4BA1I

Archaeal exosome (rrp4-rrp41(d182a)-rrp42) bound to inorganic phosphate
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
212
structure length
204
Chain Sequence
SQEIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGERRYLDVGDYVIARIENFDRSIDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGNKSMYETLTSKCSIFVANNGRIWASRFSEEILIEAIRKIENE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a 9-Subunit Archaeal Exosome in Pre-Catalytic States of the Phosphorolytic Reaction.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords PROBABLE EXOSOME COMPLEX EXONUCLEASE 2
total genus 41
structure length 204
sequence length 212
ec nomenclature
pdb deposition date 2012-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ba1I01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ba1I02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4ba1I03
1K83H 1FJGQ 1V1QA 1AH9A 4A3JH 3NE5B 3N6RA 1Y69U 2A6HD 2KCTA 4HIDA 4BA1I 2DGYA 3K7UC 2E5LL 1QJOA 3BDOA 3D31A 1KHIA 2K33A 3VR2A 4DUYQ 4KKSA 5J3BA 3HOWH 3I4MG 2OPUA 4A3IH 1KHMA 4OWWB 2A68C 4POGA 3HOUH 2AWNA 1VQPA 2OQKA 2ANRA 3KLWA 1DT4A 1U0LA 1Y8PB 1IL2A 4HR7B 1E2WA 2B29A 3FPPA 3PUVA 1S3OA 2WFWA 4GNXA 2K5HA 1IBKQ 4NB3A 3CW2C 4DV1L 3KYHC 1HCZA 2QA4A 2ZT9C 2IX0A 4AYBE 4LF6Q 2FMRA 3T51B 4KLKA 1E7ZA 1YVCA 2JEAI 2R7ZH 2VUMH 4IQZA 1QVCA 1WCMG 2CCZA 2GVAA 1P16A 1EC6A 1IW7C 2ALYB 4A3EG 3PUYA 2WAQE 4DNIA 5K36H 2F4VL 2FXQA 3PO2G 1DXMA 3H0GG 1DTJA 2K5VA 1E22A 1NMGA 3TS0A 4BBSG 2VW9A 3RN5A 3ULPA 3T1HL 1HR0L 2NVTH 1IZ6A 1HZAA 3NBHB 3WDNA 2Q2TA 1PH2A 3T53B 4A93G 4H02A 1K9MC 1Q12A 1TWHH 2QGQA 4YWKA 3BZCA 1OXUA 3DM3A 3PIOA 1YEZA 4HJ8A 1XPRA 4BY1H 4DV1Q 1UEBA 4LF6L 3RN2A 4JI4Q 1IBKL 1WOCA 3J81i 2OPVA 2EXDA 4A3CH 1H9JA 3VR4A 1VF5C 1H9SB 1TWCH 4JI2L 3M3YH 4A3KG 1WVNA 1CKOA 2RHQB 4GS3A 4BY7G 4OGQC 3STBD 4QY7A 3G4SA 4DR5L 4DR2Q 1VQ8A 3PF4A 4KKUA 3Q8DA 4IJHA 3FKIG 4A3GH 4DUYL 1PA6A 3M85A 1PYSB 5C3EH 3CMEA 1RL2A 1GM5A 1E2ZA 3FMCA 2E5LQ 4WJ3M 4Y52H 2ZTCA 1SMXA 1PH8A 3CMAA 1L1OA 4LUOA 4DV0Q 3PIPA 2UXBQ 3OOCA 2AKWB 2IX1A 1EQQA 1ZZIA 1YITA 1YHQA 1VQKA 1E3PA 1X65A 3ER0A 1EWIA 1XPUA 1YNXA 4A3KH 1KRTA 3W1BA 1CKMA 1FYCA 3SGIA 2IHFA 3H94A 1HR0Q 2OTLA 3T1HQ 4A3BG 4GOPB 1IYUA 4KHPL 4RG1A 4QL5A 2CTLA 2QF7A 3CCUA 1CKNB 1ZKOA 1TWAH 2PQAB 3QG1A 1GUOA 1SLJA 2L15A 2K32A 2UUCQ 3A7LA 2PPBC 3VR3A 1A62A 2EIFA 4LF7L 4NXNQ 1CUKA 5JEAG 4GNXC 4KN4C 3IRBA 2EQSA 4AH6A 4JYAL 1MIUA 3ICEA 1VQDA 4JV5L 3H0GH 3VA7A 2Y0SG 2KHJA 1C0AA 2PI2A 3AYHB 1V8QA 4TKOB 5IP9G 1GUGA 4OX9Q 5H1SE 1YHAA 4GLXA 2R6GA 1RIPA 4A3JG 2BA1A 3HOVH 1GJXA 2HIVA 2D5DA 2KCMA 2PQUA 4YCWA 1QVFA 1K8OA 4JI5Q 3U58A 3PUZA 1Q8KA 3B6YA 4UY8C 3M4PA 5KNDA 1PYBA 1Q1BA 5GAEC 1I3QH 1XPOA 2C35B 3CXCA 4DR5Q 3GTMH 4WJ4A 4A3FH 3OYYA 1SMYC 4IOCA 5M5WH 1FJGL 4HJ5A 5IYBG 3UDGA 1K73C 4LF4Q 1XNQQ 1H9KA 4HJ7A 5JJIA 3BG3A 2HQLA 4GZYC 4JI4L 4X64Q 1DCZA 5C3EG 1KL9A 2MNAA 2RF4A 2MO1A 3I2ZA 1A8VA 1VQJA 3PSIA 4A3MH 2UU9L 1B8AA 1JJGA 4K0KL 1HNXL 4KMUC 3J81c 2JXMB 1VDZA 2CTMA 1ZYRC 4GN4B 4C3IH 5IWAL 1GO3E 4C2MH 3ZJYC 1XMQL 1ZZKA 1VS0A 3EBEA 3I56A 2NVXH 1VQIA 2MO0A 3CCEA 1OTCA 4L8JA 2N3SA 1HR0W 2ZJQA 4LF5L 4IPCA 1X4MA 5LMNW 1HNWQ 1IYJB 4X6AH 1CSQA 3J7A5 1K1GA 1KQSA 4B3MQ 3S17H 5FLXc 2CWAA 3KDFB 1EYGA 3H15A 4L5RC 1N32Q 3PO3G 5GAGC 3UDXA 2A19A 3BZKA 3LWUA 4LJZC 1PH7A 1NJIC 2IHEA 4P73A 2K5NA 2E8GA 4JBWA 2NZHA 3KF6B 2V1CC 4DK3C 2D0OA 3CCLA 4B3SL 4IFDI 1ZTGA 4P75A 1VQEA 4JI6L 3CPWA 4DR7L 4RCNA 2I0QA 4QQBX 2R93G 4A3LH 3HKZE 3AFPA 4DR3L 1K8MA 2DUDA 3U4VA 3OTOQ 1OXTA 4HJ9A 1EUJA 3G48A 2CTFA 1ZZJA 2D0PA 3I55A 2B8GA 3AB9A 5IYCH 1JJ2A 1BDOA 2IY5B 4DV5L 1M90C 2D62A 3KF6A 4DV3Q 4KN7C 3TREA 1TUAA 4A3FG 4LF9L 1YZ6A 4A76A 1J4WA 1Z47A 4JI3L 3FHWA 3J7ZC 2LXJA 5FLMG 4POFA 3CC7A 4WALA 2EVBA 1VQ5A 2R93H 2ZTDA 1G6PA 4DV7Q 1PH5A 3CCRA 1YJ9A 1N36Q 3MFYA 1YNJC 2KCCA 1D8LA 2ZTEA 3RR5A 1FL0A 3CP0A 4AYBG 5AJ3L 2VNUD 1LABA 1PHJA 2R92H 1A63A 5A35A 1HQMC 2R7DA 3AQQA 1IBML 4LF8L 3U4ZA 1DD2A 4HIKA 5IY0A 2UXBL 2GVBA 3D4RA 2EJFC 3S15H 4YHHQ 2O5JC 4GOPA 1E1OA 4GLAC 1Q1EA 4LUZA 1Y1WG 1UWVA 2A69D 3HKZG 2JA8G 4R4OA 1TU2B 3I72A 1L2FA 1XMOQ 1Q82C 2EJGC 3RLOA 2JA8H 1PH9A 1UE7A 1NY4A 4JI0L 2YV5A 1PH3A 3S24A 4LK1C 3GTQH 4G7ZC 2Q2IA 2R7FA 1BKBA 1VQOA 2BH2A 1LM0A 4A75A 4IFDG 1VIHA 1SRUA 1VQNA 1X56A 2E74C 3CD6A 2CTEA 1E1TA 2KENA 2PMZE 3UE0A 2JA7H 2MFIA 4A3DG 5E7NA 5IYBH 4DR1Q 1I94Q 5DLQE 4GN3B 1NMFA 4XTCS 1E2VA 4KKTA 1VQAA 4LFCQ 3OW7A 4A3LG 2HH2A 2UXDQ 3L7ZC 2I5MX 5GROA 1YNNC 3M9BA 1PH1A 4BY1G 3EQLC 1J5EL 3WWVA 4LFAL 1V9PA 2VQEL 5IYDG 1X9NA 3T56B 1QZHA 3HOWG 5KNBA 5IYCG 4DV4Q 4JI8L 4JI7Q 4DR6L 4A3CG 2YYZA 1VQBA 1N9WA 2ATWA 4R4CA 2B8FA 2ZM6L 1VQ9A 1VQGA 1I6HH 2E3UA 1Z7TA 1HNZL 3A5UA 1H9MA 5LMNL 4DV6Q 1CKNA 1ASZA 1CSPA 3UDIA 2QEXA 4X65L 2JA5G 1GUNA 1GD7A 2HHHQ 2HT1A 1PMRA 4FDBA 5C4XG 5EAYA 3S2HH 5IE8A 3U1KA 3MEFA 3S2DH 1YJWA 4IPGA 2VUMG 1QUQB 2K14A 1K0RA 4DK1A 2R7ZG 4LIJA 4R1JA 2B3GA 4BBRH 3L2PA 2VQFQ 1O7IA 4IO9A 1K8GA 2R92G 2UXCQ 4DV2L 4PZ7A 3E9IA 4YY3L 1FGUA 1B70B 2BDOA 1L1OB 1VQFA 4R4QA 2NN6I 4LWCA 4AQYL 1EFWA 4P72A 3GTPH 1X4NA 1Y8NB 4H13C 1H9RA 5C0XG 1YHBA 1B9NA 3F2BA 3UDFA 4RMFA 4BXXH 1IW7D 