4BA1I

Archaeal exosome (rrp4-rrp41(d182a)-rrp42) bound to inorganic phosphate
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
212
structure length
204
Chain Sequence
SQEIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGERRYLDVGDYVIARIENFDRSIDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGNKSMYETLTSKCSIFVANNGRIWASRFSEEILIEAIRKIENE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a 9-Subunit Archaeal Exosome in Pre-Catalytic States of the Phosphorolytic Reaction.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords PROBABLE EXOSOME COMPLEX EXONUCLEASE 2
total genus 41
structure length 204
sequence length 212
ec nomenclature
pdb deposition date 2012-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ba1I01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ba1I02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4ba1I03
4B3SQ 3EBEA 1PMRA 2E5LL 3CF5A 1SLJA 4YY3Q 4NXML 1A62A 5LMNL 2K75A 4A4IA 5M3FH 4HJAA 3RN5A 3K7UC 1Y1WG 1K8AC 1N32Q 1MJCA 4DUYQ 4HJ8A 4DV3Q 4LFAL 2Q2HA 4JBMA 2EJFC 4LNQA 1BBWA 4A3BH 2OPVA 2MQHA 1PH2A 2VUMG 1OXTA 2D0PA 3K81C 4DK6C 1VQ7A 1CI3M 2VY3A 4LUVA 3UE0A 1W2BA 1B7YB 4DR6L 3FKIG 2VQFL 3E0EA 2HT1A 4DR4Q 1X3FA 4GN3B 5BR8L 1H9KA 3I72A 4Y7NH 5FLMG 1VQDA 3KJOA 2EIFA 2A1AA 1IL2A 4DR2Q 1FGUA 2IX0A 3ICEA 4BY7G 1ASZA 1VQIA 1VQGA 4A3LG 1HNWL 3PGZA 4TQUS 1YEZA 2DUDA 3MXNB 4DV4L 1PH3A 1X4NA 1NTGA 3BZKA 5K36G 2RCNA 4R4QA 2R93G 2A6ED 4GLXA 4GNXB 4LF5L 2NVQH 2R92G 1UE6A 2AMCB 1PVOA 1GUOA 2A68C 1XMQL 1JMCA 1N36Q 1GKHA 1NBWA 1K8OA 2NZOA 2ZTDA 4P74A 3CCSA 5IY0A 4L5SA 4GS3A 4X65Q 1JE5A 4G7OC 3CCQA 3GQBA 1WJJA 2ID0A 1XMQQ 2UUAQ 2E2JH 3W1BA 5DLQE 4A3BG 2DN8A 2ALYB 4DR5Q 4DV5Q 3WWVA 4LUOA 4JI1L 4HJ7A 1XPOA 4DV4Q 4JI1Q 4HR7B 2IHFA 1QZGA 1ZTGA 3U4ZA 4L8JA 1I5FA 2CCZA 1DD2A 3U50C 4LFBL 2Z6KA 4PG3A 1G291 1E1TA 3OTOQ 3PF4A 1JT8A 4JOIA 5C0XH 2FXQA 5FJ8H 2E75C 1VQKA 1UE5A 2VQFQ 3OPOA 2N8NA 3K0XA 1TXYA 2CPQA 4P72A 3A0JA 1B70B 1UWVA 4QIWE 5EAYA 2LXJA 4PMWA 1XNQL 1RL2A 1ONLA 1WFQA 2E76C 3J81j 2Y0SE 1KAWA 1KHIA 4DR1Q 1MKHA 1QUQA 4GOPA 3U58A 1N32L 5LMNQ 4ALPA 2R7ZH 3J7A5 3NELA 3VR4A 2JA6G 3ULPA 4JI6Q 2BA1A 5IP9H 4IOAA 2CTKA 1ZZJA 4OXPA 1CSQA 2CQOA 2PI2A 1IYJB 2XTIA 3HOXG 4MZ9A 2UUAL 2V4DA 3CD6A 2BA0A 2F3IA 2CTJA 5BN5A 1L1OB 1Q46A 4DNIA 5IP9G 2JA6H 4TKOB 3JC66 4JV5L 1X56A 4LJZC 4A3FG 2LMCB 3A7LA 2EQSA 4NPSA 4DUYL 2ZTEA 3TEHB 1PH6A 1CKMA 3S1RH 1Z47A 3S1QH 1LUZA 1VIHA 1KXLA 5JJLA 1DCZA 4KKTA 2CFMA 4YY3L 1UEBA 4JI8Q 2NN6I 1KHMA 4P71A 1N34Q 1J6QA 4KKUA 4X66Q 1VF5C 2DNCA 5C4JH 4DNRB 3KLRA 3PF5A 2YTXA 2A69D 4OX9Q 1XNRL 2JZXA 3CC7A 5GROA 1T9HA 4GN5A 4JBJA 3HOUH 4LF6Q 3HOWH 4JI4Q 3IRBA 3T51B 4JI3Q 4G7HC 2N78A 3CP0A 2R7FA 4IJHA 4DV6L 3TQYA 1IBKQ 2Q2TA 1GUSA 3U4VA 2NN6H 4YWKA 2ANNA 4UP7A 1SN8A 4DK1A 2VS1A 2OQ0A 3G4SA 2CTFA 3PCOB 3CAMA 3HGBA 1QJOA 2PQAB 3BU2A 4YCWA 3KF6A 3ULJA 1PHJA 2N49A 5LMUL 4A75A 2K14A 2UXBQ 1DTJA 3B6YA 2YU9H 2OPUA 4OO1G 2P2RA 2KHJA 4KKSA 3RLOA 4KLKA 1OXUA 5BN4A 4GNXC 5IYCG 4JI6L 4IFDI 2EJMA 2CTEA 5M5YH 4DUZQ 1AE2A 2EJGC 1WYDA 4X64Q 1LM0A 1N8RC 3HOYG 4A3GH 4PV1C 3K80C 5GAEC 4IOCA 5KNDA 2VZAA 4LF4L 2F4VQ 3CXCA 4GKKL 4EQ5A 1GHKA 1EOVA 2MO0A 3RR5A 3I4NH 1JJCB 2E5LQ 2KBNA 5J3BA 3G71A 2HH2A 4JC0A 1FR3A 2I5HA 3HOYH 3UDIA 1L1OA 3F2CA 4KMUC 1GJXA 3AFPA 3OTOL 4B3TQ 3S14H 3LGJA 4LFBQ 4A3JH 3BG3A 2Y0SG 4DK3C 2I0QA 1QUQB 1WCMH 4I7ZC 4XTCS 1E3PA 2NN6G 5IT9c 4A3GG 3GTLH 2VL6A 1YJNA 5IE8A 4DNTB 2NVTH 2I5LX 1H9MA 5IWAL 2E8GA 1I94L 3A8KE 3KJPA 1XNRQ 3HOWG 5M5XH 2CTMA 4A76A 3ULLA 4DR3L 4YWMA 4P73A 3SE0A 1LTLA 3AQQA 1Q82C 2OCEA 3J81c 1N36L 3L0OA 2UUBL 4IFDG 4EX5A 2AWOA 4GLAC 4BXXG 2B8GA 3PIPA 3T1HL 2A6HC 3GO5A 3KF8B 3OYYA 4IQZA 1VQOA 1NJIC 5C44G 2R7ZG 4A3LH 1X4MA 4X62L 3E9HA 1EYGA 4DR2L 2BE5D 1E22A 3GTPH 3A8JE 3L2PA 2YTYA 3S17H 2IT1A 5GAGC 3TZUA 4A3EG 1PV4A 2KHIA 2Z6KC 4JI2Q 4DR4L 4OGQC 2NZHA 3PUZA 1GVPA 4NXNQ 3PV0A 4JI5L 3H94A 4JG2A 4YHHL 3RN2A 1Q7YC 2JA5G 3PO2G 4DR6Q 3CMEA 1E2ZA 4AQYL 2AKWB 3PUYA 2YYZA 3PIOA 4DV7Q 4DAMA 4RMFA 1M90C 3M85A 1A6XA 4GNXA 4DV3L 2A19A 4LK1C 4AH6A 4K0KQ 2K7VA 2UXDL 1HR0L 4JYAQ 1K1GA 1YHBA 1FVIA 1HCZA 1MIUA 2PMZE 1L0WA 3QG1A 4R1JA 3VR5A 1C9OA 3NBHB 4BY1G 3UDGA 1G6PA 1IW7D 3CRKC 3G6EA 2JA7G 1WE8A 5AJ3Q 2Z0SA 3I2ZA 5M3MH 2KENA 1QVGA 3CC2A 2A8VA 4IFDJ 2CTLA 4A3DH 3AEVB 1EIFA 1K83H 4GKJQ 2AUKA 1Q86C 1QZHA 1O7IA 2D0OA 2UU9L 2FMRA 3CMAA 4UPAA 4DR7L 1RIPA 1K0RA 3M4QA 4PZ8A 1OXSC 3ER0A 2L15A 3KOJA 3CCMA 4A3KH 2B3GA 1Q90A 4QGUA 1Z9FA 5FLXc 5ELOA 3CCEA 1KIXA 1OTCA 1PH5A 1JJGA 1K3RA 3FHWA 3W5OA 2JEBI 2HIXA 1TU2B 2R7DA 2XGTA 3JAMc 1VQ5A 2B8FA 4C3HH 4IPCA 2N3SA 1IYVA 2WAQG 4OWTB 3M4YA 3H15A 1EQQA 4LF8L 2F52A 4LF6L 3NE5B 1EFWA 3K8AA 3T1YQ 1VIGA 1Q1BA 1IBLQ 2C35B 5FJ8G 1TWFH 1YHQA 3D4RA 3K7AH 2UXCQ 1ZZIA 1Y1VG 1KRSA 1HNZL 4JI0L 3BZCA 1GUTA 1GUNA 1N33L 4POFA 1VQ8A 1A63A 2IY5B 3ERSX 3I4OA 5E7NA 1B8AA 1TWHH 1R9TH 1J5EQ 1IBMQ 2E2IH 4JBKA 3I56A 2NVYH 2GVAA 2Q8IB 5K36H 1VQBA 1TWCH 3RLNA 4LF7Q 3I4LA 3EIVA 4A3IH 1IBKL 3M4PA 3SDZA 5M3FG 3S1NH 1VF7A 4AM3A 3T56B 2K5HA 4OONA 1KRTA 4R4TA 3SGIA 4JK1C 4DV0Q 1Y8PB 1WVNA 2EVBA 3L7ZC 3STBC 4OWWB 3PUVA 4BBRG 1K8MA 1VQPA 2JA7H 