4BA1I

Archaeal exosome (rrp4-rrp41(d182a)-rrp42) bound to inorganic phosphate
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
212
structure length
204
Chain Sequence
SQEIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGERRYLDVGDYVIARIENFDRSIDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGNKSMYETLTSKCSIFVANNGRIWASRFSEEILIEAIRKIENE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE EXOSOME COMPLEX EXONUCLEASE 2
publication title Crystal Structure of a 9-Subunit Archaeal Exosome in Pre-Catalytic States of the Phosphorolytic Reaction.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 41
structure length 204
sequence length 212
ec nomenclature
pdb deposition date 2012-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ba1I01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ba1I02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4ba1I03
4QIWE 3J80i 3CRLC 1G291 1HZAA 3UDFA 1IBKQ 1WFQA 2BL5A 4OO1G 3ULLA 1VQMA 1PH9A 2O5IC 4QQBX 3Q8DA 2YTYA 4R4CA 1OXVA 4DV2Q 4RMFA 4BXXH 3J7A5 3PO2G 1R9TH 1KL9A 2JXMB 1Z6HA 1GUTA 1ASZA 2BE5C 3B6YA 5IYBG 1HTPA 4KN4C 4K0KQ 2KCTA 4A76A 1QJOA 1I6HH 4JI8Q 2BA1A 4BY1G 5FJ8G 2ID0A 1X6OA 4DR7L 3I72A 4LFAL 2Q2UA 1H9SB 1S3OA 4POGA 3BJUA 4O0AA 3CF5A 1EWHA 2KBNA 3S16H 3F2CA 4LIJA 2WB1E 4IFDG 2Q2TA 2ES2A 1UE6A 1H95A 5IYCG 4C3JH 1ZZKA 4DK0A 1U0LA 3IKJA 1GUSA 5GADC 4JI3L 3VR4A 3G48A 1YNNC 1OTCA 4IPHA 4JI5Q 4B3RQ 5LMUQ 2E76C 3PGZA 3V69A 3CCEA 1YJ9A 1KD1C 2WB1G 4JBMA 4Y52H 5GROA 3J81i 4L5QA 4X62Q 3PUWA 1IBMQ 1YHAA 1IYVA 2DUDA 1C9OA 2IX1A 1CKNA 3E9HA 3S2HH 1SRUA 1E24A 2E75C 4WANA 1J5KA 4GNXB 1YHQA 1PFSA 2HHHQ 2NZHA 4TQUS 3HOUH 5IY0A 2PI2A 3CCLA 3I4MG 1XPOA 3RLFA 3ND8A 4JI3Q 2LSSA 4DV0Q 5KNBA 1V43A 3QG1A 1WOCA 4A3EH 2R93H 4DR4Q 1HCZA 2NN6G 2EJFC 5LMNL 2D5DA 1E7ZA 5C44G 4GNXC 4PZ7A 1H9JA 1N34Q 4A4IA 2AMCB 3NEMA 5IP9H 4A3MG 2DGRA 3JAMc 2D0PA 1VQGA 2R92H 4LF9L 2RHQB 4LFCL 4DKAC 1GJXA 1LUZA 2A68D 3M4QA 2HIVA 2Z6KA 1IBLL 1KIXA 1S40A 2A6ED 5GAEC 3VR2A 1Y14B 4PV1C 2D62A 2GVBA 1PH4A 1J4WA 5JJLA 1PH3A 2MJHA 4DNIA 4OGQC 4NXML 2EJGC 2WP8J 2N49A 4JI7Q 4JI0L 1ZZJA 4BXXG 3K80C 1TWFH 3GTOH 2GVAA 1Y8PB 1IW7C 1E2WA 4PZ6A 2VZAA 4A3CG 2D0OA 2IX0A 2CW0C 4IJHA 4APVA 2C35B 2MFIA 4L5RC 2BE5D 2KCMA 2RCNA 3AFPA 3PF5A 2R6GA 3PO3H 3EQLC 1L2FA 3CMEA 3GTGH 4QJFA 4BBSH 1CTMA 2UU9L 5IWAQ 2R7DA 2DGYA 2VS1A 1M1KC 1OXSC 1KAWA 3UDGA 2KENA 3K0XA 1WJJA 4P74A 2VUMH 3SE0A 1LABA 3VR3A 4L5TA 4A93H 4KI0A 2B29A 2UXDL 1PH7A 3M4PA 4LF5Q 4IFDJ 2HIXA 4JI0Q 2QF7A 1MJCA 4IO9A 4H02A 3HOZH 2JA7H 2OQ0A 1JJCB 3OYYA 1H9KA 4LUVA 4GZYC 3BZKA 4HJAA 3KF6B 4OX9L 3HOVH 2OWOA 3MXUA 1RIPA 4PMWA 4JOIA 1Q86C 3L7ZC 4IFDI 3CD6A 3GTMH 1PH8A 1GO3E 4DR6L 3CCSA 1XNRQ 4P72A 1VQNA 4NB3A 3T1YQ 1C0AA 3PUXA 3D4RA 1N8RC 3IFTA 2OPUA 3HOUG 4DR3Q 2YV5A 2YTVA 2CPQA 2K5HA 4XTCS 1XPRA 1LTLA 2QA4A 2E2IH 1GKHA 4Y7NH 1B9NA 1TXYA 4UY8C 2CQOA 1ZTGA 4IJLA 1HZ9A 2K75A 4A3EG 1K73C 2R93G 4J15A 1GHJA 3M4OH 1NJIC 3CMAA 1FGUA 5JJKA 4P73A 2B8FA 2RHSB 4DK1A 1SN8A 4X65Q 1CI3M 2AKWB 3H15A 2ALYB 2R7FA 3I56A 5IP9G 4XIGS 4DR6Q 5DLQE 2R92G 1UEBA 3FMCA 2GN5A 2L5TA 4DR5Q 2IT1A 4G7ZC 2A69C 1KC8C 1I94Q 4LF8Q 3BG3A 2Z0SA 2IY5B 1X4MA 4DUZL 1HNZL 2F3IA 2B8GA 2PNRC 2VQEQ 4ALPA 3HOYH 2UUCL 1E22A 4KLKA 2OCEA 2I5MX 5GAGC 4KN7C 2Q2IA 3G4SA 4JI4Q 3AQQA 3VA7A 1IBKL 1D8LA 2VNUD 1YVCA 3AB9A 2FMRA 3MFYA 4B8TA 4DV7Q 4A3FG 3S1RH 4ME3A 4DV2L 1XPUA 1VQIA 3TZUA 1IW7D 2YQRA 2JA8H 3PO3G 4JV5Q 3AYHB 1SR3A 3GTQH 1PH2A 4BBSG 1G51A 4K0KL 4YWMA 4R1JA 1CSQA 1Y8NB 2UXCQ 4WALA 4JI8L 2V4DA 1NMGA 4DAMA 1HJPA 1QVGA 3UDIA 4RG1A 2JEAI 2VUMG 1TWAH 2JA5H 3EIVA 2JVZA 4A93G 1PYBA 1CKNB 4JVHA 4DAYB 1EFWA 1A6XA 4HJ8A 1E2ZA 5GAHC 1WYDA 3HOZG 2KHIA 2JA7G 3KDFA 3HOVG 3F8TA 2JZXA 3S2DH 4GKKQ 1EUJA 5GQOA 4JI6Q 2LXJA 1EC6A 3FHWA 4JI5L 4B3RL 5LMUL 3CPFA 3EBEA 1Y1VH 1GUNA 2KHJA 1HR0W 2CTKA 2FXQA 1X3GA 1FVIA 1U5KA 2K32A 2PI2E 1PH1A 4JBJA 5M5XH 4X62L 1IBML 5C0XH 1K0RA 3TS2A 1T5EA 1JB7A 1N32L 4P75A 2ASBA 1ZYRC 1DGSA 4LWCA 1VS0A 4WJ3M 2UUBL 4AM3A 2EXDA 3PF4A 5J3BA 5ELOA 4X66Q 4HIDA 3HGBA 1YNJC 3KF8B 5IP7H 4YY3Q 2HHHL 1KHMA 4GLVB 1EOVA 4GKJQ 2PY9A 4LUZA 3EN2A 3H0GH 5BR8L 4DK6C 2ZTEA 2I0QA 1V9PA 1Q12A 1K8AC 1NE3A 1PV4A 3U4ZA 1S72A 1HZCA 3GO5A 3RLNA 4DV0L 3S1NH 3GTPH 4HJ9A 4JBWA 4DR4L 1TWGH 1K8OA 1CKMA 2UUAQ 3GD7A 3I2ZA 4LUOA 3M9BA 4NXNL 4JK1C 3OTOL 4A3JH 1N34L 2PQAA 5C4JH 3HFZB 4DV6Q 1EIFA 1D7QA 2A69D 1VQFA 2K4KA 1Q1EA 1N32Q 1IYJB 1VQJA 1YEZA 1O7IA 3PUZA 3HOYG 2Z6KC 1DT4A 2UUBQ 2H5XA 3BZCA 1MJEA 3T53B 1JE5A 1BKBA 1J6QA 2QEXA 2A6HC 4MTNA 4AIMA 2F4VQ 2CTEA 4LFBL 5BR8Q 1FJGQ 4A3GH 4JI7L 3U58A 5HY6A 2JA8G 5JJIA 3RN5A 1PH6A 3CCRA 3DLLA 2LMCB 5K36H 5AJ3L 5C3EH 3CAMA 4BA1I 4L5SA 1N9WA 3FKIH 1QUQA 4DPGA 1XMQQ 4YCUA 3CXCA 4A3KH 4NXNQ 3OTOQ 1WCMH 3A8JE 4LW1A 1QZHA 1GVPA 4HJ7A 3F2DA 2JA5G 5IWAL 1YI2A 4UP7A 2JEBI 1VQDA 1P16A 4GOPA 2QNDA 1WE8A 1UE5A 4BA2I 4PZ8A 1H9MA 1X54A 3CCUA 2IHEA 1NY4A 4LFBQ 4DNRB 1K1GA 5ELNA 4LF5L 2I5LX 1LM0A 3S17H 2K7VA 3A8KE 5AJ3Q 3TS0A 4GN4B 4JOIC 4IOAA 4DR2Q 1Q8KA 3VKEA 3ICEA 3FP9A 3LGJA 4YHHQ 4R4QA 2R7ZH 3DXJC 4KKUA 1XNRL 3J80c 3CQZH 3IRBA 2UXBQ 3T1YL 4MNOA 4B3SQ 5C4XH 5IP7G 3HKZE 