGLKLQARVVEITANGVGVELTDLSTPYPKIISDVLIREQLVLRCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TUDOR DOMAIN-CONTAINING PROTEIN 1
publication title The Multiple Tudor Domain-Containing Protein Tdrd1 is a Molecular Scaffold for Mouse Piwi Proteins and Pirna Biogenesis Factors.
pubmed doi rcsb
source organism Mus musculus
molecule tags Replication
total genus 42
structure length 194
sequence length 196
ec nomenclature
pdb deposition date 2012-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00567 TUDOR Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4b9xA02
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4b9xA01
4C5EA 3LGFA 4KY5A 3S3NA 2F0UA 4DU9A 5NUCA 1A3VA 1EY7A 3LLRA 2LTOA 2D9TA 5I9PA 2R58A 1OZ3A 3PMIA 3SHLA 1A2TA 2F0IA 1EY5A 2PW5A 3OS1A 4KD3A 5KIXA 4LAAA 2EYMA 2F0NA 2F0JA 3SK5A 5C4HA 3OYIA 5IIFA 2EFIA 5KCHA 3ASKA 3EJIA 4ME5A 2F0TA 1WJQA 3O8VA 4DF7A 3NHHA 1EY6A 4RKLA 4WRDA 5EGTA 3QBYA 3QIIA 5KYIA 4ZQ3A 2XDPA 4IUPA 4B9WA 3UT1A 4K5VA 3L2RA 1SYCA 3S3MA 2HQXA 3META 1SNCA 4K6DA 4BE0A 1KDAA 1SYDA 1EYDA 4J6HA 1TR5A 2VYTA 4N4HA 2PW7A 1XNIA 1OZ2A 1SYEA 2EY6A 1IHZA 2NUCA 4KY6A 4EVOA 4N4GA 1SYFA 4F8MA 5CV6A 2RHUA 3VA5A 2PYKA 2EQMA 3SD4A 5K5PA 2NLUA 3DB3A 4G57A 2PZTA 5CIUA 3OSOA 2PZWA 3QB3A 2EYFA 2X4XA 2BKDN 4K8IA 4PMCA 4R8NA 4BDYA 4UC4A 2X4WA 3OWFA 3U9OA 3D8GA 2L3RA 3FEOA 2HQEA 2DIQA 4IUNA 4X34A 4KD4A 3C1FA 3OYBA 3E9GA 5KH6A 2L89A 4NKLA 5DEHA 5FRNA 1OI1A 4N4IA 1SYBA 3D4WA 1SSFA 2RKSA 4IUUA 5ISRA 4YIJA 4DFAA 3MP1A 3MZ5A 3OY9A 4A4GA 4C5HA 2F5KA 1SYGA 3OYHA 5CV9A 5IODA 5C0MA 1WGSA 2JZ2A 2EYPA 2EY5A 3MP6A 4N9PA 3OS2A 2G3RA 2MWOA 2LCCA 4ZUIA 5IGEA 3OQ5A 3GOXA 4N9TA 2QDBA 3EAEA 5KYLA 3DLMA 4KY7A 5CV5A 4IKFA 1NSNS 5IN1A 3MVVA 2EQKA 2KQ3A 1EY9A 1JOQA 3MEUA 4TRDA 4ODGA 3KUFA 2F3WA 2RBMA 5KRUA 3RUZA 4OL7A 2R57A 2RHYA 5KE3A 4HMJA 4K5XA 5F2DA 3EVQA 5IGBA 1STNA 2O4XB 5CV7A 2K3YA 3OMGA 4E7KA 5C6AA 4NP5A 5J26A 4GY5A 2EYHA 1EY4A 2SOBA 4EQPA 4E7IA 3OYJA 2YRVA 2F0FA 2E5QA 4II1A 1ENAA 4Q5WA 3OS0A 2M1HA 4BDZA 1SNPA 4K5WA 2K3XA 3LH0A 3OYAA 3TMEA 3FC3A 4PL6A 4PMBA 5EKKA 5JOBA 5C3WA 2F0QA 4NDXA 1SNDA 2WACA 2RJCA 2F0SA 4NMZA 4QW2A 3L2VA 1EZ8A 5FRMA 1RKNA 4E7LA 4KV6A 4QQDA 1STAA 2F0WA 1KDBA 2F0LA 3C1EA 2BIVA 4KJOA 2EYOA 2F0EA 5KCOA 2RHIA 3CEYA 2E6NA 1KHCA 5E3FA 2M0OA 3DMUA 4RKBA 3P75A 3C4SA 3SXHA 2LRQA 4QVZA 1EQVA 5IGDA 3SK8A 4QQGA 2X35A 3OYGA 3F70A 4J1MA 3ZEHA 4I65A 3QKJA 2LKVA 1WJSA 4FL6A 4E7JA 2RI2A 3PMTA 3V2TA 4BE2A 4QMGA 1RI0A 3D4DA 1TQOA 1KDCA 2PZUA 3S6WA 3NK9A 5CV8A 3OYFA 5KEEA 4PLIA 4E6IA 2IG0A 1KABA 5E1FA 4A4EA 4EQOA 4CRIA 2QQSA 3EROA 3ME9A 2EYLA 3L2WA 5D6XA 1JOKA 4K14A 5C6SA 3DHQA 4KHVA 5EKLA 4IUVA 1ENCA 3LGLA 4C5GA 4QF4A 5KE2A 2PQEA 1F2MA 1F2YA 5CV4A 2FHDA 3P8DA 2F3VA 4WORA 1SNOA 1STYA 3SK6A 2ENBA 3MEWA 1U9RA 2GFAA 4FU6A 4A4FA 3PNWC 2RHXA 3QOJA 3P8HA 3LX7A 4IZ8A 3SR1A 2OF1A 4RG2A 4S3SA 1STHA 2EQUA 1EYAA 1F2ZA 1JOOA 4PLLA 1KAAA 2EYJA 3TP7A 4K2KA 1N27A 2RJEA 4ZUJA 3H8ZA 4IUQA 1G5VA 2M16A 4HCZA 2RI5A 5J22A 5CR3A 2DIGA 2RHZA 4HTHA 1EYCA 2X4YA 4EDUA 3OYKA 5M9OA 2GFUA 3NTHA 4KTAA 3HEJA 3OYEA 2P0KA 2OXPA 3QJ6A 4B9XA 3ITPA 4L59A 4DGZA 4QQ6A 5D6YA 2L8DA 3T13A 2EY1A 3MEHA 5C5MA 5IOCA 1SNQA 5C4ZA 2MWPA 3MEAA 2LDMA 4KJNA 2F0MA 2F0DA 2F0GA 2GF7A 4IUTA 2KHSA 3E9FA 1OYXA 1A3TA 3OYNA 4LD6A 5J39A 2SNSA 2EY2A 2F0HA 4EQNA 1SNMA 3S9WA 4C5IA 1EY8A 1TT2A 4OVAA 4IALA 2RI3A 4BD3A 5DAUA 4PNYA 1A2UA 2BUDA 5CC4A 3OYLA 3Q1JA 4E7HA 3R3OA 1STBA 3ERQA 5FROA 3OYDA 2B8AA 1MHNA 3P1HA 5I9OA 3OYMA 2EXZA 4QB4A 2M00A 4IURA 4A4HA 3BDLA 2F0PA 1STGA 3QOLA 4ID6A 3MHBA 4F7XA 1WJRA 2RJFA 4K2LA 3S3OA 1A3UA 5HGTA 1EY0A 2CKKA 3UWNA 3H6ZA 4BACA 2F0KA 3NTKA 5JAVA 3MXPA 3MP8A 5KGUA 2RDFA 1H3ZA 5IAYA 5IGCA 2RJDA 5I6YA 2OEOA 3MEVA 2R5AA 3L42A 1NUCA 2PQWA 3TP6A 2EQJA 3BDCA 5C5LA 3LX0A 3NTIA 3D6CA 2O4XA 3T16A 3H6MA 2RO0A 3MO8A 3OB9A 4BE1A 3L2QA 2XK0A 5J1ZA 5IGFA 4HMIA 4MIUA 4Z02A 3FDRA 2EKOA 2QQRA 2LVMA 3OMCA 4ZTFA 2F0VA 3LYIA 5HURA 3FLGA 3HZXA 3PMFA 5D6WA 3M9QA 1JORA 2JTFA 3OYCA 3NQTA 5I6WA 3NP8A 3TP5A 3E5SA 5IGGA 3PFSA 3TP8A 5CGKA 1II3A 3L2UA 2F0OA 4H7BA 3NXWA 2DAQA 3OA6A 1EZ6A 4NS5A 3NUCA 4K8JA 3SK4A 2SNMA 5C3XA 2R5MA 1AEXA 4ZTJA 3DB4A
chains in the Genus database with same CATH superfamily
4DV3Q 1PXUA 4C5EA 1E2ZA 4QVCA 3S2HH 1TUCA 5KYXA 1OXTA 3S3NA 5IT9E 4M7AC 2NUTA 1X3QA 1SR3A 2NB0A 3HOZB 1VQFA 2WIIB 3LLRA 3A8OB 1O75A 4RTWA 4DV6Q 5LJ3j 5C4JH 3CCUA 1TWCH 4DNRB 1RABB 4PJOB 1S5ED 3H3VI 4DR6Q 2KXCA 5JPMC 3SHLA 3EH1A 1A2TA 2PW5A 1M2VA 1PH2A 4E6RA 2ZAEA 2Q8IB 1EIYB 4O5VA 1NEBA 3U4VA 2F0NA 1LLRD 3H3VC 2CYZB 3OBWA 3EGXB 4C0FA 2K01A 1EOTA 1M1KC 3RD4A 1H9SA 1KD1U 2F0TA 5LJ5j 4DKAC 1WJQA 3TSSA 5A0GA 5CK9A 1BR9A 2LCSA 2CP5A 4LUOA 4IOCA 5GANh 2OWOA 3P7JA 3X3NA 3QBYA 2YT6A 2FZGB 3QIIA 3BVGA 2LQWA 3K7UC 2JA6G 2FHTA 1BCPC 4ZQ3A 2MOXA 4FIBA 1YP5A 3ZL7C 5CKBA 1L0WA 4V190 2ED1A 3UT1A 4K5VA 2J06A 1NR2A 2JA9A 4A3MG 4M78B 2AUKA 3A8HB 5CQXA 3VS4A 5M3MB 4P5NA 5KYWA 1MI2A 3SEBA 2AT1B 3QXEB 2E2IB 1DJRD 4C92D 1VQ8T 1GXIE 2VYTA 3J81E 3TBIB 4XTXA 5FO8B 4JI1Q 2KBNA 3PV0A 3LH5A 3M54A 3I4OA 1SYEA 2NUCA 1I50B 4C0DC 2OI3A 5GAMg 1VIEA 4N4GA 2ICIA 