1CKNA 3ND9A 3EN2A 1GO3E 4IPDA 1SMYC 1YZ6A 3J7ZC 3VDYA 2A6EC 4JI7L 4A3EH 3CQZH 1VQ6A 5A35A 5HY6A 5C3EG 4GLVB 3E9IA 4BY7H 1Y69U 4A3KG 5IP7G 1H95A 2ZM6L 1X3EA 1VQAA 1D7QA 1XMOQ 4A3DG 3GD7A 4JBWA 2KCMA 3HKZG 2ZJPA 4B3RQ 1JJ2A 3CW2C 5IYBG 1AH9A 4POGA 2QF7A 2PNRC 2JQOA 2JA8G 1Q8KA 4B3MQ 3JAMi 4DV1Q 3N6RA 4JVHA 2A69C 3I55A 2BE5C 4GOPC 2JA9A 2WAQE 1SR3A 3PSIA 3A5ZB 4A3IG 1H9JA 4DK0A 1VS0A 4LF7L 3V69A 2AUJD 4BXXH 3I73A 4LFCL 2IHEA 1E2WA 5KNCA 5C3EH 3HFZB 3IFTA 4A3MG 1IBML 5JEAJ 4PZ6A 1HTPA 5IYDG 4JI0Q 1YNJC 3AEVA 1X55A 3LWUA 2VW9A 1BDOA 1Y14B 2UUCL 2QNDA 3T1YL 1BVSA 1KC8C 1H9SB 1HJPA 3I4MH 3HOZG 1X3GA 1S72A 1VQ9A 1K8GA 4HIDA 4AIMA 4AYBG 1KL9A 1LACA 3Q8DA 4DV2Q 1WI5A 3CCRA 1TWGH 1I94Q 1DXMA 1YNNC 2A68D 1NE3A 1YBYA 2JEAI 3OOCA 1H9RA 1U5KA 5IYCH 1PA6A 2ASBA 2DGYA 3RLFA 1E7ZA 2YQRA 2D2CC 2E2HH 3BDOA 1XJVA 4DPGA 1V43A 4DV2L 1J5KA 1ZZKA 4HIKA 2VQEL 3TS0A 2VQEQ 3PUXA 1C0AA 2UXDQ 1CFMA 2V1CC 3J80i 1Y1VH 4PZ7A 1I6HH 2UUCQ 3UDFA 4IPHA 4AQYQ 3QIAA 1VQMA 4KN4C 4LF9L 2JA5H 4G7ZC 1K73C 4YCVA 2BL5A 3ZJYC 2GN5A 1VQ4A 4X6AH 2DGRA 1HZBA 4QY7A 1I3QH 4O0AA 4B8TA 1N9WA 4QMFB 1V9PA 4H02A 2ZT9C 2DNEA 2EXDA 2B63H 3GTGH 2MJHA 1EWHA 1HR0W 2A6HD 5C44H 2QGQA 1X9NA 1V8QA 2OWOA 3NENA 1PYBA 1SRUA 3T1HQ 1FJGQ 1PH4A 1VQHA 3A7AB 4IFDH 2PCFB 1IZ6A 1SE8A 1WOCA 2K5NA 1GHJA 2KCTA 4IJLA 3M4OH 5IYBH 4B3RL 2LXKA 2JVZA 1XMOL 4RCNA 3VA7A 1VQFA 1VDZA 1BKBA 4P75A 1NY4A 2K50A 1B9MA 3BJUA 4MNOA 3CCJA 3A8IE 2JJQA 4LFCQ 4LIJA 1C7YA 1Y1WH 3DLLA 1I50H 1VQCA 3GTJH 2KA7A 4HIMA 3AFQA 1JB7A 4IPGA 5C0XI 5M5WH 1X65A 1VQLA 3EQLC 2AHOB 4DV1L 3RZDH 3CC4A 2BH2A 1FYCA 3PO3G 4A3JG 2ZTCA 4KHZA 1CTMA 3U1KA 2EDGA 2YV5A 3W1GA 1PH7A 4WJ4A 4BBRH 4DV0L 3KF6B 1IXRA 4L5TA 3S2DH 2PQAA 5C0XG 3WDNA 1B9NA 3J80c 3DXJC 1HPCA 4AYBE 1S40A 1YIJA 1XPRA 3IKJA 3KDFB 3VR6A 3CPFA 3KDFA 3I4NG 1CUKA 5JJIA 4UP8A 1J5EL 2F4VL 4H44C 1WCMG 4YCUA 3ND8A 3HOVG 3F2BA 3AB9A 1EUJA 3KYHC 4O2DA 1HNZQ 2ATWA 4QL5A 1YITA 3RZOH 5JEAG 1EQRA 4NBQA 1IBLL 2UXCL 3H3VH 3MXUA 4JOIC 1KQSA 1FJGL 3FPPA 2HQLA 2CWAA 4NB3A 4LF8Q 4Y52H 5LMUQ 3D0FA 2KCCA 1OXVA 1X6OA 1P8LA 2H5XA 4FDBA 3LNNA 1A0IA 1TKWB 4R4CA 1SROA 1YNXA 3TREA 2MNAA 5C0XJ 3S24A 4QJFA 2B63G 2R93H 5JJKA 4BBSH 1XTDA 4GKKQ 2K33A 4OO1I 1PH1A 3MEFA 4JI4L 3TS2A 2D5DA 3G48A 4DKAC 2ES2A 1KD1C 4LF9Q 1N33Q 1EC6A 1HZ9A 2UU9Q 1TUAA 3S1MH 5FLMH 2PPBC 3GTMH 1NMGA 2OTJA 3M7NA 3CCVA 3H0GG 2OTLA 1N34L 5JEAH 1YJWA 4WANA 2AXYA 4A3MH 1E1OA 4JI8L 2WB1E 2VUMH 2I5MX 4JVYA 1Q12A 1FL0A 4GOPB 5LMNW 1M1KC 1MJEA 1XPUA 2ANRA 2WB1G 1HR0Q 1GUGA 3I7FA 3GTKH 4HJ9A 4XIGS 2PI2E 2RHSB 3TRZA 2HH3A 1QVFA 3A5UA 4DV7L 1SFOH 3HOUG 4OO1H 1HZAA 1GD7A 2CWPA 3FKIH 4LUZA 1YHAA 4JI5Q 4GKJL 4BA2I 1A8VA 1DGSA 3PO2H 1U0LA 2K32A 1HQMC 1Y8NB 3U9SA 2GVBA 4APVA 5AJ3L 3KLWA 4ME3A 4C3IH 4JI2L 2R92H 1LYLA 2YTVA 2D62A 4KN7C 4A3CG 2WFWA 2JXMB 2BH8A 3PO3H 3H3VI 5HGQA 5IP7H 4JYAL 1AE3A 4KI0A 1E2VA 1Z7TA 4DR1L 2NVXH 4K0KL 2VNUD 1QVCA 1ASYA 4KHPQ 1PH8A 1GM5A 3KFUA 1XNQQ 3A74A 2UUBQ 1J4WA 1PH9A 3CCUA 4YHHQ 2HIVA 1E24A 4NXNL 2QA4A 1BBUA 1VQNA 4A93H 4C3JH 1Q1EA 4UP9A 4WJ3M 3HOXH 4DR3Q 1VQEA 2O5IC 5GQOA 2JK8A 5IWAQ 5GAHC 3P20A 1UE7A 1YVCA 3AYHB 4HJ5A 2BDOA 3OW7A 1PYSB 2MFIA 4X62Q 1Q81C 1TWAH 3FMCA 1OXXK 2Q2UA 3CCLA 4A3CH 3STBD 4RG1A 2CW0C 1CKOA 3D31A 2WP8J 1IW7C 4C2MH 3W3AA 1H9SA 1T5EA 1LABA 2OQKA 4DV5L 4DR5L 4B3ML 3QJYA 1YJ9A 2JA8H 2RHQB 2R6GA 4UY8C 3HKSA 4MTNA 4X65L 4B3TL 4WALA 2LSSA 4JCVE 1VCIA 3H0GH 1V1QA 2K4KA 2O5JC 1DT4A 3FP9A 4LWCA 2ZM6Q 3S15H 4H13C 1Y8OB 4R4IA 5H1SE 4J15A 2PQUA 5C4XG 1UE1A 4L5QA 4KHPL 3T53B 3CPWA 4LF5Q 4LF4Q 4JI7Q 3J81i 1NMFA 1ZYRC 2UXBL 1HNWQ 4X64L 3HKZE 4DUZL 1Z6HA 5C4XH 3I4MG 2E3UA 4IO9A 3VR3A 1G51A 1I6VC 4L5RC 4GZYC 1HZCA 2CKZB 2K52A 5BR8Q 2IX1A 3M3YH 3F2DA 2QEXA 3VR2A 3MFYA 4BBSG 1O7LA 4QQBX 4BY1H 3UDXA 3DM3A 1P16A 3F8TA 3NEMA 4TVAB 4JI3L 2AWNA 4LFAQ 5GADC 2ZJRA 3RNUA 3S16H 2E74C 2PNHA 2Q2IA 3GDEA 4HIOA 1L1OC 1CKNB 2L5TA 4R4OA 4NXMQ 2K5VA 4OX9L 3S2HH 2F1MA 1K9MC 1ZKOA 4YWLA 2RF4A 5KNBA 3F1ZA 1O78A 4X66L 2MO1A 2B29A 1D8LA 1SMXA 1L2FA 4BA1I 1YI2A 4B3SL 3GTQH 3HOVH 5BN3A 4DR7Q 1HH2P 4OWXB 3OW2A 5IYDH 1S3OA 1EWIA 2JE6I 2HHHL 4DAYB 1HNXL 4LW1A 4DV6Q 1W3SA 5ELNA 3HOZH 3CRLC 1CSPA 1X54A 4JV5Q 1HNXQ 4A3FH 2HHHQ 4H0LC 4GN4B 1EIYB 4A93G 3PUWA 1PFSA 3UE1A 1VQJA 3VKEA 2PY9A 2ZJQA 3GTOH 5M3MG 1IYUA 3M9BA
chains in the Genus database with same CATH superfamily
4B3SQ 3T4AC 2F4IA 3S1MB 1A62A 5LMNL 4A3DB 2K75A 1Y1WG 5M3FH 1MJCA 2F0PA 4JBMA 4LNQA 4RGNA 4QIWB 4DK6C 1TS4A 1VQ7A 2VY3A 4LUVA 2VQFL 4PNYA 5JPMC 4JV5H 2LY7A 5FLMG 1Y1WB 3GTJB 4XDXA 3ICEA 3PGZA 4TQUS 2DUDA 1PH3A 3QO2A 1MSGA 1X4NA 2F0GA 2RCNA 2A6ED 2R92G 2NVQH 1GUOA 2FINB 1U4MA 4F87A 4DR2H 1K8OA 2ZTDA 2M9VA 4EQOA 4Q0FA 4N8X1 4C3JB 4DR5Q 4HJ7A 5KGUA 1ZTGA 3KF8A 4L8JA 1AZQA 2CPMA 2F0JA 2Z6KA 1E1TA 4I65A 2UU9H 1EIGA 2FXQA 3GTLB 5M5WB 5C4ZA 4CHTB 2N8NA 3A55A 1TQOA 3SK6A 1B70B 2VB2X 1IKMA 2EY2A 4FO2A 1QE6A 4RGTA 1AW7A 1RL2A 2E76C 1KHIA 2F0QA 3U58A 3NELA 1ZZJA 3OIQA 3GTQB 2XIWA 2PI2A 2XTIA 4MZ9A 3CD6A 2V4DA 1L1OB 2E2JB 5CV9A 4OEMB 5E3FA 3JC66 1KLUD 1CA5A 2Q8TA 3A7LA 1PH6A 3I4MB 4BS9A 2JA6B 1CKMA 1Z47A 2RBMA 1VIHA 1EU3A 1UEBA 3DMUA 2NN6I 