4BA9A

The structural basis for the coordination of y-family translesion dna polymerases by rev1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
114
structure length
104
Chain Sequence
GPHMHKKSFFDKKRSERASNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structural Basis for the Coordination of Y- Family Translesion DNA Polymerases by Rev1
rcsb
molecule keywords DNA POLYMERASE KAPPA, DNA REPAIR PROTEIN REV1
molecule tags Transferase
source organism Homo sapiens
total genus 40
structure length 104
sequence length 114
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4ba9A00
4EXTA 4GK5E 2LSGA 2LSKA 2LSJA 2LSIA 2LSYA 4FJOA 4BA9A 4GK0E 3VU7H 2N1GA
chains in the Genus database with same CATH superfamily
3N2KE 5E0OA 2XAGB 1WR0A 3SS1A 5JDNA 3FZHB 2ZM8A 4TUYE 1HX8A 5IWAT 4AI6A 3AECA 4P0BA 2Q9QB 4AKLA 2WY2A 3FHNA 1YXRA 3FXEB 4LMKA 2WCAA 1UCUA 3KFWX 5CFBA 4U74A 1VRBA 4QXBB 2V8SV 4H9OC 5JRCA 4GOUA 1YD8G 2LOPA 4Z8XA 5HXEA 4X20E 3I1AA 2BG9E 4AISA 1QUUA 3GN5B 4ILAA 4BA9A 3NZPA 4KMCA 1HNXT 2XQ7A 2PJQA 1WLXA 5ABEA 5L47A 3AEAA 2X9XA 5IYZE 3MXZA 2ZMAA 3ONLC 2H88A 3PUWF 3ZMVB 2W67A 2CLYC 4NUVA 3R6NA 1UUSA 1W0BA 2V6YA 2UXDT 2EHOD 4IE6A 4YTMA 1U4QA 3AE5A 3CX8B 2NTYA 2XSBA 1XNQT 3ZMZB 2WU5A 5L3BB 3N2GE 2WWVA 5F8PA 3SRZA 1KEYA 4IDNA 3N2OA 5LG4A 3OVUA 1NEKA 4YHHT 5LBMA 5JREA 3L39A 2XM2A 4H63V 5C2TA 2E9XC 2NP9A 4HGAA 5AQVB 3RQUA 2MPKA 4TV8E 4HFVA 2IDOB 4EEDA 3Q5XA 4WW0A 3RKGA 4FJOA 4XAXB 2N2NA 1YW0A 5HXHA 2WS3A 2HHHT 2LOSA 3R84B 4CN1A 1XWMA 4LF5T 4PK5A 5LHHB 5JDGA 4GK5E 1KNZA 2LT3A 3QNUA 2KSRA 2DHRA 3NRYA 5HYAA 4G2AA 3NRXA 3OJAA 3ZYKA 3OYXA 2L8KA 2W2UA 2RA1A 3KBUA 2ZM6T 2LRLA 3RC3A 3C51A 5AQNB 5HEOA 3QK6A 2V7KA 4DV0T 2JQKA 3VR9A 1G8XA 5LNKA 4OFZA 3GN5A 3DJBA 3ZMSB 2FJEA 4IT4A 2WDVA 3CX7B 4DV3T 2NW9A 4L9IA 4EGWA 3JC6D 1J5ET 2V5CA 4NXMT 5AQMB 1R8IA 2CXLA 4F8HA 4TN7B 4AQFA 3T1HT 2ODUA 5FL0A 4XZCA 3JAFA 2Q9QC 4NPPA 3RQWA 2A9UA 4DIDB 3D0TA 2LHNA 5LXTE 4DR3T 2VL0A 4PK6A 5ABGA 4WZXA 1WR6A 2J1DG 5LCYA 3UT5E 4LFAT 2LJLA 4U7YA 3ZT7A 5AQRB 3P8CD 3B5MA 2XQYA 2X67A 5F3JA 3AAIA 4ZXLA 4I0UA 2PTFA 4ZI3C 4A5XA 2OLTA 3FB2A 4P09A 3AAEB 2DNXA 3W15B 4K0KT 3ZT6A 4OHFA 4X1YE 1MIWA 4QX8B 3O1JA 4XBFB 4M1PA 3L8RA 4BJNA 4B3TT 2PFVA 5LYJE 1XZYA 2H3RA 3ESLA 2AE9A 2BBHA 4AQFC 2DWGA 5LBQB 3PUZF 4IE7A 1HX1B 4X1KE 3KV6A 2CMRA 4PJMA 4ZI3D 1J1JA 3LK42 2VVNA 2E5VA 1H7CA 3ZKRA 2LSIA 4HTEA 3UU6A 3SOLA 3MJXA 4PJJA 3H3MA 2XHEB 2JQ9A 2HPJA 5H6QB 1ZHCA 5AQSB 3TLUA 2Y8DA 3F2EA 1EZ3A 3MK7C 4OYJA 2QYWA 5C8YE 5JDQA 5FMNA 3NBXX 4HWFA 4BAYB 4TNVA 3UU4A 1QSDA 5JDMA 4UVAB 2NW8A 2X51A 4P0AA 5FY1A 2WZHA 1YKEB 4O4IE 2D0UA 3RYHE 2X9WA 4N78D 3AEDA 5BMVE 5HEHA 3AE6A 2LKHA 3VKGA 2LSJA 3H37A 3AE3A 2FJAA 1D1AA 2FJBA 2KWHA 2F4VT 4B6XA 2WWUA 2XAQB 4QH1A 5CJ5A 5L3EB 3U78A 3AE2A 5L3CB 5FYMA 3KVAA 3KV5A 2JPFA 3UU5A 1L0VA 4CZZB 4L0RA 3ONXA 5ABFA 3LBXB 3TLWA 4AKHA 1KF6A 2WDQA 