4B9XA

Structure of extended tudor domain td3 from mouse tdrd1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
196
structure length
194
Chain Sequence
b'LEWTWVEFTVDETVDVVVCMMYSPGEFYCHFLKDDALEKLDDLNQSLADYCAQKPPFKAEIGRPCCAFFSGDGNWYRALVKEILPSGNVKVHFVDYGNVEEVTTDQLQAILPQFLLLPFQGMQCWLVDIQPPNKHWTKEATARFQACVVGLKLQARVVEITANGVGVELTDLSTPYPKIISDVLIREQLVLRCG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TUDOR DOMAIN-CONTAINING PROTEIN 1
molecule tags Replication
source organism Mus musculus
publication title The Multiple Tudor Domain-Containing Protein Tdrd1 is a Molecular Scaffold for Mouse Piwi Proteins and Pirna Biogenesis Factors.
pubmed doi rcsb
total genus 42
structure length 194
sequence length 196
ec nomenclature
pdb deposition date 2012-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00567 TUDOR Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4b9xA02
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4b9xA01
4NS5A 2BIVA 2F3VA 3UWNA 1JOQA 2IG0A 2F0EA 3T13A 4II1A 4HMJA 2XDPA 4C5IA 5KCHA 1A3UA 4K8IA 3OYJA 1ENCA 4GY5A 1JOKA 4KY6A 3GOXA 3QBYA 1WGSA 3PFSA 3EVQA 5KCOA 2PW5A 5IGFA 5C6SA 2LRQA 1SNMA 3L2RA 4B9XA 1TQOA 4IKFA 1WJQA 2EY5A 4RKBA 5FRMA 4G57A 2PQEA 5EKLA 3OYKA 4IUQA 3EJIA 4DFAA 2D9TA 4NP5A 3L2VA 1XNIA 3L2QA 3ZEHA 5K5PA 4QW2A 4K14A 3OQ5A 4QF4A 2RJFA 2GFAA 1KHCA 4E7LA 4ME5A 5IOCA 4N9TA 2KQ3A 3TP8A 1NUCA 3LX0A 3D4WA 2PW7A 2VYTA 4A4HA 2F0MA 3OS1A 4ZQ3A 3LGLA 4IURA 3OYGA 4ZTFA 4PNYA 2L3RA 1A2UA 2PZTA 3DMUA 3DB4A 5ISRA 3NTHA 3MZ5A 2KHSA 3OYEA 5C3XA 1TT2A 5J26A 3MEWA 2WACA 4IALA 4A4EA 3MXPA 5D6WA 4Z02A 4KHVA 3PMTA 1N27A 3MHBA 5I9PA 3Q1JA 4A4FA 3NP8A 4PMBA 5KEEA 2X4WA 2RHUA 4KD3A 4B9WA 2LKVA 4BDZA 2LDMA 4KY5A 4H7BA 3SK4A 2F0LA 4PLIA 3L2UA 4QQGA 4UC4A 1STGA 2BKDN 5KE3A 4DU9A 4ID6A 3DLMA 5IGGA 4N4IA 3DHQA 2NLUA 5CR3A 1EZ8A 4QVZA 3RUZA 4N9PA 5IGDA 2EXZA 4ODGA 1WJSA 1SYEA 2RHYA 3LLRA 3TP5A 2O4XB 4KY7A 2GF7A 3OMCA 3QB3A 1EY5A 2EYOA 2OF1A 1EY8A 3BDCA 4RKLA 4LD6A 4QMGA 3OYLA 2RHIA 4QQDA 4E7JA 2DAQA 3BDLA 3PMIA 5D6YA 3OYFA 1F2MA 2F0UA 1OI1A 1G5VA 5CV8A 5DEHA 5C4ZA 4KV6A 2SNSA 5CV4A 2O4XA 1F2ZA 3ASKA 2EQUA 3M9QA 5KE2A 3SK8A 2RI3A 5CV5A 3MEAA 3U9OA 3UT1A 3P75A 3ME9A 3NXWA 4KD4A 2X4YA 3OSOA 5C0MA 4IUUA 5KYLA 1SNCA 2LCCA 3C1FA 2F0TA 2B8AA 3CEYA 2M00A 2PZWA 2EY6A 1KAAA 2MWOA 2JZ2A 3FDRA 3P8HA 3OY9A 1SYDA 3OYMA 2F0OA 4K8JA 4EQPA 4A4GA 5CV6A 2NUCA 4E7KA 1EQVA 2PZUA 3S3OA 2OXPA 3MP1A 4BE1A 1A2TA 4QB4A 3OB9A 3S3NA 3D4DA 3OYIA 3S6WA 3L2WA 1NSNS 3E5SA 1A3TA 4BDYA 3MVVA 4N4HA 4MIUA 4PMCA 2HQEA 3OS2A 2P0KA 4CRIA 3NTKA 2F0QA 2RI2A 4BE2A 1AEXA 3E9FA 2RHZA 4C5HA 2RHXA 4KTAA 4E7IA 5E1FA 1SNOA 1WJRA 2SNMA 2EYJA 2RJDA 3SK5A 2F0WA 1EZ6A 4WRDA 2RJCA 5IAYA 2JTFA 2F0DA 2K3YA 2EYMA 4BE0A 2F0PA 1KABA 2CKKA 2M1HA 4PL6A 3MP6A 1MHNA 3LH0A 1EYAA 4J1MA 2RJEA 2PQWA 4TRDA 4OL7A 3F70A 3DB3A 4K2KA 2R5MA 2R57A 3T16A 3MEHA 2SOBA 2RDFA 5EGTA 3OYBA 2G3RA 4BACA 4K2LA 1EYDA 1SYCA 3MO8A 2RO0A 3OA6A 5HGTA 4PLLA 1STHA 4S3SA 3OYDA 4NDXA 3P8DA 4EQOA 1ENAA 3S3MA 5C5LA 5E3FA 2F0HA 4LAAA 2QQSA 3PNWC 2F3WA 4IUTA 3E9GA 3NK9A 2EY1A 4E7HA 2R58A 3OYAA 1U9RA 1EY7A 2F5KA 4K5VA 2EKOA 2F0FA 3S9WA 5NUCA 4Q5WA 3SHLA 3H6ZA 3P1HA 3NHHA 1EY6A 4C5GA 2OEOA 1H3ZA 3OYHA 1KDCA 4K5WA 4EQNA 2FHDA 3FC3A 1STNA 3QJ6A 5M9OA 2EQKA 4J6HA 3EROA 5I9OA 2ENBA 3SXHA 3SD4A 4EDUA 1JORA 2M0OA 2F0KA 2LTOA 5KRUA 1F2YA 1II3A 3KUFA 5KH6A 1EY9A 3OMGA 5F2DA 3FLGA 3ERQA 4OVAA 2L89A 1SYGA 1SYFA 3MEUA 5IGEA 3D8GA 1RKNA 1IHZA 5EKKA 4ZUIA 5I6WA 4FU6A 4IUPA 4IUNA 5J39A 2F0JA 2F0VA 4RG2A 3NUCA 4F7XA 5C5MA 2EY2A 4HTHA 2R5AA 5CIUA 2RKSA 2F0IA 2X35A 3META 4IUVA 3LX7A 2X4XA 2L8DA 1EY0A 4K5XA 3O8VA 1A3VA 2EFIA 2F0SA 1OZ3A 2EYHA 2M16A 3FEOA 4DF7A 5J22A 3QKJA 3H6MA 4L59A 3ITPA 4ZTJA 2GFUA 4DGZA 5IIFA 4C5EA 1RI0A 4NKLA 4F8MA 5C3WA 4IZ8A 1EYCA 2PYKA 3NTIA 2MWPA 3QOLA 2E6NA 1EY4A 3C4SA 5C4HA 1OYXA 4HCZA 3OYNA 2EYLA 2BUDA 2RI5A 5CV7A 1SNQA 4QQ6A 1STBA 4ZUJA 5JAVA 2EQMA 5CV9A 1SNPA 4HMIA 2XK0A 4N4GA 3V2TA 2F0NA 3OWFA 2F0GA 2LVMA 5HURA 4X34A 5D6XA 2QDBA 5KIXA 3QIIA 4EVOA 4YIJA 3PMFA 3EAEA 1SNDA 3R3OA 3TP7A 3MP8A 3QOJA 2QQRA 5FROA 1OZ2A 1TR5A 5DAUA 2E5QA 3LYIA 5CGKA 1STAA 4KJNA 2YRVA 3TP6A 2DIQA 5KYIA 4R8NA 3H8ZA 2EYPA 3HZXA 1SYBA 1SSFA 5IGBA 5IODA 3NQTA 4NMZA 2K3XA 4FL6A 3TMEA 3VA5A 2DIGA 1STYA 1KDBA 3LGFA 5I6YA 4K6DA 1KDAA 5JOBA 5IN1A 4KJOA 5CC4A 3SR1A 3D6CA 5KGUA 2EYFA 1JOOA 5FRNA 3OS0A 3L42A 5C6AA 5J1ZA 3HEJA 2RBMA 4BD3A 4WORA 2EQJA 3MEVA 3OYCA 4I65A 3C1EA 3SK6A 5IGCA 4E6IA 2HQXA
chains in the Genus database with same CATH superfamily