4G57A 3H3VC 4P71A 4KKUA 3KLRA 4ZUIA 2EXZA 4OX9Q 4KHVA 2JZXA 3PO3B 4GN5A 4DV0H 3K5NA 3HOWH 1QCBD 3CP0A 2Q2TA 4RGOS 4DV6L 4YY3H 1A3TA 1GUSA 1F0XA 2NN6H 4YWKA 2AQ3B 4DK1A 3RF2A 2PZWA 2HCCA 3PCOB 1PHJA 3ULJA 2F4VH 5LMUL 2P2RA 1F2MA 4KKSA 4GNXC 1OXUA 2Z9HA 2EJGC 3M3YB 1LM0A 1N8RC 4PV1C 2FJ2A 2VZAA 4LF4L 4CDCC 1EOVA 3RR5A 3I4NH 2B2WA 1YNJD 5J3BA 4DGZA 3G71A 4JI4H 3TP5A 3AFPA 4C56C 1GJXA 2A74C 2FHTA 5CC4A 3BVZA 4HN7A 4DK3C 2GA4B 4B9XA 4YIJA 1B4OA 4I7ZC 1PVOA 1E3PA 2NN6G 1ZEQX 2VL6A 1YJNA 4KHPQ 5A2QW 4FXDA 2E8GA 3KJPA 4YWMA 1GOZA 2A5HA 1EY0A 5IGEA 3SE0A 3SXHA 1EZ6A 1PZJD 1Q82C 3J81c 3D6WA 1PDQA 3R93A 1KAAA 1NJIC 4BBSB 5D14A 3IAYA 1WTPA 2HHHH 1NCVA 1TS5A 2NZHA 1SYFA 4YHHL 3H94A 4B08A 2DY7A 2RDGA 4AQYL 1E2ZA 3VYTA 2PQUA 3PUYA 1M90C 4Y7NB 3M85A 4GNXA 4DV3L 4C2MB 1HFNA 3MXNA 3NQIA 1J9OA 1SE3A 2PMZE 1SE4A 1F2YA 2SNMA 3VR5A 3NBHB 4WORA 3I4NB 1IW7D 1V1PA 5M9OA 5AJ3Q 3I2ZA 5M3MH 4IFDJ 2CTLA 4A3DH 4LF8H 4GKJQ 1BNZA 3OMGA 2LS01 4UPAA 1OXSC 3KOJA 1ZXTA 1Z9FA 4L63B 1K3RA 3W5OA 2HIXA 2R7DA 2K28A 3TP7A 5IT9L 1CZGA 2K1HA 3M4YA 4ODGA 3H15A 4LF6L 3NE5B 1BCPC 1K1GA 1TWFH 1HNZL 4JI0L 3BZCA 1KNAA 1IBMQ 2E2IH 1R9TH 5K36H 1TWCH 3M4PA 2UXCH 4AM3A 2K5HA 4OONA 4JK1C 1WVNA 3STBC 4M1UB 1X3QA 3ND9A 4IPDA 4ZKCB 3VDYA 3QD7X 2VQEH 1SXTA 2F0FA 1BBXC 5C3EG 4GLVB 5IP7G 2UXDH 2KUMA 2YU9B 2F0OA 1ML0D 2FMCA 1WVLA 4A3DG 2WB1B 4ILWA 1AH9A 2QF7A 1BF4A 4B8CD 4LF4H 2BOSA 4LF9H 5F2DA 4A3IG 1VS0A 3K59A 5CV5A 2Q8RE 2AUJD 4BXXH 4JPBW 5IGBA 5C3EH 4PQXA 3HFZB 4A3MG 3JAML 4PZ6A 2HCIA 3QB3A 1DOMA 2K5QA 3LWUA 2EYMA 1W6KA 1SBBB 1Y14B 2QNDA 3T1YL 2HDMA 1H9SB 1NAPA 1PTOC 2OXPA 1S72A 4HIDA 4RKBA 4AIMA 4NW2A 1N33H 1KL9A 1LACA 3Q8DA 2KEEA 4R8IA 2X6LA 3GP7A 1TWGH 2Y0SB 1DXMA 4BBRB 1YBYA 1IBKH 1U5KA 3T1HH 2YQRA 3J80L 5LMUH 1FD7D 2E2HH 1V43A 1E0BA 4DV2L 2VQEL 1PTOF 2VQEQ 1JOOA 4O42A 2UUCQ 5HURA 4YCVA 2RDHA 1BCPB 5LL6S 4RHRA 3A56A 4O0AA 3NTKA 4QMFB 1SJHD 4H02A 3GTGH 2DNEA 2EXDA 2B63H 1IBMH 4S3SA 5C44H 2ICIA 4X3TA 1DONA 2OWOA 1V8QA 4KHPH 5LL6b 4B3RL 3M4OH 1XMOL 2L0CA 4P75A 4P74A 2WINB 1NY4A 1B9MA 3CCJA 3A8IE 1C4QA 4HIMA 1JB7A 4IPGA 5C0XI 3EQLC 3PO3G 4GKJH 1SE2A 4A3JG 3PIO3 2B2UA 3PO2B 2JN4A 3NCVA 5CV7A 4N8FA 3W1GA 5ELBA 4BBRH 1AN7A 4DV0L 1IXRA 2PQAA 3J80c 1B9NA 4AYBE 1YIJA 4CBVA 1BXTA 3VR6A 4DV2H 1CUKA 1J5EL 4H44C 2R61A 1HTLD 3F2BA 2XRSD 1B44D 5JEAG 2QKIC 2UXCL 2H1EA 2HQLA 2ZXOA 2C9OA 3D0FA 4IUTA 1X6OA 2XWJB 3LNNA 1F2ZA 1SROA 3TREA 4QJFA 5J1ZA 4BBSH 1RJTA 1TWGB 4MTKA 4JI4L 3TS2A 3MEHA 3G48A 2CQAA 2K6AA 1PZID 3EA6A 5FLMH 3M7NA 2OTLA 1N34L 3QR8A 4WANA 1EWCA 4A3MH 1JWMD 1LV9A 2WB1E 4JVYA 1FL0A 4WFN3 3HP3A 5LMNW 1M1KC 1MJEA 1XPUA 1BCPF 2WB1G 3GV3A 1HR0Q 4J1MA 4CGYB 4HJ9A 3TRZA 1QILA 4ZUJA 1I50B 2I46A 1GD7A 1I4XA 4MHEA 4JI5Q 3PO2H 4RFBA 2B2UC 1HQMC 2GVBA 5AJ3L 3KLWA 2R92H 2YTVA 2D62A 2KQ3A 2BH8A 4HEDA 4ME5A 5I2XA 1MGSA 1MSHA 3GR5A 4H8AA 4ZAIA 2NVXH 2VNUD 1QVCA 3SB1A 4FXKC 5C3WA 3A74A 4DR5H 1PH9A 4YHHQ 1YNND 1BBUA 1VQNA 1S5CD 1M8AA 1STBA 5NUCA 3NXWA 5IWAQ 1UE7A 3AYHB 1PYSB 1TWAH 2KOLA 1OXXK 4RG1A 3D31A 4KK7A 1IW7C 2PW5A 4DV5L 1H9SA 4B3ML 3G7LA 4LMQD 3QJYA 1FNUA 1VMPA 4UY8C 4B3TL 1UEAB 4MTNA 1CHPD 4X65L 4WALA 2R3ZA 1VCIA 4LWCA 2ZM6Q 5G3LD 3T1YH 3W2DA 4KHPL 3S15B 3J81i 1ZYRC 5JVG3 4X64L 2QW7A 3D4WA 3M4OB 2CH4W 3SEBA 5C4XH 1G51A 1HZCA 2F0HA 4DXFA 2QEXA 1PQXA 4BBSG 2B2TC 2QDBA 3UDXA 3F8TA 1P16A 4TVAB 2QCPX 5GADC 1ICFB 1XTCD 2ZJRA 2PZTA 1G91A 2Q2IA 4NXMQ 4OL7A 2L5TA 4X66L 4LF6Q 5EKLA 2B29A 1D8LA 4DR7Q 4BA1I 2CH4A 1RD9D 3OW2A 5IYDH 2JE6I 4IZ8A 4DAYB 4DV6Q 1W3SA 4LFBH 3H09A 3HOZH 4JV5Q 4A3GB 1TWAB 4F88A 1EIYB 5LHY1 2PY9A 1EY6A 5CR3A 2XRQD 1X9ZA 1IYUA 2PT7G 1S03G 3EBEA 2E5LL 1SLJA 3RN5A 1WTVA 1XMOH 4DAVA 4NZRM 4DV3Q 3EJIA 1KDCA 2MQHA 4C3JG 1PH2A 1FNVA 1N34H 3UE0A 3X3MA 3FKIG 4DR4Q 1SNMA 3J7AK 4GN3B 4Y7NH 1H9KA 1VQDA 2A1AA 3K7AB 1A3VA 2IX0A 1ASZA 4DV4L 1YEZA 3MXNB 2F0WA 1NTGA 1UG8A 4KTAA 2R93G 3H0GB 4LF5L 4EGVA 1UE6A 2AMCB 4X62H 1LTTD 2NZOA 5IY0A 4GS3A 1XNRL 1XMQQ 2ID0A 3FEWX 4JVZA 1V9NA 2DN8A 2ALYB 1WHRA 4DV5Q 4LUOA 4JI1L 4DV4Q 2IHFA 4HR7B 1DOLA 2LTLA 1I4RA 1I5FA 1LTBD 3U50C 2CCZA 4FF2A 1STHA 2WIIB 4LFBL 4PG3A 2NVTB 1DD2A 1Q8IA 5FJ8H 2E75C 1VQKA 3GV6A 1FNWA 2E2IB 2JP1A 2NTTA 5LMNH 3K0XA 1TXYA 4P72A 1UWVA 5EAYA 2K04A 4PMCA 4C3IB 1ONLA 1T5XD 3HOUB 1MKHA 3KDKA 4K8IA 4ALPA 3S2HB 2F0MA 2VQFH 1J8IA 1SNOA 2UXBL 2CQOA 1IYJB 2L4NA 2BA0A 2NTSA 2ZXRA 3NBIA 2SEBD 2VXWA 1I4GA 5IT9E 2JA6H 4TKOB 2PO4A 4LJZC 1Y1VB 5JVH3 4DUYL 1DOKA 3S1QH 3P75A 1LUZA 1RDPD 1ILPA 4YY3L 4KKTA 3D4DA 4JI8Q 1JCKB 1N36H 1N34Q 1HRJA 1VF5C 2DNCA 1V1OA 2YTXA 3PF5A 5EPKA 4JI4Q 3IRBA 3T51B 4JI3Q 1HXYD 2N78A 2R7FA 2ANNA 4K5XA 3TQYA 1WTXA 1SEBD 2OQ0A 2XNAC 4DXGA 2CTFA 3CAMA 1QJOA 1DTJA 1G6ZA 4C3HB 2KHJA 5BN4A 2ZQEA 5M5YH 4DUZQ 4YHHH 4A3GH 4IOCA 3K80C 5GAEC 2F4VQ 1SMYD 2RSNA 1GHKA 1LTAD 3SHLA 3F2CA 3OSOA 4B3TQ 1HA5A 4UHVA 2Z8LA 3BDCA 3JAME 1JICA 2L12A 4B9WA 4XTCS 4A3GG 4IFDI 5IE8A 1H95A 2I5LX 2VB3X 5IWAL 3DUZA 3D6CA 5EJWA 3KBXA 4ZRZA 3AQQA 3MXGA 1N36L 3L0OA 2B63B 1ODHA 4EX5A 1K83B 5T1GA 2A6HC 3GO5A 3KF8B 3ONAB 3OYYA 3NPPA 5C44G 3R2TA 1EYDA 2YTYA 2KEDA 4A3EG 3H6MA 4JI2Q 4OGQC 3PUZA 3PV0A 1JJGA 4A3JB 4IUQA 