1L0WA 1VF7A 4DR3L 1EQQA 3I4LA 4TVAB 5FLMH 3H0GG 1KQSA 1IXRA 4DV4Q 2VY3A 1KRSA 4DV3Q 1HH2P 2JA6H 1YJWA 1W3SA 4B3MQ 5M5YH 3OW7A 4LF7Q 5IYDH 5KNDA 4YCVA 1A8VA 1Q81C 4IQZA 4JG2A 5E7NA 3GDEA 3A8IE 1TU2B 1PA6A 3PUVA 2ZJPA 1YIJA 3KFUA 4X65L 4A3JG 3HOWH 1SLJA 1HNWQ 4OWXB 4DUYQ 1K83H 1FR3A 2NVTH 3A7AB 3PCOB 1HNXQ 1V8QA 1J5EL 3NENA 1VQOA 4R4OA 4DR5L 1YHBA 1I94L 1Q46A 4LF8L 1UE7A 2JA9A 2K14A 3VR5A 1SROA 1PYSB 2CTJA 4KHPQ 2VQEL 4OWWB 4LF6Q 1N36L 3UE1A 4A3GG 2A6HD 1E2VA 2A1AA 4QL5A 3I4NH 4A3DH 3J81c 2NVXH 4JI4L 5K36G 1OXUA 1Q7YC 1Q82C 4OWTB 5C3EG 1EWIA 2NVYH 3HKSA 2ZJRA 1L1OA 1OXXK 1SE8A 3FKIG 4DV7L 2DN8A 1ASYA 3RLOA 3OW2A 4BY7H 4EQ5A 4DV1Q 4A3KG 3KDFB 1WCMG 4OXPA 1W2BA 1HQMC 3K7UC 4JV5L 2MO0A 1XJVA 4JVYA 1KHIA 4HR7B 1CSPA 4IPDA 1J5EQ 3I7FA 2CCZA 2K52A 3F1ZA 2UXCL 4YWKA 1YBYA 2ZM6Q 3K8AA 2CFMA 1CFMA 1VQ5A 2VW9A 1UWVA 1XNQQ 2N78A 2BDOA 3TEHB 2E5LQ 2N8NA 1JMCA 1T9HA 2HT1A 2AWOA 1N36Q 1ONLA 4HIMA 4C3HH 4H13C 5JEAH 4NPSA 4X64Q 4A3IH 4H0LC 2OTJA 2B3GA 2LXKA 5BN5A 4GKKL 4JI6L 1P8LA 3AEVA 3ULJA 4A3LH 2R7ZG 4JI2Q 1GUOA 4DK3C 3JAMi 3D0FA 1I6VC 1JT8A 1Y8OB 1QVCA 1K8GA 4KMUC 2DNCA 1EQRA 5HGQA 1IL2A 1V1QA 5C4XG 5EAYA 1LACA 1GHKA 4AQYQ 2VQFQ 5FLMG 3OPOA 4KKSA 2PPBC 2PMZE 3WDNA 3RNUA 4AH6A 2PQAB 3W1BA 1BBWA 4X66L 5C0XI 1GD7A 3VR6A 4EX5A 2KCCA 2HQLA 2OQKA 4YY3L 1BDOA 5C44H 4DR1Q 4X6AH 5IYDG 4GKJL 4OONA 1X4NA 1B8AA 3UDXA 3G6EA 1FL0A 3U50C 2ZT9C 2ANNA 1VQCA 5BN3A 3AFQA 2A68C 1N33Q 3HOWG 1O78A 4DV5L 1DTJA 2VL6A 1C7YA 4HIKA 1DXMA 2UUAL 3NE5B 2PCFB 1IZ6A 2ZTDA 2N3SA 4DV6L 3T1HL 1QUQB 1JJ2A 3A5UA 4JYAQ 4UPAA 2OTLA 2I5HA 3I4NG 1Q90A 4IOCA 4A3DG 4A3CH 1B7YB 2P2RA 2AUKA 3TRZA 3JC66 1X65A 2F4VL 3NELA 4GOPB 1Q1BA 5LMNW 4A75A 2EJMA 1VIGA 1LYLA 4JI1Q 5IT9c 1FJGL 4BY7G 3CC2A 1CUKA 2B63H 5M3MH 3T56B 1VQAA 3MXNB 3QIAA 4DV5Q 2MNAA 2YTXA 3A0JA 3STBC 1SMYC 4GN5A 4R4TA 4G7OC 3LWUA 1HPCA 1XMQL 5M3FH 1QZGA 3H3VI 1PVOA 4KHZA 4L8JA 4G7HC 4HJ5A 1YITA 3A5ZB 2DNEA 1SMXA 3T1HQ 2F52A 3ND9A 1TKWB 4GOPC 3I55A 4TKOB 4LK1C 3A74A 1HZBA 2AXYA 4A3BH 1TWHH 5H1SE 3RZDH 2K5VA 3CCJA 2Q8IB 5JEAG 1H9RA 3S1QH 1VQPA 4GS3A 4A3IG 2ZJQA 3S14H 1FYCA 4JC0A 3L2PA 2NZOA 4IPCA 2YYZA 4MZ9A 3BU2A 1VQHA 4DR7Q 3OOCA 2CTFA 3CPWA 1HR0L 4LJZC 1X3FA 4LFAQ 1BVSA 4A3LG 4LF4L 1M90C 2HH3A 3RZOH 1WVNA 1I50H 3H3VH 1YJNA 1X9NA 3S15H 4PG3A 3H94A 3P20A 4DR2L 2K33A 1I3QH 3GQBA 4YHHL 3A7LA 1TWCH 1MIUA 4IPGA 4RCNA 2UXBL 4YWLA 3S1MH 2ANRA 2D2CC 1G6PA 4B3SL 3L0OA 1PMRA 1A63A 4BBRH 1H9SA 2Q2HA 4DV4L 4DV3L 3GTJH 1UE1A 4B3ML 3RN2A 3U1KA 3E0EA 2CTMA 4LF7L 1HR0Q 1VQ4A 1WI5A 1VDZA 3W5OA 2PNHA 3W3AA 2PQUA 2WFWA 4LF4Q 3M4YA 1Y1VG 2JE6I 3I73A 1X56A 1Y1WH 1HNWL 4DUYL 1L1OB 5C0XG 1HNXL 3PV0A 1MKHA 2JQOA 3TREA 4UP8A 3U4VA 3BDOA 3KLRA 1VQLA 1NTGA 2K5NA 3RR5A 2E2JH 3U9SA 1BBUA 4A3FH 5LMNQ 2BA0A 2BH2A 2MQHA 4H44C 4KKTA 2QGQA 4B3TL 4KHPL 4QY7A 4YCWA 4OO1I 2A8VA 1AE3A 3T51B 4LF6L 1YZ6A 3PIPA 4LNQA 3S24A 4GNXA 1RL2A 2KA7A 4LF9Q 2B63G 3M7NA 5M3MG 1NBWA 1GM5A 1L1OC 3M3YH 4QMFB 3HOXH 4LFCQ 1ZZIA 4QGUA 2AWNA 3N6RA 1VQ9A 1IYUA 3CW2C 3HKZG 4AYBE 3FPPA 1IBLQ 4P71A 3KLWA 1SFOH 5M3FG 3STBD 3CP0A 4DV1L 1GUGA 3ULPA 1XTDA 2OPVA 2Y0SE 4I7ZC 1DCZA 1VQ8A 4NXMQ 3ERSX 2BH8A 3GTLH 3M85A 3AEVB 1Z47A 3CC7A 1VQEA 1Z9FA 4A3BG 1XMOL 2XGTA 4OO1H 2ZTCA 4AYBG 2ZM6L 3J7ZC 2EVBA 2A19A 1A0IA 1XNQL 3SDZA 5BN4A 4B3TQ 3PO2H 2V1CC 2Y0SG 2E5LL 3DM3A 2AUJD 3QJYA 5JEAJ 1A62A 2CWPA 2UU9Q 5IYBH 1DD2A 4X64L 1K3RA 3ZJYC 4R4IA 2YU9H 1CKOA 4NBQA 4BY1H 5FJ8H 3VDYA 3SGIA 4GLXA 3PUYA 3E9IA 4FDBA 1VQBA 1OXTA 1EYGA 4JI2L 2UXDQ 2CKZB 3PIOA 2E8GA 3KYHC 4POFA 3PSIA 1B70B 3CRKC 1KRTA 4IFDH 4C3IH 3D31A 2RF4A 4OX9Q 5IYCH 4GLAC 1XMOQ 4WJ4A 3KOJA 4AQYL 1E3PA 1O7LA 4BBRG 2VQFL 1VQKA 4JCVE 1VQ6A 1KXLA 1X55A 2F1MA 5FLXc 3TQYA 5M5WH 4DR1L 1PH5A 1AH9A 1NMFA 1E1OA 1VQ7A 2WAQE 2EDGA 1VIHA 1JJGA 2IHFA 2NN6I 2EIFA 1EIYB 1I5FA 2JK8A 3K7AH 1N33L 2NVQH 4HIOA 1ZKOA 5KNCA 1K8MA 4UP9A 1Y1WG 3G71A 3WWVA 3J81j 3KF6A 1K9MC 3NBHB 2E74C 2WAQG 3LNNA 3CCVA 5C0XJ 3ER0A 2O5JC 3W1GA 1QVFA 4JBKA 3I4MH 2E2HH 3F2BA 5IE8A 5A35A 4GN3B 3KJOA 3KJPA 4JYAL 1Z7TA 1Y69U 3K81C 1E1TA 2ATWA 2L15A 4O2DA 3CCMA 2NN6H 2CWAA 4C2MH 2JA6G 2JJQA 3I4OA 3HOXG 2K50A 1VF5C 1VCIA 1AE2A 1X3EA 3UE0A 4A3MH 4DUZQ 1HNZQ 3CC4A 4JI1L 3MEFA 2EQSA 4DNTB 3CCQA 2AHOB 1TUAA 2XTIA 2MO1A 1B9MA 1PHJA 2A6EC 2UUCQ 3GTKH 1YNXA 2HH2A 2CTLA 2E3UA
chains in the Genus database with same CATH superfamily