3UUXB 4QWNB 1ZEEA 4U72A 3LFMA 2Y6XA 3O9XA 4EIWA 2B76A 2D0TA 4B3MT 4TV9E 4F6RC 2NOXA 2DWKA 3A8YC 3KDSE 4IREA 3LSVA 3EABA 4EV6A 2IW5B 3ONJA 5LMNT 4HFCA 3O1IA 3FBZA 2MYSA 4TWHA 4CXWA 4UIGA 2WMOA 2KT9A 2W4XA 3L3PA 3UUBA 3AA0B 5AQKB 2HPLA 2K9AA 4HWIB 2ES0A 2IC9A 4IIJE 1BR4A 3ETUA 4A97A 4COFA 3Q9DA 1MIVA 3ZCJA 2YU2A 4DV5T 2XPKA 3CQGB 3ZJ2A 2G0UA 3RF1A 1NWMX 3AEBA 4X64T 2IAKA 4YHJA 3MACA 2IMLA 2PBIA 2ZM2A 2JRKA 1HFAA 3KVBA 2VQFT 2MTQA 2V7MA 2UU9T 2BVMA 3SFDA 5LJMA 4HKAA 3GWHA 2JJ9A 4ILUA 5FXVA 4JBWF 4PJNA 3RHWA 2K48A 3U3IA 2OA5A 3RKOA 2ZM0A 1WYCA 4O2BE 5JDHA 3CVRA 4FI5A 3UUNA 4LFBT 1OEDB 3OKQA 4DR4T 3ZEFB 2XQ9A 1KNPA 2A72A 1B7TA 4DV2T 4LMLA 2J4GA 3K3NA 5AQJB 4CQIA 5J0ZA 4GK0E 2DCFA 2X0YA 4JYAT 1MNDA 3LBXA 2NTXA 5JH7E 2CBIA 2XQAA 3HI2A 2E5LT 5GONE 3EDUA 4ZEYA 2NW7A 4KHZF 5IUXA 2E9XA 2V5DA 3AE7A 2YN6A 5L3FB 1SHZC 3CQXC 3DP7A 1BR2A 2X68A 5CA0E 3E22E 3TLTA 4DR1T 2LM2A 4JLEA 3N5LA 2CRBA 2CPTA 3E0ZA 2M6IA 4C90A 2NWBA 2WMNA 3ZC0A 4DVDA 3C64A 3RIFA 3JADA 3RC8A 4U7IA 3IA3A 4PJLA 1VCSA 4JEHB 3JCFA 2VB6A 3CQCB 2YINA 1FMWA 5F5WA 3UULA 4U3CA 4YTNA 2D2SA 1W9RA 4DBRA 3P50A 3CIRA 3HA4A 3UUMA 2J62A 1QLBA 5DJQC 2GK9A 5L3GB 4DUYT 3UQ7A 5ADXL 4YSXA 1FEWA 1XMOT 2VKDA 3A5XA 4KX6A 1YKHB 1DU2A 1WRDA 4LMJA 5AQLB 2J47A 3PURA 4ILBA 2XQ3A 3K1SA 2BZBA 4MHCA 2V7LA 3F31A 4A98A 1D1BA 2QRXA 3LK3B 3AAAB 2W0GA 1OEDA 3RRCA 4KBMB 4MFRA 3EI0A 2LSKA 1N34T 2E9XD 2Q9QA 5FL1A 4LF6T 4CXXA 2I59A 2XZEA 4U2ZA 5LGNB 3UU3A 1XDOA 2X9YA 4QKNA 3HL6A 2W61A 4ZS2A 4JUYA 4X5TA 4AIUA 3N9OA 1M62A 3OPCA 3N9NA 4PAGA 4IDQA 4I4TE 4QXHB 2KZ7B 2UXNB 1CHUA 4PK4A 3GMIA 3CWZB 5CB4E 3VRBA 4AKIA 1W0AA 4J2CA 5LP6E 1MMDA 2X9HA 4GKKT 3O4XE 4ZHQE 3CX6B 1WYBA 3UFGA 3AEEA 1OEDC 4DNDA 4JI8T 3QB5A 4PFPA 3RRWA 2CXFA 3T1YT 3WAKA 5ABHA 3RGLA 4E7SA 2CWOA 3KINB 4UF0B 3RPUA 4YT0A 2H7OA 2Y48B 5FVKA 5A1LA 4YSYA 2W63A 3CMLA 1XDPA 2XAFB 4GKJT 5AQUB 3B57A 3DTOA 2DL1A 2SPCA 4IE5A 4JI3T 3EDVA 2K24A 3KV4A 1AJ3A 3ZN1B 2KLQA 5JQGE 3RIUA 2YU1A 4O8SA 2Q9QD 3PUVF 2IUBA 2JMKA 4AKGA 3C4WA 4EAHA 3FBLA 2V7IA 2X0LB 1G73A 3BK9A 5C3JA 3MA9A 3K3QC 2XQ6A 2L9QA 3P4WA 4HWDA 1HR0T 2M6BA 4EOZB 4KHPT 4DV6T 3UQ4A 3E08A 1VCTA 5FNVE 2YOEA 4HEAA 5J1GA 3C50A 2UUCT 4UVCB 3N9QA 2QVAA 5KX5E 2JIWA 4E7ZA 4ZI2C 3PUYF 2LLYA 2CEAA 1IJ5A 2H89A 4C91A 4EB6E 3P7IA 5KDMC 4P1NA 4DV7T 1MNEA 4LF8T 2WDRA 2K5BB 3TLVA 1SUMB 3Q2MA 4K0UA 4KUMB 3RIUC 1BR0A 2R6GF 3Q5DA 3ZSTA 2XAHB 4JI2T 4UR9A 4H9PC 5FP3A 1T98A 3AE4A 3FZKB 4EYYR 4ISTA 5FXWA 3LK2B 4ZI2D 4H63H 3VU7H 4MLKA 3GA8A 1E1HB 4DO0A 3FZMB 3RYCE 3O1HA 4EZHA 4ZZBA 3NVOA 1GQEA 4CXYA 5EK4A 2VQET 1FIOA 2W62A 4YJ2E 2VURA 5CGMA 2V6XA 3P4PA 4UF0A 4AKRB 1HG5A 2L3LA 3JAEA 2H7VC 3KBTA 4HFIA 2EHOB 3SFEA 1J5WA 2XQ8A 1D0ZA 2CBJA 3C4ZA 3PU8A 4JEUB 1X9BA 2CHOA 2E8IA 3ZMUB 1WCRA 1Z0PA 2CCQA 4DR5T 3J7Yq 2YDSA 1XNRT 4I55E 1OXZA 1LKXA 3FXDB 4YY3T 4V1Av 2MOZA 3PUXF 4OX9T 2KWIB 1X79A 4WBOA 3MZKB 2CXDA 