4BA4A

Crystal structure of the apo omega-transaminase from chromobacterium violaceum
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
427
structure length
427
Chain Sequence
ARVMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPFYNTFFKTTHPAVVELSSLLAEVTPAGFDRVFYTNSGSESVDTMIRMVRRYWDVQGKPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGDLPIPGMAHIEQPWWYKHGKDMTPDEFGVVAARWLEEKILEIGADKVAAFVGEPIQGAGGVIVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQHFGFQPDLFTAAKGLSSGYLPIGAVFVGKRVAEGLIAGGDFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKDDIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKRELFPDFGEIGTLCRDIFFRNNLIMRACGDHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQTLKARGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AMINOTRANSFERASE
publication title Structural Studies with Pseudomonas and Chromobacterium [Omega]-Aminotransferases Provide Insights Into Their Differing Substrate Specificity.
pubmed doi rcsb
source organism Chromobacterium violaceum
molecule tags Transferase
total genus 169
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.6.1.18: Beta-alanine--pyruvate transaminase.
pdb deposition date 2012-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00202 Aminotran_3 Aminotransferase class-III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4ba4A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4ba4A01
1GC4A 2WK9A 4XJOA 3FZ8A 4E77A 4M2JA 1G7WA 1AY4A 1DFOA 3FVXA 3QHXA 5F8VA 3AEJC 4K2IA 3ACZA 4PFFA 2YCPA 3FDBA 2OGAA 2W7DA 1KMJA 1MAQA 2EH6A 1AKBA 3A9ZA 3NU8A 4MQRA 2VLHA 2W7EA 4U2HA 4UOYA 1TASA 2CB1A 2F8JA 1P3WA 3CQ6A 3WGBA 7AATA 2W8WA 3GZDC 2BI9A 4E3RA 4IYOB 1PMOA 2BI2A 5EIGA 1AICA 1PMMA 4BQ0A 4WYGA 1KL2A 1TOIA 1C7NA 2Z67A 4CBSA 3K28A 5LHAA 3GR9A 4HF8A 1ARGA 3R4TA 3EIAA 4IXSA 3FVSA 1GBNA 4Q31A 1VEFA 4LW2A 4OYTA 2W7FA 1W23A 1BQDA 4PIWA 2YCNA 2HORA 4AO4A 1ASGA 3W1IA 1BJWA 4O6ZA 2AY6A 4B9BA 3MKJA 4M2MA 1AJRA 1LK9A 3FQ8A 4A0FA 4N0WA 4ZDOA 1BKGA 2GSAA 1QIRA 1XEYA 4RLGA 1ARIA 4F4EA 3OP7A 3KGWA 4F5FA 5M49A 8AATA 4ATQA 4LNLA 2VMNA 4MGRA 4CXRA 3FCRA 4WD2A 1TATA 5K8BA 3I5TA 4W5KA 3L44A 5DJ9A 1JF9A 2NMPA 3EUCA 1OXOA 2YOBA 3MEBA 3NUBA 4GRXA 1ZC9A 5DB5A 4U1TA 3VK2A 2VIAA 3P6KA 4F5MA 3G8MA 1TOGA 4Q6RA 5D95A 4UHMA 1D7VA 3NYTA 2W8TA 2D63A 1V2DA 4H51A 1YJZA 2BIEA 3MBBA 1ASBA 1EG5A 1MDZA 2D5YA 5G4JA 3WGCA 1BJOB 3NYUA 2BIAA 3ZRRA 4EFFA 2CH1A 2HP2A 4K2MA 5EUEA 4UHOA 3T32A 1GEXA 4ZWVA 4IYOA 4ADCA 3HL2A 3FSLA 4J8LA 2W8VA 2X5FA 2W7HA 1DGEA 1SPAA 2X3LA 5E4ZA 3AEMA 3LV2A 4F5IA 4HVKA 4I8AA 3W1JA 1WKGA 2BYLA 3E77A 3RUYA 1C0NA 2VMYA 2CJDA 1AHFA 1BW0A 1AMRA 1X29A 3E2ZB 2C7TA 2CJGA 3COGA 3G0TA 3FRKA 4MKJA 3USFA 3ZRPA 1W7NA 4W1XA 2AY7A 2BWOA 1D7SA 2AY3A 4GDYA 1G4VA 4R8DA 4MSOA 4OCAA 1MDXA 1IJIA 5HXXA 2BI3A 3II0A 1S06A 2D7ZA 1YJSA 5EFSA 1YJYA 1FG3A 2PB2A 1FG7A 2CY8A 2ZY3A 2DKJA 4PVFA 5EQCA 1IX6A 4GSAA 3VP6A 2E54A 3H14A 1PG8A 4JF0A 3W1HA 3M5UA 1B9IA 2DGMA 2OKKA 3WKSA 4A6UA 1G4XA 3PIUA 4KAMA 4F5LA 2O7CA 2VMZA 5AX8A 2DGKA 3WCOA 2JGTA 1EJIA 2G6WA 4JEZA 4NOGA 1N31A 2FQ6A 3HMUA 4ZWMA 4BHDA 3PGYA 4N0BA 4WXGA 1M4NA 1BJNA 1UU1A 3AENB 4IY7A 1WYTB 1AMAA 1AHGA 3ZRQA 2VMRA 1CJ0A 1SZUA 1B5OA 2GQNA 1MGVA 1CQ8A 1W3UA 1CL2A 2CSTA 4JEYA 1ZOBA 1ASAA 3DC1A 1V2FA 4A6RA 1LS3A 3FZ6A 1LKCA 3FTBA 4XAUA 2RFVA 2VI8A 3NDNA 4LNJA 2HUIA 4WLJA 1BJOA 5EUDA 3DODA 1E5FA 2HZPA 3ATHA 2VLFA 2HOYA 2W7KA 3BWNA 2ZSMA 3PDBB 4ITGA 3JZLA 4OC9A 1ASEA 2GMSA 4A0RA 3A8UX 3EI5A 1C4KA 3E2FA 3HVYA 1WSTA 4PFNA 2JISA 4XK1A 3E2ZA 4ZSWA 3EI9A 4AH3A 1B9HA 3EIBA 1S08A 4KYOA 1WYUB 2TPLA 2W7MA 1N8PA 2JJFA 4ADBA 3BN1A 1Z7DA 1CQ6A 4BA5A 4MKKA 1OHWA 3JWAA 3HBXA 1C7OA 1ARSA 3B46A 3BC8A 3LWSA 4RJ0A 4Y0HA 2X5DA 2JJGA 5FT5A 5M4BA 4XJPA 3DU4A 3RCHB 1H1CA 1KKPA 1D2FA 2XBNA 3DYDA 3N0LA 4GE7A 3HT4A 4F5HA 2EZ1A 3BCBA 1M0PA 2R0TA 3G7QA 5TF5A 4JE5D 4OT8A 4E1OA 3PJ0A 2AY5A 3BB8A 3FZ7A 3N75A 3PD6A 1M0QA 3AEOA 3IF2A 1DJEA 4FFCA 1E5EA 3QN6A 1WYTA 1AY8A 2O1BA 1UKJA 2W7JA 3GZCA 1QJ3A 4AO9A 2Z1ZA 2VGSA 2PO3A 2X8UA 4WYFA 2OATA 5IWQA 1DJ9A 3FKDA 3RBLA 2D64A 1MLYA 1LC8A 1QZ9A 4JEXA 1GD9A 4WLHA 3WCNA 1SZKA 2VMOA 1AHYA 1LC5A 2AY9A 4W91A 3PDBA 2AATA 4CXQA 3WKRA 1ASMA 3D6KA 3EI6A 4ADDA 1AHEA 3MAFB 1AAMA 3VK3A 1OHVA 3OKSA 2QLRA 1WKHA 3DZZA 5D5SA 4WB0B 3NUIA 5G2PA 3UAKA 1FC4A 3RI6A 1LW4A 1DTYA 2VMVA 3NNKA 3I16A 1WYUA 3AOWA 4RAEA 5G0AA 1SF2A 2EZ2A 2CINA 4XQ2A 4P3MA 1EQBA 3CQ4A 4JEWA 3QBOA 1X0MA 1OATA 1C7GA 4Y0DA 1I43A 2EO5A 3RCHA 2HOXA 2FYFA 5G4IA 4R5ZA 1YNUA 3FFHA 1V72A 4WXBA 1MDOA 2JJEA 1AKCA 1DJUA 1JS6A 4Q75A 3A9XA 1D7UA 3P1TA 4XEWA 3VOMA 4ZAHA 4ZM4A 3FDDA 4IW7A 2ZY4A 2HUUA 4MQQA 2FM1A 1B8GA 2YCTA 5F9SA 2BWNA 3A2BA 3MC6A 1J04A 3NX3A 1G7XA 2VGWA 1M6SA 1GC2A 3JW9A 1ELQA 3Q8NA 3LVJA 4FL0A 4BA4A 1C9CA 3AEJA 1BT4A 4A00A 3F0HA 3GSBA 2V0YA 2ZJGA 2QMAA 2D66A 1Z3ZA 3TCMA 3KE3A 1TPLA 5JAYA 2QB3A 4UHNA 1CQ7A 4IXOA 1Y4IA 4M2KA 3MAFA 1RV4A 5EUNA 3GZDA 2DOUA 2W8JA 2FN6A 2O0RA 4W1VA 2AY2A 2W7LA 4WYCA 1IAXA 3E2YA 3B1DA 4DGTA 1TOEA 1W7MA 2WK7A 1S07A 1X28A 3PDXA 4LC3A 1BS0A 3EZSA 4E3QA 2Z1YA 1VJOA 3RQ1A 1AHXA 4WYDA 4XJLA 1M32A 2BIGA 4GE9A 1TARA 4ISYA 2YRIA 4EB5A 1AIAA 2WKAA 1YOOA 3IHJA 4GE4A 1O62A 3JU7A 4F5GA 1ARHA 1GEYA 3FD0A 1DKAA 4IX8A 2AY1A 4F5KA 2FNUA 3BCXA 4A72A 2HOZA 2HUFA 4AZJA 4OTLA 2ORDA 3DXWA 3NYSA 4ZDLA 2BI5A 1RV3A 3AOVA 1ECXA 4ZDPA 3LVLB 2VMXA 2YKVA 4ATPA 2OKJA 1IVRA 3E6GA 3GBXA 4TMRA 5FT4A 1JG8A 3FVUA 4ZLVA 1BQAA 3GJUA 1BJ4A 3GWPA 2Z61A 4CVQA 1W7LA 4R5FA 3B1CA 4EU1A 1LW5A 2R5EA 2VYCA 1AAWA 3B1EA 4RITA 1ASNA 3DRDA 1ASLA 5BJ4A 4IXZA 2CJHA 1XI9A 2VMSA 3BV0A 3FFRA 1S0AA 1ASFA 4JF1A 1IAYA 1SFFA 3BS8A 4WBTA 2AEVA 3AENA 4GEBA 1M0OA 2BHXA 4TN4A 1O61A 5LH9A 3WZFA 3E9KA 4Q76A 2VGZA 1UU2A 3TQXA 4KXKA 1PFFA 1ELUA 3TFUA 3QI6A 1WYVB 2BYJA 2D61A 3CQ5A 5DX5A 1O4SA 4MQPA 3ISLA 1AKAA 3EI8A 4ZSYA 3CBFA 3TATA 4CBRA 1IX8A 4WXFA 2EGYA 4AZKA 2VMUA 5J8QA 1QGNA 5G09A 1CS1A 1GC3A 2DKBA 2D7YA 3FQAA 1GDEA 1T3IA 3LG0A 2C81A 9AATA 1VP4A 4AOAA 1B5PA 4ZASA 2E7JA 2CANA 2W8UA 4WP0A 2GB3A 2JG2A 