1STYA 2Z6BA 4QIWE 3J80i 1F9SA 3CRLC 1G291 2N88A 1HZAA 3UDFA 1IBKQ 4R9WA 4BWGB 1WFQA 2BL5A 3ULLA 1VQMA 4OO1G 2F0WA 1PH9A 5IGBA 5K5PA 2O5IC 4QQBX 3Q8DA 3GABA 1HHVA 2O2LD 4U673 2YTYA 4R4CA 5FOBB 1OXVA 4DV2Q 3MWYW 1PFMA 4MN3A 2GA4B 4RMFA 2HD3A 3J7A5 4BXXH 3WOEA 3I0PA 3PO2G 1R9TH 3M4OB 4RH6A 1KL9A 2JXMB 2DJFC 5EPLA 4C3IB 2C9OA 1S5BD 1CZWA 1Z6HA 1KDAA 1GUTA 1ASZA 2BE5C 2MPMA 3B6YA 2X06A 3UOEA 2ENBA 1ENCA 4GKKH 4E9JA 4JI6H 1ENAA 5T1IA 5IYBG 1HTPA 4KN4C 1S20A 3D6CA 4K0KQ 2KCTA 4A76A 1U4MA 1EZ8A 1QJOA 3DEOA 3MXGA 1I6HH 3FRPB 4JI8Q 5C5MA 2BA1A 4IUTA 4BY1G 5TSSA 1ILQA 5FJ8G 3DWAA 1J9OA 2ID0A 1KTKA 1X6OA 4DR7L 1EY9A 3I72A 3J7YW 5M5WB 1C8CA 4LFAL 2Q2UA 1H9SB 4G4KA 4K6DA 1FKAH 1S3OA 4POGA 3BJUA 1DM0B 3SK8A 1C48A 2JYOA 4O0AA 3CF5A 3O13A 1EWHA 2F0JA 5I2YA 2KBNA 4JI8H 3KLSA 3S16H 2F0MA 3F2CA 4LIJA 2KEEA 2WB1E 3DWPA 2NWGA 4IFDG 2Q2TA 3HOYB 1I4PA 4J8QA 2ES2A 1UE6A 3DHQA 4X66H 1H95A 5IYCG 4C3JH 1ZZKA 4DK0A 2K1HA 1U0LA 3IKJA 1GUSA 3FPUB 5GADC 4YY3H 5CYUA 4JI3L 1XX8A 3G48A 3VR4A 4ZKBB 1YNNC 4GKJH 1OTCA 4XXEA 4IPHA 3SEBA 4JI5Q 5E4XA 4B3RQ 2VXWA 5LMUQ 2E76C 3PGZA 5IT9W 3V69A 3CCEA 3X3NA 1SE2A 5ISRA 3S1RB 1YJ9A 1KD1C 3QO2A 3ERQA 2WB1G 2E2HB 4JBMA 4Y52H 5GROA 3J81i 4RCOA 3F2UA 5E1FA 2ZXOA 2JA8B 3DEPA 4L5QA 4X62Q 4E6IA 3PUWA 2B2TC 1IBMQ 1F2LA 1YHAA 4CJ1B 2DUDA 1IYVA 1C9OA 4H7BA 2IX1A 3GTQB 1CKNA 5IODA 2XWBB 1EY8A 2XIWA 3E9HA 4DAYA 3S2HH 1MSHA 4FYDA 4IUQA 2UUAH 4C2MB 2X69A 2H4OA 4FF3A 1SRUA 2K6AA 4QB4A 1D1KA 4ZRZA 1E24A 5CV4A 2E75C 5DNFA 1J5KA 4WANA 1PZJD 1BR9A 3IAYA 4GNXB 2R61A 4DV6H 2HCIA 1YHQA 1PFSA 2HHHQ 1Z2IA 2NZHA 5KGUA 1TWAB 4TQUS 3A54A 1N32H 2JA5B 3BYTB 3TP7A 5IY0A 2PI2A 3HOUH 3CCLA 3KDGA 1T5XD 3D8GA 2UUBH 1GUWA 3I4MG 3GTKB 1LTSD 3VYUA 1XPOA 1PRTD 5CR3A 3RLFA 3TSSA 4ZYSA 5I4DA 3ND8A 4JI3Q 2LSSA 1FNWA 4XQNA 4DV0Q 5KNBA 1V43A 1PYWD 2F4VH 1WOCA 3QG1A 4A3EH 2R93H 4O1NA 3ZYYX 4DR4Q 4S3SA 5BR8H 3ONAB 1HCZA 2NN6G 2EYPA 4RKLA 2EJFC 1ET9A 5LMNL 1SDFA 1TY2A 1E7ZA 2D5DA 5C44G 2C5CA 4XT1B 4GNXC 4KY5A 4PZ7A 1H9JA 1R9TB 1N34Q 3E5SA 5CV7A 4A4IA 2AMCB 3NEMA 4F88A 5IP9H 4A3MG 3JAMc 2DGRA 4NP5A 2D0PA 3FAUA 3KF8A 1VQGA 2R92H 2ICEC 1DZ1A 4LF9L 2RHQB 2B2TA 5M5XB 1XMQH 1TS4A 4Q0FA 5EBCA 5G3LD 4U68A 1LTGD 5DM73 1RODA 1VBIA 4LFCL 2SEBD 4DKAC 4NXNH 3OTOH 2O4XA 1LUZA 1GJXA 2A68D 3M4QA 2Z4HA 2HIVA 2Z6KA 4Z9CB 1IBLL 1KIXA 1S40A 2A6ED 5GAEC 3VR2A 2PZUA 4FVMA 3J7AF 1Y14B 2F0KA 3NTIA 5CGKA 1BF4A 2GVBA 2D62A 4PV1C 5NUCA 1WTQA 3NBIA 1PH4A 1B1ZA 2LF0A 1X0AA 1J4WA 5JJLA 1PH3A 2MJHA 1LT6D 1QWYA 3BVMA 4DNIA 4I7AA 2XN9C 4OGQC 4NXML 2EJGC 2WP8J 4KK7A 2N49A 1K28A 4JI7Q 3KLSX 5FK9C 1ZEQX 3BVGA 4JI0L 3S16B 1ZZJA 4BXXG 3KBXA 4UDUC 3H0GB 3K80C 1TWFH 3A56A 1C4QA 1CQFA 3DM1A 5KRUA 4IUPA 2M8WA 3GTOH 2GVAA 3GV6A 1Y8PB 1IW7C 1G6ZA 1E2WA 4PZ6A 2VZAA 4LFBH 4A3CG 2D0OA 2IX0A 5D14A 2CW0C 4IJHA 5COYA 4APVA 2C35B 4V190 1U4LA 1V8CA 3S1NB 2MFIA 1STNA 4L5RC 2BE5D 2KCMA 3S9WA 2RCNA 1ML0D 3AFPA 3R2IA 3PF5A 2R6GA 1JC7A 3PO3H 3TP6A 3EQLC 1L2FA 3CMEA 3GTGH 4QJFA 4BBSH 4DR2H 1CTMA 2UU9L 5IWAQ 2R7DA 4A3JB 2DGYA 2NZ1D 2VS1A 1HFGA 4YHHH 1M1KC 1OXSC 1KAWA 3UDGA 3A55A 2KENA 3K0XA 3P1HA 2UXBH 1EQTA 1WJJA 4P74A 2VUMH 5ELFA 3SE0A 1BUVT 1LABA 1O80A 4C3JG 4B3SH 3VR3A 4L5TA 4A93H 4KI0A 2B29A 2UXDL 4ZUIA 1PH7A 2RVLA 4X3TA 3M4PA 4LF5Q 4IFDJ 2HIXA 2F03A 4JI0Q 2QF7A 1MJCA 2FINB 4MHEA 4DV4H 2IJ0A 1KDBA 4IO9A 2ICIA 4H02A 1SNCA 2JA7H 1BNZA 2KVMA 2OQ0A 3HOZH 4DV3H 3E6ZX 1YNND 1JJCB 3OYYA 4A3GB 1H9KA 4LUVA 4GZYC 3BZKA 4HJAA 3KF6B 4OX9L 3K59A 3HOVH 2OWOA 4B3MH 2WKDA 1A3TA 1AEXA 1WTRA 3MXUA 3C46A 1RIPA 4PMWA 5FLXE 3H6MA 5C3EB 4JOIA 1Q86C 3L7ZC 3CD6A 2CHBD 3GTMH 4IFDI 1PH8A 1GO3E 4DR6L 4A3EB 2J0TD 2R93B 1UUPA 3NWSA 3CCSA 2WV6D 3PQIA 3SK6A 4ZK9B 3FKIB 4V0BA 1XNRQ 2B2YC 4P72A 1VQNA 2PT7G 4NB3A 3T1YQ 1C0AA 3PUXA 4J6HA 4DUYH 3D4RA 3D6WA 1E0BA 3GKUA 1N8RC 1HNXH 1MD2D 3IFTA 1TS2A 2OPUA 3HOUG 4DR3Q 4XYOA 1S4ZA 4RGOS 5I6WA 2R92B 2YV5A 2PO4A 2LRRA 2YTVA 4IURA 2CPQA 2K5HA 3Q22A 1F9QA 2Z1CA 4XTCS 1XPRA 1LTLA 2QA4A 2E2IH 1GKHA 1X3PA 1JORA 4Y7NH 2AQ2B 1B9NA 1TXYA 1TR5A 4UY8C 1MGSA 2CQOA 1KNEA 1PTOC 2B2UC 4C56C 1ZTGA 2IPKD 1HZ9A 2K75A 4IJLA 4ZAIA 4A3EG 1SYBA 1K73C 3C2PA 4J15A 2R93G 4LF6H 1GHJA 3M4OH 1W6JA 1NJIC 3CMAA 4K5VA 1FGUA 4G08A 1JICA 4PDBA 5JJKA 1F0XA 4P73A 3FVQA 2B8FA 2RDGA 2RHSB 4DK1A 1SN8A 4CDCC 4X65Q 1CI3M 3AU7A 2AKWB 1TWFB 2ALYB 3H15A 2R7FA 3I56A 1SYGA 5IP9G 2Q8RE 4XIGS 1ICWA 2EZVA 4DR6Q 5DLQE 2R92G 1UEBA 3J80L 4DN4M 1EY4A 3SK5A 3FMCA 2GN5A 2K04A 2L5TA 2XNAC 4DR5Q 1BQQT 2IT1A 4ZLTF 4G7ZC 2A69C 1KC8C 1I94Q 4LF8Q 3GP7A 4DV1H 3BG3A 2R7ZB 3K5NA 2Z0SA 4X3UA 1STGA 2IY5B 4I65A 3OWEB 3I90A 1DYQA 1X4MA 1RDPD 4DUZL 1HNZL 4KD4A 3GTGB 2F3IA 2B8GA 1J5EH 1O7YA 2PNRC 1NXUA 3HG9A 2VQEQ 5JPMC 2SOBA 4ALPA 3SB1A 4FJSA 3HOYH 1I94H 3E3XA 2UUCL 1E22A 4KLKA 2OCEA 2I5MX 1F2MA 5GAGC 3I3CA 3HP3A 3OWFA 4KN7C 2Q2IA 1L0XB 3G6JB 3NK9A 1XNQH 3G4SA 5FLXW 4JI4Q 1LTBD 3AQQA 3VA7A 1IBKL 1D8LA 1NSNS 2VNUD 1YVCA 1STHA 2E5LH 3AB9A 2FMRA 1PQXA 3MFYA 4ABNA 4A93B 1N36H 3K58A 2NYZD 4B8TA 5M5YB 2EXZA 1XRHA 4DV7Q 4A3FG 3S1RH 4ME3A 4DV2L 1XPUA 2RSOA 3LX0A 1SJHD 1VQIA 3TZUA 2K1BA 1B44D 4X64H 1IW7D 2YQRA 2JA8H 4FF4A 2CW0D 3PO3G 4JV5Q 3AYHB 2X6LA 1EFID 1D6EC 1SR3A 2CQAA 3GTQH 1PH2A 3K0YA 4BBSG 1G51A 2PMZB 1EY7A 4K5XA 1MBYA 5J39A 3HOWB 3MHBA 4DV7H 4K0KL 4YWMA 2CVRA 4R1JA 2FMMA 1CSQA 1Y8NB 2UXCQ 4JI2H 5EGTA 1HXYD 4WALA 4JI8L 2NVTB 2V4DA 2NUCA 1NMGA 4DAMA 2QKIC 1HJPA 1QVGA 5EKKA 5ELDA 3UDIA 5IT9E 1A3VA 4OHJA 4RG1A 1SSOA 1K0SA 2JEAI 4F7XA 4CJ0B 2VUMG 1TWAH 2L55A 1S5CD 3G7LA 2JA5H 1SBBB 2Y3MA 1A2TA 3EIVA 2JVZA 4A93G 5FO9B 3IL8A 1PYBA 3D4DA 1CKNB 4JVHA 2KQ3A 4DAYB 1AZQA 1EEID 3J81L 2VQFH 2Z8LA 1EFWA 1A6XA 4HJ8A 1B3QA 1RTOA 1E2ZA 5GAHC 1WYDA 1WHRA 3HOZG 2KHIA 2JA7G 2L0CA 3KDFA 4HCEA 3HOVG 3F8TA 2E2IB 2F0GA 1NR4A 3P7JA 4A3DB 2JZXA 3S2DH 5AFWA 2NVXB 4DR1H 4GKKQ 1EUJA 2Z4IA 4Y7NB 5GQOA 4JI6Q 4PNYA 2LXJA 1EC6A 1UEAB 3FHWA 4JI5L 4B3RL 5LMUL 3CPFA 5A2QE 