1D0YA 3QC9A 1E2AA 5HEUA 4HWCA 4TX5A 1HS7A 2XTLA 4O4LE 3EAMA 3L09A 2UUAT 3AE1A 4BJMA 2OV9A 4DMWA 3PJAA 4HWHA 4PW8A 1UK5A 2BG9B 2A3DA 4JI5T 5LGTB 4O4HE 2DLRA 4IL4A 3ANWB 1ZKEA 3P4RA 1I6ZA 4B3ST 5HWYA 4QH4A 2WAUA 4AXPA 2KMFA 2W00A 1IBLT 5AQTB 1JNZA 3PUAA 4B3RT 2D5UA 2MBGA 2LHRA 3WAJA 2A2FX 3C4XA 4YLHA 4UXNB 3X1DA 2CHNA 2NR4A 1T72A 1Y01A 3WI3A 4NXNT 2W66A 3RYFE 4KP3C 1MIYA 3ZMTB 3CKDA 2RP4A 1NAFA 1HCIA 5FY0A 4ASKA 5L2LA 5HXSA 5J2TE 3BQLA 5J2UE 2P9BA 1XMQT 4O2AE 1MMAA 3B13A 3AEFA 2KXPB 2ZLYA 2EHOA 4JI1T 2V26A 3AVSA 4L5GA 4YJ3E 4Z90A 3I0QA 1YQ4A 2CM0A 2D9DA 2YKSA 2VASA 3F57A 2WM9A 1KNRA 1ZP0A 4GIWA 5KXJA 4IGUA 2BVLA 1IZNB 4UEMA 1D1CA 3IF8B 5ETWA 4U31A 2X66A 5HCMA 2RPAA 2YDQA 2LSGA 2PG8A 3M65A 4CN6A 4IL9A 5HWXA 4JI0T 2HH7A 1JNRA 2BG9A 2CA5A 2LM9A 3ZT5A 4ERRA 4DR2T 2EHOC 4AQGA 1S35A 3ANWA 4MALA 5HEJA 5LJNA 3AA7B 3LDQB 4HN9A 4ADZA 2C5KT 1MMGA 3IBPA 4YFSA 1LVFA 4ZZCA 5HAXA 5IHYA 4UELA 1T8BA 4DR6T 4QHOA 5L4HA 3N9MA 2C5IT 4UV8B 5TAOA 5HCJA 5FY7A 1ZOYA 5LB7B 4DBQA 4QH5A 2VKJA 3QUJA 5JR9B 3ZPOA 2XSAA 2BKPA 2UXBT 4LF4T 2LE8A 2BG9C 2C0SA 1LVKA 3V5SA 2VK9A 3UFEA 2XY8B 3OTOT 3HKDE 1E7PA 4TWFA 2BS3A 4HFBA 1OEDE 3OBVE 3AVRA 3ETVA 3QB5K 5LMUT 3PUSA 4JI4T 4IDZA 2WBLA 3PE0A 2N9DA 2E2AA 1LRZA 4WNKA 3H3AA 2YK0A 1T7SA 4IE4A 4H9SE 4DV4T 2WZIA 3JC6C 2V1DB 2M67A 2UXCT 3N9LA 3I9YA 1HG2A 1ZV4X 4PFOA 1FMVA 2VWAA 1HNWT 4IDOA 4H9RC 1HF8A 3BQKA 3ZCIA 1MMNA 4X1IE 3S4UA 2VL8A 1HNZT 4I43B 3ZC1A 3PDYA 5AQHB 4HFDA 4DMVA 5EZYE 4HFHA 1SA0E 4CN4A 1SE7A 4EZ4A 5AQOB 4QXCB 5AQFB 4H9QC 4PNIA 4ZS3A 4DV1T 1N36T 4Z91A 2I0MA 5JR9A 3PTRB 2V7JA 3IEEA 4HFEA 2MAWA 4LF9T 5FKYA 1IAPA 3CPZA 1N32T 3ZN0B 3AXJB 3IHRA 2YEVC 3LJCA 4X65T 2BS2A 5KMGP 2ACXA 3ZLIA 5JTGA 4DUZT 4LF7T 3AE9A 3P4SA 2BDEA 4NIQA 2CWYA 1IJ6A 3PV0F 3RX6A 1U5PA 3EHZA 1UX5A 4X62T 2FUPA 1VOMA 3RIAA 3UTKA 2BS4A 4QX7B 1Y64B 3AA1B 1HTJF 2XJ7A 4OYKA 5HXCA 2KINB 3PJAJ 5ABFB 4JI7T 2LSYA 4LFCT 4CI2B 2KNDA 4I50E 2YDRA 3NWIA 1N33T 1CUNA 2UUBT 3PU3A 5FVLA 4MBQA 5JVDE 2LKGA 5JR9C 3MKDA 3VRAA 3I9WA 3VHLA 2QGSA 3K3OA 4EEBA 4H9NC 4TNWA 1O3XA 4HE8A 3T8OA 4ISSA 1UGOA 3RH3A 4Q25A 4JI6T 5BR8T 5EK3A 4KI0F 3OYZA 5M4YA 2WSSV 1IBMT 4CI1B 5FXZA 3AEGA 1D0XA 3N9PA 1KFYA 1OWAA 3ABVA 2LEHA 1UURA 3FZFB 3C98B 3PUQA 1S94A 1NENA 2B1EA 2HN2A 5AQIB 4OK0A 2VKOA 4WYVA 3HR0A 1V9DA 3UU8A 3V5UA 3I0OA 5LHGB 1US7B 2WQYA 1FJGT 3M3ZB 3TKLB 1W09A 5DQVA 3AE8A 3AXJA 3NKZA 5CA1E 4U33A 2AXDS 2CE7A 4CI3B 3BQIA 3ZYLA 2WU2A 3AA6B 1UX4A 5AQQB 4ILCA 5FXXA 2JQQA 2XASB 2CLYB 2DI4A 4G63A 2IHR1 1BR1A 2HN1A 2Z6EA 4EXTA 4X66T 2WB5A 3NZQA 3HKEE 3K8PC 3PUGA 4IHJE 2XQ5A 5LOVE 2VVSA 4IE0A 3EUHA 4TWDA 4YXDA 5JRCB 4JV5T 3Q5EA 3J9X1 5JDLA 2N1GA 3RYIE 3A7MA 2XQ4A 4TZ4C 4NUUA 1I94T 1YQ3A 2FBWA 3HKBE 3Q5WA 2E9XB 2IIUA 5AFUL 4EYUA 2LRKA 4AQYT 3ZJ1A 2K3WA 5EK2A 1IBKT 2BKNA 3FZLB 3TLSA 4UV9B 2ACZA 4UVBB 3P4QA 2BKOA 3QOFA 1WFDA 5DQWA 2JMHA 3KV9A 3VR8A 5LG3A 5AQPB 4ZOLE 3RLFF 2XAJB 3AB3B 3HKCE 5LA6E 3LG7A 2V6YB 2C5JA 2XM1A 3CK6A 3G06A 2QA7A 3EVYA 4IDPA 4GYSA 5DABA 5JDFA 5HXRA 4DR7T 4O4JE 4ZI7E 5L3DB 3ZSSA 2FJDA 2ODVA 4GYRA 3ZYMA 4YSZA 2I6HA 2IC6A 2WP9A 2XUEA 2UXXB 5AQGB 3VKHA 1KK7A 2JQHA 4U2YA 5HEGA 5LHIB 5LGUB 5L4EA 2VKHA 1M7KA 2X0HA 3SWHA 5H6RB 4YTPA 1Z8UA 4WBNE 4ANJA 3RI5A 4A56A 2BBJA