2QBTA 3AEPA 4LNMA 1CZCA 3ZZJA 2EPJA 5E3KA 2CH2A 2Z9UA 4RIZA 5M46A 2R2NA 4F5JA 1ARTA 2E7UA 3ELPA 3BWNC 3QPGA 4K2BA 2VGUA 3AELA 2DR1A 4W8IA 2CTZA 1ASDA 1SZSA 3DR7A 1AX4A 3JTXA 3LVKA 2QB2A 5BJ3A 2CFBA 4RKDA 4EMYA 2VGVA 3K40A 1KL1A 4Y0IA 3PA9A 4BMKA 3LY1A 1I48A 2VIBA 4J5UA 1YIZA 1RVUA 2YRRA 1AIBA 3QM2A 4TV7A 2VMQA 4UQVA 1TOKA 5EAVA 1U08A 2C0RA 3HQTA 2BKWA 4QGRA 1AJSB 2OQXA 3PPLA 1AMQA 2OGEA 4DQ6A 3F6TA 3AATA 3NTJA 1SVVA 2D65A 5HHYA 2XH1A 5HDMA 3ECDA 2YKUA 2R5CB 2QA3A 1AMSA 1I41A 1O69A 4L0OA 3F9TA 2HP1A 2W7GA 5FT6A 3RBFA 1D7RA 3MADA 1WYVA 2VGTA 4DBCA 1AY5A 3H7FA 2FNIA 3PAAA 1ORDA 1IBJA 1V2EA 5EAAA 3BCAA 4R2NA 3AV7A 4A6TA 1TOJA 2V1PA 2C44A 1J32A 3ELEA 3K7YA 3VAXA 3ASAA 2Z9WA 1QITA 2W7IA 2PB0A 2ZP7A 1S09A 2BI1A 3KGXA 1M7YA 4JE5A 3FQ7A 3NRAA 1LC7A 1H0CA 1UU0A 1KMKA 3NU7A 1YIYA 4A0GA 1GC0A 2DGLA 2Z9XA 3ZZKA 3HLMA 3EZ1A 4ZM3A 3BWOA 2ZY5A 1MAPA 4WB0A 1X2AA 5G2QA 4A0HA 4B98A 2VMPA 2BWPA 3B8XA 4WYEA 4OBVA 2AY4A 4EB7A 2YKXA 4JEVA 3TFTA 2WK8A 3R9AA 1OXPA 3KKIA 2Z20A 5EIGB 2Q7WA 5I92A 2VI9A 1M0NA 2VMWA 4RKCA 1ASCA 3GETA 3MAUA 3I4JA 4OBUA 1I29A 3N5MA 3A9YA 4RJYA 4ITXA 4XJMA 2YHKA 4W1WA 1KKJA 3ASBA 2ZYJA 2AEUA 1RVYA 1YAAA 3PD6B 1IUGA 4P7YA 3UE8A 5C6UA 2ZC0A 4ADEA 2GMUA 2AY8A 3HDOA 2YKYA 1AJSA 3L8AA 4MY5A 3WY7A 3UWCA 1OHYA 1N2TA 5E5IA 2ZUKA 3JWBA 1DGDA 3DR4A 3EI7A 3WLXA 1QJ5A 2E7IA 2R5CA 1GCKA 2Z9VA 3AEMC 5FT8A 3DXVA 1GEWA 1ZODA 2ZSLA 5M4DA 2JJHA 1MLZA 3QGUA 4OMAA 1QISA 5DJ1A 4WYAA 2ZY2A 3WX9A 2VMTA 3LVMA 4LW4A 1CZEA 1JS3A 3MC6C 1IX7A 1CL1A 3CAIA 1B4XA 4RM1A 3VK4A
chains in the Genus database with same CATH superfamily
1GC4A 2WK9A 4XJOA 3FZ8A 4E77A 4M2JA 1G7WA 1AY4A 1DFOA 3FVXA 3QHXA 5F8VA 3AEJC 4K2IA 3ACZA 4PFFA 2YCPA 3FDBA 2OGAA 2W7DA 1KMJA 1MAQA 2EH6A 1AKBA 3A9ZA 3NU8A 2KFPA 4MQRA 2VLHA 2W7EA 4U2HA 4UOYA 1TASA 2CB1A 2F8JA 1P3WA 3CQ6A 3WGBA 7AATA 2W8WA 3GZDC 2BI9A 4E3RA 4IYOB 1PMOA 2BI2A 5EIGA 1AICA 1PMMA 4BQ0A 4WYGA 1KL2A 1TOIA 1C7NA 2Z67A 4CBSA 3K28A 5LHAA 3GR9A 4HF8A 1ARGA 3R4TA 3EIAA 4IXSA 3FVSA 2FKIA 1GBNA 4Q31A 1VEFA 4LW2A 4OYTA 2W7FA 1W23A 1BQDA 4PIWA 2YCNA 2HORA 2EYQA 4AO4A 1ASGA 3W1IA 1BJWA 4O6ZA 2AY6A 4B9BA 3MKJA 4M2MA 1AJRA 1LK9A 3FQ8A 4A0FA 4N0WA 4ZDOA 1BKGA 2GSAA 1QIRA 1XEYA 4RLGA 1ARIA 4F4EA 3OP7A 3KGWA 4F5FA 5M49A 8AATA 4ATQA 4LNLA 2VMNA 4MGRA 4CXRA 3FCRA 4WD2A 1TATA 5K8BA 3I5TA 4W5KA 3L44A 5DJ9A 1JF9A 2NMPA 3EUCA 1OXOA 2YOBA 3MEBA 3NUBA 4GRXA 1ZC9A 5DB5A 4U1TA 3VK2A 2VIAA 3P6KA 4F5MA 3G8MA 1TOGA 4Q6RA 5D95A 4UHMA 1D7VA 3NYTA 2W8TA 2D63A 1V2DA 4H51A 1YJZA 2BIEA 3MBBA 1ASBA 1EG5A 1MDZA 2D5YA 5G4JA 3WGCA 1BJOB 3NYUA 2BIAA 3ZRRA 4EFFA 2CH1A 2HP2A 4K2MA 5EUEA 4UHOA 3T32A 1GEXA 4ZWVA 4IYOA 4ADCA 3HL2A 3FSLA 4J8LA 2W8VA 2X5FA 2W7HA 1DGEA 1SPAA 2X3LA 5E4ZA 3AEMA 3LV2A 4F5IA 4HVKA 4I8AA 3W1JA 1WKGA 2BYLA 3E77A 3RUYA 1C0NA 2VMYA 2CJDA 1AHFA 1BW0A 1AMRA 1X29A 3E2ZB 2C7TA 2CJGA 3COGA 3G0TA 3FRKA 4MKJA 3USFA 3ZRPA 1W7NA 4W1XA 2AY7A 2BWOA 1D7SA 2AY3A 4GDYA 1G4VA 4R8DA 4MSOA 4OCAA 1MDXA 1IJIA 5HXXA 2BI3A 3II0A 1S06A 2D7ZA 1YJSA 5EFSA 1YJYA 1FG3A 2PB2A 1FG7A 2CY8A 2ZY3A 2DKJA 4PVFA 5EQCA 1IX6A 4GSAA 3VP6A 2E54A 3H14A 1PG8A 4JF0A 3W1HA 3M5UA 1B9IA 2DGMA 2OKKA 3WKSA 4A6UA 1G4XA 3PIUA 4KAMA 4F5LA 2O7CA 2VMZA 5AX8A 2DGKA 3WCOA 2JGTA 1EJIA 2G6WA 4JEZA 4NOGA 1N31A 2FQ6A 3HMUA 4ZWMA 4BHDA 3PGYA 4N0BA 4WXGA 1M4NA 1BJNA 1UU1A 3AENB 4IY7A 1WYTB 1AMAA 1AHGA 3ZRQA 2VMRA 1CJ0A 1SZUA 1B5OA 2GQNA 1MGVA 1CQ8A 1W3UA 1CL2A 2CSTA 4JEYA 1ZOBA 1ASAA 3DC1A 1V2FA 4A6RA 1LS3A 3FZ6A 1LKCA 3FTBA 4XAUA 2RFVA 2VI8A 3NDNA 4LNJA 2HUIA 4WLJA 3N7NA 1BJOA 5EUDA 3DODA 1E5FA 2HZPA 3ATHA 2VLFA 2HOYA 2W7KA 3BWNA 2ZSMA 3PDBB 4ITGA 3JZLA 4OC9A 1ASEA 2GMSA 4A0RA 3A8UX 3EI5A 1C4KA 3E2FA 3HVYA 1WSTA 4PFNA 2JISA 4XK1A 3E2ZA 4ZSWA 3N4RA 3EI9A 4AH3A 1B9HA 3EIBA 1S08A 4KYOA 1WYUB 2TPLA 2W7MA 1N8PA 2JJFA 4ADBA 3BN1A 1Z7DA 1CQ6A 4BA5A 4MKKA 1OHWA 3JWAA 3HBXA 1C7OA 1ARSA 3B46A 3BC8A 3LWSA 4RJ0A 4Y0HA 2X5DA 2JJGA 5FT5A 5M4BA 4XJPA 3DU4A 3RCHB 1H1CA 1KKPA 1D2FA 2XBNA 3DYDA 3N0LA 4GE7A 3HT4A 4F5HA 2EZ1A 3BCBA 1M0PA 2R0TA 3G7QA 5TF5A 4JE5D 4OT8A 4E1OA 3PJ0A 2AY5A 3BB8A 3FZ7A 3N75A 3PD6A 1M0QA 3AEOA 3IF2A 1DJEA 4FFCA 1E5EA 3QN6A 1WYTA 1AY8A 2O1BA 1UKJA 2W7JA 3GZCA 1QJ3A 4AO9A 2Z1ZA 2VGSA 2PO3A 2X8UA 4WYFA 2OATA 5IWQA 1DJ9A 3FKDA 3RBLA 2D64A 1MLYA 1LC8A 1QZ9A 4JEXA 1GD9A 4WLHA 3WCNA 1SZKA 2VMOA 1AHYA 1LC5A 3N4SA 2AY9A 4W91A 3PDBA 2AATA 4CXQA 3WKRA 1ASMA 3D6KA 3EI6A 4ADDA 1AHEA 3MAFB 1AAMA 3VK3A 1OHVA 3OKSA 2QLRA 1WKHA 3DZZA 5D5SA 4WB0B 3NUIA 5G2PA 3UAKA 1FC4A 3RI6A 1LW4A 1DTYA 2VMVA 3NNKA 3I16A 1WYUA 3AOWA 4RAEA 5G0AA 1SF2A 2EZ2A 2CINA 4XQ2A 4P3MA 1EQBA 3CQ4A 4JEWA 3QBOA 1X0MA 1OATA 1C7GA 4Y0DA 1I43A 2EO5A 3RCHA 2HOXA 2FYFA 5G4IA 4R5ZA 1YNUA 3FFHA 1V72A 4WXBA 1MDOA 2JJEA 1AKCA 1DJUA 1JS6A 4Q75A 3A9XA 1D7UA 3P1TA 4XEWA 3VOMA 4ZAHA 4ZM4A 3FDDA 4IW7A 2ZY4A 2HUUA 4MQQA 2FM1A 1B8GA 2YCTA 5F9SA 2BWNA 3A2BA 3MC6A 1J04A 3NX3A 1G7XA 2VGWA 1M6SA 1GC2A 3JW9A 1ELQA 3Q8NA 3LVJA 4FL0A 4BA4A 1C9CA 3AEJA 1BT4A 4A00A 3F0HA 3GSBA 2V0YA 2ZJGA 2QMAA 2D66A 1Z3ZA 3TCMA 3KE3A 1TPLA 5JAYA 2QB3A 4UHNA 1CQ7A 4IXOA 1Y4IA 4M2KA 4K05A 3MAFA 1RV4A 5EUNA 3GZDA 2DOUA 2W8JA 2FN6A 2O0RA 4W1VA 2AY2A 2W7LA 4WYCA 1IAXA 3E2YA 3B1DA 4DGTA 1TOEA 1W7MA 2WK7A 1S07A 1X28A 3PDXA 4LC3A 1KAFA 1BS0A 3EZSA 4E3QA 2Z1YA 1VJOA 3RQ1A 1AHXA 4WYDA 4XJLA 1M32A 2BIGA 4GE9A 1TARA 4ISYA 2YRIA 4EB5A 1AIAA 2WKAA 1YOOA 3IHJA 4GE4A 1O62A 3JU7A 4F5GA 1ARHA 1GEYA 3FD0A 1DKAA 4IX8A 2AY1A 4F5KA 2FNUA 3BCXA 4A72A 2HOZA 2HUFA 4AZJA 4OTLA 2ORDA 3DXWA 3NYSA 4ZDLA 2BI5A 1RV3A 3AOVA 1ECXA 4ZDPA 3LVLB 2VMXA 2YKVA 4ATPA 2OKJA 1IVRA 3E6GA 3GBXA 4TMRA 5FT4A 1JG8A 3FVUA 4ZLVA 1BQAA 3GJUA 1BJ4A 3GWPA 2Z61A 4CVQA 1W7LA 4R5FA 3B1CA 4EU1A 1LW5A 2R5EA 2VYCA 1AAWA 3B1EA 4RITA 1ASNA 3DRDA 1ASLA 5BJ4A 4IXZA 2CJHA 1XI9A 2VMSA 3BV0A 3FFRA 1S0AA 1ASFA 4JF1A 1IAYA 1SFFA 3BS8A 4WBTA 2AEVA 3AENA 4GEBA 1M0OA 2BHXA 2WB6A 4TN4A 1O61A 5LH9A 3WZFA 3E9KA 4Q76A 2VGZA 1UU2A 3TQXA 5KTBA 4KXKA 1PFFA 1ELUA 3TFUA 3QI6A 1WYVB 2BYJA 2D61A 3CQ5A 5DX5A 1O4SA 4MQPA 