3FP9A 1N33Q 3EG9B 4A3BB 2FEIA 1SYFA 1Q1EA 3E9HA 1C8CA 2OX7A 5HY6A 1ZXTA 1QB5D 2C5CA 1HFNA 1A8VA 5CV6A 4ESRA 3VA5A 3E0JA 3GTOB 5LL6S 4BY6C 2BDNA 4JLIA 3FKIB 1VQOT 5K5PA 2HEQA 3PVQA 1PRTF 2NLUA 2NTTA 4GOPB 4XU0A 3VS1A 4CGYB 3GTMH 4IIMA 4G57A 1S1NA 2EDGA 3E0EA 2UUBQ 1KQSA 3D6WA 5AYFA 5CIUA 3OSOA 3JCMd 4BY7H 4OWXB 4AG1C 1T5XD 2K50A 2BKDN 2V8JA 3CCST 3PIPA 1GCQA 1PHJA 1MSGA 1ZBJA 4Z88A 4R8NA 4A93G 4BDYA 1BKBA 4CJ1B 4C92A 4DNTB 1N5ZA 2ZXPA 1SPKA 3TSZA 2KENA 3U9OA 5HK3A 1I4PA 2L3RA 3RMHA 4M77D 2HQEA 3VA7A 3CC2Q 4X34A 3SWNB 4M7DB 3RBBB 1W2BA 2ZPHB 4OMFB 4C8QF 4PZ6A 4FYYB 2XIWA 4JI4L 3HOWB 2DA9A 2O9VA 1VQCA 2QEXA 3GTGB 3X25B 3X26B 2CT3A 1ZSZC 2MF2A 1W70A 3M4YA 4KBMB 2HDLA 1KRTA 3AT1B 2LT1A 4ABNA 1SYBA 2KCMA 4RCCA 1NMFA 4YIJA 2O2LD 4A3FB 2OJ2A 1GHKA 3S1QH 3OY9A 3QO2A 3F2DA 1SDFA 2VQFL 3S16B 4A3MH 4VUBA 8AT1B 1G51A 3SHWA 4LDWA 3R93A 5FU7B 3MP6A 4O42A 2KAFA 1RIPA 2RCFA 2KQWA 1NCVA 4OO1I 1ASYA 4GLAC 1U1TA 2MWOA 1MMAA 1HTPA 1CQFA 1JJCB 3G6JB 5M5WB 4N9TA 1DJ7B 4M77A 4KHZA 2QDBA 1O7ZA 3QO3A 1BCPF 2WB1E 4A3IG 2HSPA 4X6AH 4C92E 5CV5A 5CR2A 1M4VA 3R6OA 3WVDB 2V26A 1Y57A 4JJCA 5IN1A 3MVVA 5BR8Q 5A0LA 4HIMA 4HAEA 1QCFA 1EY9A 1FNVA 1VQ5Q 2K4YA 2LQKA 1Z7TA 3QWYA 5GAN4 1ESRA 1HUMA 1KFZA 2G9HD 3RUZA 3V7CA 2VXWA 1C7YA 1B34B 2R57A 3E1SA 1LTSD 2JM8A 4HMJA 5F2DA 2HDAA 1UJYA 2VXEA 3GP7A 3CCMA 1XNRL 1M90R 2CVRA 3ZYYX 3M0QA 5IYBH 2JOYA 2O4XB 2DD4A 2I0NA 1B70B 1XPRA 4HXJA 2K3YA 2WSCE 2DL5A 5J26A 3NPPA 1VQNQ 2OCEA 1GOZA 4GY5A 2QQBA 2DPPB 3KF6B 2LSSA 4DV0L 3CRLC 2MIOA 3PCOB 1D1BA 2L0AA 3VR3A 4E7IA 1EU3A 1QZHA 5GAMf 4LWCA 2KRSA 4FYDA 3OBYA 4JI6Q 2CUDA 3TVTA 4JI8Q 2B2VC 5D3DA 2K04A 3CBPA 4DV7Q 4LF5L 1ENAA 4Q5WA 3OS0A 2A6EC 4BBRB 4ZN3A 2M1HA 4MDWA 2VUBA 4BDZA 4K5WA 4KGZB 4DV3L 2EZVA 1MIUA 2GBQA 2JA5G 3UPUA 4IPGA 3OYAA 4R4OA 5GAHC 2K5WA 1UUEA 5JOBA 5KNCA 5GAN6 2F0QA 5C3WA 1H8KA 5GADC 5GAEC 1K8MA 2WACA 4DV6L 5FWCA 1LM0A 3CMEA 1UJ0A 5AJ3L 4F7UF 2C35B 1ZBXA 2SDFA 3STBC 3TU4K 4KV6A 1YJNQ 3GNGA 5M3MG 2ZTCA 3PO2G 1HHVA 2R3ZA 1STAA 1PRTD 2ZXOA 1KDBA 5IP7H 5GMKh 5JJIA 3QWXX 4RGMA 3C1EA 2K2VA 2NVXB 3I2ZA 1BU1A 2EE1A 3BG3A 2ZPFB 2EYOA 3TEHB 2JK8A 3BY7A 1JO8A 1KLGD 2RHIA 2E41A 3JV3A 2M0OA 3RZOB 1K28A 1BBZA 1UGSB 2LT4A 4RKBA 1UTIA 1UGPB 3P8BB 3TZDA 4X66Q 4LD9K 1Z9FA 2Y0SG 3HSBA 2LMCB 4CJ0B 1CKBA 1QVGA 1VQ7T 2ZJPA 1PM3A 3HTRA 1EL0A 4M7AD 4QQGA 5FU6B 2X35A 1RODA 2ZJRA 1CSQA 1QVFA 2R92H 1R0BG 3QJYA 2QILA 3FKIG 4HSVA 2R93B 5GANe 4I7AA 3FRNA 5LMNL 1PD1A 2QI2A 4Y92A 3QKJA 2LKVA 4A3CH 2K5DA 4LF9Q 5M5YH 1I3QB 3GD7A 2YUNA 3CC7T 2I5MX 4LFCL 3WOFA 1VQ9T 1EIHA 1N9SA 1PZJD 4G7HC 1AT1B 3JB9I 4P74A 3S14H 1LTLA 4AFUC 1J5EL 1I6HB 5D14A 1PYBA 1NY4A 3D4DA 1TQOA 4RWSC 1L1OA 2R7ZB 2L3PA 1W6JA 3OYFA 2X3WD 1X56A 5KNBA 2DUDA 1D6EC 5A2QE 4JI2L 4A4EA 4JJNK 2BA0A 4CRIA 4M7DG 3Q6SA 3HOWG 1AFPA 3VYHB 5I21A 4AIMA 4XAXB 2N3SA 1BCPD 2QQSA 3SDZA 1TWBA 4M7AA 3C2PA 3VRYA 1KC8R 4L5QA 4YY3Q 3REAB 5D6XA 3RR5A 5K36G 2UUBL 1QILA 5KYUA 5C6SA 2WINB 2Q2IA 1I94Q 1G291 2KVMA 2KSSA 3HOYB 1F9QA 1HFGA 5KE2A 1JR0D 4X62L 2EVRA 1K4US 3T1HL 3P8DA 1AZGB 2K5NA 1Q12A 3RNUA 3DUZA 2B63G 1X65A 5C3EB 4Y52H 2LCLA 5IWAQ 5LMUQ 4R9WA 1BNZA 4NXMQ 2XSCA 5FLXc 5I22A 4JBWA 1PHTA 3O5ZA 3OSVA 4WFN3 3RUXA 4IPHA 3ICEA 3CCJQ 1ILQA 4LDXA 3PF4A 3VS3A 4DV4Q 1OU8A 2VL6A 2KCCA 3HOVH 2VZAA 4YCVA 2A68C 2NVQB 1I1JA 4PJLA 1STHA 3PQIA 1BBUA 3MPUB 3H0HA 4F16A 1EOVA 2EQUA 2KK4A 2V4DA 1KAAA 5TSSA 4PLLA 4M7AE 3AU7A 2CSQA 4FW2A 2RJEA 2V1CC 3RMQA 4V0BA 1PZKD 3CCQA 1SSOA 2HQHA 1K83H 1QVPA 3QUIA 1VQLT 2B2YC 4FF4A 4RCNA 4KUIA 4HCZA 1PCXA 1XTDA 3GTJH 2EOTA 4DAMA 1ENFA 2KJXA 2DIGA 1HNWQ 2PI2A 4YWLA 2PNRC 2L11A 1CK1A 2DXUA 1DYQA 4DR1Q 3GTMB 1YIJA 1FMVA 3PGGA 4HEDA 2EAYA 2RQXA 1Y71A 3OYKA 2K5QA 5M9OA 5BR8L 3GTPH 2QEXT 4KI0A 4GN4B 3L3OC 3OYEA 1AHJB 2P0KA 2EW3A 4OB2B 2OXPA 4B3SQ 1VUBA 1IHWA 3SE0A 3ITPA 2YXYA 3P20A 4L59A 5CKEA 4BBRG 4C2MH 2OTJQ 3I4MB 4LUVA 1VYVA 1SSHA 4L6V5 1D1KA 1VQMA 1OOTA 3JB9F 1JCKB 3ULPA 4M75F 4OF1A 2JUFA 4QQ6A 2L8DA 5D6YA 4POFA 3T13A 3X3MA 1XMQL 2R6GA 3MEHA 3DWPA 4C3JG 4KUDK 1GXDC 4AMCA 2KECA 2X6GA 2F4VQ 1W1FA 3K0YA 3MEAA 4KJNA 3VYGA 1H9KA 2FYKA 1QG7A 4RAUC 4IFDJ 4HKEA 4LF8Q 2EYZA 2R7FA 4IUTA 1SJED 3NHNA 1IYVA 1MJCA 3E9FA 1OYXA 1ZSZA 1A3TA 4XTVA 1YVCA 1FXXA 2PI2E 1K0XA 1BXTA 4PJOC 1KD1R 4RTVA 2EY2A 3CCLT 3REBB 2RVLA 3M0RA 4DV7L 2ROLA 1YITT 1VF7A 2ZXRA 3V7RA 2CP0A 4GBQA 3OW2A 1YJWT 2FFKB 3HGBA 5DAUA 1VQ5T 2MHVA 2XDDA 1A2UA 3T56B 1CQVA 4DAYB 5CC4A 1EYGA 3VS7A 3SFMA 3C94A 3I56Q 3THKA 3HOXB 3EA6A 3HKZB 1STBA 3SEMA 2XRQD 2R93G 1YNXA 3HFNA 1KTKA 1EEFD 2P4TA 1X9NA 3VDYA 3KLRA 1LTID 3M4OH 4QB4A 4BWGB 1JJ2A 4HCKA 1I5OB 2M2LA 1WA7A 3VR2A 3PF5A 1QZGA 5IH2A 1JU5C 1EQQA 2C0IA 4M78C 3T1YL 2DKGA 5GMKe 1YHQT 5D65A 2A6ED 2ZZDA 5DM73 1NJIU 1M3BA 1A3UA 2Z0SA 3AFPA 5IT9c 2W0ZA 1N36Q 1HJDA 1EU4A 5EKIA 4X66L 4TSSA 4BUGA 4IIOA 2F1MA 4FYXB 4AYBE 5GAMd 2CWAA 3H6ZA 4BACA 3NTKA 2LJ3A 1OU9A 4JRQA 1K76A 3MP8A 3MXPA 1D7QA 1H3ZA 4JZ4A 3JCMV 2IL8A 2DLPA 2VW9A 1WTPA 5GANg 5I2XA 3CCVQ 4FVMA 1PWTA 1XJWB 3N5BB 7AT1B 2DFUA 2OEOA 3STBD 4C1NI 3NQIA 4LF9L 3MEVA 1AD5A 1Q7YU 2R5AA 3CC4Q 3A8JE 3GIBA 1NUCA 2PQWA 2UXBL 