4BA9A

The structural basis for the coordination of y-family translesion dna polymerases by rev1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
114
structure length
104
Chain Sequence
GPHMHKKSFFDKKRSERASNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structural Basis for the Coordination of Y- Family Translesion DNA Polymerases by Rev1
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords DNA POLYMERASE KAPPA, DNA REPAIR PROTEIN REV1
total genus 40
structure length 104
sequence length 114
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4ba9A00
2LSIA 2LSGA 3VU7H 2N1GA 2LSYA 4GK0E 4BA9A 4FJOA 2LSJA 4GK5E 4EXTA 2LSKA
chains in the Genus database with same CATH superfamily
2D0UA 2LOSA 4ILAA 5JVDE 3ZYMA 1XDOA 1GQEA 1D0YA 2QRXA 5DQWA 1G8XA 1N34T 2E2AA 1XMOT 3PTRB 4WZXA 5AFUL 5ABFB 2BKNA 2I6HA 4OFZA 3OJAA 4YTNA 4U72A 5FL1A 3AB3B 3UU5A 3HI2A 2XAJB 2WB5A 5C2TA 1T7SA 2WZIA 4H9PC 2H3RA 2ZM2A 3OKQA 3UU8A 1BR0A 1OEDC 2CM0A 2E9XB 3PUSA 1W9RA 1ZOYA 4M1PA 3VKHA 3L8RA 3UU6A 3F31A 2X0YA 4KUMB 4I43B 5IHYA 2Q9QB 4HGAA 2LKGA 1KEYA 3UUBA 2SPCA 3UULA 5KMGP 4DV5T 3K3NA 2YK0A 4WBOA 3OYXA 2HHHT 1NEKA 3I9WA 4I0UA 4NXNT 3FHNA 3FZKB 5FYMA 1HX8A 5GONE 3U78A 4HWCA 4YLHA 4IHJE 3AXJB 1HG2A 1YQ3A 3CQGB 1D0ZA 1XWMA 1SA0E 2BG9C 3N9QA 3NZQA 4P1NA 4U2YA 1R8IA 1AJ3A 1LKXA 2L8KA 1U4QA 3RRWA 5IUXA 3H37A 3EAMA 5FMNA 2BDEA 2LOPA 2X9HA 1Z8UA 3KV4A 4IDZA 3K3QC 2LT3A 4GIWA 4X20E 1DU2A 3O1IA 4XAXB 4HWIB 4JEHB 5AQRB 4CN1A 3CX8B 2VQFT 1HR0T 3J7Yq 3RKGA 2XSAA 4PFPA 2HPLA 2NTYA 4JI4T 2JMHA 2V7IA 5LMNT 5AQTB 2DLRA 2YDRA 4P0BA 3FBLA 2LSGA 2PG8A 4YSXA 3LFMA 4WBNE 1IBMT 2XAQB 2FJEA 4TX5A 3ZYLA 4HWDA 3RC8A 2BG9A 3F2EA 3L09A 4IE6A 5ABFA 4DBQA 5ABEA 3TLUA 4JYAT 4EB6E 2BS3A 2CWOA 3RC3A 5J1GA 3I0QA 2CA5A 3N2GE 3KBTA 1XNQT 3O1JA 5AQNB 1KFYA 2B76A 3AE4A 3HKDE 3MXZA 4TN7B 4EXTA 4DV6T 3S4UA 2LKHA 2X0HA 5L3BB 2BS2A 2V26A 2Y8DA 4DUZT 3CX7B 5HEOA 2NR4A 4YJ2E 5J2TE 4YSYA 2MTQA 4IREA 5LGTB 2W00A 4U33A 3CMLA 3DP7A 3RYHE 4X1IE 2VL0A 2XQ9A 2W4XA 3UUNA 4CXWA 3BQKA 4IDQA 3LJCA 2J47A 2BZBA 2EHOD 2WP9A 4E7ZA 5LXTE 3AEAA 2L9QA 4YHHT 4DV7T 2LHNA 4H63H 5AQIB 5LCYA 3NKZA 4AI6A 3QNUA 3AAIA 1LVFA 4UR9A 2VVSA 3AE8A 4OX9T 2H89A 3C50A 3H3AA 4LMKA 1XMQT 2NTXA 1FJGT 2BS4A 3C51A 2BVLA 2FJDA 2YDQA 4QX7B 2XQYA 3AE3A 3SFEA 4LFBT 2CLYC 2ES0A 3NZPA 4MBQA 5L3FB 4AQFC 3ZT6A 3FXEB 3AEDA 3H3MA 3Q5DA 3QOFA 4ILCA 5FXVA 2W67A 3RIUA 5HXCA 4A98A 2XQ4A 2BVMA 5AQHB 3ZN1B 1WYCA 1I6ZA 2LHRA 4B3ST 2Z6EA 4L9IA 2QVAA 5AQUB 3ZYKA 1SE7A 3AEGA 3ONJA 2QA7A 2WDVA 1OXZA 3DJBA 5TAOA 3RKOA 2JMKA 2JJ9A 3IBPA 3L39A 4KHZF 4UXNB 2NW9A 5J0ZA 4UIGA 3JC6C 2DWGA 2KINB 3K8PC 3LK2B 4BA9A 3CK6A 3LG7A 4HFEA 2H7VC 3BK9A 4U2ZA 2BKPA 5BMVE 3MKDA 3AVRA 2K3WA 1EZ3A 3AE2A 3C4WA 1OEDB 3FZFB 3NVOA 5JR9A 1WR0A 2KWHA 3VRAA 2H7OA 1HNXT 4DMVA 4G2AA 3ZT7A 3A5XA 2UXBT 2XQ7A 5FXZA 4IT4A 3N9LA 2C5IT 1W0BA 5FY1A 2UUAT 2VKDA 4KBMB 4GKKT 2XUEA 2XQ5A 2Y48B 4LMLA 4AQYT 4B3RT 4K0KT 5L2LA 1MMAA 2CXLA 3AE6A 3ZEFB 3P50A 3AE9A 1N33T 4HFHA 5FNVE 2N2NA 3J9X1 5JREA 1S35A 4ZEYA 3UT5E 2HN2A 2MPKA 2LM9A 3P7IA 1WFDA 2ODVA 2V6YB 1YQ4A 4YFSA 3VRBA 4HFBA 1YKEB 3AA0B 5KDMC 2XM2A 4NXMT 4FJOA 4CI3B 4XBFB 4QH4A 5HEHA 5HEGA 3K3OA 4NUVA 4ISTA 5LOVE 4PW8A 3ZT5A 3ESLA 4JUYA 4O2BE 4AKGA 4EAHA 2CHNA 2WZHA 2VL8A 4ZS3A 4B6XA 2VKJA 1Z0PA 3GMIA 3PUWF 3AE7A 3I1AA 3N2OA 2IC6A 3N9OA 4HKAA 2J62A 1HFAA 2KNDA 1IJ6A 3RYCE 4DR6T 3VU7H 2NWBA 4X64T 3OPCA 2WY2A 2ZMAA 4I50E 2CPTA 2IMLA 2VQET 4U7IA 2PTFA 4ILBA 3AEBA 2ACZA 3R84B 1YXRA 2VWAA 2J4GA 2D0TA 5HCJA 3PU3A 2JQHA 4JI2T 1VCTA 3IEEA 4IDOA 5H6QB 5FY0A 3HKBE 4BJMA 5BR8T 3ZJ1A 1IBLT 4Z8XA 4LFCT 3RPUA 4X1YE 4WW0A 1BR2A 3AECA 1HS7A 4LMJA 3EHZA 1UX4A 4CXXA 4IDNA 3CKDA 4XZCA 5LA6E 2FUPA 2WQYA 5JDQA 2YOEA 3AA7B 3V5SA 4A97A 3O1HA 4AQFA 4AKIA 2LLYA 2X51A 3B13A 4HFDA 4O4JE 3G06A 5IYZE 3NBXX 5LHIB 3ZCIA 1UK5A 3UQ7A 2DI4A 5JDNA 4YTMA 4TWFA 1KK7A 2W63A 2HN1A 4H9RC 2MAWA 3TKLB 2WU5A 4DV1T 4QX8B 1HG5A 2E9XD 2QYWA 2W2UA 2WBLA 3AE1A 5FVKA 2JPFA 4UEMA 3PU8A 4HFIA 1VCSA 3D0TA 3NRYA 1M7KA 4MALA 4EGWA 5CA0E 2UUCT 2PFVA 5LHGB 4X65T 5HCMA 2L3LA 4IDPA 4HE8A 3P4QA 3PJAJ 1T98A 4ZHQE 3PJAA 5L3EB 4G63A 3KVBA 2KZ7B 3MJXA 4K0UA 5HEUA 3WI3A 2LEHA 1ZHCA 3PUVF 4HWHA 4GYSA 1ZEEA 3T1YT 1CHUA 2XZEA 2YN6A 1HNZT 4EYUA 2LSYA 3PE0A 4YTPA 5CB4E 2XHEB 