1SR3A 1OXVA 1N33L 1AE2A 4L5SA 1HTPA 1KAWA 3CCMA 2JZXA 4PZ8A 5FJ8H 1XNRQ 2YQRA 1BBWA 2A69C 2XTIA 3K80C 3J80i 3G71A 4DUZL 3HOXH 1QVGA 1N34L 5M5YH 3V69A 4OWTB 1NE3A 4JVYA 4OXPA 4JI1L 5BR8Q 2EDGA 4QIWE 1IBLL 4C3JH 2JA7G 3CPFA 1L1OC 2I5HA 3GQBA 3FKIH 3JC66 2VY3A 3ULLA 4GKKQ 4PG3A 2JEBI 2CTJA 2DGRA 5LMUQ 2KBNA 3SDZA 2WB1G 3HOVG 2OWOA 1T5EA 4BXXG 2P2RA 4JVHA 2NN6H 1XNRL 1G291 2HIXA 5M3FH 3STBC 2YTYA 5FJ8G 2UUAL 4ALPA 3TQYA 1TWFH 1N33Q 1X54A 4A3GG 4B8TA 4YWMA 4QMFB 3AEVA 4DK0A 2Z6KC 1Y1WH 3H3VI 2B63G 5GADC 4NXMQ 1VQLA 2ASBA 2CTKA 1X55A 3A0JA 4ME3A 3KJPA 4GNXB 4YY3Q 4DV2Q 2K7VA 2CKZB 3FP9A 2A8VA 3K8AA 1YBYA 2AHOB 4YCVA 3PGZA 4GKJL 2OCEA 5KNCA 2ID0A 4OWXB 3M4OH 3IFTA 4UP9A 4H0LC 3RLFA 1H95A 4GN5A 4JOIA 4DK6C 5LMNQ 4DV6L 4GOPC 4A3MG 2UUBL 3CC2A 4LFBL 1VIGA 2Z6KA 4DR4Q 3KF8B 3KOJA 1MKHA 5M5XH 2NVQH 1CI3M 1NTGA 5C0XI 4QJFA 3ND8A 2JA9A 1VQ6A 4TQUS 4JC0A 3S1RH 1J6QA 4GKKL 4TVAB 4X66L 2QNDA 2VQEQ 4A3IG 4A3DH 1J5EQ 2F3IA 1JT8A 3J81j 4X66Q 3A8IE 2V4DA 4OO1G 1ASYA 3LGJA 4APVA 2E2JH 2UXDL 3W3AA 2AMCB 3NELA 4X62L 1Y1VG 5BN3A 4LW1A 1Q7YC 1N34Q 3E0EA 4JBMA 4DR4L 1UE5A 3T1YQ 2AXYA 2JK8A 3A8JE 3F1ZA 4B3TQ 4DPGA 3PO3H 2Y0SE 4UP8A 3G6EA 1R9TH 2A6HC 4BA2I 1HZBA 1N32L 2AWOA 2MQHA 3JAMc 1QZGA 2Q8IB 3AEVB 1PH6A 1E24A 2JA6G 1WJJA 2MJHA 1NBWA 1L0WA 3GTGH 1O7LA 2YTXA 2KHIA 1DGSA 3CAMA 2VL6A 1XMOL 2H5XA 5BN4A 3KFUA 1G51A 1MJEA 3RLNA 3RZOH 3KJOA 4NXML 2E2HH 1WI5A 1TXYA 2JE6I 1HZCA 4EX5A 1Y8OB 3TZUA 1HPCA 1TWGH 1W3SA 3J80c 1M1KC 2IT1A 3TS2A 2GN5A 4X65Q 4JBJA 5ELOA 1CTMA 3P20A 4B3TL 3M4QA 1HNZQ 1J5KA 2BA0A 3L0OA 4MZ9A 3T1YL 2F1MA 1BVSA 1U5KA 1WCMH 1X3FA 3GDEA 4HIMA 4X62Q 1Q90A 2JA6H 3A8KE 5LMUL 4DR6Q 1WE8A 5FLMH 3TEHB 5C44H 2K52A 3I4NG 1A6XA 1WFQA 4O2DA 1B9MA 4IJLA 1GUSA 1KIXA 1Q46A 1KXLA 1SE8A 1IBLQ 3PUXA 4YCUA 3K0XA 4JI1Q 3W5OA 5BR8L 3CCJA 4LF9Q 3GTKH 2HH3A 2O5IC 4GLVB 4DV5Q 5HGQA 1OXSC 4A4IA 3ULJA 1X3GA 2Z0SA 4LFBQ 1JJCB 2UUBQ 1GKHA 2LSSA 4IFDJ 3HKSA 1FR3A 1VQ4A 5ELNA 2ZJRA 1KC8C 2YU9H 2AUKA 5BN5A 4JCVE 4JG2A 4JK1C 4DR7Q 2B63H 5C44G 3I4NH 4BY7H 1IYVA 3QJYA 1JE5A 4AQYQ 1EIYB 4UP7A 3CC4A 3GTLH 4GKJQ 4KHZA 1ONLA 5IP7G 1GVPA 1WYDA 5IT9c 1PVOA 1QUQA 4G7OC 3K7AH 3W1GA 3RNUA 4B3SQ 3M4YA 2DNEA 2NZOA 1C9OA 1X6OA 1C7YA 1EIFA 5M3MG 1GUTA 2JJQA 2ES2A 4WANA 2LXKA 3NENA 4XIGS 2JQOA 2CW0C 2CPQA 1S40A 5C4JH 2UUAQ 3E9HA 1HNWL 3OW2A 3LNNA 1S72A 1K8AC 3JAMi 2JVZA 2AUJD 1VCIA 2DN8A 1N36L 2JA5H 3KLRA 3MXNB 4H44C 2K75A 1LYLA 4JI8Q 2BH8A 3CCVA 4JI7L 4A3BH 1V43A 3KDFA 5IYDH 2LMCB 2A1AA 4DV4L 3HOZH 3I73A 2XGTA 1CFMA 3QIAA 3UE1A 1SFOH 1HNXQ 1KD1C 4OO1H 3OPOA 1B7YB 1PFSA 4R4IA 4IFDH 1X3EA 2UU9Q 3I4MH 2EJMA 1Y1VH 4R4TA 2BE5C 2E2IH 2NVYH 4MTNA 1VQMA 2DNCA 3I4OA 4DUZQ 4LF4L 3HOUG 3S1MH 2VZAA 4PMWA 4DR1L 1I94L 4NBQA 3OTOL 1T9HA 4JBKA 1JMCA 2N8NA 1Y14B 2PQAA 1SROA 4B3RL 2L5TA 2PY9A 2BL5A 4BBRG 5HY6A 2Q2UA 3GD7A 1LUZA 2WB1E 4JI5L 4JI6Q 2RHSB 3PV0A 4JI0Q 4DKAC 3GTJH 3F2DA 3HOYG 1D7QA 2N49A 2E75C 5IP9H 2UXCL 4O0AA 1N8RC 3H3VH 3S14H 5C0XH 2VQFL 3A74A 2ANNA 1Z9FA 1K3RA 1VQCA 2F52A 4C3HH 1VQ7A 1VQHA 3VR6A 1UE6A 4AIMA 4YHHL 5IP7H 4JV5Q 5GQOA 4BBSH 2K50A 4G7HC 2HHHL 4JOIC 5C4XH 1IBMQ 4B3ML 4LF7Q 3HGBA 1P8LA 3EIVA 3U50C 4I7ZC 1YIJA 4A93H 4LNQA 4PV1C 3ERSX 3U9SA 2D2CC 3GO5A 2ZM6Q 1XJVA 2KA7A 2A6EC 3D0FA 5GAHC 5K36G 3CCSA 4DV7L 3PF5A 5IWAQ 1XMQQ 3PO2H 4KHPQ 1IXRA 4OO1I 4OONA 3CQZH 1H9SA 2YTVA 4Y7NH 1AE3A 1XTDA 4J15A 3S1QH 3I4LA 4DAYB 4JI3Q 4L5TA 1I5FA 4LFAQ 4IOAA 4K0KQ 3S1NH 1W2BA 4IPHA 2NN6G 3NEMA 3BU2A 3CRKC 1PH4A 1Z6HA 2A68D 3ND9A 4X64L 1GHJA 4LFCL 2N78A 3HOZG 4P74A 1YJNA 1MJCA 3VDYA 2PNRC 2PNHA 1HZ9A 1EWHA 4DR3Q 1JB7A 3VR5A 1O78A 2ZJPA 4UPAA 3EN2A 1TKWB 1VF7A 1A0IA 1BBUA 1I6VC 1KRSA 1HJPA 3AFQA 2OQ0A 2E76C 4P71A 5C0XJ 4DR2L 4JI2Q 2CFMA 3BJUA 2VS1A 3K81C 3HOXG 3A7AB 3A5ZB 1Q81C 4OX9L 3TRZA 4PZ6A 4MNOA 4KI0A 3DLLA 3DXJC 4QGUA 2PCFB 5JJLA 3F2CA 4A3EH 5JEAJ 3GTOH 3PUWA 1EOVA 4DNTB 2CWPA 2Q2HA 4LUVA 4DAMA 3RZDH 1YI2A 3HOYH 4JYAQ 1OXXK 2OTJA 1LACA 3CRLC 4AM3A 3IKJA 2CQOA 4NXNL 5JEAH 1UE1A 3SE0A 2UUCL 4HIOA 4LF8Q 1HH2P 1FVIA 1LTLA 5M3MH 3PCOB 1PV4A 5AJ3Q 4LF5Q 2F4VQ 4L5QA 4NPSA 1EQRA 1I50H 2PI2E 5M3FG 1Q86C 4EQ5A 3VKEA 3HFZB 4IPDA 2WAQG 3CCQA 2RCNA 4DNRB 4HJAA 3MXUA 2K4KA 3S16H 4B3RQ 2WP8J 3I7FA 3F8TA 3M7NA 2BE5D 1GHKA 1SN8A 2I5LX 4YWLA 3CF5A 4DV3L 1XNQL 2A6ED 4DV0L 5JJKA
chains in the Genus database with same CATH superfamily
1K83H 1FJGQ 3KF8A 3N6RA 3J7AF 3K7UC 4RFBA 5CV4A 2F3VA 3W2DA 3D31A 4DUYQ 2K33A 1BCPD 4A3IH 3NK9A 3HOUH 4DV0H 3T1YH 2EYPA 1U4RA 1E2WA 3PUVA 3PIP3 3CW2C 3KYHC 1HCZA 1HFGA 4HTHA 2QA4A 1LTAD 2Z9HA 2R7ZH 4IQZA 4FO2A 2CCZA 2NWGA 2QDBA 1P16A 3H6MA 3I8ZA 2ALYB 4MIUA 3PO2G 3H0GG 2K5VA 1NMGA 2LY7A 1WHRA 4XT3B 1SYFA 1HR0L 3K5NA 2Q2TA 1HQRD 3KBXA 1K9MC 1DT4A 2QGQA 3DM3A 4HJ8A 1HA5A 3RN2A 4JI4Q 4YY3H 1ET9A 3J81i 4DR2H 4CKEA 4JI2L 3M3YH 4A3KG 1FKAH 4OGQC 3E3XA 4KKUA 1TWFB 3FKIG 4DUYL 3GTQB 1PA6A 1PYSB 1GM5A 3HKZB 3FMCA 4DV0Q 2VB3X 5ELCA 4A3IB 2E2DC 3GV3A 4RGNA 1EQQA 1E3PA 3ER0A 1EWIA 1YNXA 4DAPA 3HRZC 4FXDA 5EPLA 3H94A 2M8WA 1F2LA 4A3BG 1B50A 4GOPB 1IYUA 3MA2B 4RG1A 4KHPL 1HFNA 2CTLA 1N33H 2QF7A 3CCUA 4DU9A 1TWAH 4HEDA 1W6KA 5CC4A 2K32A 1STYA 