3AMUA 3TN2A 2G5DA 2E2JH 2UUAL 5C5LA 5GAOl 3VKIA 4HCEA 4GOPC 3I4NH 3BJUA 5J3BA 5JJZA 2JJ9A 3NTIA 4YCUA 3F2UA 1OX8A 1TWGH 4IPCA 2PCFB 1Q8KA 2B2VA 4A75A 3S1RB 2HCIA 1U4RA 3LW5E 1MSHA 4L5RC 3H6MA 2L5QA 2E74C 1BI2A 1O7YA 1IO6A 4XYQA 4MZ9A 1YJ9A 2UU9L 1ABQA 4BY1H 9ATCB 4JYAQ 4BI4A 2D2CC 2DVJA 1WNLA 2NWMA 1C9OA 4M7DC 4DR2L 3DM3A 2WSFE 1LACA 2XICA 1SMYC 1SN8A 5ELNA 3J81c 2EKOA 1I94L 5I11A 1ONLA 3LYIA 4A53A 3PMFA 1OEBA 5C4XB 2AZSA 3OYCA 3TZUA 1JE5A 3INZA 3NQTA 1EFID 2HBWA 1QOHA 1H641 5IY0A 2EVBA 3WXMB 5IXBA 5FOBB 4NXML 5IWAL 5LMUL 3K80C 1Y96B 4DA2A 1Y69U 1WX6A 3JB9D 1VQ8A 1QMCA 1M30A 4H7BA 4C8QG 4NS5A 2PQAB 4K8JA 4DV4L 3SK4A 1Q86U 1PSEA 1U4MA 2LX9A 2DNCA 1VQ4A 3I8ZA 2AMCB 5JEAH 3G6EA 3ZJYC 3S14B 2IJ0A 4RTTA 4D8DA 3DWQA 4OEMB 5DM63 3HPWA 1I4XA 5CBEE 1VQ6T 1VOMA 2GNCA 1I07A 3M5AA 1RAIB 2QXFA 2JA7H 2B86A 4HJ8A 1QUQA 1VQOA 4CBVA 4ZLTF 1OXUA 5GAOn 1TWAB 4XU3A 2CQAA 5BN5A 4DA4A 1BIAA 2D9TA 1G83A 4NW2A 1YCSB 4ME3A 1OZ3A 4Z89A 4OB1B 1UB4A 3VR6A 5KYYB 2RN8A 5HK0A 1EY5A 3CCSA 1N9WA 1BCMA 2A69C 2WKCA 1SFOB 2KOLA 2GTJA 2ENMA 2B2WC 4NB3A 5C4HA 2HL5C 1K8AC 1TU2B 3SK5A 2H4OA 3A54A 4G7ZC 2Y4XA 5IIFA 1ZSGA 3CPWP 2B8GA 2D0OA 2KA7A 2DMOA 2EFIA 1UDLA 2CREA 1LJOA 2DJQA 1ICWA 3EGDA 1ET9A 2A68D 2K2MA 2E75C 1Y14B 3O8VA 3W1BA 4DF7A 4BA2I 1QWYA 2P4RA 3NHHA 2DVEA 4RKLA 4B3SL 1N8RU 1RDPD 4HJ9A 3U23A 5EGTA 5EAYA 1TUGB 2JA6B 5COYA 1SJHD 4G4KA 1XMOQ 3D4RA 3NENA 4L5SA 2M02A 4DBQA 2XDPA 3SVMA 3KBGA 5GANf 3M0TA 2DNUA 2YTVA 1PTOB 1Y8OB 4KKUA 4KHPQ 4HT8A 1IXDA 4FCYA 2QK0A 2FZKB 4C0GA 2SRCA 1SYCA 3CCQT 1TY2A 2VGNA 3HKZG 3META 3PVLA 3J80E 1Q7YC 3GTQH 3I55Q 2F4VL 1KDAA 3H91A 4C3HH 3PGZA 2YU9B 4GLMA 2K03A 2KROA 2JW4A 2OTLT 1EYDA 1SYDA 4J6HA 4A3JH 1OX9A 1TXQA 1LT6D 1TR5A 3BVZA 2PW7A 5M5XB 3I9QA 4LF8L 3KLSA 1YIJT 4JJBA 2AWNA 1IHZA 4KY6A 1NM7A 1TSFA 1Y8PB 3I72A 1GKHA 2DX1A 1V43A 4MNOA 1SXTA 1M1KU 1NBEB 4PV1C 4Y7NB 4MZPA 5IYBG 1HNZL 2E3IA 1JWSD 2K79A 4F8MA 3F2BA 1PH5A 1HZAA 2NZOA 4XT3B 3JRZA 3K81C 3OYYA 4RG8A 1HXDA 1SHGA 2E5KA 3PO3B 1X69A 3GLXA 3S1MH 3DB3A 1EEID 1X75C 4C92F 2B2YA 4DAVA 3GV3A 2COYA 2IIMA 4OMQA 2EYFA 2NVTH 4F7UG 2DM1A 4A93B 2MCNA 2K7VA 3KF8B 1PH6A 4UC4A 3GF5A 2X4WA 1AVZC 2CW0C 1HRJA 2EQSA 3RN2A 2FVUA 1DGSA 2EBPA 3R6NA 3D8GA 1R9TB 2A08A 3FEOA 3OWEB 2DIQA 1IHVA 2COWA 3GBQA 4PJOD 3I70A 3UATA 1ZX6A 4FT4A 3C1FA 4PG3A 3E9GA 2NVYB 5KH6A 1Q86C 2L89A 2DILA 1E6GA 2P0QA 3UA7A 4LMQD 4N4IA 5CVIA 2K52A 5DEHA 1PH8A 1OXSC 2RKSA 4FXKC 2RNAA 3GTKB 2H5XA 4DK6C 2FO0A 2RA2A 5ISRA 4MN3A 4DFAA 4XIGS 3G1JA 2CP2A 3KLWA 5IP7G 2P84A 3G4SA 1T0HA 1SYGA 3OYHA 5CV9A 3VV0A 2EYPA 2JZ2A 3NBHB 1G2BA 4RH6A 3VR5A 3NMZC 3E6ZX 2HCKA 1SHFA 1IKMA 3OS2A 2A3LA 1LCKA 3I56T 3S2DH 1Q81R 2LCCA 1VQKA 1PFNA 5IGEA 4J6XA 3UDIA 1LT3D 2HD3A 1F1BB 3L9AX 4M78D 3PIO3 1JICA 2NUPB 3DLMA 2XDBA 4PJOA 4R4QA 4GNXB 4X3TA 2QTXA 3H41A 3ERSX 3L0OA 1NSNS 2YDLA 2R92G 3PUYA 1MV3A 3PUVA 3FMCA 2K3BA 2KEEA 3T9NA 1TY0A 1N34Q 1K1ZA 1KIXA 3EGXA 2F3WA 2RBMA 3J7YW 5KRUA 4LF5Q 3A1PA 3VS5A 4MMLA 3I5RA 4A3KH 1NE8A 3K7AB 2DL4A 2RHYA 1VQ7A 1N6AA 4LF7Q 5KE3A 4IFDI 2Z8LA 1LTTD 3HOUH 2KT1A 4FYVB 2Q2HA 2MPXC 3DWAA 3FRPB 5CV7A 2C06A 3CCVT 4E7KA 2QQ9A 2ZPGB 4KN7C 5H1SE 3CC7A 2MP1A 4XXEA 5AJ3Q 2EYHA 1VQ9A 1EY4A 2SOBA 4M78A 2NN6I 5GAN5 1WCMH 1E1TA 1RHPA 4JI3L 3I7FA 4EQPA 3OYJA 1VQPQ 3E9IA 1ZYRC 4LDVA 4PJOE 1HH2P 3HL8A 5DLQE 1YJ9T 3EQLC 2E5QA 5GAOq 1RJTA 5GROA 4DXFA 2JA5B 4ZNXA 4M7DD 1HTLD 3PT9A 2X6LA 4JRIA 3PTAA 4JBKA 3C0CA 3EG9A 1SMYD 3TMEA 1X2QA 1I4QA 4OX9L 4PMBA 4BB7A 1TWGB 2DTHA 1S5FD 2AQ3B 2X51A 1EX4A 1AWOA 1SNDA 4P75A 1FNWA 1W6XA 4DBHA 3ER0A 1ICFB 4XK8E 4QW2A 5FLXL 5LMNQ 4GOPA 1EZ8A 1RKNA 4E7LA 3PO2B 1SF9A 4LFCQ 4A63B 2F3IA 3OHXC 2XG8D 4QKUA 1X3GA 1TG0A 4CDDC 3HOVG 2RB6A 2YTYA 2MUYA 4X64Q 1HSQA 5LJ5h 2Q8TA 4C56C 2PUOB 1JB7A 5GMKm 1J5EQ 4ORZA 5CKHA 2N8NA 4M78E 3CQZH 3MC0B 4RCOA 2G6FX 2A6HC 4POGA 1KHCA 3M59A 1XPOA 2N49A 2BH2A 5E3FA 2NUTB 3I3CA 1YN8A 2CH4W 4YTLA 5D7UA 1QKWA 1VQ4T 4E7ZA 3DMUA 2NYSA 4JI2Q 3G6ET 2Y0SB 1YNNC 1GUOA 3P75A 4K6LA 2D5DA 3OPOA 3UF4A 1ACMB 4QVZA 3CCEQ 5IGDA 1TWFB 1WJJA 1XMOL 1F9RA 1M2VB 3OTOL 2I0QA 1ZUKA 4KHPL 4TQUS 1ZA1B 2BZXA 1AWWA 1AWXA 4FL6A 1CZWA 4C3IH 2A69D 3A5UA 4EIKA 4E7JA 1XXGA 1DOKA 3CPFA 2AQ1B 3FEWX 2RI2A 3PMTA 2QG9B 4LDYA 4X62Q 1IKLA 4QMGA 1K3BC 1VQLA 3T1HQ 4A3DH 1RI0A 2VC8A 1IB8A 3CAMA 4DUYL 1T3SA 3X20B 3H3VH 3CW2C 2JA7B 4RTZA 4WJ3M 1V1QA 5CV8A 5KEEA 5GAOr 4PLIA 4JBMA 1WXTA 3S1NH 1SE3A 4M7AF 3HFOA 3CBOA 1KABA 1NJIR 3AQQA 4RHSA 2M9VA 3M55A 1X6BA 5CORA 1PH1A 1GFCA 1CKNB 1A62A 4AFSC 1BF4A 1UWVA 4ZAIA 3ME9A 1WI7A 2EYLA 3BYYB 4M7DE 3BU2A 3RLFA 2XKOC 3H9NA 1KQSP 2R7DA 1OPLA 1ENCA 4NPSA 4QF4A 2QYZA 4HCSA 1QW1A 5GANd 1SRUA 1FVIA 4JBJA 2QKIC 2DEUA 3I35A 2D8JA 1PYWD 1NE3A 2B2WA 2B63B 4LNPA 1JQYD 1SNOA 1QCNA 3TS0A 1X3EA 4HIOA 3I55T 2ENBA 2OQ0A 4J9CA 1S72Q 2SEMA 1GFDA 2RA4A 2GFAA 1W2BP 3J7A5 4DBFA 1VQJA 3KF6A 3PNWC 2DN8A 4LNQA 1K9MU 2J6KA 3QOJA 3P8HA 4JOIC 1S3OA 3KLSX 2GQIA 3V96A 3M3YB 3CCLA 4S3SA 4A3JB 2VS1A 2C0OA 3JCMc 2CSIA 3G71T 1YITA 4J8OA 2LQNA 4KH1B 3KXTA 2EGAA 1EYAA 3TP7A 1YJWA 1PKTA 2EYJA 2E70A 2XN9C 1VQ5A 2X69A 3M9BA 1N27A 5JVG3 1WHKA 1DM0B 4IUQA 