chains in the Genus database with same CATH topology
2WWUA 2Q9QD 3N2KE 3HKDE 5E0OA 2XAGB 2XAQB 2JMKA 5L3EB 3U78A 4AKGA 3SS1A 5JDNA 3C4WA 5L3CB 4EAHA 3FBLA 2V7IA 3OBVE 5FYMA 2ZM8A 2X0LB 3AVRA 3KVAA 3ETVA 1G73A 3KV5A 2JPFA 4TUYE 1HX8A 3BK9A 3PUSA 4CZZB 4IDZA 4L0RA 3ONXA 4AI6A 3MA9A 2WBLA 3K3QC 2L9QA 3PE0A 4P0BA 2Q9QB 4AKLA 2N9DA 3FHNA 4EOZB 3LBXB 3FXEB 4AKHA 1LRZA 1UCUA 3E08A 4WNKA 3KFWX 3H3AA 4HEAA 5FNVE 5J1GA 3UUXB 4QWNB 4U74A 1VRBA 3C50A 2YK0A 1ZEEA 4QXBB 4UVCB 4H9OC 4U72A 5JRCA 3N9QA 3LFMA 4GOUA 2Y6XA 1YD8G 2LOPA 4Z8XA 5KX5E 4IE4A 4E7ZA 5HXEA 4H9SE 3O9XA 4EIWA 4X20E 4ZI2C 2D0TA 3I1AA 3JC6C 4TV9E 4F6RC 2V1DB 2M67A 2NOXA 2DWKA 3KDSE 2CEAA 1QUUA 1IJ5A 3GN5B 4C91A 4BA9A 3NZPA 4KMCA 4EB6E 2PJQA 2IW5B 3N9LA 3P7IA 3O1IA 5KDMC 3I9YA 3FBZA 2MYSA 1MNEA 4CXWA 4UIGA 2WMOA 1HG2A 1WLXA 1ZV4X 2K5BB 2KT9A 4PFOA 1FMVA 3L3PA 3Q2MA 2VWAA 4K0UA 3AA0B 4KUMB 1BR0A 4H9RC 2X9XA 1HF8A 2XAHB 4H9PC 5IYZE 5FP3A 2HPLA 3BQKA 1T98A 2K9AA 2ZMAA 3MXZA 3ZCIA 2ES0A 1MMNA 2IC9A 4IIJE 4X1IE 1BR4A 3ETUA 4EYYR 4ISTA 5FXWA 3S4UA 3Q9DA 1MIVA 3ZCJA 2VL8A 2YU2A 3LK2B 3ZMVB 2CLYC 4ZI2D 4H63H 3VU7H 4NUVA 4I43B 3CQGB 3R6NA 3ZC1A 2G0UA 3ZJ2A 3PDYA 1NWMX 4MLKA 4DMVA 3GA8A 1E1HB 5EZYE 3RYCE 1SA0E 4DO0A 2EHOD 2IAKA 3O1HA 4EZHA 4EZ4A 4IE6A 4YHJA 4QXCB 3MACA 4CXYA 4H9QC 5EK4A 1U4QA 4PNIA 4ZS3A 3CX8B 2ZM2A 2PBIA 2NTYA 2JRKA 1FIOA 1HFAA 2W62A 4YJ2E 3KVBA 2MTQA 4UF0A 2V7MA 3ZMZB 5L3BB 3N2GE 5F8PA 4AKRB 3SRZA 1HG5A 2L3LA 5JR9A 2BVMA 3PTRB 2V7JA 2H7VC 3KBTA 3N2OA 5LG4A 3IEEA 2EHOB 5LJMA 5LBMA 1D0ZA 4HKAA 3GWHA 3C4ZA 2JJ9A 1IAPA 5JREA 4ILUA 3CPZA 4H63V 5FXVA 3PU8A 4PJNA 4JEUB 2E9XC 3ZN0B 2K48A 2NP9A 3U3IA 3IHRA 2YEVC 2E8IA 3LJCA 4HGAA 2OA5A 3ZMUB 1Z0PA 3RKOA 5KMGP 2ACXA 3ZLIA 4TV8E 2CCQA 2ZM0A 1WYCA 4O2BE 4HFVA 5JDHA 3J7Yq 3CVRA 4FI5A 3UUNA 3Q5XA 4WW0A 3OKQA 4FJOA 1OXZA 4I55E 4XAXB 1LKXA 3ZEFB 2BDEA 2CWYA 1IJ6A 2A72A 2N2NA 1B7TA 3FXDB 1YW0A 5HXHA 3RX6A 1U5PA 2LOSA 1UX5A 3R84B 4V1Av 2MOZA 1VOMA 3UTKA 3K3NA 2KWIB 1X79A 4WBOA 4CQIA 4PK5A 4QX7B 4GK0E 1Y64B 5LHHB 3MZKB 3AA1B 2CXDA 5JDGA 4GK5E 2DCFA 1HTJF 1KNZA 1D0YA 2LT3A 3QC9A 2DHRA 4OYKA 3NRYA 5HXCA 4TX5A 2KINB 5HYAA 1MNDA 4G2AA 3NRXA 1HS7A 2XTLA 4O4LE 2LSYA 3LBXA 3L09A 4CI2B 2KNDA 2NTXA 3OJAA 4I50E 4BJMA 3ZYKA 5JH7E 3OYXA 2L8KA 3HI2A 2RA1A 3KBUA 4DMWA 5GONE 1CUNA 3EDUA 3RC3A 3C51A 4PW8A 2NW7A 3PU3A 2E9XA 4MBQA 5JVDE 5L3FB 3QK6A 3MKDA 5JR9C 2A3DA 3I9WA 3VHLA 2V7KA 2QGSA 1SHZC 3K3OA 4H9NC 3CQXC 5LGTB 3DP7A 1G8XA 1BR2A 4O4HE 2DLRA 5LNKA 1O3XA 4HE8A 4OFZA 3T8OA 4ISSA 2X68A 3GN5A 