4BA1I

Archaeal exosome (rrp4-rrp41(d182a)-rrp42) bound to inorganic phosphate
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
212
structure length
204
Chain Sequence
b'SQEIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGERRYLDVGDYVIARIENFDRSIDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGNKSMYETLTSKCSIFVANNGRIWASRFSEEILIEAIRKIENE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE EXOSOME COMPLEX EXONUCLEASE 2
publication title Crystal Structure of a 9-Subunit Archaeal Exosome in Pre-Catalytic States of the Phosphorolytic Reaction.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 41
structure length 204
sequence length 212
ec nomenclature
pdb deposition date 2012-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ba1I01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ba1I02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4ba1I03
3HOXG 1N8RC 3I4NH 5AJ3L 2V1CC 2NVXH 2WB1G 4A93G 1QZGA 1KC8C 4OWXB 4LF4L 4PZ6A 2HIXA 2PQAB 4DPGA 4PMWA 3OTOL 5JJLA 2K52A 1SN8A 4JI1Q 1K3RA 4TKOB 3ND8A 3HKZG 3A8JE 1CKNA 2OTLA 3CC2A 1EQRA 2B63G 3NE5B 2D2CC 1DT4A 1X9NA 1SFOH 4AQYL 2YV5A 1FL0A 2JE6I 3PO3H 2XTIA 2IHFA 5LMNL 3QIAA 4A3EG 3BZKA 1OXTA 1BVSA 3J7A5 4BBSH 4JI5L 1LYLA 5GADC 1C0AA 5M3MG 4LFCQ 3NENA 3B6YA 5IP9H 1VQ7A 2A8VA 2NN6G 2VS1A 3J81c 5IYCG 1BBUA 4NXML 3GTLH 2KA7A 2UXCQ 1HZBA 2PI2A 3OOCA 4IJHA 1QVFA 1Q81C 4HIDA 5GAHC 2ZJPA 5AJ3Q 2I0QA 1W2BA 4LF4Q 2JA7H 1SE8A 4LF7Q 1GO3E 4B3MQ 1E7ZA 1K8GA 4LWCA 1HZAA 3A5UA 1V9PA 2K50A 4DR3L 1B8AA 1PH1A 2E8GA 2E3UA 4A3CG 1HZCA 3DLLA 2NVTH 3CC4A 1VQHA 1BDOA 3FMCA 2QEXA 2R7ZH 2VQEQ 5C3EH 1PVOA 5JJIA 4AQYQ 5C0XG 4DUZQ 1XMOQ 2JVZA 4DR7L 4GLXA 2ANNA 5IP7H 5IT9c 5LMNQ 1IZ6A 1WVNA 4BY1G 1K73C 1Y1VH 1MJEA 5H1SE 1EWIA 1LM0A 2E2JH 1Y1WH 1CKOA 4AH6A 2OPVA 2IT1A 3CCQA 3M3YH 3BU2A 4P72A 2EQSA 4K0KL 1N34Q 4NXMQ 4AIMA 4DUYQ 2BH2A 1Q8KA 4YCWA 2Q2HA 2C35B 1E2WA 4Y52H 1GUNA 2IX0A 2K5VA 1FJGQ 1SMXA 1X3EA 4RCNA 1VQKA 1Y14B 4DV3L 1FVIA 1Q12A 1KHMA 4DR3Q 2PI2E 4MTNA 3HKZE 2JK8A 2CW0C 4YHHL 2UUCQ 3ERSX 3T56B 4GKJL 1S3OA 3J80i 2GN5A 4TQUS 4DR7Q 3S14H 3S1RH 1VQ6A 1K8OA 2EDGA 2ZTEA 2YQRA 1J6QA 2E2HH 1OXSC 2IY5B 2ANRA 5IYDH 4JI0Q 3H94A 4P74A 3J81i 2JA8H 1CSPA 2HQLA 2K5NA 3CC7A 4DR5L 4NXNQ 5BN5A 2KCMA 2KHJA 1KRSA 1V1QA 2D5DA 4YWLA 2UXDQ 5A35A 4OX9L 2JA6G 1EYGA 2XGTA 1YZ6A 4A3LG 1Q90A 4A3KG 1PYSB 1N32Q 4H0LC 1VQGA 4QMFB 2EIFA 4HJAA 3CCMA 3FKIG 2QF7A 4J15A 1H9KA 5C0XJ 5C44G 3GTOH 3CXCA 4GN3B 4C3HH 1G51A 1SMYC 4GKJQ 3VR4A 3CF5A 2RHQB 2PNRC 1TWCH 2E75C 2UXBL 1HTPA 3UDIA 3EN2A 3L2PA 2R92G 2D62A 1TXYA 3IRBA 5M5YH 4JI2L 2JZXA 3WDNA 2JA5G 3D31A 2CFMA 1VQFA 1HNWQ 1P16A 4G7ZC 3MEFA 4A3FG 1AE3A 3S1QH 3T1HL 4DR5Q 1HPCA 3J81j 5JEAH 2AHOB 1OXXK 1FYCA 2K7VA 1WI5A 1E3PA 4QJFA 3U58A 4NPSA 2B63H 3D4RA 4OX9Q 4LF5L 1I5FA 1XTDA 4BA1I 3G48A 4MZ9A 3L7ZC 1FR3A 4A3EH 1HCZA 4OO1I 4IQZA 3KYHC 2VUMH 3HOVH 3VR2A 1YNJC 2F1MA 2ALYB 1Y8PB 1VS0A 1IBML 1AH9A 3S2HH 3Q8DA 4R4CA 5IYCH 4WJ3M 4YWKA 3AFQA 2Q8IB 4L5QA 3IFTA 2WFWA 2A19A 1JE5A 1C9OA 4LFBL 5C4XH 4Y7NH 3ICEA 4JI2Q 4WJ4A 2AUKA 1M90C 1D8LA 4JV5L 4QY7A 2AUJD 3M4OH 1PV4A 3BG3A 1HNZL 4JI8L 3T1HQ 1PH2A 2R7FA 3OW7A 1GUSA 3S2DH 3H3VH 3S1NH 2QGQA 1E2VA 3CCLA 1JJGA 3K0XA 5FJ8G 2R93G 4JVHA 1DXMA 4X6AH 1GD7A 1YVCA 4DV2Q 1X6OA 3OPOA 2CTFA 5C4JH 2A69C 3HOWG 3NELA 1BKBA 1YJWA 1NJIC 4POGA 4JI6L 2BA1A 4DV6Q 5HY6A 1N33L 3TEHB 3U4ZA 1IBMQ 3CW2C 4JI1L 1IL2A 2LXKA 2A69D 2L5TA 1WCMG 3EIVA 4KN7C 4KHPQ 3H0GG 2EVBA 1VQLA 1D7QA 1O7IA 4XIGS 2OQ0A 3GTJH 3M4QA 3RLNA 1PMRA 3GTQH 3PIOA 1A63A 3KDFB 4C3IH 1SROA 5IYBG 2IHEA 2JEBI 1ASYA 3MFYA 4LFCL 3T1YQ 4IFDG 1XPOA 4DR1Q 3GD7A 2UXCL 1ZKOA 3PUXA 4RMFA 4HIMA 1EQQA 3W1GA 3PO2G 3VKEA 1IW7D 1UE6A 4A3JH 5GQOA 3JAMc 4LF7L 4B3ML 4A3BG 1XNQQ 4JI6Q 2R6GA 1N33Q 2ZTCA 2VY3A 2CQOA 2CWAA 3VA7A 3BZCA 1H9JA 2E76C 4APVA 3AEVB 2VQEL 2A6EC 3I4MG 4DUZL 1XMOL 3HOYG 4KKTA 4EQ5A 3I56A 1IBLQ 4BXXG 2BA0A 5HGQA 3M85A 1XMQL 3ZJYC 1RIPA 1EIFA 3KFUA 1MJCA 3GTPH 3SE0A 2A6ED 3GTGH 1N34L 1GVPA 5ELOA 2DNCA 4GOPA 1Q1EA 4DUYL 2B3GA 4BY7H 4OO1H 4B3TQ 2PMZE 4GLAC 5ELNA 5K36H 5LMNW 3CRLC 4OGQC 2AWNA 4JCVE 1TWHH 2JA5H 1FJGL 1VQDA 1WE8A 3KJPA 1YITA 4L8JA 1VIGA 4QL5A 3HOUG 1HQMC 3VR5A 1YHAA 2PNHA 2NZHA 2UUCL 2VZAA 4DKAC 2QA4A 3M7NA 2GVBA 3CMEA 2MJHA 2ID0A 3IKJA 3PSIA 1CSQA 4HR7B 4JG2A 1SLJA 4P73A 4DR4Q 4IFDJ 4H44C 3S17H 2F4VL 1PH8A 1XMQQ 4GOPC 4JI0L 4HIOA 1JMCA 1NE3A 1MIUA 3OYYA 4OWWB 1IBKQ 4A3GG 1I50H 4NXNL 1WFQA 1Z6HA 1IYJB 4OONA 4YWMA 3KF6A 4TVAB 5J3BA 3RZDH 3H3VI 1O78A 3KLRA 2UXDL 5EAYA 1I3QH 2OCEA 1CI3M 2K14A 4C3JH 1Z7TA 5C0XI 1YI2A 1N32L 2CPQA 4LJZC 4R4OA 3PUZA 1HR0Q 3L0OA 1X54A 4DAMA 1OXVA 4BBRH 1K8AC 2LSSA 4A3IH 5JEAJ 4X66Q 5FJ8H 1XPUA 2PQUA 1ONLA 5BN4A 2UUBQ 2VNUD 1J5KA 4DV1Q 3CP0A 3MXNB 4IOAA 4GLVB 1T5EA 3HOWH 4R4TA 2F4VQ 1Q46A 2OPUA 3M4YA 4LUZA 1HNWL 4DV5Q 4GKKQ 4A3MH 2Q2UA 3S1MH 4MNOA 1QZHA 3PUYA 1X3GA 3UE0A 3I4NG 3KLWA 3ULJA 2Z6KA 5IE8A 1WCMH 4AM3A 3ULLA 4P71A 1LABA 4KHZA 1ZTGA 3F2BA 4B8TA 2Q2TA 1VQMA 3CCSA 3ND9A 3LNNA 2ZM6L 3KDFA 2HHHQ 3AYHB 3K7UC 1KQSA 2NVQH 3PO3G 1YHQA 3CRKC 3CCVA 4GOPB 3TS0A 4A3DH 3N6RA 4X64Q 5FLMH 4BBSG 1K9MC 1J5EL 2NZOA 