1IW7C 4NS5A 1VQJA 1UWVA 3EHRA 4MTNA 2FZCB 4II1A 4JI7L 1VQPT 4J5YA 2FVUA 4K8IA 3K0YA 2KI7A 1ENCA 2HZYA 3NBIA 1YJNA 2LFNA 2JM9A 1QVFP 4GY5A 3VKIA 1JOKA 4KY6A 3GBQA 3GP7A 4DR6L 2JSOA 2IW3A 4ESRA 1WGSA 3FKIH 2ZPIB 1K9MC 1ESFA 5KCOA 1X2QA 4POFA 4DV4Q 3GQBA 2P5ZX 4ALPA 1N5ZA 2B2TC 3WWVA 3F2DA 4D6WA 5M3FB 2OAWA 2NUZA 2ES2A 4IIMA 2V8KA 2I5HA 4CJ0B 3CMAT 1LTRD 3OHXC 3BYTB 4DR5L 1QLYA 4IKFA 1WJQA 2L3SA 2KAFA 4HJ9A 2UXCQ 2OTLA 1WCMB 4FDBA 5C3EG 3NELA 2I0QA 4PKCC 3LW5E 2JA6B 4A3MB 2ZPHB 1ENFA 1UUEA 1ZUYA 1D09B 3CCVQ 1EIGA 2KT1A 4H13C 4XQQA 1PH4A 1PRMC 1UE5A 2Y0SG 4FSSA 4A3LH 1K9AA 2P4RA 1KG1A 1YI2A 4HAEA 3TEEA 2HNIA 2VASA 4E2FB 3CCUQ 3EJIA 3SE0A 1HNWL 5FWCA 1SXTA 1BF4A 4NP5A 2K01A 3JCMb 1R8OB 1HSQA 2V1RA 3RKXA 3KXTA 1P16A 4M78G 2GN5A 1VQNQ 1K8AC 4FIBA 4F7UE 1TWHB 2D1XA 3G7ZA 1WCMG 3I5SA 4QF4A 5GAN6 1ZYRD 4E7LA 4ME5A 2JXMB 3U23A 4X3TA 5IOCA 3CCVA 2RA2A 2Y4YA 4KGVB 2YYZA 2COWA 1HA5A 1N9WA 1W6JA 1Q81C 1K0SA 1YNJC 1D0YA 2PW7A 3H91A 3V05A 4GNXC 4A4HA 1LYLA 2JS0A 4EMHA 1T5EA 3UDXA 1IBLQ 1KD1C 1L0WA 4X6AH 3O5ZA 3OYGA 1PVOA 1VA7A 2L3RA 1A2UA 1EEID 4K6LA 4UAIA 5IP9H 5L8RE 1PTOC 2KHSA 2JS2A 3W3AA 1NAPA 4MZMA 1OXXK 3G48A 4QIWE 1UHFA 5IT9E 1TT2A 3KF6B 1F2LA 3I91A 2RQVA 1P8LA 4IALA 1WYXA 2B29A 1M27C 4M78C 4HCBA 4B3MQ 4IN3A 1RJTA 4EMKC 4KHVA 1N27A 4RTZA 3X3MA 5I9PA 1QNKA 3Q1JA 4XQJA 3HGBA 5KEEA 3KF8A 2K32A 2M9VA 5C0XH 3S2DB 4QUFA 1XNQL 1SEMA 4B9WA 2LKVA 1E6HA 4B6MA 1GUTA 4BDZA 1K73C 1SLJA 4LNQA 3G71Q 4MHEA 4F17A 1R0CB 5I2MA 1VQKQ 4MZ9A 5ELBA 4JOIC 4KH0B 5LJ5h 2OQ0A 4H7BA 3SK4A 1QVPA 4DAMA 4QQGA 1NJIR 2VVKA 5EC7A 2GQIA 2JA5G 3MTSA 4RCOA 3A56A 1STGA 3S16B 2DXBA 1WOCA 4BBSG 1Q46A 4DU9A 4ID6A 4DR1L 3A8HB 1CSPA 3SHWA 1VQCA 4LJZC 2OWOA 1EZ8A 1VQKT 2E2JB 4M7DG 3M4PA 3F2BA 1SYEA 2RHYA 3HKZB 3LLRA 1ZA1B 5FU6B 2EVBA 5LMUQ 3RLNA 3TP5A 1QZHA 2O4XB 1NJIC 2A6ED 3S1NH 2WB1G 3CF5A 4LXCA 1Q82C 3A1PA 2RSOA 4F14A 3G6JB 4CDFC 3STBC 3L2ZA 4J9IA 4XYQA 3CCRT 4KUDK 3JAMc 5BN4A 2EZVA 1JR0D 5GAOn 4LWCA 2EGAA 3PGZA 4ANJA 4BBSH 5LJ3h 2RHIA 1ILQA 4FCYA 2XU8A 5IHKA 2ZM6Q 1J5EL 4EGVA 1H8KA 2K04A 1KQSA 2RNAA 3HOUG 1NR4A 4MTKA 2LCSA 3PO3H 1UGPB 4EX5A 1B07A 4CKEA 8AT1B 3MA2B 3CBOA 3PIO3 2L0AA 3EH2A 3GNFB 5C4ZA 1VQ4Q 1JCKB 2MF2A 2SNSA 3EFOB 4KBMB 2DFUA 1K83H 2O4XA 4PG3A 4PZ6A 4M7DC 1KFZA 1RODA 3HRUA 2NVYH 1AD5A 2VC8A 3ASKA 2EQUA 3M9QA 3TSWA 3F1ZA 4JC0A 1YHQQ 3M58A 4DV3Q 4OB1B 1QVFA 1YHQT 3U9OA 2B2TA 1M3BA 2IX1A 1Y71A 1SEBD 3NXWA 2BE9B 2KCNA 4AYBE 4LF6Q 5FU7C 4IUUA 4AFZC 4BBRB 2MI6A 2JUFA 1CSKA 4OO1I 1OX8A 2E75C 5DM63 1PTOD 2QGGA 3C2PA 3OIPA 4R9WA 5CBEE 5M3MB 4HSVA 3EGXB 4A63B 2PZWA 2EY6A 1K28A 3CCMT 2GVBA 3QR8A 5HKCA 1G3YA 1I94L 3EA6A 4LMQD 4K8JA 3QYGB 2BH2A 4OMFB 1SE4A 3PUWA 4OO1G 2LZ6B 2NUCA 3CCRQ 1YNJD 1Z9QA 4DK1A 5JEAH 4RTUA 2K4KA 2XI9A 5EBDA 1WJJA 4UP8A 3T1HL 1JICA 1YJWT 3M4OB 5G3LF 4GKKQ 1YJWQ 4MMLA 2O88A 1GUWA 3LWIA 4QB4A 1PFSA 3D4DA 2E76C 1K0RA 5GMKm 1U4LA 2VQFQ 4M7DD 1A3TA 4MIUA 1M2OA 3EBEA 1B2TA 3A8JE 1WXUA 4QL5A 3GTLH 3I56T 3X24B 1KQSP 2RI2A 1IKMA 1M1FA 1AEXA 3E9FA 3M0TA 4JI0Q 5GANd 2FZKB 3VUBA 3EFXD 2RHXA 4KN7C 5D3DA 5I2XA 4LUDA 4XU1A 5C0XG 4B3RQ 1BR9A 1HXDA 3C95A 3TRZA 4ZGJB 2KCCA 2H3JA 1I8FA 1VQDA 1SR3A 4L63B 3FKIG 4A4KA 3P7JA 3HFNA 2CKZB 4JZ4A 4OGQC 3T51B 2RJDA 2UU9L 1X3FA 4LDUA 2HL5C 2PVOB 2FZGB 2NN6I 2F0WA 1VQ6Q 2JA6H 3SWNA 1SFOB 1I4K1 1ML0D 2K03A 2RJCA 1ET9A 1L1OC 2XTIA 1EU3A 2KY9A 1ICFB 4AFSC 1JC7A 4C92E 1SROA 3CCJT 5D14A 5GJWB 1JWMD 4NXNL 1GHKA 1I6HH 5C3EH 1KABA 1Q81R 3A8LB 2M1HA 2RQTA 3JB9I 4A3KB 3UA7A 3GTJB 2PUOB 3NSWA 2YHTA 2ZPBB 4RGOS 4ZCKA 2FPEA 3LH0A 1WTQA 2K5WA 1EYAA 1TTHB 5EPKA 3CPFA 3UDIA 3HS0C 4IPHA 4RGTA 5DNFA 1LPLA 2R7ZG 1VQ8Q 4TRDA 2B8GA 2Q2IA 1EQTA 4OL7A 4B3RL 3CCLQ 1W6KA 2R5MA 1WPYA 1AW7A 3T16A 1E1OA 3MEHA 5GAMd 1VQEA 1M4VA 3HG9A 1B4OA 3GD7A 3TQ7P 3PQIA 2MK5A 5EGTA 3MPUB 1LVKA 4DA2A 1N32L 1OXUA 2L5TA 3FP9A 3C46A 2I5LX 1UGVA 1X2KA 2FPDA 2M51A 1KD1U 1EYDA 1AVZC 2CT3A 3MO8A 1MD2D 2KENA 3S14B 1FX7A 2LMCB 4HCEA 2CGHA 1E1TA 5M3MH 1A15A 1I3QH 4S3SA 2AZVA 5C44H 2SEMA 5C5LA 1HK9A 1K0XA 1SHGA 1BCPB 4PMWA 3EG9A 4R4OA 1JJ2A 4BBRH 1RI9A 1ZLMA 3CCJQ 4C8QD 1PFNA 3MFGA 4LAAA 4AG2C 3PNWC 2DNEA 4YY3L 4CDEC 4JZ3A 1DCZA 1QCFA 2V1QA 3CMEQ 1D8LA 2Z9HA 4JK1C 4X3KA 2EY1A 3V8KA 3TREA 4E7HA 1AWXA 3OYAA 1U9RA 1KQSS 2NN6H 3A74A 2C0IA 2NVYB 3H3VH 1C48A 2A68C 4JVZA 2VQEL 2KYBA 2EKOA 2N78A 1V1QA 4IJHA 2A37A 1D5MC 2DBMA 1RAIB 1O7ZA 2QGQA 4LF7L 3FMCA 2L5QA 3L9AX 4O0AA 1NYFA 1XJWB 2CFMA 4RA8A 2JXBA 4JBKA 1NJIU 4DV3L 4C3JB 1B50A 3QG1A 4R4CA 2DX1A 2OCEA 4K5WA 2VB6A 4EQNA 1PWTA 4CJ2C 3L2PA 4BBSB 1KIXA 1PYBA 4XK8E 2RVLA 5M9OA 2HAXA 2EQKA 2D0PA 2W10A 3EROA 5I9OA 1VQ8A 4C1NK 4RTWA 1C8CA 5ELEA 2ENBA 3SXHA 4Y28E 1X3EA 5GANe 2A68D 1JORA 2FMCA 2WAQE 3W1BA 2QK0A 1F9QA 2F0KA 1Q7YR 1Y1WG 2CP6A 2AT1B 1ZHIA 4QY7A 5LMNW 5CQYA 2EPBA 4IPDA 2ZXPA 3IFTA 2DYIA 2DLPA 5FO9B 1HTPA 4DUZQ 4XTCS 5F2DA 2NZOA 3ERQA 1UECA 1NR2A 4A3GH 4PJOF 4JJCA 1MMNA 2PZ1A 2AHOB 3GTKB 1K9MU 2YDLA 1RKNA 4LDXA 2DY8A 1IHZA 2DRMA 1BCPD 2G9HD 2VL6A 5JJZA 4X62Q 1FGBD 1MGSA 5J39A 2OAUA 2L1BA 3FJPA 4A54A 4J6XA 3NUCA 2BZYA 3U50C 2F2VA 3QDFA 3K59A 5C5MA 5GAN5 1K76A 3CCSA 5FO7B 2IPKD 3RKWA 1FMVA 1I5FA 3CHBD 4BXXH 4ZNXA 1HD3A 1VQNT 1PRTD 4XU2A 3OTOL 2VUMG 2F0IA 2X35A 4M7AD 3FEWX 3KOJA 4HCSA 2YU9B 4QVCA 5KYXA 5C4XG 2E64A 4WFN3 3NWSA 1L1OB 1A3VA 3GF5A 4A3BH 3INZA 4JI1L 2V1CC 4PFPA 2M16A 3EGXA 3FEOA 3A8KE 4JI8Q 2YU9H 1QWEA 3URYA 4YY3Q 3REAB 1TWFH 1N34L 2PI2A 1PC0A 2HMAA 1SAPA 4HN7A 4M77E 1M1KC 1ZX6A 1T3SA 1PSFA 3BVGA 2VB3X 1G291 3GTQB 3ZL7C 1B34A 2RD1A 4KUIA 1J3TA 1EYCA 2PYKA 2ZTEA 3MXNA 4HJAA 3NTIA 2NVXB 2K57A 3JRZA 2EBPA 1M1KU 1WD1A 1M90C 1X75C 1VIFA 2FINB 2LQKA 4DV5Q 4PJOC 4XU0A 4C0ZA 5CR2A 1S5ED 3I5RA 4OIKA 4CKCA 5C4HA 4DR7Q 3U9SA 4JYAL 3TN2A 2JP1A 5JJIA 1SG5A 4M77C 