3E0JA 3MA2B 3EBEA 1Y1VH 1GUNA 2KHJA 1HR0W 2CTKA 2FXQA 3AMUA 1X3GA 1FVIA 1U5KA 3LWEA 2K32A 2PI2E 1PH1A 4CKEA 3HEJA 4R8IA 4JBJA 5M5XH 4X62L 1SYCA 1IBML 1SYEA 5C0XH 1K0RA 2LFNA 3TS2A 3PIO3 1T5EA 2FFKB 3PMFA 2D9UA 1B3AA 1JB7A 1N32L 4P75A 5JJZA 2ASBA 1ZYRC 1I4GA 1DGSA 2CPMA 4LWCA 1VS0A 4WJ3M 2UUBL 1ZXTA 4AM3A 1CA5A 2EXDA 3PF4A 5J3BA 1KNAA 5ELOA 4X66Q 2RQXA 3HGBA 4CHTB 4HIDA 2G9DA 1YNJC 3KF8B 5IP7H 4YY3Q 1D5ZC 2HHHL 4NMZA 1KHMA 4GLVB 3RUZA 1EOVA 4GKJQ 2PY9A 3TZDA 4LUZA 4JYAH 3MTSA 1NAPA 3EN2A 3H0GH 2QILA 5BR8L 2HDLA 1XTCD 4C3IG 5D3IB 4DK6C 1PTOD 4JPBW 2ZTEA 2I0QA 1V9PA 1Q12A 3KDKA 1K8AC 5JVH3 1NE3A 1AN8A 1PV4A 1EYDA 5EPKA 4C3HB 3U4ZA 1RF2D 1S72A 2QEJC 2IWHA 1HZCA 3DMUA 3GO5A 1QNUA 3RLNA 3D4WA 3UI2A 4DV0L 3S1NH 3MEHA 3GTPH 5EKIA 2FMCA 3HZXA 1EU4A 1PFBA 5I2XA 4HJ9A 1LV9A 3KK7A 4JBWA 4DR4L 1TWGH 1K8OA 2Z9HA 1CKMA 4JI1H 2UUAQ 1AN7A 1QG7A 2FPHX 3GD7A 3I2ZA 1X32A 2M00A 1BCPB 4LUOA 2F0UA 5DEHA 1HTLD 3M9BA 4NXNL 4JK1C 3OTOL 4A3JH 3JAME 1CM9A 2EYLA 3P75A 2LTMA 1N34L 1B4OA 4DV5H 2PQAA 5C4JH 3HFZB 1RHPA 4MTKA 4DV6Q 1EIFA 5C3XA 2FFMA 5J1ZA 1D7QA 1VQFA 2A69D 4KJOA 2K4KA 5C5LA 1Q1EA 1N32Q 1IYJB 2A73B 4CKCA 1VQJA 1YEZA 1O7IA 1JOQA 3PUZA 3HOYG 2Z6KC 1DT4A 2UUBQ 1L0YB 2H5XA 3BZCA 1MJEA 3T53B 1JE5A 4OELB 1BKBA 3DUZA 2HCCA 1J6QA 2QCPX 2QEXA 4CDFC 3T1HH 1SYDA 2TMPA 5CMDA 4EQPA 2A6HC 4EQOA 4MTNA 4O42A 3K5OA 5A2QW 1WTJA 3KUPA 1TS3A 4K6LA 4AIMA 2F4VQ 2CTEA 5CV5A 4LFBL 3RD4A 5BR8Q 3DWQA 1BCPC 2TSSA 2CH4A 1IKLA 1FJGQ 4A3GH 4JI7L 1ENFA 2ZXRA 3U58A 3SVMA 5HY6A 2JA8G 5JJIA 3V2TA 3RN5A 1PH6A 3CCRA 3DLLA 2LMCB 5K36H 2OXPA 5AJ3L 1KDCA 5C3EH 3T16A 5LL6S 1PTOH 3CAMA 4DR7H 2MHVA 4BA1I 3S2DB 4L5SA 1N9WA 3FKIH 2AQ3B 1QUQA 1Q8IA 4DPGA 1SEIA 1FJGH 4NKLA 4QUFA 1XMQQ 1RCVD 4RHSA 4YCUA 3CXCA 2EOTA 3ITPA 4A3KH 4NXNQ 3OTOQ 1WCMH 4FJUA 3A8JE 4LW1A 1Y1VB 2F0FA 1QZHA 1GVPA 4HJ7A 5FO7B 3TBIB 3F2DA 2JA5G 1EY0A 5IWAL 1YI2A 5EQ0A 4UP7A 4KV6A 2DY7A 2JEBI 5D3DA 4B9WA 1VQDA 1P16A 1EY6A 4GOPA 2QNDA 1WE8A 1UE5A 5CORA 1G2TA 4BA2I 1A3UA 4PZ8A 5JAVA 1H9MA 4HMIA 1X54A 3MXNA 2HQEA 3CCUA 1K3BC 4CDEC 1QCBD 4QCLA 2RDHA 5IT9L 2IHEA 3TP5A 1NY4A 4LFBQ 4DNRB 4YIJA 3URYA 1K1GA 5ELNA 4LF5L 2WINB 3JAMW 5HURA 2I5LX 3EVQA 3SXHA 1LM0A 3S17H 3VYSA 1G2SA 2K7VA 4OD6A 3A8KE 5AJ3Q 3TS0A 3D3RA 1U9RA 4RGNA 4GN4B 4JOIC 4RGTA 2B63B 5M3MB 4IOAA 4DR2Q 2L11A 1HR0H 1Q8KA 3VKEA 3ICEA 3FP9A 5KYIA 3LGJA 3GTPB 4YHHQ 1B50A 4R4QA 4EGVA 2R7ZH 4LF4H 4KHVA 3DXJC 2IX3A 3HKZB 1EOTA 4KKUA 1TWGB 4IALA 2MJ8A 1IKMA 1XNRL 2B39A 3J80c 3CQZH 3IRBA 2F0IA 2UXBQ 2O4CA 3T1YL 4MNOA 4B3SQ 5C4XH 5IP7G 1ZYRD 1LT3D 2H1EA 3HKZE 5C4JB 4WRDA 1LTID 1TT2A 1L0WA 1EIHA 2KUMA 5JPNC 4CGYB 1VF7A 4DR3L 1KABA 1EQQA 3I4LA 4TVAB 5FLMH 1O7ZA 5I6YA 3H0GG 1YNJD 1KQSA 1PRTF 1IXRA 4DV4Q 4FF1A 4KY6A 2VY3A 1KRSA 4A3BB 4DV3Q 1TWHB 1PZID 4AYBB 4P2CB 1NNXA 4KD3A 2KECA 4DXFA 1HH2P 2JA6H 1YJWA 3S1QB 1W3SA 5LMNH 4B3MQ 4K2KA 5M5YH 1QOHA 1I4QA 2EYMA 1XXGA 3OW7A 4LF7Q 5IYDH 2M6QA 5KNDA 4YCVA 3J80W 1A8VA 3NWTA 2Y0SB 1R4PB 3OMGA 1Q81C 4IQZA 3MXPA 4JG2A 5E7NA 4PQXA 1GOZA 4PMCA 3GDEA 3A8IE 2ZXPA 1QE6A 1TU2B 1PA6A 3PUVA 2ZJPA 1YIJA 2DJGC 1B53A 1WTOA 4LF9H 3KFUA 3EFXD 4K14A 5EKLA 4X65L 4FP5D 4A3JG 3HOWH 1V9NA 4LFCH 4LF7H 3OIPA 1I50B 1SLJA 1HNWQ 4OWXB 4DUYQ 1K83H 1FR3A 3V05A 1PTOB 2NVTH 3IFDA 5G3LF 3S15B 3A7AB 3PCOB 1HNXQ 1V8QA 5EPJA 1J5EL 1IBLH 2EYJA 3NENA 5IGEA 1VQOA 4R4OA 4DR5L 1YHBA 5JVG3 1D5MC 1I94L 1Q46A 4LF8L 4CKBA 3OSSD 1I6UA 1BO0A 1UE7A 2JA9A 4JW0A 1DOKA 1JWSD 3K57A 1LT5D 3H09A 4A3KB 2K14A 1WCMB 4NXMH 1TIID 2A1SA 1HNWH 4XQJA 3VR5A 1SROA 1PYSB 1XWEA 2CTJA 4KHPQ 4DGZA 2VQEL 4HMJA 4OWWB 4LF6Q 1N36L 1CK1A 1SNOA 3UE1A 1UAPA 3W2DA 4OCHA 2G5DA 4A3GG 2A6HD 1W6KA 1E2VA 2A1AA 4QL5A 3I4NH 4A3DH 4ZQ3A 3J81c 2NVXH 3H3VC 3CHBD 4JI4L 5K36G 1BCPD 1OXUA 1Q7YC 5LHY1 1Q82C 5C4HA 4OWTB 5C3EG 1EWIA 1F2ZA 4OEMB 4B3TH 4KHPH 2NVYH 3HKSA 4XT3B 2F0TA 2ZJRA 1L1OA 1V1OA 1OXXK 2OT2A 1SE8A 2B2VA 2EY5A 3FKIG 4UAIA 3MFGA 4DV7L 2DN8A 1ASYA 2JN4A 3RLOA 2UU9H 3OW2A 4BY7H 1EU3A 1KLGD 5DT9A 4EQ5A 4FNFA 4DV1Q 4A3KG 1EY5A 3KDFB 1WCMG 3MZ5A 5E4WC 5LL6X 4OXPA 1W2BA 3S17B 1HQMC 3K7UC 4JV5L 2MO0A 4DFAA 1DJRD 1HA6A 1XJVA 1G8ZD 4JVYA 1KHIA 1CSPA 1SNQA 4HR7B 4IPDA 1J5EQ 3I7FA 2CCZA 1WTXA 3J81W 2K52A 4NW2A 1EQVA 3F1ZA 2UXCL 4FO2A 4YWKA 1YBYA 2UXDH 2ZM6Q 5EJWA 3K8AA 1JCKB 2CFMA 1CFMA 1VQ5A 2VW9A 1UWVA 3OIQA 3R2TA 1XNQQ 2N78A 2WAQB 4F8MA 3CQZB 4PMBA 2BDOA 3TEHB 2E5LQ 1MSGA 2N8NA 3V96A 1JMCA 1T9HA 2HT1A 1SEBD 2AWOA 2XRSD 5C4XB 2F0PA 1CHQD 4OX9H 1N36Q 1F77A 1ONLA 1XMOH 1JQYD 2ZM6H 3NUCA 4HIMA 4C3HH 4H13C 5JEAH 2NTTA 4NPSA 4IUUA 4X64Q 3NCVA 4A3IH 4H0LC 2OTJA 2B3GA 2KJXA 5KIXA 3NQIA 2MGSA 3NP8A 1J8IA 1WTHA 4XDXA 3TDQA 2LXKA 2JA6B 5BN5A 4GKKL 2WKCA 1V1PA 4JI6L 5C6AA 1BBXC 5T1GA 1P8LA 1S5FD 3AEVA 4QUCA 3HOXB 3ULJA 4A3LH 4ZCKA 2R7ZG 1LTAD 4JI2Q 4H8AA 5M9OA 4R8NA 1GUOA 2PZTA 4RGMA 4DK3C 1HUMA 3JAMi 3D0FA 4HSVA 4MIUA 1I6VC 2NB0A 1KAAA 1D2BA 1JT8A 1Y8OB 2IW3A 1QVCA 5CBEE 1SFOB 1K8GA 1CT1D 1I4XA 4KMUC 2DNCA 2F0SA 1EQRA 5HGQA 4FXGC 1IL2A 5IGFA 1V1QA 5J22A 1JR0D 5C4XG 5EAYA 4XYQA 1AW7A 3GR5A 1LACA 5KYLA 1K83B 1GHKA 4TRDA 1VMPA 4AQYQ 2VQFQ 5FLMG 3OPOA 1SYFA 1LTRD 4KKSA 2PPBC 2PMZE 