2EIFA 1QWYA 3VR3A 5IIFA 4NXNQ 5JEAG 3UOEA 3KLSX 3ICEA 1SXTA 4XYOA 1FGBD 1VQDA 1WTOA 4KTAA 2Z4HA 3AYHB 2CQAA 2F4IA 4S3SA 1STAA 2R6GA 3S2DB 2BA1A 5ISRA 3HOVH 2D5DA 4YCWA 1QVFA 3PUZA 4ZUJA 4HMJA 5GAEC 2WACA 2EYLA 3GKUA 3BYYB 1SMYC 5KEEA 4IOCA 1WD1A 1BQQT 1RDPD 5IYBG 5JJIA 4LF4Q 1H9KA 4JI4L 1WTWA 4GZYC 1DCZA 5C3EG 1CQVA 1A8VA 1VQJA 5L37A 1L0XB 5IWAL 1ILQA 4C2MH 5A2QL 4MTKA 1XMQL 3EBEA 4L8JA 1IYJB 3J7A5 4K0KH 4B3MQ 2F0PA 3KDFB 1AFPA 5GAGC 3UDXA 1AN7A 5C5LA 1SJHD 3KF6B 3CCLA 5JPMC 2B39A 1WTRA 4JI6L 1XYIA 4A3LH 2F0FA 4DR3L 1NXUA 1N36H 1OXTA 2D0PA 3E0JA 3AB9A 5IYCH 1WTJA 1M90C 1SYCA 2HDLA 4A3FG 4LF9L 1J4WA 4A76A 2AQ2B 1Z47A 3FEWX 4JI3L 3FHWA 2N88A 5ELEA 2X6LA 5FLMG 5EBDA 2OF1A 3CC7A 2R93H 1SEIA 4WALA 1BO0A 3CP0A 2DY8A 1A63A 2R7DA 3HOZB 3U4ZA 2XSCA 1PRTB 3NHHA 4KV6A 4GOPA 2O5JC 4LUZA 1Q1EA 4XQJA 2A69D 1PFBA 2JA8G 2P5ZX 5DAUA 2F0MA 3I72A 4OIJA 1XMOQ 1Q82C 1UE7A 4JI0L 2YV5A 2I07B 2EY6A 2H1EA 2NVYB 2BH2A 1VQOA 4K8JA 2E74C 3CD6A 2CTEA 4CJ0B 5IYBH 4DR1Q 4ZQ3A 4XTCS 2HH2A 1VQAA 3OW7A 2I5MX 3L7ZC 4DAYA 1NR4A 3WWVA 1V9PA 5A2QE 5IYDG 5DEHA 2VQEL 4X64H 4LFBH 5IYCG 1VQBA 4IALA 4JI1H 2KEEA 1HNZL 1ASZA 2X6GA 1CKNA 3UDIA 2QEXA 4J6HA 2HHHQ 5C4XG 5FO9B 2SNMA 3MEFA 4X62H 5G3LF 4CKBA 4DK1A 4R1JA 2B3GA 3V96A 4BBRH 3L2PA 1O7IA 2VQFQ 1X0AA 2KVMA 1WTQA 2BDOA 1X3PA 3I3CA 4MHEA 4LWCA 3GTPH 2CH4W 1IW7D 1SR3A 1OXVA 3NUCA 5J39A 4OCHA 3MTSA 5FJ8H 1XNRQ 3MXNA 1S20A 3G71A 1HR0H 3WOFA 2N55A 5FLXW 4DR6H 1FNVA 3I91A 5ELDA 1F77A 2VY3A 4H7BA 4GKKQ 5EJWA 2DGRA 4ZKCB 2WB1G 2P2RA 2NN6H 1G291 4J8QA 2YTYA 1J5EH 2ENBA 3TQYA 1X54A 4QMFB 3H3VI 1SNPA 2EYJA 2ASBA 3DEOA 5C3XA 3FP9A 4K5XA 3PO3B 2AHOB 1WTVA 3BDLA 1TS5A 2ICIA 3E6ZX 5KGUA 3NWTA 4JOIA 1XX8A 4RKLA 2HQEA 2UUBL 3OMGA 4LFBL 2Z6KA 4NXMH 3KOJA 2NTSA 1MKHA 1STBA 1K0SA 4QJFA 2JA9A 1JOKA 3S1RH 4X66L 1NCVA 3MEHA 1CQFA 2F3IA 3U9OA 5M3FB 1IBKH 5I6YA 4NKLA 3NELA 4X62L 1N34Q 4LW1A 2NVTB 2L11A 5LHY1 4B3TQ 2Y0SE 5JJZA 1HHVA 4A3JB 2A5HA 5D3IB 3JAMc 2RDHA 2Q8IB 3HOXB 3AEVB 1PH6A 1IL8A 1NBWA 3GTGH 2SNSA 2KHIA 1XMOL 2HDMA 1DZ1A 3NTHA 1Y8OB 5LL6S 3C1EA 3TS2A 2OXPA 2SDFA 1F9QA 5CV9A 1X3FA 1WE8A 1KNEA 4DR6Q 5K5PA 4JYAH 1LTGD 3I4NG 1A6XA 3D4DA 4IJLA 1KIXA 3PUXA 3W5OA 3K0XA 4QB4A 2HH3A 1EL0A 1SYBA 2KOLA 1OXSC 2HD3A 4FF4A 4K6DA 1A2TA 2B2WA 2LSSA 4IFDJ 2SEBD 1KC8C 2ZJRA 2AUKA 2QDLA 4DR7Q 5C44G 4LFCH 1JE5A 4GKJQ 1PVOA 4KHZA 5IP7G 1GVPA 2IX1A 2Z6BA 2DNEA 1X6OA 2TSSA 2LKVA 4JI3H 3S1QB 4WANA 3K6OA 4IUQA 1LT4D 1F2MA 5COYA 5C4JH 2WV6D 3OW2A 1S72A 1K8AC 3JAMi 2JVZA 2AUJD 4DR3H 2RSOA 1N36L 2JA5H 4LF7H 3CCVA 4A3BH 1LYLA 4JI8Q 2BH8A 2PYKA 2A1AA 4DV4L 4R8NA 3I73A 1KD1C 1X3EA 2UU9Q 3I4MH 2EJMA 4R4TA 1VQMA 4LF4L 1I94L 4NBQA 1T9HA 4JBKA 1XMOH 1F0XA 3OSOA 1R4QB 2PY9A 1DJRD 5ELBA 2WB1E 3PV0A 3GTJH 3MZ5A 1D7QA 4JV5H 3I4MB 1QB5D 2E75C 5CR3A 3K59A 1N8RC 3Q23A 3PMFA 1EQVA 4CBVA 1UE6A 2EE1A 4JV5Q 1RF2D 5IP7H 4JI0H 1P8LA 3DWAA 3HGBA 4I7ZC 4CDFC 2EZVA 2LS01 3GO5A 2ZM6Q 1XJVA 5GAHC 5K36G 1E0BA 4B08A 4KHPQ 1G2TA 2YTVA 4J15A 3S1QH 2E2IB 4DAYB 4IOAA 3S1NH 4BWGB 5E4XA 1W2BA 2R3ZA 2RCFA 4X64L 1SFOB 1FNWA 4LFCL 2N78A 2O4CA 2XIWA 1YJNA 2JA5B 5J1ZA 1HZ9A 1EWHA 4DR3Q 2C5CA 2BOSA 3VR5A 1PQXA 2CVRA 1JE4A 1F9SA 1TKWB 1XNQH 1KRSA 4DA2A 2ZXPA 5M5WB 4JI2Q 3HOXG 4DAVA 1SDFA 4QGUA 3F2CA 1N32L 4C2MB 1EOVA 3HOYH 1YI2A 4DAMA 4EGVA 4XXEA 4Q0FA 2CQOA 1WCMB 4DR7H 1UE1A 1LT6D 3TSSA 1DOLA 4L5QA 1EY7A 5C4HA 5M3FG 3SK4A 4HCEA 4QMGA 5CBEE 1G2SA 1UNSA 2WB1B 3RD4A 3EA6A 4HJAA 4PMBA 3VA5A 2X06A 2WP8J 5ELFA 3D3RA 3F8TA 3CF5A 1X3QA 2JN4A 5JOBA 2A6ED 1SNMA 1V1QA 2F0EA 2NUCA 4A3KB 3QO2A 2A6HD 2KCTA 4HIDA 2DGYA 4BA1I 3JAML 1QJOA 3I4MG 2FJ2A 4KKSA 5J3BA 5IGBA 4POGA 4OWWB 5FO7B 2AWNA 1TWGB 2OQKA 4RGOS 2ANRA 3KLWA 5EBCA 1U0LA 1IL2A 5I4DA 4HR7B 2WFWA 1S3OA 4X66H 3HG9A 4NB3A 4AYBE 2VKCA 1E7ZA 1YVCA 1J9OA 1QVCA 2CHBD 2GVAA 2F4VL 5K36H 3TS0A 3RN5A 2NVTH 3NBHB 4ZAIA 1D6EC 1JR0D 1RJTA 4H02A 5FLXE 4YWKA 1TWHH 4N9TA 3AMUA 1YEZA 2QEJC 1UEBA 2F0LA 1IBKL 1PTOD 2HUGA 3VR4A 1SAPA 1TWCB 2WINB 1WVNA 5M9OA 1CKOA 2RHQB 4DR2Q 4QY7A 4DR5L 3PF4A 3Q8DA 3M85A 3CMEA 4K2LA 4Y52H 2EOTA 1SMXA 1ESRA 3CMAA 1L1OA 2AKWB 1ZZIA 4PMCA 3SXHA 1XPUA 2ZXRA 4WJWA 1T5XD 3SGIA 2IHFA 2MUYA 1HR0Q 1BCPC 2PQEA 1JWMD 1QNKA 4QUCA 4FYDA 1JOQA 1CHPD 4QL5A 1ZKOA 2SOBA 2PQAB 1SLJA 1GUOA 2L15A 3EROA 4KN4C 4AH6A 1EEID 4JYAL 3HOUB 3OWEB 2KHJA 2Y0SB 2PI2A 2BDNA 3EVQA 5IP9G 2VQFH 1YHAA 4GLXA 1RIPA 2KCMA 4J1MA 1K8OA 4JI5Q 1Q8KA 3M4PA 1PYBA 5KNDA 3GTMH 5D65A 4DR5Q 1STHA 4C1NI 1PTOC 1ZXTA 5M5WH 1FJGL 1I6UA 4MN3A 3J7AV 3BG3A 2EYFA 4X64Q 4A3MH 3I2ZA 4OELB 2Y3MA 2L12A 2UXDH 2JXMB 1ZYRC 4C3IH 1GO3E 2JA7B 2NVXH 1VQIA 2ZJQA 1OTCA 2N3SA 4LF5L 4X6AH 1K1GA 2R61A 1KQSA 2Q8RE 2PW5A 5FLXc 1O80A 3H15A 3NQIA 4KHPH 1FD7D 3BZKA 4KK7A 3LWUA 4LJZC 1PH7A 3MXPA 1NJIC 1TVXA 4P73A 5D14A 4BS9A 2E8GA 1BCPB 3S9WA 2D0OA 1EYAA 5FK9C 4P75A 4C56C 2NTTA 2I0QA 3BYTB 3C1FA 3HKZE 1WTHA 3AFPA 4LFAH 4C3JG 2K1BA 3U4VA 4HJ9A 2B8GA 1JJ2A 5IWAH 1UAPA 3P1HA 4DV3Q 1EYDA 2LXJA 3N52A 2EVBA 1VQ5A 2ZTDA 4WRDA 3MFYA 4AYBG 5I6WA 5AJ3L 1FL0A 1TQOA 1PHJA 2R92H 1LO5D 4A3BB 1R4PB 4YHHQ 1Y1WG 1E1OA 4FXGC 4GLAC 1D5XC 1TU2B 4NZRM 5DNFA 3RLOA 3ERQA 1N32H 1NY4A 4EQOA 