2VUBA 1JO8A 3RLOA 4DV5L 2D8JA 3Q0AA 2WSFE 3HSBA 1SNQA 5DM73 3KJOA 4LUVA 1XMOQ 3AHUA 4ZGEB 3NMZC 4O6JA 1QUQA 4KLKA 3RBBB 1GUNA 1NTGA 2Z6BA 5IYBH 1QVCA 1RAEB 2RSNA 5H1SE 2LT4A 1VYTA 1VF7A 4DXFA 1WTPA 2CP7A 2XK0A 1E0BA 4CI0C 5IYBG 1WXTA 2KHJA 2IPOB 2ICEC 2MQHA 4EQ5A 4ZYSA 1ZXTA 1UE9A 3UF4A 5KYXB 4IPGA 1B7YB 4LUZA 1ZA2B 1TU2B 3RD4A 4HIDA 4A93B 1Q3LA 2EGEA 3JCMJ 2CUBA 2E5KA 2C35B 5D6XA 1NLPC 1YITT 3QIIA 3CRKC 4D8DA 1LTID 5GJVB 1U3OA 4G7OC 2DN8A 3EAEA 2KSSA 3M0PA 1K73U 4DV6L 5DLQE 2DTOA 5C0XI 1CKAA 4JRKA 2IL8A 3R93A 3MP8A 1J6QA 1Q86U 2RMOA 4YWLA 5A2QL 4BA2I 1U8RA 4M7AB 4M77G 1H95A 3K7AH 3CC4T 2A36A 3HPWA 3LYIA 3KUPA 4EMGA 4KJNA 4JI5Q 4RHRA 2J7ZA 1NZ9A 1LJOA 3RMQA 2EYPA 1LT6D 3R2TA 2YSQA 5IGBA 1AHJB 1YCYA 5T1IA 2F3IA 5IODA 4POGA 2YT6A 3QXEB 3BU2A 3OW7A 4F88A 1TS2A 2QA4T 3PGGA 4FT4A 1IL8A 1OXTA 1STYA 2VB2X 5JJKA 1RIPA 1TXQA 1QVGP 3M3YB 3EG3A 5I6YA 2C0TA 1D1IA 4J9HA 1LOJA 3FVQA 2QQAA 3EGUA 3E0JA 5IN1A 1RLQC 2KK4A 5CC4A 3RN2A 4M78F 1C7YA 1NCVA 1BUVT 1WFQA 5KGUA 2EYFA 1AE2A 1TY2A 1A6XA 4R4QA 4MZPA 1LT3D 2Y90A 4KULA 1IYJB 2XRSD 1LTLA 3OS0A 3VR3A 4C56C 1E7OA 2QILA 3HOUB 1DZ1A 2KECA 1PFBA 4WORA 3D31A 3BJUA 3FIFA 3MEVA 3OYCA 3AEVA 3R6OA 5IXBA 3EG0A 4BXXG 1UGQB 3PUYA 1I50B 2E65A 1GUGA 1KC8R 3FHWA 4DR2L 3CPWS 2N49A 4KHPQ 1YNNC 5LJ3j 3CP0A 2CP2A 2KQWA 4GN5A 3T13A 1WIEA 2QEXT 3M59A 4HMJA 5IWAQ 4C5IA 5KCHA 1A3UA 1EOVA 1LTGD 3HOXG 5A2QE 4JW0A 1H9RA 4LF6L 3J7A5 4KHPL 1I6HB 1FJGL 1DOKA 5LMNL 5GAN3 1XPOA 1RAGB 3JV3A 1KIKA 3IFDA 2R3ZA 3PFSA 4JLGA 3CCST 2MPXC 2EJGA 2YUQA 3EVQA 2L9HA 2PW5A 1KSWA 4FW1A 3V7CA 5IGFA 4EPCA 2WB1E 2Y0SB 1STEA 3KFUA 2YRCA 3S14H 1Y8PB 2LRQA 2GA4B 2PMZB 4PZ7A 5D65A 3RZOH 5EJWA 5CMDA 1CTMA 1HHVA 4GLVB 1W70A 3SEMA 4GN3B 4OWXB 3J81E 1UAPA 3HOXB 1BB9A 1VQPQ 4RKBA 3C94A 2EYXA 5HK0A 4G57A 2IY5B 1U0LA 1UJ0A 1HZBA 1T9HA 2NVTB 2NVQH 4B3SL 4PJOG 2IJ0A 2DM1A 5EKLA 1CM9A 1CKNA 3MXUA 2LQWA 3OYKA 2BE5C 4IUQA 4B3TQ 4RUGA 2P0PA 2DD5A 1AZEA 2D9TA 2OI3A 1HTLD 3J7AF 4BY1B 4JI5L 1XNIA 2ZZDA 3L2QA 1ZQ1A 3M55A 1X69A 5C3EB 3AYHB 3ZEHA 5K5PA 1NPPA 3JCMg 4K14A 4DN4M 3HHTB 5ECAA 1Y14B 5LMNQ 3OQ5A 1Y1WB 1Q95G 2R6GA 4HCKA 1NBWA 1FNUA 2GFAA 1EQQA 1HR0L 2UXDL 4NL3A 4QGUA 1XJVA 1O80A 1SFOH 2LMJA 2KQ3A 5BR8Q 1K8AU 4J9FA 3LX0A 3D4WA 1WX6A 4C92C 3PT9A 4X62L 2BA0A 2JNGA 5EG2A 4RG8A 1TUCA 4XQNA 1U1SA 2NYZD 4IFDG 2DNCA 4X3SA 3LGLA 2HQHA 4OMOA 1D1CA 1CUKA 4ZTFA 4ZN3A 3ULJA 2PZTA 4F87A 4KGXB 3RUXA 5FU7B 4JLIA 3VYGA 3NTHA 1TOVA 1KNAA 1C4QA 3MEFA 4C3IH 2RN8A 3I4NB 3A0JA 4OHJA 5J26A 3MEWA 1MI2A 2DJZA 1PZJD 5C4XB 3K5LA 4AQYQ 2B2YA 4K0KL 3QO3A 4A4EA 2XNAC 1ZEQX 1VQ7T 4M7DF 5D6WA 1D6EC 2ATCB 3PMTA 5CV4A 5EPJA 4R4IA 4PMBA 4GOPA 3HP9A 2X4WA 4R55A 4MZTA 4A3EG 1Q8KA 1NE8A 2D9UA 3I4MG 3FRPB 1TUGB 4M7DB 4KY5A 2YTYA 2DGYA 3H0HA 3T1HQ 4HT8A 4A3GG 5GMKi 3SVMA 3A5UA 1V8QA 5LMUL 1X9NA 3DLLA 4A3JG 1VYUA 2BKDN 4AMCA 2D6FA 1RADB 1KK7A 1UUPA 3S15B 2Q2TA 3CMET 4QQBX 3CCMQ 4WJ4A 2XSCA 4JI1Q 1PKTA 1KTKA 2ABLA 2J0TD 3RUZA 1MIUA 4X64Q 2LQNA 4J9BA 1YNZA 2EXZA 3TDQA 3KJPA 3V8LA 2K75A 2WIIB 3I4MB 1TY0A 4X65L 1GVPA 2GF7A 3OMCA 4RHSA 2H5XA 2E2IB 2NVTH 1OEBA 2EQIA 4LD6A 5GROA 2JA8B 1BBUA 1G8XA 2QF7A 4CC3A 3BZCA 4QMGA 3DWAA 4C3HG 1VQLA 3OYLA 2JJ9A 1HUMA 3A7AB 2KRSA 1FMKA 5GANg 1Q7YU 3HOXH 3NWTA 4JI4L 1RACB 3BDLA 5IH2A 1IW7D 2LSSA 2MO0A 5LJ3e 4XXEA 5FJ8G 1SMYD 3ULPA 4FF2A 4X66Q 4JRPA 4M75A 3T56B 4DV1L 1B53A 5IYDG 1G5VA 1N36L 4V190 1XNRL 3LH5A 1CZWA 4RCBA 4C8QA 4N8FA 1WHKA 2E4HA 2QTVA 5CKHA 2RCFA 2VZAA 4KV6A 2JA8G 1BI0A 2ZM6L 1LT4D 2PI2E 4M75G 4GLXA 1AN8A 5CV5A 1F9RA 1PRTC 4X1VA 3VV0A 3CXCP 3RERA 3DEOA 2AK5A 1EEFD 3ME9A 5IHIA 3BFMA 1MMAA 4KRTA 1QWFA 1I1JA 3FPUB 5C0XJ 2QDYB 1SPKA 1WHGA 4JJDA 3QUIA 1O78A 4C8QB 2F0TA 2BE5D 4C8QE 3K5NA 4HKEA 3HOVG 2M00A 1HFGA 4LUOA 1HNXQ 2LJ1A 1BQQT 3S1MB 3I4LA 1KAAA 4M75D 2LCLA 1LABA 1NM7A 2B2WA 2D5DA 2JT4A 1UE6A 2B2UC 2MWOA 2JZ2A 3P8HA 2AZSA 3OY9A 1CQVA 4LUEA 4EQPA 3Q23A 4A4GA 4RCNA 1WZOA 2E2HB 1Y69U 4A3MG 3TS0A 2PUKB 1TG0A 1X01A 2CQAA 1EQVA 1QP2A 2E41A 3HRZC 1WQ7A 2L3QA 4O42A 3RZDH 2ENMA 1B9MA 1D1BA 2E3HA 4KKSA 1WTVA 4JV5L 3CCRA 3CPWP 4BE1A 1A2TA 1KD1R 4Z89A 2CREA 2NBFA 4HSPA 3OB9A 2KUMA 3HOVB 4FVMA 1PTOF 3OYIA 4HIMA 1IHWA 1NSNS 3E5SA 4JI6Q 2OTJQ 1BBZA 2HQEA 5LJ3f 2KRMA 5KYYA 3GIBA 4CRIA 1VQIA 3Q6SA 1CSQA 4LF8L 3PO2G 3H15A 1VMCA 4PK4A 4C5HA 4HA8A 2K6DA 1EUJA 1O7YA 1E2WA 2HL3A 5CORA 5CKBA 4IQZA 2F69A 4E7IA 2YV5A 4GS3A 3JCMX 4L5RC 5FW9A 1SNOA 2M9UA 5KNDA 1K83B 1BU1A 4LN2A 2G6FX 4LFBL 2XIDA 1BCPF 5CAIA 2FFKB 4JPBW 3JB9G 1EZ6A 3Q8DA 2E74C 4WRDA 4NOYA 2VXWA 4OELB 2K5NA 3BW1A 4BI8B 2I07B 1SSHA 2D0QB 5IAYA 2JTFA 1KRSA 1PCXA 2AUKA 4UHVA 2K33A 4YHHL 3VS2A 4DOWA 1SRLA 3QPHA 4J15A 4BE0A 4FYXB 2F0PA 1UFFA 3I4MH 2ED1A 1MGQA 4M7AF 3UPUA 1PFMA 3ND8A 2KEAA 2PVGB 1Y8OB 4R1JA 2B39A 4JCVE 1A8VA 2UUAQ 1RTOA 1MV3A 1GJXA 1RDPD 2CQOA 4M77A 2BZ8A 1XMQQ 3KBGA 1FWZA 3Q24A 1HA6A 4D8KA 1B1ZA 2RJEA 3I35A 1HJPA 2OX7A 2E12A 2PQWA 2VGNA 3J80c 2CCZA 2HEQA 2B2UA 4ZAIA 4PJMA 1YJ9T 1Y1VG 1M3AA 1ET6A 2R92H 3RR6A 1M90R 3C3LA 1M1GA 1B3QA 3N52A 3VR6A 2BDNA 2G3RA 1U1TA 1NEGA 1I50H 2PVDB 1RUWA 1Q8IA 2ZPGB 1GBQA 4LF5Q 3OBYA 2DXTA 3I55T 3O13A 1V1PB 2JA7H 3S1QB 2IHEA 3AT1B 