4JLEA 4AQGA 5JH7E 1VOMA 4EOZB 2QGSA 4HFVA 2KWIB 3RQWA 2J1DG 4UF0A 3CPZA 3CVRA 4EIWA 4B3TT 5JQGE 1E1HB 2BG9B 4QH5A 3TLSA 2Q9QA 5ABHA 2C5JA 2LSJA 4U74A 5HEJA 4IL9A 4ASKA 2K9AA 4UV9B 5ABGA 4EZ4A 4B3MT 4O4LE 1IJ5A 2D2SA 3Q2MA 3PUAA 1O3XA 2M6IA 4ZI7E 4P09A 4X1KE 5JRCB 5JTGA 5LG4A 4DR2T 1NENA 2RP4A 2NW7A 2V6YA 3OTOT 2F4VT 1WCRA 2WU2A 4UVAB 2HPJA 3ZC0A 3P4PA 2W0GA 3FZHB 3GN5A 2WDRA 3I0OA 3I9YA 3K1SA 3LBXA 4TZ4C 2NW8A 2X9XA 5JDFA 4ZI3C 4EV6A 2V6XA 5AQMB 3ZJ2A 3HR0A 4ERRA 5LJMA 3RLFF 3X1DA 4GYRA 1E2AA 3PUGA 4HTEA 4UF0B 2FJBA 1IAPA 3Q9DA 4IE5A 3PUQA 4DV4T 2JQ9A 4H9OC 3ZLIA 4ZI2D 5ETWA 1FEWA 1MIVA 3ZSSA 3N9NA 2WWUA 3P4RA 2X67A 2ZM6T 4DNDA 3ZKRA 2ACXA 3A8YC 3F57A 3MACA 4PJJA 4Z91A 5AQVB 3AA1B 2XPKA 3IHRA 1US7B 2CWYA 4GK5E 2A2FX 2W61A 4LF8T 2BG9E 5LG3A 1KNZA 2VKHA 2JQKA 4I4TE 4CI2B 4HFCA 4ADZA 5HXRA 4CZZB 5KX5E 2OV9A 4JV5T 2WAUA 4HWFA 4MFRA 2LRKA 5LMUT 3ANWA 3LK42 3E08A 2BKOA 1MMNA 4E7SA 4DUYT 3ONLC 2CEAA 2DL1A 4GOUA 3TLWA 3RI5A 5AQKB 3RQUA 4A5XA 2LE8A 2V8SV 3ZPOA 1OEDE 3AE5A 3KVAA 3UUMA 5FXXA 4DIDB 5HWXA 3PDYA 3VKGA 3A7MA 5CGMA 2AE9A 3FXDB 4JI3T 4JI5T 5LB7B 2FBWA 5L47A 3JCFA 2XAHB 5EK2A 3EI0A 5C8YE 1ZV4X 4JI1T 1LVKA 1M62A 3VR8A 2VB6A 2HH7A 2VK9A 2VKOA 2CE7A 3JADA 2YINA 5EK4A 1KF6A 3ABVA 4UELA 3IA3A 3SOLA 3MK7C 1J1JA 2CRBA 4TV9E 4TWHA 1SHZC 2A72A 3ANWB 3FZLB 2MBGA 4AKRB 1BR1A 4PJLA 1D1BA 1ZKEA 2V7KA 4IGUA 2Y6XA 4C91A 4DVDA 1W0AA 2M6BA 3UU3A 1S94A 1XDPA 3W15B 3RYFE 1HCIA 1UUSA 3NWIA 3PURA 3PV0F 3ZMUB 3RH3A 1MNEA 2CLYB 1BR4A 3CX6B 4X66T 3ZN0B 3UU4A 2LSIA 4PJMA 4ZZCA 2G0UA 3OVUA 2X66A 3B57A 4EZHA 2WDQA 1WR6A 2JRKA 3U3IA 1MMDA 3NRXA 3HKEE 4YT0A 5C3JA 4MLKA 3CQCB 2ZM8A 3UTKA 4F6RC 3QUJA 4TWDA 3SS1A 2CXFA 3HKCE 2YU2A 3RIUC 4WYVA 4PK5A 2VURA 3JAFA 2XM1A 4YJ3E 3P4WA 4KHPT 2ODUA 2EHOA 1WRDA 2K24A 2CXDA 3FZMB 2C5KT 2JIWA 3QK6A 4H9NC 4QKNA 5H6RB 2P9BA 3ZMZB 4DO0A 4DV3T 3RYIE 4IE0A 4JI0T 3ONXA 4PK4A 3QB5A 4PJNA 5L3GB 2IHR1 2YKSA 3C4XA 4BJNA 4F8HA 4LF4T 1U5PA 2GK9A 4ISSA 2D5UA 3HA4A 1D0XA 4KP3C 5FP3A 1XNRT 3FB2A 2VVNA 2ZM0A 2X68A 4NPPA 3GWHA 5L3CB 1WYBA 3WAJA 2UU9T 4JI8T 3ZMTB 5AQSB 4QXCB 2WM9A 2I59A 3N9PA 3KV9A 2WMNA 3AA6B 1IBKT 1J5WA 3ZCJA 5JDLA 5LHHB 1T72A 3PUZF 1QUUA 5JDMA 3KFWX 5LYJE 5LGNB 3DTOA 4L5GA 3CWZB 2I0MA 5HWYA 5LNKA 2WSSV 4ANJA 1OEDA 2CMRA 3AAAB 3KINB 3KV6A 4JEUB 4PNIA 5JR9B 1XZYA 3M3ZB 2OA5A 4CQIA 3ZMVB 1SUMB 2NOXA 1YD8G 5FL0A 4ZXLA 1KNRA 2XQAA 5L3DB 4LF9T 2UXDT 4QHOA 2W66A 4O8SA 4I55E 2UXXB 1UX5A 3WAKA 3MA9A 3R6NA 2YDSA 4N78D 4QWNB 4TV8E 2KXPB 5DABA 3RF1A 3ZMSB 5LJNA 2LJLA 4X62T 3LK3B 4H63V 2IDOB 4HEAA 4QXBB 2FJAA 2A3DA 4CI1B 3KV5A 5HYAA 3T1HT 1VRBA 4UVCB 2UXCT 2PJQA 3JAEA 5F8PA 2X0LB 3C98B 3E22E 2XY8B 4QH1A 3UFGA 3C64A 4MHCA 1FIOA 3P4SA 2BBHA 3ETVA 4Q25A 3UFEA 5LGUB 4DR7T 1Y64B 3OYZA 4DV2T 4PFOA 5J2UE 2CHOA 4YHJA 4LF7T 1X9BA 2DNXA 1MIWA 2LSKA 2K48A 1H7CA 4H9SE 1T8BA 3KBUA 2IW5B 4A56A 2Q9QC 1UGOA 2BBJA 2XQ6A 2XAGB 4P0AA 4CXYA 2WS3A 1HX1B 4U3CA 1MNDA 3Q5WA 4AISA 3RIAA 4EYYR 5CJ5A 5JR9C 1YW0A 2E9XC 3EUHA 3GA8A 4ILUA 4TUYE 5FVLA 2KMFA 4OHFA 3BQIA 1MMGA 4QXHB 3RX6A 5ADXL 4O4HE 2UUBT 4AXPA 3N5LA 5HXSA 4HN9A 4OYKA 3M65A 5F5WA 4DR1T 2XASB 2A9UA 3FBZA 4CN6A 5AQFB 2LRLA 2XJ7A 3ETUA 2V7LA 2V7MA 2C0SA 1HF8A 1NWMX 3OBVE 1FMWA 4X5TA 3V5UA 4DR4T 2IAKA 2IIUA 1HTJF 2WMOA 5F3JA 4AKHA 1J5ET 2EHOC 4CN4A 1B7TA 3CQXC 4LF6T 3SFDA 4U31A 2E5VA 3Q5XA 1KNPA 3KDSE 4ZI2C 3SRZA 4GKJT 1HNWT 5JDHA 2XAFB 3LDQB 4KMCA 3ZSTA 2B1EA 4L0RA 4PK6A 2KT9A 4GK0E 4OK0A 2W62A 1D1AA 4PAGA 4OYJA 3VR9A 4JI7T 1N32T 4V1Av 5AQJB 1CUNA 5CA1E 1IZNB 2WCAA 2YEVC 2V1DB 1ZP0A 2NP9A 4IIJE 3UQ4A 1L0VA 4EEDA 3AEFA 3BQLA 1X79A 1JNRA 3EDVA 5LBMA 5FKYA 4YSZA 1NAFA 1WLXA 2OLTA 4ZI3D 5CFBA 4LFAT 4LF5T 5LBQB 4TNWA 2KSRA 4Z90A 1MIYA 3TLTA 4BAYB 5A1LA 5HXHA 4DR5T 2YU1A 3LSVA 3SWHA 4DR3T 1YKHB 5DQVA 3O9XA 3N2KE 2RPAA 2DWKA 2IC9A 3E0ZA 3AXJA 5AQGB 1LRZA 1UCUA 5AQQB 1JNZA 4COFA 3CIRA 3RIFA 2DHRA 2Q9QD 2ZLYA 3B5MA 5AQPB 5L4EA 1I94T 3LBXB 4FI5A 5EZYE 5HAXA 5M4YA 3VHLA 2XSBA 3ZC1A 3Q5EA 5EK3A 3PUXF 2N9DA 1W09A 2MOZA 4EEBA 4YXDA 2X9YA 3UUXB 2V5DA 5IWAT 2H88A 3L3PA 3RGLA 4UVBB 3TLVA 3JC6D 5JRCA 5DJQC 5E0OA 1OWAA 4UV8B 3QB5K 3EABA 5AQOB 4AKLA 4DV0T 4KI0F 1V9DA 2EHOB 2N1GA 2PBIA 2V5CA 3HL6A 3T8OA 4DBRA 2K5BB 2KLQA 2AXDS 3AEEA 4NIQA 2X9WA 4WNKA 5FXWA 2D9DA 4C90A 3N9MA 1E7PA 4O4IE 2DCFA 4TNVA 2CBIA 4H9QC 2E8IA 4JBWF 4ZZBA 4AIUA 2M67A 2XQ3A 3EVYA 2LM2A 2XQ8A 1FMVA 4IE4A 4J2CA 3RHWA 4IL4A 3AAEB 4JI6T 2R6GF 2MYSA 2RA1A 2V7JA 3EDUA 5L4HA 5LP6E 4ZOLE 1D1CA 2WWVA 4YY3T 4IE7A 2JQQA 2CCQA 3RRCA 1N36T 5FY7A 3GN5B 2E5LT 3PUYF 3QC9A 5JDGA 2CBJA 5AQLB 4DMWA 1G73A 2E9XA 4KX6A 5KXJA 3O4XE 3MZKB 1Y01A 1UURA 4O2AE 2IUBA 3AVSA 3IF8B 4ZS2A 3C4ZA 2UXNB 3P8CD 4NUUA 1QSDA 1QLBA 2VASA 2XTLA 5HXEA 4U7YA