1BNZA 3QB3A 4E9JA 2D9UA 3S24A 4LK1C 2Q2IA 4B3MH 1BKBA 5DT9A 1CZGA 5D3DA 2NB0A 1VIHA 3DWPA 1HTLD 1X56A 3HP3A 2KENA 3UE0A 2RQXA 4A3DG 2MFIA 1ZTGA 3JAMW 4GN3B 1SE2A 1E2VA 4JVZA 4LFCQ 2PZWA 2GA4B 4ABNA 4KY7A 1YNNC 4BY1G 2UUAH 4G4KA 4CHTB 3DEPA 3HOWG 4FVMA 1U4PA 1RCVD 2B8FA 2F0OA 2ZM6L 1VQGA 1VQ9A 2E3UA 1Z7TA 1ICFB 3A5UA 5LMNL 5C6AA 3O13A 3L9AX 3I0PA 1GD7A 2F0WA 4L63B 2HT1A 1PMRA 4FDBA 5EAYA 3S2HH 1X32A 4HCSA 4EVOA 4IPGA 2R7ZG 4LIJA 1SBBB 2O2LD 3IFDA 4DV2L 4PZ7A 1S5DD 5TSSA 1QILA 4YY3L 1FGUA 1XTCD 1EFWA 1GOZA 1L1OB 2RDGA 1X4NA 4P72A 1Y8NB 5E3FA 5E1FA 4H13C 5KYIA 3F2BA 1TWAB 4B3RQ 1IBLH 1N33L 4L5SA 1KAWA 2YQRA 1PTOH 1BBWA 2XTIA 1CT1D 5I2XA 1UEAB 1SEBD 1N34L 3AU7A 4OWTB 1NE3A 4OXPA 4JI1L 5BR8Q 3H0GB 3FKIH 3GQBA 1NR2A 3HS0C 3MAQA 3A55A 5LMUQ 1FNUA 3HEJA 3HOVG 2OWOA 1T5EA 2HIXA 5M3FH 4ALPA 1N33Q 4B8TA 4DK0A 3D6CA 5GADC 1VQLA 4ME3A 1R9TB 4YY3Q 4JI4H 2CKZB 3K8AA 4YCVA 2F03A 3PGZA 1ENCA 4GKJL 1WD0A 2ID0A 3GV6A 2K1HA 4OWXB 3M4OH 3IFTA 3RF2A 1H95A 5LMNQ 1VIGA 5F2DA 3URYA 4DR4Q 1SNQA 2EY2A 5C0XI 1NTGA 3J80L 2FPHX 3DHQA 1YNND 2XRSD 4GKKL 1XXGA 4TVAB 3MFGA 4DV1H 4A3DH 3J81j 2V4DA 1D5ZC 4OO1G 2E2JH 3W3AA 1Q7YC 1Y1VG 4ME5A 3E0EA 4DR4L 4RKBA 3ONAB 2JK8A 3A8JE 4DV2H 3G6EA 5IGFA 3SEBA 3QR8A 4HAEA 1B44D 1Y1WB 1FJGH 3Q0AA 1F9RA 1E24A 1WJJA 1O7LA 2Z4IA 1M8AA 3CAMA 5EKLA 2H5XA 3D6WA 3KFUA 1MJEA 3RLNA 3RZOH 5JAVA 1JC7A 4NXML 1WI5A 3CU7A 1EYCA 1HZCA 3TZUA 1KAAA 1W3SA 1I4HA 2D9IA 3NBIA 5JVH3 4JBJA 4B3TL 3M4QA 3KLSA 1HNZQ 4LF5H 4DXGA 3H3VC 2LTLA 1CA5A 5LMUL 1K83B 4X3KA 5C44H 2K52A 1PTOB 4E6IA 2HHHH 4A3EB 4O2DA 1B9MA 2KJXA 1GUSA 5HURA 1Q46A 1IBLQ 1UUPA 1IKLA 4JI1Q 5BR8L 5C3WA 3GTKH 5IODA 4A4IA 4QF4A 4LFBQ 1OO9B 2F0UA 3HKSA 1C48A 2YU9H 2CPMA 2KEDA 4JG2A 3TN2A 2B63H 3I4NH 4BY7H 4AQYQ 3RZDB 4IUPA 1B1ZA 4R8IA 1RTOA 5IT9E 3KDGA 3J7YW 4XIGS 2ZQEA 2L1BA 2UUAQ 3LNNA 2MHVA 1A3VA 1ET6A 1KLGD 5IOCA 5CV7A 4JI7L 2KUMA 3KDFA 3HOZH 5EPKA 1CFMA 1D1KA 3QIAA 4F8MA 4OO1H 3OPOA 3H09A 2L55A 2TMPA 2DNCA 3I4OA 4DUZQ 1TS2A 2JYOA 1BBXC 1MSGA 1A15A 1K3BC 1Y14B 1SROA 4P2CB 2K5DA 3GD7A 2RSNA 3X3MA 4JI5L 3D4WA 4JI6Q 2RHSB 3SK5A 3Q22A 2N49A 5IP9H 4G08A 3H3VH 1QNUA 2ANNA 1DM0B 5CORA 2F52A 4C3HH 4YHHL 3VR6A 2F0IA 2HHHL 5C4XH 4B3ML 4PV1C 2CWFA 2D2CC 2PT7G 4DV3H 3CCSA 3PO2H 4DGZA 1XMQQ 5IWAQ 4OO1I 3WOEA 3CQZH 1SE4A 4Y7NH 1AE3A 4L5TA 3DWQA 4K0KQ 4IPHA 3NEMA 4YIJA 5NUCA 3CRKC 3V2TA 1PH4A 1AW7A 1Z6HA 2A68D 3K7AB 4L6TB 1B3AA 5C5MA 3HOZG 4C3IG 5KIXA 1V9NA 3I4NB 1QG7A 2K04A 3VDYA 1WVLA 1JB7A 2RBMA 4O42A 1TS3A 3TP7A 2XVSA 2EYHA 1BUVT 1EY5A 4P71A 3R93A 3AFQA 2B2YC 3S17B 3BJUA 4A3FB 3GTKB 1A3TA 4H8AA 3SK8A 1QOHA 3M7GA 4PZ6A 4MNOA 4OX9L 1UG8A 3DXJC 5JJLA 4B3SH 4R9WA 4A3EH 2CWPA 2RA4A 2M00A 4AM3A 3RZDH 1OXXK 3CRLC 3HOVB 3LWEA 3OIPA 5M3MH 3PCOB 4I65A 4NPSA 3VKEA 1YNJD 2UUBH 1V1OA 4IPDA 3K5MA 2WAQG 2E2HB 4RGMA 4PNYA 4DNRB 3RZOB 2VB2X 1XNQL 4DV0L 3TBIB 2F0VA 1MI2A 1Y69U 4JPBW 2G8YA 3HOWH 1D5MC 4X65H 2A68C 4KJOA 2H4OA 2E2JB 4GNXA 3FPPA 2K5HA 4HSVA 4DV1L 2IX0A 3T51B 4KLKA 2B2TA 4K14A 2LTMA 5DM73 5FLXL 3MC0B 3Q6SA 1NAPA 1MBYA 1WCMG 2QKIC 4HMIA 4A3EG 3PUYA 1DTJA 1DXMA 4BBSG 1L0YB 1PRTC 2VW9A 3ULPA 3T1HL 1IZ6A 1HZAA 1KDCA 3R8BA 4DXFA 4BY1H 4Z9CB 3BZCA 1OXUA 1SE3A 4KD3A 4KY6A 3PIOA 2VNUD 4DV1Q 2OPVA 2J0TD 2EXDA 1H9JA 1TWCH 1H9SB 4F87A 2EYOA 4ZK9B 4DR4H 3STBD 3U1KA 1VQ8A 4IUTA 1QCBD 4A3GH 4IJHA 1JOOA 1RKNA 2K6AA 5C3EH 4ZLTF 2ZTCA 4LUOA 1HXYD 3OOCA 4DUYH 5FOBB 1YHQA 4G57A 1VQKA 1DONA 1X65A 4CJ1B 1CKMA 1FYCA 1II3A 3TP5A 1F2ZA 2B2TC 1CKNB 3NP8A 3QG1A 2JA8H 2UUCQ 1A62A 3A7LA 2PPBC 4LF7L 4GNXC 5LMUH 2EQSA 3I90A 3NQTA 4JV5L 3H0GH 3KDKA 1ENFA 2F4VH 1V8QA 4TKOB 3J81W 4OX9Q 5H1SE 1PRTD 2PQUA 4B8CD 3S2HB 1MSZA 3U58A 1LTBD 4UY8C 1D2BA 1Q1BA 1I3QH 2C35B 5I2YA 4A3FH 3OYYA 4JI7H 3UDGA 4O1NA 3FRPB 4HJ7A 1KL9A 5IGGA 3A54A 2UU9L 3CHBD 1B8AA 1U4LA 4CDEC 3LX0A 4K0KL 1SNOA 1HNXL 4CGYB 1BXTA 1TIID 1LLRD 3ZJYC 1VS0A 3I56A 2MO0A 5EKIA 3CCEA 1X4MA 4IPCA 5LMNW 1HNWQ 3ITPA 1CSQA 5I9OA 2LFNA 2B2VA 4Y7NB 2CWAA 1N32Q 1CM9A 2IHEA 2K5NA 2NZHA 4JBWA 1NSNS 4IFDI 2V1CC 4DK3C 1STEA 5LL6b 3CPWA 4DR7L 2FINB 1JCKB 2F0QA 2DUDA 1EUJA 2FMCA 3G48A 1G8ZD 3G7LA 4DV5L 1TUAA 3TREA 3E5SA 1YZ6A 1W6JA 2DJFC 5E4WC 3J7ZC 4YHHH 1LTID 4POFA 1SMYD 2BCOA 3R3OA 1PRTF 1G6PA 4DV7Q 2JP1A 4KY5A 1PH5A 3OTOH 1EIHA 1D8LA 1YNJC 1LABA 1VBIA 2K03A 2F3WA 1HQMC 3AQQA 3JAME 1IBML 1MSHA 1PZKD 4HIKA 1BOSA 2GVBA 3VYTA 1EWCA 4R4OA 1PH9A 2IW3A 4NMZA 1ZEQX 4G7ZC 2CW0D 3EZJA 2UU9H 4IFDG 4EQNA 4M1UB 1E1TA 2PMZE 1HNXH 2JA7H 2VXWA 2PMZB 1I94Q 1NMFA 4BY7B 3DMUA 4A3LG 1HUNA 2UXDQ 3QD7X 3NXWA 4IURA 3M9BA 4DF7A 4ZYSA 3EQLC 5C4JB 4LFAL 1X9NA 4DV4Q 4JI8L 4A3CG 2YYZA 1VMCA 5KRUA 1I6HH 4DR5H 1DYQA 3GTMB 1H9MA 5G3LD 1CSPA 2NVXB 4X65L 1JORA 4WFN3 4C3IB 3KK7A 3F2UA 5IE8A 1IHZA 4CKCA 1YJWA 2VUMG 1PZJD 1Q8IA 1K8GA 4IO9A 2UXCQ 1LTTD 1VQFA 4R4QA 3RUZA 2NN6I 4DV5H 1H9RA 5C0XG 4QCLA 2KQ3A 3UDFA 4AYBB 4BXXH 2JZXA 4PZ8A 3K80C 1I4QA 4DUZL 1QVGA 5M5YH 3V69A 1TR5A 2XN9C 1AEXA 2EDGA 4QIWE 3J81E 5CV5A 3CPFA 2JA7G 1L1OC 2I5HA 4FP5D 3SB1A 3MHBA 4PG3A 3BVGA 3VYRA 2KBNA 3SDZA 1GUWA 2E5LH 1XNRL 2UUAL 4FJSA 4YWMA 3T1HH 2EYMA 3A56A 3PIO3 1X55A 3KJPA 1ZYRD 1B4OA 