3NBHA 3S1MH 1IHVA 1ZSZC 4WF2A 3M7NA 4DR5Q 1QW1A 1VF5C 1WTXA 4PLLA 3A98A 1STHA 1KRTA 3OYDA 4EQOA 1IBML 1ENAA 3WOFA 4U68A 5E7NA 1ESRA 5EBCA 5E3FA 4GOPC 2DY7A 1BXTA 1TS9A 4J6YA 3CC2Q 2L15A 3HKZG 2F3WA 3WDNA 1Z9ZA 3CQZH 4DNRB 5C44G 5FO8B 1RTNA 1G6ZA 2LQ8A 3JAME 1H9JA 4NXMQ 1NEBA 1D5ZC 3PF4A 2V8IA 4J8OA 3PIOA 1BI2A 5EPLA 5FK9C 4FF1A 1EY7A 2NTTA 2O2OA 3TSZA 1PD0A 5I21A 1AEYA 3DUZA 3S9WA 1QG7A 3M85A 1JMCA 3A8OB 2EJMA 2JM8A 4A3EB 1QKWA 2H3EB 2HCCA 3H6ZA 1XOVA 3VUZA 3NHHA 4YTLA 1WXBA 1SE2A 2XIWA 3QIAA 1OXVA 2QQ9A 1RF2D 3JAMi 4J83A 4PJOD 1IKLA 3TQYA 4A3GB 1KDCA 3OYHA 1X65A 3U4VA 2HCKA 1S72A 2CP5A 3CAMA 1XNQQ 4A3FG 3S17H 3PIPA 2X3WD 5ELDA 1Q86C 2EOTA 2EYWA 2KXDA 2F5TX 2Q2HA 4I7ZC 3RN5A 5FLMH 5IP9G 3E9IA 1SMYC 5I22A 3GTGH 5KRUA 1FD7D 4RGNA 1YJNT 2XRQD 2KROA 3JAML 4QJFA 4P74A 1YJ9Q 4L6V5 4M1UB 4DUYL 3KUFA 5KH6A 1EY9A 5FLMG 3HFOA 3OMGA 4XTXA 2B2VC 3MWYW 1JJ2P 2DVJA 4K11A 1U5KA 3U58A 2D62A 3DM1A 2Z0WA 3H0GG 4NL2A 1S5BD 5J3BA 3HOZH 1F1BB 3J80i 4C8QC 5AJ3Q 4HJ8A 1OTCA 1JRIA 3SWNC 2J4XA 5FOBB 4DV2Q 2F0JA 2NUTA 1C6VX 2R7DA 2FB7A 3BZDB 4ZKBB 2EY2A 1AE3A 2RA4A 2DL8A 2KCTA 4HTHA 4C2MH 5CIUA 3UATA 1BNZA 2QA4Q 2NVXH 3META 3LX7A 1TVXA 5M3FH 4DUYQ 1IXRA 4UDUC 3CCUT 2E5LQ 1J8IA 2O9SA 1EY0A 2JN4A 4K5XA 3UA6A 1O7IA 1OZ3A 1VQOQ 2EYHA 3M9BA 3MJXA 1IYUA 2KT8A 1J9OA 4JV5Q 3CKIB 1K1ZA 2HHHL 2ALYB 2DTHA 3QKJA 3CCVT 3H6MA 1TS3A 4C3IB 3I4NH 1PDQA 2QCPX 1W3SA 4C5EA 4J9GA 1EFNA 2GCXA 2B2YC 2QXFA 3X20B 3X3NA 4FXDA 1DXMA 1BYMA 4DAPA 1XPRA 1T0HA 4L6TB 2H4OA 1KJWA 3ULRB 2UXCL 2A6HD 3PV0A 5M5WB 1HNXL 2MWPA 2ECZA 2A69C 2V26A 3QOLA 2XWJB 3VYTA 3C4SA 2X4JA 4OMPA 4JI2Q 1UG1A 3CC7A 1DD2A 3L3OC 2DILA 3JCMV 5FLXc 2N88A 6AT1B 2EYLA 1OV3A 2BUDA 2RI5A 2TMPA 2KRNA 5CV7A 2DERA 2JE6I 3VYSA 2LXJA 2EYZA 4QQ6A 4X9CA 4DXGA 4JBMA 3CCQQ 4P75A 2BOSA 2OTLT 4ZUJA 4FNFA 5JAVA 1KHIA 3BS1A 4A3KG 3QO2A 3SDZA 1TXYA 2Y0SE 3GTMH 3ONAB 3VS5A 1W1FA 2YTXA 1YNND 2Z0SA 4HMIA 4MN3A 1HNZQ 4BY1H 1X6OA 4A3DG 1WQWA 2J6KA 3ZFJA 4CC7A 5J1ZA 3BVZA 1H9SA 3V2TA 2F0NA 3L7ZC 1EU4A 2K2VA 2F0GA 1Q82R 1GFDA 2GBQA 4H0LC 2YUOA 2CS7A 3CQTA 3P20A 2HKNA 2SRCA 1OPLA 1QVFS 3H0FA 4EVOA 3PMFA 1Q12A 1M4ZA 4TVAB 2K5VA 3JB9J 5C4JB 5M5YB 4BB7A 3N5BB 1X54A 2N3SA 3TP7A 1ZSZB 2FO0A 4AFQC 1CI3M 2QQRA 2KHIA 3J81i 2A7YA 4LD9K 4M78D 1PZKD 1OZ2A 1PG5B 1YIJT 5DAUA 2E5QA 5CGKA 3VS0A 1AZGB 2EYYA 3KK7A 1VMPA 4BI3A 3N6RA 3M0SA 1KQ2A 5KYIA 3CC2A 2O5IC 1Y57A 1N6AA 2VGMA 1XXGA 2DE0X 2DL5A 4L5QA 1G51A 3H8ZA 3GNGA 1PKSA 4OIJA 3CCLT 5E4WC 3WVDB 4GNXB 3TU4K 4XIGS 3EG2A 1DYQA 3EN2A 1M90U 1D0XA 4OX9Q 3VA5A 2CH4A 3MFYA 2A74C 1DM0B 3S17B 1PM3A 3NBHB 3LGFA 1ABQA 3GTMB 3RDVA 1AFPA 1WLPB 2ZCFB 4K6DA 1EX4A 2X51A 3JCMd 4PV1C 1KDAA 5JOBA 1QVGA 1ZBJA 4KJOA 4QIWB 1HJDA 3PE0A 2FL7A 1U5SA 5L37A 1KQ1A 5FRNA 2Z8LA 3GV3A 5C6AA 2N55A 1TSFA 1VQGA 1JE5A 2ROTA 2ZAEA 1FMWA 1BBWA 4I65A 4YCVA 5IP7H 1MJCA 3JCMP 2XG8D 3VYRA 5IGCA 4C3JG 2EQSA 3VR4A 4E6IA 2HQXA 4OMMA 1YJWA 1PRTF 1TIID 1EIYB 2ZJQA 2E1HA 5M3FG 3QWXX 3GLXA 2H8HA 3RKYA 1H9MA 2F3VA 5GAEC 4JI4Q 2EGCA 5CCAA 3QDRB 1LV9A 2D0OA 4WJWA 2B2VA 2JN0A 1S3OA 2WV6D 5KYYB 5CYUA 2XDPA 3S24A 4ZK9B 2LNVA 2OT2A 1RL2A 3CQZB 2MUYA 3PUVA 1AOJA 1G8ZD 1VQMQ 4JI6L 3GTGB 1GM5A 4EIKA 2ZGWA 1D1KA 2ROLA 3FB9A 3GOXA 1TS4A 1PA6A 3QBYA 5GAN4 3VA7A 4GLMA 3I56Q 2B3GA 5HK3A 2MP1A 1HNWQ 5GAOp 4QKUA 1GBRA 2I5MX 4DNIA 1F9PA 5C6SA 1ZSGA 1E22A 1W4SA 3S1QH 2JA7B 1D2BA 2UUAL 1Z9FA 4ME7A 4IO9A 1SNMA 1VQ7Q 1FYNA 3L2RA 4M78B 1X3PA 4NB3A 1NYGA 3PCOB 3GTOH 4B9XA 1PNJA 3CW2C 4A3DH 1H641 2I2LA 1WTWA 4I7AA 4YHHQ 1GXDC 1E3PA 1OU8A 3RR5A 4IPCA 2QYZA 1JQQA 1IBKQ 2LX7A 5LHY1 3CCQA 2PQEA 3NPPA 4C3HH 3DM3A 4QCLA 4BS9A 4Q5VA 4KN4C 2VW9A 3HOVH 5EKIA 2HIXA 1WYDA 4R0KA 2EPDA 4RMFA 4YCWA 4DFAA 1IBMQ 1CFMA 3IQLA 2NN6G 4HIKA 3CMEA 4ZN1A 1K3RA 2XDBA 4LDWA 2QW7A 1MV0B 4WTOB 3OSVA 1D1AA 3MHXA 2NUPB 2GTJA 1DOLA 5CK9A 3W1GA 1VQLT 4LF5L 5GANh 2RJFA 1VQLQ 1WHLA 2DNUA 4OMNA 3I8ZA 2K6AA 5JPMC 2M2LA 1IXDA 1O7LA 3TP8A 1EL0A 1JJGA 3G6EQ 4M75F 4X66L 4E7ZA 3M7GA 1YWPA 4BY1G 4NW2A 4A3LG 3OS1A 4XTZA 3QWNA 4ZQ3A 3T53B 2PPBC 4JJNK 3HKSA 4FO2A 2JOYA 3G1JA 2QEXA 1VQ5T 1BOSA 3ZYYX 5A0DA 1FGUA 1C1AA 2HQLA 4PNYA 2KEEA 4LF9Q 2HD0A 1MNEA 1TKWB 3AFPA 1MNDA 3DMUA 5EQ0A 4XT3B 3DB4A 3PSIA 4RGMA 5ISRA 2I0NA 1A62A 2WFWA 3MZ5A 2HHHQ 3OYEA 1EIHA 1HR0Q 2FHTA 2WACA 4OP0A 4XTVA 3STBD 3LWHA 1SMXA 2E2DC 4RAUC 2MMPA 4C0FA 3SB2A 3PUZA 5GAN8 4P2CB 2E8GA 2OTJT 2PCFB 1BO0A 1M8MA 3LWUA 3TZDA 3NP8A 4A4FA 4X64L 3H41A 2R93B 1GCPA 3QYHB 2C9OA 2PNRC 4Q0FA 2Z6KC 3EHQA 4LDYA 2B8FA 1EYGA 4F7UF 5LJ5f 1R4PB 4LFBQ 4GBQA 1PH6A 3I4NG 2IT1A 1VS0A 3TBIB 2ZJPA 1GD7A 1YWOA 2F0LA 4PLIA 1V1OA 5M5XB 3JCMe 2AMCB 3E19A 5KYUA 1LACA 1XWEA 3PO3B 1XNRQ 1IGQA 2L55A 4DV1Q 3CCEQ 3CC2T 2HKQB 3DHQA 2AQ3B 2RF0A 3PVLA 4XU3A 4MDXA 1PZID 1XX8A 2KVMA 5CR3A 5JEAJ 2COYA 3H3VC 2R93G 2RDHA 5ELFA 2PNIA 1VQFA 4PJJA 1VCIA 4RTVA 1WJSA 2JMCA 3K58A 1CHPD 1Q90A 2DVEA 1GL5A 3H09A 2VUMH 1E24A 4K0KQ 1KC8C 1L0YB 3K7UC 3JB9H 5DLOA 1YHAA 3HOWB 1M3CA 4J9EA 1YITA 1JB3A 2K05A 3CRLC 4LDVA 1PH7A 1IZ6A 2AKLA 3WXMB 1F9SA 1OO9B 4GLKA 4LNPA 2PQAA 1JT8A 1DJ7B 3SWNB 3BG3A 2C5CA 4DV6Q 1EWIA 3E1SA 4Y92A 1Z6HA 1PLFA 3OW2P 1UE1A 2AWOA 3EGDB 2TSSA 1T0JA 