chains in the Genus database with same CATH topology
2D0UA 2LOSA 5JVDE 3ZYMA 1D0YA 5DQWA 1G8XA 3PTRB 5AFUL 4OFZA 3OJAA 4U72A 3AB3B 3HI2A 2XAJB 4H9PC 2H3RA 2ZM2A 3OKQA 1BR0A 2CM0A 2E9XB 3PUSA 4M1PA 3VKHA 3F31A 4KUMB 4I43B 3UULA 5IHYA 2Q9QB 4HGAA 2SPCA 5KMGP 3K3NA 2YK0A 4WBOA 3OYXA 3I9WA 3FHNA 5FYMA 5GONE 1HX8A 3U78A 4YLHA 5HXEA 4IHJE 1HG2A 4DO0A 3CQGB 1D0ZA 1SA0E 3NZQA 3N9QA 1AJ3A 1LKXA 2L8KA 1U4QA 3RRWA 3H37A 5FMNA 2BDEA 2LOPA 2X9HA 3KV4A 4IDZA 3K3QC 2LT3A 4GIWA 4X20E 3O1IA 4XAXB 4JEHB 3CX8B 3J7Yq 4PFPA 2HPLA 2NTYA 2JMHA 2V7IA 2DLRA 4P0BA 3FBLA 2LSGA 2PG8A 3LFMA 4WBNE 2XAQB 4TX5A 3ZYLA 3RC8A 3F2EA 3L09A 4IE6A 4DBQA 4EB6E 2CWOA 3RC3A 5J1GA 3I0QA 2CA5A 3N2GE 3KBTA 3O1JA 3HKDE 4EXTA 3MXZA 4TN7B 3S4UA 5L3BB 2V26A 2Y8DA 3CX7B 4YJ2E 5J2TE 2MTQA 5LGTB 2W00A 3CMLA 3DP7A 3RYHE 4X1IE 4CXWA 3UUNA 3BQKA 4E7ZA 3LJCA 5LXTE 2BZBA 2EHOD 2L9QA 4AI6A 2LHNA 4H63H 5LCYA 3AAIA 1LVFA 3H3AA 3C50A 2NTXA 3C51A 2BVLA 4QX7B 2XQYA 2CLYC 2ES0A 3NZPA 4MBQA 5L3FB 4AQFC 3FXEB 5FXVA 5HXCA 2BVMA 3ZN1B 1WYCA 2LHRA 2Z6EA 4L9IA 3ZYKA 4F6RC 2QA7A 1OXZA 3DJBA 5TAOA 3RKOA 2JMKA 2JJ9A 3IBPA 4UXNB 2NW9A 4UIGA 3JC6C 2DWGA 2KINB 3K8PC 3LK2B 4BA9A 3LG7A 2H7VC 3BK9A 5BMVE 3MKDA 3AVRA 1EZ3A 3C4WA 5JR9A 2KWHA 2H7OA 4DMVA 4G2AA 3A5XA 5FXZA 5FY1A 3N9LA 2C5IT 2VKDA 4KBMB 2XUEA 2Y48B 5L2LA 1MMAA 2CXLA 3ZEFB 5FNVE 2N2NA 3J9X1 5JREA 1S35A 3UT5E 2LM9A 3P7IA 2ODVA 4YFSA 1YKEB 3AA0B 5KDMC 4FJOA 4CI3B 4XBFB 3K3OA 4NUVA 4ISTA 5LOVE 4PW8A 3ESLA 4JUYA 4O2BE 4AKGA 4EAHA 2VL8A 4ZS3A 4B6XA 2VKJA 1Z0PA 3GMIA 3N2OA 3I1AA 3N9OA 2IC6A 4HKAA 3RYCE 1HFAA 2KNDA 1IJ6A 3VU7H 2NWBA 2ZMAA 4I50E 3R84B 2VWAA 2D0TA 3PU3A 3IEEA 4BJMA 5H6QB 5FY0A 3HKBE 3ZJ1A 4Z8XA 3RPUA 4X1YE 4WW0A 1BR2A 1HS7A 1UX4A 4CXXA 3CKDA 4XZCA 5LA6E 5JDQA 4AKIA 3V5SA 3AA7B 3O1HA 4AQFA 2X51A 3B13A 4O4JE 5IYZE 3NBXX 5LHIB 3ZCIA 2DI4A 5JDNA 1KK7A 2W63A 3TKLB 4H9RC 4QX8B 1HG5A 2E9XD 2WBLA 2JPFA 4UEMA 3PU8A 3D0TA 3NRYA 4MALA 5CA0E 2PFVA 5LHGB 2L3LA 4HE8A 1T98A 4ZHQE 5L3EB 4G63A 3KVBA 2KZ7B 3MJXA 4K0UA 3WI3A 2LEHA 1ZHCA 4GYSA 1ZEEA 4EYUA 2LSYA 3PE0A 5CB4E 2XHEB 4JLEA 4AQGA 5JH7E 1VOMA 4EOZB 2QGSA 4HFVA 2KWIB 2J1DG 4UF0A 3CPZA 3CVRA 4EIWA 5JQGE 1E1HB 2Q9QA 2C5JA 2LSJA 4U74A 4ASKA 2K9AA 4UV9B 4EZ4A 4O4LE 1IJ5A 2D2SA 3Q2MA 3PUAA 1O3XA 4ZI7E 4P09A 4X1KE 5JRCB 2RP4A 2NW7A 4UVAB 2HPJA 3ZC0A 4TZ4C 2W0GA 3GN5A 3I0OA 3I9YA 4ZOLE 3LBXA 5JDFA 2NW8A 2X9XA 4ZI3C 3ZJ2A 4ERRA 3HR0A 5LJMA 4GYRA 3PUGA 4HTEA 4UF0B 3Q9DA 1IAPA 4IE5A 3PUQA 3ZLIA 4H9OC 4ZI2D 5ETWA 1FEWA 1MIVA 3N9NA 2WWUA 2X67A 4DNDA 2ACXA 3F57A 3MACA 4PJJA 3AA1B 3IHRA 1US7B 2CWYA 4GK5E 2A2FX 2W61A 1KNZA 2VKHA 4CI2B 4I4TE 5KX5E 4ADZA 4CZZB 5HXRA 2WAUA 4MFRA 3ANWA 3LK42 3E08A 1MMNA 4E7SA 2CEAA 4GOUA 2LE8A 3ZPOA 5HWXA 3KVAA 3UUMA 5FXXA 3PDYA 3VKGA 3FXDB 2XAHB 5EK2A 5C8YE 1ZV4X 1LVKA 2VB6A 2HH7A 2VK9A 2VKOA 2CE7A 5EK4A 2YINA 3SOLA 4UELA 3MK7C 4TV9E 1SHZC 2A72A 3ANWB 4AKRB 2MBGA 1BR1A 4PJLA 1D1BA 1ZKEA 2V7KA 4IGUA 2Y6XA 4C91A 4DVDA 1S94A 3W15B 3RYFE 1HCIA 3PURA 3ZMUB 3RH3A 1MNEA 2CLYB 1BR4A 3CX6B 3ZN0B 2LSIA 4PJMA 2G0UA 2X66A 3B57A 4EZHA 3U3IA 1WR6A 2JRKA 1MMDA 3NRXA 3HKEE 4MLKA 3CQCB 2ZM8A 3UTKA 3QUJA 3SS1A 2CXFA 3HKCE 2YU2A 4PK5A 4YJ3E 2ODUA 2EHOA 1WRDA 2K24A 2CXDA 3QK6A 2C5KT 4H9NC 4QKNA 5H6RB 3ZMZB 2P9BA 3RYIE 4IE0A 3ONXA 4PK4A 4PJNA 5L3GB 3C4XA 4BJNA 1U5PA 2GK9A 4ISSA 2D5UA 3HA4A 1D0XA 4KP3C 5FP3A 3FB2A 2ZM0A 2X68A 3GWHA 5L3CB 1WYBA 3WAJA 3ZMTB 4QXCB 2WM9A 2I59A 3N9PA 3KV9A 2WMNA 3AA6B 3ZCJA 5LHHB 1QUUA 5JDMA 3KFWX 5LYJE 5LGNB 3DTOA 4L5GA 3CWZB 5HWYA 5LNKA 2WSSV 4ANJA 2CMRA 3AAAB 3KINB 3KV6A 4PNIA 4JEUB 5JR9B 2OA5A 4CQIA 3ZMVB 2NOXA 1YD8G 5L3DB 4QHOA 4O8SA 4I55E 2UXXB 1UX5A 3WAKA 3MA9A 3R6NA 4N78D 4TV8E 4QWNB 5DABA 2KXPB 5LJNA 3ZMSB 2LJLA 3LK3B 4H63V 4HEAA 4QXBB 2A3DA 4CI1B 5HYAA 3KV5A 1VRBA 4UVCB 2PJQA 5F8PA 2X0LB 3C98B 3E22E 3C64A 4MHCA 1FIOA 3ETVA 3UFEA 