3ISLA 1AKAA 3EI8A 4ZSYA 3CBFA 3TATA 4CBRA 1IX8A 4WXFA 2EGYA 3H9XA 4AZKA 2VMUA 5J8QA 1QGNA 5G09A 1CS1A 1GC3A 2DKBA 2D7YA 3FQAA 1GDEA 1T3IA 3LG0A 2C81A 9AATA 1VP4A 4AOAA 1B5PA 4ZASA 2E7JA 2CANA 2W8UA 4WP0A 2GB3A 2JG2A 2QBTA 3AEPA 4LNMA 1CZCA 3ZZJA 2EPJA 5E3KA 2CH2A 2Z9UA 4RIZA 5M46A 2R2NA 4F5JA 1ARTA 2QSRA 2E7UA 3ELPA 3BWNC 3QPGA 4K2BA 2VGUA 3AELA 2DR1A 4W8IA 2CTZA 1ASDA 1SZSA 3DR7A 1AX4A 3JTXA 3LVKA 2QB2A 5BJ3A 2CFBA 4RKDA 4EMYA 2VGVA 3K40A 1KL1A 4Y0IA 3PA9A 4BMKA 3LY1A 1I48A 2VIBA 4J5UA 1YIZA 1RVUA 2YRRA 1AIBA 3QM2A 4TV7A 2VMQA 4UQVA 1TOKA 5EAVA 1U08A 2C0RA 3HQTA 2BKWA 4QGRA 1AJSB 2OQXA 3PPLA 1AMQA 2OGEA 4DQ6A 3F6TA 3AATA 3NTJA 2A1VA 1SVVA 2D65A 5HHYA 2XH1A 5HDMA 3ECDA 2YKUA 2R5CB 2QA3A 1AMSA 1I41A 1O69A 4L0OA 3F9TA 2HP1A 2W7GA 5FT6A 3RBFA 1D7RA 3MADA 1WYVA 2VGTA 4DBCA 1AY5A 3H7FA 2FNIA 3PAAA 1ORDA 1IBJA 1V2EA 5EAAA 3BCAA 4R2NA 3AV7A 4A6TA 1TOJA 2V1PA 2C44A 1J32A 3ELEA 3K7YA 3VAXA 3ASAA 2G7JA 2Z9WA 1QITA 2W7IA 2PB0A 2ZP7A 1S09A 2BI1A 3KGXA 1M7YA 4JE5A 3FQ7A 3NRAA 1LC7A 1H0CA 1UU0A 1KMKA 3NU7A 1YIYA 4A0GA 1GC0A 2DGLA 2Z9XA 3ZZKA 3HLMA 3EZ1A 4ZM3A 3BWOA 2ZY5A 1MAPA 4WB0A 1X2AA 5G2QA 4A0HA 4B98A 2VMPA 2BWPA 3B8XA 4WYEA 4OBVA 2AY4A 4EB7A 2YKXA 4JEVA 3TFTA 2WK8A 3R9AA 1OXPA 3KKIA 2Z20A 5EIGB 2Q7WA 5I92A 2VI9A 1M0NA 2VMWA 4RKCA 1ASCA 3GETA 3MAUA 3I4JA 4OBUA 1I29A 3N5MA 3A9YA 4RJYA 4ITXA 4XJMA 3N4XA 2YHKA 4W1WA 1KKJA 3ASBA 2ZYJA 2AEUA 1RVYA 1YAAA 3PD6B 1IUGA 4P7YA 3UE8A 5C6UA 2ZC0A 4ADEA 2GMUA 2AY8A 3HDOA 2YKYA 1AJSA 3L8AA 4MY5A 3WY7A 3UWCA 1OHYA 1N2TA 4H63Q 5E5IA 2ZUKA 3JWBA 1DGDA 3DR4A 3EI7A 3WLXA 1QJ5A 2E7IA 2R5CA 1GCKA 2Z9VA 3AEMC 5FT8A 3DXVA 1GEWA 1ZODA 2ZSLA 5M4DA 2JJHA 1MLZA 3QGUA 4OMAA 1QISA 5DJ1A 4WYAA 2ZY2A 3WX9A 2VMTA 3LVMA 4LW4A 1CZEA 1JS3A 3MC6C 1IX7A 1CL1A 3CAIA 1B4XA 4RM1A 3VK4A
chains in the Genus database with same CATH topology
1GC4A 2WK9A 4XJOA 3FZ8A 4E77A 4M2JA 1G7WA 1AY4A 1DFOA 3FVXA 3QHXA 5F8VA 3AEJC 4K2IA 3ACZA 4PFFA 2YCPA 3FDBA 2OGAA 2W7DA 1KMJA 1MAQA 2EH6A 1AKBA 3A9ZA 3NU8A 2KFPA 4MQRA 2VLHA 2W7EA 4U2HA 4UOYA 1TASA 2CB1A 2F8JA 1P3WA 3CQ6A 3WGBA 7AATA 2W8WA 3GZDC 2BI9A 4E3RA 4IYOB 1PMOA 2BI2A 5EIGA 1AICA 1PMMA 4BQ0A 4WYGA 1KL2A 1TOIA 1C7NA 2Z67A 4CBSA 3K28A 5LHAA 3GR9A 4HF8A 1ARGA 3R4TA 3EIAA 4IXSA 3FVSA 2FKIA 1GBNA 4Q31A 1VEFA 4LW2A 4OYTA 2W7FA 1W23A 1BQDA 4PIWA 2YCNA 2HORA 2EYQA 4AO4A 1ASGA 3W1IA 1BJWA 4O6ZA 2AY6A 4B9BA 3MKJA 4M2MA 1AJRA 1LK9A 3FQ8A 4A0FA 4N0WA 4ZDOA 1BKGA 2GSAA 1QIRA 1XEYA 4RLGA 1ARIA 4F4EA 3OP7A 3KGWA 4F5FA 5M49A 8AATA 4ATQA 4LNLA 2VMNA 4MGRA 4CXRA 3FCRA 4WD2A 1TATA 5K8BA 3I5TA 4W5KA 3L44A 5DJ9A 1JF9A 2NMPA 3EUCA 1OXOA 2YOBA 3MEBA 3NUBA 4GRXA 1ZC9A 5DB5A 4U1TA 3VK2A 2VIAA 3P6KA 4F5MA 3G8MA 1TOGA 4Q6RA 5D95A 4UHMA 1D7VA 3NYTA 2W8TA 2D63A 1V2DA 4H51A 1YJZA 2BIEA 3MBBA 1ASBA 1EG5A 1MDZA 2D5YA 5G4JA 3WGCA 1BJOB 3NYUA 2BIAA 3ZRRA 4EFFA 2CH1A 2HP2A 4K2MA 5EUEA 4UHOA 3T32A 1GEXA 4ZWVA 4IYOA 4ADCA 3HL2A 3FSLA 4J8LA 2W8VA 2X5FA 2W7HA 1DGEA 1SPAA 2X3LA 5E4ZA 3AEMA 3LV2A 4F5IA 4HVKA 4I8AA 3W1JA 1WKGA 2BYLA 3E77A 3RUYA 1C0NA 2VMYA 2CJDA 1AHFA 1BW0A 1AMRA 1X29A 3E2ZB 2C7TA 2CJGA 3COGA 3G0TA 3FRKA 4MKJA 3USFA 3ZRPA 1W7NA 4W1XA 2AY7A 2BWOA 1D7SA 2AY3A 4GDYA 1G4VA 4R8DA 4MSOA 4OCAA 1MDXA 1IJIA 5HXXA 2BI3A 3II0A 1S06A 2D7ZA 1YJSA 5EFSA 1YJYA 1FG3A 2PB2A 1FG7A 2CY8A 2ZY3A 2DKJA 4PVFA 5EQCA 1IX6A 4GSAA 3VP6A 2E54A 3H14A 1PG8A 4JF0A 3W1HA 3M5UA 1B9IA 2DGMA 2OKKA 3WKSA 4A6UA 1G4XA 3PIUA 4KAMA 4F5LA 2O7CA 2VMZA 5AX8A 2DGKA 3WCOA 2JGTA 1EJIA 2G6WA 4JEZA 4NOGA 1N31A 2FQ6A 3HMUA 4ZWMA 4BHDA 3PGYA 4N0BA 4WXGA 1M4NA 1BJNA 1UU1A 3AENB 4IY7A 1WYTB 1AMAA 1AHGA 3ZRQA 2VMRA 1CJ0A 1SZUA 1B5OA 2GQNA 1MGVA 1CQ8A 1W3UA 1CL2A 2CSTA 4JEYA 1ZOBA 1ASAA 3DC1A 1V2FA 4A6RA 1LS3A 3FZ6A 1LKCA 3FTBA 4XAUA 2RFVA 2VI8A 3NDNA 4LNJA 2HUIA 4WLJA 3N7NA 1BJOA 5EUDA 3DODA 1E5FA 2HZPA 3ATHA 2VLFA 2HOYA 2W7KA 3BWNA 2ZSMA 3PDBB 4ITGA 3JZLA 4OC9A 1ASEA 2GMSA 4A0RA 3A8UX 3EI5A 1C4KA 3E2FA 3HVYA 1WSTA 4PFNA 2JISA 4XK1A 3E2ZA 4ZSWA 3N4RA 3EI9A 4AH3A 1B9HA 3EIBA 1S08A 4KYOA 1WYUB 2TPLA 2W7MA 1N8PA 2JJFA 4ADBA 3BN1A 1Z7DA 1CQ6A 4BA5A 4MKKA 1OHWA 3JWAA 3HBXA 1C7OA 1ARSA 3B46A 3BC8A 3LWSA 4RJ0A 4Y0HA 2X5DA 2JJGA 5FT5A 5M4BA 4XJPA 3DU4A 3RCHB 1H1CA 1KKPA 1D2FA 2XBNA 3DYDA 3N0LA 4GE7A 3HT4A 4F5HA 2EZ1A 3BCBA 1M0PA 2R0TA 3G7QA 5TF5A 4JE5D 4OT8A 4E1OA 3PJ0A 2AY5A 3BB8A 3FZ7A 3N75A 3PD6A 1M0QA 3AEOA 3IF2A 1DJEA 4FFCA 1E5EA 3QN6A 1WYTA 1AY8A 2O1BA 1UKJA 2W7JA 3GZCA 1QJ3A 4AO9A 2Z1ZA 2VGSA 2PO3A 2X8UA 4WYFA 2OATA 5IWQA 1DJ9A 3FKDA 3RBLA 2D64A 1MLYA 1LC8A 1QZ9A 4JEXA 1GD9A 4WLHA 3WCNA 1SZKA 2VMOA 1AHYA 1LC5A 3N4SA 2AY9A 4W91A 3PDBA 2AATA 4CXQA 3WKRA 1ASMA 3D6KA 3EI6A 4ADDA 1AHEA 3MAFB 1AAMA 3VK3A 1OHVA 3OKSA 2QLRA 1WKHA 3DZZA 5D5SA 4WB0B 3NUIA 5G2PA 3UAKA 1FC4A 3RI6A 1LW4A 1DTYA 2VMVA 3NNKA 3I16A 1WYUA 3AOWA 4RAEA 5G0AA 1SF2A 2EZ2A 2CINA 4XQ2A 4P3MA 1EQBA 3CQ4A 4JEWA 3QBOA 1X0MA 1OATA 1C7GA 4Y0DA 1I43A 2EO5A 3RCHA 2HOXA 2FYFA 5G4IA 4R5ZA 1YNUA 3FFHA 1V72A 4WXBA 1MDOA 2JJEA 1AKCA 1DJUA 1JS6A 4Q75A 3A9XA 1D7UA 3P1TA 4XEWA 3VOMA 4ZAHA 4ZM4A 3FDDA 4IW7A 2ZY4A 2HUUA 4MQQA 2FM1A 1B8GA 2YCTA 5F9SA 2BWNA 3A2BA 3MC6A 1J04A 3NX3A 1G7XA 2VGWA 1M6SA 1GC2A 3JW9A 1ELQA 3Q8NA 3LVJA 4FL0A 4BA4A 1C9CA 3AEJA 1BT4A 4A00A 3F0HA 3GSBA 2V0YA 2ZJGA 2QMAA 2D66A 1Z3ZA 3TCMA 3KE3A 1TPLA 5JAYA 2QB3A 4UHNA 1CQ7A 4IXOA 1Y4IA 4M2KA 4K05A 3MAFA 1RV4A 5EUNA 3GZDA 2DOUA 2W8JA 2FN6A 2O0RA 4W1VA 2AY2A 2W7LA 4WYCA 1IAXA 3E2YA 3B1DA 4DGTA 1TOEA 1W7MA 2WK7A 1S07A 1X28A 3PDXA 4LC3A 1BS0A 3EZSA 4E3QA 2Z1YA 1VJOA 3RQ1A 1AHXA 4WYDA 4XJLA 1M32A 2BIGA 4GE9A 1TARA 4ISYA 2YRIA 4EB5A 1AIAA 2WKAA 1YOOA 3IHJA 4GE4A 1O62A 3JU7A 4F5GA 1ARHA 1GEYA 3FD0A 1DKAA 4IX8A 2AY1A 4F5KA 2FNUA 3BCXA 4A72A 2HOZA 2HUFA 4AZJA 4OTLA 2ORDA 3DXWA 3NYSA 4ZDLA 2BI5A 1RV3A 3AOVA 1ECXA 4ZDPA 3LVLB 2VMXA 2YKVA 4ATPA 2OKJA 1IVRA 3E6GA 3GBXA 4TMRA 5FT4A 1JG8A 3FVUA 4ZLVA 1BQAA 3GJUA 1BJ4A 3GWPA 2Z61A 4CVQA 1W7LA 4R5FA 3B1CA 4EU1A 1LW5A 2R5EA 2VYCA 1AAWA 3B1EA 4RITA 1ASNA 3DRDA 1ASLA 5BJ4A 4IXZA 2CJHA 