3PO2H 3I7FA 4OXPA 3HOXH 3JC66 4LFAQ 4XTCS 2K32A 3U50C 4A93H 2Z6KC 1R9TH 3BDOA 2DGYA 4HJ8A 2E5LQ 3PGZA 1VQNA 2JA7G 1VF7A 4IPGA 3S24A 3F2CA 1UWVA 3OW2A 2RCNA 1VQOA 4KI0A 1JJCB 1GUOA 3AEVA 3CCUA 1S40A 3PF4A 3HOYH 4DV2L 3VDYA 2F52A 3U1KA 3HOZG 3SGIA 2ZM6Q 1A62A 2YTXA 3I73A 4UP9A 2R7ZG 3CPWA 4DV7Q 1NMGA 5M3MH 4DV6L 3UDXA 4UP7A 2DN8A 2ZJRA 4X62Q 1H9RA 3K7AH 5IP7G 2NN6H 2KBNA 1Y1VG 4LK1C 3KF6B 4JK1C 2JA9A 3KF8B 1H9SB 4JYAQ 1J5EQ 1VCIA 4KHPL 4DV4Q 1Y1WG 3H15A 4JI3Q 2KHIA 2K75A 1HNXQ 1O7LA 1Y8OB 3VR3A 1PYBA 1EFWA 4R4QA 3W5OA 1EWHA 2UUAL 3T1YL 4A3CH 4QQBX 3UDFA 4DR1L 4HJ9A 3CD6A 1FGUA 4JI4Q 1N9WA 1YIJA 5C0XH 1PA6A 1X56A 4JC0A 4PV1C 2F3IA 2ZJQA 4BY1H 4JBWA 1E1TA 1X4NA 1GM5A 2NVYH 2N8NA 3D0FA 3T53B 1PH9A 1XNQL 1JJ2A 3CMAA 2A68C 4LF6Q 2JEAI 1K0RA 2E2IH 3S15H 2I5LX 3FPPA 3UE1A 1YHBA 4JBKA 4GNXB 5IYDG 4DNRB 1NBWA 5IWAQ 1GHKA 2JA8G 4I7ZC 2A68D 2K5HA 3CCJA 1LACA 1IBLL 3PUVA 1X65A 5LMUQ 2MNAA 4AYBE 3RLFA 3A0JA 5BR8L 2UUAQ 2Y0SE 1PFSA 4HIKA 1GJXA 1IW7C 2EJMA 1QUQA 1JT8A 2QNDA 1XNRL 1EC6A 1V8QA 5E7NA 2D0PA 4B3TL 1G291 4C2MH 2HT1A 4GN5A 4LF9Q 4R1JA 1PHJA 2ASBA 1X55A 1LTLA 3RR5A 2FXQA 3RZOH 1E2ZA 4EX5A 1UE5A 1S72A 4O2DA 5JJKA 2CTMA 1A0IA 3STBD 1IXRA 4LF8Q 4G7HC 2MFIA 4JOIA 4DAYB 4H13C 4GZYC 1KXLA 3V69A 2IX1A 2CCZA 3CPFA 4IFDI 4QGUA 1K1GA 3NEMA 2JA6H 1B7YB 5JEAG 3TZUA 3NBHB 1VQ4A 2O5JC 4DR4L 4RG1A 1OTCA 4A3LH 4A3KH 1DTJA 4BA2I 2BL5A 2EXDA 1VQEA 1PH7A 5BR8Q 2DNEA 2FMRA 2RHSB 2I5MX 3U4VA 2AKWB 3J80c 1IBKL 3FKIH 3AFPA 5GAGC 2YYZA 5C44H 1EIYB 1XNRQ 2VUMG 3HOVG 1PH3A 3U9SA 2K33A 1WOCA 3GQBA 4L5TA 2R92H 4DR2L 2EJFC 4JOIC 1HH2P 3E9HA 4ME3A 1UEBA 5M5XH 1UE1A 1IYUA 3GTMH 4UP8A 3T51B 4NB3A 3A8KE 4A3FH 3I4OA 1HR0L 4IPDA 1ZYRC 5M5WH 2N49A 4UY8C 5C4XG 2CTLA 4X66L 2KCCA 3CCRA 1B9MA 3OTOQ 2NN6I 1TKWB 3M9BA 4R4IA 1QVGA 1H95A 2EJGC 2UUBL 4DV1L 3HGBA 3HOZH 1L1OA 2CTJA 3I4LA 3GO5A 4WALA 2RF4A 4DV5L 4GKKL 3FHWA 1EOVA 1NTGA 1HR0W 1L0WA 2GVAA 3SDZA 3VR6A 1VQCA 4DV0L 1HJPA 3W3AA 5M3FG 1I94L 4JI5Q 4QIWE 2E74C 1AE2A 1T9HA 4DK3C 3RN5A 2HIVA 1H9SA 3TQYA 3A5ZB 1ZZJA 1GHJA 3JAMi 1KIXA 4P75A 4IPCA 1G6PA 4DR2Q 4H02A 4YCUA 1LUZA 2MO0A 1Q82C 3A8IE 1U5KA 3HKSA 1Q86C 2HHHL 2R7DA 1QUQB 1J4WA 2WB1E 4WANA 2WAQG 2AWOA 3QJYA 4O0AA 4LUVA 1E24A 1YJ9A 2L15A 2R93H 2VL6A 1Q7YC 4X64L 1L1OC 4PG3A 2DGRA 4OWTB 4IO9A 3PUWA 1YEZA 4KKSA 4NBQA 1K83H 4LFAL 1M1KC 2KCTA 4A75A 1VQ5A 1X3FA 1MKHA 2E5LL 3A7LA 4DK6C 4GN4B 2HH3A 2WP8J 1TUAA 4DV0Q 3PF5A 3AQQA 3MXUA 4ALPA 2K4KA 4A3JG 5FLXc 1CUKA 1I94Q 2JQOA 2OWOA 1TWFH 4DK1A 3H0GH 3ER0A 3K80C 2D0OA 1I6HH 5IY0A 3CAMA 4GNXA 1X4MA 1PH4A 1A6XA 1CKNB 2PCFB 3PCOB 4K0KQ 3CQZH 3TRZA 4LW1A 2KENA 3K81C 2CTEA 3LGJA 5IYBH 1VQJA 3EBEA 4YY3L 1EUJA 4DV7L 3J7ZC 1XJVA 2PPBC 4X62L 5BN3A 4IFDH 4PZ8A 1ZZIA 4YCVA 4HJ7A 3E0EA 1N36L 1Z47A 2YTVA 3M4PA 1TU2B 1HZ9A 1CTMA 4DV3Q 1JB7A 4JYAL 2VW9A 2P2RA 1YBYA 4IJLA 1WJJA 4DV4L 4JI3L 1E1OA 5IP9G 4YHHQ 1I6VC 3TREA 4DR6L 1KHIA 1CFMA 4L5SA 4FDBA 1HNXL 4A3BH 2VQFL 4DNTB 2Q2IA 4BY7G 1VQBA 1NY4A 4LUOA 4OO1G 2H5XA 3GDEA 3UDGA 1DD2A 1VQPA 4GNXC 4AYBG 5K36G 1L2FA 2Y0SG 4IPHA 2B8FA 1E22A 3S16H 2N3SA 3E9IA 3WWVA 1B9NA 2YU9H 1CKMA 1KAWA 1OXUA 1GKHA 3EQLC 2PQAA 1VQ9A 4JI4L 4KKUA 3I4MH 1Y8NB 1KL9A 1K8MA 1KD1C 4KN4C 1BBWA 1YNNC 3PIPA 2HH2A 3PV0A 1YNXA 1L1OB 4BXXH 3A7AB 1VQAA 2B29A 3BJUA 2Z0SA 3KJOA 2UU9L 2CWPA 4YY3Q 2OTJA 2CKZB 5C3EG 2WAQE 2OQKA 1VF5C 4LF6L 2YTYA 4PZ7A 1PH5A 4LIJA 2ATWA 3P20A 1PH6A 1N36Q 3I2ZA 4A4IA 4JI7L 1VQ8A 3TS2A 4JBMA 3FP9A 1VIHA 2MQHA 2ZTDA 1B70B 2MO1A 2AXYA 1TWGH 3RNUA 5IWAL 1RL2A 4X65L 2CTKA 1GUTA 4DR6Q 2A1AA 3F1ZA 4B3SL 2VQFQ 3I72A 1SRUA 5LMUL 2BE5C 3HOUH 2N78A 2UXBQ 1DGSA 4JBJA 2B8GA 1KRTA 1NMFA 5KNBA 1C7YA 4G7OC 3G71A 3AB9A 1ZZKA 1V43A 3KOJA 3ULPA 3F8TA 1YJNA 1Q1BA 3CCEA 2BE5D 4DK0A 1WYDA 4LF9L 1W3SA 4BBRG 4A3IG 3RN2A 2UU9Q 3F2DA 3A74A 4GS3A 4B3RL 5GAEC 4LF5Q 4IOCA 1TWAH 4A3GH 1QVCA 2A6HC 4LF8L 1QJOA 2DUDA 2V4DA 4A76A 4JI7Q 5M3FH 2JJQA 1VDZA 2PY9A 4DNIA 4KLKA 2BH8A 4A3MG 1Y69U 4X65Q 1DCZA 3QG1A 3W1BA 3G4SA 5KNCA 3LWUA 1GUGA 2O5IC 1P8LA 3RLOA 2A6HD 1SR3A 1Z9FA 4B3SQ 3DXJC 2ZT9C 3G6EA 1H9MA 4JVYA 1XPRA 2ES2A 1A8VA 2I5HA 1UE7A 1VQIA 4LFBQ 4UPAA 1IYVA 4JV5Q 1U0LA 5DLQE 4LNQA 4KMUC 3HFZB 1HNZQ 3STBC 1ASZA 4JI8Q 4HJ5A 5KNDA 3GTKH 2JXMB 3DM3A 3I55A 4A3DG 3K8AA 2BDOA 5GROA 2LXJA 5FLMG 2AMCB 4L5RC 4B3RQ 4POFA 2LMCB
chains in the Genus database with same CATH superfamily