1EY6A 2K7VA 2WKDA 4NZTM 5LMNH 2A8VA 1YBYA 3M4OB 2OCEA 5KNCA 1N34H 2F0TA 4UP9A 2F0SA 3OIQA 3GABA 4GN5A 4A3MG 3KF8B 5M5XH 2NVQH 3ZYYX 3ND8A 4ID6A 3SK6A 3P7JA 2QNDA 2VQEQ 4A3IG 4LF6H 4K8IA 4X66Q 2UXBH 1ASYA 2UXDL 2AMCB 5BN3A 2G5DA 1V1PB 1UE5A 5KYLA 4UAIA 2AXYA 3FKIB 3QOJA 4DPGA 3PO3H 5JPNC 2A6HC 2AWOA 1EY0A 2IL8A 2MQHA 2ZXOA 1QZGA 2VUMB 2JA6G 2YTXA 1DGSA 2VL6A 4B3RH 5BN4A 3MXGA 1KDAA 3OMCA 1TXYA 1B3QA 1VMPA 1ENAA 1M1KC 1TWGH 1HPCA 3J80c 5EGTA 4IUUA 2K05A 4K5WA 2GN5A 3P20A 5CGKA 1J5KA 1KLUD 5IGEA 4MZ9A 3T1YL 1U5KA 4HIMA 1WCMH 3GDEA 4FJUA 1Q90A 3NCVA 3OHXC 3TEHB 4C1NK 4TRDA 4LF9Q 1KTKA 3CCJA 2O5IC 4DV5Q 1ML0D 1RODA 1JJCB 1GKHA 4CDCC 2B2WC 1FR3A 1VQ4A 2UXCH 5ELNA 3SHLA 5BN5A 4DN4M 4JK1C 4K5VA 1KNAA 3EFXD 3GTLH 1Z2IA 3X3NA 3HOYB 5IT9c 1WYDA 4XYQA 4G7OC 1C9OA 1EZ8A 3SR1A 1EIFA 5JVG3 2FHTA 3TP6A 1TY0A 2J7ZA 4JI2H 1TS4A 2ES2A 2LXKA 3NENA 2B2UC 2JQOA 4K2KA 2CW0C 4XDXA 3K5LA 4DV4H 1S5BD 1WTPA 3E9HA 1HNWL 1ESFA 1DOMA 1SNCA 4A93B 1KDBA 3KLRA 3MXNB 1D1IA 3S15B 4H44C 1HUMA 2K75A 2A1SA 4X3UA 1PDQA 2XGTA 2OT2A 1SFOH 3UE1A 1HNXQ 5FO8B 2R92B 1SYDA 1B7YB 1PFSA 3S14B 4R4IA 2NZ1D 4WORA 2E2IH 2NVYH 3S1MH 2RKSA 4PMWA 4DR1L 3OTOL 3J80W 2N8NA 2ZM6H 4B3RL 4ULLA 2L5TA 2BL5A 3R2TA 1IBMH 1LUZA 1STNA 1HRJA 2KCNA 3S1MB 4JI0Q 4DKAC 3HOYG 4EQPA 5HGTA 3S14H 3A74A 1VQ7A 2MPMA 2MGSA 1BR9A 1IBMQ 1SJED 4LF7Q 3EIVA 2C9OA 4A93H 4LNQA 3D0FA 2A6EC 4DV7L 2JSOA 1SSOA 4QUFA 1XTDA 3I4LA 4JI3Q 1I5FA 1C8CA 3GR5A 4UHVA 3BU2A 2F0DA 2EY5A 1GHJA 4ZUIA 4GKJH 5CBAE 4JI8H 1SNDA 2M2LA 2QCPX 5IT9L 2QW7A 1G6ZA 3QWNA 2ZJPA 4A3MB 4UPAA 1JB3A 1A0IA 1BBUA 4RHSA 5C0XJ 2OQ0A 2EXZA 4FF2A 2VS1A 1Q81C 1EY9A 1HNWH 3T4AC 1XRHA 3TRZA 3DLLA 1S5CD 5JEAJ 4JI5H 2Q2HA 4LUVA 4JYAQ 2OTJA 5CMDA 1Q3LA 5AFWA 1LACA 2MP1A 4LF8Q 3SE0A 4HIOA 1HH2P 1LTLA 3SVMA 1PV4A 5AJ3Q 1MD2D 4KHVA 1PFMA 2NYZD 3HFZB 2RCNA 4U68A 2IWHA 4LF9H 3G6JB 4DV3L 4YWLA 1F2YA 1GHKA 3GTGB 5JJKA 1AH9A 3KUPA 4A3JH 3NE5B 2FFKB 4KD4A 2E5LL 4OX9H 1KHIA 3BDOA 4RWSC 3VR2A 2OPUA 4B3TH 1KHMA 2B2YA 4M8AA 1VQPA 1CA6A 1Y8PB 2B29A 5C4ZA 1IBKQ 4LF6Q 2ZT9C 2FMRA 2VQEH 1K28A 2JEAI 1U4MA 2VUMH 2L9HA 1EC6A 1IW7C 2RDFA 1AZPA 2WAQE 4DNIA 1M4VA 2FXQA 1AP0A 1DOKA 1E22A 1TWHB 3NTIA 3RMHA 5CV8A 4A93G 3WDNA 4IUVA 1PH2A 3T53B 3J80E 3HZXA 1Q12A 2UXBQ 3GTQH 4NDXA 1XPRA 4LF6L 4FNFA 4IN3A 1WOCA 2AQ3B 3S1RB 4FF1A 4A3CH 2AQ1B 2F0NA 1VF5C 1ILPA 2XRQD 5M5XB 1EY4A 2NVQB 4GS3A 4BY7G 3G4SA 2QILA 2E5LQ 1RL2A 1CZWA 1E2ZA 4WJ3M 1I4RA 1PH8A 4JW0A 3PIPA 1YITA 3VYSA 4A3KH 1KRTA 3W1BA 1V8CA 5M5YB 2OTLA 2Z1CA 5T1GA 3T1HQ 5J22A 2X69A 1C4QA 4NP5A 2K5WA 1EOTA 1XWEA 2MJ8A 2HCCA 4KJNA 1X9ZA 1CUKA 3IRBA 1EU3A 1MIUA 4QIWB 5EPJA 4FXKC 3VA7A 2Y0SG 4IUNA 1C0AA 1GUGA 4BBRB 2PZTA 3TMEA 4A3JG 4LF8H 2HIVA 1GJXA 1I4XA 2ICEC 3B6YA 3I70A 1ZZKA 4WJ4A 4ZCKA 3CXCA 1XPOA 4F88A 3K5OA 3GTPB 4HJ5A 5CV6A 1K73C 1XNQQ 2HQLA 2MNAA 1EY8A 2RF4A 2MO1A 3PSIA 1A3UA 1JJGA 2HCIA 4ZKBB 4KMUC 3J81c 1VDZA 2CTMA 3KBGA 4GN4B 1LTSD 4XQQA 5EQ0A 1PLFA 2WIIB 1HR0W 4LAAA 3S1NB 3S17H 4C3HG 1EYGA 1S4ZA 4L5RC 3PO3G 1A2UA 2A19A 5EKKA 2OEOA 4B3SL 1V1PA 1LT5D 3Q24A 2XNAC 1VQEA 4RGTA 4DR1H 1I4PA 4RCNA 4QQBX 2R93G 2O4XA 1K8MA 1SYEA 2CTFA 3OTOQ 4DV7H 3GTJB 1ODHA 2R93B 3CQZB 1ZZJA 3I55A 2IY5B 1BDOA 2A73B 2D62A 3KF6A 4KN7C 5CYUA 2A74C 1EZ6A 3J7AK 1J8IA 3OSSD 2F0JA 3CCRA 1YJ9A 1N36Q 4C3HB 2EY1A 2KCCA 2ZTEA 3RR5A 5DM63 5A35A 4LF8L 2PO4A 1DD2A 4OL7A 5IY0A 3D4RA 2EJFC 3S15H 1RD9D 2LF0A 2Z8LA 1UWVA 3HKZG 1L2FA 3C3LA 2EJGC 1S5FD 1LTRD 1O7ZA 3UI2A 4XQNA 1PH3A 4TSSA 2R7FA 1EFID 1IKMA 2XWJB 1LM0A 4A75A 4N8X1 4B9XA 1SRUA 1VQNA 1EU4A 1G91A 4RHRA 2J4XA 5E7NA 5DLQE 1SYGA 3GTLB 4KKTA 5GROA 1BCPF 1PH1A 1J5EL 3K58A 1QZHA 4OIKA 3T56B 3DM1A 5KNBA 1NUCA 4LF4H 4RAUC 4JI7Q 2KHSA 4DR6L 2CH4A 1N9WA 2ATWA 4R4CA 3DUZA 1I3QB 3IL8A 4RCOA 4DV6Q 1CHQD 2JA5G 1GUNA 3NSWA 1PFNA 4ZRZA 1EIGA 2DJGC 2B63B 3S2DH 3BVZA 1QUQB 2K14A 1K0RA 1O7YA 2K28A 3J81L 2R92G 2Q8TA 1HA6A 2K5QA 3PQIA 3E9IA 1F9PA 1B70B 4OHJA 4AQYL 1S03G 1PYWD 4UDUC 1YHBA 1B9NA 4ILWA 4RMFA 1AE2A 1HTPA 3CCMA 2A69C 4CJ2C 5C44B 5T1IA 3J80i 3NPPA 3HOXH 3C46A 5IT9W 1LV9A 4JVYA 4B9WA 1IBLL 4C3JH 1PZID 1PXUA 3JC66 3ULLA 2JEBI 2CTJA 4NXNH 4PDBA 2UUCH 4BXXG 4JVHA 2WKCA 5C3EB 2XWBB 3STBC 5FJ8G 1WTXA 1U9RA 2KECA 1TWFH 4A3GG 4A3GB 3AEVA 3M3YB 2F0GA 2Z6KC 1B53A 1Y1WH 1B2TA 2B63G 2G9DA 1EQTA 4NXMQ 2CTKA 4GNXB 3A0JA 3QOLA 4DV2Q 2LRRA 1TT2A 4BY1B 1AZQA 2M9VA 3NTKA 2F0HA 2EPBA 3TDQA 3BS1A 4H0LC 3RLFA 3IAYA 4GOPC 4DK6C 3CC2A 2I46A 4DV6L 4A3DB 4N9PA 1CI3M 1VQ6A 4TQUS 4JC0A 4K6LA 1J6QA 2WAQB 5FKAC 4RA8A 1RHPA 1J5EQ 1EEFD 1QE6A 1JT8A 3A8IE 3LGJA 4APVA 4JBMA 3T1YQ 4GKKH 3F1ZA 3EJIA 4UP8A 1R9TH 4BA2I 1HZBA 5I9PA 2R7ZB 3BDCA 2MJHA 1L0WA 1XNRH 3V05A 4OD6A 1JICA 3NBHA 1G51A 3KJOA 2E2HH 1TY2A 2JE6I 4EX5A 2IT1A 2L0CA 4X65Q 5ELOA 4C3JB 1CTMA 3HOWB 3GP7A 5BR8H 2BA0A 2F0KA 3L0OA 2F1MA 1BVSA 3VYUA 2JA6H 4X62Q 5IGDA 3A8KE 5FLMH 1JQYD 2CWHA 1WFQA 4HSPA 2FFMA 1KXLA 1JWUD 1SE8A 3S16B 4YCUA 2M6QA 4X3SA 1I6HB 4GLVB 5HGQA 1ICWA 1AN8A 3ULJA 3BVMA 1X3GA 2Z0SA 1PTOF 1I50B 2UUBQ 3OWFA 5M3MB 4JCVE 3FVQA 1GXDC 3CC4A 3QJYA 1EIYB 3C2PA 1IYVA 4PQXA 4UP7A 1ONLA 1I94H 3GTOB 1QUQA 3K7AH 3W1GA 3RNUA 4B3SQ 3M4YA 