1XI9A 2VMSA 3BV0A 3FFRA 1S0AA 1ASFA 4JF1A 1IAYA 1SFFA 3BS8A 4WBTA 2AEVA 3AENA 4GEBA 1M0OA 2BHXA 2WB6A 4TN4A 1O61A 5LH9A 3WZFA 3E9KA 4Q76A 2VGZA 1UU2A 3TQXA 5KTBA 4KXKA 1PFFA 1ELUA 3TFUA 3QI6A 1WYVB 2BYJA 2D61A 3CQ5A 5DX5A 1O4SA 4MQPA 3ISLA 1AKAA 3EI8A 4ZSYA 3CBFA 3TATA 4CBRA 1IX8A 4WXFA 2EGYA 3H9XA 4AZKA 2VMUA 5J8QA 1QGNA 5G09A 1CS1A 1GC3A 2DKBA 2D7YA 3FQAA 1GDEA 1T3IA 3LG0A 2C81A 9AATA 1VP4A 4AOAA 1B5PA 4ZASA 2E7JA 2CANA 2W8UA 4WP0A 2GB3A 2JG2A 2QBTA 3AEPA 4LNMA 1CZCA 3ZZJA 2EPJA 5E3KA 2CH2A 2Z9UA 4RIZA 5M46A 2R2NA 4F5JA 1ARTA 2QSRA 2E7UA 3ELPA 3BWNC 3QPGA 4K2BA 2VGUA 3AELA 2DR1A 4W8IA 2CTZA 1ASDA 1SZSA 3DR7A 1AX4A 3JTXA 3LVKA 2QB2A 5BJ3A 2CFBA 4RKDA 4EMYA 2VGVA 3K40A 1KL1A 4Y0IA 3PA9A 4BMKA 3LY1A 1I48A 2VIBA 4J5UA 1YIZA 1RVUA 2YRRA 1AIBA 3QM2A 4TV7A 2VMQA 4UQVA 1TOKA 5EAVA 1U08A 2C0RA 3HQTA 2BKWA 4QGRA 1AJSB 2OQXA 3PPLA 1AMQA 2OGEA 4DQ6A 3F6TA 3AATA 3NTJA 2A1VA 1SVVA 2D65A 5HHYA 2XH1A 5HDMA 3ECDA 2YKUA 2R5CB 2QA3A 1AMSA 1I41A 1O69A 4L0OA 3F9TA 2HP1A 2W7GA 5FT6A 3RBFA 1D7RA 3MADA 1WYVA 2VGTA 4DBCA 1AY5A 3H7FA 2FNIA 3PAAA 1ORDA 1IBJA 1V2EA 5EAAA 3BCAA 4R2NA 3AV7A 4A6TA 1TOJA 2V1PA 2C44A 1J32A 3ELEA 3K7YA 3VAXA 3ASAA 2G7JA 2Z9WA 1QITA 2W7IA 2PB0A 2ZP7A 1S09A 2BI1A 3KGXA 1M7YA 4JE5A 3FQ7A 3NRAA 1LC7A 1H0CA 1UU0A 1KMKA 3NU7A 1YIYA 4A0GA 1GC0A 2DGLA 2Z9XA 3ZZKA 3HLMA 3EZ1A 4ZM3A 3BWOA 2ZY5A 1MAPA 4WB0A 1X2AA 5G2QA 4A0HA 4B98A 2VMPA 2BWPA 3B8XA 4WYEA 4OBVA 2AY4A 4EB7A 2YKXA 4JEVA 3TFTA 2WK8A 3R9AA 1OXPA 3KKIA 2Z20A 5EIGB 2Q7WA 5I92A 2VI9A 1M0NA 2VMWA 4RKCA 1ASCA 3GETA 3MAUA 3I4JA 4OBUA 1I29A 3N5MA 3A9YA 4RJYA 4ITXA 4XJMA 3N4XA 2YHKA 4W1WA 1KKJA 3ASBA 2ZYJA 2AEUA 1RVYA 1YAAA 3PD6B 1IUGA 4P7YA 3UE8A 5C6UA 2ZC0A 4ADEA 2GMUA 2AY8A 3HDOA 2YKYA 1AJSA 3L8AA 4MY5A 3WY7A 3UWCA 1OHYA 1N2TA 4H63Q 5E5IA 2ZUKA 3JWBA 1DGDA 3DR4A 3EI7A 3WLXA 1QJ5A 2E7IA 2R5CA 1GCKA 2Z9VA 3AEMC 5FT8A 3DXVA 1GEWA 1ZODA 2ZSLA 5M4DA 2JJHA 1MLZA 3QGUA 4OMAA 1QISA 5DJ1A 4WYAA 2ZY2A 3WX9A 2VMTA 3LVMA 4LW4A 1CZEA 1JS3A 3MC6C 1IX7A 1CL1A 3CAIA 1B4XA 4RM1A 3VK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GC4 A;  2WK9 A;  4XJO A;  3FZ8 A;  4E77 A;  4M2J A;  1G7W A;  1AY4 A;  1DFO A;  3FVX A;  3QHX A;  5F8V A;  3AEJ C;  4K2I A;  3ACZ A;  4PFF A;  2YCP A;  3FDB A;  2OGA A;  2W7D A;  1KMJ A;  1MAQ A;  2EH6 A;  1AKB A;  3A9Z A;  3NU8 A;  4MQR A;  2VLH A;  2W7E A;  4U2H A;  4UOY A;  1TAS A;  2CB1 A;  2F8J A;  1P3W A;  3CQ6 A;  3WGB A;  7AAT A;  2W8W A;  3GZD C;  2BI9 A;  4E3R A;  4IYO B;  1PMO A;  2BI2 A;  5EIG A;  1AIC A;  1PMM A;  4BQ0 A;  4WYG A;  1KL2 A;  1TOI A;  1C7N A;  2Z67 A;  4CBS A;  3K28 A;  5LHA A;  3GR9 A;  4HF8 A;  1ARG A;  3R4T A;  3EIA A;  4IXS A;  3FVS A;  1GBN A;  4Q31 A;  1VEF A;  4LW2 A;  4OYT A;  2W7F A;  1W23 A;  1BQD A;  4PIW A;  2YCN A;  2HOR A;  4AO4 A;  1ASG A;  3W1I A;  1BJW A;  4O6Z A;  2AY6 A;  4B9B A;  3MKJ A;  4M2M A;  1AJR A;  1LK9 A;  3FQ8 A;  4A0F A;  4N0W A;  4ZDO A;  1BKG A;  2GSA A;  1QIR A;  1XEY A;  4RLG A;  1ARI A;  4F4E A;  3OP7 A;  3KGW A;  4F5F A;  5M49 A;  8AAT A;  4ATQ A;  4LNL A;  2VMN A;  4MGR A;  4CXR A;  3FCR A;  4WD2 A;  1TAT A;  5K8B A;  3I5T A;  4W5K A;  3L44 A;  5DJ9 A;  1JF9 A;  2NMP A;  3EUC A;  1OXO A;  2YOB A;  3MEB A;  3NUB A;  4GRX A;  1ZC9 A;  5DB5 A;  4U1T A;  3VK2 A;  2VIA A;  3P6K A;  4F5M A;  3G8M A;  1TOG A;  4Q6R A;  5D95 A;  4UHM A;  1D7V A;  3NYT A;  2W8T A;  2D63 A;  1V2D A;  4H51 A;  1YJZ A;  2BIE A;  3MBB A;  1ASB A;  1EG5 A;  1MDZ A;  2D5Y A;  5G4J A;  3WGC A;  1BJO B;  3NYU A;  2BIA A;  3ZRR A;  4EFF A;  2CH1 A;  2HP2 A;  4K2M A;  5EUE A;  4UHO A;  3T32 A;  1GEX A;  4ZWV A;  4IYO A;  4ADC A;  3HL2 A;  3FSL A;  4J8L A;  2W8V A;  2X5F A;  2W7H A;  1DGE A;  1SPA A;  2X3L A;  5E4Z A;  3AEM A;  3LV2 A;  4F5I A;  4HVK A;  4I8A A;  3W1J A;  1WKG A;  2BYL A;  3E77 A;  3RUY A;  1C0N A;  2VMY A;  2CJD A;  1AHF A;  1BW0 A;  1AMR A;  1X29 A;  3E2Z B;  2C7T A;  2CJG A;  3COG A;  3G0T A;  3FRK A;  4MKJ A;  3USF A;  3ZRP A;  1W7N A;  4W1X A;  2AY7 A;  2BWO A;  1D7S A;  2AY3 A;  4GDY A;  1G4V A;  4R8D A;  4MSO A;  4OCA A;  1MDX A;  1IJI A;  5HXX A;  2BI3 A;  3II0 A;  1S06 A;  2D7Z A;  1YJS A;  5EFS A;  1YJY A;  1FG3 A;  2PB2 A;  1FG7 A;  2CY8 A;  2ZY3 A;  2DKJ A;  4PVF A;  5EQC A;  1IX6 A;  4GSA A;  3VP6 A;  2E54 A;  3H14 A;  1PG8 A;  4JF0 A;  3W1H A;  3M5U A;  1B9I A;  2DGM A;  2OKK A;  3WKS A;  4A6U A;  1G4X A;  3PIU A;  4KAM A;  4F5L A;  2O7C A;  2VMZ A;  5AX8 A;  2DGK A;  3WCO A;  2JGT A;  1EJI A;  2G6W A;  4JEZ A;  4NOG A;  1N31 A;  2FQ6 A;  3HMU A;  4ZWM A;  4BHD A;  3PGY A;  4N0B A;  4WXG A;  1M4N A;  1BJN A;  1UU1 A;  3AEN B;  4IY7 A;  1WYT B;  1AMA A;  1AHG A;  3ZRQ A;  2VMR A;  1CJ0 A;  1SZU A;  1B5O A;  2GQN A;  1MGV A;  1CQ8 A;  1W3U A;  1CL2 A;  2CST A;  4JEY A;  1ZOB A;  1ASA A;  3DC1 A;  1V2F A;  4A6R A;  1LS3 A;  3FZ6 A;  1LKC A;  3FTB A;  4XAU A;  2RFV A;  2VI8 A;  3NDN A;  4LNJ A;  2HUI A;  4WLJ A;  1BJO A;  5EUD A;  3DOD A;  1E5F A;  2HZP A;  3ATH A;  2VLF A;  2HOY A;  2W7K A;  3BWN A;  2ZSM A;  3PDB B;  4ITG A;  3JZL A;  4OC9 A;  1ASE A;  2GMS A;  4A0R A;  3A8U X;  3EI5 A;  1C4K A;  3E2F A;  3HVY A;  1WST A;  4PFN A;  2JIS A;  4XK1 A;  3E2Z A;  4ZSW A;  3EI9 A;  4AH3 A;  1B9H A;  3EIB A;  1S08 A;  4KYO A;  1WYU B;  2TPL A;  2W7M A;  1N8P A;  2JJF A;  4ADB A;  3BN1 A;  1Z7D A;  1CQ6 A;  4BA5 A;  4MKK A;  1OHW A;  3JWA A;  3HBX A;  1C7O A;  1ARS A;  3B46 A;  3BC8 A;  3LWS A;  4RJ0 A;  4Y0H A;  2X5D A;  2JJG A;  5FT5 A;  5M4B A;  4XJP A;  3DU4 A;  3RCH B;  1H1C A;  1KKP A;  1D2F A;  2XBN A;  3DYD A;  3N0L A;  4GE7 A;  3HT4 A;  4F5H A;  2EZ1 A;  3BCB A;  1M0P A;  2R0T A;  3G7Q A;  5TF5 A;  4JE5 D;  4OT8 A;  4E1O A;  3PJ0 A;  2AY5 A;  3BB8 A;  3FZ7 A;  3N75 A;  3PD6 A;  1M0Q A;  3AEO A;  3IF2 A;  1DJE A;  4FFC A;  1E5E A;  3QN6 A;  1WYT A;  1AY8 A;  2O1B A;  1UKJ A;  2W7J A;  3GZC A;  1QJ3 A;  4AO9 A;  2Z1Z A;  2VGS A;  2PO3 A;  2X8U A;  4WYF A;  2OAT A;  5IWQ A;  