2DY7A 3HOXG 1N8RC 3I4NH 4JI8H 1SNMA 3J7AF 5AJ3L 2BOSA 2V1CC 2NVXH 2WB1G 4A93G 1QZGA 1KC8C 4OWXB 4LF4L 1S5FD 4PZ6A 3GKUA 2VKCA 2HIXA 2PQAB 4DPGA 3ONAB 2XRSD 1FKAH 4PMWA 1XRHA 1PTOF 3OTOL 2NBFA 3N52A 2F0NA 3CU7A 1CM9A 5FKAC 5JJLA 4K6DA 1W6JA 2K52A 1SN8A 3GTPB 4JI1Q 1BF4A 1K3RA 5C44B 3GTGB 4PQXA 4TKOB 3ND8A 1IL8A 5D3DA 4HN7A 3HKZG 3A8JE 1CKNA 2OTLA 3CC2A 1BUVT 1EQRA 5FLXW 2B63G 3NE5B 5DNFA 2D2CC 3EVQA 1DT4A 4BY7B 4JI6H 1X9NA 1SNOA 3DUZA 1SFOH 3SVMA 4AQYL 1II3A 2YV5A 1FL0A 1N33H 2JE6I 3E3XA 3PO3H 3NPPA 1M8AA 1DONA 2XTIA 1V1PB 2R92B 2IHFA 3BVGA 5LMNL 4E9JA 4JI1H 3HG9A 3QIAA 3D6WA 4A3EG 3BZKA 2JA5B 2NYZD 4N9TA 2VB2X 1OXTA 1BVSA 3J7A5 2CH4A 1HUNA 3V96A 4JI5L 4BBSH 1LYLA 1ICWA 1Q3LA 5GADC 1C0AA 5M3MG 4IUNA 4LAAA 5ELEA 4LFCQ 3NENA 5M5WB 3B6YA 2A1SA 5IP9H 1VQ7A 2A8VA 2NN6G 2VS1A 4OIJA 3J81c 5IYCG 1BBUA 4NXML 3RD4A 2EY6A 2KA7A 3GTLH 2UXCQ 1HZBA 2KECA 2PI2A 3OIPA 3P75A 3OOCA 4IJHA 2RDGA 1S5ED 1QVFA 3RMHA 1Q81C 4HIDA 1E0BA 3K58A 1JC7A 4WJWA 4LFCH 5GAHC 2ZJPA 3VYRA 5AJ3Q 5LHY1 2I0QA 1W2BA 1MSZA 4LF4Q 2JA7H 1SE8A 3K5NA 4LF7Q 2Q8RE 1GO3E 4B3MQ 1SNPA 1E7ZA 1WVLA 1K8GA 3QB3A 2UXCH 3EFXD 4KD3A 4LWCA 1HZAA 3WOFA 3A5UA 4FF3A 1V9PA 2K50A 4J1MA 4DR3L 4XT3B 3T4AC 1B8AA 4ZCKA 3PIO3 1TVXA 1PH1A 1I50B 2E8GA 2E3UA 4A3CG 1XXGA 4CKBA 3FVQA 1HZCA 3DLLA 2RBMA 2NVTH 3CC4A 1VQHA 1BDOA 3FMCA 5CC4A 4LF7H 2QEXA 4B3MH 3R2TA 2R7ZH 4X3SA 2K1HA 2LF0A 2VQEQ 5C3EH 1PVOA 5JJIA 1D1KA 4AQYQ 3MC0B 4HCSA 5C0XG 4DUZQ 3NSWA 1XMOQ 2JVZA 4DR7L 4GLXA 1EY6A 1EU4A 4EGVA 1I3QB 1PQXA 2F0QA 5IP7H 5IT9c 1XYIA 2ANNA 1O7ZA 5LMNQ 1IZ6A 4UDUC 1WVNA 1SE4A 4BY1G 1K73C 1Y1VH 3I3CA 4C3JB 4E6IA 1MJEA 1D1IA 2KJXA 1BQQT 5H1SE 1BCPC 1EWIA 1LM0A 2E2JH 5ELCA 1BO0A 2VQEH 1Y1WH 1CKOA 4AH6A 3OETA 2OPVA 2IT1A 1DJRD 2JP1A 3DWQA 3OMCA 4DUZH 1XMOH 3CCQA 3M3YH 3BU2A 4P72A 4DGZA 2EQSA 4K0KL 1N34Q 4BBRB 4NXMQ 1QWYA 1UAPA 4AIMA 4DUYQ 1HTLD 4A3IB 1A2TA 2R93B 1VBIA 1XMQH 4IALA 3EROA 4Q0FA 2BH2A 5ELDA 4X3UA 1BCPD 1ENFA 1KLGD 2G9HD 2LRRA 4N9PA 1Q8KA 4YCWA 2Q2HA 2C35B 1E2WA 4Y52H 2RKSA 4PMCA 1GUNA 3HOWB 1K83B 2PMZB 4K5VA 2IX0A 2WKDA 2K5VA 1TS5A 1FJGQ 1N34H 1SMXA 4DUYH 4KJOA 1X3EA 4RCNA 1VQKA 1Y14B 1EZ6A 4DV3L 3S1MB 4A3MB 1FVIA 1Q12A 1KHMA 1ZEQX 4DR3Q 2PI2E 4MTNA 3HKZE 4QUCA 1SAPA 2JK8A 1D5ZC 5EBDA 4X3KA 2CW0C 4YHHL 2UUCQ 2IJ0A 2O2LD 2EPBA 3ERSX 1PZID 3T56B 1WCMB 5J22A 4GKJL 3L9AX 1S3OA 1FJGH 3J80i 2GN5A 4TQUS 3HS0C 1ENCA 1I6HB 2M6QA 4I65A 1A3UA 4N8X1 4DR7Q 1F2ZA 3S14H 3S1RH 1VQ6A 1K8OA 3K5MA 2LFNA 2EDGA 4BS9A 2ZTEA 4CDCC 4OEMB 4CKEA 1DOLA 2UUCH 2YQRA 1J6QA 2CW0D 3BVZA 1QE6A 2HDMA 2E2HH 1OXSC 2IY5B 2ANRA 3MEHA 2JN4A 1K28A 4MN3A 5IYDH 4JI0Q 3H94A 4P74A 3G7LA 3H3VC 3Q24A 4ZYSA 2AQ1B 4K14A 3J81i 2JA8H 1F2YA 2NVQB 5DM63 1CSPA 2HQLA 3TSSA 1QILA 2K5NA 3CC7A 1STBA 4DR5L 4NXNQ 5BN5A 4G08A 2KCMA 5CBEE 2PQEA 2F4VH 4A3DB 2KHJA 1KRSA 1HA6A 4RAUC 1V1QA 4JI0H 3MVVA 5HGTA 2D5DA 4YWLA 2UXDQ 1QNUA 2ZXOA 5A35A 4OX9L 2A5HA 3PO2B 3EJIA 2JA6G 1CZWA 1EYGA 2XGTA 1SNDA 1CK1A 4NXNH 2L1BA 1YZ6A 4A93B 2KEDA 1SEBD 2DY8A 1EFID 1R9TB 4A3LG 1Q90A 4A3KG 1PYSB 1N32Q 1VQGA 4H0LC 4K8IA 4QMFB 3KBGA 2EIFA 4HJAA 4F7XA 4RGMA 3CCMA 4IN3A 2UXDH 3FKIG 1TS3A 2QF7A 4J15A 1H9KA 5C0XJ 2XRQD 4V0BA 2L55A 5C44G 1BCPB 3CXCA 3GTOH 1EY4A 2K5QA 2EYPA 2SOBA 4GN3B 3HKZB 4C3HH 1G51A 1SMYC 4GKJQ 4ME5A 4QMGA 3VR4A 5I6WA 3V2TA 3S16B 5ISRA 5T1GA 1N32H 1F2MA 3E6ZX 4NDXA 1KDAA 3CF5A 2RHQB 2LKVA 1QCBD 3GV6A 1LTRD 2PNRC 5HURA 1TWCH 1SDFA 4RA8A 2E75C 3T13A 2UXBL 1HTPA 3UDIA 3OSSD 3HOYB 3EN2A 3L2PA 2R92G 5EBCA 1TXYA 2D62A 3IRBA 5M5YH 1MHWC 4JI2L 4M1UB 2JZXA 3WDNA 2JA5G 5I4DA 3D31A 2EYJA 2CFMA 1VQFA 1HNWQ 1IKLA 3J80E 1P16A 4G7ZC 3MEFA 3DMUA 4U673 5KYLA 5M3MB 4A3FG 1AZPA 5FO9B 1AE3A 2F0LA 5FO8B 3S1QH 3K7AB 3T1HL 2F0KA 4DR5Q 1HPCA 4XQQA 3J81j 5JEAH 2AHOB 3C2PA 1OXXK 1FYCA 2K7VA 1WI5A 1E3PA 4QJFA 3U58A 4NPSA 2FHTA 2B63H 3G6JB 1S5CD 5DAUA 1UG8A 4ZUIA 1HNWH 1KABA 2TSSA 3D4RA 4OX9Q 2IX3A 2QDBA 3A55A 3J81E 1WTHA 4LF5L 1I5FA 1XTDA 4BA1I 3R93A 1J8IA 1STNA 3G48A 4MZ9A 3L7ZC 1FR3A 1XX8A 2F0FA 4WRDA 4A3EH 1WTOA 1HCZA 4RWSC 4OO1I 1V1PA 3KYHC 4IQZA 3Q23A 2VUMH 3HOVH 3VR2A 3D8GA 3R8BA 3VA5A 1RKNA 1YNJC 1G2TA 2F1MA 2ALYB 1Y8PB 5FOBB 1VS0A 3E5SA 4CBVA 1R4PB 3J80W 2G8YA 1IBML 2M2LA 3FRPB 1AH9A 3S2HH 3Q8DA 5EPLA 3A54A 4R4CA 5IYCH 3QO2A 1MD2D 4WJ3M 4YWKA 2H1EA 2MGSA 2ZM6H 1LTSD 1EQTA 3AFQA 1ML0D 2Q8IB 1ESRA 2HCCA 4L5QA 3IFTA 3FEWX 1JOQA 1YNJD 2WFWA 5IODA 2A19A 1BOSA 1JE5A 1C9OA 4LFBL 5C4XH 4Y7NH 3ICEA 4BY1B 4JI2Q 3H6MA 2M9VA 4WJ4A 3J81W 4C3JG 2AUKA 1M90C 1D8LA 4JV5L 4QY7A 1A3VA 2NVYB 3KDKA 2AUJD 1SYBA 3M4OH 1STHA 1PV4A 4IZ8A 5IT9E 3BG3A 1J5EH 3ZYYX 1HNZL 4L63B 1SNCA 1EY5A 4IUPA 4JI8L 3T1HQ 1TS4A 2X06A 1PH2A 5IT9L 3S15B 2R7FA 3OW7A 1GUSA 3TP8A 1BNZA 3H3VH 3S2DH 3S1NH 3BYYB 2QGQA 5E4WC 1E2VA 2PO4A 3CCLA 1JJGA 3K0XA 5FJ8G 2R93G 4JVHA 4BWGB 1GXDC 5I9PA 5IGBA 3MWYW 4EQOA 1DXMA 4X6AH 4P2CB 3A56A 5IOCA 5F2DA 5CV8A 1GD7A 1YVCA 4DV2Q 1X6OA 3MTSA 1JQYD 3OPOA 2CTFA 1SYEA 1EYCA 1S5BD 2A69C 5I6YA 5C4JH 5CYUA 2B2TA 3HOWG 3NELA 5C5LA 1BKBA 1YJWA 1NJIC 4POGA 2L4NA 4KD4A 4JI6L 2BA1A 4DV6Q 1TY0A 5HY6A 1C48A 1N33L 4DF7A 4XQNA 3TEHB 3U4ZA 5E4XA 3R2IA 1EY0A 1IBMQ 3CW2C 4DV2H 1PYWD 5C3XA 2EOTA 2D9IA 5IT9W 4RKLA 4JI1L 1IL2A 5G3LF 2LXKA 2A69D 2L5TA 1WCMG 3EIVA 2KHSA 4B08A 4KN7C 2MHVA 4KHPQ 5A2QE 3H0GG 2EVBA 1VQLA 1D7QA 1I6UA 2X6LA 4DV6H 1O7IA 4XIGS 2OQ0A 5EPKA 4C2MB 2VXWA 3GTJH 1ODHA 3M4QA 3RLNA 3I90A 1PMRA 3GTQH 1U4LA 3PIOA 3GTKB 3RZOB 4UAIA 1A63A 1V8CA 3KDFB 4C3IH 3KK7A 1SROA 4L6TB 1S20A 5IYBG 2IHEA 3GV3A 4H7BA 1A2UA 2JEBI 4B9WA 4KHPH 2F0SA 4IURA 1ASYA 3MFYA 1S03G 3IL8A 3P7JA 2KEEA 4LFCL 1B3AA 3I4NB 3T1YQ 3C3LA 5FLXE 4IFDG 2F0MA 1XPOA 4B9XA 4I7AA 3EA6A 1NNXA 4DR1Q 2B2TC 1HRJA 3GD7A 4KK7A 2UXCL 1ZKOA 5C6AA 3PUXA 4RMFA 4HIMA 1WHRA 1EQQA 3W1GA 3MXPA 4XXEA 2A74C 3PO2G 1NXUA 2Z4HA 2UUAH 2JA6B 3VKEA 5A2QW 3T1YH 1IW7D 1UE6A 4A3JH 3MXNA 5GQOA 4DR1H 3JAMc 2B2WA 4LF7L 4A3KB 4B3ML 4A3BG 1XNQQ 