5BN3A 5DLOA 1Z9QA 2CW0D 1B7YB 4DXGA 2DXCA 1PH3A 2CZ7B 2E2HB 1XMQQ 2ATCB 1TH7A 1UAPA 2RI5A 1S5CD 1ZEQX 2RHZA 5IT9L 2JA8H 4LXCA 4J83A 3BDUA 4DEYA 4APVA 4GLKA 4RTYA 1BO0A 1O7IA 4LJZC 3S1MB 1FJGQ 3T4AC 2MNAA 1FMWA 1JBMA 2X4YA 1CUKA 4L8JA 2DYBA 1AZPA 2XGTA 5FLMH 1OPKA 1Q86R 1N34L 4JV5Q 1WTHA 4B3RL 1YHQA 4A3CG 2K05A 2EYXA 1CKMA 2VXFA 2K75A 4PFOA 3EFSA 1MV0B 1FX7A 4PQXA 3MAQA 3WVEB 3G4ST 1RTNA 4JK1C 3I4NG 4M77B 2J6FA 2RQUA 3MEFA 5ELCA 2AKLA 4DGZA 4Z9CB 1YBYA 3J81i 1B53A 4GKKQ 1K73C 4N0AC 1PLFA 5C5MA 4C3JB 1SNQA 5IOCA 4RTXA 4I7ZC 1YWPA 4PMWA 1VQKT 1HXYD 5C4ZA 2MWPA 3MWYW 4H0LC 1BYMA 1U1SA 2HBPA 1R4QB 4CC2A 2A37A 2F0MA 1AEYA 4YWMA 3ZFJA 4BY1G 5C44H 4OO1H 1HNXQ 2ES2A 3L1AA 2KHSA 3CCRQ 2PNIA 4LD6A 1Z9ZA 2E6ZA 4FT2A 5J39A 1YJNA 2CWPA 2SNSA 2JYOA 2FPEA 3EIVA 3F2CA 1U4LA 1UE1A 3T1YQ 3N52A 2J05A 2A74C 3J81L 2O5JC 1N8RR 4DK1A 1EY8A 4PJMA 2CGHA 1B8AA 1LTAD 2YYZA 3A0JA 2HSEB 3LWUA 4OVAA 4X65Q 1KSWA 2EIFA 3LWHA 1FYNA 2DBKA 3W3AA 4MHEA 3HRTA 1PH9A 3Q1JA 4E7HA 3R3OA 1J9OA 1YI2Q 3OYDA 1JB3A 2DJGC 1SROA 3W5OA 3URYA 4ULLA 5I9OA 2MO0A 1MD2D 1PG5B 4MDXA 3E3XA 3MHXA 1KK7A 2MK5A 1KQ1A 5FW9A 4A4KA 1Q82C 4X64L 3S15B 2B3GA 5JEAG 2AUJD 2F0PA 2UUAQ 1YEZA 2A0FB 1PTOC 1ZYRD 2KI7A 2KXDA 2YSQA 3QOLA 3S2HB 2FPFA 1WJRA 1X3PA 1N32Q 2CZ1B 2RJFA 1IBKL 5EPLA 2JA7G 1TS4A 4JYAL 1GO3E 2K32A 5LJ5e 2E65A 3GNFB 1M1KR 3A8LB 1K9MC 3RKYA 1K3RA 5C4JB 2KNBB 1TWCB 2UU9Q 3UWNA 1QVGP 3NE5B 1G8XA 2P5ZX 2YRCA 2RDFA 1K8OA 2J0TD 4G7OC 1UE9A 1QVFP 5IAYA 1YNZA 3MTSA 1VQ6A 2L9HA 2L4NA 1RCVD 4DR2Q 2HT1A 2OT2A 3GDEA 2E5LL 4PFPA 4DUZL 3GV6A 5EPJA 4OMPA 3L42A 4LF4Q 5CAIA 5A0DA 1ZHIA 1AZEA 4OMNA 1ZKOA 3LX0A 1PH4A 5LL6X 1XNQL 3TQ7P 2LC4A 4IN3A 4CHTB 1VYTA 1I6VC 2VB2X 2A6HD 4ZKBB 1PA6A 1QP2A 4HA8A 3BZCA 3NWSA 1D2BA 1WTVA 1PDQA 1H3HA 3T16A 2CCZA 5LMNW 4HIKA 1QVFS 4DN4M 1YNND 3MO8A 4J9EA 1E7OA 4OP0A 2YUPA 5JVH3 2Q2UA 3TREA 3QYHB 1D0ZA 1JQQA 2B29A 2L5TA 3J80c 4EMKB 1GM5A 5J1ZA 5IGFA 1U8RA 4C3HG 2KGTA 1PRTB 4MMKA 3CCJA 1TWHH 2WKDA 4MIUA 4R1JA 4A3JG 1X55A 5FJ8H 3FDRA 3C95A 4C92G 4JW0A 2LVMA 3CQZB 3CCET 3OMCA 1X27A 1GUNA 3VYUA 1AW7A 3HZXA 5FK9C 4JRKA 2DRKA 5C0XJ 3J81j 1WXBA 1PC0A 1LABA 4PNOA 4OGEA 3HRZC 3U50C 3H15A 2MMPA 4HCBA 4CDFC 3I4LA 1BB9A 3TQYA 2XIDA 1A0NB 1CI3M 1OO9B 4JS4A 1II3A 2OTLA 4QL5A 3GTLH 3JB9H 1IL8A 4BXXH 4C8QB 1LO5D 3NXWA 2DAQA 2JTEA 3QYGB 1NAPA 4KGVB 3OA6A 1EZ6A 1NTGA 2QGQA 3HP3A 1G6ZA 1B9MA 5GAMj 2EJFC 1FGUA 4C3IB 4Z8AA 2Z0WA 4CDEC 4BY7B 2DL3A 3VR4A 3CC2T 2B8FA 2ZGWA 2FJ2A 2AQ2B 4H02A 4YHHQ 4A3DB 4F87A 2DZ9A 4B6MA 1EUJA 5ELFA 4GNXC 1KNEA 1KL9A 5KYNA 4DU9A 1D3BA 2K5IA 5GAN8 2CZ6B 2IPOB 1EY7A 3D3RA 2C0TA 3RKWA 1TKWB 3AYHB 3K6OA 4JI5L 4WCIA 4M77G 5I9PA 4PFZA 1NPPA 2R58A 2PNHA 2F2WA 1UNSA 2EYQA 1QVCA 2DTIA 2O01E 3PMIA 3U9SA 4DAYA 2XVSA 2KYBA 4CC7A 4KD3A 2L3SA 2WAQB 3F1ZA 5KIXA 1TU0B 2EYMA 1BCPB 1LTBD 2DERA 4L5TA 2F0JA 4J8QA 4F14A 4LFAL 1FJGL 3K59A 4KGXB 3FIFA 4X9DA 1VQMQ 1PZID 3S1QB 3KFVA 4JI0L 1EFNA 2AZVA 3RERA 4OGQC 2UXDL 5KCHA 4RGNA 3ASKA 3JCMQ 3EJIA 1I4GA 3PIOA 4OHJA 4A3MB 4JV5L 2V1QA 5IHKA 5FO9B 5HKCA 1TIID 4EQ5A 5BN4A 4XTZA 1D5MC 1V1OA 2VUMH 1FGBD 1HNZQ 5KYIA 5CCAA 1ARKA 1D1AA 4FSSA 2V1RA 4LFBL 2KY9A 4RUGA 2ALYB 3L2RA 1XYIA 3JCMP 4JG2A 5IYCH 1XQHA 2D9UA 3X28B 1M9SA 3EG3A 1JXOA 2HQXA 4DK0A 3CRKC 1SNCA 4GKKL 1V1PB 3W1GA 5L23A 5T1IA 1UUPA 3H0GH 3I56A 3HP9A 2EJGC 4J6WA 4N4HA 4E7SA 1R8OB 1HNXL 1OZ2A 2RM4A 4LUEA 4DEXA 2EY6A 3HKZE 4A3KG 1KLUD 4OMLA 1K8AU 5GAOp 4JOIA 4OIJA 4DV1Q 4LF6L 4K0KQ 3UDFA 4EVOA 1VQNT 1P92A 1G91A 4ZGDB 4D8KA 1E6HA 3JAME 3LWIA 4A3IH 1RACB 1PKSA 1SEBD 2SEBD 3HOUG 1AP0A 5M3FH 4TVAB 1ET6A 4X65L 4ZGEB 2PTKA 1V9PA 2EQMA 3SD4A 1F9PA 3WOEA 3OW2P 1GVPA 5A2QL 2K5VA 2MJ8A 2IPKD 2DL8A 1WCMG 2PZTA 2TMPA 1Q95G 3U4ZA 3CXCA 1M3AA 2CHBD 1Y1WH 2QAZA 1M3CA 5LJ3g 2E8GA 2PZWA 3FDTA 2X4XA 4GKJL 4F7UB 4K8IA 1S5DD 2RK2A 2N88A 1QWFA 2RSNA 1BDOA 1JJ2P 3OWFA 4YCWA 5CMDA 3CCVA 3HOZH 5GQOA 4IUNA 3CMAQ 2QA4Q 2ESWA 2RQTA 4KD4A 1N32L 1YJNT 4PJNA 1WXUA 3A55A 8ATCB 5LJ5g 4ME5A 2KYMA 1QQJA 4M4ZA 3VJPA 3PSIA 1JJGA 1OI1A 3RLOA 2J7IA 1EZZB 4IUUA 3URGA 2JMAA 2PQAA 5GAN2 1U0LA 3MP1A 2MFIA 3CXCP 5FWBA 1R77A 4A4GA 4N0AA 3SWNC 1G3WA 5IODA 1H9RA 3I90A 2JNGA 1BK2A 1RD9D 2EY5A 4A3EH 1AN8A 1ABOA 2I46A 4AQYQ 4PJOF 5ELOA 1IBML 4LF4L 2C9OA 3CQTA 4ZUIA 1PTOD 1BBWA 3GOXA 3MA2B 2VQEQ 2VKNA 3MXNA 2DJFC 5ELEA 3ULRB 1K9AA 2ECZA 2RCNA 3EAEA 3V8KA 4Q0FA 1B3QA 4FP5D 4KY7A 1EWCA 2B39A 2RQRA 4F04B 1UEAB 4XQQA 5KYYA 4IKFA 1A63A 4JI3Q 1R4PB 1CKAA 2F5TX 2R92B 4M7AG 1WFWA 1LV9A 2FL7A 5FU7C 1NZ9A 2E2IH 1I4RA 1WQ7A 5M5YB 1H95A 4TRDA 1M2OA 4C3IG 4H44C 4J7FA 2ZPIB 3A8MB 1XX8A 4BY7G 4E2FB 4IJHA 4OL7A 1I50H 1HR0Q 1DXMA 1Q8IA 2HZYA 4A3DG 5IHNA 1E1OA 4K5XA 1NLOC 4OELB 1VQ8Q 1M90U 1STNA 3JC66 4OX9Q 4M78F 2CP3A 1P16A 2MGSA 1HA5A 3GTOH 2PVOB 1VQEA 4XTWA 3OMGA 2MYSA 3FJPA 4NP5A 4J9FA 2JS0A 2Z6BA 1SMXA 4BBSH 3S17H 2JP1A 3RKXA 2UXBQ 1EQRA 1RLQC 2WAQG 1HQRD 1MGQA 2BE9B 4DPGA 1MHWC 1VQOQ 3QIAA 4FF3A 3V7SA 2F0FA 2CUBA 2FZCB 1KIKA 3IRBA 2AWOA 2D1XA 2D62A 2J6OA 4QIWB 3C46A 1KXLA 5CYUA 4C1NK 5IHIA 1ZUYA 4FSXA 1V29B 2RF0A 4KMUC 1WTOA 1SNPA 1SE4A 2K3XA 4LUDA 3RIRA 3CCSQ 3MCAB 