5LGUB 1Y64B 3OYZA 4PFOA 5J2UE 4YHJA 2DNXA 1MIWA 2LSKA 2K48A 1H7CA 4H9SE 4A56A 3KBUA 2IW5B 2Q9QC 4P0AA 2XAGB 4CXYA 5JR9C 1MNDA 3Q5WA 4EYYR 1YW0A 2E9XC 3EUHA 3GA8A 4ILUA 4TUYE 5ADXL 2KMFA 4OHFA 3BQIA 1MMGA 4QXHB 3RX6A 4O4HE 4AXPA 3N5LA 5HXSA 4HN9A 4OYKA 3M65A 2XASB 3FBZA 3ETUA 3OBVE 2V7LA 2V7MA 2C0SA 1HF8A 1NWMX 3V5UA 1FMWA 2IAKA 2WMOA 1HTJF 5F3JA 4AKHA 2EHOC 1B7TA 3CQXC 3Q5XA 3KDSE 4ZI2C 3SRZA 5JDHA 2XAFB 4KMCA 2B1EA 4L0RA 4PK6A 2KT9A 4GK0E 4OK0A 2W62A 1D1AA 4PAGA 4OYJA 4V1Av 1CUNA 5CA1E 1IZNB 2YEVC 2V1DB 2NP9A 4IIJE 3BQLA 1X79A 4ZI3D 3EDVA 5LBMA 5JDLA 1NAFA 1WLXA 5LBQB 1MIYA 4BAYB 5A1LA 5HXHA 2YU1A 3SWHA 1YKHB 5DQVA 3O9XA 3N2KE 2DWKA 2IC9A 3E0ZA 1LRZA 1UCUA 2DHRA 2Q9QD 2ZLYA 3LBXB 4FI5A 5EZYE 5HAXA 5M4YA 3VHLA 3ZC1A 5EK3A 2N9DA 2MOZA 2X9YA 3UUXB 3L3PA 5JRCA 4UVBB 3JC6D 5DJQC 5E0OA 1OWAA 4UV8B 4AKLA 1V9DA 2EHOB 2N1GA 2PBIA 3HL6A 3T8OA 5LG4A 4DBRA 2K5BB 2KLQA 4C90A 2X9WA 4WNKA 5FXWA 3N9MA 4O4IE 2DCFA 4H9QC 2E8IA 2M67A 3EVYA 1FMVA 4IE4A 4J2CA 3AAEB 2V7JA 2MYSA 2RA1A 3EDUA 5LP6E 1D1CA 4IE7A 2JQQA 2CCQA 3RRCA 5FY7A 3GN5B 3QC9A 5JDGA 4DMWA 1G73A 2E9XA 3O4XE 3MZKB 4O2AE 3AVSA 3IF8B 4ZS2A 3C4ZA 2UXNB 3P8CD 4NUUA 1QSDA 2VASA 2XTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSI A;  2LSG A;  3VU7 H;  2N1G A;  2LSY A;  4GK0 E;  4BA9 A;  4FJO A;  2LSJ A;  4GK5 E;  4EXT A;  2LSK A; 
#chains in the Genus database with same CATH topology
 2D0U A;  2LOS A;  4ILA A;  5JVD E;  3ZYM A;  1XDO A;  1GQE A;  1D0Y A;  2QRX A;  5DQW A;  1G8X A;  1N34 T;  2E2A A;  1XMO T;  3PTR B;  4WZX A;  5AFU L;  5ABF B;  2BKN A;  2I6H A;  4OFZ A;  3OJA A;  4YTN A;  4U72 A;  5FL1 A;  3AB3 B;  3UU5 A;  3HI2 A;  2XAJ B;  2WB5 A;  5C2T A;  1T7S A;  2WZI A;  4H9P C;  2H3R A;  2ZM2 A;  3OKQ A;  3UU8 A;  1BR0 A;  1OED C;  2CM0 A;  2E9X B;  3PUS A;  1W9R A;  1ZOY A;  4M1P A;  3VKH A;  3L8R A;  3UU6 A;  3F31 A;  2X0Y A;  4KUM B;  4I43 B;  5IHY A;  2Q9Q B;  4HGA A;  2LKG A;  1KEY A;  3UUB A;  2SPC A;  3UUL A;  5KMG P;  4DV5 T;  3K3N A;  2YK0 A;  4WBO A;  3OYX A;  2HHH T;  1NEK A;  3I9W A;  4I0U A;  4NXN T;  3FHN A;  3FZK B;  5FYM A;  1HX8 A;  5GON E;  3U78 A;  4HWC A;  4YLH A;  4IHJ E;  3AXJ B;  1HG2 A;  1YQ3 A;  3CQG B;  1D0Z A;  1XWM A;  1SA0 E;  2BG9 C;  3N9Q A;  3NZQ A;  4P1N A;  4U2Y A;  1R8I A;  1AJ3 A;  1LKX A;  2L8K A;  1U4Q A;  3RRW A;  5IUX A;  3H37 A;  3EAM A;  5FMN A;  2BDE A;  2LOP A;  2X9H A;  1Z8U A;  3KV4 A;  4IDZ A;  3K3Q C;  2LT3 A;  4GIW A;  4X20 E;  1DU2 A;  3O1I A;  4XAX B;  4HWI B;  4JEH B;  5AQR B;  4CN1 A;  3CX8 B;  2VQF T;  1HR0 T;  3J7Y q;  3RKG A;  2XSA A;  4PFP A;  2HPL A;  2NTY A;  4JI4 T;  2JMH A;  2V7I A;  5LMN T;  5AQT B;  2DLR A;  2YDR A;  4P0B A;  3FBL A;  2LSG A;  2PG8 A;  4YSX A;  3LFM A;  4WBN E;  1IBM T;  2XAQ B;  2FJE A;  4TX5 A;  3ZYL A;  4HWD A;  3RC8 A;  2BG9 A;  3F2E A;  3L09 A;  4IE6 A;  5ABF A;  4DBQ A;  5ABE A;  3TLU A;  4JYA T;  4EB6 E;  2BS3 A;  2CWO A;  3RC3 A;  5J1G A;  3I0Q A;  2CA5 A;  3N2G E;  3KBT A;  1XNQ T;  3O1J A;  5AQN B;  1KFY A;  2B76 A;  3AE4 A;  3HKD E;  3MXZ A;  4TN7 B;  4EXT A;  4DV6 T;  3S4U A;  2LKH A;  2X0H A;  5L3B B;  2BS2 A;  2V26 A;  2Y8D A;  4DUZ T;  3CX7 B;  5HEO A;  2NR4 A;  4YJ2 E;  5J2T E;  4YSY A;  2MTQ A;  4IRE A;  5LGT B;  2W00 A;  4U33 A;  3CML A;  3DP7 A;  3RYH E;  4X1I E;  2VL0 A;  2XQ9 A;  2W4X A;  3UUN A;  4CXW A;  3BQK A;  4IDQ A;  3LJC A;  2J47 A;  2BZB A;  2EHO D;  2WP9 A;  4E7Z A;  5LXT E;  3AEA A;  2L9Q A;  4YHH T;  4DV7 T;  2LHN A;  4H63 H;  5AQI B;  5LCY A;  3NKZ A;  4AI6 A;  3QNU A;  3AAI A;  1LVF A;  4UR9 A;  2VVS A;  3AE8 A;  4OX9 T;  2H89 A;  3C50 A;  3H3A A;  4LMK A;  1XMQ T;  2NTX A;  1FJG T;  2BS4 A;  3C51 A;  2BVL A;  2FJD A;  2YDQ A;  4QX7 B;  2XQY A;  3AE3 A;  3SFE A;  4LFB T;  2CLY C;  2ES0 A;  3NZP A;  4MBQ A;  5L3F B;  4AQF C;  3ZT6 A;  3FXE B;  3AED A;  3H3M A;  3Q5D A;  3QOF A;  4ILC A;  5FXV A;  2W67 A;  3RIU A;  5HXC A;  4A98 A;  2XQ4 A;  2BVM A;  5AQH B;  3ZN1 B;  1WYC A;  1I6Z A;  2LHR A;  4B3S T;  2Z6E A;  4L9I A;  2QVA A;  5AQU B;  3ZYK A;  1SE7 A;  3AEG A;  3ONJ A;  2QA7 A;  2WDV A;  1OXZ A;  3DJB A;  5TAO A;  3RKO A;  2JMK A;  2JJ9 A;  3IBP A;  3L39 A;  4KHZ F;  4UXN B;  2NW9 A;  5J0Z A;  4UIG A;  3JC6 C;  2DWG A;  2KIN B;  