2EYHA 3SK4A 4JI6Q 2R6GA 3FAUA 3NK9A 2EY5A 3MAQA 2NTSA 4HSPA 5JVH3 1MBYA 1N33Q 2ZTCA 2FJ2A 2RSOA 1Q8IA 2VY3A 3FKIB 2CQOA 1KLUD 2NTTA 2CWAA 4MTKA 2P5ZX 3VA7A 3BZCA 1H9JA 1S4ZA 2HDLA 2E76C 4APVA 1XNQH 3AEVB 1EIGA 2SNMA 1FNUA 4G57A 2VQEL 2A6EC 3I4MG 4DUZL 1XMOL 3HOYG 1PFMA 4KKTA 4EQ5A 3I56A 1IBLQ 1IHZA 2KOLA 4R9WA 4CHTB 4BXXG 5CBAE 2BA0A 5HGQA 3M85A 2SEBD 1X32A 1XMQL 2L12A 1A15A 5M5XB 4XYQA 3ZJYC 3GTMB 4A3FB 1MI2A 1RIPA 5L37A 1EIFA 3KFUA 1WTVA 2X69A 1MJCA 1UUPA 5CV5A 3SE0A 1PRTC 3GTPH 2A6ED 2OT2A 1F0XA 3GTGH 2QKIC 3O13A 1IBLH 3H91A 1WTXA 1N34L 1GVPA 5ELOA 2DNCA 4GOPA 1Q1EA 4DUYL 3RF2A 2K6AA 2B3GA 4BY7H 2B2WC 1HXYD 4OO1H 5BR8H 4B3TQ 2EZVA 2PMZE 2K28A 4GLAC 1MSGA 5ELNA 2Y3MA 5K36H 5LMNW 3CRLC 4OGQC 2AWNA 4JCVE 4FXKC 3HOZB 1TWHH 2F0HA 1NR4A 1PRTD 2JA5H 3QD7X 1FJGL 1VQDA 1WE8A 3OIQA 1XNRH 3KJPA 1YITA 4L8JA 2F4IA 1VIGA 4QL5A 3HOUG 1HQMC 1CHQD 4DA2A 4DFAA 3VR5A 4B3TH 4KY5A 2NB0A 1PZJD 1YHAA 2PYKA 4FXGC 5G3LD 4CJ1B 2PNHA 2NZHA 1X0AA 1QNKA 2UUCL 1J9OA 4NZRM 2VZAA 4DKAC 3DEPA 1D2BA 2F0VA 2QA4A 3M7NA 1AFPA 2GVBA 3CMEA 5ELFA 3CHBD 4RGTA 4CDEC 2MJHA 2ID0A 1I4RA 3IKJA 1ENAA 4NZTM 1X3QA 5KIXA 1SSOA 3PSIA 1CSQA 4HR7B 4JG2A 1SLJA 4P73A 4DR4Q 4IFDJ 2C9OA 4H44C 3UI2A 4ZAIA 2F4VL 1PH8A 3S17H 2K04A 1XMQQ 1KNAA 1LT4D 2EE1A 4GOPC 1ILQA 4JI0L 4HIOA 3KDGA 1JMCA 1NE3A 1MIUA 3OYYA 4OWWB 1IBKQ 4KHVA 4A3GG 4DXGA 1AN7A 1I50H 2O4XA 4NXNL 1PTOC 1A3TA 1WFQA 4DR4H 1Z6HA 1B50A 1IYJB 4OONA 2J0TD 3HEJA 1VMPA 3D3RA 4YWMA 3BYTB 1STYA 3KF6A 4K2LA 4TVAB 4EC5A 5J3BA 3RZDH 3H3VI 2EY2A 1WD1A 1O78A 4CKCA 3KLRA 3W2DA 2UXDL 5EAYA 1I3QH 2LY7A 5I2XA 1I4XA 3LX0A 1IBKH 2OCEA 1CI3M 2K14A 1CT1D 4C3JH 1F9SA 1Z7TA 5C0XI 2O4CA 4HEDA 1YI2A 1PTOD 1N32L 4ILWA 1B53A 2DJGC 2CPQA 2CWHA 4LJZC 1WTWA 4R4OA 1XTCD 3PUZA 1HR0Q 3L0OA 1R4QB 3TP6A 1X54A 2RCFA 1KNEA 2DJFC 3ERQA 4DAMA 1OXVA 4BBRH 1K8AC 1SYDA 4PNYA 2LSSA 4EVOA 4DR2H 5JEAJ 4X66Q 4A3IH 2E2HB 5FJ8H 3NTKA 1O80A 1XPUA 4CJ2C 1TWFB 1I4GA 2PQUA 2C5CA 5LL6b 1PRTB 5C4ZA 3H0GB 3NHHA 1ONLA 3SEBA 5BN4A 2UUBQ 1ZXTA 1LV9A 1G2SA 1SXTA 2CQAA 2VNUD 1J5KA 4RH6A 1HR0H 4DV1Q 3CP0A 3MXNB 4NMZA 4IOAA 1EY8A 4GLVB 1T5EA 3HOWH 3CQZB 2XVSA 4R4TA 2F4VQ 1B2TA 1Q46A 3DWAA 3X3NA 2Z4IA 2OPUA 4X66H 3M4YA 4LUZA 1V1OA 1HNWL 4DV5Q 4K6LA 4A3MH 2Q2UA 3S1MH 4GKKQ 4K8JA 3V05A 2ICIA 4MNOA 2XSCA 1QZHA 3PUYA 2UUBH 1X3GA 3UE0A 3I4NG 3KLWA 3ULJA 4DV1H 1EYDA 2Z6KA 4CDDC 5IE8A 5J39A 1I4PA 3NWSA 1I4HA 4EQNA 1WCMH 2QEJC 4AM3A 3ULLA 4P71A 1BR9A 1LABA 4KHZA 4DN4M 3ITPA 2G5DA 1ZTGA 3F2BA 4DV5H 4GKKH 4B8TA 1D5MC 2Q2TA 3HP3A 3R3OA 5I2YA 4R8NA 1VQMA 3CCSA 3GTOB 5D65A 3ND9A 2RVLA 4DV0H 4C3HB 3LNNA 5DM73 1O7YA 2ZM6L 4HSVA 4A3BB 1I94H 4FF4A 3KDFA 1ET6A 5EKLA 5J1ZA 3AMUA 2HHHQ 3AYHB 2J4XA 3K7UC 1JOKA 3HRZC 1TWCB 3D4DA 5IIFA 1KQSA 2NVQH 2PW5A 3PO3G 1YHQA 3CRKC 3CCVA 4GOPB 2Z8LA 4EQPA 3TS0A 3K57A 4TRDA 1G8ZD 2F0TA 3JAML 2QDLA 4A3DH 4WFN3 3QR8A 3N6RA 4X64Q 2YU9B 5FLMH 3SR1A 4BBSG 1MSHA 1K9MC 2N55A 3KBXA 1J5EL 2HHHH 1PTOB 2NZOA 1I4QA 5ELBA 3PO2H 3I4MB 3I7FA 4OXPA 5KYIA 3HOXH 3JC66 1RJTA 4LFAQ 4XTCS 4JVZA 2K32A 2ZXRA 3U50C 4A93H 5EKKA 2Z6KC 1R9TH 1B4OA 3BDOA 2PZUA 2DGYA 4HJ8A 4X64H 2E5LQ 2NWGA 4X3TA 3TDQA 1TS2A 2HCIA 4OL7A 3PGZA 4LFAH 1VQNA 1W6KA 2JA7G 1VF7A 2CHBD 2VUMB 4IPGA 3S24A 3F2CA 1UWVA 1LTGD 3OW2A 5IGDA 2RCNA 1SJHD 5JPMC 1VQOA 4KI0A 2CVRA 1OO9B 2ZQEA 3KLSA 1M4VA 1JJCB 1GUOA 1TWGB 2E5LH 3AEVA 3CCUA 1S40A 3PF4A 3HOYH 4DV2L 3VDYA 3HZXA 4FYDA 2F52A 3U1KA 3HOZG 3SGIA 2ZM6Q 1A62A 2YTXA 1STGA 2ENBA 3I73A 4UP9A 1AEXA 2R7ZG 3CPWA 4G4KA 1NMGA 4DV7Q 5M3MH 4DV6L 3UDXA 3HOUB 4UP7A 2DN8A 2RQXA 2ZJRA 4KY6A 4X62Q 1H9RA 3K7AH 5IP7G 3LWEA 2NN6H 4XDXA 5C4XB 2KBNA 1Y1VG 2RA4A 4LK1C 3KF6B 4JK1C 1SNQA 2JA9A 3KF8B 1H9SB 4JYAQ 1J5EQ 1VCIA 5KRUA 4KHPL 1ESFA 1GUWA 4YY3H 3IFDA 4FO2A 1SYCA 4DV4Q 4DV7H 1Y1WG 3H15A 4JI3Q 3D6CA 1NSNS 4X62H 1EZ8A 3DEOA 2KHIA 2WACA 4FVMA 2K75A 3DHQA 1HNXQ 3EZJA 1O7LA 1N36H 1Y8OB 3VR3A 1PYBA 1EFWA 3K59A 1PFBA 4XT1B 3URYA 2FFMA 1JORA 3K5LA 4R4QA 3PQIA 3W5OA 2Q8TA 5KEEA 4JYAH 5I9OA 1EWHA 1F9QA 2UUAL 2F03A 3NP8A 4DV4H 4ZRZA 1TWAB 4JI3H 4A3GB 1KDCA 3Q22A 3T1YL 4LMQD 4A3CH 4QQBX 1DYQA 2B39A 4DR6H 3UDFA 2FPHX 1EWCA 4DR1L 4HJ9A 1HNXH 5M3FB 3SK5A 2K01A 4FJUA 2VQFH 3CD6A 1FGUA 1Z2IA 1DM0B 4JI4Q 1N9WA 1YIJA 5C0XH 1PA6A 1X56A 4JC0A 4PV1C 4JPBW 3J7AK 3KUPA 2F3IA 5JOBA 2ZJQA 1KDBA 3J7AV 2F3VA 5EQ0A 4BY1H 4JBWA 1E1TA 1VMCA 1X4NA 3CKIB 1U4PA 5EPJA 1GM5A 2Z6BA 2NVYH 2N8NA 3D0FA 3T53B 1PH9A 1XNQL 5DT9A 1JJ2A 3CMAA 1QOHA 4IUTA 2A68C 3QOLA 4LF6Q 2A73B 4JI4H 1RTNA 1K0RA 2E2IH 2JEAI 1RODA 3NQTA 3DM1A 4RFBA 3SK6A 3K5OA 3S15H 2CWFA 3GP7A 2I5LX 4HMIA 2WAQB 3FPPA 4O42A 3OMGA 3H09A 3UE1A 1YHBA 1S5DD 1EEID 4JBKA 2UU9H 4XYOA 4GNXB 5IYDG 4DNRB 3OWFA 1NBWA 4Z9CB 5IWAQ 1G91A 1GHKA 2JA8G 4LF6H 4I7ZC 2A68D 2K5HA 4FP5D 4KY7A 3CCJA 1LACA 1IBLL 1NR2A 4K5XA 5DEHA 3PUVA 1X65A 4K2KA 4JI7H 5LMUQ 5T1IA 1SE2A 1PDQA 5IGFA 1CA6A 2MNAA 4OELB 4AYBE 3A0JA 3RLFA 5BR8L 2UUAQ 3NCVA 2Y0SE 1PFSA 4HIKA 1GJXA 5IWAH 1IW7C 4OCHA 2SDFA 3PIP3 2EJMA 4X65H 1QUQA 3TBIB 1JT8A 1TIID 2NVXB 4N8FA 2QNDA 1XNRL 3NTIA 2KQ3A 4B3SH 1LT6D 5D3IB 4RGOS 1EC6A 1V8QA 5LMUH 5E7NA 1AW7A 2D0PA 1C8CA 2R61A 2Z9HA 2Z1CA 