1U4RA 2F0UA 5A35A 2A3LA 4Z88A 3NFCA 3A8GB 5HGQA 3HOWG 5DEHA 2HBPA 2WB1B 5M5XH 4Y91A 1FL0A 1GUOA 1AWJA 1LM0A 1X6GA 2R92G 3LGJA 3MEAA 2EJFA 2ESWA 2QGFB 3G4SQ 2K9GA 2DZCA 4A75A 2PQAB 4XTUA 3G4ST 4BUGA 4KD4A 1MSGA 2MIOA 3J81c 4JS4A 3OSOA 4B3TL 2YXYA 4ORZA 1SBBB 2XD0A 3KFVA 1SNCA 1ZKOA 4JOIA 3HOYB 1Q81U 2KYMA 2LCCA 3AQQA 3C1FA 4DR4Q 4A3FH 2B8AA 3VR2A 4AQYL 5KNCA 1RABB 4M75B 1VQ4A 2CHBD 3GV6A 1N9SA 4IJLA 1CKMA 4AYBB 4A3MH 1EFID 1SSOA 1UGSB 1WNLA 2F0OA 1PH9A 4C92B 2NZ1D 4KKUA 1CKNB 5CV6A 2RK2A 1Y1WH 5IE8A 1QVGS 4E7KA 3E6ZX 4ZLTF 4PJLA 3RMHA 1WHHA 2NZHA 1ASYA 1UEAB 1YNXA 1YJ9A 3S3OA 2DPPB 1L2FA 4JJBA 2OXPA 2PZUA 1EIFA 1N9RA 2XVSA 1WFWA 3ICEA 3HOYG 3H0GH 1XMQL 4H44C 1G83A 1QMCA 3QZ9B 1PRLC 5GMKh 1ARKA 3J80E 2KNBB 2IHFA 4KKTA 4TQUS 2O9VA 2CP3A 2B86A 3L2WA 2KOLA 3MVVA 5TSSA 1S40A 1RD9D 3OS2A 2P0KA 3A8IE 3NTKA 1GKHA 2DXCA 2MFIA 4FT2A 4JBJA 2RHZA 2PMZE 3LNNA 4KTAA 1GRIA 1JWSD 1CQFA 2ID0A 2KXCA 2L4NA 4KK7A 4BY7H 1I4RA 4CJ1B 3CBPA 1VQ5Q 1Y8NB 3I56A 4GKJL 2SNMA 1B9NA 1ZUKA 2QI2A 4NPSA 5GAOl 3SK5A 2ZTCA 1Q86R 3S1RB 2KDSA 4Y7NH 1VOMA 3JCMW 1WHMA 5IT9L 1HR0W 4B3SQ 4OXPA 3HKZE 1K4US 3UE0A 4L5SA 1G3SA 1ONLA 5GMKj 1NBEB 4C92D 1SKUB 2DEQA 2JA6G 3BDUA 4AG1C 4LF8Q 4KHZA 3T1YQ 3TZUA 1Y1VB 2CKKA 1A0IA 1BCPC 3R2IA 4U673 4JI2L 2GQVA 2NTSA 3GTLB 1C0AA 4PL6A 3MP6A 5CVIA 5GMKl 5KNBA 3FKIB 5GAMg 1YI2Q 4JI3L 3M4GA 2VS1A 3J7YW 2KEDA 3V8JA 1OX9A 4HT9A 2RK1A 4M8AA 1HRJA 3CPWA 2HUGA 2AQ2B 2K4YA 2NVQB 3HP3A 4DR3L 4K2KA 4DV0L 1E2ZA 2DA9A 1M8VA 2SOBA 1SDFA 4KT0E 2RDFA 4CC2A 1VQOT 3CMAQ 2DXUA 2DKGA 2IIMA 3D7SB 4WCIA 4BACA 2K1BA 1Y96A 2LP5A 4X65Q 4K2LA 1MJEA 1ICWA 3V7SA 3NENA 2E5LL 1QZGA 2RQWA 1SYCA 3I4OA 3JCMc 3C0CA 5GAMj 3RMSA 2QA4A 2RQUA 1W2BP 1H3HA 2VKNA 2DL4A 2A6EC 3P8DA 2DYBA 3CCSQ 1XPUA 3S3MA 5CO7A 1AH9A 2L12A 3DEPA 3IRBA 4ULLA 4C0DC 2F0HA 2YUPA 2R7ZH 3AMUA 2Z6KA 2VXFA 3E9GA 5CQXA 4MDWA 4DBQA 4OO1H 2K79A 4OB3B 2VY3A 1V1CA 4DPGA 1OOTA 2FPFA 2F5KA 4F7UA 1CA5A 4C0DB 1IYVA 1C9OA 2AKKA 1N36Q 4OWTB 3CCQT 5NUCA 1X3GA 1UB4A 1XTCD 2K14A 2YTVA 4CHTB 3SHLA 3AFQA 3KLRA 4M7DA 5EAYA 1AZPA 2JEAI 1S72Q 1E2VA 2LC4A 1I4PA 2RHSB 3G7LA 4AH6A 1B70B 2DL3A 2RQRA 4C5GA 4A93H 2M02A 1JBMA 4PJOB 1H3ZA 2Q8IB 3I70A 2FHDA 4DBRA 3FC3A 2UUCQ 3JB9D 1STNA 4ZGDB 2HIVA 3QJ6A 4DEXA 1ABOA 1TWCB 3EQLC 4J6HA 4LW1A 1N34Q 2Y4XA 3SD4A 4CC4B 1LUZA 5LJ5g 3CXCS 3MKDA 3VS1A 2M0OA 4JI8L 3PO2H 2JVVA 4E6RA 2CZ7B 1FNWA 3W5OA 2Z1CA 3KDFB 5BR8L 2VUMB 3UDGA 2RH2A 3THKA 2UXDQ 4MNOA 2KGTA 1W6XA 2NWMA 4DQ2A 3VR5A 1OULA 3PVQA 2E10A 2MGSA 4OVAA 4IOCA 4A76A 1SYGA 2DK3A 2BH8A 1OQKA 1WD0A 3FPPA 3MEUA 4DAVA 3CXCA 2LJ0A 1W2BA 3KLSX 5T1GA 5EKKA 1UE7A 1D5XC 4ZUIA 4IUPA 2FMMA 1R9TH 4DK0A 3UI2A 4ME3A 4DV7Q 5FU6C 2F0VA 1ACMB 3D6WA 4LFCQ 2XMFA 1G3WA 4GLAC 4F7XA 3CD6T 1YITQ 4J9CA 2AIRB 4C1NI 4JI0L 3CD6Q 2XDDA 1H9SB 2A6HC 4JYAQ 2RKSA 1G6PA 4FYVB 4J7IA 3T4AC 5M5WH 3KF8B 2EW3A 4JRQA 3D4RA 1OU9A 3RIRA 3RLFA 3S2HB 2X4XA 2L8DA 1EWCA 2EFIA 2F0SA 2AHJB 2E70A 3P8BB 4DV7L 2K5QA 1VQ7A 2CH4W 3M0UA 4DA4A 3CCEA 1GCQA 4PZ8A 1N8RC 4L59A 3ITPA 2D0NA 2GFUA 3OSSC 3CCLA 4X3UA 4BWGB 3BE3A 1G2TA 3M5AA 2MPMA 3GTPB 3JCMh 5IIFA 1C0MA 1RI0A 1QWYA 1G2BA 3TCJA 4M4ZA 3I90A 4NKLA 4F8MA 1QP3A 5C3WA 1P92A 1SRUA 1K8OA 3V7RA 4RTYA 1HYOA 3L0OA 5GMKe 4J9DA 1YIJA 3GTKH 3I73A 1R9TB 1BCOA 1UHCA 3T9NA 1EY4A 3D3RA 5I2SA 1Q1BA 5IWAL 1OYXA 1PHTA 2DZ9A 1ZSZA 2K52A 3GP8A 4HCZA 4AYBG 4CBVA 1UNSA 1K8GA 5FJ8H 2BZXA 3J81L 3AU7A 1JEGA 5I2YA 3HOUH 4JRIA 4C0GA 4G7ZC 2UUCL 4XDXA 2JTEA 4LF9L 1T3LA 1STBA 5A0LA 1TWFB 5DM7R 4RTXA 1Y0MA 4B08A 1GXIE 2EQMA 1SNPA 1TWGB 1TWCH 3I3CA 4A3BB 4XAXB 2K28A 2LNHB 3EG9B 5CBAE 3M54A 3G6EA 2A5HA 2L0CA 1VQ9A 1DGSA 2WKCA 4N4GA 2YLCA 1B8AA 4JUVA 3ULLA 5GAOr 2LVMA 3GDEA 1ILPA 5HURA 2DF6A 5LJ3d 3EG1A 3BYYB 5M5YH 3RNJA 1HZAA 1I4GA 2QDBA 4RFBA 5KIXA 2DUDA 4EMKB 2O5JC 2EJGC 5GAMe 4F04B 2HDAA 2MO1A 3M53A 2CSIA 1SNDA 3X26B 2RHQB 3NE5B 2JA5B 4OGCA 4A3DB 2F4VQ 3EFSA 5GAN2 2CYZB 1DJRD 1HH2P 2CWAA 3ERSX 3M56A 1VQMA 5FROA 2FRYA 1JJCB 1LTAD 3UDCA 2B63B 1MKHA 1TR5A 2RPNA 1AWOA 1VQ9T 1STAA 2EVRA 3GTQH 2KMTA 4DAYB 2DIQA 1I81A 4A3EH 2ATWA 5GAHC 3CCJA 3VS6A 3X25B 3R6NA 1YEZA 1IBKL 3H0IA 4GN4B 4FP5D 2K5HA 3HZXA 3BDOA 3KDFA 3VS4A 1FVIA 3NEMA 2LT1A 1FXXA 1SSFA 2FJ2A 2RQXA 1VQ6A 5C44B 3K5MA 1K73R 3G6ET 2FG0A 3TMEA 3RNUA 1JE4A 3KYHC 4P71A 2CSQA 2GVAA 3OOCA 4EMKA 1KC8U 1EWHA 3H9NA 1KDBA 2CZ6B 4M7AA 4ILWA 1S5DD 2YRDA 2K2MA 1SJED 1ZBXA 2XHCA 3D6CA 4PJOA 4HIOA 4M77F 3M0RA 2F4VL 2QKIC 3GO5A 1BIBA 1BK2A 4BD3A 3RESA 5KYNA 1NMFA 2RBMA 3EFRA 2EQJA 3NQIA 5GAMf 2C06A 1FNVA 2UU9Q 1GFCA 5LL6S 2A1AA 2XWBB 3C1EA 2F1LA 1NMGA 3SK6A 1TH7A 3T1YL 2A28A 2X69A 4OB2B 4OB0B 2KBTA 5GANj 4GNXA 4RWSC 1PXUA 2JJQA 1MMGA 3VS3A 1IL2A 2BIVA 3CCET 1S4ZA 1NY4A 3UWNA 2BCOA 2IX0A 3DWPA 1JOQA 2QDLA 2R92B 2IG0A 4XT1B 2F0EA 1V9PA 2FXQA 3J80L 4DBHA 3OW2A 1GO3E 3AB9A 3J81j 2J06A 3OYJA 1QCNA 1IREB 1FYCA 1VQAA 2SDFA 3GTPH 3PO2B 4RKUE 1M2VA 4ELYC 4DNTB 2KA7A 4GKJQ 5IYCH 3JCMQ 3NGPA 3DWQA 4BBRG 2FRWA 4ZRZA 1JJ2S 3GPLA 2PO4A 2CZ1B 4UP9A 1JB7A 2LXKA 5LJ5e 3OW2S 3HOZB 3MXGA 1A63A 4C3JH 3HL8A 2JEBI 3IKJA 2ICIA 2FEIA 1PD1A 2R7FA 1O75A 4A3IH 1TQOA 3CD6A 1I94Q 4C92G 2EY5A 2A08A 4G4KA 5FRMA 1X56A 