3PO2G 4DV7Q 1A63A 4RCOA 2P5ZX 2K5WA 4FF3A 1A6XA 4AH6A 5I9OA 2K7VA 3P1HA 1XNRH 1JOKA 1L0WA 3UDGA 4BY1G 2JYOA 2JA7G 3CKIB 1WE8A 2A8VA 1D1IA 4QUFA 4E6IA 2EYJA 5DAUA 3CMAA 1RIPA 4ZKBB 4A3KH 3CCMA 3M7GA 3ER0A 1HNZH 1N32H 2B3GA 1Q90A 5ELOA 5A2QL 2FPHX 1PH5A 3FHWA 1TU2B 1VQ5A 4KY5A 3MVVA 1WCMB 4IPCA 2N3SA 1IYVA 4QCLA 2UUBH 3Q23A 5M5XB 4UAIA 3RMHA 5TSSA 2JSOA 2M8WA 3K7AH 1KRSA 3NWSA 1EYCA 1N33L 2UXBH 2IY5B 3ERSX 3X3NA 1CZWA 1TWHH 3I56A 1AFPA 3HOYB 1SAPA 2HDLA 1VQBA 4HTHA 4LF7Q 1IBLH 3S1NH 5LL6X 3NUCA 3SGIA 3D8GA 1X32A 4AQYH 3NP8A 4IUNA 4BBRG 5EPLA 3EN2A 1SMYC 4JI7L 1K28A 4A3EH 3E3XA 5HY6A 3E9IA 1X3EA 1D7QA 1XMOQ 1S5FD 1LTRD 1SYDA 5C5MA 1R4PB 2KCMA 1PRTB 4B3RQ 1I94H 3CW2C 5IYBG 4POGA 2PNRC 1TWHB 3JAMi 4FYDA 1SNPA 3CU7A 1TS3A 3N6RA 3V05A 2A69C 5FLXW 4GOPC 3I73A 3NWTA 2IHEA 1E2WA 3E5SA 1HUNA 3IFTA 2G8YA 5JEAJ 3AEVA 1X55A 2EYHA 2VW9A 4QF4A 2UUCL 1PRTC 3S1QB 3NBHA 4KJOA 3HOZG 2L9HA 3KUPA 4XQQA 2ENBA 1JWUD 4C3IG 1FKAH 5KYIA 4JYAH 3EFXD 1IL8A 4AYBB 3OOCA 1H9RA 1PA6A 3H91A 3RLFA 2D2CC 3J81E 1F2LA 2F0SA 2E2HB 1ZZKA 4HIKA 3MFGA 3TS0A 5J22A 3PUXA 4P2CB 2UXDQ 3Q22A 2V1CC 3PMFA 4PZ7A 4FP5D 1D2BA 3K5MA 5C3XA 1KDBA 2JA8B 4KN4C 1SNQA 4HMIA 3ZJYC 4X6AH 4QY7A 1CQVA 1B2TA 1RTNA 1EWHA 3T1HQ 1TT2A 3MHBA 1KABA 1MSZA 3TBIB 1VQHA 3A7AB 1IZ6A 3F2UA 1ILQA 2LXKA 2JVZA 1VQFA 4RCNA 3VA7A 4LIJA 5EGTA 3QWNA 1Y1WH 3DLLA 1I50H 5I2YA 2KA7A 4PMBA 1X65A 4DV1L 2ICEC 4K8JA 2PYKA 4KHZA 3RD4A 1CTMA 2EY1A 2IPKD 2EYFA 1B53A 2YV5A 3BVGA 4K6LA 4RA8A 4DF7A 3KF6B 5C0XG 1HPCA 3A54A 1HR0H 2J4XA 1NNXA 4O2DA 1HNZQ 2LTMA 1YITA 1EQRA 3H3VH 1TVXA 1UUPA 4DV5H 4FDBA 2BDNA 2B2TA 1A0IA 1TKWB 4R4CA 5FK9C 1YNXA 5C0XJ 2R93H 1BO0A 3NTHA 1XTDA 2K33A 5I9PA 3MEFA 2D5DA 4UDUC 2ES2A 1HZ9A 3OTOH 2PPBC 4CDDC 4A3KB 1PYWD 4MN3A 3TDQA 2I5MX 4A3MB 3EZJA 1O7YA 1Q3LA 2PI2E 2RHSB 2RVLA 1QVFA 3MXPA 5CV6A 3HOUG 1HFGA 4OO1H 1EOTA 2CWPA 3FKIH 3ITPA 4LUZA 4FNFA 5IGGA 2R92B 1DGSA 4C3IH 1SYEA 4ME3A 1LT4D 2RSOA 3KLSX 5D3DA 4A3CG 2IX3A 5I6YA 1JQYD 3TN2A 1STNA 2A1SA 2TMPA 5JOBA 1XNQQ 2G5DA 2UUBQ 5JPNC 4R8NA 1A2TA 2QA4A 4B3TH 1CT1D 4C3JH 3HOXH 4DR3Q 5GQOA 2O5IC 3OW7A 3CCLA 4A3CH 2Q2UA 3T16A 1TUAA 2M6QA 4C2MH 4QGUA 2WP8J 3W3AA 4DR5L 1U4RA 2JA8H 2JA5B 2RHQB 3HKSA 3C46A 5EQ0A 2K4KA 4N9PA 2B2VA 5CV8A 3S15H 4J15A 4B3MH 1NMFA 4CKCA 4JI3H 2E3UA 3VR3A 4L5RC 5BR8Q 1BCPD 2B2YC 1O7LA 3DM3A 2NBFA 3RZDB 5CGKA 3FRPB 3GTMB 4EVOA 3RNUA 1F77A 1DM0B 2MUYA 4R4OA 2K5VA 1RKNA 2F1MA 3DHQA 2Z6BA 1L2FA 3J80W 1HH2P 1EWIA 2CVRA 1HNXL 2EY6A 4LW1A 5D65A 5ELNA 3CRLC 1CSPA 5L37A 3PIP3 4A3FH 4A93G 3PUWA 1RTOA 3UE1A 3I8ZA 5T1IA 3VKEA 1G8ZD 3S1RB 4HSVA 1PMRA 5C6AA 3CF5A 4YY3Q 3GTPB 4A4IA 4HJAA 1K8AC 3K7UC 4DUYQ 4HJ8A 3S2DB 2EJFC 2UUAH 1BBWA 3GKUA 2OPVA 1LTGD 1OXTA 2D0PA 1CI3M 1B7YB 1LT3D 3E0EA 2HT1A 2HQEA 1X3FA 5BR8L 3I72A 1FGUA 4BY7G 5DM73 4QMGA 1VQIA 3ZYYX 4A3LG 3FVQA 2PW7A 3BZKA 5K36G 4GLXA 4GNXB 2A68C 2NUCA 1JMCA 5EBCA 1N36Q 3HS0C 2RDFA 2WAQB 3CCSA 4L5SA 2Z4HA 3CCQA 3GQBA 4G7OC 1TIID 2E2JH 3W1BA 5DLQE 1EYAA 1SYBA 4JI1Q 1QZGA 4U673 4TSSA 5D3IB 3OETA 1MD2D 3OTOQ 2X06A 3I90A 1JT8A 1AEXA 4JOIA 4ZLTF 2VQFQ 3OPOA 3HG9A 2N55A 4QIWE 1XNQL 1WFQA 3J81j 1KAWA 1QUQA 5IOCA 1EQVA 5LMNQ 3VR4A 2QILA 2JA6G 4K6DA 2BA1A 5IP9H 4IOAA 1G2TA 1JORA 1KHMA 2CTJA 5A2QE 2F3IA 1DJRD 5BN5A 3FAUA 1HNWH 5J39A 4H7BA 5CBEE 4A3FG 2LMCB 3K6OA 2ZTEA 3TEHB 3GTOB 2CFMA 1ENFA 1Z2IA 1AZPA 4DNRB 1IHZA 2A69D 1VBIA 4IURA 3CC7A 1T9HA 2K03A 1S5ED 4JBJA 5C4JB 1D5MC 4G7HC 4GKKL 1BR9A 5C5LA 2KJXA 1SN8A 4UP7A 2VS1A 4B3SH 3KDGA 3KF6A 3DEOA 4A75A 2UXBQ 2YU9H 2RKSA 4OO1G 4JI6L 1B3AA 4KLKA 3RLOA 1HNXH 4HAEA 5IYCG 2EJMA 1II3A 1WYDA 3HOYG 1KXLA 3CXCA 2MO0A 3E0JA 1JJCB 1PZKD 4ABNA 2HH2A 1FR3A 2I5HA 3HOYH 5EBDA 2EYPA 4KMUC 3S1NB 4K2LA 3S14H 2PMZB 3LGJA 4LFBQ 2I0QA 3BG3A 4Q5VA 3SK8A 4IUPA 1U4LA 1WCMH 4HMJA 5IT9c 1EQTA 3J7AV 4DNTB 4A3BH 2CTMA 1ET9A 4DR7H 3A8KE 1XNRQ 3HOWG 1O7ZA 4A76A 3ULLA 4DR3L 4P73A 4DUYH 3S9WA 4BY1B 2UUBL 4IFDG 1EY9A 4JI5H 1EEFD 2K05A 4BXXG 3D3RA 3T1HL 4JI2H 1EY5A 4IQZA 1VQOA 2RA4A 1X4MA 1OO9B 4XT3B 4DR2L 1E22A 3J81L 1D5ZC 1GXDC 3S17H 5GAGC 3TZUA 1DZ1A 4DR1H 1WTHA 2EYOA 3DWQA 1PV4A 2Z6KC 1ET6A 2FMMA 3RUZA 4DR4L 1KNEA 1GVPA 3UI2A 2JA5G 1Q7YC 4JG2A 5DM63 4NXNQ 4DR6Q 3RZOB 3CMEA 4DAMA 4RMFA 4LK1C 4K0KQ 3IFDA 2UXDL 2J0TD 3URYA 5I6WA 2ZM6H 1FVIA 1UAPA 1HCZA 1MIUA 2PQEA 3QG1A 4R1JA 1G6PA 1BOSA 2F0LA 2NB0A 3CC2A 3AEVB 1TR5A 2HUGA 1EIFA 5M3FB 1Q86C 2UU9L 1O7IA 5FKAC 5KEEA 1K0RA 1A2UA 1EFID 1I94L 1ENAA 2L15A 2EY5A 5FLXc 2TSSA 4HCSA 3KBGA 2JEBI 1C48A 4DR7L 4OWTB 4Z9CB 4LFCH 1EFWA 1IBLQ 1JWSD 1YHQA 2LF0A 4X3KA 2O2LD 1GUNA 4POFA 1VQ8A 3C1FA 3I4OA 1B8AA 4JBKA 1EZ8A 2EE1A 2O4XA 2NVYH 1GUWA 1PXUA 3RLNA 3EIVA 4MIUA 3SDZA 5M3FG 1VF7A 3T56B 2X6GA 4R4TA 3KLSA 1Y8PB 3L7ZC 4OWWB 4XQNA 3PUVA 1K8MA 3SVMA 2VUMB 1CKNA 4QB4A 4GKKH 2F0DA 1YZ6A 4A93B 1D5XC 2A6EC 4M8AA 3CQZH 4RKLA 5A35A 3K58A 4BY7H 1Y69U 4OELB 2ZM6L 2DY8A 1VQAA 2SNSA 2B2WC 4EQNA 1QNKA 2G9DA 4B3MQ 1R9TB 2BE5C 2E5LH 4KY6A 4OD6A 1B3QA 1SR3A 1CQFA 3PSIA 4DK0A 3S17B 4LF7L 3V69A 5KNCA 2E2DC 1YNJC 4KD4A 1BDOA 1BVSA 1DYQA 4DN4M 3I4MH 1PRTD 2D9IA 1X3GA 1VQ9A 5M5YB 4DR3H 2NVQB 4AYBG 1XWEA 2NVYB 3CCRA 