1DJ9 A;  3FKD A;  3RBL A;  2D64 A;  1MLY A;  1LC8 A;  1QZ9 A;  4JEX A;  1GD9 A;  4WLH A;  3WCN A;  1SZK A;  2VMO A;  1AHY A;  1LC5 A;  2AY9 A;  4W91 A;  3PDB A;  2AAT A;  4CXQ A;  3WKR A;  1ASM A;  3D6K A;  3EI6 A;  4ADD A;  1AHE A;  3MAF B;  1AAM A;  3VK3 A;  1OHV A;  3OKS A;  2QLR A;  1WKH A;  3DZZ A;  5D5S A;  4WB0 B;  3NUI A;  5G2P A;  3UAK A;  1FC4 A;  3RI6 A;  1LW4 A;  1DTY A;  2VMV A;  3NNK A;  3I16 A;  1WYU A;  3AOW A;  4RAE A;  5G0A A;  1SF2 A;  2EZ2 A;  2CIN A;  4XQ2 A;  4P3M A;  1EQB A;  3CQ4 A;  4JEW A;  3QBO A;  1X0M A;  1OAT A;  1C7G A;  4Y0D A;  1I43 A;  2EO5 A;  3RCH A;  2HOX A;  2FYF A;  5G4I A;  4R5Z A;  1YNU A;  3FFH A;  1V72 A;  4WXB A;  1MDO A;  2JJE A;  1AKC A;  1DJU A;  1JS6 A;  4Q75 A;  3A9X A;  1D7U A;  3P1T A;  4XEW A;  3VOM A;  4ZAH A;  4ZM4 A;  3FDD A;  4IW7 A;  2ZY4 A;  2HUU A;  4MQQ A;  2FM1 A;  1B8G A;  2YCT A;  5F9S A;  2BWN A;  3A2B A;  3MC6 A;  1J04 A;  3NX3 A;  1G7X A;  2VGW A;  1M6S A;  1GC2 A;  3JW9 A;  1ELQ A;  3Q8N A;  3LVJ A;  4FL0 A;  4BA4 A;  1C9C A;  3AEJ A;  1BT4 A;  4A00 A;  3F0H A;  3GSB A;  2V0Y A;  2ZJG A;  2QMA A;  2D66 A;  1Z3Z A;  3TCM A;  3KE3 A;  1TPL A;  5JAY A;  2QB3 A;  4UHN A;  1CQ7 A;  4IXO A;  1Y4I A;  4M2K A;  3MAF A;  1RV4 A;  5EUN A;  3GZD A;  2DOU A;  2W8J A;  2FN6 A;  2O0R A;  4W1V A;  2AY2 A;  2W7L A;  4WYC A;  1IAX A;  3E2Y A;  3B1D A;  4DGT A;  1TOE A;  1W7M A;  2WK7 A;  1S07 A;  1X28 A;  3PDX A;  4LC3 A;  1BS0 A;  3EZS A;  4E3Q A;  2Z1Y A;  1VJO A;  3RQ1 A;  1AHX A;  4WYD A;  4XJL A;  1M32 A;  2BIG A;  4GE9 A;  1TAR A;  4ISY A;  2YRI A;  4EB5 A;  1AIA A;  2WKA A;  1YOO A;  3IHJ A;  4GE4 A;  1O62 A;  3JU7 A;  4F5G A;  1ARH A;  1GEY A;  3FD0 A;  1DKA A;  4IX8 A;  2AY1 A;  4F5K A;  2FNU A;  3BCX A;  4A72 A;  2HOZ A;  2HUF A;  4AZJ A;  4OTL A;  2ORD A;  3DXW A;  3NYS A;  4ZDL A;  2BI5 A;  1RV3 A;  3AOV A;  1ECX A;  4ZDP A;  3LVL B;  2VMX A;  2YKV A;  4ATP A;  2OKJ A;  1IVR A;  3E6G A;  3GBX A;  4TMR A;  5FT4 A;  1JG8 A;  3FVU A;  4ZLV A;  1BQA A;  3GJU A;  1BJ4 A;  3GWP A;  2Z61 A;  4CVQ A;  1W7L A;  4R5F A;  3B1C A;  4EU1 A;  1LW5 A;  2R5E A;  2VYC A;  1AAW A;  3B1E A;  4RIT A;  1ASN A;  3DRD A;  1ASL A;  5BJ4 A;  4IXZ A;  2CJH A;  1XI9 A;  2VMS A;  3BV0 A;  3FFR A;  1S0A A;  1ASF A;  4JF1 A;  1IAY A;  1SFF A;  3BS8 A;  4WBT A;  2AEV A;  3AEN A;  4GEB A;  1M0O A;  2BHX A;  4TN4 A;  1O61 A;  5LH9 A;  3WZF A;  3E9K A;  4Q76 A;  2VGZ A;  1UU2 A;  3TQX A;  4KXK A;  1PFF A;  1ELU A;  3TFU A;  3QI6 A;  1WYV B;  2BYJ A;  2D61 A;  3CQ5 A;  5DX5 A;  1O4S A;  4MQP A;  3ISL A;  1AKA A;  3EI8 A;  4ZSY A;  3CBF A;  3TAT A;  4CBR A;  1IX8 A;  4WXF A;  2EGY A;  4AZK A;  2VMU A;  5J8Q A;  1QGN A;  5G09 A;  1CS1 A;  1GC3 A;  2DKB A;  2D7Y A;  3FQA A;  1GDE A;  1T3I A;  3LG0 A;  2C81 A;  9AAT A;  1VP4 A;  4AOA A;  1B5P A;  4ZAS A;  2E7J A;  2CAN A;  2W8U A;  4WP0 A;  2GB3 A;  2JG2 A;  2QBT A;  3AEP A;  4LNM A;  1CZC A;  3ZZJ A;  2EPJ A;  5E3K A;  2CH2 A;  2Z9U A;  4RIZ A;  5M46 A;  2R2N A;  4F5J A;  1ART A;  2E7U A;  3ELP A;  3BWN C;  3QPG A;  4K2B A;  2VGU A;  3AEL A;  2DR1 A;  4W8I A;  2CTZ A;  1ASD A;  1SZS A;  3DR7 A;  1AX4 A;  3JTX A;  3LVK A;  2QB2 A;  5BJ3 A;  2CFB A;  4RKD A;  4EMY A;  2VGV A;  3K40 A;  1KL1 A;  4Y0I A;  3PA9 A;  4BMK A;  3LY1 A;  1I48 A;  2VIB A;  4J5U A;  1YIZ A;  1RVU A;  2YRR A;  1AIB A;  3QM2 A;  4TV7 A;  2VMQ A;  4UQV A;  1TOK A;  5EAV A;  1U08 A;  2C0R A;  3HQT A;  2BKW A;  4QGR A;  1AJS B;  2OQX A;  3PPL A;  1AMQ A;  2OGE A;  4DQ6 A;  3F6T A;  3AAT A;  3NTJ A;  1SVV A;  2D65 A;  5HHY A;  2XH1 A;  5HDM A;  3ECD A;  2YKU A;  2R5C B;  2QA3 A;  1AMS A;  1I41 A;  1O69 A;  4L0O A;  3F9T A;  2HP1 A;  2W7G A;  5FT6 A;  3RBF A;  1D7R A;  3MAD A;  1WYV A;  2VGT A;  4DBC A;  1AY5 A;  3H7F A;  2FNI A;  3PAA A;  1ORD A;  1IBJ A;  1V2E A;  5EAA A;  3BCA A;  4R2N A;  3AV7 A;  4A6T A;  1TOJ A;  2V1P A;  2C44 A;  1J32 A;  3ELE A;  3K7Y A;  3VAX A;  3ASA A;  2Z9W A;  1QIT A;  2W7I A;  2PB0 A;  2ZP7 A;  1S09 A;  2BI1 A;  3KGX A;  1M7Y A;  4JE5 A;  3FQ7 A;  3NRA A;  1LC7 A;  1H0C A;  1UU0 A;  1KMK A;  3NU7 A;  1YIY A;  4A0G A;  1GC0 A;  2DGL A;  2Z9X A;  3ZZK A;  3HLM A;  3EZ1 A;  4ZM3 A;  3BWO A;  2ZY5 A;  1MAP A;  4WB0 A;  1X2A A;  5G2Q A;  4A0H A;  4B98 A;  2VMP A;  2BWP A;  3B8X A;  4WYE A;  4OBV A;  2AY4 A;  4EB7 A;  2YKX A;  4JEV A;  3TFT A;  2WK8 A;  3R9A A;  1OXP A;  3KKI A;  2Z20 A;  5EIG B;  2Q7W A;  5I92 A;  2VI9 A;  1M0N A;  2VMW A;  4RKC A;  1ASC A;  3GET A;  3MAU A;  3I4J A;  4OBU A;  1I29 A;  3N5M A;  3A9Y A;  4RJY A;  4ITX A;  4XJM A;  2YHK A;  4W1W A;  1KKJ A;  3ASB A;  2ZYJ A;  2AEU A;  1RVY A;  1YAA A;  3PD6 B;  1IUG A;  4P7Y A;  3UE8 A;  5C6U A;  2ZC0 A;  4ADE A;  2GMU A;  2AY8 A;  3HDO A;  2YKY A;  1AJS A;  3L8A A;  4MY5 A;  3WY7 A;  3UWC A;  1OHY A;  1N2T A;  5E5I A;  2ZUK A;  3JWB A;  1DGD A;  3DR4 A;  3EI7 A;  3WLX A;  1QJ5 A;  2E7I A;  2R5C A;  1GCK A;  2Z9V A;  3AEM C;  5FT8 A;  3DXV A;  1GEW A;  1ZOD A;  2ZSL A;  5M4D A;  2JJH A;  1MLZ A;  3QGU A;  4OMA A;  1QIS A;  5DJ1 A;  4WYA A;  2ZY2 A;  3WX9 A;  2VMT A;  3LVM A;  4LW4 A;  1CZE A;  1JS3 A;  3MC6 C;  1IX7 A;  1CL1 A;  3CAI A;  1B4X A;  4RM1 A;  3VK4 A; 
#chains in the Genus database with same CATH topology