3WDNA 3RNUA 4AH6A 3NXWA 5DAUA 4G57A 4WORA 2Q8TA 2PQAB 3W1BA 1BBWA 4X66L 5C0XI 1GD7A 3VR6A 5ELBA 4EX5A 2HQLA 2KCCA 2OQKA 4YY3L 1BDOA 5C44H 4DR1Q 4X6AH 4N8X1 5IYDG 4GKJL 4HN7A 4AQYH 1JWUD 4OONA 5KEEA 1X4NA 1B8AA 3PO2B 3OHXC 1ILPA 5CC4A 3UDXA 3G6EA 1FL0A 3U50C 2ZT9C 2LTLA 2ANNA 1VQCA 4RA8A 4HAEA 5BN3A 3AFQA 3Q0AA 2QDBA 2A68C 2I07B 3I4NB 2XRQD 1N33Q 1G91A 4F87A 3HOWG 1O78A 4DV5L 2YU9B 5LL6b 2IL8A 5C4ZA 3SHLA 2EY6A 4JVZA 4BY1B 2VL6A 1DTJA 1LLRD 2NVYB 1SJED 4DUZH 1II3A 1HNZH 1C7YA 4HIKA 2F4IA 1DXMA 2UUAL 2RDFA 1IHZA 4ZUJA 3NE5B 5IOCA 2PCFB 4BY7B 1IZ6A 2K5DA 1PFNA 3M7GA 2ZTDA 1N33H 2K5WA 2UUCH 2N3SA 3BYYB 3EA6A 2L4NA 4CDDC 4DV6L 3T1HL 5C3WA 1QUQB 1SE4A 1JJ2A 2WIIB 2LY7A 3A5UA 3I91A 1IBKH 4JYAQ 4UPAA 5CV8A 5FLXL 2OTLA 2I5HA 1WVLA 3K5LA 1HQRD 3Q24A 4M8AA 3I4NG 1Q90A 1RTNA 4IOCA 4A3DG 4A3CH 1B7YB 2P2RA 2AUKA 2A74C 2KOLA 2F0EA 4DV2H 1D5XC 3TRZA 3JC66 4ODGA 4ILWA 4N8FA 3QR8A 4C1NK 2EY1A 3N52A 1UG8A 1X65A 1VMCA 2F4VL 3NELA 4GOPB 1Q1BA 5LMNW 4RFBA 1F2YA 4A75A 2EJMA 1VIGA 1LYLA 4JI1Q 1A2UA 5IT9c 1FJGL 4UHVA 2WB1B 4HSPA 4BY7G 3NBHA 3MC0B 2MP1A 3CC2A 1CUKA 4K0KH 2F0HA 2B63H 5M3MH 1VQAA 3MXNB 3T56B 1ET6A 1JOKA 4A3IB 3QIAA 4DV5Q 2QW7A 2MNAA 1FNVA 1LT4D 2YTXA 3A0JA 3STBC 1SMYC 4GN5A 4LMQD 4R4TA 3K7AB 1LO5D 3OSOA 4G7OC 2HDMA 4K8IA 2NVQB 3LWUA 4KTAA 1X3QA 1HPCA 1UNSA 1XMQL 5M3FH 1QZGA 4ZKCB 1S5DD 4DXGA 1TQOA 3H3VI 1PVOA 4KHZA 1X9ZA 4L8JA 2AQ1B 4HJ5A 4G7HC 1YITA 3A5ZB 4B08A 1PZKD 2DNEA 5IGCA 1SMXA 3T1HQ 3L3OC 2F52A 3ND9A 3RMHA 1TKWB 1I4HA 4GOPC 3I55A 4TKOB 3GV3A 4LK1C 3A74A 1HZBA 2AXYA 3I4MB 5DM63 4A3BH 5HGTA 2VB2X 1TWHH 3X3MA 5H1SE 3RZDH 2K5VA 2RKSA 3CCJA 2Q8IB 4C3HG 5JEAG 1H9RA 3S1QH 1VQPA 4GS3A 3Q23A 4A3IG 4JI5H 4B3RH 2ZJQA 1AZPA 3S14H 1FYCA 3HRZC 5LMUH 4JC0A 4L6TB 3L2PA 2NZOA 4IPCA 1WD1A 2YYZA 4MZ9A 3BU2A 1VQHA 3J7AV 4DR7Q 3OOCA 2CTFA 2K01A 3WOFA 3CPWA 1IL8A 1HR0L 5C44B 4LJZC 1X3FA 4LFAQ 1EIGA 1BVSA 2B2WC 4A3LG 4IUNA 4X62H 1HFNA 1IBMH 4LF4L 2CH4W 1M90C 2HH3A 4A3MB 3C1EA 4KJNA 3QOLA 4DAVA 2WACA 3RZOH 1WVNA 1I50H 3H3VH 1F9PA 1YJNA 2SNMA 1SXTA 1X9NA 3S15H 4PG3A 2ZQEA 3H94A 1OO9B 1CQVA 3P20A 2PQEA 4DR2L 2K33A 1I3QH 2EE1A 3FDTA 3GQBA 2K5QA 4LFAH 3R3OA 4YHHL 3A7LA 1TWCH 4OL7A 1MIUA 3J80E 2HHHH 4IPGA 4FXDA 4RCNA 3NQTA 1NCVA 2UXBL 4YWLA 1TS5A 2F0QA 3S1MH 1STBA 2ANRA 2D2CC 1WTPA 1G6PA 2KCNA 1HRJA 4B3SL 2RA4A 4ID6A 1ESFA 1GXDC 3L0OA 1FD7D 2BCOA 3EJIA 1PMRA 3TP8A 1A63A 1PTOF 4BBRH 4JI3H 1EYAA 4DV0H 1H9SA 2Q2HA 2KHSA 3NPPA 4DV4L 2G8YA 3L9AX 3K6OA 4CBVA 4DV3L 1WTVA 3GTJH 3BS1A 4DR4H 4IUVA 3CKIB 1UE1A 1R4QB 4EQNA 4B3ML 5FKAC 3RN2A 3U1KA 3E0EA 2CTMA 2M9VA 1HR0Q 4LF7L 1VQ4A 1I6HB 1WI5A 1N34H 1VDZA 3W5OA 2PNHA 3W3AA 2PQUA 2WFWA 4LF4Q 3HS0C 1EYCA 1Y1VG 3M4YA 2A5HA 2F3VA 2K03A 2JE6I 2B2WA 2EYHA 3KBGA 3I73A 2VB3X 1XYIA 2RBMA 3T4AC 1SAPA 4M1UB 4K5WA 2CWHA 1QB5D 1X56A 2MUYA 2JP1A 2F0LA 3MVVA 2VKCA 1CHPD 5IGDA 2XWJB 2HUGA 2E2DC 1CZGA 4BS9A 1Y1WH 5FO8B 1HNWL 4OIJA 4DUYL 1L1OB 4K2LA 4C1NI 5C0XG 2XVSA 3C3LA 2RSNA 3NTKA 2BDNA 1HNXL 2KEDA 3VYRA 2JQOA 1MKHA 3NSWA 2M2LA 3PV0A 4UP8A 3TREA 2F0DA 3U4VA 4N9PA 1DONA 3BDOA 3KLRA 4QF4A 1VQLA 1PLFA 5M3FB 4C3JB 1NTGA 2K5NA 5A2QL 3RR5A 2E2JH 3U9SA 1MHWC 1BBUA 4A3FH 4JI7H 5LMNQ 2BA0A 1SNMA 2PW7A 2BH2A 2MQHA 4H44C 2QGQA 4KKTA 4B3TL 4RKBA 4KHPL 4TSSA 4QY7A 4YCWA 4OO1I 2A8VA 2F0VA 1AE3A 1D1IA 3I70A 5CV6A 4RHRA 3T51B 4LF6L 1YZ6A 3PIPA 3VA5A 1S03G 4LNQA 3S24A 4GNXA 4B8CD 4EC5A 3J81E 1M4VA 1RL2A 2L9HA 3RZDB 2KA7A 4LF9Q 3NHHA 2B63G 1S5ED 5IGGA 5M3MG 3M7NA 1NBWA 1GM5A 1L1OC 3M3YH 4QMFB 2B2VC 3S14B 3HOXH 4LFCQ 1ZZIA 2XSCA 4QGUA 2AWNA 3N6RA 3BVZA 2QDLA 1VQ9A 1IYUA 2LS01 3CW2C 3QOJA 3S2HB 3HKZG 4AYBE 3OETA 2J4XA 3FPPA 1IBLQ 3Q6SA 4P71A 1FGBD 3KLWA 4KY7A 1SFOH 5M3FG 5IWAH 2DY8A 3STBD 1SMYD 3EZJA 3EROA 3CP0A 3SK4A 4DV1L 1GUGA 1BOSA 1Q3LA 3ULPA 1XTDA 2OPVA 2Y0SE 4I7ZC 1DCZA 1VQ8A 3RZOB 4NXMQ 1A15A 1PXUA 2G9HD 3ERSX 2BH8A 1V1PB 4NZTM 3HOUB 1U4RA 3GTLH 3M85A 3AEVB 4EVOA 2D9IA 4X3SA 1Z47A 2FHTA 3CC7A 4N9TA 1VQEA 1Z9FA 3C1FA 3VYTA 1I3QB 4LAAA 5IIFA 1NUCA 4A3BG 1XMOL 2XGTA 4OO1H 2ZTCA 3BZDB 4RAUC 4AYBG 5F2DA 3TN2A 2ZM6L 3J7ZC 2EVBA 2A19A 1TWCB 1HUNA 4DA2A 4LF5H 1A0IA 1XNQL 2PYKA 3U9OA 5D65A 4JI0H 3SDZA 4QMGA 1KLUD 2J7ZA 1NR2A 5BN4A 3JAML 4B3TQ 2V1CC 1RD9D 3PO2H 3S1MB 2Y0SG 5ELCA 2E5LL 4HEDA 4CJ2C 3DM3A 2NBFA 2AUJD 3QJYA 1CA6A 5JEAJ 2F0NA 4IZ8A 1A62A 2CWPA 2UU9Q 2PW5A 4DAPA 5IYBH 4BBRB 1DD2A 4X64L 1EEFD 1K3RA 2L12A 3ZJYC 4R4IA 2YU9H 3H91A 4HCSA 4FXKC 1CKOA 4NBQA 3GTJB 4BY1H 5FJ8H 2X6GA 3VDYA 3NTHA 3SGIA 4GLXA 3MAQA 3PUYA 1XNRH 1STAA 3E9IA 4FDBA 3K5MA 4HTHA 5I9OA 3RF2A 2EYFA 1EL0A 3T1YH 1VQBA 1OXTA 2I46A 1EYGA 4L63B 4JI2L 5CBAE 3BDLA 2UXDQ 2CKZB 2PZWA 3KYHC 2E8GA 3PIOA 5E3FA 1U4PA 4POFA 2K05A 4DR3H 3PSIA 1B70B 2SDFA 3CRKC 1KRTA 5CV9A 4IFDH 4C3IH 1JE4A 3D31A 2RF4A 1Y1WB 2EPBA 5IYCH 4GLAC 1XMOQ 4OX9Q 1JWMD 3QB3A 4WJ4A 3KOJA 1AP0A 4AQYL 1E3PA 1SE3A 2K28A 1O7LA 4BBRG 2VQFL 1DOLA 1VQKA 4NZRM 1BXTA 4JCVE 4Q5VA 1ESRA 1VQ6A 1F9RA 3T13A 1KXLA 3GTOB 1X55A 2F1MA 1TY0A 5FLXc 1B2TA 1PRTB 4X3KA 2E2JB 3TQYA 3R8BA 2OF1A 4A3FB 5M5WH 4DR1L 2BOSA 1PH5A 1AH9A 1NMFA 4X65H 1E1OA 1VQ7A 2NTSA 2WAQE 5L37A 2EDGA 2FJ2A 1VIHA 3PO3B 