3EIVA 4G7HC 4N0AC 1VQMT 4HVVA 4A3CG 2I46A 3OTOQ 2Q2UA 2JA8H 1X43A 2JA7G 1S5FD 3VRYA 4UY8C 1X32A 2KE9A 5IT9c 3QZ5B 2YLBA 4BI4A 2ASBA 1DONA 3CC4Q 5HY6A 3CC7Q 4Z8AA 1HXYD 4A3KH 1QB5D 3S1NB 3L2VA 1SE8A 4KGZB 1IB8A 2R61A 4Z9CB 1Y1VH 4QW2A 2GTOA 4C3IG 3K8AA 1I07A 2Z4HA 1G91A 1OXSC 2G9DA 2K7VA 3S15H 1A0NB 1KL9A 4DR7L 1KHCA 1KLUD 1GOZA 4N9TA 1L0XB 2JW4A 1M1KR 1BI3A 2PNHA 1NUCA 3HTRA 3CC7T 3K57A 1MBYA 2G5DA 2VYTA 1V1PA 2F0MA 1G3TA 2QG9B 3K80C 4M78E 1TWAH 2ZJRA 5A0GA 2E2HH 1VQOA 4IURA 3JC66 4FF4A 2HSEB 1SN8A 5JPNC 1I5LA 2HCIA 2J6FA 3K6OA 5JVG3 2VXEA 1D7QA 2LJ3A 3MC0B 2ZXOA 1YHQA 4FM4B 2JYOA 3OIQA 2YWWA 4JBWA 1BKBA 1X27A 1CK1A 1QOHA 5C3XA 5K36G 1PTOH 1HZ9A 1BDOA 5ELOA 3MXPA 1PH8A 4Z02A 4F7UG 3WVEB 4RG1A 4DK6C 3MHBA 5I11A 3QWYA 2DJGC 4GOPB 2J6OA 4OF1A 3ND9A 2RHUA 4KD3A 2R7ZB 1U4PA 1YHBA 4ABNA 2VQEQ 2AUJD 4DR1Q 1JQYD 2O2LD 1QILA 2MHVA 3KLSA 4AIMA 4FSXA 4DEYA 4DV0Q 2MAMA 1JXOA 2LDMA 3VJPA 3JSCA 4C2MB 2L2PA 1K3BC 1KLGD 3L2UA 3R8BA 2A8VA 2QTXA 4UC4A 3IAYA 1K9MR 1GHJA 1X6BA 3LWEA 8ATCB 3E9HA 4RH6A 5KYUB 1RAHB 1QE6A 2OTLQ 5KE3A 2KJXA 2NB0A 4A3FB 3DLMA 2WSCE 5IGGA 1TU0B 2EYQA 2VQFL 4N4IA 4F7UB 4TKOB 4H02A 2NLUA 2V4DA 4KMUC 4MMKA 2K3BA 1ZYRC 2AKWB 1TUDA 1MUZA 3J7AV 4QVZA 1AT1B 1WVLA 1UGRB 4N9PA 5IGDA 5IYDH 4OMQA 2D8HA 4ODGA 2F03A 1CKOA 2ZPEB 4B3ML 3G71T 2XICA 4L5GA 2HDMA 5GADC 1N32Q 5GANf 1YP5A 4KY7A 1MMDA 3QB3A 2RB6A 5CKDA 1EY5A 2EYOA 1VIEA 5FLXE 3HRSA 2OF1A 1EY8A 3BDCA 3F8TA 4RKLA 4O5VA 4A3BG 3FRNA 2AQ1B 3H0GB 3G71A 3U4ZA 3UDFA 4A3JB 3S16H 1IO6A 1EQRA 5BN5A 1YFNA 1LTTD 4CGYB 4JI7Q 4QQDA 4E7JA 2XN9C 1IBLL 2QASA 1FJGQ 1H92A 2DAQA 1QQJA 1K8AR 3PMIA 5GAOm 4X9DA 1YN8A 3EGDA 5D6YA 3OYFA 1JWUD 1F2MA 4N0AA 4XTWA 3BZKA 1OI1A 3RZOB 2R93H 2F52A 5CV8A 1YI2T 4Y7NB 1PH2A 4DR2Q 4F16A 1WI5A 1IRXA 1TWBA 2FYKA 4DR3Q 3HRTA 1JB0E 4LK1C 1H9KA 1VQPA 1B44D 5M3MG 1F2ZA 5LL6X 5JJLA 2WKDA 5KE2A 3SK8A 2RI3A 4V2SA 3OPOA 3SEBA 5JEAG 7AT1B 4JI3Q 2BA1A 3UT1A 3P75A 2SEBD 4FXKC 3W2DA 2NUTB 1Q1EA 3E0EA 5D3IB 5JVH3 2X4YA 5FLXL 3HFZB 3C12A 5C0MA 2E2JH 5HCKA 5KYLA 3URGA 1R4QB 1G2SA 1PTOB 2MYSA 1RAAB 3I2ZA 3H94A 1B34B 2F2XA 4BY6C 3CEYA 4M7DE 2WAQG 1J5EQ 2P4TA 4CDCC 1LTSD 4YCUA 3A7LA 5LJ5d 3FDRA 1SYDA 3OYMA 1QJOA 3MAQA 4O1NA 1YJNQ 2VWFA 4P73A 4IFDI 4QT7A 4LFCL 3CCUA 1XQHA 4BY6B 2XGTA 2QEJC 4HXJA 1AZQA 2NYSA 1UTIA 3J7ZC 2RM4A 2Q8RE 4R56A 1M8AA 2KVQG 1RHPA 3MP1A 2ZXRA 2Q8TA 1HZCA 1QCOA 3KBXA 4FYDA 3X28B 2JTMA 2VNUD 3QHSA 4DR6Q 1SF9A 3S3NA 2WAQB 2V8JA 3D0FA 3S6WA 1S72T 5IY0A 3HOYH 4JG2A 4PMCA 4BDYA 4N4HA 3DXJC 5KYWA 2F0QA 4V0BA 5GAMh 4BE2A 1I4XA 5COYA 4DKAC 2QEXQ 3M0QA 3CMAA 2EE1A 3K7AB 2CT4A 2HSPA 3A54A 5E1FA 1WJRA 1GCQC 4AT1B 3WOEA 5D7UA 2K7AA 2EYJA 4CKBA 3TEHB 3H3VI 3HOZG 4BY7G 4FYYB 2GGRA 1CHQD 2O31A 4PFOA 1YVCA 3I9QA 1LNXA 2X6GA 1UJYA 3VYUA 1LO5D 1XMOL 2JMAA 1BI1A 4M78A 2F0DA 4UPAA 4A3IB 2E2IH 2K3YA 1TWHH 2EYMA 2DO3A 2CW0C 4HVUA 2CP0A 3FDTA 1VQBA 1N33Q 4P5NA 5KYWB 1Q82U 1VQHA 1VYVA 2H1EA 3EFOA 4GKKL 1M2VB 1MHNA 2EDGA 4PJNA 1VQ4T 1ASZA 2WINB 4J1MA 3HOWH 1X3QA 4Y52H 1Y7XA 2X6LA 2HBWA 5BN3A 3OWEB 1PHJA 2B2WC 2EKHA 4C8QF 3F70A 3DB3A 3KLWA 3RZDB 1KXLA 4J7FA 2RF4A 4A3IG 3F2UA 4HR7B 2R57A 2WP8J 2K50A 1LTBD 1EZZB 1VQ5A 3G4SA 1OPKA 3MCAB 4C92F 3OYBA 1VQ9Q 4PQXA 4LFAQ 1AWWA 3M57A 4P72A 4J6WA 4M7AG 3PO3G 3VU3C 2X3XD 2F2WA 4M75E 2RO0A 3OA6A 2A73B 3QJYA 5CKEA 1NE3A 2PTKA 5HGTA 1N8RR 4NDXA 2IVWA 2X9HA 2GNCA 3I55A 2OJ2A 4JDSA 1WDXA 2COZA 4A53A 2DJQA 1KNEA 2QQSA 1VQNA 3S2DH 4QVDA 5LJ3g 4IUTA 2DJFC 1Z7TA 3NK9A 1EFWA 9ATCB 1PSEA 3FJ5A 2K5DA 5AFWA 2R58A 4LF4Q 1M30A 4R4TA 4DUZL 1NG2A 1XYIA 1HUNA 4K5VA 1I4HA 2F0FA 3V96A 1PH3A 2KCMA 1I0CA 4IOAA 4LFAL 1FR3A 2OQKA 4Q5WA 1WCMH 4IFDH 1B3AA 3JCMf 3P1HA 4DV4L 4DR4L 1R0BG 2MNAA 4A3CH 1EY6A 2JK8A 2E6ZA 2HD3A 4M7AC 4E47A 2B63H 2ZTDA 3VS7A 2OEOA 3OBWA 1SJHD 3I7FA 4DBFA 2BDOA 2JA5H 3VDYA 5K36H 4HJ5A 3EH1A 4JS5A 4YWKA 1IGUA 4A3JH 5G3LD 2A19A 2HT1A 1NLOC 1PYWD 2MCNA 1DOMA 1O9SA 3ZJYC 4EDUA 2NUPA 4LF7Q 4HCCA 3M4YA 2KR3A 5CKFA 2UXBL 2EAYA 2CZ0B 5E4XA 4M7AE 4FF3A 2LTOA 4LF4L 1F2YA 3I72A 1II3A 4FW2A 2PU9B 1SE3A 1Z47A 3TVTA 1S1NA 3E2UA 5AYFA 1VQKA 3FLGA 4RTTA 3CC4A 1R77A 3A55A 2L89A 2CDTA 2DRKA 2WSEE 4N8X1 3F2CA 3BY7A 5IXFA 1I5OB 5IHNA 1YIJQ 1SYFA 2ZT9C 1CT1D 5IGEA 3PIP3 2DD4A 3A8MB 3D8GA 1WTHA 4C3HB 3JB9F 1YBYA 4M77D 5I6WA 4FU6A 2ZPFB 1T5XD 1YZ6A 2LX9A 5AT1B 2K5LA 4IUNA 4L5TA 1X55A 4RG2A 4HVWA 2CUDA 5LJ5j 1I4QA 4OEMB 4E7SA 4HJ7A 1MHWC 2R5AA 4OWWB 2NWGA 3GTOB 1D0ZA 1Y07A 1B7TA 2EJFC 4OGEA 2RCNA 3KF6A 4O2DA 3K0XA 3VRZA 2DL7A 4IUVA 1HCZA 2E3IA 3OS5A 1WI7A 3ER0A 3O8VA 2L11A 1HQMC 3VYHB 4NXML 2K5IA 3M4QA 3K81C 4DV2L 4GZYC 4DOVA 2P0QA 2XKOC 5L23A 2YUNA 4DF7A 5C4XH 5J22A 2ED0A 3NPFA 2CVRA 4PJOE 1AP0A 1HQRD 4ZTJA 2EXDA 4DGZA 1M9SA 1I3QB 5ELCA 1NNXA 1PYSB 3PF5A 1PMRA 2DETA 1GUSA 1LCKA 4RCCA 2DMOA 1TS5A 4IZ8A 4L8JA 4A4IA 3S2HH 2C0OA 3K5OA 3REBB 4C8QG 3MXNB 4KI0A 2HDLA 1TWAB 1RAFB 3TSSA 4PNOA 1U4MA 2P84A 2Z4IA 2IWHA 2E6NA 4IIOA 1CKBA 1BIAA 3SFMA 2JA9A 3NHNA 5IYCG 3M3YH 3OYNA 1HPCA 4J8QA 4NXNQ 5FWBA 4TVRA 5GQOA 1VQ6T 3PUXA 2LY7A 4OONA 1MSHA 1PH1A 1KAWA 1ZUUA 1QUQB 2DTIA 1SHFA 4ZKCB 1WTOA 4FXGC 1RCVD 2RDGA 5CV9A 3GTJH 2J7IA 2VV5A 3A5ZB 3L1AA 2N8NA 