 1GC4 A;  2WK9 A;  4XJO A;  3FZ8 A;  4E77 A;  4M2J A;  1G7W A;  1AY4 A;  1DFO A;  3FVX A;  3QHX A;  5F8V A;  3AEJ C;  4K2I A;  3ACZ A;  4PFF A;  2YCP A;  3FDB A;  2OGA A;  2W7D A;  1KMJ A;  1MAQ A;  2EH6 A;  1AKB A;  3A9Z A;  3NU8 A;  2KFP A;  4MQR A;  2VLH A;  2W7E A;  4U2H A;  4UOY A;  1TAS A;  2CB1 A;  2F8J A;  1P3W A;  3CQ6 A;  3WGB A;  7AAT A;  2W8W A;  3GZD C;  2BI9 A;  4E3R A;  4IYO B;  1PMO A;  2BI2 A;  5EIG A;  1AIC A;  1PMM A;  4BQ0 A;  4WYG A;  1KL2 A;  1TOI A;  1C7N A;  2Z67 A;  4CBS A;  3K28 A;  5LHA A;  3GR9 A;  4HF8 A;  1ARG A;  3R4T A;  3EIA A;  4IXS A;  3FVS A;  2FKI A;  1GBN A;  4Q31 A;  1VEF A;  4LW2 A;  4OYT A;  2W7F A;  1W23 A;  1BQD A;  4PIW A;  2YCN A;  2HOR A;  2EYQ A;  4AO4 A;  1ASG A;  3W1I A;  1BJW A;  4O6Z A;  2AY6 A;  4B9B A;  3MKJ A;  4M2M A;  1AJR A;  1LK9 A;  3FQ8 A;  4A0F A;  4N0W A;  4ZDO A;  1BKG A;  2GSA A;  1QIR A;  1XEY A;  4RLG A;  1ARI A;  4F4E A;  3OP7 A;  3KGW A;  4F5F A;  5M49 A;  8AAT A;  4ATQ A;  4LNL A;  2VMN A;  4MGR A;  4CXR A;  3FCR A;  4WD2 A;  1TAT A;  5K8B A;  3I5T A;  4W5K A;  3L44 A;  5DJ9 A;  1JF9 A;  2NMP A;  3EUC A;  1OXO A;  2YOB A;  3MEB A;  3NUB A;  4GRX A;  1ZC9 A;  5DB5 A;  4U1T A;  3VK2 A;  2VIA A;  3P6K A;  4F5M A;  3G8M A;  1TOG A;  4Q6R A;  5D95 A;  4UHM A;  1D7V A;  3NYT A;  2W8T A;  2D63 A;  1V2D A;  4H51 A;  1YJZ A;  2BIE A;  3MBB A;  1ASB A;  1EG5 A;  1MDZ A;  2D5Y A;  5G4J A;  3WGC A;  1BJO B;  3NYU A;  2BIA A;  3ZRR A;  4EFF A;  2CH1 A;  2HP2 A;  4K2M A;  5EUE A;  4UHO A;  3T32 A;  1GEX A;  4ZWV A;  4IYO A;  4ADC A;  3HL2 A;  3FSL A;  4J8L A;  2W8V A;  2X5F A;  2W7H A;  1DGE A;  1SPA A;  2X3L A;  5E4Z A;  3AEM A;  3LV2 A;  4F5I A;  4HVK A;  4I8A A;  3W1J A;  1WKG A;  2BYL A;  3E77 A;  3RUY A;  1C0N A;  2VMY A;  2CJD A;  1AHF A;  1BW0 A;  1AMR A;  1X29 A;  3E2Z B;  2C7T A;  2CJG A;  3COG A;  3G0T A;  3FRK A;  4MKJ A;  3USF A;  3ZRP A;  1W7N A;  4W1X A;  2AY7 A;  2BWO A;  1D7S A;  2AY3 A;  4GDY A;  1G4V A;  4R8D A;  4MSO A;  4OCA A;  1MDX A;  1IJI A;  5HXX A;  2BI3 A;  3II0 A;  1S06 A;  2D7Z A;  1YJS A;  5EFS A;  1YJY A;  1FG3 A;  2PB2 A;  1FG7 A;  2CY8 A;  2ZY3 A;  2DKJ A;  4PVF A;  5EQC A;  1IX6 A;  4GSA A;  3VP6 A;  2E54 A;  3H14 A;  1PG8 A;  4JF0 A;  3W1H A;  3M5U A;  1B9I A;  2DGM A;  2OKK A;  3WKS A;  4A6U A;  1G4X A;  3PIU A;  4KAM A;  4F5L A;  2O7C A;  2VMZ A;  5AX8 A;  2DGK A;  3WCO A;  2JGT A;  1EJI A;  2G6W A;  4JEZ A;  4NOG A;  1N31 A;  2FQ6 A;  3HMU A;  4ZWM A;  4BHD A;  3PGY A;  4N0B A;  4WXG A;  1M4N A;  1BJN A;  1UU1 A;  3AEN B;  4IY7 A;  1WYT B;  1AMA A;  1AHG A;  3ZRQ A;  2VMR A;  1CJ0 A;  1SZU A;  1B5O A;  2GQN A;  1MGV A;  1CQ8 A;  1W3U A;  1CL2 A;  2CST A;  4JEY A;  1ZOB A;  1ASA A;  3DC1 A;  1V2F A;  4A6R A;  1LS3 A;  3FZ6 A;  1LKC A;  3FTB A;  4XAU A;  2RFV A;  2VI8 A;  3NDN A;  4LNJ A;  2HUI A;  4WLJ A;  3N7N A;  1BJO A;  5EUD A;  3DOD A;  1E5F A;  2HZP A;  3ATH A;  2VLF A;  2HOY A;  2W7K A;  3BWN A;  2ZSM A;  3PDB B;  4ITG A;  3JZL A;  4OC9 A;  1ASE A;  2GMS A;  4A0R A;  3A8U X;  3EI5 A;  1C4K A;  3E2F A;  3HVY A;  1WST A;  4PFN A;  2JIS A;  4XK1 A;  3E2Z A;  4ZSW A;  3N4R A;  3EI9 A;  4AH3 A;  1B9H A;  3EIB A;  1S08 A;  4KYO A;  1WYU B;  2TPL A;  2W7M A;  1N8P A;  2JJF A;  4ADB A;  3BN1 A;  1Z7D A;  1CQ6 A;  4BA5 A;  4MKK A;  1OHW A;  3JWA A;  3HBX A;  1C7O A;  1ARS A;  3B46 A;  3BC8 A;  3LWS A;  4RJ0 A;  4Y0H A;  2X5D A;  2JJG A;  5FT5 A;  5M4B A;  4XJP A;  3DU4 A;  3RCH B;  1H1C A;  1KKP A;  1D2F A;  2XBN A;  3DYD A;  3N0L A;  4GE7 A;  3HT4 A;  4F5H A;  2EZ1 A;  3BCB A;  1M0P A;  2R0T A;  3G7Q A;  5TF5 A;  4JE5 D;  4OT8 A;  4E1O A;  3PJ0 A;  2AY5 A;  3BB8 A;  3FZ7 A;  3N75 A;  3PD6 A;  1M0Q A;  3AEO A;  3IF2 A;  1DJE A;  4FFC A;  1E5E A;  3QN6 A;  1WYT A;  1AY8 A;  2O1B A;  1UKJ A;  2W7J A;  3GZC A;  1QJ3 A;  4AO9 A;  2Z1Z A;  2VGS A;  2PO3 A;  2X8U A;  4WYF A;  2OAT A;  5IWQ A;  1DJ9 A;  3FKD A;  3RBL A;  2D64 A;  1MLY A;  1LC8 A;  1QZ9 A;  4JEX A;  1GD9 A;  4WLH A;  3WCN A;  1SZK A;  2VMO A;  1AHY A;  1LC5 A;  3N4S A;  2AY9 A;  4W91 A;  3PDB A;  2AAT A;  4CXQ A;  3WKR A;  1ASM A;  3D6K A;  3EI6 A;  4ADD A;  1AHE A;  3MAF B;  1AAM A;  3VK3 A;  1OHV A;  3OKS A;  2QLR A;  1WKH A;  3DZZ A;  5D5S A;  4WB0 B;  3NUI A;  5G2P A;  3UAK A;  1FC4 A;  3RI6 A;  1LW4 A;  1DTY A;  2VMV A;  3NNK A;  3I16 A;  1WYU A;  3AOW A;  4RAE A;  5G0A A;  1SF2 A;  2EZ2 A;  2CIN A;  4XQ2 A;  4P3M A;  1EQB A;  3CQ4 A;  4JEW A;  3QBO A;  1X0M A;  1OAT A;  1C7G A;  4Y0D A;  1I43 A;  2EO5 A;  3RCH A;  2HOX A;  2FYF A;  5G4I A;  4R5Z A;  1YNU A;  3FFH A;  1V72 A;  4WXB A;  1MDO A;  2JJE A;  1AKC A;  1DJU A;  1JS6 A;  4Q75 A;  3A9X A;  1D7U A;  3P1T A;  4XEW A;  3VOM A;  4ZAH A;  4ZM4 A;  3FDD A;  4IW7 A;  2ZY4 A;  2HUU A;  4MQQ A;  2FM1 A;  1B8G A;  2YCT A;  5F9S A;  2BWN A;  3A2B A;  3MC6 A;  1J04 A;  3NX3 A;  1G7X A;  2VGW A;  1M6S A;  1GC2 A;  3JW9 A;  1ELQ A;  3Q8N A;  3LVJ A;  4FL0 A;  4BA4 A;  1C9C A;  3AEJ A;  1BT4 A;  4A00 A;  3F0H A;  3GSB A;  2V0Y A;  2ZJG A;  2QMA A;  2D66 A;  1Z3Z A;  3TCM A;  3KE3 A;  1TPL A;  5JAY A;  2QB3 A;  4UHN A;  1CQ7 A;  4IXO A;  1Y4I A;  4M2K A;  4K05 A;  3MAF A;  1RV4 A;  5EUN A;  3GZD A;  2DOU A;  2W8J A;  2FN6 A;  2O0R A;  4W1V A;  2AY2 A;  2W7L A;  4WYC A;  1IAX A;  3E2Y A;  3B1D A;  4DGT A;  1TOE A;  1W7M A;  2WK7 A;  1S07 A;  1X28 A;  3PDX A;  4LC3 A;  1KAF A;  1BS0 A;  3EZS A;  4E3Q A;  2Z1Y A;  1VJO A;  3RQ1 A;  1AHX A;  4WYD A;  4XJL A;  1M32 A;  2BIG A;  4GE9 A;  1TAR A;  4ISY A;  2YRI A;  4EB5 A;  1AIA A;  2WKA A;  1YOO A;  3IHJ A;  4GE4 A;  1O62 A;  3JU7 A;  4F5G A;  1ARH A;  1GEY A;  3FD0 A;  1DKA A;  4IX8 A;  2AY1 A;  4F5K A;  2FNU A;  3BCX A;  4A72 A;  2HOZ A;  2HUF A;  4AZJ A;  4OTL A;  2ORD A;  3DXW A;  3NYS A;  4ZDL A;  2BI5 A;  1RV3 A;  3AOV A;  1ECX A;  4ZDP A;  3LVL B;  2VMX A;  2YKV A;  4ATP A;  2OKJ A;  1IVR A;  3E6G A;  3GBX A;  4TMR A;  5FT4 A;  1JG8 A;  3FVU A;  4ZLV A;  1BQA A;  3GJU A;  1BJ4 A;  3GWP A;  2Z61 A;  4CVQ A;  1W7L A;  4R5F A;  3B1C A;  4EU1 A;  1LW5 A;  2R5E A;  2VYC A;  1AAW A;  3B1E A;  4RIT A;  1ASN A;  3DRD A;  1ASL A;  5BJ4 A;  4IXZ A;  2CJH A;  1XI9 A;  2VMS A;  3BV0 A;  3FFR A;  1S0A A;  1ASF A;  4JF1 A;  1IAY A;  1SFF A;  3BS8 A;  4WBT A;  2AEV A;  3AEN A;  4GEB A;  1M0O A;  2BHX A;  2WB6 A;  4TN4 A;  1O61 A;  5LH9 A;  3WZF A;  3E9K A;  4Q76 A;  2VGZ A;  1UU2 A;  3TQX A;  5KTB A;  4KXK A;  1PFF A;  1ELU A;  3TFU A;  3QI6 A;  1WYV B;  2BYJ A;  2D61 A;  3CQ5 A;  5DX5 A;  1O4S A;  4MQP A;  3ISL A;  1AKA A;  3EI8 A;  4ZSY A;  3CBF A;  3TAT A;  4CBR A;  1IX8 A;  4WXF A;  2EGY A;  3H9X A;  4AZK