4ODGA 4B3TL 1TT2A 1G291 2WV6D 4C2MH 3Q0AA 2HT1A 4GN5A 4LF9Q 4R1JA 1PHJA 2ASBA 1X55A 1CZGA 2E2DC 1LTLA 1B44D 3RR5A 2FXQA 3RZOH 1E2ZA 4C3HG 4EX5A 4R8IA 1UE5A 1S72A 2MUYA 4O2DA 3I0PA 2IW3A 5JJKA 5LL6X 1SFOB 2CTMA 1NCVA 1STEA 3PO3B 3GR5A 1A0IA 3STBD 1IXRA 1BCPF 4LF8Q 4G7HC 2LS01 4LF9H 2MFIA 4JOIA 1DZ1A 4DAYB 4H13C 4GZYC 1KXLA 1PLFA 3V69A 2IX1A 2EY1A 4S3SA 2CCZA 1EY7A 3CPFA 4IFDI 4BBSB 4QGUA 4B3RH 2F0OA 1K1GA 3NEMA 3S9WA 1L0YB 2JA6H 1B7YB 5JEAG 4KJNA 3TZUA 3NBHB 4LF8H 1VQ4A 1F77A 2O5JC 1F2LA 4DR4L 4RG1A 1OTCA 4A3LH 4U68A 2ICEC 3GTLB 4A3KH 1DTJA 2CPMA 4BA2I 1X9ZA 2BL5A 2EXDA 1B3QA 1VQEA 1PH7A 5BR8Q 2QW7A 2DNEA 2FMRA 2RHSB 2I5MX 3U4VA 4ZQ3A 2F0GA 1JCKB 2AKWB 1SJED 3J80c 1IBKL 3FKIH 3C1EA 3AFPA 3TZDA 4AYBB 5GAGC 4RHRA 2YYZA 5C44H 1JWMD 1MGSA 2IPKD 2Y0SB 1EIYB 2JA7B 1TWHB 1XNRQ 2HUGA 4TSSA 2VUMG 3HOVG 3FPUB 1PH3A 3MA2B 3U9SA 3GABA 2K33A 3DWPA 1SBBB 1WOCA 1NAPA 3C1FA 3GQBA 4QUFA 4WORA 4L5TA 5JPNC 4QB4A 5K5PA 2F0UA 2R92H 1T5XD 4OIKA 4DR2L 2EJFC 2NVTB 4JOIC 1HH2P 3E0JA 3E9HA 1FNVA 4ME3A 2N88A 1UEBA 2R7ZB 5M5XH 1UE1A 1IYUA 3GTMH 4UP8A 5C3EB 4ID6A 4NB3A 3A8KE 4UHVA 5E3FA 5EJWA 3T51B 4FNFA 4A3FH 3I4OA 1HR0L 1L0XB 4IPDA 1JE4A 1ZYRC 2I46A 4NP5A 5M5WH 2VB3X 2N49A 4UY8C 5C4XG 2CTLA 1QB5D 2QILA 2WINB 1Y1VB 3S17B 4X66L 5CV6A 1JWSD 1JOOA 2KCCA 1KTKA 4DXFA 3CCRA 1B9MA 2NZ1D 4Q5VA 3PMFA 3OTOQ 2NN6I 1TKWB 3M9BA 4R4IA 1QVGA 2E2JB 1H95A 2EJGC 2UUBL 1Y1WB 1RTOA 5E1FA 4DV1L 3M3YB 1PXUA 1ZYRD 3HGBA 3HOZH 1WTPA 4LF4H 2PZTA 1L1OA 3MZ5A 2CTJA 4RGNA 3I4LA 3GO5A 4WALA 2RF4A 2K1BA 3RZDB 4DV5L 3C46A 4GKKL 3OTOH 3FHWA 4O1NA 2BDNA 3Q6SA 1EOVA 1NTGA 2KCNA 1HHVA 3F2UA 1HR0W 2NUCA 1SYGA 1L0WA 2GVAA 1ILPA 3SDZA 4FXDA 1VQCA 3VR6A 4DV0L 2EYMA 5JJZA 1HJPA 3W3AA 5M9OA 1HA5A 5M3FG 1I94L 4JI5Q 4QIWE 2M00A 2EYLA 2E74C 1AE2A 1T9HA 2OXPA 4DK3C 3TP7A 3RN5A 3KF8A 2HIVA 1H9SA 1TY2A 4AQYH 3TQYA 3A5ZB 5EGTA 1GHJA 2EYFA 1CQFA 3JAMi 1ZZJA 1UEAB 4RKBA 1KIXA 2RSNA 4P75A 1EEFD 4IPCA 1G6PA 5LMNH 2FINB 4DR2Q 1LTTD 4DAVA 4H02A 4YCUA 1LUZA 2XWBB 2MO0A 1Q82C 3A8IE 5IGCA 5JAVA 1EL0A 1U5KA 5IGGA 2MP1A 3HKSA 2JYOA 1Q86C 4JI5H 1SYFA 2HHHL 1LT5D 2R7DA 1QUQB 1QG7A 1J4WA 2WB1E 5IGEA 3S14B 3S1RB 4WANA 5FO7B 2WAQG 2AWOA 3QJYA 4O0AA 4LUVA 4C3IG 1E24A 1YJ9A 4NXMH 3MFGA 2L15A 4ZKBB 2RDHA 1V9NA 2R93H 1G6ZA 2VL6A 1Q7YC 4X64L 1L1OC 2OEOA 3BZDB 4PG3A 2DGRA 4B8CD 4IUVA 2LTMA 2JA8B 4OWTB 4IO9A 3PUWA 1YEZA 4KKSA 3VYUA 4NBQA 1K83H 1X3PA 4LFAL 4DAPA 3RUZA 1SE3A 3P1HA 1M1KC 3TN2A 2KCTA 3K6OA 5CORA 4A75A 1AZQA 1VQ5A 1X3FA 1MKHA 2E5LL 3A7LA 4DK6C 4GN4B 4DR3H 2HH3A 1JB3A 2B2UA 2WP8J 1TUAA 3KLSX 5C3WA 4DV0Q 3PF5A 2F0JA 3AQQA 2PZWA 1NUCA 1CQVA 3MXUA 2K4KA 4ALPA 4A3JG 1WTJA 2CH4W 5FLXc 1CUKA 1I94Q 1LTAD 4QCLA 3BDCA 2EXZA 2JQOA 2OWOA 1TWFH 4CGYB 3T16A 4DK1A 3H0GH 3ER0A 3K80C 2FMMA 2D0OA 4C1NK 2EYOA 5IY0A 1I6HH 3CAMA 4GNXA 1X4MA 1PH4A 1F9PA 2TMPA 4OHJA 4QIWB 4DR7H 5EKIA 1A6XA 4M8AA 4ZUJA 1CKNB 2PCFB 3PCOB 4K0KQ 3CQZH 2MJ8A 3TRZA 4LW1A 2KENA 1RDPD 4RCOA 2KVMA 1B1ZA 3K81C 2CTEA 4OD6A 3LGJA 5IYBH 1AN8A 2B2VA 1VQJA 3EBEA 4YY3L 1EUJA 4DV7L 3J7ZC 2OF1A 2F0EA 1WTQA 1XJVA 2PPBC 2AQ3B 3HOXB 4X62L 3QWNA 5BN3A 3JAME 4PZ8A 4IFDH 2K5DA 1ZZIA 5M5YB 4YCVA 4ULLA 4DU9A 2B2YA 2WB1B 4HJ7A 4K0KH 3E0EA 1TQOA 1N36L 2XNAC 1Z47A 2YTVA 3M4PA 1TU2B 1HZ9A 1CTMA 1TR5A 4DV3Q 1JB7A 2LTLA 1FGBD 4JYAL 1LLRD 2VW9A 3OHXC 2P2RA 1YBYA 4IJLA 1WJJA 2GA4B 4DV4L 1LTBD 4JI3L 1E1OA 1CHPD 5IP9G 3S1QB 1ET9A 4YHHQ 1I6VC 3QOJA 3TREA 2XN9C 4HAEA 1KHIA 1CFMA 2B2UC 4DR6L 4L5SA 4HTHA 4FDBA 4ZLTF 1HNXL 1K0SA 2ZXPA 2B63B 4A3BH 2VQFL 4DNTB 5TSSA 2Q2IA 4BY7G 1VQBA 4CDFC 1NY4A 1DOMA 4LUOA 4DV3H 4OO1G 2H5XA 3GDEA 3UDGA 1DD2A 4ABNA 1U4RA 1VQPA 4GNXC 4AYBG 5CV7A 5K36G 1L2FA 2Y0SG 4YHHH 4A3EB 4IPHA 3SK8A 2F3WA 2B8FA 1U9RA 3HOVB 4GKJH 1E22A 3S16H 2N3SA 3E9IA 3JAMW 4DAYA 3WWVA 1B9NA 1LTID 1ICFB 1SMYD 1EU3A 1CKMA 2YU9H 1KAWA 1OXUA 2K5WA 1GKHA 3EQLC 1PTOH 2B2VC 2PQAA 1VQ9A 4MHEA 4JI4L 4KKUA 3I4MH 1Y8NB 3J80L 1KL9A 2H4OA 1K8MA 1KD1C 4KN4C 1BBWA 1YNNC 3PIPA 2HH2A 1HFGA 3PV0A 1YNXA 3S2HB 1L1OB 4ZK9B 4BXXH 1HFNA 3A7AB 1VQAA 2B29A 3BJUA 2Z0SA 3KJOA 2UU9L 2B2YC 3NBHA 2CWPA 1D6EC 4YY3Q 1EY9A 2OTJA 2CKZB 5C3EG 5CR3A 5C4HA 2WAQE 3BS1A 2OQKA 1VF5C 4LF6L 2JSOA 2YTYA 4PZ7A 2PT7G 1PH5A 1STAA 3L3OC 4LIJA 2ATWA 2FMCA 4DR5H 3K0YA 3P20A 4ZKCB 4Y7NB 3J81L 1PH6A 1N36Q 3TMEA 3I2ZA 5CV4A 1YNND 4A4IA 4JI7L 4FJSA 1VQ8A 3TS2A 4JBMA 3FP9A 1VIHA 2MQHA 4PMBA 1FNWA 3M4OB 3BDLA 2ZTDA 4JW0A 1B70B 2MO1A 2AXYA 1TWGH 3RNUA 5IWAL 4OX9H 1RL2A 4X65L 2CTKA 2IL8A 2K03A 4F88A 1GUTA 3S2DB 4DR6Q 2F0WA 4NW2A 3S1NB 2A1AA 3F1ZA 2QCPX 1GOZA 2K05A 3M7GA 4B3SL 2VQFQ 4MIUA 3I72A 1SRUA 3I8ZA 3X3MA 5LMUL 3WOEA 2BE5C 3SXHA 4HCEA 1EIHA 2L11A 2X6GA 5NUCA 4C56C 3HOUH 2N78A 3NUCA 2UXBQ 1DGSA 4JBJA 2B8GA 1KRTA 1EQVA 2BCOA 1UNSA 5C4JB 1NMFA 1SEIA 5KNBA 1C7YA 1K3BC 4G7OC 4XQJA 3G71A 2L9HA 1FD7D 5C5MA 3NTHA 1PFNA 2G9DA 4C1NI 3AB9A 1ZZKA 1V43A 3SHLA 3KOJA 2L0CA 3NQIA 2KUMA 3ULPA 2SNSA 3F8TA 4IUQA 3IAYA 1YJNA 2E2IB 1Q1BA 2R3ZA 3CCEA 2BE5D 2J7ZA 5D14A 3UOEA 4J8QA 2UXBH 4DK0A 1WYDA 5KGUA 4LF9L 4NKLA 1W3SA 4BBRG 4HMJA 2WKCA 4JI2H 3I70A 4A3IG 3RN2A 5COYA 5FK9C 3F2DA 2UU9Q 3A74A 3MXGA 4K5WA 4GS3A 