3N52A 1YNNC 4LF5H 4DAPA 4CDEC 5IYCH 2ASBA 2DGYA 2DJGC 1TY0A 3BDOA 3HOWB 4DPGA 2IWHA 5C3EB 1K3BC 4DU9A 1C0AA 2CWHA 1CFMA 3J80i 1Y1VH 3DWAA 1LT5D 1WTOA 4C3HG 1I6HB 1EY4A 2DJFC 5CYUA 1VQ4A 2LKVA 4ULLA 1PFBA 1HZBA 2DGRA 2NYZD 1X3PA 1ZYRD 4B8TA 1F9PA 1QWYA 3MA2B 1HR0W 2A6HD 4FVMA 5FO9B 5ISRA 1X9NA 3DEPA 1F9SA 2VKCA 1WOCA 1SE8A 2KCTA 1GHJA 4FF4A 5IYBH 3DM1A 5HGTA 3ULPA 2K50A 2B2YA 3BJUA 2JJQA 1VQCA 4NP5A 5IODA 2CWFA 4DR6H 2KCNA 5M5WH 3WOFA 1VQLA 1PTOB 2ZXPA 3CC4A 2BH2A 1FYCA 2XWBB 5E1FA 1NUCA 3ERQA 3U1KA 3AMUA 3S2DH 1F9QA 1RODA 1S40A 2B2VC 3DXJC 2NWGA 2I07B 3IKJA 3KDFB 4K0KH 3DWPA 2R7ZB 1PFMA 4DV1H 2F4VL 1WCMG 3ND8A 1D1KA 2F03A 3AB9A 1RHPA 4QL5A 2OF1A 3RZOH 4NBQA 1KQSA 4Y52H 3FPPA 2CWAA 4NB3A 4LF8Q 5CORA 3R3OA 4LFAH 1OXVA 2H5XA 2FFKB 2MNAA 2B63G 5JJKA 1PH1A 4LAAA 5EKIA 4DKAC 1KD1C 5C44B 2AQ1B 2Z4IA 4G4KA 2OTJA 3GTMH 3BDLA 1YJWA 1E1OA 4JI8L 3EVQA 1Q12A 4A3BB 4GOPB 1CM9A 1XMQH 1WTJA 1GUGA 3GTKH 4F8MA 1SYGA 3I3CA 4DV7L 2IW3A 1HZAA 1SSOA 1YHAA 4GKJL 4BA2I 2L1BA 4JI2L 4APVA 1NSNS 4KN7C 1AN8A 1ESRA 2JXMB 2WFWA 4C1NI 2Z1CA 5HGQA 5IP7H 1AE3A 4KI0A 4DR1L 4K0KL 4BWGB 1ASYA 1S5DD 5ELEA 4DR4H 1PH8A 5CV4A 5COYA 1J4WA 3CCUA 4NXNL 1E24A 3CQZB 1EIHA 3KK7A 4DV3H 4A93H 4WJ3M 5KRUA 4KY7A 1VQEA 3P20A 5JJZA 2MFIA 3FMCA 1PTOH 4K2KA 3STBD 1CKOA 2CW0C 3S16H 1T5EA 2OQKA 1X0AA 4LF7H 1LTID 1YJ9A 2R6GA 2LSSA 4JCVE 1V1QA 1PLFA 1DT4A 4CKEA 3FP9A 1A3UA 1B1ZA 5H1SE 1Y8OB 4R4IA 4EQPA 4L5QA 5FLXL 3T53B 3CPWA 4LF5Q 2EYLA 4ZQ3A 3J81W 3V2TA 1HNWQ 3HKZE 4DUZL 1Z6HA 1XRHA 1I6VC 1SJED 2CKZB 3OMCA 1LTSD 5DEHA 2IX1A 3M3YH 4NZTM 3F2DA 3J7AF 3VR2A 4I7AA 3MFYA 2H4OA 3NEMA 4JI3L 4LFAQ 1STGA 2PNHA 3U9OA 3GABA 3I91A 4HIOA 2D9UA 4A3IB 3S2HH 3S14B 1K9MC 2E5LQ 1I4HA 1ZKOA 2RF4A 4YWLA 5KNBA 3NQTA 4NKLA 1YI2A 1MBYA 1SMXA 5BN3A 2C5CA 1JE4A 4OWXB 1S3OA 1QG7A 3VYUA 4JI1H 3HOVB 1SFOB 4F7XA 1X54A 2LRRA 2X69A 1PFSA 3L9AX 4O1NA 2ZJQA 3TZDA 4L6TB 3GTOH 1EY8A 5M3MG 2UUAQ 3M9BA 4FF1A 4PDBA 4HSPA 4NXML 2LFNA 1STYA 3J7YW 1N32Q 3FPUB 3OSSD 3HRZC 4EC5A 3Q6SA 5DT9A 4LFAL 2Q2HA 1JOQA 3MTSA 2VUMG 3K81C 4DR6L 3G6JB 4IN3A 1W2BA 5CMDA 1XYIA 3KJOA 4RAUC 1V1PB 2EIFA 1IL2A 4DR2Q 1VQGA 1HNWL 3P7JA 4DV7H 3K57A 4R4QA 3K5LA 2PZUA 1XMQL 5ELDA 1B50A 1GKHA 1KDAA 1NBWA 2WKCA 5FO7B 1JE5A 4ID6A 4X65Q 1WJJA 1JB3A 2JA7B 4A3BG 2F3VA 5JAVA 1XPOA 3WWVA 4XYOA 2EZVA 1SEIA 3U4ZA 2L11A 1G291 1LLRD 3WOEA 3PF4A 5C0XH 5IGFA 1UE5A 1CHQD 3QOLA 2SDFA 3MWYW 3NSWA 2CPQA 2WACA 3A0JA 3SK4A 3VA5A 4PMWA 2LXJA 1JR0D 4K14A 5AFWA 5KYLA 2Y0SE 3T13A 1QOHA 4DR1Q 4GOPA 2RQXA 1N32L 4X65H 2R7ZH 3J7A5 2CTKA 4JI6Q 3OWFA 1CSQA 4OXPA 3HOXG 2UUAL 4V0BA 4C1NK 4BY7B 1Q46A 4DNIA 5IP9G 2NZ1D 2WKDA 1X56A 3HOXB 4JV5L 4DUZH 4NPSA 2EQSA 1S20A 4E9JA 3E6ZX 3S1RH 1NR4A 5K5PA 5JJLA 1DCZA 1NR2A 4ZK9B 3NHHA 4JI0H 1J6QA 2K01A 4X66Q 5C4JH 2F0IA 3HKZB 1PFNA 5GROA 3VYRA 1SDFA 3HOUH 1K0SA 4IJHA 3OIPA 4G08A 3U4VA 2HD3A 3G4SA 4YCWA 2PQAB 3HGBA 1ICWA 3BU2A 2N49A 2K14A 3IL8A 3R8BA 3B6YA 2OPUA 1WTWA 2CTEA 3NTIA 3BZDB 1WTQA 1AE2A 4X3UA 4X64Q 2QEJC 2AQ2B 2F0EA 4OCHA 5KNDA 2EPBA 4EQ5A 5FOBB 2KBNA 4NDXA 2UUCH 4JC0A 2KHSA 3UDIA 1L1OA 1SNDA 4XQJA 4X64H 3OTOL 4RWSC 4OIJA 3VYSA 4A3JH 2Y0SG 1M4VA 4FJSA 3I0PA 4DA2A 4IUVA 1QUQB 3V96A 3AU7A 3GTLH 2NVTH 1SYCA 1H9MA 1HHVA 1TWFB 5M5XH 1WD1A 2MHVA 1LTLA 3LWEA 2OCEA 1XX8A 4LF6H 2B39A 4DV4H 2AWOA 4GLAC 3GTGB 4X66H 2B8GA 3PIPA 4K5VA 2R7ZG 4A3LH 4X62L 3E9HA 1EYGA 4FJUA 2MJ8A 2BE5D 2F0KA 3GTPH 3A8JE 3L2PA 2IT1A 4NXNH 3BYTB 2BCOA 2KHIA 4IALA 1ESFA 2G9HD 4JI5L 3RN2A 3BVMA 3QOJA 1L0XB 4R9WA 2AKWB 1BQQT 2XVSA 2YYZA 2XSCA 3PIOA 3PQIA 2A19A 1HR0L 4JYAQ 2F0TA 1YHBA 1C9OA 1EU4A 1ENCA 1MI2A 3CRKC 1STEA 3TP6A 3G6EA 2Z0SA 1QVGA 2KENA 1K83H 2AUKA 2FMRA 1QZHA 2D0OA 2MGSA 1VMCA 3M4QA 4PZ8A 1V8CA 2RCFA 5EKKA 3CCEA 1KIXA 1RCVD 1OTCA 1QB5D 2XGTA 3JAMc 2B8FA 1PRTF 4C3HH 2QDLA 5IWAH 2WAQG 3TSSA 1EQQA 4LF8L 2F52A 4CJ2C 5FO8B 1VIGA 3K8AA 3R2IA 5C4HA 1Q1BA 3T1YQ 2C35B 5FJ8G 2UXCQ 1ZZIA 3D4RA 3FKIB 3OHXC 4CJ0B 1Y1VG 5IGCA 2F3WA 3FDTA 1GUTA 4CKBA 5CBAE 5E7NA 1J5EQ 3NK9A 2GVAA 1D6EC 2Q8IB 4DAYA 3I4LA 4A3IH 1IBKL 1NXUA 1I4PA 5G3LF 1KRTA 1KLGD 4DV0Q 1W6JA 2EVBA 2JA7H 1VQPA 1LT6D 1GO3E 3J7ZC 1I6UA 1VQ6A 1FJGH 1EL0A 3SK5A 2F0UA 4A3KG 3UOEA 5IIFA 3GD7A 4JBWA 3HKZG 2ZJPA 1JJ2A 1WD0A 2K5DA 3O13A 2JQOA 2M00A 2JA8G 1Q8KA 4KJNA 4DV1Q 2NVXB 5KIXA 4JVHA 3I55A 2JA9A 2WAQE 1HQRD 1U4PA 3A5ZB 1H9JA 5I4DA 4LFCL 4B3RH 2FFMA 2IJ0A 4V190 1IBML 1HTPA 5IYDG 4JI0Q 1KC8C 1PTOD 4A3EB 5BR8H 1HJPA 4WRDA 1K8GA 5ELCA 1WTRA 2XN9C 4CJ1B 4DV2Q 1WI5A 1I4QA 1FGBD 3K0YA 1I94Q 2A68D 1NE3A 2JEAI 4ZCKA 2K1BA 1E7ZA 3C3LA 1XJVA 1HA6A 2MPMA 1J5KA 2OT2A 1R4QB 3K5OA 1I6HH 3UDFA 3GTKB 4IPHA 4AQYQ 3QIAA 1VQMA 4LF9L 2JA5H 4G7ZC 1K73C 2BL5A 1O80A 4J6HA 4XXEA 2GN5A 1I3QH 3HZXA 2F0VA 1N9WA 1V9PA 1TY2A 2ZT9C 5E4XA 1XNQH 2MJHA 1SNCA 2N88A 2QGQA 5ELFA 3NENA 1PYBA 1SRUA 1FJGQ 1PH4A 5FLXE 4IFDH 2PCFB 2K5NA 4IJLA 3HOZB 1VDZA 1BKBA 4MNOA 4LFCQ 3EROA 1C7YA 2MP1A 3GTJH 4OX9H 3AFQA 4FXGC 2AHOB 3RZDH 2L55A 2CW0D 2ZTCA 3Q24A 5IT9W 5EPJA 2EDGA 3LX0A 1PH7A 4WJ4A 3S16B 5M3MB 4IUUA 4OIKA 4L5TA 3WDNA 2J7ZA 1IKLA 1XPRA 4OHJA 3CPFA 3I4NG 3KDFA 5JJIA 2KECA 4UP8A 4YCUA 3HOVG 1EUJA 3KYHC 