A;  2VMU A;  5J8Q A;  1QGN A;  5G09 A;  1CS1 A;  1GC3 A;  2DKB A;  2D7Y A;  3FQA A;  1GDE A;  1T3I A;  3LG0 A;  2C81 A;  9AAT A;  1VP4 A;  4AOA A;  1B5P A;  4ZAS A;  2E7J A;  2CAN A;  2W8U A;  4WP0 A;  2GB3 A;  2JG2 A;  2QBT A;  3AEP A;  4LNM A;  1CZC A;  3ZZJ A;  2EPJ A;  5E3K A;  2CH2 A;  2Z9U A;  4RIZ A;  5M46 A;  2R2N A;  4F5J A;  1ART A;  2QSR A;  2E7U A;  3ELP A;  3BWN C;  3QPG A;  4K2B A;  2VGU A;  3AEL A;  2DR1 A;  4W8I A;  2CTZ A;  1ASD A;  1SZS A;  3DR7 A;  1AX4 A;  3JTX A;  3LVK A;  2QB2 A;  5BJ3 A;  2CFB A;  4RKD A;  4EMY A;  2VGV A;  3K40 A;  1KL1 A;  4Y0I A;  3PA9 A;  4BMK A;  3LY1 A;  1I48 A;  2VIB A;  4J5U A;  1YIZ A;  1RVU A;  2YRR A;  1AIB A;  3QM2 A;  4TV7 A;  2VMQ A;  4UQV A;  1TOK A;  5EAV A;  1U08 A;  2C0R A;  3HQT A;  2BKW A;  4QGR A;  1AJS B;  2OQX A;  3PPL A;  1AMQ A;  2OGE A;  4DQ6 A;  3F6T A;  3AAT A;  3NTJ A;  2A1V A;  1SVV A;  2D65 A;  5HHY A;  2XH1 A;  5HDM A;  3ECD A;  2YKU A;  2R5C B;  2QA3 A;  1AMS A;  1I41 A;  1O69 A;  4L0O A;  3F9T A;  2HP1 A;  2W7G A;  5FT6 A;  3RBF A;  1D7R A;  3MAD A;  1WYV A;  2VGT A;  4DBC A;  1AY5 A;  3H7F A;  2FNI A;  3PAA A;  1ORD A;  1IBJ A;  1V2E A;  5EAA A;  3BCA A;  4R2N A;  3AV7 A;  4A6T A;  1TOJ A;  2V1P A;  2C44 A;  1J32 A;  3ELE A;  3K7Y A;  3VAX A;  3ASA A;  2G7J A;  2Z9W A;  1QIT A;  2W7I A;  2PB0 A;  2ZP7 A;  1S09 A;  2BI1 A;  3KGX A;  1M7Y A;  4JE5 A;  3FQ7 A;  3NRA A;  1LC7 A;  1H0C A;  1UU0 A;  1KMK A;  3NU7 A;  1YIY A;  4A0G A;  1GC0 A;  2DGL A;  2Z9X A;  3ZZK A;  3HLM A;  3EZ1 A;  4ZM3 A;  3BWO A;  2ZY5 A;  1MAP A;  4WB0 A;  1X2A A;  5G2Q A;  4A0H A;  4B98 A;  2VMP A;  2BWP A;  3B8X A;  4WYE A;  4OBV A;  2AY4 A;  4EB7 A;  2YKX A;  4JEV A;  3TFT A;  2WK8 A;  3R9A A;  1OXP A;  3KKI A;  2Z20 A;  5EIG B;  2Q7W A;  5I92 A;  2VI9 A;  1M0N A;  2VMW A;  4RKC A;  1ASC A;  3GET A;  3MAU A;  3I4J A;  4OBU A;  1I29 A;  3N5M A;  3A9Y A;  4RJY A;  4ITX A;  4XJM A;  3N4X A;  2YHK A;  4W1W A;  1KKJ A;  3ASB A;  2ZYJ A;  2AEU A;  1RVY A;  1YAA A;  3PD6 B;  1IUG A;  4P7Y A;  3UE8 A;  5C6U A;  2ZC0 A;  4ADE A;  2GMU A;  2AY8 A;  3HDO A;  2YKY A;  1AJS A;  3L8A A;  4MY5 A;  3WY7 A;  3UWC A;  1OHY A;  1N2T A;  4H63 Q;  5E5I A;  2ZUK A;  3JWB A;  1DGD A;  3DR4 A;  3EI7 A;  3WLX A;  1QJ5 A;  2E7I A;  2R5C A;  1GCK A;  2Z9V A;  3AEM C;  5FT8 A;  3DXV A;  1GEW A;  1ZOD A;  2ZSL A;  5M4D A;  2JJH A;  1MLZ A;  3QGU A;  4OMA A;  1QIS A;  5DJ1 A;  4WYA A;  2ZY2 A;  3WX9 A;  2VMT A;  3LVM A;  4LW4 A;  1CZE A;  1JS3 A;  3MC6 C;  1IX7 A;  1CL1 A;  3CAI A;  1B4X A;  4RM1 A;  3VK4 A; 
#chains in the Genus database with same CATH homology
 1GC4 A;  2WK9 A;  4XJO A;  3FZ8 A;  4E77 A;  4M2J A;  1G7W A;  1AY4 A;  1DFO A;  3FVX A;  3QHX A;  5F8V A;  3AEJ C;  4K2I A;  3ACZ A;  4PFF A;  2YCP A;  3FDB A;  2OGA A;  2W7D A;  1KMJ A;  1MAQ A;  2EH6 A;  1AKB A;  3A9Z A;  3NU8 A;  2KFP A;  4MQR A;  2VLH A;  2W7E A;  4U2H A;  4UOY A;  1TAS A;  2CB1 A;  2F8J A;  1P3W A;  3CQ6 A;  3WGB A;  7AAT A;  2W8W A;  3GZD C;  2BI9 A;  4E3R A;  4IYO B;  1PMO A;  2BI2 A;  5EIG A;  1AIC A;  1PMM A;  4BQ0 A;  4WYG A;  1KL2 A;  1TOI A;  1C7N A;  2Z67 A;  4CBS A;  3K28 A;  5LHA A;  3GR9 A;  4HF8 A;  1ARG A;  3R4T A;  3EIA A;  4IXS A;  3FVS A;  2FKI A;  1GBN A;  4Q31 A;  1VEF A;  4LW2 A;  4OYT A;  2W7F A;  1W23 A;  1BQD A;  4PIW A;  2YCN A;  2HOR A;  2EYQ A;  4AO4 A;  1ASG A;  3W1I A;  1BJW A;  4O6Z A;  2AY6 A;  4B9B A;  3MKJ A;  4M2M A;  1AJR A;  1LK9 A;  3FQ8 A;  4A0F A;  4N0W A;  4ZDO A;  1BKG A;  2GSA A;  1QIR A;  1XEY A;  4RLG A;  1ARI A;  4F4E A;  3OP7 A;  3KGW A;  4F5F A;  5M49 A;  8AAT A;  4ATQ A;  4LNL A;  2VMN A;  4MGR A;  4CXR A;  3FCR A;  4WD2 A;  1TAT A;  5K8B A;  3I5T A;  4W5K A;  3L44 A;  5DJ9 A;  1JF9 A;  2NMP A;  3EUC A;  1OXO A;  2YOB A;  3MEB A;  3NUB A;  4GRX A;  1ZC9 A;  5DB5 A;  4U1T A;  3VK2 A;  2VIA A;  3P6K A;  4F5M A;  3G8M A;  1TOG A;  4Q6R A;  5D95 A;  4UHM A;  1D7V A;  3NYT A;  2W8T A;  2D63 A;  1V2D A;  4H51 A;  1YJZ A;  2BIE A;  3MBB A;  1ASB A;  1EG5 A;  1MDZ A;  2D5Y A;  5G4J A;  3WGC A;  1BJO B;  3NYU A;  2BIA A;  3ZRR A;  4EFF A;  2CH1 A;  2HP2 A;  4K2M A;  5EUE A;  4UHO A;  3T32 A;  1GEX A;  4ZWV A;  4IYO A;  4ADC A;  3HL2 A;  3FSL A;  4J8L A;  2W8V A;  2X5F A;  2W7H A;  1DGE A;  1SPA A;  2X3L A;  5E4Z A;  3AEM A;  3LV2 A;  4F5I A;  4HVK A;  4I8A A;  3W1J A;  1WKG A;  2BYL A;  3E77 A;  3RUY A;  1C0N A;  2VMY A;  2CJD A;  1AHF A;  1BW0 A;  1AMR A;  1X29 A;  3E2Z B;  2C7T A;  2CJG A;  3COG A;  3G0T A;  3FRK A;  4MKJ A;  3USF A;  3ZRP A;  1W7N A;  4W1X A;  2AY7 A;  2BWO A;  1D7S A;  2AY3 A;  4GDY A;  1G4V A;  4R8D A;  4MSO A;  4OCA A;  1MDX A;  1IJI A;  5HXX A;  2BI3 A;  3II0 A;  1S06 A;  2D7Z A;  1YJS A;  5EFS A;  1YJY A;  1FG3 A;  2PB2 A;  1FG7 A;  2CY8 A;  2ZY3 A;  2DKJ A;  4PVF A;  5EQC A;  1IX6 A;  4GSA A;  3VP6 A;  2E54 A;  3H14 A;  1PG8 A;  4JF0 A;  3W1H A;  3M5U A;  1B9I A;  2DGM A;  2OKK A;  3WKS A;  4A6U A;  1G4X A;  3PIU A;  4KAM A;  4F5L A;  2O7C A;  2VMZ A;  5AX8 A;  2DGK A;  3WCO A;  2JGT A;  1EJI A;  2G6W A;  4JEZ A;  4NOG A;  1N31 A;  2FQ6 A;  3HMU A;  4ZWM A;  4BHD A;  3PGY A;  4N0B A;  4WXG A;  1M4N A;  1BJN A;  1UU1 A;  3AEN B;  4IY7 A;  1WYT B;  1AMA A;  1AHG A;  3ZRQ A;  2VMR A;  1CJ0 A;  1SZU A;  1B5O A;  2GQN A;  1MGV A;  1CQ8 A;  1W3U A;  1CL2 A;  2CST A;  4JEY A;  1ZOB A;  1ASA A;  3DC1 A;  1V2F A;  4A6R A;  1LS3 A;  3FZ6 A;  1LKC A;  3FTB A;  4XAU A;  2RFV A;  2VI8 A;  3NDN A;  4LNJ A;  2HUI A;  4WLJ A;  3N7N A;  1BJO A;  5EUD A;  3DOD A;  1E5F A;  2HZP A;  3ATH A;  2VLF A;  2HOY A;  2W7K A;  3BWN A;  2ZSM A;  3PDB B;  4ITG A;  3JZL A;  4OC9 A;  1ASE A;  2GMS A;  4A0R A;  3A8U X;  3EI5 A;  1C4K A;  3E2F A;  3HVY A;  1WST A;  4PFN A;  2JIS A;  4XK1 A;  3E2Z A;  4ZSW A;  3N4R A;  3EI9 A;  4AH3 A;  1B9H A;  3EIB A;  1S08 A;  4KYO A;  1WYU B;  2TPL A;  2W7M A;  1N8P A;  2JJF A;  4ADB A;  3BN1 A;  1Z7D A;  1CQ6 A;  4BA5 A;  4MKK