2F0IA 1DOKA 4PDBA 4B3RL 5GAEC 2F0DA 2F0PA 1F9RA 1PZKD 4LF5Q 4IOCA 1TWAH 4RHSA 1HUMA 1U4MA 3SB1A 1EYAA 1XWEA 3GTJB 1QVCA 3VYTA 4A3GH 4FF2A 3T1HH 2A6HC 4LF8L 1QJOA 3MHBA 3GTQB 1WD0A 2DUDA 4J6HA 5CMDA 4KTAA 2V4DA 3U9OA 4C3IB 4A76A 4JI7Q 5CV9A 5M3FH 2JJQA 1VDZA 1AP0A 1PRTF 1RD9D 2AQ2B 1JR0D 2MPMA 2BH8A 2HQEA 4KLKA 4DNIA 5CGKA 2PY9A 2PW7A 4A3MG 4KV6A 1Y69U 1RCVD 3OWEB 3NBIA 2XIWA 1CA5A 2IWHA 4X65Q 1DCZA 2WIIB 4LF5H 3QG1A 3W1BA 3G4SA 3VYSA 5KNCA 3LWUA 3J7YW 1GUGA 4CJ0B 2O5IC 1HQRD 1P8LA 3RLOA 1Z9FA 1SR3A 2A6HD 4B3SQ 2D9UA 2M8WA 3DXJC 3OSOA 2ZT9C 3G6EA 4V190 1H9MA 4JVYA 1IKMA 1XPRA 4F87A 2ES2A 3I91A 1A8VA 5A2QL 5LL6S 2I5HA 1D5XC 3FDTA 1UE7A 1VQIA 4LFBQ 4YIJA 3NWTA 4H8AA 1IBMH 1LO5D 4UPAA 4QF4A 1IYVA 2I07B 4A3JB 1WTRA 3BVMA 4F8MA 4JV5Q 1U0LA 5DLQE 1RHPA 4LNQA 4KMUC 3AU7A 3HFZB 1HNZQ 1KAAA 2XWJB 3STBC 1ASZA 4JI8Q 3NXWA 4HJ5A 1EOTA 5KNDA 4LFBH 5AFWA 4FF1A 3GTKH 2HD3A 2JXMB 4IUUA 3DM3A 1JWUD 3I55A 5FLXL 5JVG3 4A3DG 3K8AA 1LT3D 1RF2D 2BDOA 5GROA 4JV5H 2LXJA 5FLMG 2AMCB 4L5RC 3D4WA 4B3RQ 1C4QA 3TP5A 2FFKB 1JICA 2RDFA 4POFA 1BXTA 2LMCB 1BBXC 1HNZH
chains in the Genus database with same CATH topology
2DY7A 3HOXG 1N8RC 3I4NH 1SNMA 3J7AF 5AJ3L 2BOSA 2V1CC 2NVXH 2WB1G 4A93G 1QZGA 1KC8C 4OWXB 4LF4L 1S5FD 4PZ6A 2HIXA 2PQAB 4DPGA 3ONAB 2XRSD 4PMWA 1PTOF 3OTOL 2NBFA 3N52A 2F0NA 3CU7A 1CM9A 5FKAC 5JJLA 4K6DA 1W6JA 2K52A 1SN8A 3GTPB 4JI1Q 1BF4A 1K3RA 5C44B 3GTGB 4PQXA 4TKOB 3ND8A 1IL8A 5D3DA 4HN7A 3HKZG 3A8JE 1CKNA 2OTLA 3CC2A 1BUVT 1EQRA 2B63G 3NE5B 5DNFA 2D2CC 3EVQA 1DT4A 4BY7B 1X9NA 1SNOA 3DUZA 1SFOH 3SVMA 4AQYL 1II3A 2YV5A 1FL0A 2JE6I 3PO3H 3NPPA 1M8AA 1DONA 2XTIA 1V1PB 2R92B 2IHFA 3BVGA 5LMNL 3HG9A 3QIAA 3D6WA 4A3EG 3BZKA 2JA5B 2NYZD 4N9TA 2VB2X 1OXTA 1BVSA 3J7A5 1HUNA 3V96A 4JI5L 4BBSH 1LYLA 1ICWA 1Q3LA 5GADC 1C0AA 5M3MG 4IUNA 4LAAA 5ELEA 4LFCQ 3NENA 5M5WB 3B6YA 5IP9H 1VQ7A 2A8VA 2NN6G 2VS1A 4OIJA 3J81c 5IYCG 1BBUA 4NXML 3RD4A 2EY6A 2KA7A 3GTLH 2UXCQ 3P75A 2KECA 1HZBA 3OIPA 2PI2A 3OOCA 4IJHA 2RDGA 1S5ED 1QVFA 3RMHA 1Q81C 4HIDA 1E0BA 3K58A 1JC7A 4WJWA 5GAHC 2ZJPA 3VYRA 5AJ3Q 5LHY1 2I0QA 1W2BA 4LF4Q 2JA7H 3K5NA 1SE8A 4LF7Q 2Q8RE 1GO3E 4B3MQ 1SNPA 1E7ZA 1WVLA 1K8GA 3QB3A 3EFXD 4KD3A 4LWCA 1HZAA 3WOFA 3A5UA 4FF3A 1V9PA 2K50A 4J1MA 4DR3L 4XT3B 3T4AC 1B8AA 3PIO3 1TVXA 1PH1A 1I50B 2E8GA 2E3UA 4A3CG 1XXGA 4CKBA 3FVQA 1HZCA 3DLLA 2RBMA 2NVTH 3CC4A 1VQHA 1BDOA 3FMCA 5CC4A 2QEXA 3R2TA 2R7ZH 4X3SA 2VQEQ 5C3EH 1PVOA 5JJIA 1D1KA 4AQYQ 3MC0B 4HCSA 5C0XG 4DUZQ 3NSWA 1XMOQ 2JVZA 4DR7L 4GLXA 1EY6A 1EU4A 4EGVA 1I3QB 2ANNA 2F0QA 1XYIA 5IP7H 5IT9c 1O7ZA 5LMNQ 1IZ6A 4UDUC 1WVNA 1SE4A 4BY1G 1K73C 1Y1VH 3I3CA 4C3JB 4E6IA 1MJEA 1D1IA 2KJXA 1BQQT 5H1SE 1BCPC 1EWIA 1LM0A 2E2JH 5ELCA 1BO0A 1Y1WH 1CKOA 4AH6A 2OPVA 2IT1A 1DJRD 2JP1A 3DWQA 3OMCA 3CCQA 3M3YH 3BU2A 4P72A 4DGZA 2EQSA 4K0KL 1N34Q 4BBRB 4NXMQ 1QWYA 1UAPA 4AIMA 4DUYQ 1HTLD 4A3IB 1A2TA 2R93B 4IALA 3EROA 4Q0FA 2BH2A 5ELDA 4X3UA 1BCPD 1ENFA 1KLGD 2G9HD 4N9PA 1Q8KA 4YCWA 2Q2HA 2C35B 1E2WA 4Y52H 2RKSA 4PMCA 1GUNA 3HOWB 1K83B 2PMZB 4K5VA 2IX0A 2WKDA 2K5VA 1TS5A 1FJGQ 1SMXA 4KJOA 1X3EA 4RCNA 1VQKA 1Y14B 1EZ6A 4DV3L 3S1MB 4A3MB 1FVIA 1Q12A 1KHMA 1ZEQX 4DR3Q 2PI2E 4MTNA 3HKZE 4QUCA 1SAPA 2JK8A 1D5ZC 5EBDA 4X3KA 2CW0C 4YHHL 2UUCQ 2IJ0A 2O2LD 2EPBA 3ERSX 1PZID 3T56B 1WCMB 5J22A 4GKJL 3L9AX 1S3OA 3J80i 2GN5A 4TQUS 3HS0C 1ENCA 1I6HB 4I65A 1A3UA 4DR7Q 1F2ZA 3S14H 3S1RH 1VQ6A 1K8OA 3K5MA 2LFNA 2EDGA 4BS9A 2ZTEA 4CKEA 1DOLA 2YQRA 1J6QA 2CW0D 3BVZA 1QE6A 2HDMA 2E2HH 1OXSC 2IY5B 2ANRA 3MEHA 4MN3A 5IYDH 4JI0Q 3H94A 4P74A 3G7LA 3H3VC 3Q24A 4ZYSA 2AQ1B 4K14A 3J81i 2JA8H 1F2YA 2NVQB 5DM63 1CSPA 2HQLA 3TSSA 1QILA 2K5NA 3CC7A 1STBA 4DR5L 4NXNQ 5BN5A 2KCMA 5CBEE 2PQEA 4A3DB 2KHJA 1KRSA 1HA6A 4RAUC 1V1QA 3MVVA 5HGTA 2D5DA 4YWLA 2UXDQ 1QNUA 2ZXOA 5A35A 4OX9L 2A5HA 3PO2B 3EJIA 2JA6G 1CZWA 1EYGA 2XGTA 1SNDA 1CK1A 2L1BA 4A93B 1YZ6A 2KEDA 1SEBD 2DY8A 1EFID 1R9TB 4A3LG 1Q90A 4A3KG 1PYSB 1N32Q 4H0LC 1VQGA 4K8IA 4QMFB 3KBGA 2EIFA 4HJAA 4F7XA 4RGMA 3CCMA 4IN3A 3FKIG 1TS3A 2QF7A 5C0XJ 1H9KA 4J15A 2XRQD 4V0BA 2L55A 5C44G 1BCPB 3CXCA 3GTOH 1EY4A 2K5QA 2EYPA 2SOBA 4GN3B 3HKZB 4C3HH 1G51A 1SMYC 4GKJQ 4ME5A 4QMGA 3VR4A 5I6WA 3V2TA 3S16B 5ISRA 5T1GA 1F2MA 3E6ZX 4NDXA 1KDAA 3CF5A 3GV6A 2LKVA 1QCBD 2RHQB 1LTRD 2PNRC 5HURA 4RA8A 1SDFA 1TWCH 2E75C 3T13A 2UXBL 1HTPA 3UDIA 3HOYB 3EN2A 3L2PA 2R92G 5EBCA 2D62A 1TXYA 3IRBA 5M5YH 4JI2L 4M1UB 2JZXA 3WDNA 2JA5G 5I4DA 3D31A 2EYJA 2CFMA 1VQFA 1HNWQ 1IKLA 3J80E 1P16A 4G7ZC 3MEFA 3DMUA 4U673 5KYLA 5M3MB 4A3FG 1AZPA 5FO9B 1AE3A 2F0LA 5FO8B 3S1QH 3K7AB 3T1HL 2F0KA 4DR5Q 1HPCA 4XQQA 3J81j 5JEAH 2AHOB 3C2PA 1OXXK 1FYCA 2K7VA 1WI5A 1E3PA 4QJFA 3U58A 4NPSA 2FHTA 2B63H 3G6JB 1S5CD 5DAUA 4ZUIA 1KABA 2TSSA 3D4RA 4OX9Q 2IX3A 2QDBA 3A55A 3J81E 4LF5L 1I5FA 1XTDA 4BA1I 3R93A 1J8IA 1STNA 3G48A 4MZ9A 3L7ZC 1FR3A 1XX8A 2F0FA 4WRDA 1WTOA 4A3EH 1HCZA 4RWSC 4OO1I 1V1PA 4IQZA 3Q23A 3KYHC 2VUMH 3HOVH 3VR2A 3D8GA 3R8BA 3VA5A 1RKNA 1YNJC 1G2TA 2F1MA 2ALYB 1Y8PB 5FOBB 1VS0A 3E5SA 4CBVA 1R4PB 1IBML 2M2LA 3FRPB 1AH9A 3S2HH 3Q8DA 5EPLA 3A54A 4R4CA 5IYCH 3QO2A 1MD2D 4WJ3M 4YWKA 2H1EA 2MGSA 1LTSD 