5CA0E 3ANWB 1ZKEA 3DJBA 3E22E 3RH3A 5HWYA 3ZMSB 4JLEA 2WAUA 4AXPA 2KMFA 2W00A 3N5LA 3CX7B 3PUAA 3E0ZA 5EK3A 2D5UA 4C90A 3OYZA 2NWBA 2NW9A 5M4YA 2MBGA 2LHRA 2WMNA 3WAJA 2WSSV 3ZC0A 2A2FX 3C4XA 4YLHA 4CI1B 4DVDA 3C64A 4L9IA 4UXNB 5FXZA 3JC6D 1D0XA 3N9PA 1OWAA 3RC8A 2LEHA 4PJLA 3WI3A 3PUQA 3C98B 4JEHB 1S94A 2B1EA 2CXLA 2VB6A 3CQCB 4TN7B 2YINA 4AQFA 1FMWA 4KP3C 1MIYA 3RYFE 3ZMTB 3UULA 3CKDA 2ODUA 4OK0A 2RP4A 2VKOA 1NAFA 1HCIA 2D2SA 3HR0A 1V9DA 4DBRA 4XZCA 5FY0A 2Q9QC 4ASKA 3HA4A 3UUMA 5L2LA 3V5UA 5DJQC 5HXSA 3I0OA 5J2TE 3BQLA 5J2UE 2P9BA 3D0TA 2LHNA 2GK9A 4O2AE 5LXTE 5LHGB 5L3GB 1US7B 1MMAA 5ADXL 4PK6A 1FEWA 1WR6A 2VKDA 3B13A 2J1DG 5LCYA 3UT5E 2KXPB 2LJLA 3A5XA 2ZLYA 1YKHB 3P8CD 2XQYA 2EHOA 2V26A 2X67A 1WRDA 3TKLB 3AVSA 4L5GA 3PURA 5F3JA 5DQVA 3AAIA 4YJ3E 2BZBA 3I0QA 4MHCA 2CM0A 4ZI3C 5CA1E 2V7LA 3FB2A 4CI3B 2CE7A 3F31A 3BQIA 4P09A 3AAEB 3ZYLA 2VASA 3AA6B 1UX4A 1D1BA 3F57A 2DNXA 2WM9A 3W15B 5FXXA 2JQQA 2XASB 2CLYB 2DI4A 3LK3B 4G63A 3AAAB 4GIWA 2W0GA 4OHFA 3RRCA 4KBMB 4X1YE 4MFRA 4IGUA 1MIWA 1IZNB 2BVLA 4QX8B 4UEMA 1BR1A 1D1CA 2LSKA 3IF8B 5ETWA 3O1JA 4XBFB 4M1PA 2Z6EA 4BJNA 4EXTA 2E9XD 2PFVA 2X66A 2Q9QA 3NZQA 5LYJE 2H3RA 3ESLA 4CXXA 3HKEE 2I59A 3K8PC 4AQFC 3PUGA 5LGNB 2DWGA 2LSGA 2PG8A 4IHJE 5LBQB 3M65A 4IE7A 4X1KE 5LOVE 4IE0A 3EUHA 3KV6A 5JRCB 2CMRA 2X9YA 3J9X1 4QKNA 5JDLA 4PJMA 2N1GA 3RYIE 4ZI3D 4TZ4C 5HWXA 3LK42 3HL6A 2W61A 4NUUA 4ZS2A 3HKBE 4JUYA 3Q5WA 2E9XB 2HH7A 5AFUL 4EYUA 1H7CA 2LSIA 4HTEA 2CA5A 3N9OA 3SOLA 2LM9A 3ZJ1A 3N9NA 4PAGA 4ERRA 5EK2A 2EHOC 4AQGA 3MJXA 4PJJA 4UV9B 4I4TE 4QXHB 4UVBB 2KZ7B 1S35A 3ANWA 4MALA 2XHEB 5LJNA 2HPJA 2UXNB 3AA7B 5H6QB 1ZHCA 4PK4A 5DQWA 2JMHA 3GMIA 3KV9A 4HN9A 4ADZA 2C5KT 3CWZB 5CB4E 4AKIA 1MMGA 2Y8DA 3F2EA 3IBPA 4YFSA 4ZOLE 1EZ3A 4J2CA 3MK7C 5LP6E 1LVFA 1MMDA 2X9HA 2XAJB 4OYJA 3O4XE 3AB3B 4ZHQE 5HAXA 5C8YE 3CX6B 1WYBA 3HKCE 5LA6E 5IHYA 5JDQA 4DNDA 5FMNA 3LG7A 3NBXX 4UELA 2C5JA 4PFPA 4QHOA 2QA7A 3EVYA 4BAYB 3N9MA 2C5IT 3RRWA 4GYSA 5DABA 2CXFA 4UV8B 5JDFA 3WAKA 1QSDA 5HXRA 4E7SA 5JDMA 4UVAB 5TAOA 2CWOA 5FY7A 2NW8A 2X51A 3KINB 4UF0B 3RPUA 4DBQA 4P0AA 5FY1A 2VKJA 3QUJA 4O4JE 4ZI7E 2H7OA 5L3DB 2Y48B 5JR9B 2ODVA 5A1LA 4GYRA 2W63A 3ZPOA 1YKEB 3CMLA 3ZYMA 4O4IE 2XAFB 2D0UA 3RYHE 2X9WA 4N78D 2IC6A 3B57A 5BMVE 3DTOA 2XUEA 2UXXB 3VKHA 1KK7A 2SPCA 2LE8A 5LHIB 4IE5A 5LGUB 2VKHA 3VKGA 2C0SA 2LSJA 3EDVA 3H37A 3SWHA 1LVKA 1D1AA 5H6RB 3V5SA 2VK9A 2K24A 3KV4A 1AJ3A 3ZN1B 4WBNE 2KLQA 3UFEA 4ANJA 2KWHA 5JQGE 4A56A 2YU1A 4O8SA 4B6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EXT A;  4GK5 E;  2LSG A;  2LSK A;  2LSJ A;  2LSI A;  2LSY A;  4FJO A;  4BA9 A;  4GK0 E;  3VU7 H;  2N1G A; 
#chains in the Genus database with same CATH topology