3K8P C;  3LK2 B;  4BA9 A;  3CK6 A;  3LG7 A;  4HFE A;  2H7V C;  3BK9 A;  4U2Z A;  2BKP A;  5BMV E;  3MKD A;  3AVR A;  2K3W A;  1EZ3 A;  3AE2 A;  3C4W A;  1OED B;  3FZF B;  3NVO A;  5JR9 A;  1WR0 A;  2KWH A;  3VRA A;  2H7O A;  1HNX T;  4DMV A;  4G2A A;  3ZT7 A;  3A5X A;  2UXB T;  2XQ7 A;  5FXZ A;  4IT4 A;  3N9L A;  2C5I T;  1W0B A;  5FY1 A;  2UUA T;  2VKD A;  4KBM B;  4GKK T;  2XUE A;  2XQ5 A;  2Y48 B;  4LML A;  4AQY T;  4B3R T;  4K0K T;  5L2L A;  1MMA A;  2CXL A;  3AE6 A;  3ZEF B;  3P50 A;  3AE9 A;  1N33 T;  4HFH A;  5FNV E;  2N2N A;  3J9X 1;  5JRE A;  1S35 A;  4ZEY A;  3UT5 E;  2HN2 A;  2MPK A;  2LM9 A;  3P7I A;  1WFD A;  2ODV A;  2V6Y B;  1YQ4 A;  4YFS A;  3VRB A;  4HFB A;  1YKE B;  3AA0 B;  5KDM C;  2XM2 A;  4NXM T;  4FJO A;  4CI3 B;  4XBF B;  4QH4 A;  5HEH A;  5HEG A;  3K3O A;  4NUV A;  4IST A;  5LOV E;  4PW8 A;  3ZT5 A;  3ESL A;  4JUY A;  4O2B E;  4AKG A;  4EAH A;  2CHN A;  2WZH A;  2VL8 A;  4ZS3 A;  4B6X A;  2VKJ A;  1Z0P A;  3GMI A;  3PUW F;  3AE7 A;  3I1A A;  3N2O A;  2IC6 A;  3N9O A;  4HKA A;  2J62 A;  1HFA A;  2KND A;  1IJ6 A;  3RYC E;  4DR6 T;  3VU7 H;  2NWB A;  4X64 T;  3OPC A;  2WY2 A;  2ZMA A;  4I50 E;  2CPT A;  2IML A;  2VQE T;  4U7I A;  2PTF A;  4ILB A;  3AEB A;  2ACZ A;  3R84 B;  1YXR A;  2VWA A;  2J4G A;  2D0T A;  5HCJ A;  3PU3 A;  2JQH A;  4JI2 T;  1VCT A;  3IEE A;  4IDO A;  5H6Q B;  5FY0 A;  3HKB E;  4BJM A;  5BR8 T;  3ZJ1 A;  1IBL T;  4Z8X A;  4LFC T;  3RPU A;  4X1Y E;  4WW0 A;  1BR2 A;  3AEC A;  1HS7 A;  4LMJ A;  3EHZ A;  1UX4 A;  4CXX A;  4IDN A;  3CKD A;  4XZC A;  5LA6 E;  2FUP A;  2WQY A;  5JDQ A;  2YOE A;  3AA7 B;  3V5S A;  4A97 A;  3O1H A;  4AQF A;  4AKI A;  2LLY A;  2X51 A;  3B13 A;  4HFD A;  4O4J E;  3G06 A;  5IYZ E;  3NBX X;  5LHI B;  3ZCI A;  1UK5 A;  3UQ7 A;  2DI4 A;  5JDN A;  4YTM A;  4TWF A;  1KK7 A;  2W63 A;  2HN1 A;  4H9R C;  2MAW A;  3TKL B;  2WU5 A;  4DV1 T;  4QX8 B;  1HG5 A;  2E9X D;  2QYW A;  2W2U A;  2WBL A;  3AE1 A;  5FVK A;  2JPF A;  4UEM A;  3PU8 A;  4HFI A;  1VCS A;  3D0T A;  3NRY A;  1M7K A;  4MAL A;  4EGW A;  5CA0 E;  2UUC T;  2PFV A;  5LHG B;  4X65 T;  5HCM A;  2L3L A;  4IDP A;  4HE8 A;  3P4Q A;  3PJA J;  1T98 A;  4ZHQ E;  3PJA A;  5L3E B;  4G63 A;  3KVB A;  2KZ7 B;  3MJX A;  4K0U A;  5HEU A;  3WI3 A;  2LEH A;  1ZHC A;  3PUV F;  4HWH A;  4GYS A;  1ZEE A;  3T1Y T;  1CHU A;  2XZE A;  2YN6 A;  1HNZ T;  4EYU A;  2LSY A;  3PE0 A;  4YTP A;  5CB4 E;  2XHE B;  4JLE A;  4AQG A;  5JH7 E;  1VOM A;  4EOZ B;  2QGS A;  4HFV A;  2KWI B;  3RQW A;  2J1D G;  4UF0 A;  3CPZ A;  3CVR A;  4EIW A;  4B3T T;  5JQG E;  1E1H B;  2BG9 B;  4QH5 A;  3TLS A;  2Q9Q A;  5ABH A;  2C5J A;  2LSJ A;  4U74 A;  5HEJ A;  4IL9 A;  4ASK A;  2K9A A;  4UV9 B;  5ABG A;  4EZ4 A;  4B3M T;  4O4L E;  1IJ5 A;  2D2S A;  3Q2M A;  3PUA A;  1O3X A;  2M6I A;  4ZI7 E;  4P09 A;  4X1K E;  5JRC B;  5JTG A;  5LG4 A;  4DR2 T;  1NEN A;  2RP4 A;  2NW7 A;  2V6Y A;  3OTO T;  2F4V T;  1WCR A;  2WU2 A;  4UVA B;  2HPJ A;  3ZC0 A;  3P4P A;  2W0G A;  3FZH B;  3GN5 A;  2WDR A;  3I0O A;  3I9Y A;  3K1S A;  3LBX A;  4TZ4 C;  2NW8 A;  2X9X A;  5JDF A;  4ZI3 C;  4EV6 A;  2V6X A;  5AQM B;  3ZJ2 A;  3HR0 A;  4ERR A;  5LJM A;  3RLF F;  3X1D A;  4GYR A;  1E2A A;  3PUG A;  4HTE A;  4UF0 B;  2FJB A;  1IAP A;  3Q9D A;  4IE5 A;  3PUQ A;  4DV4 T;  2JQ9 A;  4H9O C;  3ZLI A;  4ZI2 D;  5ETW A;  1FEW A;  1MIV A;  3ZSS A;  3N9N A;  2WWU A;  3P4R A;  2X67 A;  2ZM6 T;  4DND A;  3ZKR A;  2ACX A;  3A8Y C;  3F57 A;  3MAC A;  4PJJ A;  4Z91 A;  5AQV B;  3AA1 B;  2XPK A;  3IHR A;  1US7 B;  2CWY A;  4GK5 E;  2A2F X;  2W61 A;  4LF8 T;  2BG9 E;  5LG3 A;  1KNZ A;  2VKH A;  2JQK A;  4I4T E;  4CI2 B;  4HFC A;  4ADZ A;  5HXR A;  4CZZ B;  5KX5 E;  2OV9 A;  4JV5 T;  2WAU A;  4HWF A;  4MFR A;  2LRK A;  5LMU T;  3ANW A;  3LK4 2;  3E08 A;  2BKO A;  1MMN A;  4E7S A;  4DUY T;  3ONL C;  2CEA A;  2DL1 A;  4GOU A;  3TLW A;  3RI5 A;  5AQK B;  3RQU A;  4A5X A;  2LE8 A;  2V8S V;  3ZPO A;  1OED E;  3AE5 A;  3KVA A;  3UUM A;  5FXX A;  4DID B;  5HWX A;  3PDY A;  3VKG A;  3A7M A;  5CGM A;  2AE9 A;  3FXD B;  4JI3 T;  4JI5 T;  5LB7 B;  2FBW A;  5L47 A;  3JCF A;  2XAH B;  5EK2 A;  3EI0 A;  5C8Y E;  1ZV4 X;  4JI1 T;  1LVK A;  1M62 A;  3VR8 A;  2VB6 A;  2HH7 A;  2VK9 A;  2VKO