1EQTA 3AFQA 1ML0D 2Q8IB 1ESRA 2HCCA 4L5QA 3IFTA 3FEWX 1JOQA 1YNJD 2WFWA 5IODA 2A19A 1BOSA 1JE5A 1C9OA 4LFBL 5C4XH 4Y7NH 3ICEA 4BY1B 4JI2Q 3H6MA 2M9VA 4WJ4A 4C3JG 2AUKA 1M90C 1D8LA 4JV5L 4QY7A 1A3VA 2NVYB 2AUJD 1SYBA 3M4OH 1STHA 1PV4A 4IZ8A 5IT9E 3BG3A 3ZYYX 1HNZL 4L63B 1SNCA 1EY5A 4IUPA 4JI8L 3T1HQ 1TS4A 1PH2A 5IT9L 3S15B 2R7FA 3OW7A 1GUSA 3TP8A 1BNZA 3H3VH 3S2DH 3S1NH 3BYYB 2QGQA 5E4WC 1E2VA 2PO4A 3CCLA 1JJGA 3K0XA 5FJ8G 2R93G 4JVHA 4BWGB 1GXDC 5I9PA 5IGBA 3MWYW 4EQOA 1DXMA 4X6AH 4P2CB 3A56A 5IOCA 5F2DA 5CV8A 1GD7A 1YVCA 4DV2Q 1X6OA 3MTSA 1JQYD 3OPOA 2CTFA 1SYEA 1EYCA 1S5BD 2A69C 5I6YA 5C4JH 5CYUA 2B2TA 3HOWG 3NELA 5C5LA 1BKBA 1YJWA 1NJIC 4POGA 2L4NA 4KD4A 4JI6L 2BA1A 4DV6Q 1TY0A 5HY6A 1C48A 1N33L 4DF7A 4XQNA 3TEHB 3U4ZA 5E4XA 3R2IA 1EY0A 1IBMQ 3CW2C 1PYWD 5C3XA 2EOTA 4RKLA 4JI1L 1IL2A 5G3LF 2LXKA 2A69D 2L5TA 1WCMG 3EIVA 2KHSA 4B08A 4KN7C 2MHVA 4KHPQ 5A2QE 3H0GG 2EVBA 1VQLA 1D7QA 2X6LA 1O7IA 4XIGS 2OQ0A 5EPKA 4C2MB 2VXWA 3GTJH 3M4QA 3RLNA 3I90A 1PMRA 3GTQH 1U4LA 3GTKB 3PIOA 3RZOB 4UAIA 1A63A 3KDFB 4C3IH 3KK7A 1SROA 4L6TB 5IYBG 2IHEA 3GV3A 4H7BA 1A2UA 2JEBI 4B9WA 2F0SA 4IURA 1ASYA 3MFYA 3IL8A 3P7JA 2KEEA 4LFCL 1B3AA 3I4NB 3T1YQ 3C3LA 5FLXE 4IFDG 2F0MA 1XPOA 4B9XA 3EA6A 4DR1Q 2B2TC 1HRJA 3GD7A 4KK7A 2UXCL 1ZKOA 5C6AA 3PUXA 4RMFA 4HIMA 1EQQA 3W1GA 3MXPA 4XXEA 2A74C 3PO2G 2Z4HA 2JA6B 3VKEA 1IW7D 1UE6A 4A3JH 3MXNA 5GQOA 3JAMc 2B2WA 4LF7L 4A3KB 4B3ML 4A3BG 1XNQQ 2EYHA 3SK4A 4JI6Q 2R6GA 3NK9A 2EY5A 3MAQA 2NTSA 4HSPA 5JVH3 1MBYA 1N33Q 2ZTCA 2FJ2A 2RSOA 1Q8IA 2VY3A 3FKIB 2CQOA 1KLUD 2NTTA 2CWAA 3VA7A 3BZCA 1H9JA 1S4ZA 2HDLA 2E76C 4APVA 3AEVB 1EIGA 2SNMA 1FNUA 4G57A 2VQEL 2A6EC 3I4MG 4DUZL 1XMOL 3HOYG 1PFMA 4KKTA 4EQ5A 3I56A 1IBLQ 1IHZA 2KOLA 4R9WA 4CHTB 4BXXG 5CBAE 2BA0A 5HGQA 3M85A 2SEBD 1X32A 1XMQL 2L12A 1A15A 5M5XB 4XYQA 3GTMB 3ZJYC 4A3FB 1MI2A 1RIPA 1EIFA 3KFUA 1WTVA 1UUPA 2X69A 3SE0A 5CV5A 1MJCA 1PRTC 3GTPH 2A6ED 2OT2A 3GTGH 2QKIC 3O13A 3H91A 1WTXA 1N34L 1GVPA 5ELOA 2DNCA 4GOPA 1Q1EA 4DUYL 2K6AA 2B3GA 4BY7H 2B2WC 1HXYD 4OO1H 4B3TQ 2EZVA 2PMZE 2K28A 4GLAC 1MSGA 5ELNA 5K36H 5LMNW 3CRLC 4OGQC 2AWNA 4JCVE 4FXKC 3HOZB 1TWHH 2F0HA 1NR4A 1PRTD 2JA5H 1FJGL 1VQDA 1WE8A 3OIQA 3KJPA 1YITA 4L8JA 2F4IA 1VIGA 4QL5A 3HOUG 1HQMC 1CHQD 4DA2A 4DFAA 3VR5A 4KY5A 2NB0A 1PZJD 1YHAA 2PYKA 4FXGC 5G3LD 4CJ1B 2PNHA 2NZHA 1QNKA 2UUCL 1J9OA 2VZAA 4DKAC 3DEPA 1D2BA 2F0VA 3M7NA 1AFPA 2QA4A 2GVBA 3CMEA 5ELFA 3CHBD 4RGTA 2MJHA 2ID0A 1I4RA 3IKJA 1ENAA 1X3QA 5KIXA 1SSOA 3PSIA 1CSQA 4HR7B 4JG2A 1SLJA 4P73A 4DR4Q 4IFDJ 2C9OA 4H44C 3UI2A 4ZAIA 2F4VL 1PH8A 3S17H 2K04A 1XMQQ 1KNAA 1LT4D 2EE1A 4GOPC 1ILQA 4JI0L 4HIOA 1JMCA 1NE3A 1MIUA 3OYYA 4OWWB 1IBKQ 4KHVA 4A3GG 4DXGA 1I50H 2O4XA 4NXNL 1PTOC 1A3TA 1WFQA 1Z6HA 1B50A 1IYJB 4OONA 2J0TD 3HEJA 1VMPA 3D3RA 4YWMA 3BYTB 1STYA 4K2LA 3KF6A 4TVAB 5J3BA 3RZDH 3H3VI 2EY2A 1WD1A 1O78A 4CKCA 3KLRA 3W2DA 2UXDL 5EAYA 1I3QH 2LY7A 5I2XA 1I4XA 3LX0A 2OCEA 1CI3M 2K14A 1CT1D 4C3JH 1F9SA 1Z7TA 5C0XI 4HEDA 1YI2A 1PTOD 1N32L 4ILWA 1B53A 2CPQA 4LJZC 1WTWA 4R4OA 1XTCD 3PUZA 1HR0Q 3L0OA 1R4QB 3TP6A 1X54A 1KNEA 3ERQA 4DAMA 1OXVA 4BBRH 1K8AC 1SYDA 4EVOA 4PNYA 2LSSA 5JEAJ 4X66Q 4A3IH 2E2HB 5FJ8H 3NTKA 1O80A 1XPUA 4CJ2C 1TWFB 1I4GA 2PQUA 2C5CA 1PRTB 5C4ZA 3H0GB 3NHHA 1ONLA 3SEBA 5BN4A 2UUBQ 1ZXTA 1LV9A 1G2SA 1SXTA 2CQAA 2VNUD 1J5KA 4RH6A 4DV1Q 3CP0A 4NMZA 3MXNB 4IOAA 1EY8A 4GLVB 1T5EA 3HOWH 3CQZB 2XVSA 4R4TA 2F4VQ 1B2TA 1Q46A 3DWAA 3X3NA 2Z4IA 2OPUA 3M4YA 4LUZA 1V1OA 1HNWL 4DV5Q 4K6LA 4A3MH 2Q2UA 3S1MH 4GKKQ 4K8JA 3V05A 2ICIA 4MNOA 2XSCA 1QZHA 3PUYA 1X3GA 3UE0A 3I4NG 3KLWA 3ULJA 1EYDA 2Z6KA 5IE8A 5J39A 1I4PA 3NWSA 4EQNA 1I4HA 1WCMH 2QEJC 4AM3A 3ULLA 4P71A 1BR9A 1LABA 4KHZA 4DN4M 3ITPA 1ZTGA 3F2BA 4B8TA 1D5MC 2Q2TA 3HP3A 3R3OA 5I2YA 4R8NA 1VQMA 3CCSA 3GTOB 5D65A 3ND9A 2RVLA 4C3HB 3LNNA 5DM73 1O7YA 2ZM6L 4HSVA 4A3BB 4FF4A 5EKLA 1ET6A 5J1ZA 3AMUA 3KDFA 2HHHQ 3AYHB 2J4XA 3K7UC 1JOKA 3HRZC 1TWCB 3D4DA 5IIFA 1KQSA 2NVQH 2PW5A 3PO3G 1YHQA 3CRKC 3CCVA 4GOPB 2Z8LA 4EQPA 3TS0A 3K57A 4TRDA 1G8ZD 2F0TA 3JAML 4A3DH 4WFN3 3N6RA 4X64Q 2YU9B 5FLMH 3SR1A 4BBSG 1MSHA 1K9MC 2N55A 3KBXA 1J5EL 1PTOB 2NZOA 1I4QA 5ELBA 3PO2H 3I4MB 3I7FA 4OXPA 5KYIA 3HOXH 3JC66 1RJTA 4LFAQ 4XTCS 2K32A 2ZXRA 3U50C 4A93H 5EKKA 2Z6KC 1R9TH 1B4OA 3BDOA 2PZUA 2DGYA 4HJ8A 2E5LQ 2NWGA 4X3TA 3TDQA 1TS2A 2HCIA 4OL7A 3PGZA 1VQNA 1W6KA 2JA7G 1VF7A 2CHBD 2VUMB 4IPGA 3S24A 3F2CA 1UWVA 1LTGD 3OW2A 5IGDA 2RCNA 1SJHD 5JPMC 1VQOA 4KI0A 2CVRA 1OO9B 3KLSA 1M4VA 1JJCB 1GUOA 1TWGB 3AEVA 3CCUA 1S40A 3PF4A 3HOYH 4DV2L 3VDYA 3HZXA 4FYDA 2F52A 3U1KA 3HOZG 3SGIA 2ZM6Q 1A62A 2YTXA 1STGA 2ENBA 3I73A 4UP9A 1AEXA 2R7ZG 3CPWA 4G4KA 1NMGA 4DV7Q 5M3MH 4DV6L 3UDXA 3HOUB 4UP7A 2DN8A 2RQXA 2ZJRA 4KY6A 4X62Q 1H9RA 3K7AH 5IP7G 3LWEA 2NN6H 4XDXA 5C4XB 2KBNA 1Y1VG 2RA4A 4LK1C 3KF6B 4JK1C 1SNQA 2JA9A 3KF8B 1H9SB 4JYAQ 1J5EQ 5KRUA 1VCIA 1GUWA 1ESFA 4KHPL 3IFDA 4FO2A 1SYCA 4DV4Q 1Y1WG 3H15A 4JI3Q 3D6CA 1NSNS 1EZ8A 3DEOA 2KHIA 2WACA 4FVMA 2K75A 3DHQA 1HNXQ 1O7LA 1Y8OB 3VR3A 1PYBA 1EFWA 3K59A 1PFBA 4XT1B 3URYA 1JORA 3K5LA 4R4QA 3W5OA 2Q8TA 5KEEA 5I9OA 1EWHA 1F9QA 2UUAL 2F03A 3NP8A 