4YHHL 4HT9A 1OTCA 1R0CB 4NL3A 2WSEE 3CCJT 1I5LA 3FC3A 2GVAA 3IKJA 1A6XA 3GO5A 3GTGH 4R4IA 1UGVA 3A74A 1VS0A 3K57A 5LJ3f 1GCPA 3OTOQ 2RJCA 2F0SA 2QEJC 4NMZA 1C0AA 1KRSA 3L2VA 1G6PA 2UXCL 2DXBA 4ILWA 3U58A 3K5LA 3KDFA 4M1UB 4A3FH 3CPWS 3HOVB 1B44D 1RI9A 1GD7A 2F0WA 3SGIA 1HZ9A 2HL3A 3EFRA 2PMZB 3S16H 2KDSA 1TWHB 2ASBA 1NPRA 2JS2A 5EC7A 3KF8A 4DUYQ 1XPUA 2ZTDA 4JJDA 4M7DF 2OAUA 3I55A 1MBYA 3CEYA 2F0EA 2AKWB 3NBIA 5LJ5f 3V05A 4DR3Q 1DONA 4XDXA 2XRSD 3M0SA 3K5NA 4JUVA 3PE0A 2YLBA 2XHCA 3V8LA 4QY7A 5M5WH 4R56A 4GN5A 1PFMA 1K83B 3C4SA 4RCBA 2L1BA 3SXHA 1DOMA 1D0YA 3NGPA 3GTJB 2FPDA 1VA7A 1E22A 2KT8A 2RDHA 3F70A 1IW7C 3M4QA 4J1MA 1E2WA 2JA8G 2EYWA 2HMAA 3G71A 4M75B 4I65A 2ATWA 2JM9A 4OO1G 2EYYA 4LDUA 1WJSA 4RMFA 1HJPA 1KNAA 4LK1C 2OTJT 3GTPB 1K0SA 1HPCA 1HZBA 3VS0A 5FLMG 4HIDA 1A15A 3EGDB 4B3TL 4AYBG 3NBHA 1PSFA 2F1LA 5FU6C 4KK7A 3MJXA 2DNEA 3QG1A 2BZ8A 2PZUA 2EJFA 2QCPX 4CC3A 3ND8A 3NK9A 4C2MB 4DV1L 2Z6KC 4K0KL 4E6IA 4QJFA 2IG0A 4RA8A 5E1FA 3RDVA 4EQOA 4A3GH 2Q8RE 2NUPA 1WIEA 3A5ZB 4GNXA 5C0XI 2JE6I 1UHCA 1WZOA 2N78A 1IRXA 2JSOA 1MUZA 4D6WA 2JVVA 3OIQA 1M27C 5C44G 4DR5L 1JOKA 2KMTA 1Z47A 3HS0C 4MZMA 1TUDA 2X9HA 3JCMW 1M90C 4K14A 2HKQB 4ZRZA 5EKLA 1RAGB 1WHMA 4IUVA 2HDMA 1CA6A 2ED0A 1XOVA 4C5GA 3VUBA 2DRMA 1F2MA 2WFWA 2DBMA 3SB2A 2FHDA 4OMMA 5ECAA 1IZ6A 3MXUA 2F3VA 3AB9A 2DO3A 4WORA 1EWIA 1STYA 4Q5VA 2O5IC 1PRMC 4HR7B 4J9HA 2VUMB 2LP5A 3VYTA 3SK6A 1WTQA 2ZCFB 1JXMA 1U9RA 1X6GA 2RQVA 3RR6A 1NR4A 2K5FA 2V8IA 4CI0C 5IYDH 2COZA 2RHXA 1CTMA 1WD0A 4PJJA 2YUQA 3I5SA 2Z1CA 1M1FA 3LX7A 4KKSA 2OF1A 1RAAB 2EXDA 1W4SA 3BDOA 4DR4Q 1GL5A 1ESFA 2N55A 2QGGA 1GHJA 4B3RQ 2J7ZA 4FO2A 1CFMA 2LXKA 4P72A 4ZYSA 4FDBA 3M4OB 3IQLA 2KBTA 1JOOA 2VNUD 4P71A 3RZOH 1V1CA 1I8FA 5HCKA 3H8ZA 2XMFA 3FHWA 2XU8A 3CD6Q 4ANJA 4J9GA 4FNFA 2M16A 4AQYL 1OQKA 3TDQA 2VV5A 2FRWA 4EMKC 4JI7Q 1W6KA 3EHQA 1MMDA 2H3JA 2VQEL 1BI1A 5CR3A 5J22A 1VMPA 1I0CA 2VGMA 4U673 3DEPA 4CKBA 1PRLC 2CP6A 3CC4T 1VQ7Q 4Y28E 1M8AA 1EYCA 1I3QH 1SG5A 1BVSA 4WJWA 1WTWA 3EFOB 4KTAA 3HEJA 1TOVA 2FXQA 1I6HH 1NYFA 3JCMh 2QA4T 2XWBB 3QJ6A 4B9XA 1QJOA 2R7ZH 3CCUQ 4AT1B 1VQPA 3CC7Q 2JTMA 1VQ9Q 1JWUD 5C0XH 1ASZA 1KHIA 1HR0L 3NEMA 2E2JB 1EIFA 3RLNA 4C8QC 3J80i 5LJ3h 4XQNA 3I4NB 3KYHC 1E3PA 5GANj 3H09A 1Q46A 4L63B 2MPMA 3OW7A 3QHSA 1VYUA 3K0XA 5GJWB 1BQQT 2KCNA 1NG2A 2Z4IA 2TSSA 1YCYA 1JRIA 3VS6A 4YWKA 2YHTA 1M8VA 2F0DA 4BY1B 2F0GA 1AZQA 3C3LA 2GF7A 2Y4YA 3HOYH 2D0QB 2A5HA 3TS2A 1IGQA 4DR7L 3KBXA 3OYNA 1D0XA 1LT4D 3LNNA 3RNJA 1KQ2A 3Q8DA 3J80L 5FJ8G 4OWWB 1QNUA 2F0HA 1VDZA 1SNMA 4EQNA 1OULA 4A3EB 1IBKQ 5G3LF 5KYXB 1H92A 1GUSA 2IX3A 5C3EH 3NSWA 4ME7A 3VYSA 5DNFA 1TT2A 2B2UC 3SWNA 2RI3A 1KC8C 4M7DA 4BD3A 1HCZA 2YV5A 3ULLA 1AOJA 4X3KA 4CKCA 2QQAA 2HCCA 2X4JA 4C0ZA 1CKNA 1G8ZD 3ERQA 3IAYA 1LTRD 4EGVA 3JB9G 1RTOA 1Y7XA 3BW1A 4OGCA 1D5ZC 4BXXG 3QSUA 4M75G 1HZCA 3P1HA 3CCEA 2DGYA 3QPHA 2Y0SE 3OYMA 2E5LQ 2NVQH 4IFDH 1K73U 4DUZQ 2DJZA 3AEVA 5CKDA 4MTNA 1LNXA 3UA6A 2E76C 1HR0W 1H9SB 1I4HA 4WF2A 3M85A 1CZGA 2DXTA 1XNQQ 4F7XA 1K8AR 5GMKi 3HFZB 2JN0A 4DR3L 2F03A 2QTVA 2NN6H 3A8GB 3UI2A 1LOJA 2KCTA 5HGTA 1EY0A 1HUNA 2AIRB 2EGCA 2BCOA 1S5BD 1D5XC 1HD3A 2D8HA 1QCBD 1NNXA 5JAVA 1M1GA 4BBSB 3H0IA 1PD0A 1Q90A 3S17B 1VQLQ 4HVWA 5KYWB 1G2TA 3CC2A 2YWWA 5L8RE 1SBBB 2RD1A 2JN4A 2RJDA 1EFWA 3GPLA 2AHJB 4RFBA 5DM7R 1UEBA 4F17A 1UE6A 1TTHB 1TS9A 4CC4B 1Q7YR 1BCOA 3FJ5A 1B34A 1CSPA 5LJ3d 2K9GA 2QEXQ 3BDCA 3I4MH 2BDOA 2CT4A 3L2ZA 4HN7A 4ALPA 1WTXA 4FYWB 1WHHA 1WLPB 1Q82U 5IP9H 3AFQA 2VUMG 3KUPA 2O4XA 4O6JA 4UY8C 2VASA 4LN2A 1O7LA 2RO0A 2CZ0B 2RK1A 3OB9A 1SE8A 2NTSA 5IYCG 4BE1A 2HHHL 3L2QA 1PH7A 5LJ5d 2D6FA 2RHSB 1S72A 1KQSS 3GTQB 2LZ6B 1IW7D 5JPNC 3K58A 4C3HB 1K0RA 4HMIA 2GQVA 1C1AA 1GBRA 2ZJQA 3H0GG 5JEAJ 5T1GA 2WB1B 4Z02A 1MJEA 3W2DA 2Y90A 4C92B 4IJLA 3A8IE 5IXFA 4ZTFA 2R61A 2EJ9A 3UE0A 1G3TA 1WHGA 3M9QA 5D6WA 1GBQA 5AFWA 1JORA 2Z4HA 4R55A 2HQLA 4JI5Q 2DZCA 3A7LA 3FPPA 1Y07A 5I6WA 3L7ZC 1YFNA 1I4K1 1W2BS 1J3TA 3E5SA 3TP5A 5IGGA 3JAMc 3EG1A 3CCLQ 3GP8A 3FPUB 2PZ1A 3PFSA 4HCCA 3TP8A 3HOXH 5M3FG 1CSKA 2LNVA 4DV5L 4EMGA 1HA6A 5E7NA 4RG1A 2F52A 2PPBC 1YITQ 2F0OA 4QUCA 1YNJC 3TRZA 4KN4C 4PKCC 2VY3A 4GS3A 4RKUE 2ABLA 4LW1A 1YJWQ 4XQ3A 1KD1C 2A19A 4LFAQ 3M7NA 4DV2L 3S24A 1U3OA 1BI0A 4J15A 4QUFA 3RMSA 2SNMA 2UXDQ 5C3XA 4JI0Q 1B7TA 1Y1WG 1VQNA 3CCMQ 1VQIA 3IL8A 1CA5A 4V2SA 3RN5A 4HVUA 2NVTB 4DR4L 3J7ZC 1N9RA 1BBXC 1RAFB 3LGFA 4UP8A 4KY5A 4FF1A 1SRMA 3DLLA 2F2VA 4PZ7A 2F0UA 1V76A 4PZ8A 1A3VA 5NUCA 4NXNQ 3HOZG 5EBDA 4N8X1 1X32A 5G3LD 2LTOA 2QGFB 4A3GB 4LFBQ 4PJOG 5E4XA 1RUWA 1YHQQ 4JI7L 2F0IA 2DE0X 2F4IA 1JMCA 1KJWA 3OS1A 2ZM6Q 2GCXA 4LAAA 4BI8B 1U5KA 2Z6KA 1XWEA 4A54A 3QZ5B 4M77E 5GAOm 3D31A 2QASA 2FB7A 3EGUA 3OYIA 2KRMA 2LJ0A 4B3ML 4TVRA 4RMOA 2K33A 2NWGA 2KEAA 5GMKj 2DY7A 4OXPA 4LF6Q 1C0MA 1EY6A 2NZHA 3QWNA 4A3EG 4WRDA 3CMEQ 1LVKA 3S2DB 4J7IA 2DK3A 4BI3A 3LGJA 3CCRA 3S1RH 4LE9A 2WV6D 3JCMe 2DTOA 1B4OA 2JMCA 2EJMA 2K6AA 4Y91A 2O88A 3D0FA 4IUPA 1PNJA 2PU9B 4B9WA 4ELZC 1CHPD 4AG2C 1PV4A 4M78G 3S3MA 1X01A 4FM4B 1O80A 3V8JA 2AHOB 2I5HA 2ICEC 4DR6L 2IY5B 4HVVA 5LJ3e 4K6DA 2CFMA 