A;  2CE7 A;  3JAD A;  2YIN A;  5EK4 A;  1KF6 A;  3ABV A;  4UEL A;  3IA3 A;  3SOL A;  3MK7 C;  1J1J A;  2CRB A;  4TV9 E;  4TWH A;  1SHZ C;  2A72 A;  3ANW B;  3FZL B;  2MBG A;  4AKR B;  1BR1 A;  4PJL A;  1D1B A;  1ZKE A;  2V7K A;  4IGU A;  2Y6X A;  4C91 A;  4DVD A;  1W0A A;  2M6B A;  3UU3 A;  1S94 A;  1XDP A;  3W15 B;  3RYF E;  1HCI A;  1UUS A;  3NWI A;  3PUR A;  3PV0 F;  3ZMU B;  3RH3 A;  1MNE A;  2CLY B;  1BR4 A;  3CX6 B;  4X66 T;  3ZN0 B;  3UU4 A;  2LSI A;  4PJM A;  4ZZC A;  2G0U A;  3OVU A;  2X66 A;  3B57 A;  4EZH A;  2WDQ A;  1WR6 A;  2JRK A;  3U3I A;  1MMD A;  3NRX A;  3HKE E;  4YT0 A;  5C3J A;  4MLK A;  3CQC B;  2ZM8 A;  3UTK A;  4F6R C;  3QUJ A;  4TWD A;  3SS1 A;  2CXF A;  3HKC E;  2YU2 A;  3RIU C;  4WYV A;  4PK5 A;  2VUR A;  3JAF A;  2XM1 A;  4YJ3 E;  3P4W A;  4KHP T;  2ODU A;  2EHO A;  1WRD A;  2K24 A;  2CXD A;  3FZM B;  2C5K T;  2JIW A;  3QK6 A;  4H9N C;  4QKN A;  5H6R B;  2P9B A;  3ZMZ B;  4DO0 A;  4DV3 T;  3RYI E;  4IE0 A;  4JI0 T;  3ONX A;  4PK4 A;  3QB5 A;  4PJN A;  5L3G B;  2IHR 1;  2YKS A;  3C4X A;  4BJN A;  4F8H A;  4LF4 T;  1U5P A;  2GK9 A;  4ISS A;  2D5U A;  3HA4 A;  1D0X A;  4KP3 C;  5FP3 A;  1XNR T;  3FB2 A;  2VVN A;  2ZM0 A;  2X68 A;  4NPP A;  3GWH A;  5L3C B;  1WYB A;  3WAJ A;  2UU9 T;  4JI8 T;  3ZMT B;  5AQS B;  4QXC B;  2WM9 A;  2I59 A;  3N9P A;  3KV9 A;  2WMN A;  3AA6 B;  1IBK T;  1J5W A;  3ZCJ A;  5JDL A;  5LHH B;  1T72 A;  3PUZ F;  1QUU A;  5JDM A;  3KFW X;  5LYJ E;  5LGN B;  3DTO A;  4L5G A;  3CWZ B;  2I0M A;  5HWY A;  5LNK A;  2WSS V;  4ANJ A;  1OED A;  2CMR A;  3AAA B;  3KIN B;  3KV6 A;  4JEU B;  4PNI A;  5JR9 B;  1XZY A;  3M3Z B;  2OA5 A;  4CQI A;  3ZMV B;  1SUM B;  2NOX A;  1YD8 G;  5FL0 A;  4ZXL A;  1KNR A;  2XQA A;  5L3D B;  4LF9 T;  2UXD T;  4QHO A;  2W66 A;  4O8S A;  4I55 E;  2UXX B;  1UX5 A;  3WAK A;  3MA9 A;  3R6N A;  2YDS A;  4N78 D;  4QWN B;  4TV8 E;  2KXP B;  5DAB A;  3RF1 A;  3ZMS B;  5LJN A;  2LJL A;  4X62 T;  3LK3 B;  4H63 V;  2IDO B;  4HEA A;  4QXB B;  2FJA A;  2A3D A;  4CI1 B;  3KV5 A;  5HYA A;  3T1H T;  1VRB A;  4UVC B;  2UXC T;  2PJQ A;  3JAE A;  5F8P A;  2X0L B;  3C98 B;  3E22 E;  2XY8 B;  4QH1 A;  3UFG A;  3C64 A;  4MHC A;  1FIO A;  3P4S A;  2BBH A;  3ETV A;  4Q25 A;  3UFE A;  5LGU B;  4DR7 T;  1Y64 B;  3OYZ A;  4DV2 T;  4PFO A;  5J2U E;  2CHO A;  4YHJ A;  4LF7 T;  1X9B A;  2DNX A;  1MIW A;  2LSK A;  2K48 A;  1H7C A;  4H9S E;  1T8B A;  3KBU A;  2IW5 B;  4A56 A;  2Q9Q C;  1UGO A;  2BBJ A;  2XQ6 A;  2XAG B;  4P0A A;  4CXY A;  2WS3 A;  1HX1 B;  4U3C A;  1MND A;  3Q5W A;  4AIS A;  3RIA A;  4EYY R;  5CJ5 A;  5JR9 C;  1YW0 A;  2E9X C;  3EUH A;  3GA8 A;  4ILU A;  4TUY E;  5FVL A;  2KMF A;  4OHF A;  3BQI A;  1MMG A;  4QXH B;  3RX6 A;  5ADX L;  4O4H E;  2UUB T;  4AXP A;  3N5L A;  5HXS A;  4HN9 A;  4OYK A;  3M65 A;  5F5W A;  4DR1 T;  2XAS B;  2A9U A;  3FBZ A;  4CN6 A;  5AQF B;  2LRL A;  2XJ7 A;  3ETU A;  2V7L A;  2V7M A;  2C0S A;  1HF8 A;  1NWM X;  3OBV E;  1FMW A;  4X5T A;  3V5U A;  4DR4 T;  2IAK A;  2IIU A;  1HTJ F;  2WMO A;  5F3J A;  4AKH A;  1J5E T;  2EHO C;  4CN4 A;  1B7T A;  3CQX C;  4LF6 T;  3SFD A;  4U31 A;  2E5V A;  3Q5X A;  1KNP A;  3KDS E;  4ZI2 C;  3SRZ A;  4GKJ T;  1HNW T;  5JDH A;  2XAF B;  3LDQ B;  4KMC A;  3ZST A;  2B1E A;  4L0R A;  4PK6 A;  2KT9 A;  4GK0 E;  4OK0 A;  2W62 A;  1D1A A;  4PAG A;  4OYJ A;  3VR9 A;  4JI7 T;  1N32 T;  4V1A v;  5AQJ B;  1CUN A;  5CA1 E;  1IZN B;  2WCA A;  2YEV C;  2V1D B;  1ZP0 A;  2NP9 A;  4IIJ E;  3UQ4 A;  1L0V A;  4EED A;  3AEF A;  3BQL A;  1X79 A;  1JNR A;  3EDV A;  5LBM A;  5FKY A;  4YSZ A;  1NAF A;  1WLX A;  2OLT A;  4ZI3 D;  5CFB A;  4LFA T;  4LF5 T;  5LBQ B;  4TNW A;  2KSR A;  4Z90 A;  1MIY A;  3TLT A;  4BAY B;  5A1L A;  5HXH A;  4DR5 T;  2YU1 A;  3LSV A;  3SWH A;  4DR3 T;  1YKH B;  5DQV A;  3O9X A;  3N2K E;  2RPA A;  2DWK A;  2IC9 A;  3E0Z A;  3AXJ A;  5AQG B;  1LRZ A;  1UCU A;  5AQQ B;  1JNZ A;  4COF A;  3CIR A;  3RIF A;  2DHR A;  2Q9Q D;  2ZLY A;  3B5M A;  5AQP B;  5L4E A;  1I94 T;  3LBX B;  4FI5 A;  5EZY E;  5HAX A;  5M4Y A;  3VHL A;  2XSB A;  3ZC1 A;  3Q5E A;  5EK3 A;  3PUX F;  2N9D A;  1W09 A;  2MOZ A;  4EEB A;  4YXD A;  2X9Y A;  3UUX B;  2V5D A;  5IWA T;  2H88 A;  3L3P A;  3RGL A;  4UVB B;  3TLV