A;  1OHW A;  3JWA A;  3HBX A;  1C7O A;  1ARS A;  3B46 A;  3BC8 A;  3LWS A;  4RJ0 A;  4Y0H A;  2X5D A;  2JJG A;  5FT5 A;  5M4B A;  4XJP A;  3DU4 A;  3RCH B;  1H1C A;  1KKP A;  1D2F A;  2XBN A;  3DYD A;  3N0L A;  4GE7 A;  3HT4 A;  4F5H A;  2EZ1 A;  3BCB A;  1M0P A;  2R0T A;  3G7Q A;  5TF5 A;  4JE5 D;  4OT8 A;  4E1O A;  3PJ0 A;  2AY5 A;  3BB8 A;  3FZ7 A;  3N75 A;  3PD6 A;  1M0Q A;  3AEO A;  3IF2 A;  1DJE A;  4FFC A;  1E5E A;  3QN6 A;  1WYT A;  1AY8 A;  2O1B A;  1UKJ A;  2W7J A;  3GZC A;  1QJ3 A;  4AO9 A;  2Z1Z A;  2VGS A;  2PO3 A;  2X8U A;  4WYF A;  2OAT A;  5IWQ A;  1DJ9 A;  3FKD A;  3RBL A;  2D64 A;  1MLY A;  1LC8 A;  1QZ9 A;  4JEX A;  1GD9 A;  4WLH A;  3WCN A;  1SZK A;  2VMO A;  1AHY A;  1LC5 A;  3N4S A;  2AY9 A;  4W91 A;  3PDB A;  2AAT A;  4CXQ A;  3WKR A;  1ASM A;  3D6K A;  3EI6 A;  4ADD A;  1AHE A;  3MAF B;  1AAM A;  3VK3 A;  1OHV A;  3OKS A;  2QLR A;  1WKH A;  3DZZ A;  5D5S A;  4WB0 B;  3NUI A;  5G2P A;  3UAK A;  1FC4 A;  3RI6 A;  1LW4 A;  1DTY A;  2VMV A;  3NNK A;  3I16 A;  1WYU A;  3AOW A;  4RAE A;  5G0A A;  1SF2 A;  2EZ2 A;  2CIN A;  4XQ2 A;  4P3M A;  1EQB A;  3CQ4 A;  4JEW A;  3QBO A;  1X0M A;  1OAT A;  1C7G A;  4Y0D A;  1I43 A;  2EO5 A;  3RCH A;  2HOX A;  2FYF A;  5G4I A;  4R5Z A;  1YNU A;  3FFH A;  1V72 A;  4WXB A;  1MDO A;  2JJE A;  1AKC A;  1DJU A;  1JS6 A;  4Q75 A;  3A9X A;  1D7U A;  3P1T A;  4XEW A;  3VOM A;  4ZAH A;  4ZM4 A;  3FDD A;  4IW7 A;  2ZY4 A;  2HUU A;  4MQQ A;  2FM1 A;  1B8G A;  2YCT A;  5F9S A;  2BWN A;  3A2B A;  3MC6 A;  1J04 A;  3NX3 A;  1G7X A;  2VGW A;  1M6S A;  1GC2 A;  3JW9 A;  1ELQ A;  3Q8N A;  3LVJ A;  4FL0 A;  4BA4 A;  1C9C A;  3AEJ A;  1BT4 A;  4A00 A;  3F0H A;  3GSB A;  2V0Y A;  2ZJG A;  2QMA A;  2D66 A;  1Z3Z A;  3TCM A;  3KE3 A;  1TPL A;  5JAY A;  2QB3 A;  4UHN A;  1CQ7 A;  4IXO A;  1Y4I A;  4M2K A;  4K05 A;  3MAF A;  1RV4 A;  5EUN A;  3GZD A;  2DOU A;  2W8J A;  2FN6 A;  2O0R A;  4W1V A;  2AY2 A;  2W7L A;  4WYC A;  1IAX A;  3E2Y A;  3B1D A;  4DGT A;  1TOE A;  1W7M A;  2WK7 A;  1S07 A;  1X28 A;  3PDX A;  4LC3 A;  1BS0 A;  3EZS A;  4E3Q A;  2Z1Y A;  1VJO A;  3RQ1 A;  1AHX A;  4WYD A;  4XJL A;  1M32 A;  2BIG A;  4GE9 A;  1TAR A;  4ISY A;  2YRI A;  4EB5 A;  1AIA A;  2WKA A;  1YOO A;  3IHJ A;  4GE4 A;  1O62 A;  3JU7 A;  4F5G A;  1ARH A;  1GEY A;  3FD0 A;  1DKA A;  4IX8 A;  2AY1 A;  4F5K A;  2FNU A;  3BCX A;  4A72 A;  2HOZ A;  2HUF A;  4AZJ A;  4OTL A;  2ORD A;  3DXW A;  3NYS A;  4ZDL A;  2BI5 A;  1RV3 A;  3AOV A;  1ECX A;  4ZDP A;  3LVL B;  2VMX A;  2YKV A;  4ATP A;  2OKJ A;  1IVR A;  3E6G A;  3GBX A;  4TMR A;  5FT4 A;  1JG8 A;  3FVU A;  4ZLV A;  1BQA A;  3GJU A;  1BJ4 A;  3GWP A;  2Z61 A;  4CVQ A;  1W7L A;  4R5F A;  3B1C A;  4EU1 A;  1LW5 A;  2R5E A;  2VYC A;  1AAW A;  3B1E A;  4RIT A;  1ASN A;  3DRD A;  1ASL A;  5BJ4 A;  4IXZ A;  2CJH A;  1XI9 A;  2VMS A;  3BV0 A;  3FFR A;  1S0A A;  1ASF A;  4JF1 A;  1IAY A;  1SFF A;  3BS8 A;  4WBT A;  2AEV A;  3AEN A;  4GEB A;  1M0O A;  2BHX A;  2WB6 A;  4TN4 A;  1O61 A;  5LH9 A;  3WZF A;  3E9K A;  4Q76 A;  2VGZ A;  1UU2 A;  3TQX A;  5KTB A;  4KXK A;  1PFF A;  1ELU A;  3TFU A;  3QI6 A;  1WYV B;  2BYJ A;  2D61 A;  3CQ5 A;  5DX5 A;  1O4S A;  4MQP A;  3ISL A;  1AKA A;  3EI8 A;  4ZSY A;  3CBF A;  3TAT A;  4CBR A;  1IX8 A;  4WXF A;  2EGY A;  3H9X A;  4AZK A;  2VMU A;  5J8Q A;  1QGN A;  5G09 A;  1CS1 A;  1GC3 A;  2DKB A;  2D7Y A;  3FQA A;  1GDE A;  1T3I A;  3LG0 A;  2C81 A;  9AAT A;  1VP4 A;  4AOA A;  1B5P A;  4ZAS A;  2E7J A;  2CAN A;  2W8U A;  4WP0 A;  2GB3 A;  2JG2 A;  2QBT A;  3AEP A;  4LNM A;  1CZC A;  3ZZJ A;  2EPJ A;  5E3K A;  2CH2 A;  2Z9U A;  4RIZ A;  5M46 A;  2R2N A;  4F5J A;  1ART A;  2QSR A;  2E7U A;  3ELP A;  3BWN C;  3QPG A;  4K2B A;  2VGU A;  3AEL A;  2DR1 A;  4W8I A;  2CTZ A;  1ASD A;  1SZS A;  3DR7 A;  1AX4 A;  3JTX A;  3LVK A;  2QB2 A;  5BJ3 A;  2CFB A;  4RKD A;  4EMY A;  2VGV A;  3K40 A;  1KL1 A;  4Y0I A;  3PA9 A;  4BMK A;  3LY1 A;  1I48 A;  2VIB A;  4J5U A;  1YIZ A;  1RVU A;  2YRR A;  1AIB A;  3QM2 A;  4TV7 A;  2VMQ A;  4UQV A;  1TOK A;  5EAV A;  1U08 A;  2C0R A;  3HQT A;  2BKW A;  4QGR A;  1AJS B;  2OQX A;  3PPL A;  1AMQ A;  2OGE A;  4DQ6 A;  3F6T A;  3AAT A;  3NTJ A;  2A1V A;  1SVV A;  2D65 A;  5HHY A;  2XH1 A;  5HDM A;  3ECD A;  2YKU A;  2R5C B;  2QA3 A;  1AMS A;  1I41 A;  1O69 A;  4L0O A;  3F9T A;  2HP1 A;  2W7G A;  5FT6 A;  3RBF A;  1D7R A;  3MAD A;  1WYV A;  2VGT A;  4DBC A;  1AY5 A;  3H7F A;  2FNI A;  3PAA A;  1ORD A;  1IBJ A;  1V2E A;  5EAA A;  3BCA A;  4R2N A;  3AV7 A;  4A6T A;  1TOJ A;  2V1P A;  2C44 A;  1J32 A;  3ELE A;  3K7Y A;  3VAX A;  3ASA A;  2G7J A;  2Z9W A;  1QIT A;  2W7I A;  2PB0 A;  2ZP7 A;  1S09 A;  2BI1 A;  3KGX A;  1M7Y A;  4JE5 A;  3FQ7 A;  3NRA A;  1LC7 A;  1H0C A;  1UU0 A;  1KMK A;  3NU7 A;  1YIY A;  4A0G A;  1GC0 A;  2DGL A;  2Z9X A;  3ZZK A;  3HLM A;  3EZ1 A;  4ZM3 A;  3BWO A;  2ZY5 A;  1MAP A;  4WB0 A;  1X2A A;  5G2Q A;  4A0H A;  4B98 A;  2VMP A;  2BWP A;  3B8X A;  4WYE A;  4OBV A;  2AY4 A;  4EB7 A;  2YKX A;  4JEV A;  3TFT A;  2WK8 A;  3R9A A;  1OXP A;  3KKI A;  2Z20 A;  5EIG B;  2Q7W A;  5I92 A;  2VI9 A;  1M0N A;  2VMW A;  4RKC A;  1ASC A;  3GET A;  3MAU A;  3I4J A;  4OBU A;  1I29 A;  3N5M A;  3A9Y A;  4RJY A;  4ITX A;  4XJM A;  3N4X A;  2YHK A;  4W1W A;  1KKJ A;  3ASB A;  2ZYJ A;  2AEU A;  1RVY A;  1YAA A;  3PD6 B;  1IUG A;  4P7Y A;  3UE8 A;  5C6U A;  2ZC0 A;  4ADE A;  2GMU A;  2AY8 A;  3HDO A;  2YKY A;  1AJS A;  3L8A A;  4MY5 A;  3WY7 A;  3UWC A;  1OHY A;  1N2T A;  4H63 Q;  5E5I A;  2ZUK A;  3JWB A;  1DGD A;  3DR4 A;  3EI7 A;  3WLX A;  1QJ5 A;  2E7I A;  2R5C A;  1GCK A;  2Z9V A;  3AEM C;  5FT8 A;  3DXV A;  1GEW A;  1ZOD A;  2ZSL A;  5M4D A;  2JJH A;  1MLZ A;  3QGU A;  4OMA A;  1QIS A;  5DJ1 A;  4WYA A;  2ZY2 A;  3WX9 A;  2VMT A;  3LVM A;  4LW4 A;  1CZE A;  1JS3 A;  3MC6 C;  1IX7 A;  1CL1 A;  3CAI A;  1B4X A;  4RM1 A;  3VK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...