1JJGA 2IHFA 2B2YA 2NN6I 4ULLA 2EIFA 4NDXA 2RCFA 1EIYB 4DR6H 1SNPA 4BBSB 1JOOA 1I5FA 2JK8A 3K7AH 1M8AA 1I4RA 4DR5H 1N33L 3R93A 2NVQH 1STEA 4HIOA 4LF8H 1ZKOA 2R3ZA 3I8ZA 4J1MA 4FF2A 5KNCA 1K8MA 4OIKA 4UP9A 1Y1WG 3M3YB 1QILA 3G71A 1QNKA 2LKVA 3WWVA 1JB3A 3J81j 3TMEA 1WD0A 3KF6A 1K9MC 3NBHB 2E74C 2VUMB 2VQEH 2WAQG 1MI2A 3LNNA 3PIP3 1PRTC 3CCVA 3J7AK 2CWFA 1EZ6A 1SNDA 5ELEA 5C0XJ 3ER0A 1LTTD 3W1GA 2O5JC 2B2UA 5JOBA 4JBKA 1QVFA 1PDQA 3SR1A 3I4MH 1EWCA 2F0OA 3QD7X 1HA5A 2E2HH 3F2BA 5IE8A 1ICFB 3GTLB 4ME5A 5A35A 4JI4H 2P5ZX 3FEWX 4GN3B 3KJOA 1RKNA 3BDCA 1Z7TA 4IN3A 3KJPA 1Y69U 3HOZB 4JYAL 2JA7B 3K81C 1E1TA 2L1BA 2ATWA 4WFN3 2L15A 4K8JA 1RJTA 4RWSC 3HOVB 4O2DA 1BCPF 3CCMA 2CWAA 2NN6H 3CU7A 4C2MH 2JA6G 1AFPA 2JJQA 2JSOA 3I4OA 4DU9A 3HOXG 3GTMB 2K50A 2SNSA 1VF5C 1VCIA 1AE2A 4JV5H 1X3EA 3UE0A 4A3MH 4DUZQ 5I9PA 1HNZQ 3CC4A 1DOMA 4JI1L 3MEFA 2EQSA 1MSZA 4B9XA 1WTWA 4QIWB 4XQQA 4DNTB 1FNUA 3CCQA 2AHOB 3OMCA 2F3WA 2N55A 2EY2A 1TUAA 2UXCH 2XTIA 2MO1A 1B9MA 3QWNA 1PHJA 2OEOA 2A6EC 2UUCQ 4WJWA 3GTKH 1ODHA 5EBDA 1YNXA 2EYOA 2HH2A 1TVXA 2CTLA 4DF7A 2E3UA
chains in the Genus database with same CATH topology
1STYA 4QIWE 3J80i 1F9SA 3CRLC 1G291 2N88A 1HZAA 3UDFA 1IBKQ 4R9WA 4BWGB 1WFQA 2BL5A 4OO1G 3ULLA 1VQMA 2F0WA 1PH9A 5IGBA 5K5PA 2O5IC 4QQBX 3Q8DA 1HHVA 2O2LD 4U673 2YTYA 5FOBB 4R4CA 1OXVA 4DV2Q 3MWYW 1PFMA 4MN3A 2GA4B 4RMFA 4BXXH 3J7A5 3WOEA 3PO2G 1R9TH 3M4OB 4RH6A 1KL9A 2JXMB 5EPLA 4C3IB 2C9OA 1S5BD 1CZWA 1Z6HA 1KDAA 1GUTA 1ASZA 2BE5C 2MPMA 3B6YA 2ENBA 1ENCA 1ENAA 5T1IA 5IYBG 1HTPA 4KN4C 3D6CA 4K0KQ 2KCTA 4A76A 1U4MA 1EZ8A 1QJOA 3DEOA 3MXGA 1I6HH 3FRPB 4JI8Q 5C5MA 2BA1A 4IUTA 4BY1G 5TSSA 1ILQA 5FJ8G 3DWAA 1J9OA 2ID0A 1KTKA 1X6OA 4DR7L 1EY9A 3I72A 3J7YW 5M5WB 1C8CA 4LFAL 2Q2UA 1H9SB 4G4KA 4K6DA 1S3OA 4POGA 3BJUA 1DM0B 3SK8A 1C48A 2JYOA 4O0AA 3CF5A 3O13A 1EWHA 2F0JA 5I2YA 2KBNA 3KLSA 3S16H 2F0MA 3F2CA 4LIJA 2KEEA 2WB1E 3DWPA 2NWGA 4IFDG 2Q2TA 3HOYB 1I4PA 4J8QA 2ES2A 1UE6A 3DHQA 1H95A 5IYCG 4C3JH 1ZZKA 4DK0A 1U0LA 3IKJA 1GUSA 3FPUB 5GADC 5CYUA 4JI3L 1XX8A 3VR4A 3G48A 4ZKBB 1YNNC 1OTCA 4XXEA 4IPHA 3SEBA 4JI5Q 5E4XA 4B3RQ 2VXWA 5LMUQ 2E76C 3PGZA 3V69A 3CCEA 3X3NA 1SE2A 5ISRA 3S1RB 1YJ9A 1KD1C 3QO2A 3ERQA 2WB1G 2E2HB 4JBMA 4Y52H 5GROA 3J81i 4RCOA 3F2UA 5E1FA 2ZXOA 2JA8B 3DEPA 4L5QA 4X62Q 4E6IA 3PUWA 2B2TC 1IBMQ 1F2LA 1YHAA 4CJ1B 1IYVA 2DUDA 4H7BA 1C9OA 2IX1A 3GTQB 1CKNA 5IODA 2XWBB 1EY8A 2XIWA 4DAYA 3E9HA 3S2HH 1MSHA 4FYDA 4IUQA 4C2MB 2X69A 2H4OA 4FF3A 2K6AA 4QB4A 1SRUA 1D1KA 4ZRZA 1E24A 5CV4A 2E75C 5DNFA 1J5KA 4WANA 1PZJD 1BR9A 3IAYA 4GNXB 2R61A 2HCIA 1YHQA 1PFSA 2HHHQ 2NZHA 5KGUA 1TWAB 4TQUS 3A54A 2JA5B 3BYTB 3TP7A 5IY0A 2PI2A 3HOUH 3CCLA 1T5XD 3D8GA 1GUWA 3I4MG 3GTKB 1LTSD 3VYUA 1XPOA 1PRTD 5CR3A 3RLFA 3TSSA 5I4DA 4ZYSA 3ND8A 4JI3Q 2LSSA 1FNWA 4XQNA 4DV0Q 5KNBA 1V43A 1PYWD 3QG1A 1WOCA 4A3EH 2R93H 4O1NA 3ZYYX 4DR4Q 4S3SA 3ONAB 1HCZA 2NN6G 2EYPA 4RKLA 2EJFC 1ET9A 5LMNL 1SDFA 1TY2A 2D5DA 1E7ZA 5C44G 2C5CA 4XT1B 4GNXC 4KY5A 4PZ7A 1H9JA 1R9TB 1N34Q 3E5SA 5CV7A 4A4IA 2AMCB 4F88A 3NEMA 5IP9H 4A3MG 3JAMc 2DGRA 4NP5A 2D0PA 3KF8A 1VQGA 2R92H 2ICEC 1DZ1A 4LF9L 2RHQB 2B2TA 5M5XB 1TS4A 4Q0FA 5EBCA 5G3LD 4U68A 1LTGD 5DM73 1RODA 4LFCL 2SEBD 4DKAC 2O4XA 1GJXA 1LUZA 2A68D 3M4QA 2Z4HA 2HIVA 4Z9CB 2Z6KA 1IBLL 1KIXA 1S40A 2A6ED 3J7AF 3VR2A 2PZUA 4FVMA 5GAEC 2F0KA 3NTIA 1Y14B 5CGKA 1BF4A 4PV1C 2D62A 5NUCA 1WTQA 2GVBA 3NBIA 1PH4A 1B1ZA 1J4WA 5JJLA 1PH3A 2MJHA 1LT6D 1QWYA 3BVMA 4DNIA 2XN9C 4OGQC 4NXML 2EJGC 2WP8J 4KK7A 2N49A 4JI7Q 3KLSX 5FK9C 1ZEQX 3BVGA 3S16B 4JI0L 1ZZJA 4BXXG 3KBXA 4UDUC 3H0GB 3K80C 1TWFH 3A56A 1C4QA 1CQFA 3DM1A 5KRUA 4IUPA 3GTOH 2GVAA 3GV6A 1Y8PB 1IW7C 1G6ZA 1E2WA 4PZ6A 2VZAA 4A3CG 5D14A 2IX0A 2D0OA 2CW0C 4IJHA 5COYA 4APVA 2C35B 4V190 1U4LA 3S1NB 2MFIA 1STNA 4L5RC 2BE5D 2KCMA 3S9WA 2RCNA 1ML0D 3R2IA 3AFPA 3PF5A 2R6GA 1JC7A 3PO3H 3TP6A 3EQLC 1L2FA 3CMEA 3GTGH 4QJFA 4BBSH 1CTMA 2UU9L 5IWAQ 4A3JB 2R7DA 2DGYA 2NZ1D 2VS1A 1HFGA 1M1KC 1OXSC 1KAWA 3UDGA 3A55A 2KENA 3K0XA 3P1HA 1EQTA 1WJJA 4P74A 2VUMH 5ELFA 3SE0A 1BUVT 1LABA 1O80A 4C3JG 3VR3A 4L5TA 4A93H 4KI0A 2B29A 2UXDL 4ZUIA 1PH7A 2RVLA 4X3TA 3M4PA 4LF5Q 4IFDJ 2HIXA 2F03A 4JI0Q 4MHEA 2QF7A 2FINB 1MJCA 2IJ0A 1KDBA 4IO9A 2ICIA 4H02A 1SNCA 2JA7H 1BNZA 2KVMA 2OQ0A 3HOZH 3E6ZX 1YNND 4A3GB 1JJCB 3OYYA 1H9KA 4LUVA 4GZYC 3BZKA 4HJAA 3KF6B 4OX9L 3K59A 3HOVH 2OWOA 2WKDA 1A3TA 1AEXA 1WTRA 3MXUA 3C46A 5FLXE 4PMWA 1RIPA 3H6MA 5C3EB 4JOIA 1Q86C 3L7ZC 4IFDI 2CHBD 3CD6A 3GTMH 1PH8A 1GO3E 4DR6L 4A3EB 2J0TD 2R93B 1UUPA 3NWSA 3CCSA 2WV6D 3SK6A 4ZK9B 3FKIB 4V0BA 1XNRQ 2B2YC 4P72A 1VQNA 4NB3A 3T1YQ 1C0AA 3PUXA 4J6HA 3D4RA 3D6WA 1E0BA 1N8RC 1MD2D 3IFTA 1TS2A 2OPUA 3HOUG 4DR3Q 5I6WA 4XYOA 1S4ZA 4RGOS 2R92B 2YV5A 2PO4A 4IURA 2YTVA 2CPQA 3Q22A 2K5HA 1F9QA 2Z1CA 4XTCS 1XPRA 1LTLA 2QA4A 2E2IH 1X3PA 1GKHA 1JORA 4Y7NH 2AQ2B 1B9NA 1TXYA 1TR5A 4UY8C 1MGSA 2CQOA 1KNEA 1PTOC 2B2UC 4C56C 1ZTGA 2IPKD 4ZAIA 1HZ9A 2K75A 4IJLA 3C2PA 1SYBA 4A3EG 1K73C 4J15A 2R93G 1GHJA 3M4OH 1W6JA 1NJIC 3CMAA 4K5VA 1FGUA 1JICA 5JJKA 4P73A 3FVQA 2B8FA 2RDGA 2RHSB 4DK1A 1SN8A 4X65Q 1CI3M 3AU7A 2AKWB 1TWFB 2ALYB 