A;  3JC6 D;  5JRC A;  5DJQ C;  5E0O A;  1OWA A;  4UV8 B;  3QB5 K;  3EAB A;  5AQO B;  4AKL A;  4DV0 T;  4KI0 F;  1V9D A;  2EHO B;  2N1G A;  2PBI A;  2V5C A;  3HL6 A;  3T8O A;  4DBR A;  2K5B B;  2KLQ A;  2AXD S;  3AEE A;  4NIQ A;  2X9W A;  4WNK A;  5FXW A;  2D9D A;  4C90 A;  3N9M A;  1E7P A;  4O4I E;  2DCF A;  4TNV A;  2CBI A;  4H9Q C;  2E8I A;  4JBW F;  4ZZB A;  4AIU A;  2M67 A;  2XQ3 A;  3EVY A;  2LM2 A;  2XQ8 A;  1FMV A;  4IE4 A;  4J2C A;  3RHW A;  4IL4 A;  3AAE B;  4JI6 T;  2R6G F;  2MYS A;  2RA1 A;  2V7J A;  3EDU A;  5L4H A;  5LP6 E;  4ZOL E;  1D1C A;  2WWV A;  4YY3 T;  4IE7 A;  2JQQ A;  2CCQ A;  3RRC A;  1N36 T;  5FY7 A;  3GN5 B;  2E5L T;  3PUY F;  3QC9 A;  5JDG A;  2CBJ A;  5AQL B;  4DMW A;  1G73 A;  2E9X A;  4KX6 A;  5KXJ A;  3O4X E;  3MZK B;  1Y01 A;  1UUR A;  4O2A E;  2IUB A;  3AVS A;  3IF8 B;  4ZS2 A;  3C4Z A;  2UXN B;  3P8C D;  4NUU A;  1QSD A;  1QLB A;  2VAS A;  2XTL A;  5HXE A;  4U7Y A; 
#chains in the Genus database with same CATH homology
 2D0U A;  2LOS A;  5JVD E;  3ZYM A;  1D0Y A;  5DQW A;  1G8X A;  3PTR B;  5AFU L;  4OFZ A;  3OJA A;  4U72 A;  3AB3 B;  3HI2 A;  2XAJ B;  4H9P C;  2H3R A;  2ZM2 A;  3OKQ A;  1BR0 A;  2CM0 A;  2E9X B;  3PUS A;  4M1P A;  3VKH A;  3F31 A;  4KUM B;  4I43 B;  3UUL A;  5IHY A;  2Q9Q B;  4HGA A;  2SPC A;  5KMG P;  3K3N A;  2YK0 A;  4WBO A;  3OYX A;  3I9W A;  3FHN A;  5FYM A;  5GON E;  1HX8 A;  3U78 A;  4YLH A;  5HXE A;  4IHJ E;  1HG2 A;  4DO0 A;  3CQG B;  1D0Z A;  1SA0 E;  3NZQ A;  3N9Q A;  1AJ3 A;  1LKX A;  2L8K A;  1U4Q A;  3RRW A;  3H37 A;  5FMN A;  2BDE A;  2LOP A;  2X9H A;  3KV4 A;  4IDZ A;  3K3Q C;  2LT3 A;  4GIW A;  4X20 E;  3O1I A;  4XAX B;  4JEH B;  3CX8 B;  3J7Y q;  4PFP A;  2HPL A;  2NTY A;  2JMH A;  2V7I A;  2DLR A;  4P0B A;  3FBL A;  2LSG A;  2PG8 A;  3LFM A;  4WBN E;  2XAQ B;  4TX5 A;  3ZYL A;  3RC8 A;  3F2E A;  3L09 A;  4IE6 A;  4DBQ A;  4EB6 E;  2CWO A;  3RC3 A;  5J1G A;  3I0Q A;  2CA5 A;  3N2G E;  3KBT A;  3O1J A;  3HKD E;  4EXT A;  3MXZ A;  4TN7 B;  3S4U A;  5L3B B;  2V26 A;  2Y8D A;  3CX7 B;  4YJ2 E;  5J2T E;  2MTQ A;  5LGT B;  2W00 A;  3CML A;  3DP7 A;  3RYH E;  4X1I E;  4CXW A;  3UUN A;  3BQK A;  4E7Z A;  3LJC A;  5LXT E;  2BZB A;  2EHO D;  2L9Q A;  4AI6 A;  2LHN A;  4H63 H;  5LCY A;  3AAI A;  1LVF A;  3H3A A;  3C50 A;  2NTX A;  3C51 A;  2BVL A;  4QX7 B;  2XQY A;  2CLY C;  2ES0 A;  3NZP A;  4MBQ A;  5L3F B;  4AQF C;  3FXE B;  5FXV A;  5HXC A;  2BVM A;  3ZN1 B;  1WYC A;  2LHR A;  2Z6E A;  4L9I A;  3ZYK A;  4F6R C;  2QA7 A;  1OXZ A;  3DJB A;  5TAO A;  3RKO A;  2JMK A;  2JJ9 A;  3IBP A;  4UXN B;  2NW9 A;  4UIG A;  3JC6 C;  2DWG A;  2KIN B;  3K8P C;  3LK2 B;  4BA9 A;  3LG7 A;  2H7V C;  3BK9 A;  5BMV E;  3MKD A;  3AVR A;  1EZ3 A;  3C4W A;  5JR9 A;  2KWH A;  2H7O A;  4DMV A;  4G2A A;  3A5X A;  5FXZ A;  5FY1 A;  3N9L A;  2C5I T;  2VKD A;  4KBM B;  2XUE A;  2Y48 B;  5L2L A;  1MMA A;  2CXL A;  3ZEF B;  5FNV E;  2N2N A;  3J9X 1;  5JRE A;  1S35 A;  3UT5 E;  2LM9 A;  3P7I A;  2ODV A;  4YFS A;  1YKE B;  3AA0 B;  5KDM C;  4FJO A;  4CI3 B;  4XBF B;  3K3O A;  4NUV A;  4IST A;  5LOV E;  4PW8 A;  3ESL A;  4JUY A;  4O2B E;  4AKG A;  4EAH A;  2VL8 A;  4ZS3 A;  4B6X A;  2VKJ A;  1Z0P A;  3GMI A;  3N2O A;  3I1A A;  3N9O A;  2IC6 A;  4HKA A;  3RYC E;  1HFA A;  2KND A;  1IJ6 A;  3VU7 H;  2NWB A;  2ZMA A;  4I50 E;  3R84 B;  2VWA A;  2D0T A;  3PU3 A;  3IEE A;  4BJM A;  5H6Q B;  5FY0 A;  3HKB E;  3ZJ1 A;  4Z8X A;  3RPU A;  4X1Y E;  4WW0 A;  1BR2 A;  1HS7 A;  1UX4 A;  4CXX A;  3CKD A;  4XZC A;  5LA6 E;  5JDQ A;  4AKI A;  3V5S A;  3AA7 B;  3O1H A;  4AQF A;  2X51 A;  3B13 A;  4O4J E;  5IYZ E;  3NBX X;  5LHI B;  3ZCI A;  2DI4 A;  5JDN A;  1KK7 A;  2W63 A;  3TKL B;  4H9R C;  4QX8 B;  1HG5 A;  2E9X D;  2WBL A;  2JPF A;  4UEM A;  3PU8 A;  3D0T A;  3NRY A;  4MAL A;  5CA0 E;  2PFV A;  5LHG B;  2L3L A;  4HE8 A;  1T98 A;  4ZHQ E;  5L3E B;  4G63 A;  3KVB A;  2KZ7 B;  3MJX A;  4K0U A;  3WI3 A;  2LEH A;  1ZHC A;  4GYS A;  1ZEE A;  4EYU A;  2LSY A;  3PE0 A;  5CB4 E;  2XHE B;  4JLE A;  4AQG A;  5JH7 E;  1VOM A;  4EOZ B;  2QGS A;  4HFV A;  2KWI B;  2J1D G;  4UF0 A;  3CPZ A;  3CVR A;  4EIW A;  5JQG E;  1E1H B;  2Q9Q A;  2C5J A;  2LSJ A;  4U74 A;  4ASK A;  2K9A A;  4UV9 B;  4EZ4 