 3N2K E;  5E0O A;  2XAG B;  1WR0 A;  3SS1 A;  5JDN A;  3FZH B;  2ZM8 A;  4TUY E;  1HX8 A;  5IWA T;  4AI6 A;  3AEC A;  4P0B A;  2Q9Q B;  4AKL A;  2WY2 A;  3FHN A;  1YXR A;  3FXE B;  4LMK A;  2WCA A;  1UCU A;  3KFW X;  5CFB A;  4U74 A;  1VRB A;  4QXB B;  2V8S V;  4H9O C;  5JRC A;  4GOU A;  1YD8 G;  2LOP A;  4Z8X A;  5HXE A;  4X20 E;  3I1A A;  2BG9 E;  4AIS A;  1QUU A;  3GN5 B;  4ILA A;  4BA9 A;  3NZP A;  4KMC A;  1HNX T;  2XQ7 A;  2PJQ A;  1WLX A;  5ABE A;  5L47 A;  3AEA A;  2X9X A;  5IYZ E;  3MXZ A;  2ZMA A;  3ONL C;  2H88 A;  3PUW F;  3ZMV B;  2W67 A;  2CLY C;  4NUV A;  3R6N A;  1UUS A;  1W0B A;  2V6Y A;  2UXD T;  2EHO D;  4IE6 A;  4YTM A;  1U4Q A;  3AE5 A;  3CX8 B;  2NTY A;  2XSB A;  1XNQ T;  3ZMZ B;  2WU5 A;  5L3B B;  3N2G E;  2WWV A;  5F8P A;  3SRZ A;  1KEY A;  4IDN A;  3N2O A;  5LG4 A;  3OVU A;  1NEK A;  4YHH T;  5LBM A;  5JRE A;  3L39 A;  2XM2 A;  4H63 V;  5C2T A;  2E9X C;  2NP9 A;  4HGA A;  5AQV B;  3RQU A;  2MPK A;  4TV8 E;  4HFV A;  2IDO B;  4EED A;  3Q5X A;  4WW0 A;  3RKG A;  4FJO A;  4XAX B;  2N2N A;  1YW0 A;  5HXH A;  2WS3 A;  2HHH T;  2LOS A;  3R84 B;  4CN1 A;  1XWM A;  4LF5 T;  4PK5 A;  5LHH B;  5JDG A;  4GK5 E;  1KNZ A;  2LT3 A;  3QNU A;  2KSR A;  2DHR A;  3NRY A;  5HYA A;  4G2A A;  3NRX A;  3OJA A;  3ZYK A;  3OYX A;  2L8K A;  2W2U A;  2RA1 A;  3KBU A;  2ZM6 T;  2LRL A;  3RC3 A;  3C51 A;  5AQN B;  5HEO A;  3QK6 A;  2V7K A;  4DV0 T;  2JQK A;  3VR9 A;  1G8X A;  5LNK A;  4OFZ A;  3GN5 A;  3DJB A;  3ZMS B;  2FJE A;  4IT4 A;  2WDV A;  3CX7 B;  4DV3 T;  2NW9 A;  4L9I A;  4EGW A;  3JC6 D;  1J5E T;  2V5C A;  4NXM T;  5AQM B;  1R8I A;  2CXL A;  4F8H A;  4TN7 B;  4AQF A;  3T1H T;  2ODU A;  5FL0 A;  4XZC A;  3JAF A;  2Q9Q C;  4NPP A;  3RQW A;  2A9U A;  4DID B;  3D0T A;  2LHN A;  5LXT E;  4DR3 T;  2VL0 A;  4PK6 A;  5ABG A;  4WZX A;  1WR6 A;  2J1D G;  5LCY A;  3UT5 E;  4LFA T;  2LJL A;  4U7Y A;  3ZT7 A;  5AQR B;  3P8C D;  3B5M A;  2XQY A;  2X67 A;  5F3J A;  3AAI A;  4ZXL A;  4I0U A;  2PTF A;  4ZI3 C;  4A5X A;  2OLT A;  3FB2 A;  4P09 A;  3AAE B;  2DNX A;  3W15 B;  4K0K T;  3ZT6 A;  4OHF A;  4X1Y E;  1MIW A;  4QX8 B;  3O1J A;  4XBF B;  4M1P A;  3L8R A;  4BJN A;  4B3T T;  2PFV A;  5LYJ E;  1XZY A;  2H3R A;  3ESL A;  2AE9 A;  2BBH A;  4AQF C;  2DWG A;  5LBQ B;  3PUZ F;  4IE7 A;  1HX1 B;  4X1K E;  3KV6 A;  2CMR A;  4PJM A;  4ZI3 D;  1J1J A;  3LK4 2;  2VVN A;  2E5V A;  1H7C A;  3ZKR A;  2LSI A;  4HTE A;  3UU6 A;  3SOL A;  3MJX A;  4PJJ A;  3H3M A;  2XHE B;  2JQ9 A;  2HPJ A;  5H6Q B;  1ZHC A;  5AQS B;  3TLU A;  2Y8D A;  3F2E A;  1EZ3 A;  3MK7 C;  4OYJ A;  2QYW A;  5C8Y E;  5JDQ A;  5FMN A;  3NBX X;  4HWF A;  4BAY B;  4TNV A;  3UU4 A;  1QSD A;  5JDM A;  4UVA B;  2NW8 A;  2X51 A;  4P0A A;  5FY1 A;  2WZH A;  1YKE B;  4O4I E;  2D0U A;  3RYH E;  2X9W A;  4N78 D;  3AED A;  5BMV E;  5HEH A;  3AE6 A;  2LKH A;  3VKG A;  2LSJ A;  3H37 A;  3AE3 A;  2FJA A;  1D1A A;  2FJB A;  2KWH A;  2F4V T;  4B6X A;  2WWU A;  2XAQ B;  4QH1 A;  5CJ5 A;  5L3E B;  3U78 A;  3AE2 