4BE0A 2QW7A 4GKJQ 5CQYA 3GQBA 1T5EA 2NZ1D 2E1HA 2MAMA 2QDYB 3CD6T 4CKEA 3EFXD 1YI2A 1XNIA 1Y1VH 4IPDA 3VYRA 4A3KB 1X2KA 3K8AA 1Y0MA 2LXJA 2YUOA 4L5GA 3QDFA 1DOLA 1Y8NB 5CKFA 5C4XH 1FWZA 2RDGA 1AH9A 3DEOA 1AE2A 3R8BA 4NL2A 1B2TA 3E2UA 1YHBA 3HOUB 3OS5A 1QNKA 2EKHA 4KRTA 2LY7A 4QT7A 2RHUA 4UPAA 4HSPA 4C8QD 2PYKA 1VQPT 1WVLA 4A3LH 4XTYA 2O2OA 4XYOA 1DZ1A 4BBSG 5E4WC 1WCMB 3RZDH 1U5SA 3RESA 3CCUT 2O9SA 2EPBA 2Z9HA 4EMKA 3VS2A 3ONAB 3QB3A 1TS2A 5A35A 4PMCA 2FMCA 4BS9A 3K5MA 4WTOB 1LYLA 4JZ3A 4JI1L 5L37A 4FXDA 1IBMQ 4UP7A 3M4GA 4IO9A 1E7ZA 3JSCA 1TWAH 2HKNA 4X3UA 3CP0A 4X1VA 4M75C 1N33L 3Q24A 1X6OA 1QVGS 1VQ6Q 4KH0B 4OIKA 3OYBA 1SFOH 1VQGA 2RSOA 4NKLA 1WTRA 2KR3A 5FRNA 4C8QA 2K14A 2K28A 3D4WA 1SSFA 1UHFA 2OQKA 1QE6A 4CJ2C 4E47A 3MZ5A 5HGQA 4A3FG 3AHUA 5LHY1 4C5HA 2F5KA 3D7SB 1UECA 1WGSA 5C0MA 2B2TC 2WB1G 3MFGA 4GZYC 2K57A 1GJXA 2VVKA 4XU1A 1Q81U 4N9PA 1L1OB 1BUVT 2G3RA 1B3AA 2BH8A 4CDCC 1K8GA 2DD5A 4X9CA 2IX0A 4DAPA 2JA6H 3OQ5A 5GMKl 2AK5A 2KHIA 4ZGJB 2EWNA 1PTOH 5DY9A 5KYLA 2A28A 2FG0A 3IFDA 2GVBA 1VQBA 1B07A 4M7AB 1VQDA 1CHQD 2EQKA 2KQ3A 5AT1B 3CKIB 2YU9H 2CQOA 1DD2A 1TVXA 3OSSC 4JCVE 2B2UA 3UDXA 1STEA 4HJ5A 2MI6A 1JOQA 3MEUA 5M5XH 3K5OA 5KYUB 4ODGA 3KUFA 3CCQQ 2KRNA 2JT4A 1C48A 5FO7B 1OV3A 3E19A 3JCMb 3BYTB 5CBAE 3NPFA 1SEMA 4C8QE 2L0CA 1WD1A 2OTLQ 1PTOF 3EVQA 1UE7A 5IGBA 3J7AF 3A8KE 3ULJA 1BIBA 1YIJQ 1CT1D 4Y7NH 3S1NB 3EHRA 3KJPA 1PYSB 5C6AA 3PUXA 2F69A 1WHJA 1O78A 4A3GG 4ELYC 2H3EB 3OIPA 4UAIA 3PO3H 2UXCQ 2OTJA 3WDNA 1MNDA 2CDTA 3M57A 5GAMh 3KOJA 2JEAI 4OB0B 1VF5C 3EBEA 1A0IA 3KK7A 3C12A 2A7YA 3HRSA 1X3FA 2YRDA 1V1PA 2YRVA 1JWMD 4BA1I 2DETA 4A93H 4DBRA 4A4IA 4HJ7A 4AH6A 1JEGA 2BE5C 1G3YA 4R8IA 4II1A 1R9TH 2WAQE 1S72T 1B1ZA 3LH0A 3TEEA 2KEDA 5EPKA 3PIP3 4PL6A 1D1CA 5EKKA 3L2PA 1UGQB 2BTTA 1CKOA 1JC7A 4NXNL 2JEBI 4NDXA 2ROTA 2D0PA 2BZYA 3N6RA 2L15A 3VU3C 1RAHB 2NVYH 3BS1A 4C0DB 4WJ4A 1ILPA 2DYIA 5FRMA 1D09B 1D8LA 2MO1A 4EX5A 5IYDG 4QQDA 3GTKH 2FRYA 1MGSA 4R4CA 2DF6A 2ZM6L 4A3BG 3ZBDA 1YNJD 2F0LA 1HQMC 4OB3B 2BIVA 4KJOA 4F7UA 1PMRA 4BY6B 1UE5A 2BE7D 4B3TQ 1T3LA 5I4DA 1WPYA 4P73A 3O13A 4JI6L 5KCOA 4JI8L 2IVWA 2K5LA 2E6NA 2WP8J 3EH2A 1PFSA 2HAXA 1IXRA 2HIXA 1D3BB 3CF5A 1TXYA 2ZPBB 3BVMA 2G9DA 5I2YA 3H0FA 1FL0A 3NELA 2ZTEA 3R2TA 1GUTA 2RH2A 1X54A 2LRQA 1EQVA 1S40A 1PVOA 1WQWA 4ATOA 3SK8A 1IGUA 3QDRB 1F77A 3M4PA 2E64A 3FB9A 2O31A 3JCMg 3OYGA 3CCMT 1ZQ1A 1W3SA 3CU7A 5EBCA 2JA8B 4LUZA 3ZEHA 3R2IA 2UUCQ 2YLCA 2A8VA 1QCOA 2LNHB 3M0UA 1FYCA 4DR5Q 4P2CB 1MMGA 6AT1B 1Q81C 4IQZA 1K73R 3EG0A 1ZSZB 1CM9A 3I73A 3K7AH 3V2TA 2M9UA 4BE2A 1GUGA 4AYBB 3Q0AA 1AE3A 5ELDA 1KDCA 3H94A 2R7ZG 1MMNA 2E4HA 4FXGC 1QLYA 2XI9A 3S6WA 5C0XG 2GGRA 1WDXA 2RF4A 2K5HA 4F7UE 3CC4A 3TSWA 2E2DC 1GRIA 2JXBA 3OW2S 2XNAC 2KUMA 1VMCA 2F2XA 2PVDB 3M0PA 1Y96A 3BE3A 1BOSA 4UP9A 4JPBW 5EQ0A 3HHTB 4ZKCB 1RAEB 3MKDA 1FMKA 3CMAA 2X3XD 2QA4A 3BZKA 3CCRT 4J6YA 3EROA 2LX7A 4B08A 1VQHA 1G3SA 3L2WA 1TS5A 2QF7A 2DY8A 5C44B 3CMET 1ML0D 2RPNA 3DHQA 4KHVA 2A36A 1JJ2S 2K4KA 3HOYG 1RADB 4M8AA 3LGLA 3PO3G 2PQEA 1YHAA 2JA5H 4LF7L 2XTIA 4UDUC 1F2YA 2BA1A 1LT5D 5CV4A 1XJVA 2HUGA 1KG1A 1IBLQ 2XWJB 2P0PA 3PUWA 1B9NA 3UE1A 2KVQG 1I81A 3TCJA 2KHJA 5C3EG 1YJ9Q 4AFZC 3DKMA 3IFTA 3JCMJ 1YI2T 1Q82R 1L0XB 1L2FA 2HIVA 3MEWA 1WOCA 1IYUA 1NEGA 4FU6A 4A4FA 3I91A 2QDLA 1IYJB 1JB0E 1E2VA 5M3MH 3PO2H 1TS3A 5IE8A 3CBMA 2ZT9C 1NYGA 2CH4A 1X43A 2L3QA 3CXCS 1E24A 3DXJC 1K9MR 2L55A 4IZ8A 3SR1A 1B50A 4RG2A 1LUZA 4N8FA 4XT1B 2GTOA 3HRUA 2GA4B 4PK4A 4KKTA 4YY3L 4IFDG 1GUWA 2NUZA 4GLVB 1OXVA 1Y1VB 1AWJA 4KT0E 4XTCS 1V8QA 4XU2A 1F2ZA 1C6VX 2EQIA 4K2KA 4ZUJA 3EG2A 2K6DA 1FNUA 1G5VA 1U4PA 1WFQA 2NBFA 4A3BH 3BFMA 2RQWA 2NN6G 1EQTA 1TWFH 3EN2A 1FD7D 2IHEA 1S4ZA 4TKOB 1BI3A 5GAN7 4M75D 1D1IA 1KAWA 1GCQC 2LS01 1VQ4Q 3FKIH 3A7AB 4ZCKA 4HTHA 4J9BA 3G6EQ 4C92C 2V8KA 4GN3B 1VQAA 4DOVA 3RZDB 3CPWA 1Q1BA 3DM1A 4EDUA 4QCLA 1FR3A 2GFUA 1T0JA 2EPDA 3NTHA 3B6YA 3MXGA 1LPLA 1IREB 1EIGA 2LJ1A 4DR7Q 1Z6HA 4X3SA 1P8LA 2E3HA 2JQOA 2CS7A 4QGUA 3KJOA 3UDCA 3JCMf 3QZ9B 3I4MG 2M51A 4JVZA 1MKHA 4MZTA 2PVGB 3MXNB 3HOWH 5IP9G 4GLXA 2YTXA 3MFYA 2H8HA 4QIWE 2IX1A 5I2SA 4UHVA 3G7ZA 4QVDA 4F88A 2EY1A 3A98A 2LMJA 1HNWL 1M4ZA 3VRZA 4M75A 4DR1L 2AKKA 2LDMA 2RHQB 2DEQA 5K36H 1YZ6A 1HYOA 2A73B 4O0AA 3JAMi 2NYZD 2BOSA 1XTCD 4M77C 2JXMB 3M58A 1F2LA 1NJIC 1F9SA 1ZLMA 1WYDA 1UGRB 5GAMe 2CP7A 2VB6A 2B63H 3S9WA 1QUQB 4C5IA 2H1EA 4DNIA 2HNIA 5CO7A 2IT1A 1EWHA 3BZDB 5FLXE 4OWTB 4L6TB 3ND9A 2PMZE 3G7LA 4OONA 4IALA 1SKUB 2B2TA 4PNYA 3M7GA 1G2SA 1M8MA 2BUDA 3OYLA 3T51B 3HOXG 2L2PA 4JS5A 1RF2D 4IOAA 3GTLB 3JAML 1SLJA 1RLPC 3G48A 5FROA 1MHNA 2B8AA 3M3YH 4J5YA 2IW3A 1M5Q1 2EXZA 1WYXA 2ID0A 1SAPA 3J7AV 2M00A 1H9MA 1O9SA 3PUZA 4IURA 4A4HA 3A56A 3BDLA 4EPCA 4DK3C 1LTGD 4RGTA 1STGA 1YWOA 4M75E 3M56A 4ID6A 3MHBA 1HK9A 3HKSA 4QQBX 4JI4Q 2BE5D 3F8TA 4XTUA 3G71Q 3S3OA 3LWEA 4K2LA 2EGEA 4MTKA 4XQJA 1IL2A 4J9DA 2DL7A 2JJQA 2IWHA 2E2HH 3M53A 1ZA2B 2CKKA 2F0KA 5JJKA 2OAWA 4R0KA 1VQMT 5KGUA 5GJVB 2XD0A 3KDFB 2HHHQ 3UDGA 1KC8U 2GN5A 4K11A 3FVQA 2I2LA 3X24B 4H13C 2VQFQ 1NMGA 4JC0A 5IGCA 2UUCL 4EMHA 1H9JA 5I6YA 2FMMA 