2ATWA 1A15A 1S5BD 1IBLL 3MXUA 4JOIC 1FJGL 5LMUQ 1S4ZA 2KCCA 1CA6A 1U9RA 1P8LA 3C1EA 1IBKQ 3KFUA 5E4WC 3S24A 4CDFC 1STAA 4GKKQ 1RF2D 4K5WA 4OO1I 4JI7H 4QUCA 1N33Q 4LF9Q 1EC6A 2UU9Q 3S1MH 1LO5D 1NMGA 3CCVA 3H0GG 5JEAH 2OEOA 4N9TA 1MHWC 2AXYA 2VUMH 4J8QA 2ANRA 5C4XB 4WJWA 3I7FA 3TMEA 4RH6A 4XIGS 2HH3A 4XYQA 3CHBD 3A5UA 1SFOH 4KV6A 1AP0A 2EOTA 1A8VA 1U0LA 2K32A 1Y8NB 3U9SA 1LYLA 4TRDA 1UNSA 2R93B 1J5EH 1XXGA 3PO3H 3H3VI 4JYAL 1E2VA 1Z7TA 3J80E 3MAQA 4NMZA 1BUVT 1GM5A 2HIVA 2CHBD 2SOBA 1Q1EA 4UP9A 3TP8A 1QNUA 2KVMA 3MZ5A 2JK8A 5GAHC 1YVCA 4RGMA 4HJ5A 2BDOA 4X62Q 1Q81C 4A3FB 1KTKA 1LABA 3C2PA 3H0GH 4JI8H 4KD3A 2O5JC 4H13C 5C4XG 1EEID 4HCEA 1UE1A 1L0YB 2Y3MA 4U68A 5DNFA 4LF4Q 4JI7Q 3HEJA 1F9RA 3I4MG 2F0NA 4IO9A 1TS2A 3BYYB 4GZYC 2K52A 3OWEB 1C8CA 3BS1A 2M2LA 2IL8A 4QQBX 1CK1A 1JC7A 4BY1H 2O4CA 4X3SA 2AWNA 4JW0A 1G2SA 2E74C 3MC0B 1TWCB 3GDEA 1L1OC 1CKNB 4DV6H 1EY7A 4OX9L 4ZYSA 3JAMW 3F1ZA 1O78A 4B3SL 2MO1A 3GTQH 3HOVH 5IGDA 4DFAA 3Q0AA 4JI6H 3L3OC 2HHHL 1HUMA 4NXMH 4RHSA 2WV6D 3SR1A 1HNXQ 2HHHQ 4H0LC 4GN4B 4XT1B 1VQJA 1I3QB 3I70A 2A73B
chains in the Genus database with same CATH topology
4B3SQ 3T4AC 2F4IA 3S1MB 4A3DB 1A62A 5LMNL 2K75A 1Y1WG 5M3FH 1MJCA 2F0PA 4JBMA 4LNQA 4RGNA 4QIWB 4DK6C 1TS4A 1VQ7A 2VY3A 4LUVA 2VQFL 4PNYA 5JPMC 2LY7A 5FLMG 1Y1WB 3GTJB 4XDXA 3ICEA 3PGZA 4TQUS 2DUDA 1PH3A 3QO2A 1MSGA 1X4NA 2F0GA 2RCNA 2A6ED 2R92G 2NVQH 1GUOA 2FINB 1U4MA 4F87A 1K8OA 2ZTDA 2M9VA 4EQOA 4Q0FA 4C3JB 4DR5Q 4HJ7A 5KGUA 1ZTGA 3KF8A 4L8JA 1AZQA 2F0JA 2Z6KA 1E1TA 4I65A 1EIGA 2FXQA 3GTLB 5M5WB 5C4ZA 4CHTB 3A55A 2N8NA 1TQOA 3SK6A 2VB2X 1B70B 1IKMA 2EY2A 4FO2A 1QE6A 4RGTA 1AW7A 1RL2A 2E76C 2F0QA 1KHIA 3U58A 3NELA 1ZZJA 3OIQA 3GTQB 2XIWA 2PI2A 2XTIA 4MZ9A 3CD6A 2V4DA 1L1OB 2E2JB 5CV9A 5E3FA 3JC66 1KLUD 1CA5A 2Q8TA 3A7LA 3I4MB 1PH6A 4BS9A 2JA6B 1CKMA 1Z47A 2RBMA 1VIHA 1EU3A 1UEBA 3DMUA 2NN6I 4G57A 3H3VC 4P71A 4KKUA 3KLRA 4ZUIA 2EXZA 4OX9Q 4KHVA 2JZXA 3PO3B 4GN5A 3K5NA 3HOWH 1QCBD 3CP0A 2Q2TA 4RGOS 4DV6L 1A3TA 1GUSA 2NN6H 4YWKA 2AQ3B 4DK1A 2PZWA 2HCCA 3PCOB 1PHJA 3ULJA 5LMUL 2P2RA 1F2MA 4KKSA 4GNXC 1OXUA 2EJGC 3M3YB 1LM0A 1N8RC 4PV1C 2FJ2A 2VZAA 4LF4L 1EOVA 3RR5A 3I4NH 2B2WA 1YNJD 4DGZA 5J3BA 3G71A 3TP5A 1GJXA 4C56C 3AFPA 2A74C 2FHTA 5CC4A 3BVZA 4HN7A 4DK3C 2GA4B 4B9XA 4YIJA 1B4OA 4I7ZC 1PVOA 1E3PA 2NN6G 1ZEQX 2VL6A 1YJNA 4KHPQ 4FXDA 2E8GA 3KJPA 4YWMA 1GOZA 2A5HA 1EY0A 5IGEA 3SE0A 3SXHA 1EZ6A 1PZJD 1Q82C 3J81c 3D6WA 1PDQA 3R93A 1KAAA 4BBSB 1NJIC 5D14A 3IAYA 1WTPA 1NCVA 1TS5A 2NZHA 1SYFA 4YHHL 3H94A 4B08A 2DY7A 2RDGA 4AQYL 1E2ZA 3VYTA 2PQUA 3PUYA 1M90C 4Y7NB 3M85A 4GNXA 4DV3L 4C2MB 1HFNA 3MXNA 3NQIA 1J9OA 1SE3A 2PMZE 1SE4A 1F2YA 2SNMA 3VR5A 3NBHB 4WORA 3I4NB 1IW7D 1V1PA 5M9OA 5AJ3Q 3I2ZA 5M3MH 4IFDJ 2CTLA 4A3DH 4GKJQ 1BNZA 3OMGA 2LS01 4UPAA 1OXSC 3KOJA 1ZXTA 1Z9FA 4L63B 1K3RA 3W5OA 2HIXA 2R7DA 2K28A 3TP7A 5IT9L 1CZGA 3M4YA 4ODGA 3H15A 4LF6L 3NE5B 1BCPC 1K1GA 1TWFH 1HNZL 4JI0L 3BZCA 1KNAA 1IBMQ 2E2IH 1R9TH 5K36H 1TWCH 3M4PA 4AM3A 2K5HA 4OONA 4JK1C 1WVNA 3STBC 4M1UB 1X3QA 3ND9A 4IPDA 4ZKCB 3VDYA 1SXTA 2F0FA 1BBXC 5C3EG 4GLVB 5IP7G 2KUMA 2YU9B 2F0OA 1ML0D 1WVLA 2FMCA 4A3DG 2WB1B 4ILWA 1AH9A 2QF7A 1BF4A 2BOSA 5F2DA 4A3IG 3K59A 1VS0A 5CV5A 2Q8RE 2AUJD 4BXXH 5IGBA 5C3EH 4PQXA 3HFZB 4A3MG 3JAML 4PZ6A 2HCIA 3QB3A 1DOMA 2K5QA 3LWUA 2EYMA 1W6KA 1SBBB 1Y14B 2QNDA 3T1YL 2HDMA 1H9SB 1NAPA 1PTOC 2OXPA 1S72A 4HIDA 4RKBA 4AIMA 4NW2A 1KL9A 1LACA 3Q8DA 2KEEA 4R8IA 2X6LA 3GP7A 2Y0SB 1TWGH 1DXMA 4BBRB 1YBYA 1U5KA 2YQRA 3J80L 1FD7D 2E2HH 1V43A 1E0BA 4DV2L 2VQEL 1PTOF 2VQEQ 1JOOA 4O42A 2UUCQ 5HURA 4YCVA 2RDHA 1BCPB 5LL6S 4RHRA 3A56A 4O0AA 3NTKA 4QMFB 1SJHD 4H02A 3GTGH 2DNEA 2EXDA 2B63H 4S3SA 5C44H 2ICIA 4X3TA 1DONA 2OWOA 1V8QA 4B3RL 3M4OH 1XMOL 2L0CA 4P75A 4P74A 2WINB 1NY4A 1B9MA 3CCJA 3A8IE 1C4QA 4HIMA 1JB7A 5C0XI 4IPGA 3EQLC 3PO3G 1SE2A 3PO2B 3PIO3 2B2UA 4A3JG 5CV7A 3W1GA 5ELBA 4BBRH 4DV0L 1IXRA 2PQAA 3J80c 1B9NA 4AYBE 1YIJA 4CBVA 1BXTA 3VR6A 1CUKA 1J5EL 4H44C 2R61A 1HTLD 3F2BA 2XRSD 1B44D 5JEAG 2QKIC 2UXCL 2H1EA 2HQLA 2ZXOA 2C9OA 3D0FA 4IUTA 1X6OA 2XWJB 3LNNA 1F2ZA 1SROA 3TREA 4QJFA 5J1ZA 4BBSH 1RJTA 1TWGB 4JI4L 3TS2A 3MEHA 3G48A 2CQAA 2K6AA 1PZID 3EA6A 5FLMH 3M7NA 2OTLA 1N34L 4WANA 1EWCA 4A3MH 1JWMD 1LV9A 2WB1E 4JVYA 1FL0A 4WFN3 3HP3A 5LMNW 1M1KC 1MJEA 1XPUA 1BCPF 3GV3A 2WB1G 1HR0Q 4J1MA 4CGYB 4HJ9A 3TRZA 1QILA 4ZUJA 1I50B 2I46A 1GD7A 1I4XA 4MHEA 4JI5Q 3PO2H 4RFBA 2B2UC 1HQMC 2GVBA 5AJ3L 3KLWA 2R92H 2YTVA 2D62A 2KQ3A 2BH8A 4HEDA 4ME5A 5I2XA 1MGSA 1MSHA 4ZAIA 2NVXH 2VNUD 1QVCA 4FXKC 5C3WA 3A74A 1PH9A 4YHHQ 1YNND 1BBUA 1VQNA 1S5CD 1M8AA 1STBA 5NUCA 3NXWA 5IWAQ 1UE7A 3AYHB 1PYSB 1TWAH 2KOLA 1OXXK 4RG1A 3D31A 4KK7A 1IW7C 2PW5A 4DV5L 1H9SA 4B3ML 3G7LA 4LMQD 3QJYA 1FNUA 1VMPA 4UY8C 4B3TL 1UEAB 4MTNA 1CHPD 4X65L 4WALA 2R3ZA 1VCIA 4LWCA 2ZM6Q 5G3LD 3W2DA 4KHPL 3S15B 3J81i 1ZYRC 5JVG3 4X64L 3D4WA 3M4OB 5C4XH 3SEBA 1G51A 1HZCA 2F0HA 4DXFA 2QEXA 4BBSG 2B2TC 2QDBA 3UDXA 3F8TA 1P16A 4TVAB 2QCPX 5GADC 1XTCD 2ZJRA 2PZTA 1G91A 2Q2IA 4NXMQ 2L5TA 4OL7A 4X66L 4LF6Q 5EKLA 2B29A 1D8LA 4DR7Q 4BA1I 1RD9D 3OW2A 5IYDH 2JE6I 4IZ8A 4DAYB 4DV6Q 