3IL8A 1BVSA 1F77A 2EIFA 2EJ9A 2W0ZA 2BE7D 2B63G 1EOTA 4DAYA 4XQ3A 1NPRA 4QUCA 1V43A 2QAZA 3OWFA 4IFDJ 2A69D 1BCMA 5ELNA 4BA1I 1PRTB 2CW0D 2EWNA 4X34A 1LLRD 2D2CC 2MOXA 1CA6A 2UUBQ 3B6YA 2UXBQ 3PTAA 3E3XA 1L1OA 3DKMA 2LS01 1Q7YC 4YIJA 3S1RH 1RLPC 4KH1B 1QKXA 4VUBA 3R3OA 5I4DA 2L3PA 3CBMA 5GAN7 1UDLA 4C92A 2DEUA 3QOJA 4WJ3M 2MJ8A 3TS2A 1XTDA 4BY7B 2QQBA 3I55Q 1N8RU 3CU7A 4R8IA 1HNZL 4A93G 4ELZC 2YRVA 1W2BS 2F4IA 3TP6A 1JU5C 4FYWB 5C4JH 1SRMA 5AJ3L 2JQOA 4R8NA 2AWNA 1TWGH 1WA7A 5GAOq 4M75C 2CWPA 1PH5A 1VUBA 2DBKA 5GAGC 1D3BB 4HEDA 4OX9L 1D3BA 1K8MA 1QCBD 1CZGA 1SYBA 3ZBDA 2F1MA 3NQTA 4NMZA 4UP7A 3UE1A 1VQ8T 1HFNA 2K3XA 4FL6A 4RMOA 1QNUA 1S5CD 4XYOA 3M4OH 2DIGA 2BTTA 4M77B 1E7ZA 4DK3C 2K5FA 5DY9A 3QSUA 1N33L 2UUBL 1U06A 2A0FB 2J05A 5FKAC 1UEBA 4YWMA 1JXMA 1VDZA 3SGIA 3CCMA 1WTRA 3SR1A 2IX3A 4AFUC 1V29B 4XTYA 2OTJA 5IP7G 1PV4A 1JOOA 3Q22A 4PFZA 3L42A 4APVA 3HEJA 1V76A 2O01E 1E6GA 1WHJA 3BVMA 1YCSB 4LE9A 1Y96B 4OMLA 1BBXC 1M5Q1 1I6VC 2KBNA 2M0YA 3OYYA 4CDDC 1LT5D 4TSSA 4ATOA
chains in the Genus database with same CATH topology
1IW7C 4NS5A 4II1A 1VQPT 4J5YA 2FVUA 4K8IA 3K0YA 1ENCA 3NBIA 1YJNA 2LFNA 4GY5A 3VKIA 1JOKA 4KY6A 3GP7A 2JSOA 2IW3A 1WGSA 2ZPIB 1K9MC 1ESFA 5KCOA 3GQBA 2B2TC 4D6WA 5M3FB 2V8KA 4CJ0B 3CMAT 1LTRD 3OHXC 3BYTB 4IKFA 1WJQA 2KAFA 2OTLA 1WCMB 4PKCC 3LW5E 2JA6B 4A3MB 2ZPHB 1ENFA 1EIGA 4H13C 4XQQA 1KG1A 1YI2A 4HAEA 3TEEA 2HNIA 3SE0A 3EJIA 1SXTA 1BF4A 4NP5A 2K01A 3JCMb 1R8OB 3RKXA 3KXTA 4M78G 1K8AC 4FIBA 4F7UE 1TWHB 3G7ZA 4QF4A 5GAN6 1ZYRD 4E7LA 4ME5A 2JXMB 5IOCA 4X3TA 3CCVA 2RA2A 2Y4YA 2YYZA 1HA5A 1W6JA 1Q81C 1YNJC 2PW7A 3H91A 3V05A 4A4HA 4EMHA 1T5EA 1KD1C 3OYGA 2L3RA 1A2UA 1EEID 4K6LA 4UAIA 5L8RE 1PTOC 2KHSA 3W3AA 1NAPA 4MZMA 1OXXK 5IT9E 1TT2A 1F2LA 3I91A 4IALA 4M78C 4HCBA 4IN3A 1RJTA 4EMKC 4KHVA 1N27A 3X3MA 5I9PA 1QNKA 3Q1JA 4XQJA 3HGBA 5KEEA 3KF8A 2K32A 2M9VA 5C0XH 3S2DB 4QUFA 4B9WA 2LKVA 1GUTA 4BDZA 1K73C 4MHEA 5ELBA 5I2MA 4H7BA 5LJ5h 3SK4A 1QVPA 4QQGA 3MTSA 4RCOA 3A56A 1STGA 3S16B 2DXBA 4DU9A 4ID6A 3A8HB 4LJZC 1EZ8A 1VQKT 2E2JB 4M7DG 1SYEA 2RHYA 3HKZB 3LLRA 5FU6B 2EVBA 3TP5A 2O4XB 1NJIC 2A6ED 1Q82C 2RSOA 3G6JB 3L2ZA 4XYQA 3CCRT 4KUDK 5BN4A 2EZVA 1JR0D 5GAOn 5LJ3h 2RHIA 1ILQA 2XU8A 4EGVA 2K04A 1KQSA 1NR4A 1UGPB 4CKEA 3MA2B 3CBOA 3PIO3 5C4ZA 3GNFB 1JCKB 2MF2A 2SNSA 4KBMB 5CV4A 5EPJA 2O4XA 2NVTB 5I2XA 4M7DC 1RODA 4BS9A 3HRUA 2VC8A 3ASKA 2EQUA 3M9QA 3M58A 4OB1B 1QVFA 1YHQT 3U9OA 2B2TA 2IX1A 1Y71A 1SEBD 3NXWA 2KCNA 5FU7C 4IUUA 4BBRB 2MI6A 2JUFA 4OO1I 2E75C 5DM63 1PTOD 3C2PA 3OIPA 4R9WA 5CBEE 5M3MB 4HSVA 2PZWA 2EY6A 3CCMT 5HKCA 1G3YA 3EA6A 4LMQD 4K8JA 3QYGB 4OMFB 1SE4A 3PUWA 4OO1G 2NUCA 1YNJD 4DK1A 5JEAH 2XI9A 5EBDA 1JICA 1YJWT 3M4OB 5G3LF 4MMLA 1GUWA 3LWIA 4QB4A 3D4DA 2E76C 1U4LA 5GMKm 4M7DD 1A3TA 4MIUA 1B2TA 3A8JE 3I56T 3X24B 1IKMA 2RI2A 1M1FA 1AEXA 3E9FA 5GANd 3EFXD 3VUBA 4KN7C 2RHXA 5D3DA 5C0XG 4XU1A 1BR9A 1HXDA 3C95A 4ZGJB 2KCCA 2H3JA 1I8FA 4L63B 4A4KA 3P7JA 3HFNA 4OGQC 3T51B 2RJDA 4LDUA 2PVOB 2NN6I 2F0WA 3SWNA 1SFOB 1I4K1 1ML0D 2K03A 2RJCA 1ET9A 1EU3A 2KY9A 1JC7A 4C92E 3CCJT 5D14A 1JWMD 1GHKA 1KABA 3A8LB 2M1HA 4A3KB 3JB9I 3GTJB 2PUOB 3NSWA 2YHTA 2ZPBB 4RGOS 3LH0A 1WTQA 2K5WA 1EYAA 5EPKA 3CPFA 3HS0C 5DNFA 4TRDA 2B8GA 4OL7A 1EQTA 1W6KA 2R5MA 1WPYA 1AW7A 3T16A 3MEHA 5GAMd 3HG9A 1M4VA 1B4OA 3GD7A 5EGTA 4DA2A 1OXUA 2L5TA 3C46A 1EYDA 1KD1U 3S14B 3MO8A 1MD2D 1FX7A 2LMCB 4HCEA 2CGHA 1A15A 4S3SA 5C5LA 1HK9A 1BCPB 4PMWA 1JJ2A 4C8QD 1PFNA 3MFGA 4LAAA 3PNWC 2DNEA 1DCZA 4JK1C 4X3KA 2EY1A 3V8KA 3TREA 4E7HA 3OYAA 1U9RA 1KQSS 2NN6H 2NVYB 1C48A 2A68C 2EKOA 1D5MC 1O7ZA 3FMCA 2L5QA 3L9AX 4RA8A 1NJIU 4C3JB 1B50A 3QG1A 4EQNA 4K5WA 4CJ2C 4BBSB 4XK8E 2RVLA 5M9OA 2HAXA 2EQKA 3EROA 5I9OA 1VQ8A 4C1NK 1C8CA 5ELEA 2ENBA 3SXHA 4Y28E 5GANe 2A68D 1JORA 2FMCA 1F9QA 2F0KA 1ZHIA 5CQYA 2EPBA 2ZXPA 3IFTA 5FO9B 1HTPA 4XTCS 5F2DA 3ERQA 1NR2A 4PJOF 3GTKB 1K9MU 1RKNA 4LDXA 2DY8A 1IHZA 1BCPD 2G9HD 5JJZA 1FGBD 1MGSA 5J39A 2OAUA 2L1BA 3FJPA 4A54A 4J6XA 3NUCA 3K59A 5C5MA 5GAN5 3CCSA 5FO7B 2IPKD 3RKWA 3CHBD 1PRTD 1VQNT 4XU2A 2F0IA 2X35A 4M7AD 3FEWX 4HCSA 2YU9B 4QVCA 2E64A 4WFN3 3NWSA 1A3VA 3GF5A 3INZA 2M16A 3FEOA 3A8KE 3URYA 1SAPA 4HN7A 4M77E 1M1KC 1PSFA 3BVGA 2VB3X 1G291 3GTQB 1B34A 2RD1A 4KUIA 1EYCA 2PYKA 3MXNA 3NTIA 2NVXB 2K57A 3JRZA 1WD1A 1M1KU 1M90C 1X75C 1VIFA 2FINB 2LQKA 4PJOC 4XU0A 4C0ZA 5CR2A 1S5ED 4OIKA 4CKCA 5C4HA 3U9SA 3TN2A 2JP1A 4M77C 2VUBA 3Q0AA 2WSFE 3HSBA 1SNQA 5DM73 3AHUA 4ZGEB 4O6JA 1GUNA 2RSNA 2LT4A 4DXFA 1VF7A 1WTPA 2XK0A 1E0BA 4CI0C 2ICEC 4ZYSA 1ZXTA 4A93B 1TU2B 3RD4A 1Q3LA 3JCMJ 5D6XA 1YITT 3QIIA 3CRKC 1LTID 4G7OC 2DN8A 3EAEA 2KSSA 1K73U 5DLQE 2DTOA 5C0XI 4JRKA 2IL8A 3R93A 3MP8A 5A2QL 1Q86U 4BA2I 1U8RA 4M7AB 4M77G 3CC4T 3HPWA 3LYIA 3KUPA 4EMGA 4KJNA 4RHRA 2J7ZA 1NZ9A 1LJOA 3RMQA 2EYPA 1LT6D 3R2TA 5IGBA 1AHJB 1YCYA 5T1IA 5IODA 3QXEB 3OW7A 4F88A 1TS2A 2QA4T 3PGGA 4FT4A 1IL8A 1OXTA 1STYA 2VB2X 3M3YB 5I6YA 1D1IA 1LOJA 3FVQA 2QQAA 3E0JA 5IN1A 2KK4A 5CC4A 4M78F 1A6XA 1NCVA 1BUVT 5KGUA 2EYFA 1TY2A 4MZPA 1LT3D 2Y90A 4KULA 2XRSD 3OS0A 3VR3A 4C56C 1DZ1A 2QILA 3HOUB 2KECA 1PFBA 4WORA 3D31A 3FIFA 3MEVA 3OYCA 3R6OA 