2NZOA 1I4GA 4DV6H 1C7YA 2NBFA 1MHWC 5M3MG 1GUTA 2JJQA 3K0YA 3MWYW 4CDDC 2CPQA 1XMQH 1S40A 3PO2B 5A2QW 1VCIA 2DN8A 2L4NA 5C4XB 1NNXA 5IYDH 2G9HD 4BBSB 1V43A 3BZDB 2LMCB 1LT3D 4FF3A 5IGCA 4IFDH 1Y1VH 2BE5C 4MTNA 3FPUB 3T13A 3HOUG 2VZAA 4JI6H 3FDTA 4IZ8A 1JMCA 3L3OC 4DFAA 2PQAA 4BBRG 5HY6A 2Q2UA 4F7XA 5LL6X 3F2DA 2UXCL 4O0AA 5C0XH 2VQFL 4HN7A 1Z9FA 1K3RA 1VQCA 1VQHA 4AIMA 1KABA 5GQOA 4BBSH 1CK1A 2K50A 4G7HC 3T16A 4JOIC 2IX3A 3U50C 3MVVA 1YIJA 3ERSX 3U9SA 2FMMA 3H91A 2KA7A 3PF5A 2B2UA 2IJ0A 1IXRA 4OONA 4DUZH 1H9SA 1Y1VB 4LFAQ 2NN6G 3ND9A 4AQYH 1MGSA 2IPKD 4P74A 4U673 1MJCA 1RTNA 4V190 2PNRC 2PNHA 1S5ED 2YU9B 1O78A 1STGA 3CKIB 3TZDA 3EN2A 4ODGA 1VF7A 2K01A 1I6VC 4DR2L 1HJPA 2E76C 4X3TA 3NWSA 2PW7A 2CFMA 4LMQD 3K81C 4OEMB 2B2VC 3A7AB 3A5ZB 4XT1B 4V0BA 3D8GA 4KI0A 4RH6A 2PCFB 4Q5VA 2UXBL 3GTOH 3PUWA 4DNTB 3TP8A 2JA6B 3IKJA 4NXNL 5JEAH 2UUCL 3K57A 3P75A 1JWSD 1FVIA 4LF5Q 3OETA 1HNZH 2F4VQ 2RVLA 2PZUA 1EQRA 1I50H 2PI2E 1Q86C 4EQ5A 3R2IA 3CCQA 4I7AA 1BF4A 2DY7A 2JA8B 3MXUA 3FAUA 2K4KA 3S16H 3I7FA 3M7NA 1SN8A 2BE5D 2I5LX 4NW2A 4EC5A 4N8FA
chains in the Genus database with same CATH topology
1K83H 1FJGQ 3KF8A 3N6RA 3J7AF 4RFBA 3K7UC 5CV4A 2F3VA 3W2DA 3D31A 4DUYQ 2K33A 1BCPD 4A3IH 3NK9A 3HOUH 2EYPA 1U4RA 1E2WA 3PUVA 3PIP3 3CW2C 3KYHC 1HCZA 1HFGA 4HTHA 2QA4A 1LTAD 2R7ZH 4IQZA 4FO2A 2CCZA 2NWGA 2QDBA 3H6MA 1P16A 3I8ZA 2ALYB 4MIUA 3PO2G 3H0GG 2K5VA 1NMGA 2LY7A 4XT3B 1SYFA 1HR0L 3K5NA 2Q2TA 1HQRD 3KBXA 1K9MC 1DT4A 2QGQA 3DM3A 4HJ8A 1HA5A 3RN2A 4JI4Q 1ET9A 3J81i 4CKEA 4JI2L 3M3YH 4A3KG 4OGQC 4KKUA 1TWFB 3FKIG 4DUYL 3GTQB 1PA6A 1PYSB 1GM5A 3HKZB 3FMCA 4DV0Q 2VB3X 5ELCA 4A3IB 2E2DC 3GV3A 4RGNA 1EQQA 1E3PA 3ER0A 1EWIA 1YNXA 4DAPA 3HRZC 4FXDA 5EPLA 3H94A 1F2LA 4A3BG 1B50A 4GOPB 1IYUA 3MA2B 4RG1A 4KHPL 1HFNA 2CTLA 2QF7A 3CCUA 4DU9A 1TWAH 4HEDA 1W6KA 5CC4A 2K32A 1STYA 3VR3A 1QWYA 5IIFA 2EIFA 4NXNQ 5JEAG 3KLSX 3ICEA 1SXTA 4XYOA 1FGBD 1VQDA 1WTOA 4KTAA 2Z4HA 3AYHB 2CQAA 2F4IA 4S3SA 1STAA 2R6GA 3S2DB 2BA1A 5ISRA 3HOVH 2D5DA 4YCWA 1QVFA 3PUZA 4ZUJA 4HMJA 5GAEC 2WACA 2EYLA 3BYYB 1SMYC 5KEEA 4IOCA 1WD1A 1BQQT 1RDPD 5IYBG 5JJIA 4LF4Q 1H9KA 4JI4L 1WTWA 4GZYC 1DCZA 5C3EG 1CQVA 1A8VA 1VQJA 1L0XB 5A2QL 1ILQA 4C2MH 5IWAL 1XMQL 3EBEA 4L8JA 1IYJB 3J7A5 4B3MQ 2F0PA 3KDFB 1AFPA 5GAGC 3UDXA 5C5LA 1SJHD 3KF6B 3CCLA 5JPMC 2B39A 1WTRA 4JI6L 1XYIA 4A3LH 2F0FA 4DR3L 1OXTA 3E0JA 2D0PA 3AB9A 5IYCH 1M90C 1SYCA 2HDLA 4A3FG 4LF9L 1J4WA 4A76A 2AQ2B 1Z47A 3FEWX 4JI3L 3FHWA 2N88A 5ELEA 2X6LA 5FLMG 5EBDA 2OF1A 3CC7A 2R93H 4WALA 1BO0A 3CP0A 2DY8A 1A63A 2R7DA 3HOZB 3U4ZA 2XSCA 1PRTB 3NHHA 4KV6A 4GOPA 2O5JC 4LUZA 1Q1EA 4XQJA 2A69D 1PFBA 2JA8G 5DAUA 2F0MA 3I72A 4OIJA 1XMOQ 1Q82C 1UE7A 4JI0L 2YV5A 2I07B 2EY6A 2H1EA 2NVYB 2BH2A 1VQOA 4K8JA 2E74C 3CD6A 2CTEA 4CJ0B 5IYBH 4DR1Q 4ZQ3A 4XTCS 2HH2A 1VQAA 3OW7A 3L7ZC 4DAYA 2I5MX 1NR4A 3WWVA 5A2QE 1V9PA 5IYDG 5DEHA 2VQEL 5IYCG 1VQBA 4IALA 2KEEA 1HNZL 1ASZA 2X6GA 1CKNA 3UDIA 2QEXA 4J6HA 2HHHQ 5C4XG 5FO9B 2SNMA 3MEFA 5G3LF 4CKBA 4DK1A 4R1JA 2B3GA 3V96A 4BBRH 3L2PA 1O7IA 2VQFQ 2KVMA 1WTQA 2BDOA 1X3PA 3I3CA 4MHEA 4LWCA 3GTPH 1IW7D 5J39A 1OXVA 3NUCA 1SR3A 3MTSA 5FJ8H 1XNRQ 3MXNA 3G71A 3WOFA 2N55A 1FNVA 3I91A 5ELDA 1F77A 2VY3A 4H7BA 4GKKQ 5EJWA 2DGRA 4ZKCB 2WB1G 2P2RA 2NN6H 1G291 4J8QA 2YTYA 2ENBA 3TQYA 1X54A 4QMFB 3H3VI 1SNPA 2EYJA 2ASBA 3DEOA 5C3XA 4K5XA 3PO3B 3FP9A 2AHOB 1WTVA 3BDLA 1TS5A 2ICIA 3E6ZX 5KGUA 3NWTA 4JOIA 1XX8A 4RKLA 2HQEA 2UUBL 3OMGA 4LFBL 2Z6KA 3KOJA 2NTSA 1MKHA 1STBA 4QJFA 2JA9A 1JOKA 3S1RH 4X66L 1NCVA 3MEHA 1CQFA 3U9OA 5M3FB 2F3IA 5I6YA 4NKLA 3NELA 4X62L 1N34Q 4LW1A 2NVTB 2L11A 5LHY1 4B3TQ 2Y0SE 5JJZA 1HHVA 4A3JB 2A5HA 5D3IB 3JAMc 2RDHA 2Q8IB 3HOXB 3AEVB 1PH6A 1IL8A 1NBWA 3GTGH 2SNSA 2KHIA 1XMOL 2HDMA 1DZ1A 3NTHA 1Y8OB 5LL6S 3C1EA 3TS2A 2OXPA 2SDFA 1F9QA 5CV9A 1X3FA 1WE8A 1KNEA 4DR6Q 5K5PA 1LTGD 3I4NG 1A6XA 3D4DA 4IJLA 1KIXA 3PUXA 3W5OA 3K0XA 4QB4A 2HH3A 1EL0A 1SYBA 2KOLA 1OXSC 4FF4A 4K6DA 1A2TA 2B2WA 2LSSA 4IFDJ 2SEBD 1KC8C 2ZJRA 2AUKA 4DR7Q 5C44G 1JE5A 4GKJQ 1PVOA 4KHZA 5IP7G 1GVPA 2IX1A 2DNEA 1X6OA 2TSSA 2LKVA 3S1QB 4WANA 3K6OA 4IUQA 1LT4D 1F2MA 5COYA 5C4JH 2WV6D 3OW2A 1S72A 1K8AC 3JAMi 2JVZA 2AUJD 2RSOA 1N36L 2JA5H 3CCVA 4A3BH 1LYLA 4JI8Q 2BH8A 2PYKA 2A1AA 4DV4L 4R8NA 3I73A 1KD1C 1X3EA 2UU9Q 3I4MH 2EJMA 4R4TA 1VQMA 4LF4L 1I94L 4NBQA 1T9HA 4JBKA 3OSOA 1R4QB 2PY9A 1DJRD 5ELBA 2WB1E 3PV0A 3GTJH 3MZ5A 1D7QA 3I4MB 1QB5D 2E75C 5CR3A 3K59A 1N8RC 3Q23A 3PMFA 1EQVA 4CBVA 1UE6A 2EE1A 4JV5Q 1RF2D 5IP7H 3HGBA 3DWAA 1P8LA 4I7ZC 2EZVA 2LS01 3GO5A 2ZM6Q 1XJVA 5GAHC 5K36G 1E0BA 4B08A 4KHPQ 1G2TA 2YTVA 2E2IB 4J15A 3S1QH 4DAYB 4IOAA 3S1NH 4BWGB 5E4XA 1W2BA 2R3ZA 1SFOB 4X64L 1FNWA 4LFCL 2N78A 2XIWA 1YJNA 2JA5B 5J1ZA 1HZ9A 1EWHA 4DR3Q 3VR5A 2C5CA 2BOSA 2CVRA 1JE4A 1F9SA 1TKWB 1KRSA 4DA2A 2ZXPA 5M5WB 4JI2Q 3HOXG 4DAVA 1SDFA 4QGUA 3F2CA 1N32L 4C2MB 1EOVA 3HOYH 1YI2A 4DAMA 4EGVA 4XXEA 4Q0FA 2CQOA 1WCMB 1UE1A 1LT6D 3TSSA 1DOLA 4L5QA 1EY7A 5C4HA 5M3FG 3SK4A 4HCEA 4QMGA 5CBEE 1G2SA 1UNSA 2WB1B 3RD4A 3EA6A 4HJAA 4PMBA 3VA5A 2WP8J 5ELFA 3D3RA 3F8TA 3CF5A 1X3QA 5JOBA 2A6ED 1SNMA 1V1QA 2F0EA 2NUCA 4A3KB 