1ZUUA 2KE9A 4JDSA 4U68A 2IHFA 1I5FA 2J4XA 1QP3A 3TP6A 4BBRH 2VB3X 3JCMX 2EQJA 1E0BA 3Q22A 5EG2A 2VWFA 5JJLA 2M0YA 4RTUA 5EJWA 3D6CA 4DV5Q 2D0NA 5KNDA 4RHRA 1JT8A 2CKZB 3Q23A 4A76A 1RL2A 1QWEA 1UG1A 1N36L 3OOCA 4C3JH 5FKAC 3G4SQ 1QKXA 4FW1A 3JB9J 4O2DA 2K1BA 3NFCA 4J9IA 3WWVA 3NWTA 2E12A 2FINB 4DV2Q 1UFFA 3HG9A 1U06A 2MQHA 3KFUA 2XK0A 3EFOA 1WI5A 2E10A 2NVXH 1VQKQ 3H0GB 1J6QA 4OMOA 1JE4A 4DOWA 1L0YB 4RGOS 4M77F 1SRLA 1OXXK 2QQRA 1MNEA 1Y1VG 4DQ2A 2F0VA 4FF2A 5HURA 3FLGA 1XNRQ 2L12A 1J8IA 1SE2A 4JLGA 5ELBA 2JTFA 1PFBA 5C4XG 1DCZA 1IBLL 1VCIA 3NP8A 5GAGC 4ZN1A 2RMOA 2PO4A 4HJAA 2EJGA 3QR8A 4A3IB 2PUKB 4ZK9B 2W10A 4DV0Q 5M3FB 5CGKA 3T53B 2Q2TA 4KLKA 3L2UA 4JRPA 1PRTC 2A1AA 5D3IB 4A3LG 3CD6A 2R93H 2I07B 4KULA 4NOYA 1C4QA 1VIFA 1NBWA 3CHBD 1NLPC 4R4TA 1L1OC 3VUZA 3NUCA 4AFQC 5I2MA 4B3MQ 2ZPEB 2R5MA 1T9HA 1N8RC 2HD0A 1AEXA 4ZTJA 1Q3LA 2I5LX 1Y1WB 1WHLA 5GAN3 2LQ8A 2LFNA 3S15H 3DB4A 4O1NA 3CMAT 2K7AA
chains in the Genus database with same CATH topology
1PXUA 4C5EA 1E2ZA 4QVCA 1OXTA 3S3NA 5IT9E 4M7AC 1X3QA 2NB0A 3HOZB 2WIIB 3LLRA 3A8OB 1O75A 5LJ3j 3CCUA 4DNRB 4PJOB 1S5ED 5JPMC 3SHLA 1A2TA 2PW5A 2Q8IB 4O5VA 2F0NA 1LLRD 3H3VC 2CYZB 3OBWA 4C0FA 2K01A 1EOTA 1M1KC 3RD4A 1H9SA 1KD1U 2F0TA 5LJ5j 1WJQA 3TSSA 5A0GA 5CK9A 1BR9A 5GANh 3P7JA 3X3NA 3QBYA 3QIIA 3BVGA 2FHTA 1BCPC 4ZQ3A 4FIBA 5CKBA 4V190 3UT1A 4K5VA 1NR2A 4M78B 2AUKA 3A8HB 5CQXA 5M3MB 4P5NA 1MI2A 3SEBA 3QXEB 2E2IB 1DJRD 4C92D 1VQ8T 1GXIE 2VYTA 3J81E 3TBIB 4XTXA 5FO8B 3PV0A 3M54A 1SYEA 2NUCA 1I50B 4C0DC 5GAMg 1VIEA 4N4GA 2ICIA 4A3BB 1SYFA 1Q1EA 1C8CA 5HY6A 1ZXTA 1QB5D 2C5CA 1HFNA 5CV6A 3VA5A 3GTOB 3E0JA 5LL6S 4BY6C 2BDNA 4JLIA 3FKIB 1VQOT 5K5PA 2NTTA 1PRTF 2NLUA 4XU0A 4CGYB 4G57A 2EDGA 1KQSA 3D6WA 5AYFA 5CIUA 3OSOA 3JCMd 1T5XD 2BKDN 2V8JA 3CCST 3PIPA 1MSGA 4R8NA 4BDYA 1BKBA 4CJ1B 4C92A 4DNTB 2ZXPA 3U9OA 5HK3A 1I4PA 2L3RA 3RMHA 4M77D 2HQEA 3VA7A 4X34A 3SWNB 4M7DB 1W2BA 3HOWB 2ZPHB 4OMFB 4C8QF 2XIWA 2QEXA 3GTGB 3X25B 3X26B 2MF2A 3M4YA 4KBMB 2HDLA 2LT1A 4ABNA 1SYBA 4RCCA 4YIJA 2O2LD 4A3FB 1GHKA 3OY9A 3QO2A 1SDFA 3S16B 4VUBA 4LDWA 3R93A 5FU7B 3MP6A 4O42A 2KAFA 2KQWA 1NCVA 4OO1I 1U1TA 2MWOA 1HTPA 1CQFA 3G6JB 5M5WB 4N9TA 1DJ7B 4M77A 4KHZA 2QDBA 1O7ZA 3QO3A 1BCPF 4C92E 5CV5A 5CR2A 1M4VA 3R6OA 3WVDB 5IN1A 3MVVA 5A0LA 4HAEA 1EY9A 1FNVA 2K4YA 2LQKA 1Z7TA 5GAN4 1ESRA 1HUMA 2G9HD 3RUZA 3V7CA 2VXWA 1B34B 2R57A 3E1SA 1LTSD 4HMJA 5F2DA 2VXEA 3GP7A 3CCMA 2CVRA 2JOYA 2O4XB 2DD4A 2K3YA 2WSCE 5J26A 3NPPA 1GOZA 4GY5A 2QQBA 2DPPB 3CRLC 3VR3A 4E7IA 1EU3A 5GAMf 4FYDA 3OBYA 2B2VC 5D3DA 2K04A 3CBPA 1ENAA 4Q5WA 3OS0A 2A6EC 4BBRB 4ZN3A 2M1HA 4MDWA 2VUBA 4BDZA 4K5WA 2EZVA 3UPUA 3OYAA 2K5WA 5JOBA 5KNCA 5GAN6 2F0QA 5C3WA 1K8MA 2WACA 3CMEA 4F7UF 2SDFA 1ZBXA 3TU4K 4KV6A 1HHVA 3GNGA 2R3ZA 1STAA 1PRTD 2ZXOA 1KDBA 5GMKh 4RGMA 3C1EA 2K2VA 2NVXB 2EE1A 3BG3A 2ZPFB 2EYOA 3BY7A 1KLGD 2RHIA 2E41A 2M0OA 3RZOB 2LT4A 1UGSB 4RKBA 1UGPB 3P8BB 3TZDA 1ILPA 4LD9K 3HSBA 2LMCB 4CJ0B 1QVGA 1EL0A 1VQ7T 4M7AD 4QQGA 5FU6B 2X35A 1RODA 1QVFA 3QJYA 4HSVA 2QILA 2R93B 5GANe 3FRNA 2QI2A 3QKJA 2LKVA 2K5DA 1I3QB 3GD7A 3CC7T 3WOFA 1EIHA 1VQ9T 1N9SA 1PZJD 4G7HC 3JB9I 1I6HB 5D14A 3D4DA 1TQOA 4RWSC 2R7ZB 1W6JA 3OYFA 5KNBA 1D6EC 5A2QE 4A4EA 4JJNK 2BA0A 4CRIA 4M7DG 3Q6SA 1AFPA 3VYHB 5I21A 4XAXB 1BCPD 2QQSA 3SDZA 4M7AA 3C2PA 5D6XA 5K36G 1QILA 2WINB 5C6SA 1G291 2KVMA 2KSSA 3HOYB 1F9QA 1HFGA 5KE2A 1JR0D 3P8DA 1Q12A 3DUZA 5C3EB 2LCLA 1BNZA 4R9WA 2XSCA 4JBWA 3OSVA 4WFN3 3RUXA 1ILQA 4LDXA 2KCCA 2A68C 2NVQB 1STHA 2EQUA 2KK4A 2V4DA 1KAAA 5TSSA 4PLLA 4M7AE 3AU7A 2RJEA 3RMQA 4V0BA 1PZKD 3CCQA 1SSOA 1QVPA 3QUIA 1VQLT 2B2YC 4FF4A 4RCNA 4KUIA 4HCZA 1XTDA 2EOTA 1ENFA 2KJXA 2DIGA 2PNRC 2L11A 1CK1A 2DXUA 1DYQA 3GTMB 1YIJA 3PGGA 4HEDA 2EAYA 2RQXA 1Y71A 3OYKA 2K5QA 5M9OA 2QEXT 4KI0A 3L3OC 3OYEA 1AHJB 2P0KA 4OB2B 2OXPA 1VUBA 3SE0A 3ITPA 3P20A 4L59A 5CKEA 3I4MB 4L6V5 1D1KA 1VQMA 3JB9F 1JCKB 4M75F 4OF1A 2JUFA 4QQ6A 2L8DA 5D6YA 3T13A 3X3MA 2R6GA 3MEHA 3DWPA 4C3JG 4KUDK 1GXDC 2KECA 2X6GA 3K0YA 3MEAA 4KJNA 3VYGA 1H9KA 2FYKA 1QG7A 4RAUC 4IFDJ 4HKEA 4IUTA 1SJED 1IYVA 3E9FA 1OYXA 1A3TA 4XTVA 1FXXA 1BXTA 4PJOC 2EY2A 3CCLT 2RVLA 1YITT 1VF7A 2ZXRA 3V7RA 3HGBA 3OW2A 1YJWT 2FFKB 5DAUA 1VQ5T 2MHVA 2XDDA 1A2UA 3T56B 1CQVA 5CC4A 3HOXB 3SFMA 3C94A 3EA6A 3HKZB 1STBA 2XRQD 3HFNA 1KTKA 1EEFD 2P4TA 3KLRA 1LTID 4QB4A 4BWGB 1JJ2A 2M2LA 3VR2A 4M78C 2DKGA 5GMKe 1YHQT 5D65A 2A6ED 2ZZDA 5DM73 1NJIU 1A3UA 1EU4A 5EKIA 4TSSA 4BUGA 2F1MA 5GAMd 3H6ZA 4BACA 3NTKA 4JRQA 3MXPA 3MP8A 1H3ZA 3JCMV 2IL8A 1WTPA 5GANg 5I2XA 4FVMA 3N5BB 2OEOA 4C1NI 3NQIA 3MEVA 3A8JE 1Q7YU 2R5AA 3GIBA 1NUCA 2PQWA 3AMUA 3TN2A 5C5LA 5GAOl 3VKIA 4HCEA 5J3BA 5JJZA 3NTIA 3F2UA 2PCFB 2B2VA 3S1RB 2HCIA 1U4RA 3LW5E 1MSHA 3H6MA 2L5QA 2E74C 1BI2A 1O7YA 4XYQA 1YJ9A 4BI4A 2D2CC 1WNLA 4M7DC 2WSFE 1LACA 2XICA 1SMYC 2EKOA 1ONLA 3LYIA 4A53A 3PMFA 5C4XB 3OYCA 3TZUA 3NQTA 3INZA 1EFID 1QOHA 1H641 2EVBA 3WXMB 5FOBB 4DA2A 1Y96B 1Y69U 3JB9D 1VQ8A 4H7BA 4C8QG 4NS5A 4K8JA 3SK4A 1Q86U 1PSEA 1U4MA 2LX9A 2DNCA 1VQ4A 3I8ZA 5JEAH 3G6EA 3S14B 2IJ0A 3DWQA 5DM63 3HPWA 1I4XA 5CBEE 1VQ6T 