1W3SA 3H09A 3HOZH 4JV5Q 4A3GB 1TWAB 4F88A 1EIYB 5LHY1 2PY9A 1EY6A 5CR3A 2XRQD 1IYUA 3EBEA 2E5LL 1SLJA 3RN5A 1WTVA 4DAVA 4DV3Q 3EJIA 1KDCA 4C3JG 2MQHA 1PH2A 1FNVA 3X3MA 3UE0A 3FKIG 4DR4Q 1SNMA 4GN3B 4Y7NH 1H9KA 1VQDA 3K7AB 2A1AA 1A3VA 2IX0A 1ASZA 4DV4L 1YEZA 3MXNB 2F0WA 1NTGA 4KTAA 2R93G 3H0GB 4LF5L 4EGVA 1UE6A 2AMCB 1LTTD 2NZOA 5IY0A 4GS3A 1XNRL 1XMQQ 2ID0A 3FEWX 2DN8A 2ALYB 4DV5Q 4LUOA 4JI1L 4DV4Q 4HR7B 2IHFA 1DOLA 1I4RA 4FF2A 1LTBD 1DD2A 1I5FA 3U50C 1STHA 2WIIB 2CCZA 4PG3A 2NVTB 4LFBL 1Q8IA 5FJ8H 2E75C 1VQKA 3GV6A 1FNWA 2E2IB 2JP1A 2NTTA 3K0XA 1TXYA 4P72A 1UWVA 5EAYA 2K04A 4PMCA 4C3IB 1ONLA 1T5XD 3HOUB 1MKHA 4K8IA 4ALPA 3S2HB 2F0MA 1J8IA 1SNOA 2UXBL 2CQOA 1IYJB 2L4NA 2BA0A 2NTSA 2ZXRA 3NBIA 2SEBD 2VXWA 1I4GA 5IT9E 2JA6H 4TKOB 2PO4A 4LJZC 1Y1VB 5JVH3 4DUYL 1DOKA 3S1QH 3P75A 1LUZA 1RDPD 1ILPA 4YY3L 4KKTA 3D4DA 4JI8Q 1JCKB 1N34Q 1HRJA 1VF5C 2DNCA 1V1OA 2YTXA 3PF5A 5EPKA 4JI4Q 3IRBA 3T51B 4JI3Q 1HXYD 2N78A 2R7FA 2ANNA 4K5XA 3TQYA 1WTXA 1SEBD 4DXGA 2XNAC 2OQ0A 2CTFA 3CAMA 1QJOA 1DTJA 1G6ZA 4C3HB 2KHJA 5BN4A 5M5YH 4DUZQ 4A3GH 4IOCA 3K80C 5GAEC 2F4VQ 1SMYD 2RSNA 1GHKA 1LTAD 3SHLA 3F2CA 3OSOA 4B3TQ 1HA5A 2Z8LA 3BDCA 3JAME 1JICA 2L12A 4B9WA 4XTCS 4A3GG 4IFDI 5IE8A 1H95A 2VB3X 2I5LX 5IWAL 3DUZA 3D6CA 5EJWA 3KBXA 4ZRZA 3AQQA 3MXGA 1N36L 3L0OA 2B63B 4EX5A 1K83B 5T1GA 2A6HC 3GO5A 3ONAB 3KF8B 3OYYA 3NPPA 5C44G 3R2TA 1EYDA 2YTYA 2KEDA 4A3EG 3H6MA 4JI2Q 4OGQC 3PUZA 3PV0A 1JJGA 4A3JB 4IUQA 3PO2G 4DV7Q 1A63A 4RCOA 4FF3A 2K5WA 1A6XA 4AH6A 5I9OA 2K7VA 3P1HA 1JOKA 1L0WA 3UDGA 4BY1G 2JYOA 2JA7G 3CKIB 1WE8A 2A8VA 1D1IA 4QUFA 4E6IA 2EYJA 5DAUA 3CMAA 1RIPA 4ZKBB 4A3KH 3CCMA 3M7GA 3ER0A 2B3GA 1Q90A 5ELOA 5A2QL 1PH5A 3FHWA 1TU2B 1VQ5A 4KY5A 3MVVA 1WCMB 4IPCA 2N3SA 1IYVA 4QCLA 3Q23A 5M5XB 4UAIA 3RMHA 5TSSA 2JSOA 3K7AH 1KRSA 3NWSA 1EYCA 1N33L 2IY5B 3ERSX 3X3NA 1CZWA 1TWHH 1AFPA 3I56A 3HOYB 1SAPA 2HDLA 4HTHA 1VQBA 4LF7Q 3S1NH 5LL6X 3NUCA 3SGIA 3D8GA 1X32A 3NP8A 4IUNA 4BBRG 5EPLA 3EN2A 1SMYC 4JI7L 4A3EH 5HY6A 3E9IA 1X3EA 1D7QA 1XMOQ 1S5FD 1LTRD 1SYDA 5C5MA 1R4PB 2KCMA 1PRTB 4B3RQ 3CW2C 5IYBG 4POGA 2PNRC 1TWHB 4FYDA 3JAMi 1SNPA 3CU7A 1TS3A 3N6RA 3V05A 2A69C 4GOPC 3I73A 3NWTA 1HUNA 1E2WA 3E5SA 2IHEA 3IFTA 5JEAJ 3AEVA 1X55A 2EYHA 2VW9A 4QF4A 2UUCL 1PRTC 3S1QB 3NBHA 4KJOA 3HOZG 2L9HA 3KUPA 4XQQA 2ENBA 1JWUD 4C3IG 5KYIA 3EFXD 1IL8A 4AYBB 3OOCA 1H9RA 1PA6A 3H91A 3RLFA 2D2CC 3J81E 1F2LA 2F0SA 2E2HB 1ZZKA 4HIKA 3MFGA 3TS0A 5J22A 3PUXA 4P2CB 2UXDQ 3Q22A 2V1CC 3PMFA 4PZ7A 4FP5D 1D2BA 3K5MA 5C3XA 1KDBA 2JA8B 4KN4C 1SNQA 4HMIA 3ZJYC 4X6AH 4QY7A 1CQVA 1B2TA 1RTNA 1EWHA 3T1HQ 1TT2A 3MHBA 1KABA 3TBIB 1VQHA 3A7AB 1IZ6A 3F2UA 1ILQA 2LXKA 2JVZA 4RCNA 3VA7A 1VQFA 4LIJA 5EGTA 3QWNA 1Y1WH 3DLLA 1I50H 5I2YA 2KA7A 4PMBA 1X65A 4DV1L 2ICEC 4K8JA 2PYKA 4KHZA 3RD4A 1CTMA 2EY1A 2IPKD 2EYFA 1B53A 3BVGA 4K6LA 4RA8A 4DF7A 2YV5A 3KF6B 5C0XG 1HPCA 3A54A 2J4XA 4O2DA 1HNZQ 1YITA 1EQRA 3H3VH 1TVXA 1UUPA 2BDNA 4FDBA 2B2TA 5FK9C 1TKWB 1A0IA 4R4CA 5C0XJ 1YNXA 2R93H 1BO0A 3NTHA 1XTDA 2K33A 5I9PA 3MEFA 2D5DA 4UDUC 2ES2A 1HZ9A 2PPBC 4A3KB 1PYWD 4MN3A 3TDQA 2I5MX 4A3MB 1O7YA 1Q3LA 2PI2E 2RHSB 2RVLA 1QVFA 3MXPA 5CV6A 3HOUG 1HFGA 4OO1H 1EOTA 2CWPA 5IGGA 3ITPA 3FKIH 4FNFA 4LUZA 2R92B 1DGSA 4C3IH 1SYEA 4ME3A 1LT4D 2RSOA 3KLSX 5D3DA 4A3CG 2IX3A 5I6YA 1JQYD 3TN2A 1STNA 2TMPA 5JOBA 1XNQQ 2UUBQ 5JPNC 4R8NA 1A2TA 2QA4A 1CT1D 4C3JH 3HOXH 4DR3Q 2O5IC 5GQOA 3OW7A 3CCLA 4A3CH 2Q2UA 3T16A 1TUAA 4C2MH 4QGUA 2WP8J 3W3AA 4DR5L 1U4RA 2JA8H 2JA5B 2RHQB 3C46A 3HKSA 5EQ0A 2K4KA 4N9PA 2B2VA 5CV8A 3S15H 4J15A 1NMFA 4CKCA 2E3UA 3VR3A 4L5RC 5BR8Q 1BCPD 2B2YC 1O7LA 3RZDB 2NBFA 3DM3A 5CGKA 3FRPB 3GTMB 4EVOA 3RNUA 1F77A 1DM0B 2MUYA 4R4OA 2K5VA 1RKNA 2F1MA 3DHQA 1L2FA 1HH2P 1EWIA 2CVRA 1HNXL 2EY6A 5D65A 4LW1A 5ELNA 3CRLC 1CSPA 3PIP3 4A3FH 4A93G 3PUWA 1RTOA 3UE1A 3I8ZA 5T1IA 3VKEA 1G8ZD 3S1RB 4HSVA 1PMRA 5C6AA 3CF5A 4YY3Q 3GTPB 4A4IA 4HJAA 1K8AC 3K7UC 3S2DB 4DUYQ 4HJ8A 2EJFC 1BBWA 2OPVA 1LTGD 1OXTA 2D0PA 1CI3M 1B7YB 1LT3D 3E0EA 2HT1A 2HQEA 1X3FA 5BR8L 3I72A 1FGUA 4BY7G 5DM73 4QMGA 3ZYYX 1VQIA 4A3LG 3FVQA 2PW7A 3BZKA 5K36G 4GLXA 4GNXB 2A68C 2NUCA 1JMCA 5EBCA 1N36Q 3HS0C 2RDFA 2WAQB 3CCSA 4L5SA 2Z4HA 4G7OC 3GQBA 3CCQA 1TIID 2E2JH 3W1BA 5DLQE 1EYAA 1SYBA 4JI1Q 1QZGA 4U673 4TSSA 5D3IB 1MD2D 3OTOQ 3I90A 1JT8A 1AEXA 4JOIA 4ZLTF 2VQFQ 3OPOA 3HG9A 2N55A 4QIWE 1XNQL 1WFQA 3J81j 1KAWA 5IOCA 1QUQA 1EQVA 5LMNQ 3VR4A 2QILA 1G2TA 4K6DA 2BA1A 1JORA 5IP9H 2JA6G 4IOAA 1KHMA 2CTJA 5A2QE 2F3IA 1DJRD 5BN5A 5J39A 4H7BA 5CBEE 4A3FG 2LMCB 3K6OA 2ZTEA 3TEHB 3GTOB 2CFMA 1ENFA 1AZPA 4DNRB 1IHZA 2A69D 4IURA 3CC7A 1T9HA 2K03A 1S5ED 5C4JB 4JBJA 1D5MC 4G7HC 4GKKL 1BR9A 5C5LA 2KJXA 1SN8A 4UP7A 2VS1A 3KF6A 3DEOA 4A75A 2UXBQ 2YU9H 2RKSA 4OO1G 4JI6L 1B3AA 4KLKA 3RLOA 4HAEA 5IYCG 2EJMA 1II3A 1WYDA 3HOYG 1KXLA 3CXCA 2MO0A 3E0JA 1JJCB 1PZKD 4ABNA 2HH2A 1FR3A 2I5HA 3HOYH 5EBDA 2EYPA 4KMUC 3S1NB 4K2LA 3S14H 2PMZB 3LGJA 4LFBQ 2I0QA 3BG3A 4Q5VA 3SK8A 4IUPA 1U4LA 1WCMH 4HMJA 5IT9c 1EQTA 3J7AV 4DNTB 4A3BH 2CTMA 1ET9A 3A8KE 1XNRQ 3HOWG 1O7ZA 4A76A 3ULLA 4DR3L 4P73A 3S9WA 4BY1B 2UUBL 4IFDG 1EY9A 1EEFD 2K05A 4BXXG 