3QO2A 2A6HD 2KCTA 4HIDA 4BA1I 2DGYA 3JAML 1QJOA 3I4MG 2FJ2A 4KKSA 5J3BA 5IGBA 4POGA 4OWWB 5FO7B 2AWNA 1TWGB 4RGOS 2OQKA 2ANRA 3KLWA 5EBCA 1U0LA 1IL2A 5I4DA 4HR7B 2WFWA 1S3OA 3HG9A 4NB3A 4AYBE 1E7ZA 1YVCA 1J9OA 1QVCA 2CHBD 2GVAA 5K36H 2F4VL 3TS0A 3RN5A 2NVTH 3NBHB 4ZAIA 1D6EC 1JR0D 1RJTA 4H02A 5FLXE 4YWKA 1TWHH 4N9TA 3AMUA 1YEZA 2QEJC 1UEBA 2F0LA 1IBKL 1PTOD 2HUGA 3VR4A 1SAPA 1TWCB 2WINB 1WVNA 5M9OA 1CKOA 2RHQB 4DR2Q 4QY7A 4DR5L 3PF4A 3Q8DA 3M85A 3CMEA 4K2LA 4Y52H 2EOTA 1SMXA 1ESRA 3CMAA 1L1OA 2AKWB 1ZZIA 4PMCA 3SXHA 1XPUA 2ZXRA 4WJWA 1T5XD 3SGIA 2MUYA 2IHFA 1HR0Q 1BCPC 2PQEA 1QNKA 1JWMD 4QUCA 4FYDA 1JOQA 1CHPD 4QL5A 1ZKOA 2SOBA 2PQAB 1SLJA 1GUOA 2L15A 3EROA 4KN4C 4AH6A 1EEID 4JYAL 3HOUB 3OWEB 2Y0SB 2KHJA 2PI2A 2BDNA 3EVQA 5IP9G 1YHAA 4GLXA 1RIPA 4J1MA 2KCMA 1K8OA 4JI5Q 1Q8KA 3M4PA 5KNDA 1PYBA 3GTMH 5D65A 4DR5Q 1STHA 4C1NI 1PTOC 1ZXTA 5M5WH 1FJGL 4MN3A 3J7AV 3BG3A 2EYFA 4X64Q 4A3MH 3I2ZA 2L12A 2JXMB 1ZYRC 4C3IH 1GO3E 2JA7B 2NVXH 1VQIA 2ZJQA 1OTCA 2N3SA 4LF5L 4X6AH 1K1GA 2R61A 1KQSA 2Q8RE 2PW5A 5FLXc 1O80A 3H15A 3NQIA 1FD7D 3BZKA 4KK7A 3LWUA 4LJZC 1PH7A 3MXPA 1NJIC 1TVXA 5D14A 4P73A 4BS9A 2E8GA 1BCPB 3S9WA 2D0OA 1EYAA 5FK9C 4P75A 4C56C 2NTTA 2I0QA 3BYTB 3C1FA 3HKZE 3AFPA 4C3JG 2K1BA 3U4VA 4HJ9A 2B8GA 1JJ2A 1UAPA 3P1HA 4DV3Q 1EYDA 2LXJA 3N52A 2EVBA 1VQ5A 2ZTDA 4WRDA 3MFYA 4AYBG 5I6WA 5AJ3L 1FL0A 1TQOA 1PHJA 2R92H 1LO5D 4A3BB 1R4PB 4YHHQ 1Y1WG 4FXGC 1E1OA 4GLAC 1D5XC 1TU2B 5DNFA 3RLOA 3ERQA 1NY4A 4EQOA 1BNZA 3QB3A 2D9UA 3S24A 4LK1C 2Q2IA 1BKBA 1CZGA 5D3DA 2NB0A 1VIHA 3DWPA 1HTLD 1X56A 3HP3A 2KENA 3UE0A 2RQXA 4A3DG 2MFIA 1ZTGA 4GN3B 1SE2A 1E2VA 4LFCQ 2PZWA 2GA4B 4ABNA 4KY7A 1YNNC 4BY1G 4G4KA 4CHTB 3DEPA 3HOWG 4FVMA 1U4PA 1RCVD 2B8FA 2F0OA 2ZM6L 1VQGA 1VQ9A 2E3UA 1Z7TA 3A5UA 5LMNL 5C6AA 3O13A 3L9AX 2F0WA 1GD7A 4L63B 2HT1A 1PMRA 4FDBA 5EAYA 3S2HH 1X32A 4HCSA 4EVOA 4IPGA 2R7ZG 4LIJA 1SBBB 2O2LD 3IFDA 4DV2L 4PZ7A 1S5DD 5TSSA 1QILA 4YY3L 1XTCD 1FGUA 1EFWA 1GOZA 2RDGA 1L1OB 1X4NA 4P72A 1Y8NB 5E3FA 5E1FA 4H13C 5KYIA 3F2BA 1TWAB 4B3RQ 1N33L 4L5SA 1KAWA 2YQRA 1PTOH 1BBWA 2XTIA 1CT1D 5I2XA 1UEAB 1SEBD 1N34L 3AU7A 4OWTB 1NE3A 4OXPA 4JI1L 5BR8Q 3H0GB 3GQBA 3FKIH 1NR2A 3HS0C 3MAQA 3A55A 5LMUQ 1FNUA 3HEJA 3HOVG 2OWOA 1T5EA 2HIXA 5M3FH 4ALPA 1N33Q 4B8TA 4DK0A 3D6CA 5GADC 1VQLA 4ME3A 1R9TB 4YY3Q 2CKZB 3K8AA 4YCVA 2F03A 3PGZA 1ENCA 4GKJL 1WD0A 2ID0A 3GV6A 4OWXB 3M4OH 3IFTA 1H95A 5LMNQ 1VIGA 5F2DA 3URYA 4DR4Q 1SNQA 2EY2A 5C0XI 1NTGA 3J80L 3DHQA 1YNND 2XRSD 4GKKL 1XXGA 4TVAB 3MFGA 4A3DH 3J81j 2V4DA 1D5ZC 4OO1G 2E2JH 3W3AA 1Q7YC 1Y1VG 4ME5A 3E0EA 4DR4L 4RKBA 3ONAB 2JK8A 3A8JE 3G6EA 5IGFA 3SEBA 4HAEA 1B44D 1Y1WB 3Q0AA 1F9RA 1E24A 1WJJA 1O7LA 2Z4IA 1M8AA 5EKLA 3CAMA 2H5XA 3D6WA 3KFUA 1MJEA 3RLNA 3RZOH 5JAVA 1JC7A 4NXML 1WI5A 1EYCA 3CU7A 1HZCA 3TZUA 1KAAA 1W3SA 1I4HA 3NBIA 5JVH3 4JBJA 4B3TL 3KLSA 3M4QA 1HNZQ 4DXGA 3H3VC 1CA5A 5LMUL 1K83B 4X3KA 5C44H 2K52A 1PTOB 4E6IA 4A3EB 4O2DA 1B9MA 2KJXA 1GUSA 5HURA 1Q46A 1IBLQ 1UUPA 1IKLA 4JI1Q 5BR8L 5C3WA 3GTKH 5IODA 4A4IA 4QF4A 4LFBQ 1OO9B 2F0UA 3HKSA 1C48A 2YU9H 2KEDA 3TN2A 4JG2A 2B63H 3I4NH 4BY7H 4AQYQ 3RZDB 4IUPA 1B1ZA 4R8IA 1RTOA 5IT9E 3J7YW 4XIGS 2L1BA 2UUAQ 3LNNA 2MHVA 5IOCA 1A3VA 1ET6A 1KLGD 5CV7A 4JI7L 2KUMA 3KDFA 3HOZH 5EPKA 1CFMA 1D1KA 3QIAA 4F8MA 4OO1H 3OPOA 3H09A 2L55A 2TMPA 2DNCA 3I4OA 4DUZQ 1TS2A 2JYOA 1BBXC 1MSGA 1A15A 1Y14B 1SROA 4P2CB 2K5DA 3GD7A 2RSNA 3X3MA 4JI5L 3D4WA 4JI6Q 3SK5A 2RHSB 3Q22A 2N49A 5IP9H 3H3VH 1QNUA 2ANNA 1DM0B 5CORA 2F52A 4C3HH 4YHHL 3VR6A 2F0IA 2HHHL 5C4XH 4B3ML 4PV1C 2D2CC 3CCSA 3PO2H 4DGZA 4OO1I 5IWAQ 1XMQQ 3WOEA 3CQZH 1SE4A 4Y7NH 1AE3A 4L5TA 3DWQA 4K0KQ 4IPHA 5NUCA 4YIJA 3V2TA 3CRKC 3NEMA 1PH4A 1AW7A 5C5MA 1Z6HA 2A68D 3K7AB 1B3AA 4L6TB 3HOZG 4C3IG 5KIXA 3I4NB 1QG7A 2K04A 1WVLA 3VDYA 1JB7A 2RBMA 4O42A 1TS3A 3TP7A 2XVSA 2EYHA 1BUVT 1EY5A 4P71A 3R93A 3AFQA 2B2YC 3S17B 3BJUA 4A3FB 3GTKB 1A3TA 3SK8A 1QOHA 3M7GA 4PZ6A 4MNOA 4OX9L 3DXJC 5JJLA 4R9WA 4A3EH 2RA4A 2CWPA 2M00A 4AM3A 3RZDH 1OXXK 3CRLC 3HOVB 3LWEA 3OIPA 5M3MH 3PCOB 4I65A 4NPSA 3VKEA 1YNJD 1V1OA 4IPDA 3K5MA 2WAQG 2E2HB 4RGMA 4PNYA 4DNRB 3RZOB 2VB2X 1XNQL 4DV0L 3TBIB 2F0VA 1MI2A 1Y69U 3HOWH 1D5MC 2A68C 4KJOA 2H4OA 2E2JB 4GNXA 3FPPA 2K5HA 4HSVA 4DV1L 2IX0A 3T51B 4KLKA 2B2TA 4K14A 5DM73 5FLXL 3MC0B 3Q6SA 1NAPA 1MBYA 1WCMG 2QKIC 4HMIA 4A3EG 3PUYA 1DTJA 1DXMA 4BBSG 1L0YB 1PRTC 2VW9A 3ULPA 3T1HL 1IZ6A 1KDCA 1HZAA 3R8BA 4DXFA 2VNUD 4Z9CB 3BZCA 1OXUA 1SE3A 4KD3A 4KY6A 3PIOA 4BY1H 4DV1Q 2OPVA 2J0TD 2EXDA 1H9JA 1TWCH 1H9SB 4F87A 2EYOA 4ZK9B 3STBD 3U1KA 1VQ8A 4IUTA 1QCBD 4A3GH 4IJHA 1JOOA 1RKNA 2K6AA 5C3EH 4ZLTF 2ZTCA 4LUOA 1HXYD 3OOCA 5FOBB 1DONA 4G57A 1YHQA 1VQKA 1X65A 4CJ1B 1CKMA 1FYCA 1II3A 3TP5A 1F2ZA 2B2TC 1CKNB 3NP8A 3QG1A 2JA8H 2UUCQ 3A7LA 2PPBC 1A62A 4LF7L 4GNXC 2EQSA 3I90A 3NQTA 4JV5L 3H0GH 1ENFA 1V8QA 4TKOB 4OX9Q 5H1SE 1PRTD 2PQUA 3S2HB 3U58A 1LTBD 4UY8C 1D2BA 1Q1BA 1I3QH 2C35B 5I2YA 4A3FH 3OYYA 3UDGA 4O1NA 3FRPB 4HJ7A 5IGGA 1KL9A 3A54A 2UU9L 3CHBD 1U4LA 1B8AA 3LX0A 4K0KL 1SNOA 1HNXL 4CGYB 1BXTA 1TIID 1LLRD 3ZJYC 1VS0A 3I56A 5EKIA 2MO0A 3CCEA 1X4MA 4IPCA 5LMNW 1HNWQ 