4ZRZA 1TWAB 4A3GB 1KDCA 3Q22A 3T1YL 4LMQD 4A3CH 4QQBX 1DYQA 2B39A 3UDFA 1EWCA 4DR1L 4HJ9A 5M3FB 3SK5A 2K01A 3CD6A 1FGUA 1DM0B 4JI4Q 1N9WA 1YIJA 5C0XH 1PA6A 1X56A 4JC0A 4PV1C 3KUPA 2F3IA 5JOBA 2ZJQA 1KDBA 3J7AV 2F3VA 5EQ0A 4BY1H 4JBWA 1VMCA 1E1TA 1X4NA 3CKIB 1U4PA 5EPJA 1GM5A 2NVYH 2N8NA 3D0FA 3T53B 1PH9A 1XNQL 1JJ2A 3CMAA 1QOHA 4IUTA 2A68C 3QOLA 4LF6Q 2A73B 1RTNA 2JEAI 1K0RA 2E2IH 1RODA 3NQTA 3DM1A 4RFBA 3SK6A 3K5OA 3S15H 3GP7A 2I5LX 4HMIA 2WAQB 3FPPA 4O42A 3OMGA 3H09A 3UE1A 1YHBA 1S5DD 1EEID 4JBKA 4XYOA 4GNXB 5IYDG 4DNRB 3OWFA 4Z9CB 1NBWA 1G91A 5IWAQ 1GHKA 2JA8G 4I7ZC 2A68D 2K5HA 4FP5D 4KY7A 3CCJA 1LACA 1IBLL 1NR2A 4K5XA 5DEHA 3PUVA 1X65A 4K2KA 5LMUQ 5T1IA 1SE2A 1PDQA 5IGFA 1CA6A 2MNAA 4AYBE 3RLFA 3A0JA 5BR8L 2UUAQ 2Y0SE 1PFSA 4HIKA 1GJXA 1IW7C 2SDFA 3PIP3 2EJMA 1QUQA 3TBIB 1JT8A 1TIID 2NVXB 2QNDA 1XNRL 3NTIA 2KQ3A 1LT6D 5D3IB 4RGOS 1EC6A 1V8QA 5E7NA 1AW7A 2D0PA 1C8CA 2R61A 2Z1CA 4ODGA 4B3TL 1TT2A 1G291 2WV6D 3Q0AA 4C2MH 2HT1A 4GN5A 4LF9Q 4R1JA 1PHJA 2ASBA 1X55A 1CZGA 2E2DC 1LTLA 1B44D 3RR5A 2FXQA 3RZOH 1E2ZA 4C3HG 4EX5A 4R8IA 1UE5A 1S72A 2MUYA 4O2DA 2IW3A 5JJKA 5LL6X 1SFOB 2CTMA 1NCVA 1STEA 3PO3B 1A0IA 3STBD 1IXRA 1BCPF 4LF8Q 4G7HC 2LS01 2MFIA 4JOIA 1DZ1A 4DAYB 4H13C 4GZYC 1KXLA 1PLFA 3V69A 2IX1A 2EY1A 4S3SA 2CCZA 1EY7A 4BBSB 4IFDI 3CPFA 4QGUA 2F0OA 1K1GA 3S9WA 3NEMA 1L0YB 2JA6H 1B7YB 5JEAG 4KJNA 3TZUA 3NBHB 1VQ4A 1F77A 2O5JC 1F2LA 4DR4L 4RG1A 1OTCA 4A3LH 4U68A 2ICEC 3GTLB 4A3KH 1DTJA 4BA2I 2BL5A 2EXDA 1VQEA 1PH7A 5BR8Q 2DNEA 2FMRA 2RHSB 2I5MX 3U4VA 4ZQ3A 2F0GA 1JCKB 2AKWB 1SJED 3J80c 1IBKL 3FKIH 3C1EA 3AFPA 3TZDA 4AYBB 5GAGC 4RHRA 2YYZA 5C44H 1JWMD 1MGSA 2IPKD 2Y0SB 1EIYB 2JA7B 1TWHB 1XNRQ 2HUGA 4TSSA 2VUMG 3HOVG 3FPUB 1PH3A 3MA2B 3U9SA 2K33A 3DWPA 1SBBB 1WOCA 1NAPA 3C1FA 3GQBA 4QUFA 4WORA 4L5TA 5JPNC 4QB4A 5K5PA 2F0UA 2R92H 1T5XD 4OIKA 4DR2L 2EJFC 2NVTB 4JOIC 3E0JA 1HH2P 3E9HA 1FNVA 4ME3A 2N88A 1UEBA 2R7ZB 5M5XH 1UE1A 1IYUA 3GTMH 4UP8A 5C3EB 3T51B 5EJWA 3A8KE 4ID6A 5E3FA 4NB3A 4A3FH 4FNFA 3I4OA 1HR0L 1L0XB 4IPDA 1JE4A 1ZYRC 2I46A 4NP5A 5M5WH 2VB3X 2N49A 4UY8C 5C4XG 2CTLA 1QB5D 2QILA 2WINB 1Y1VB 3S17B 4X66L 5CV6A 1JWSD 1JOOA 2KCCA 4DXFA 1KTKA 3CCRA 1B9MA 2NZ1D 4Q5VA 3PMFA 3OTOQ 2NN6I 1TKWB 3M9BA 4R4IA 1QVGA 2E2JB 1H95A 2EJGC 2UUBL 1Y1WB 1RTOA 5E1FA 4DV1L 3M3YB 1PXUA 1ZYRD 3HGBA 3HOZH 1WTPA 2PZTA 1L1OA 3MZ5A 2CTJA 4RGNA 3I4LA 3GO5A 4WALA 2RF4A 2K1BA 3RZDB 3C46A 4DV5L 4GKKL 3FHWA 4O1NA 2BDNA 3Q6SA 1EOVA 1NTGA 2KCNA 1HHVA 3F2UA 1HR0W 2NUCA 1SYGA 1L0WA 2GVAA 1ILPA 3SDZA 4FXDA 3VR6A 1VQCA 4DV0L 2EYMA 5JJZA 1HJPA 3W3AA 5M9OA 1HA5A 5M3FG 1I94L 4JI5Q 4QIWE 2M00A 2EYLA 2E74C 1AE2A 1T9HA 2OXPA 4DK3C 3TP7A 3RN5A 3KF8A 2HIVA 1H9SA 1TY2A 3TQYA 3A5ZB 5EGTA 1GHJA 2EYFA 1CQFA 3JAMi 1ZZJA 1UEAB 4RKBA 1KIXA 2RSNA 4P75A 1EEFD 4IPCA 1G6PA 2FINB 4DR2Q 1LTTD 4DAVA 4H02A 4YCUA 2XWBB 1LUZA 2MO0A 1Q82C 3A8IE 5IGCA 5JAVA 1EL0A 1U5KA 5IGGA 2MP1A 3HKSA 2JYOA 1Q86C 1SYFA 2HHHL 1LT5D 2R7DA 1QUQB 1QG7A 1J4WA 2WB1E 5IGEA 3S14B 3S1RB 4WANA 5FO7B 2WAQG 2AWOA 3QJYA 4O0AA 4C3IG 4LUVA 1E24A 1YJ9A 3MFGA 4ZKBB 2L15A 2RDHA 2R93H 1G6ZA 2VL6A 1Q7YC 4X64L 1L1OC 2OEOA 3BZDB 4PG3A 2DGRA 4IUVA 2JA8B 4OWTB 4IO9A 3PUWA 1YEZA 4KKSA 3VYUA 4NBQA 1K83H 1X3PA 4LFAL 4DAPA 3RUZA 1SE3A 3P1HA 1M1KC 3TN2A 3K6OA 5CORA 2KCTA 1AZQA 4A75A 1VQ5A 1X3FA 1MKHA 2E5LL 3A7LA 4DK6C 4GN4B 2HH3A 1JB3A 2B2UA 2WP8J 1TUAA 3KLSX 5C3WA 4DV0Q 3PF5A 2F0JA 3AQQA 2PZWA 1NUCA 1CQVA 3MXUA 2K4KA 4ALPA 4A3JG 5FLXc 1CUKA 1I94Q 1LTAD 4QCLA 3BDCA 2EXZA 2JQOA 2OWOA 1TWFH 4CGYB 3T16A 4DK1A 3H0GH 3ER0A 3K80C 2FMMA 2D0OA 4C1NK 2EYOA 5IY0A 1I6HH 3CAMA 4GNXA 1X4MA 1PH4A 1F9PA 2TMPA 4OHJA 4QIWB 5EKIA 1A6XA 4M8AA 4ZUJA 1CKNB 2PCFB 3PCOB 4K0KQ 3CQZH 2MJ8A 3TRZA 4LW1A 2KENA 1RDPD 4RCOA 2KVMA 1B1ZA 3K81C 2CTEA 3LGJA 5IYBH 1AN8A 2B2VA 1VQJA 3EBEA 4YY3L 1EUJA 4DV7L 3J7ZC 2OF1A 2F0EA 1WTQA 1XJVA 2PPBC 2AQ3B 3HOXB 4X62L 3QWNA 5BN3A 3JAME 4IFDH 4PZ8A 2K5DA 1ZZIA 5M5YB 4YCVA 4ULLA 4DU9A 2B2YA 2WB1B 4HJ7A 3E0EA 1TQOA 1N36L 2XNAC 1Z47A 2YTVA 3M4PA 1TU2B 1HZ9A 1CTMA 1TR5A 4DV3Q 1JB7A 1FGBD 4JYAL 1LLRD 2VW9A 3OHXC 2P2RA 1YBYA 4IJLA 2GA4B 1WJJA 4DV4L 1LTBD 4JI3L 1E1OA 1CHPD 3S1QB 5IP9G 1ET9A 4YHHQ 1I6VC 3QOJA 3TREA 2XN9C 4HAEA 1KHIA 1CFMA 2B2UC 4DR6L 4L5SA 4HTHA 4ZLTF 4FDBA 1HNXL 2ZXPA 2B63B 4A3BH 2VQFL 4DNTB 5TSSA 2Q2IA 4BY7G 1VQBA 1NY4A 1DOMA 4LUOA 4OO1G 2H5XA 3GDEA 3UDGA 1DD2A 4ABNA 1U4RA 1VQPA 4GNXC 4AYBG 5CV7A 5K36G 1L2FA 2Y0SG 4A3EB 4IPHA 3SK8A 2F3WA 2B8FA 1U9RA 3HOVB 1E22A 3S16H 2N3SA 3E9IA 4DAYA 3WWVA 1B9NA 1LTID 2YU9H 1SMYD 1EU3A 1CKMA 2K5WA 1OXUA 1KAWA 1GKHA 3EQLC 1PTOH 2B2VC 2PQAA 1VQ9A 4MHEA 4JI4L 4KKUA 3I4MH 1Y8NB 3J80L 1KL9A 2H4OA 1K8MA 1KD1C 4KN4C 1BBWA 1YNNC 3PIPA 2HH2A 1HFGA 3PV0A 3S2HB 1YNXA 1L1OB 4ZK9B 4BXXH 1HFNA 3A7AB 1VQAA 2B29A 3BJUA 2Z0SA 3KJOA 2UU9L 2B2YC 3NBHA 2CWPA 1D6EC 4YY3Q 1EY9A 2OTJA 2CKZB 5C3EG 5CR3A 5C4HA 2WAQE 3BS1A 2OQKA 1VF5C 4LF6L 2JSOA 2YTYA 4PZ7A 1PH5A 1STAA 3L3OC 4LIJA 2ATWA 2FMCA 3K0YA 3P20A 4ZKCB 4Y7NB 3J81L 1PH6A 1N36Q 3TMEA 3I2ZA 5CV4A 1YNND 4A4IA 4JI7L 1VQ8A 3TS2A 4JBMA 3FP9A 1VIHA 4PMBA 2MQHA 1FNWA 3M4OB 3BDLA 2ZTDA 1B70B 2MO1A 2AXYA