A;  4O4L E;  1IJ5 A;  2D2S A;  3Q2M A;  3PUA A;  1O3X A;  4ZI7 E;  4P09 A;  4X1K E;  5JRC B;  2RP4 A;  2NW7 A;  4UVA B;  2HPJ A;  3ZC0 A;  4TZ4 C;  2W0G A;  3GN5 A;  3I0O A;  3I9Y A;  4ZOL E;  3LBX A;  5JDF A;  2NW8 A;  2X9X A;  4ZI3 C;  3ZJ2 A;  4ERR A;  3HR0 A;  5LJM A;  4GYR A;  3PUG A;  4HTE A;  4UF0 B;  3Q9D A;  1IAP A;  4IE5 A;  3PUQ A;  3ZLI A;  4H9O C;  4ZI2 D;  5ETW A;  1FEW A;  1MIV A;  3N9N A;  2WWU A;  2X67 A;  4DND A;  2ACX A;  3F57 A;  3MAC A;  4PJJ A;  3AA1 B;  3IHR A;  1US7 B;  2CWY A;  4GK5 E;  2A2F X;  2W61 A;  1KNZ A;  2VKH A;  4CI2 B;  4I4T E;  5KX5 E;  4ADZ A;  4CZZ B;  5HXR A;  2WAU A;  4MFR A;  3ANW A;  3LK4 2;  3E08 A;  1MMN A;  4E7S A;  2CEA A;  4GOU A;  2LE8 A;  3ZPO A;  5HWX A;  3KVA A;  3UUM A;  5FXX A;  3PDY A;  3VKG A;  3FXD B;  2XAH B;  5EK2 A;  5C8Y E;  1ZV4 X;  1LVK A;  2VB6 A;  2HH7 A;  2VK9 A;  2VKO A;  2CE7 A;  5EK4 A;  2YIN A;  3SOL A;  4UEL A;  3MK7 C;  4TV9 E;  1SHZ C;  2A72 A;  3ANW B;  4AKR B;  2MBG A;  1BR1 A;  4PJL A;  1D1B A;  1ZKE A;  2V7K A;  4IGU A;  2Y6X A;  4C91 A;  4DVD A;  1S94 A;  3W15 B;  3RYF E;  1HCI A;  3PUR A;  3ZMU B;  3RH3 A;  1MNE A;  2CLY B;  1BR4 A;  3CX6 B;  3ZN0 B;  2LSI A;  4PJM A;  2G0U A;  2X66 A;  3B57 A;  4EZH A;  3U3I A;  1WR6 A;  2JRK A;  1MMD A;  3NRX A;  3HKE E;  4MLK A;  3CQC B;  2ZM8 A;  3UTK A;  3QUJ A;  3SS1 A;  2CXF A;  3HKC E;  2YU2 A;  4PK5 A;  4YJ3 E;  2ODU A;  2EHO A;  1WRD A;  2K24 A;  2CXD A;  3QK6 A;  2C5K T;  4H9N C;  4QKN A;  5H6R B;  3ZMZ B;  2P9B A;  3RYI E;  4IE0 A;  3ONX A;  4PK4 A;  4PJN A;  5L3G B;  3C4X A;  4BJN A;  1U5P A;  2GK9 A;  4ISS A;  2D5U A;  3HA4 A;  1D0X A;  4KP3 C;  5FP3 A;  3FB2 A;  2ZM0 A;  2X68 A;  3GWH A;  5L3C B;  1WYB A;  3WAJ A;  3ZMT B;  4QXC B;  2WM9 A;  2I59 A;  3N9P A;  3KV9 A;  2WMN A;  3AA6 B;  3ZCJ A;  5LHH B;  1QUU A;  5JDM A;  3KFW X;  5LYJ E;  5LGN B;  3DTO A;  4L5G A;  3CWZ B;  5HWY A;  5LNK A;  2WSS V;  4ANJ A;  2CMR A;  3AAA B;  3KIN B;  3KV6 A;  4PNI A;  4JEU B;  5JR9 B;  2OA5 A;  4CQI A;  3ZMV B;  2NOX A;  1YD8 G;  5L3D B;  4QHO A;  4O8S A;  4I55 E;  2UXX B;  1UX5 A;  3WAK A;  3MA9 A;  3R6N A;  4N78 D;  4TV8 E;  4QWN B;  5DAB A;  2KXP B;  5LJN A;  3ZMS B;  2LJL A;  3LK3 B;  4H63 V;  4HEA A;  4QXB B;  2A3D A;  4CI1 B;  5HYA A;  3KV5 A;  1VRB A;  4UVC B;  2PJQ A;  5F8P A;  2X0L B;  3C98 B;  3E22 E;  3C64 A;  4MHC A;  1FIO A;  3ETV A;  3UFE A;  5LGU B;  1Y64 B;  3OYZ A;  4PFO A;  5J2U E;  4YHJ A;  2DNX A;  1MIW A;  2LSK A;  2K48 A;  1H7C A;  4H9S E;  4A56 A;  3KBU A;  2IW5 B;  2Q9Q C;  4P0A A;  2XAG B;  4CXY A;  5JR9 C;  1MND A;  3Q5W A;  4EYY R;  1YW0 A;  2E9X C;  3EUH A;  3GA8 A;  4ILU A;  4TUY E;  5ADX L;  2KMF A;  4OHF A;  3BQI A;  1MMG A;  4QXH B;  3RX6 A;  4O4H E;  4AXP A;  3N5L A;  5HXS A;  4HN9 A;  4OYK A;  3M65 A;  2XAS B;  3FBZ A;  3ETU A;  3OBV E;  2V7L A;  2V7M A;  2C0S A;  1HF8 A;  1NWM X;  3V5U A;  1FMW A;  2IAK A;  2WMO A;  1HTJ F;  5F3J A;  4AKH A;  2EHO C;  1B7T A;  3CQX C;  3Q5X A;  3KDS E;  4ZI2 C;  3SRZ A;  5JDH A;  2XAF B;  4KMC A;  2B1E A;  4L0R A;  4PK6 A;  2KT9 A;  4GK0 E;  4OK0 A;  2W62 A;  1D1A A;  4PAG A;  4OYJ A;  4V1A v;  1CUN A;  5CA1 E;  1IZN B;  2YEV C;  2V1D B;  2NP9 A;  4IIJ E;  3BQL A;  1X79 A;  4ZI3 D;  3EDV A;  5LBM A;  5JDL A;  1NAF A;  1WLX A;  5LBQ B;  1MIY A;  4BAY B;  5A1L A;  5HXH A;  2YU1 A;  3SWH A;  1YKH B;  5DQV A;  3O9X A;  3N2K E;  2DWK A;  2IC9 A;  3E0Z A;  1LRZ A;  1UCU A;  2DHR A;  2Q9Q D;  2ZLY A;  3LBX B;  4FI5 A;  5EZY E;  5HAX A;  5M4Y A;  3VHL A;  3ZC1 A;  5EK3 A;  2N9D A;  2MOZ A;  2X9Y A;  3UUX B;  3L3P A;  5JRC A;  4UVB B;  3JC6 D;  5DJQ C;  5E0O A;  1OWA A;  4UV8 B;  4AKL A;  1V9D A;  2EHO B;  2N1G A;  2PBI A;  3HL6 A;  3T8O A;  5LG4 A;  4DBR A;  2K5B B;  2KLQ A;  4C90 A;  2X9W A;  4WNK A;  5FXW A;  3N9M A;  4O4I E;  2DCF A;  4H9Q C;  2E8I A;  2M67 A;  3EVY A;  1FMV A;  4IE4 A;  4J2C A;  3AAE B;  2V7J A;  2MYS A;  2RA1 A;  3EDU A;  5LP6 E;  1D1C A;  4IE7 A;  2JQQ A;  2CCQ A;  3RRC A;  5FY7 A;  3GN5 B;  3QC9 A;  5JDG A;  4DMW A;  1G73 A;  2E9X A;  3O4X E;  3MZK B;  4O2A E;  3AVS A;  3IF8 B;  4ZS2 A;  3C4Z A;  2UXN B;  3P8C D;  4NUU A;  1QSD A;  2VAS A;  2XTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...