3H15A 2R7FA 3I56A 1SYGA 5IP9G 2Q8RE 4XIGS 1ICWA 2EZVA 4DR6Q 5DLQE 2R92G 1UEBA 3J80L 4DN4M 1EY4A 3SK5A 3FMCA 2GN5A 2K04A 2L5TA 2XNAC 4DR5Q 1BQQT 2IT1A 4ZLTF 4G7ZC 2A69C 1KC8C 1I94Q 4LF8Q 3GP7A 3BG3A 2R7ZB 3K5NA 2Z0SA 4X3UA 1STGA 2IY5B 4I65A 3OWEB 3I90A 1DYQA 1X4MA 1RDPD 4DUZL 1HNZL 4KD4A 3GTGB 2F3IA 2B8GA 1O7YA 2PNRC 3HG9A 2VQEQ 5JPMC 2SOBA 4ALPA 3HOYH 2UUCL 1E22A 4KLKA 2OCEA 2I5MX 1F2MA 5GAGC 3I3CA 3HP3A 3OWFA 4KN7C 2Q2IA 1L0XB 3G6JB 3NK9A 3G4SA 4JI4Q 1LTBD 3AQQA 3VA7A 1IBKL 1D8LA 1NSNS 2VNUD 1YVCA 1STHA 3AB9A 2FMRA 3MFYA 4ABNA 4A93B 3K58A 2NYZD 4B8TA 5M5YB 2EXZA 4DV7Q 4A3FG 3S1RH 4ME3A 4DV2L 1XPUA 2RSOA 3LX0A 1SJHD 1VQIA 3TZUA 2K1BA 1B44D 1IW7D 2YQRA 2JA8H 4FF4A 2CW0D 3PO3G 4JV5Q 3AYHB 2X6LA 1EFID 1D6EC 2CQAA 1SR3A 3GTQH 1PH2A 3K0YA 4BBSG 1G51A 2PMZB 1EY7A 4K5XA 1MBYA 5J39A 3HOWB 3MHBA 4K0KL 4YWMA 2CVRA 4R1JA 2FMMA 1CSQA 1Y8NB 2UXCQ 5EGTA 1HXYD 4WALA 4JI8L 2NVTB 2V4DA 2NUCA 1NMGA 4DAMA 2QKIC 1HJPA 1QVGA 5EKKA 5ELDA 5IT9E 3UDIA 1A3VA 4OHJA 4RG1A 1SSOA 2JEAI 4F7XA 4CJ0B 2VUMG 2L55A 1TWAH 1S5CD 3G7LA 2JA5H 1SBBB 1A2TA 3EIVA 2JVZA 4A93G 5FO9B 3IL8A 1PYBA 3D4DA 1CKNB 4JVHA 2KQ3A 1AZQA 4DAYB 1EEID 3J81L 2Z8LA 1EFWA 1A6XA 4HJ8A 1RTOA 1E2ZA 5GAHC 1WYDA 3HOZG 2KHIA 2JA7G 2L0CA 3KDFA 4HCEA 3HOVG 3F8TA 2E2IB 2F0GA 1NR4A 3P7JA 4A3DB 2JZXA 3S2DH 5AFWA 2NVXB 4GKKQ 1EUJA 2Z4IA 4Y7NB 5GQOA 4JI6Q 4PNYA 2LXJA 1EC6A 1UEAB 3FHWA 4JI5L 4B3RL 5LMUL 3CPFA 5A2QE 3E0JA 3MA2B 3EBEA 1Y1VH 1GUNA 2KHJA 1HR0W 2CTKA 3AMUA 2FXQA 1X3GA 1FVIA 3LWEA 1U5KA 2K32A 2PI2E 1PH1A 4CKEA 3HEJA 4R8IA 4JBJA 5M5XH 4X62L 1SYCA 1IBML 1SYEA 5C0XH 1K0RA 2LFNA 3TS2A 3PIO3 1T5EA 2FFKB 3PMFA 2D9UA 1B3AA 1JB7A 1N32L 4P75A 5JJZA 2ASBA 1ZYRC 1I4GA 1DGSA 4LWCA 1VS0A 4WJ3M 2UUBL 1ZXTA 4AM3A 1CA5A 2EXDA 3PF4A 5J3BA 1KNAA 5ELOA 4X66Q 2RQXA 3HGBA 4CHTB 4HIDA 2G9DA 1YNJC 3KF8B 5IP7H 4YY3Q 1D5ZC 2HHHL 4NMZA 1KHMA 3RUZA 4GLVB 1EOVA 4GKJQ 2PY9A 3TZDA 4LUZA 3MTSA 1NAPA 3EN2A 3H0GH 2QILA 5BR8L 2HDLA 1XTCD 4C3IG 5D3IB 4DK6C 1PTOD 2ZTEA 2I0QA 1V9PA 1Q12A 1K8AC 5JVH3 1NE3A 1AN8A 1PV4A 1EYDA 5EPKA 4C3HB 3U4ZA 1RF2D 1S72A 2QEJC 2IWHA 1HZCA 3DMUA 3GO5A 1QNUA 3RLNA 3D4WA 3UI2A 4DV0L 3S1NH 3MEHA 3GTPH 5EKIA 2FMCA 3HZXA 1EU4A 1PFBA 5I2XA 4HJ9A 1LV9A 3KK7A 4JBWA 4DR4L 1TWGH 1K8OA 1CKMA 2UUAQ 1QG7A 3GD7A 1X32A 2M00A 1BCPB 5DEHA 3I2ZA 2F0UA 4LUOA 1HTLD 3M9BA 4NXNL 4JK1C 3OTOL 4A3JH 3JAME 1CM9A 2EYLA 3P75A 1N34L 1B4OA 2PQAA 5C4JH 3HFZB 1RHPA 4DV6Q 1EIFA 5C3XA 5J1ZA 1D7QA 2A69D 4KJOA 1VQFA 2K4KA 5C5LA 1Q1EA 1N32Q 2A73B 1IYJB 4CKCA 1VQJA 1YEZA 1JOQA 1O7IA 3PUZA 3HOYG 2Z6KC 1DT4A 2UUBQ 1L0YB 2H5XA 3BZCA 1MJEA 3T53B 1JE5A 3DUZA 1BKBA 2HCCA 1J6QA 2QCPX 2QEXA 1SYDA 2TMPA 5CMDA 4EQPA 2A6HC 4EQOA 4MTNA 4O42A 3K5OA 3KUPA 1TS3A 4K6LA 4AIMA 2F4VQ 2CTEA 5CV5A 4LFBL 3RD4A 5BR8Q 3DWQA 1BCPC 2TSSA 1IKLA 1FJGQ 4A3GH 4JI7L 1ENFA 2ZXRA 3U58A 3SVMA 5HY6A 2JA8G 5JJIA 3V2TA 3RN5A 1PH6A 3CCRA 3DLLA 2LMCB 5K36H 2OXPA 5AJ3L 1KDCA 5C3EH 3T16A 5LL6S 1PTOH 3CAMA 2MHVA 4BA1I 3S2DB 4L5SA 1N9WA 3FKIH 2AQ3B 1QUQA 1Q8IA 4DPGA 4NKLA 4QUFA 1XMQQ 1RCVD 4RHSA 4YCUA 3CXCA 2EOTA 3ITPA 4A3KH 4NXNQ 3OTOQ 1WCMH 3A8JE 4LW1A 1Y1VB 2F0FA 1QZHA 1GVPA 4HJ7A 5FO7B 3TBIB 3F2DA 2JA5G 1EY0A 5IWAL 1YI2A 5EQ0A 4UP7A 4KV6A 2DY7A 2JEBI 5D3DA 4B9WA 1VQDA 1P16A 1EY6A 4GOPA 2QNDA 1WE8A 5CORA 1UE5A 1G2TA 4BA2I 1A3UA 4PZ8A 5JAVA 1H9MA 4HMIA 3MXNA 1X54A 2HQEA 3CCUA 1QCBD 4QCLA 2RDHA 5IT9L 2IHEA 3TP5A 1NY4A 4LFBQ 4DNRB 4YIJA 3URYA 1K1GA 5ELNA 4LF5L 2WINB 5HURA 3EVQA 3SXHA 2I5LX 1LM0A 3S17H 3VYSA 1G2SA 2K7VA 3A8KE 5AJ3Q 3TS0A 3D3RA 1U9RA 4RGNA 4GN4B 4JOIC 4RGTA 2B63B 5M3MB 4IOAA 4DR2Q 2L11A 1Q8KA 3VKEA 3ICEA 3FP9A 5KYIA 3LGJA 3GTPB 1B50A 4YHHQ 4R4QA 4EGVA 2R7ZH 4KHVA 3DXJC 2IX3A 3HKZB 1EOTA 4KKUA 1TWGB 4IALA 2MJ8A 1IKMA 1XNRL 2B39A 3J80c 3CQZH 3IRBA 2F0IA 2UXBQ 3T1YL 4MNOA 4B3SQ 5C4XH 5IP7G 1ZYRD 1LT3D 2H1EA 5C4JB 3HKZE 4WRDA 1LTID 1TT2A 1L0WA 1EIHA 2KUMA 5JPNC 4CGYB 1VF7A 4DR3L 1KABA 1EQQA 3I4LA 4TVAB 5FLMH 1O7ZA 5I6YA 3H0GG 1YNJD 1KQSA 1PRTF 1IXRA 4FF1A 4DV4Q 4KY6A 2VY3A 1KRSA 4A3BB 4DV3Q 1TWHB 1PZID 4AYBB 4P2CB 4KD3A 2KECA 4DXFA 1HH2P 2JA6H 3S1QB 1YJWA 1W3SA 4B3MQ 4K2KA 5M5YH 1QOHA 1I4QA 2EYMA 1XXGA 3OW7A 4LF7Q 5IYDH 5KNDA 4YCVA 1A8VA 3NWTA 2Y0SB 1R4PB 3OMGA 1Q81C 4IQZA 3MXPA 4JG2A 5E7NA 4PQXA 1GOZA 4PMCA 3GDEA 3A8IE 2ZXPA 1QE6A 1TU2B 1PA6A 3PUVA 2ZJPA 1YIJA 1B53A 1WTOA 3KFUA 3EFXD 4K14A 5EKLA 4X65L 4FP5D 4A3JG 3HOWH 3OIPA 1I50B 1SLJA 1HNWQ 4OWXB 4DUYQ 1K83H 1FR3A 3V05A 1PTOB 2NVTH 3IFDA 5G3LF 3S15B 3A7AB 3PCOB 1HNXQ 1V8QA 5EPJA 1J5EL 2EYJA 5IGEA 3NENA 1VQOA 4R4OA 4DR5L 1YHBA 5JVG3 1D5MC 1I94L 1Q46A 4LF8L 4CKBA 1BO0A 1UE7A 2JA9A 1DOKA 1JWSD 3K57A 1LT5D 3H09A 4A3KB 2K14A 1WCMB 1TIID 4XQJA 3VR5A 1SROA 1PYSB 1XWEA 2CTJA 4KHPQ 4DGZA 2VQEL 4HMJA 4OWWB 4LF6Q 1N36L 1CK1A 1SNOA 3UE1A 1UAPA 3W2DA 4A3GG 2A6HD 1W6KA 1E2VA 2A1AA 4QL5A 3I4NH 4A3DH 4ZQ3A 3J81c 2NVXH 3H3VC 3CHBD 4JI4L 5K36G 1BCPD 1OXUA 1Q7YC 5LHY1 1Q82C 5C4HA 4OWTB 5C3EG 1F2ZA 1EWIA 2NVYH 4XT3B 3HKSA 2F0TA 2ZJRA 1V1OA 1L1OA 1OXXK 2OT2A 2B2VA 2EY5A 4UAIA 1SE8A 3FKIG 3MFGA 4DV7L 2DN8A 1ASYA 3RLOA 3OW2A 4BY7H 1EU3A 1KLGD 4EQ5A 4FNFA 4DV1Q 4A3KG 1EY5A 3KDFB 5LL6X 