3ITPA 1CSQA 5I9OA 2LFNA 2B2VA 4Y7NB 2CWAA 1N32Q 1CM9A 2IHEA 2K5NA 2NZHA 4JBWA 1NSNS 4IFDI 2V1CC 4DK3C 1STEA 3CPWA 4DR7L 2FINB 1JCKB 2F0QA 2DUDA 1EUJA 2FMCA 3G48A 1G8ZD 3G7LA 4DV5L 1TUAA 3TREA 3E5SA 1YZ6A 1W6JA 5E4WC 3J7ZC 1LTID 4POFA 1SMYD 2BCOA 3R3OA 1PRTF 1G6PA 4DV7Q 2JP1A 4KY5A 1PH5A 1EIHA 1YNJC 1D8LA 1LABA 2K03A 2F3WA 1HQMC 3AQQA 3JAME 1IBML 1MSHA 1PZKD 4HIKA 1BOSA 2GVBA 3VYTA 1EWCA 4R4OA 1PH9A 2IW3A 4NMZA 1ZEQX 4G7ZC 2CW0D 4IFDG 4EQNA 4M1UB 1E1TA 2PMZE 2JA7H 2VXWA 2PMZB 1I94Q 1NMFA 4BY7B 3DMUA 1HUNA 4A3LG 2UXDQ 3NXWA 4IURA 4DF7A 4ZYSA 3M9BA 3EQLC 5C4JB 4LFAL 1X9NA 4DV4Q 4JI8L 4A3CG 2YYZA 1VMCA 5KRUA 1I6HH 3GTMB 1DYQA 1H9MA 5G3LD 1CSPA 2NVXB 4X65L 1JORA 4WFN3 4C3IB 3KK7A 3F2UA 5IE8A 1IHZA 4CKCA 1YJWA 2VUMG 1PZJD 1Q8IA 1K8GA 4IO9A 2UXCQ 1LTTD 1VQFA 3RUZA 4R4QA 2NN6I 1H9RA 5C0XG 4QCLA 2KQ3A 4AYBB 3UDFA 4BXXH 2JZXA 4PZ8A 3K80C 1I4QA 4DUZL 1QVGA 5M5YH 3V69A 1TR5A 2XN9C 1AEXA 2EDGA 3J81E 4QIWE 5CV5A 3CPFA 2JA7G 1L1OC 2I5HA 4FP5D 3MHBA 4PG3A 3BVGA 3VYRA 1GUWA 3SDZA 2KBNA 1XNRL 2UUAL 4YWMA 2EYMA 3A56A 3PIO3 1X55A 3KJPA 1ZYRD 1B4OA 1EY6A 2K7VA 2WKDA 2A8VA 1YBYA 3M4OB 2OCEA 5KNCA 2F0TA 4UP9A 2F0SA 3OIQA 4GN5A 4A3MG 3KF8B 5M5XH 2NVQH 3ZYYX 3ND8A 4ID6A 3SK6A 3P7JA 2QNDA 2VQEQ 4A3IG 4K8IA 4X66Q 1ASYA 2UXDL 2AMCB 5BN3A 1V1PB 5KYLA 1UE5A 4UAIA 2AXYA 3FKIB 3QOJA 4DPGA 3PO3H 5JPNC 2A6HC 2AWOA 1EY0A 2IL8A 2MQHA 2ZXOA 1QZGA 2VUMB 2JA6G 2YTXA 1DGSA 2VL6A 5BN4A 3MXGA 1KDAA 3OMCA 1TXYA 1VMPA 1ENAA 1M1KC 1TWGH 1HPCA 3J80c 5EGTA 4IUUA 2K05A 4K5WA 2GN5A 3P20A 5CGKA 1J5KA 1KLUD 5IGEA 4MZ9A 3T1YL 1U5KA 4HIMA 1WCMH 3GDEA 1Q90A 3OHXC 3TEHB 4C1NK 4TRDA 4LF9Q 1KTKA 3CCJA 2O5IC 4DV5Q 1ML0D 1RODA 1JJCB 1GKHA 2B2WC 1FR3A 1VQ4A 5ELNA 3SHLA 5BN5A 4DN4M 4JK1C 4K5VA 1KNAA 3EFXD 3GTLH 3X3NA 3HOYB 5IT9c 4XYQA 1WYDA 4G7OC 1C9OA 1EZ8A 3SR1A 1EIFA 5JVG3 2FHTA 3TP6A 1TY0A 2J7ZA 1TS4A 2ES2A 2LXKA 3NENA 2B2UC 2JQOA 4K2KA 2CW0C 4XDXA 3K5LA 1S5BD 1WTPA 3E9HA 1HNWL 1ESFA 1DOMA 1SNCA 4A93B 1KDBA 3KLRA 3MXNB 1D1IA 3S15B 4H44C 1HUMA 2K75A 4X3UA 1PDQA 2XGTA 2OT2A 1SFOH 2R92B 3UE1A 5FO8B 1HNXQ 1SYDA 1B7YB 3S14B 1PFSA 4R4IA 2NZ1D 4WORA 2E2IH 2NVYH 3S1MH 2RKSA 4PMWA 4DR1L 3OTOL 2N8NA 4B3RL 4ULLA 2L5TA 2BL5A 3R2TA 1LUZA 1STNA 1HRJA 2KCNA 3S1MB 4JI0Q 4DKAC 3HOYG 4EQPA 5HGTA 3S14H 3A74A 1VQ7A 2MPMA 2MGSA 1BR9A 1IBMQ 1SJED 4LF7Q 3EIVA 2C9OA 4A93H 4LNQA 3D0FA 2A6EC 4DV7L 2JSOA 1SSOA 4QUFA 1XTDA 3I4LA 4JI3Q 1I5FA 1C8CA 3BU2A 2F0DA 2EY5A 1GHJA 4ZUIA 5CBAE 1SNDA 2M2LA 2QCPX 5IT9L 1G6ZA 3QWNA 2ZJPA 4A3MB 4UPAA 1JB3A 1A0IA 5C0XJ 4RHSA 1BBUA 2OQ0A 2EXZA 4FF2A 2VS1A 1Q81C 1EY9A 3T4AC 3TRZA 3DLLA 1S5CD 5JEAJ 2Q2HA 4LUVA 4JYAQ 2OTJA 5CMDA 1Q3LA 5AFWA 1LACA 2MP1A 4LF8Q 3SE0A 4HIOA 1HH2P 3SVMA 1LTLA 1PV4A 5AJ3Q 1MD2D 4KHVA 1PFMA 2NYZD 3HFZB 2RCNA 4U68A 2IWHA 3G6JB 4DV3L 4YWLA 1F2YA 1GHKA 3GTGB 5JJKA 1AH9A 3KUPA 4A3JH 3NE5B 2FFKB 4KD4A 2E5LL 3BDOA 4RWSC 1KHIA 3VR2A 2OPUA 1KHMA 2B2YA 4M8AA 1VQPA 1CA6A 1Y8PB 2B29A 5C4ZA 1IBKQ 4LF6Q 2ZT9C 2FMRA 2JEAI 1U4MA 2VUMH 2L9HA 1EC6A 1IW7C 2RDFA 1AZPA 2WAQE 4DNIA 1M4VA 1AP0A 2FXQA 1DOKA 1TWHB 1E22A 3NTIA 3RMHA 5CV8A 4A93G 3WDNA 4IUVA 1PH2A 3T53B 3J80E 3HZXA 1Q12A 2UXBQ 3GTQH 4NDXA 1XPRA 4LF6L 4FNFA 4IN3A 1WOCA 2AQ3B 3S1RB 4FF1A 4A3CH 2AQ1B 2F0NA 1VF5C 1ILPA 2XRQD 5M5XB 1EY4A 2NVQB 4GS3A 4BY7G 3G4SA 2QILA 2E5LQ 1RL2A 1CZWA 1E2ZA 4WJ3M 1I4RA 1PH8A 3PIPA 1YITA 3VYSA 4A3KH 1KRTA 3W1BA 5M5YB 2OTLA 2Z1CA 5T1GA 3T1HQ 5J22A 2X69A 1C4QA 4NP5A 2K5WA 1EOTA 1XWEA 2MJ8A 2HCCA 4KJNA 1CUKA 3IRBA 1EU3A 1MIUA 4QIWB 5EPJA 4FXKC 3VA7A 2Y0SG 4IUNA 1C0AA 1GUGA 4BBRB 2PZTA 3TMEA 4A3JG 1GJXA 2HIVA 1I4XA 2ICEC 3B6YA 3I70A 1ZZKA 4WJ4A 1XPOA 3CXCA 4F88A 3K5OA 3GTPB 4HJ5A 5CV6A 1K73C 1XNQQ 2HQLA 2MNAA 1EY8A 2RF4A 2MO1A 3PSIA 1A3UA 1JJGA 2HCIA 4ZKBB 4KMUC 3J81c 1VDZA 2CTMA 3KBGA 4GN4B 1LTSD 4XQQA 5EQ0A 1PLFA 2WIIB 1HR0W 4LAAA 3S1NB 3S17H 4C3HG 1EYGA 1S4ZA 4L5RC 3PO3G 1A2UA 5EKKA 2A19A 2OEOA 4B3SL 1V1PA 1LT5D 3Q24A 2XNAC 1VQEA 4RGTA 1I4PA 4RCNA 4QQBX 2R93G 2O4XA 1K8MA 1SYEA 2CTFA 3OTOQ 3GTJB 2R93B 3CQZB 1ZZJA 3I55A 2IY5B 1BDOA 2A73B 2D62A 3KF6A 4KN7C 5CYUA 2A74C 1EZ6A 1J8IA 2F0JA 3CCRA 1YJ9A 1N36Q 4C3HB 2EY1A 2KCCA 2ZTEA 3RR5A 5DM63 5A35A 4LF8L 2PO4A 1DD2A 4OL7A 5IY0A 3D4RA 2EJFC 3S15H 1RD9D 2Z8LA 1UWVA 3HKZG 1L2FA 3C3LA 2EJGC 1S5FD 1LTRD 1O7ZA 3UI2A 4XQNA 1PH3A 4TSSA 2R7FA 1EFID 1IKMA 2XWJB 1LM0A 4A75A 4B9XA 1SRUA 1VQNA 1EU4A 1G91A 4RHRA 2J4XA 5E7NA 5DLQE 1SYGA 3GTLB 4KKTA 5GROA 1BCPF 1PH1A 1J5EL 3K58A 1QZHA 4OIKA 3T56B 3DM1A 5KNBA 1NUCA 4RAUC 4JI7Q 2KHSA 4DR6L 1N9WA 2ATWA 4R4CA 3DUZA 1I3QB 3IL8A 4RCOA 4DV6Q 1CHQD 2JA5G 1GUNA 3NSWA 1PFNA 4ZRZA 1EIGA 2B63B 3S2DH 3BVZA 1QUQB 3J81L 1O7YA 2K28A 1K0RA 2K14A 2R92G 2Q8TA 1HA6A 2K5QA 3E9IA 1F9PA 1B70B 4OHJA 4AQYL 1PYWD 4UDUC 1YHBA 1B9NA 4ILWA 4RMFA 1AE2A 1HTPA 3CCMA 2A69C 4CJ2C 5C44B 5T1IA 3J80i 3NPPA 3HOXH 3C46A 1LV9A 4JVYA 4B9WA 1IBLL 4C3JH 1PZID 1PXUA 3JC66 3ULLA 2JEBI 2CTJA 4JVHA 4BXXG 2WKCA 5C3EB 2XWBB 3STBC 1WTXA 5FJ8G 1U9RA 2KECA 1TWFH 4A3GG 4A3GB 3AEVA 3M3YB 2F0GA 2Z6KC 1B53A 1Y1WH 1B2TA 2B63G 2G9DA 1EQTA 4NXMQ 2CTKA 4GNXB 3A0JA 3QOLA 4DV2Q 1TT2A 4BY1B 1AZQA 2M9VA 3NTKA 2F0HA 2EPBA