1UGQB 3PUYA 1I50B 2E65A 1GUGA 3CPWS 1YNNC 5LJ3j 2KQWA 3T13A 2QEXT 3M59A 4HMJA 1WTOA 4C5IA 5KCHA 1A3UA 1LTGD 5A2QE 1H9RA 1I6HB 1DOKA 5GAN3 3IFDA 2R3ZA 3PFSA 4JLGA 3CCST 2EJGA 3EVQA 2L9HA 2PW5A 5IGFA 3V7CA 4EPCA 2Y0SB 1STEA 1Y8PB 2LRQA 2GA4B 2PMZB 5D65A 5EJWA 5CMDA 1CTMA 1HHVA 3J81E 1UAPA 3HOXB 4RKBA 3C94A 5HK0A 4G57A 4PJOG 2IJ0A 5EKLA 1CM9A 3MXUA 3OYKA 2BE5C 4IUQA 2P0PA 2DD5A 2D9TA 1HTLD 3J7AF 4BY1B 1XNIA 2ZZDA 3L2QA 1ZQ1A 3M55A 5C3EB 3ZEHA 5K5PA 1NPPA 3JCMg 4K14A 4DN4M 3HHTB 3OQ5A 1Y1WB 2R6GA 1FNUA 2GFAA 4NL3A 1O80A 2KQ3A 1K8AU 3LX0A 3D4WA 4C92C 3PT9A 2BA0A 2JNGA 5EG2A 4RG8A 4XQNA 1U1SA 2NYZD 4IFDG 2DNCA 4X3SA 3LGLA 4ZTFA 4ZN3A 2PZTA 4F87A 3RUXA 5FU7B 4JLIA 3VYGA 3NTHA 1KNAA 1C4QA 3I4NB 4OHJA 5J26A 3MEWA 1MI2A 2DJZA 1PZJD 5C4XB 3K5LA 2B2YA 3QO3A 4A4EA 2XNAC 1ZEQX 1VQ7T 4M7DF 5D6WA 1D6EC 3PMTA 4PMBA 3HP9A 2X4WA 4R55A 4MZTA 1NE8A 2D9UA 3FRPB 4M7DB 4KY5A 4HT8A 5GMKi 3SVMA 1V8QA 3DLLA 2BKDN 2D6FA 1UUPA 3S15B 3CMET 2XSCA 1KTKA 2J0TD 3RUZA 2EXZA 3TDQA 3V8LA 2WIIB 3I4MB 1TY0A 4RHSA 2GF7A 3OMCA 2E2IB 4LD6A 2JA8B 2QF7A 4QMGA 3DWAA 4C3HG 1VQLA 3OYLA 3A7AB 1HUMA 5GANg 1Q7YU 3NWTA 3BDLA 1IW7D 4FF2A 5LJ3e 4XXEA 1SMYD 4JRPA 4M75A 3T56B 1B53A 1G5VA 4V190 1CZWA 4RCBA 4C8QA 4KV6A 5CKHA 1BI0A 1LT4D 4M75G 1AN8A 5CV5A 1F9RA 1PRTC 3VV0A 3DEOA 3RERA 1EEFD 3ME9A 3BFMA 3FPUB 5C0XJ 2QDYB 3QUIA 1O78A 4C8QB 2F0TA 2BE5D 4C8QE 3K5NA 4HKEA 2M00A 1HFGA 1BQQT 3S1MB 3I4LA 1KAAA 4M75D 2LCLA 1LABA 2D5DA 2B2WA 2B2UC 2MWOA 2JZ2A 3P8HA 4EQPA 3OY9A 1CQVA 3Q23A 4A4GA 4RCNA 2E2HB 1Y69U 2PUKB 2CQAA 1X01A 1EQVA 1QP2A 2E41A 3HRZC 1WQ7A 4O42A 1B9MA 4KKSA 1WTVA 3CCRA 4BE1A 1A2TA 2NBFA 4HSPA 3OB9A 2KUMA 3HOVB 4FVMA 1PTOF 3OYIA 1NSNS 3E5SA 2HQEA 5LJ3f 3GIBA 4CRIA 3Q6SA 1VMCA 4C5HA 4HA8A 1O7YA 1E2WA 5CORA 5CKBA 4IQZA 2F69A 4E7IA 3JCMX 1SNOA 2M9UA 5KNDA 1K83B 2XIDA 1BCPF 5CAIA 2FFKB 3JB9G 1EZ6A 4WRDA 2E74C 4NOYA 2VXWA 3BW1A 4BI8B 2I07B 2D0QB 5IAYA 2AUKA 2JTFA 2K33A 4DOWA 3QPHA 4BE0A 2F0PA 1MGQA 4M7AF 3UPUA 1PFMA 3ND8A 2PVGB 1Y8OB 2B39A 1RTOA 1GJXA 1RDPD 4M77A 3KBGA 1FWZA 3Q24A 1HA6A 1B1ZA 2RJEA 2E12A 2PQWA 2VGNA 2B2UA 4ZAIA 1YJ9T 1ET6A 3C3LA 1M1GA 3N52A 3VR6A 2BDNA 2G3RA 1U1TA 2PVDB 1Q8IA 2ZPGB 3OBYA 2DXTA 3I55T 3O13A 1V1PB 3S1QB 3NBHA 4WF2A 3M7NA 1WTXA 1QW1A 1VF5C 4PLLA 1STHA 3OYDA 4EQOA 1ENAA 3WOFA 4U68A 1ESRA 5EBCA 5E3FA 2DY7A 1BXTA 4J6YA 2F3WA 3WDNA 4DNRB 5FO8B 1RTNA 1G6ZA 2LQ8A 3JAME 1H9JA 1D5ZC 2V8IA 4J8OA 3PIOA 1BI2A 5EPLA 5FK9C 4FF1A 1EY7A 2NTTA 5I21A 3DUZA 3S9WA 1QG7A 3M85A 3A8OB 2EJMA 4A3EB 2HCCA 3H6ZA 1XOVA 3VUZA 3NHHA 4YTLA 3QIAA 1SE2A 2XIWA 1OXVA 2QQ9A 1RF2D 4J83A 4PJOD 1IKLA 4A3GB 1KDCA 3OYHA 1S72A 3PIPA 5ELDA 1Q86C 2EOTA 4I7ZC 2F5TX 1SMYC 5KRUA 1FD7D 4RGNA 1YJNT 2XRQD 3JAML 4L6V5 4M1UB 3KUFA 5KH6A 1EY9A 3HFOA 3OMGA 4XTXA 2B2VC 3MWYW 2D62A 3DM1A 4NL2A 1S5BD 5J3BA 4C8QC 1JRIA 3SWNC 2J4XA 5FOBB 2F0JA 2FB7A 3BZDB 4ZKBB 2EY2A 2RA4A 4HTHA 5CIUA 1BNZA 3META 3LX7A 1TVXA 4UDUC 3CCUT 1J8IA 1EY0A 4K5XA 1OZ3A 2EYHA 1IYUA 1J9OA 3CKIB 2DTHA 3QKJA 3CCVT 3H6MA 1TS3A 4C3IB 1PDQA 2QCPX 4C5EA 2B2YC 2GCXA 2QXFA 3X20B 3X3NA 4FXDA 1DXMA 1BYMA 4DAPA 4L6TB 2H4OA 2A6HD 3PV0A 5M5WB 2MWPA 2A69C 3QOLA 2XWJB 3VYTA 3C4SA 2X4JA 3CC7A 1DD2A 3L3OC 3JCMV 2N88A 2EYLA 2BUDA 2RI5A 2TMPA 5CV7A 3VYSA 2JE6I 4DXGA 4X9CA 4QQ6A 2BOSA 2OTLT 4ZUJA 4FNFA 5JAVA 1KHIA 3BS1A 3QO2A 3SDZA 3ONAB 4MN3A 1YNND 4HMIA 1X6OA 1WQWA 3ZFJA 3BVZA 1H9SA 3V2TA 2F0NA 3L7ZC 1EU4A 2K2VA 2F0GA 4H0LC 2CS7A 3P20A 1QVFS 4EVOA 3PMFA 1Q12A 1M4ZA 3JB9J 5C4JB 5M5YB 4BB7A 3N5BB 3TP7A 1CI3M 2QQRA 2A7YA 4LD9K 1PZKD 4M78D 1OZ2A 1YIJT 5DAUA 2E5QA 5CGKA 3KK7A 1VMPA 4BI3A 3N6RA 1KQ2A 5KYIA 3CC2A 2O5IC 2VGMA 1N6AA 1XXGA 3H8ZA 3GNGA 4OIJA 3CCLT 5E4WC 3WVDB 3TU4K 4XIGS 1DYQA 1M90U 3VA5A 3MFYA 2A74C 1DM0B 3S17B 3LGFA 3GTMB 1AFPA 2ZCFB 4K6DA 3JCMd 4PV1C 1KDAA 5JOBA 1QVGA 4KJOA 4QIWB 2FL7A 1KQ1A 5FRNA 2Z8LA 3GV3A 5C6AA 2N55A 4I65A 3JCMP 2XG8D 3VYRA 5IGCA 4C3JG 3VR4A 4E6IA 2HQXA 1PRTF 1YJWA 1TIID 2E1HA 3RKYA 3GLXA 1H9MA 2F3VA 5CCAA 4WJWA 3QDRB 1LV9A 2B2VA 2JN0A 2WV6D 5CYUA 4ZK9B 2XDPA 2LNVA 2OT2A 1RL2A 3CQZB 2MUYA 3PUVA 1G8ZD 3GTGB 2ZGWA 1D1KA 3FB9A 3GOXA 1TS4A 3QBYA 5GAN4 3VA7A 5HK3A 2MP1A 5GAOp 1F9PA 5C6SA 2JA7B 1W4SA 1D2BA 4ME7A 1SNMA 3L2RA 4M78B 1X3PA 4B9XA 1H641 2I2LA 1WTWA 1GXDC 5LHY1 3CCQA 2PQEA 3NPPA 4QCLA 4Q5VA 4KN4C 5EKIA 4DFAA 1CFMA 2NN6G 3CMEA 4ZN1A 2XDBA 4LDWA 3OSVA 3MHXA 1DOLA 5CK9A 1VQLT 5GANh 2RJFA 3I8ZA 2K6AA 5JPMC 2M2LA 1O7LA 1EL0A 3TP8A 4M75F 3M7GA 4NW2A 3OS1A 4XTZA 3QWNA 4ZQ3A 3T53B 2PPBC 4JJNK 3HKSA 4FO2A 2JOYA 2QEXA 1VQ5T 1BOSA 3ZYYX 5A0DA 4PNYA 2KEEA 2HD0A 1TKWB 3DMUA 5EQ0A 4XT3B 3DB4A 4RGMA 5ISRA 3MZ5A 3OYEA 1EIHA 2FHTA 2WACA 4OP0A 4XTVA 3LWHA 2E2DC 4RAUC 2MMPA 4C0FA 3SB2A 3PUZA 5GAN8 4P2CB 2OTJT 2PCFB 1BO0A 3LWUA 3TZDA 3NP8A 4A4FA 2R93B 2C9OA 3QYHB 2PNRC 4Q0FA 4LDYA 2B8FA 4F7UF 5LJ5f 1R4PB 2IT1A 3TBIB 2F0LA 4PLIA 1V1OA 5M5XB 3JCMe 3E19A 1LACA 1XWEA 3PO3B 2L55A 3CC2T 3DHQA 2AQ3B 4XU3A 4MDXA 1PZID 1XX8A 2KVMA 3H3VC 5CR3A 5JEAJ 2RDHA 5ELFA 1VCIA 1WJSA 3K58A 1CHPD 1Q90A 2DVEA 3H09A 1KC8C 1L0YB 3JB9H 5DLOA 3HOWB 1YITA 1JB3A 2K05A 3CRLC 4LDVA 1IZ6A 3WXMB 1F9SA 1OO9B 4GLKA 1DJ7B 3SWNB 3BG3A 2C5CA