3D3RA 3T1HL 1EY5A 4IQZA 1VQOA 2RA4A 1X4MA 1OO9B 4XT3B 4DR2L 1E22A 3J81L 1D5ZC 1GXDC 1DZ1A 5GAGC 3TZUA 3S17H 2EYOA 3DWQA 1PV4A 2Z6KC 1ET6A 2FMMA 3RUZA 4DR4L 1KNEA 1GVPA 3UI2A 2JA5G 1Q7YC 4JG2A 5DM63 4NXNQ 3RZOB 4DR6Q 3CMEA 4DAMA 4RMFA 4LK1C 4K0KQ 3IFDA 2UXDL 2J0TD 3URYA 5I6WA 1UAPA 1FVIA 1HCZA 2PQEA 1MIUA 3QG1A 4R1JA 1G6PA 1BOSA 2F0LA 2NB0A 3CC2A 3AEVB 1TR5A 2HUGA 1EIFA 5M3FB 1Q86C 2UU9L 5FKAC 1O7IA 5KEEA 1K0RA 1A2UA 1EFID 1I94L 1ENAA 2L15A 2EY5A 5FLXc 2TSSA 4HCSA 3KBGA 2JEBI 1C48A 4DR7L 4OWTB 4Z9CB 1EFWA 1IBLQ 1JWSD 1YHQA 4X3KA 2O2LD 1GUNA 4POFA 1VQ8A 3C1FA 3I4OA 1B8AA 4JBKA 1EZ8A 2EE1A 2O4XA 2NVYH 1GUWA 1PXUA 3RLNA 3EIVA 4MIUA 3SDZA 5M3FG 1VF7A 3T56B 2X6GA 4R4TA 3KLSA 1Y8PB 3L7ZC 4OWWB 4XQNA 3PUVA 1K8MA 3SVMA 2VUMB 1CKNA 4QB4A 2F0DA 1YZ6A 4A93B 1D5XC 2A6EC 4M8AA 4RKLA 3CQZH 5A35A 3K58A 4BY7H 1Y69U 2ZM6L 2DY8A 1VQAA 2SNSA 2B2WC 4EQNA 1QNKA 2G9DA 4B3MQ 1R9TB 2BE5C 4KY6A 1SR3A 3PSIA 1CQFA 4DK0A 3S17B 4LF7L 3V69A 5KNCA 2E2DC 1YNJC 4KD4A 1BDOA 1DYQA 1BVSA 4DN4M 3I4MH 1PRTD 1X3GA 1VQ9A 5M5YB 2NVQB 4AYBG 1XWEA 2NVYB 3CCRA 3N52A 1YNNC 4DAPA 5IYCH 2ASBA 2DGYA 1TY0A 3BDOA 3HOWB 4DPGA 2IWHA 5C3EB 4DU9A 1C0AA 1CFMA 3J80i 1Y1VH 3DWAA 1LT5D 1WTOA 4C3HG 1I6HB 1EY4A 5CYUA 1VQ4A 2LKVA 4ULLA 1PFBA 1HZBA 2DGRA 2NYZD 1X3PA 1ZYRD 4B8TA 1F9PA 1QWYA 3MA2B 1HR0W 2A6HD 4FVMA 5FO9B 5ISRA 1X9NA 3DEPA 1F9SA 1WOCA 1SE8A 2KCTA 1GHJA 4FF4A 5IYBH 3DM1A 5HGTA 3ULPA 2K50A 2B2YA 3BJUA 2JJQA 4NP5A 1VQCA 5IODA 2KCNA 5M5WH 3WOFA 1VQLA 1PTOB 2ZXPA 3CC4A 2BH2A 1FYCA 2XWBB 5E1FA 1NUCA 3ERQA 3U1KA 3AMUA 3S2DH 1F9QA 1RODA 1S40A 2B2VC 3DXJC 2NWGA 2I07B 3IKJA 3KDFB 3DWPA 2R7ZB 1PFMA 2F4VL 1WCMG 3ND8A 1D1KA 2F03A 3AB9A 1RHPA 4QL5A 2OF1A 3RZOH 4NBQA 1KQSA 4Y52H 3FPPA 2CWAA 4NB3A 4LF8Q 5CORA 3R3OA 1OXVA 2H5XA 2FFKB 2MNAA 2B63G 5JJKA 1PH1A 4LAAA 5EKIA 4DKAC 1KD1C 5C44B 2AQ1B 2Z4IA 4G4KA 2OTJA 3GTMH 3BDLA 1YJWA 1E1OA 4JI8L 3EVQA 1Q12A 4A3BB 4GOPB 1CM9A 1GUGA 3GTKH 4F8MA 1SYGA 3I3CA 4DV7L 2IW3A 1HZAA 1SSOA 1YHAA 4GKJL 4BA2I 2L1BA 4JI2L 4APVA 1NSNS 1AN8A 4KN7C 1ESRA 2JXMB 4C1NI 2WFWA 2Z1CA 5HGQA 5IP7H 1AE3A 4KI0A 4DR1L 4K0KL 4BWGB 1ASYA 1S5DD 5ELEA 1PH8A 5CV4A 5COYA 1J4WA 3CCUA 4NXNL 1E24A 3CQZB 1EIHA 3KK7A 4A93H 4WJ3M 5KRUA 4KY7A 1VQEA 3P20A 5JJZA 2MFIA 3FMCA 1PTOH 4K2KA 3STBD 2CW0C 1CKOA 3S16H 1T5EA 2OQKA 1LTID 1YJ9A 2R6GA 2LSSA 4JCVE 1V1QA 1PLFA 1DT4A 4CKEA 3FP9A 1A3UA 1B1ZA 5H1SE 1Y8OB 4R4IA 4EQPA 4L5QA 5FLXL 3T53B 3CPWA 4LF5Q 2EYLA 4ZQ3A 3V2TA 1HNWQ 3HKZE 4DUZL 1Z6HA 1I6VC 1SJED 2CKZB 3OMCA 1LTSD 5DEHA 2IX1A 3M3YH 3F2DA 3J7AF 3VR2A 3MFYA 2H4OA 3NEMA 4JI3L 4LFAQ 1STGA 2PNHA 3U9OA 3I91A 4HIOA 2D9UA 4A3IB 3S2HH 3S14B 1K9MC 2E5LQ 1I4HA 1ZKOA 2RF4A 5KNBA 4YWLA 3NQTA 4NKLA 1YI2A 1MBYA 1SMXA 5BN3A 2C5CA 1JE4A 4OWXB 1S3OA 1QG7A 3VYUA 3HOVB 1SFOB 4F7XA 1X54A 2X69A 1PFSA 3L9AX 4O1NA 2ZJQA 3TZDA 4L6TB 3GTOH 1EY8A 5M3MG 2UUAQ 3M9BA 4FF1A 4HSPA 4NXML 2LFNA 1STYA 3J7YW 1N32Q 3FPUB 3HRZC 3Q6SA 4LFAL 2Q2HA 1JOQA 3MTSA 2VUMG 3K81C 4DR6L 3G6JB 4IN3A 1W2BA 5CMDA 1XYIA 3KJOA 4RAUC 1V1PB 2EIFA 1IL2A 4DR2Q 1VQGA 1HNWL 3P7JA 3K57A 4R4QA 3K5LA 2PZUA 1XMQL 5ELDA 1B50A 1KDAA 1GKHA 2WKCA 1NBWA 5FO7B 4ID6A 1JE5A 4X65Q 2JA7B 1JB3A 1WJJA 4A3BG 2F3VA 5JAVA 1XPOA 3WWVA 4XYOA 2EZVA 3U4ZA 2L11A 1G291 1LLRD 3WOEA 3PF4A 5C0XH 5IGFA 1UE5A 1CHQD 3QOLA 2SDFA 3MWYW 3NSWA 2CPQA 2WACA 3A0JA 3SK4A 3VA5A 4PMWA 2LXJA 1JR0D 4K14A 5AFWA 5KYLA 2Y0SE 3T13A 1QOHA 4DR1Q 4GOPA 2RQXA 1N32L 2R7ZH 3J7A5 2CTKA 4JI6Q 3OWFA 1CSQA 4OXPA 3HOXG 2UUAL 4V0BA 4C1NK 4BY7B 1Q46A 4DNIA 5IP9G 2NZ1D 2WKDA 3HOXB 1X56A 4JV5L 4NPSA 2EQSA 3E6ZX 3S1RH 1NR4A 5K5PA 5JJLA 1DCZA 1NR2A 4ZK9B 3NHHA 1J6QA 2K01A 4X66Q 5C4JH 2F0IA 3HKZB 1PFNA 3VYRA 5GROA 1SDFA 3HOUH 4IJHA 3OIPA 3U4VA 3G4SA 4YCWA 3HGBA 2PQAB 1ICWA 3BU2A 2N49A 3IL8A 2K14A 3R8BA 3B6YA 2OPUA 1WTWA 2CTEA 3NTIA 3BZDB 1WTQA 4X3UA 1AE2A 4X64Q 2QEJC 2AQ2B 2F0EA 5KNDA 2EPBA 4EQ5A 5FOBB 4NDXA 2KBNA 4JC0A 2KHSA 3UDIA 1L1OA 1SNDA 4XQJA 3OTOL 4RWSC 4OIJA 3VYSA 4A3JH 2Y0SG 1M4VA 4DA2A 4IUVA 3V96A 1QUQB 3AU7A 3GTLH 2NVTH 1SYCA 1H9MA 1HHVA 1TWFB 5M5XH 1WD1A 2MHVA 1LTLA 3LWEA 2OCEA 1XX8A 2B39A 2AWOA 4GLAC 3GTGB 2B8GA 3PIPA 4K5VA 2R7ZG 4A3LH 4X62L 3E9HA 1EYGA 2MJ8A 2BE5D 2F0KA 3GTPH 3A8JE 3L2PA 2IT1A 3BYTB 2BCOA 2KHIA 4IALA 1ESFA 2G9HD 4JI5L 3RN2A 3BVMA 3QOJA 1L0XB 4R9WA 2XVSA 1BQQT 2YYZA 2AKWB 2XSCA 3PIOA 2A19A 1HR0L 4JYAQ 2F0TA 1YHBA 1C9OA 1EU4A 1ENCA 1MI2A 3CRKC 1STEA 3TP6A 3G6EA 2Z0SA 1QVGA 2KENA 1K83H 2AUKA 2FMRA 1QZHA 2D0OA 2MGSA 1VMCA 3M4QA 4PZ8A 5EKKA 3CCEA 1KIXA 1RCVD 1OTCA 1QB5D 2XGTA 3JAMc 2B8FA 1PRTF 4C3HH 3TSSA 2WAQG 1EQQA 4LF8L 2F52A 4CJ2C 5FO8B 1VIGA 3R2IA 3K8AA 5C4HA 1Q1BA 3T1YQ 2C35B 5FJ8G 2UXCQ 1ZZIA 3D4RA 3FKIB 3OHXC 4CJ0B 5IGCA 1Y1VG 2F3WA 3FDTA 1GUTA 4CKBA 5CBAE 5E7NA 1J5EQ 3NK9A 2GVAA 1D6EC 2Q8IB 4DAYA 3I4LA 4A3IH 1IBKL 1I4PA 5G3LF 1KRTA 1KLGD 4DV0Q 1W6JA 2EVBA 2JA7H 1VQPA 1LT6D 1GO3E 3J7ZC 1VQ6A 1EL0A 3SK5A 2F0UA 4A3KG 5IIFA 3GD7A 4JBWA 3HKZG 2ZJPA 1JJ2A 1WD0A 2K5DA 3O13A 2JQOA 2M00A 2JA8G 4KJNA 1Q8KA 4DV1Q 2NVXB 5KIXA 4JVHA 3I55A 2JA9A 2WAQE 1HQRD 1U4PA 3A5ZB 1H9JA 5I4DA 4LFCL 2IJ0A 4V190 1IBML 1HTPA 5IYDG 4JI0Q 1KC8C 1PTOD 4A3EB