A;  5L3C B;  5FYM A;  3KVA A;  3KV5 A;  2JPF A;  3UU5 A;  1L0V A;  4CZZ B;  4L0R A;  3ONX A;  5ABF A;  3LBX B;  3TLW A;  4AKH A;  1KF6 A;  2WDQ A;  3UUX B;  4QWN B;  1ZEE A;  4U72 A;  3LFM A;  2Y6X A;  3O9X A;  4EIW A;  2B76 A;  2D0T A;  4B3M T;  4TV9 E;  4F6R C;  2NOX A;  2DWK A;  3A8Y C;  3KDS E;  4IRE A;  3LSV A;  3EAB A;  4EV6 A;  2IW5 B;  3ONJ A;  5LMN T;  4HFC A;  3O1I A;  3FBZ A;  2MYS A;  4TWH A;  4CXW A;  4UIG A;  2WMO A;  2KT9 A;  2W4X A;  3L3P A;  3UUB A;  3AA0 B;  5AQK B;  2HPL A;  2K9A A;  4HWI B;  2ES0 A;  2IC9 A;  4IIJ E;  1BR4 A;  3ETU A;  4A97 A;  4COF A;  3Q9D A;  1MIV A;  3ZCJ A;  2YU2 A;  4DV5 T;  2XPK A;  3CQG B;  3ZJ2 A;  2G0U A;  3RF1 A;  1NWM X;  3AEB A;  4X64 T;  2IAK A;  4YHJ A;  3MAC A;  2IML A;  2PBI A;  2ZM2 A;  2JRK A;  1HFA A;  3KVB A;  2VQF T;  2MTQ A;  2V7M A;  2UU9 T;  2BVM A;  3SFD A;  5LJM A;  4HKA A;  3GWH A;  2JJ9 A;  4ILU A;  5FXV A;  4JBW F;  4PJN A;  3RHW A;  2K48 A;  3U3I A;  2OA5 A;  3RKO A;  2ZM0 A;  1WYC A;  4O2B E;  5JDH A;  3CVR A;  4FI5 A;  3UUN A;  4LFB T;  1OED B;  3OKQ A;  4DR4 T;  3ZEF B;  2XQ9 A;  1KNP A;  2A72 A;  1B7T A;  4DV2 T;  4LML A;  2J4G A;  3K3N A;  5AQJ B;  4CQI A;  5J0Z A;  4GK0 E;  2DCF A;  2X0Y A;  4JYA T;  1MND A;  3LBX A;  2NTX A;  5JH7 E;  2CBI A;  2XQA A;  3HI2 A;  2E5L T;  5GON E;  3EDU A;  4ZEY A;  2NW7 A;  4KHZ F;  5IUX A;  2E9X A;  2V5D A;  3AE7 A;  2YN6 A;  5L3F B;  1SHZ C;  3CQX C;  3DP7 A;  1BR2 A;  2X68 A;  5CA0 E;  3E22 E;  3TLT A;  4DR1 T;  2LM2 A;  4JLE A;  3N5L A;  2CRB A;  2CPT A;  3E0Z A;  2M6I A;  4C90 A;  2NWB A;  2WMN A;  3ZC0 A;  4DVD A;  3C64 A;  3RIF A;  3JAD A;  3RC8 A;  4U7I A;  3IA3 A;  4PJL A;  1VCS A;  4JEH B;  3JCF A;  2VB6 A;  3CQC B;  2YIN A;  1FMW A;  5F5W A;  3UUL A;  4U3C A;  4YTN A;  2D2S A;  1W9R A;  4DBR A;  3P50 A;  3CIR A;  3HA4 A;  3UUM A;  2J62 A;  1QLB A;  5DJQ C;  2GK9 A;  5L3G B;  4DUY T;  3UQ7 A;  5ADX L;  4YSX A;  1FEW A;  1XMO T;  2VKD A;  3A5X A;  4KX6 A;  1YKH B;  1DU2 A;  1WRD A;  4LMJ A;  5AQL B;  2J47 A;  3PUR A;  4ILB A;  2XQ3 A;  3K1S A;  2BZB A;  4MHC A;  2V7L A;  3F31 A;  4A98 A;  1D1B A;  2QRX A;  3LK3 B;  3AAA B;  2W0G A;  1OED A;  3RRC A;  4KBM B;  4MFR A;  3EI0 A;  2LSK A;  1N34 T;  2E9X D;  2Q9Q A;  5FL1 A;  4LF6 T;  4CXX A;  2I59 A;  2XZE A;  4U2Z A;  5LGN B;  3UU3 A;  1XDO A;  2X9Y A;  4QKN A;  3HL6 A;  2W61 A;  4ZS2 A;  4JUY A;  4X5T A;  4AIU A;  3N9O A;  1M62 A;  3OPC A;  3N9N A;  4PAG A;  4IDQ A;  4I4T E;  4QXH B;  2KZ7 B;  2UXN B;  1CHU A;  4PK4 A;  3GMI A;  3CWZ B;  5CB4 E;  3VRB A;  4AKI A;  1W0A A;  4J2C A;  5LP6 E;  1MMD A;  2X9H A;  4GKK T;  3O4X E;  4ZHQ E;  3CX6 B;  1WYB A;  3UFG A;  3AEE A;  1OED C;  4DND A;  4JI8 T;  3QB5 A;  4PFP A;  3RRW A;  2CXF A;  3T1Y T;  3WAK A;  5ABH A;  3RGL A;  4E7S A;  2CWO A;  3KIN B;  4UF0 B;  3RPU A;  4YT0 A;  2H7O A;  2Y48 