3M5AA 2QXFA 1VQOA 4CBVA 4ZLTF 1OXUA 5GAOn 1TWAB 4XU3A 2CQAA 5BN5A 4DA4A 1BIAA 2D9TA 4NW2A 1OZ3A 4OB1B 1UB4A 3VR6A 5HK0A 1EY5A 2WKCA 3CCSA 2A69C 1SFOB 2KOLA 2B2WC 5C4HA 1K8AC 3SK5A 1TU2B 2H4OA 3A54A 4G7ZC 2Y4XA 5IIFA 2B8GA 2KA7A 2EFIA 4ME5A 1LJOA 2A68D 1ICWA 1ET9A 2E75C 4BA2I 3O8VA 4DF7A 1QWYA 3NHHA 4RKLA 2DVEA 1N8RU 1RDPD 5EGTA 2JA6B 5COYA 1SJHD 4G4KA 3D4RA 2XDPA 3SVMA 3KBGA 5GANf 4KKUA 1PTOB 1Y8OB 4HT8A 4C0GA 1SYCA 3CCQT 1TY2A 2VGNA 3META 1Q7YC 3J80E 1KDAA 3H91A 2YU9B 2K03A 2OTLT 1EYDA 1SYDA 4J6HA 1TR5A 5M5XB 1LT6D 3BVZA 2PW7A 3KLSA 1YIJT 2AWNA 1IHZA 4KY6A 1Y8PB 3I72A 1V43A 1SXTA 1M1KU 4PV1C 4Y7NB 4MZPA 4F8MA 1JWSD 4XT3B 3JRZA 3OYYA 4RG8A 1HXDA 3PO3B 3GLXA 3DB3A 1EEID 1X75C 4C92F 2B2YA 4DAVA 3GV3A 2EYFA 4F7UG 4A93B 2K7VA 4UC4A 3GF5A 2X4WA 2CW0C 1HRJA 2FVUA 3D8GA 1R9TB 3FEOA 3OWEB 2DIQA 4PJOD 3I70A 4FT4A 3C1FA 3E9GA 2NVYB 5KH6A 1Q86C 2L89A 2P0QA 4LMQD 5DEHA 4N4IA 5CVIA 1OXSC 2RKSA 4FXKC 3GTKB 5ISRA 2RA2A 4MN3A 4DFAA 4XIGS 3G4SA 1SYGA 3OYHA 5CV9A 3VV0A 2EYPA 2JZ2A 4RH6A 3VR5A 1DZ1A 3E6ZX 1IKMA 3OS2A 2A3LA 3I56T 2LCCA 1VQKA 1PFNA 5IGEA 4J6XA 1LT3D 3L9AX 3PIO3 4M78D 1JICA 3DLMA 2XDBA 4PJOA 4X3TA 2QTXA 1NSNS 3PUYA 3PUVA 3FMCA 2KEEA 3T9NA 1TY0A 2F3WA 2RBMA 3J7YW 5KRUA 4MMLA 1NE8A 3K7AB 2RHYA 1VQ7A 1N6AA 5KE3A 4IFDI 2Z8LA 1LTTD 3DWAA 3FRPB 5CV7A 2C06A 4E7KA 3CCVT 2QQ9A 2ZPGB 4KN7C 3CC7A 2MP1A 4XXEA 2EYHA 1VQ9A 1EY4A 2SOBA 4M78A 2NN6I 5GAN5 1RHPA 4EQPA 3OYJA 1ZYRC 4LDVA 4PJOE 3HL8A 5DLQE 1YJ9T 3EQLC 2E5QA 5GAOq 1RJTA 4DXFA 2JA5B 4M7DD 1HTLD 3PT9A 2X6LA 4JRIA 3PTAA 1SMYD 3TMEA 1I4QA 4PMBA 4BB7A 1TWGB 2DTHA 1S5FD 2AQ3B 1SNDA 1FNWA 3ER0A 4XK8E 4QW2A 5FLXL 1EZ8A 1RKNA 4E7LA 3PO2B 3OHXC 2XG8D 2RB6A 2MUYA 5LJ5h 2Q8TA 4C56C 2PUOB 5GMKm 5CKHA 4M78E 3MC0B 4RCOA 2A6HC 1KHCA 3M59A 5E3FA 3I3CA 4YTLA 1VQ4T 3DMUA 3G6ET 2Y0SB 1YNNC 1GUOA 3P75A 4K6LA 2D5DA 3OPOA 4QVZA 5IGDA 1TWFB 1F9RA 4TQUS 4FL6A 1CZWA 2A69D 1XXGA 4E7JA 3FEWX 1DOKA 3CPFA 2AQ1B 2RI2A 3PMTA 4LDYA 1IKLA 4QMGA 1VQLA 1RI0A 2VC8A 3X20B 2JA7B 5CV8A 5KEEA 5GAOr 4PLIA 1SE3A 4M7AF 3HFOA 3CBOA 1KABA 4RHSA 2M9VA 3M55A 5CORA 1BF4A 4ZAIA 3ME9A 2EYLA 3BYYB 4M7DE 3RLFA 2XKOC 1ENCA 4QF4A 4HCSA 1QW1A 5GANd 2QKIC 1PYWD 2B2WA 2B63B 1JQYD 1SNOA 3I55T 2ENBA 2RA4A 2GFAA 3PNWC 2DN8A 1K9MU 3QOJA 3P8HA 3KLSX 3V96A 3M3YB 3CCLA 4S3SA 4A3JB 3JCMc 3G71T 1YITA 4J8OA 3KXTA 1EYAA 3TP7A 1YJWA 2EYJA 2E70A 2XN9C 1VQ5A 2X69A 1N27A 5JVG3 1DM0B 4IUQA 5BN3A 5DLOA 2CW0D 4DXGA 2DXCA 2CZ7B 2E2HB 1TH7A 1UAPA 2RI5A 1S5CD 1ZEQX 2RHZA 5IT9L 4J83A 3BDUA 4GLKA 1BO0A 4LJZC 3S1MB 3T4AC 1JBMA 2X4YA 4L8JA 1AZPA 1YHQA 2K05A 2VXFA 3EFSA 1FX7A 4PQXA 3MAQA 3WVEB 3G4ST 1RTNA 4M77B 5ELCA 4DGZA 4Z9CB 1YBYA 1B53A 1K73C 4N0AC 1PLFA 5C5MA 4C3JB 1SNQA 5IOCA 4I7ZC 5C4ZA 4PMWA 1VQKT 1HXYD 2MWPA 3MWYW 4H0LC 1BYMA 1U1SA 2HBPA 1R4QB 2F0MA 3ZFJA 4OO1H 3L1AA 2KHSA 4LD6A 2E6ZA 5J39A 4FT2A 1YJNA 2SNSA 2JYOA 1U4LA 3N52A 2A74C 3J81L 2O5JC 4DK1A 1EY8A 2YYZA 2CGHA 1LTAD 2IX3A 3LWUA 4OVAA 2EIFA 3LWHA 3W3AA 4MHEA 3HRTA 3Q1JA 4E7HA 3R3OA 1J9OA 3OYDA 1JB3A 3URYA 4ULLA 5I9OA 1MD2D 4MDXA 3MHXA 1KQ1A 4A4KA 1Q82C 3S15B 5JEAG 2AUJD 2F0PA 1PTOC 1ZYRD 3QOLA 3S2HB 1WJRA 1X3PA 2CZ1B 2RJFA 5EPLA 1TS4A 2K32A 5LJ5e 2E65A 3GNFB 3A8LB 1K9MC 3RKYA 5C4JB 1TWCB 3UWNA 3NE5B 2RDFA 1K8OA 2J0TD 4G7OC 5IAYA 3MTSA 1VQ6A 2L9HA 2L4NA 1RCVD 2OT2A 3GV6A 5EPJA 3L42A 5CAIA 5A0DA 1ZHIA 1ZKOA 3LX0A 5LL6X 2LC4A 4IN3A 4CHTB 1I6VC 2VB2X 4ZKBB 2A6HD 1D2BA 1QP2A 4HA8A 3NWSA 1WTVA 1PDQA 3T16A 1QVFS 4DN4M 1YNND 3MO8A 4OP0A 5JVH3 3TREA 3QYHB 2L5TA 4EMKB 5J1ZA 5IGFA 1U8RA 4C3HG 1PRTB 4MMKA 3CCJA 2WKDA 4MIUA 3FDRA 3C95A 4C92G 2LVMA 3CQZB 3CCET 3OMCA 1GUNA 3VYUA 1AW7A 3HZXA 5FK9C 4JRKA 5C0XJ 1LABA 4PNOA 4OGEA 3HRZC 2MMPA 4HCBA 3I4LA 2XIDA 1CI3M 1OO9B 4JS4A 1II3A 2OTLA 3JB9H 1IL8A 4C8QB 1LO5D 3NXWA 2DAQA 3QYGB 1NAPA 3OA6A 1EZ6A 1G6ZA 3HP3A 1B9MA 5GAMj 2EJFC 4C3IB 4BY7B 3VR4A 3CC2T 2B8FA 2ZGWA 2FJ2A 2AQ2B 4A3DB 4F87A 2DZ9A 5ELFA 1KNEA 4DU9A 1D3BA 2K5IA 5GAN8 2CZ6B 1EY7A 3D3RA 3K6OA 3RKWA 1TKWB 4M77G 5I9PA 1NPPA 2R58A 1UNSA 2EYQA 2DTIA 2O01E 3PMIA 3U9SA 4DAYA 2XVSA 4KD3A 2WAQB 5KIXA 2EYMA 1BCPB 1LTBD 2F0JA 4J8QA 3K59A 4X9DA 3FIFA 1PZID 3S1QB 3RERA 4OGQC 5KCHA 4RGNA 3ASKA 3JCMQ 3EJIA 1I4GA 3PIOA 4OHJA 4A3MB 5FO9B 5HKCA 1TIID 5BN4A 4XTZA 1D5MC 1V1OA 1FGBD 5KYIA 5CCAA 2KY9A 1XYIA 3L2RA 3JCMP 1XQHA 2D9UA 3X28B 1M9SA 4DK0A 2HQXA 3CRKC 1SNCA 1V1PB 5T1IA 1UUPA 3I56A 3HP9A 2EJGC 4J6WA 4N4HA 1R8OB 1OZ2A 2RM4A 2EY6A 1KLUD 1K8AU 5GAOp 4OIJA 4EVOA 1VQNT 1P92A 1G91A 4ZGDB 3JAME 3LWIA 1AP0A 1SEBD 2SEBD 1ET6A 4ZGEB 2EQMA 3SD4A 1F9PA 3WOEA 5A2QL 2MJ8A 2IPKD 2PZTA 2TMPA 3CXCA 2CHBD 5LJ3g 2PZWA 3FDTA 2X4XA 4F7UB 4K8IA 1S5DD 2RK2A 2N88A 2RSNA 1BDOA 3OWFA 5CMDA 3CCVA 4IUNA 4KD4A 1YJNT 3A55A 5LJ5g 3VJPA 1OI1A 4IUUA 3URGA 5GAN2 3MP1A 4A4GA 4N0AA 3SWNC 1G3WA 5IODA 1H9RA 3I90A 2JNGA 2EY5A 1RD9D 1AN8A 2I46A 4PJOF 2C9OA 4ZUIA 1PTOD 3GOXA 3MA2B 3MXNA 5ELEA 3EAEA 3V8KA 4Q0FA 4FP5D 4KY7A 1EWCA 2B39A 4XQQA 1UEAB 4IKFA 1R4PB 2F5TX 2R92B 4M7AG 1LV9A 2FL7A 5FU7C 1NZ9A 1I4RA 1WQ7A 5M5YB 4TRDA 4C3IG 4H44C 4J7FA 2ZPIB 3A8MB 1XX8A 4OL7A 1DXMA 1Q8IA 4K5XA 1M90U 1STNA 4M78F