3MZ5A 5E4WC 3S17B 1WCMG 4OXPA 1W2BA 1HQMC 3K7UC 4JV5L 2MO0A 4DFAA 1DJRD 1HA6A 1XJVA 1G8ZD 4JVYA 1KHIA 1SNQA 4HR7B 1CSPA 4IPDA 1J5EQ 3I7FA 2CCZA 1WTXA 2K52A 4NW2A 1EQVA 3F1ZA 2UXCL 4FO2A 4YWKA 1YBYA 2ZM6Q 5EJWA 3K8AA 1JCKB 2CFMA 1CFMA 1VQ5A 2VW9A 1UWVA 3OIQA 3R2TA 1XNQQ 2N78A 2WAQB 4F8MA 3CQZB 4PMBA 2BDOA 3TEHB 2E5LQ 1MSGA 3V96A 2N8NA 1JMCA 1T9HA 2HT1A 1SEBD 2AWOA 2XRSD 5C4XB 2F0PA 1CHQD 1N36Q 1F77A 1ONLA 1JQYD 3NUCA 4HIMA 4C3HH 4H13C 5JEAH 2NTTA 4NPSA 4IUUA 4X64Q 4A3IH 4H0LC 2OTJA 2KJXA 5KIXA 2B3GA 3NQIA 2MGSA 3NP8A 1J8IA 4XDXA 3TDQA 2JA6B 2LXKA 5BN5A 4GKKL 2WKCA 1V1PA 4JI6L 5C6AA 1BBXC 5T1GA 1S5FD 1P8LA 3AEVA 4QUCA 3HOXB 3ULJA 4A3LH 2R7ZG 1LTAD 4JI2Q 5M9OA 4R8NA 1GUOA 2PZTA 4RGMA 4DK3C 1HUMA 3JAMi 3D0FA 4HSVA 4MIUA 1I6VC 2NB0A 1KAAA 1D2BA 1JT8A 1Y8OB 2IW3A 1QVCA 5CBEE 1SFOB 1K8GA 1CT1D 1I4XA 4KMUC 2DNCA 2F0SA 1EQRA 5HGQA 4FXGC 1IL2A 5IGFA 1V1QA 5J22A 1JR0D 5C4XG 5EAYA 4XYQA 1AW7A 1LACA 5KYLA 1K83B 1GHKA 4TRDA 1VMPA 4AQYQ 2VQFQ 5FLMG 3OPOA 1SYFA 1LTRD 4KKSA 2PPBC 2PMZE 3WDNA 3RNUA 4AH6A 3NXWA 5DAUA 4G57A 4WORA 2Q8TA 2PQAB 3W1BA 1BBWA 4X66L 5C0XI 1GD7A 3VR6A 5ELBA 4EX5A 2KCCA 2HQLA 2OQKA 4YY3L 1BDOA 5C44H 4DR1Q 4X6AH 5IYDG 4GKJL 4HN7A 1JWUD 5KEEA 4OONA 1X4NA 3PO2B 1B8AA 3OHXC 1ILPA 5CC4A 3UDXA 3G6EA 1FL0A 3U50C 2ZT9C 2ANNA 1VQCA 4RA8A 4HAEA 5BN3A 3AFQA 3Q0AA 2QDBA 2A68C 2I07B 3I4NB 2XRQD 1G91A 1N33Q 4F87A 3HOWG 1O78A 4DV5L 2YU9B 2IL8A 5C4ZA 3SHLA 2EY6A 4BY1B 1DTJA 2VL6A 1LLRD 2NVYB 1SJED 1II3A 1C7YA 4HIKA 2F4IA 1DXMA 2UUAL 2RDFA 1IHZA 4ZUJA 3NE5B 5IOCA 2PCFB 4BY7B 1IZ6A 2K5DA 1PFNA 3M7GA 2ZTDA 2K5WA 2N3SA 3BYYB 3EA6A 2L4NA 4DV6L 3T1HL 5C3WA 1SE4A 1QUQB 1JJ2A 2WIIB 2LY7A 3A5UA 3I91A 4JYAQ 4UPAA 5CV8A 5FLXL 2OTLA 2I5HA 1WVLA 3K5LA 1HQRD 3Q24A 4M8AA 3I4NG 1Q90A 1RTNA 4IOCA 4A3DG 4A3CH 1B7YB 2P2RA 2AUKA 2A74C 2KOLA 2F0EA 1D5XC 3TRZA 3JC66 4ODGA 4ILWA 4C1NK 2EY1A 3N52A 1X65A 1VMCA 2F4VL 3NELA 4GOPB 1Q1BA 5LMNW 4RFBA 1F2YA 4A75A 2EJMA 1VIGA 1LYLA 4JI1Q 1A2UA 5IT9c 1FJGL 2WB1B 4HSPA 4BY7G 3NBHA 3MC0B 2MP1A 3CC2A 1CUKA 2F0HA 2B63H 5M3MH 3T56B 1VQAA 3MXNB 1ET6A 1JOKA 4A3IB 3QIAA 4DV5Q 2MNAA 1FNVA 1LT4D 2YTXA 3A0JA 3STBC 1SMYC 4LMQD 4GN5A 4R4TA 3K7AB 1LO5D 3OSOA 4G7OC 2HDMA 4K8IA 2NVQB 3LWUA 4KTAA 1X3QA 1HPCA 1UNSA 1XMQL 5M3FH 1QZGA 4ZKCB 1S5DD 4DXGA 1TQOA 3H3VI 1PVOA 4KHZA 4L8JA 2AQ1B 4G7HC 4HJ5A 1YITA 4B08A 3A5ZB 1PZKD 2DNEA 5IGCA 1SMXA 3T1HQ 3L3OC 2F52A 3ND9A 3RMHA 1TKWB 1I4HA 4GOPC 3I55A 4TKOB 3GV3A 4LK1C 3A74A 1HZBA 2AXYA 3I4MB 5DM63 4A3BH 5HGTA 2VB2X 3X3MA 1TWHH 5H1SE 3RZDH 2RKSA 2K5VA 3CCJA 2Q8IB 4C3HG 5JEAG 1H9RA 3S1QH 1VQPA 4GS3A 3Q23A 4A3IG 2ZJQA 1AZPA 3S14H 1FYCA 3HRZC 4JC0A 4L6TB 3L2PA 2NZOA 4IPCA 1WD1A 2YYZA 4MZ9A 3BU2A 1VQHA 3J7AV 4DR7Q 3OOCA 2CTFA 2K01A 3WOFA 3CPWA 1IL8A 1HR0L 5C44B 4LJZC 1X3FA 4LFAQ 1EIGA 1BVSA 2B2WC 4A3LG 4IUNA 1HFNA 4LF4L 1M90C 2HH3A 4A3MB 3C1EA 4KJNA 3QOLA 4DAVA 2WACA 3RZOH 1WVNA 1I50H 3H3VH 1F9PA 1YJNA 2SNMA 1SXTA 1X9NA 3S15H 4PG3A 3H94A 1OO9B 1CQVA 3P20A 2PQEA 4DR2L 2K33A 1I3QH 2EE1A 3FDTA 3GQBA 2K5QA 3R3OA 4YHHL 3A7LA 4OL7A 1TWCH 1MIUA 3J80E 4IPGA 4FXDA 4RCNA 3NQTA 1NCVA 2UXBL 4YWLA 1TS5A 2F0QA 3S1MH 1STBA 2ANRA 2D2CC 1WTPA 1G6PA 2KCNA 1HRJA 4B3SL 2RA4A 4ID6A 1ESFA 1GXDC 3L0OA 1FD7D 2BCOA 3EJIA 1PMRA 3TP8A 1A63A 1PTOF 4BBRH 1EYAA 1H9SA 2Q2HA 2KHSA 3NPPA 4DV4L 3L9AX 3K6OA 4CBVA 4DV3L 1WTVA 3GTJH 3BS1A 4IUVA 3CKIB 1UE1A 1R4QB 4EQNA 4B3ML 5FKAC 3RN2A 3U1KA 3E0EA 2CTMA 2M9VA 1HR0Q 4LF7L 1VQ4A 1I6HB 1WI5A 1VDZA 3W5OA 2PNHA 3W3AA 2PQUA 2WFWA 4LF4Q 3HS0C 1EYCA 3M4YA 1Y1VG 2A5HA 2F3VA 2K03A 2JE6I 2B2WA 2EYHA 3KBGA 3I73A 2VB3X 1XYIA 2RBMA 3T4AC 1SAPA 4M1UB 4K5WA 1QB5D 1X56A 2MUYA 2JP1A 2F0LA 3MVVA 1CHPD 5IGDA 2XWJB 2HUGA 2E2DC 1CZGA 4BS9A 1Y1WH 5FO8B 1HNWL 4OIJA 4DUYL 1L1OB 4K2LA 4C1NI 5C0XG 2XVSA 3C3LA 2RSNA 3NTKA 2BDNA 1HNXL 2KEDA 3VYRA 3PV0A 1MKHA 3NSWA 2M2LA 2JQOA 4UP8A 3TREA 2F0DA 3U4VA 4N9PA 1DONA 3BDOA 3KLRA 4QF4A 1VQLA 1PLFA 5M3FB 4C3JB 1NTGA 2K5NA 5A2QL 3RR5A 2E2JH 3U9SA 1BBUA 4A3FH 5LMNQ 2BA0A 1SNMA 2PW7A 2BH2A 2MQHA 4H44C 4KKTA 2QGQA 4B3TL 4RKBA 4KHPL 4TSSA 4QY7A 4YCWA 4OO1I 2A8VA 2F0VA 1AE3A 1D1IA 3I70A 5CV6A 4RHRA 3T51B 4LF6L 1YZ6A 3PIPA 3VA5A 4LNQA 3S24A 4GNXA 3J81E 1M4VA 2L9HA 3RZDB 1RL2A 2KA7A 4LF9Q 3NHHA 2B63G 1S5ED 5IGGA 3M7NA 5M3MG 1NBWA 1GM5A 1L1OC 3M3YH 4QMFB 2B2VC 3S14B 3HOXH 4LFCQ 1ZZIA 2XSCA 4QGUA 2AWNA 3N6RA 3BVZA 3S2HB 1IYUA 2LS01 3QOJA 3CW2C 1VQ9A 3HKZG 4AYBE 2J4XA 3FPPA 1IBLQ 3Q6SA 4P71A 1FGBD 3KLWA 4KY7A 1SFOH 5M3FG 2DY8A 3STBD 1SMYD 3EROA 3CP0A 3SK4A 4DV1L 1GUGA 1BOSA 1Q3LA 3ULPA 1XTDA 2OPVA 2Y0SE 4I7ZC 1DCZA 1VQ8A 3RZOB 4NXMQ 1A15A 1PXUA 2G9HD 3ERSX 2BH8A 1V1PB 3HOUB 1U4RA 3GTLH 3M85A 3AEVB 4EVOA 4X3SA 1Z47A 2FHTA 3CC7A 4N9TA 1VQEA 3VYTA 3C1FA 1Z9FA 1I3QB 4LAAA 5IIFA 1NUCA 4A3BG 1XMOL 2XGTA 4OO1H 2ZTCA 3BZDB 4RAUC 4AYBG 5F2DA 3TN2A 2ZM6L 3J7ZC 2EVBA 2A19A 1TWCB 1HUNA 4DA2A 1A0IA 1XNQL 2PYKA 3U9OA 5D65A 3SDZA 4QMGA 1KLUD 2J7ZA 1NR2A 5BN4A 3JAML 4B3TQ 2V1CC 1RD9D 3S1MB 3PO2H 5ELCA 2Y0SG 2E5LL 4HEDA 4CJ2C 3DM3A 2NBFA 2AUJD 3QJYA 1CA6A 5JEAJ 2F0NA 4IZ8A 1A62A 2CWPA 2UU9Q 2PW5A 4DAPA 5IYBH 4BBRB 1DD2A 4X64L 1EEFD 1K3RA 2L12A 3ZJYC