B;  5FVK A;  5A1L A;  4YSY A;  2W63 A;  3CML A;  1XDP A;  2XAF B;  4GKJ T;  5AQU B;  3B57 A;  3DTO A;  2DL1 A;  2SPC A;  4IE5 A;  4JI3 T;  3EDV A;  2K24 A;  3KV4 A;  1AJ3 A;  3ZN1 B;  2KLQ A;  5JQG E;  3RIU A;  2YU1 A;  4O8S A;  2Q9Q D;  3PUV F;  2IUB A;  2JMK A;  4AKG A;  3C4W A;  4EAH A;  3FBL A;  2V7I A;  2X0L B;  1G73 A;  3BK9 A;  5C3J A;  3MA9 A;  3K3Q C;  2XQ6 A;  2L9Q A;  3P4W A;  4HWD A;  1HR0 T;  2M6B A;  4EOZ B;  4KHP T;  4DV6 T;  3UQ4 A;  3E08 A;  1VCT A;  5FNV E;  2YOE A;  4HEA A;  5J1G A;  3C50 A;  2UUC T;  4UVC B;  3N9Q A;  2QVA A;  5KX5 E;  2JIW A;  4E7Z A;  4ZI2 C;  3PUY F;  2LLY A;  2CEA A;  1IJ5 A;  2H89 A;  4C91 A;  4EB6 E;  3P7I A;  5KDM C;  4P1N A;  4DV7 T;  1MNE A;  4LF8 T;  2WDR A;  2K5B B;  3TLV A;  1SUM B;  3Q2M A;  4K0U A;  4KUM B;  3RIU C;  1BR0 A;  2R6G F;  3Q5D A;  3ZST A;  2XAH B;  4JI2 T;  4UR9 A;  4H9P C;  5FP3 A;  1T98 A;  3AE4 A;  3FZK B;  4EYY R;  4IST A;  5FXW A;  3LK2 B;  4ZI2 D;  4H63 H;  3VU7 H;  4MLK A;  3GA8 A;  1E1H B;  4DO0 A;  3FZM B;  3RYC E;  3O1H A;  4EZH A;  4ZZB A;  3NVO A;  1GQE A;  4CXY A;  5EK4 A;  2VQE T;  1FIO A;  2W62 A;  4YJ2 E;  2VUR A;  5CGM A;  2V6X A;  3P4P A;  4UF0 A;  4AKR B;  1HG5 A;  2L3L A;  3JAE A;  2H7V C;  3KBT A;  4HFI A;  2EHO B;  3SFE A;  1J5W A;  2XQ8 A;  1D0Z A;  2CBJ A;  3C4Z A;  3PU8 A;  4JEU B;  1X9B A;  2CHO A;  2E8I A;  3ZMU B;  1WCR A;  1Z0P A;  2CCQ A;  4DR5 T;  3J7Y q;  2YDS A;  1XNR T;  4I55 E;  1OXZ A;  1LKX A;  3FXD B;  4YY3 T;  4V1A v;  2MOZ A;  3PUX F;  4OX9 T;  2KWI B;  1X79 A;  4WBO A;  3MZK B;  2CXD A;  1D0Y A;  3QC9 A;  1E2A A;  5HEU A;  4HWC A;  4TX5 A;  1HS7 A;  2XTL A;  4O4L E;  3EAM A;  3L09 A;  2UUA T;  3AE1 A;  4BJM A;  2OV9 A;  4DMW A;  3PJA A;  4HWH A;  4PW8 A;  1UK5 A;  2BG9 B;  2A3D A;  4JI5 T;  5LGT B;  4O4H E;  2DLR A;  4IL4 A;  3ANW B;  1ZKE A;  3P4R A;  1I6Z A;  4B3S T;  5HWY A;  4QH4 A;  2WAU A;  4AXP A;  2KMF A;  2W00 A;  1IBL T;  5AQT B;  1JNZ A;  3PUA A;  4B3R T;  2D5U A;  2MBG A;  2LHR A;  3WAJ A;  2A2F X;  3C4X A;  4YLH A;  4UXN B;  3X1D A;  2CHN A;  2NR4 A;  1T72 A;  1Y01 A;  3WI3 A;  4NXN T;  2W66 A;  3RYF E;  4KP3 C;  1MIY A;  3ZMT B;  3CKD A;  2RP4 A;  1NAF A;  1HCI A;  5FY0 A;  4ASK A;  5L2L A;  5HXS A;  5J2T E;  3BQL A;  5J2U E;  2P9B A;  1XMQ T;  4O2A E;  1MMA A;  3B13 A;  3AEF A;  2KXP B;  2ZLY A;  2EHO A;  4JI1 T;  2V26 A;  3AVS A;  4L5G A;  4YJ3 E;  4Z90 A;  3I0Q A;  1YQ4 A;  2CM0 A;  2D9D A;  2YKS A;  2VAS A;  3F57 A;  2WM9 A;  1KNR A;  1ZP0 A;  4GIW A;  5KXJ A;  4IGU A;  2BVL A;  1IZN B;  4UEM A;  1D1C A;  3IF8 B;  5ETW A;  4U31 A;  2X66 A;  5HCM A;  2RPA A;  2YDQ A;  2LSG A;  2PG8 A;  3M65 A;  4CN6 A;  4IL9 A;  5HWX A;  4JI0 T;  2HH7 A;  1JNR A;  2BG9 A;  2CA5 A;  2LM9 A;  3ZT5 A;  4ERR A;  4DR2 T;  2EHO C;  4AQG A;  1S35 A;  3ANW A;  4MAL A;  5HEJ A;  5LJN A;  3AA7 B;  3LDQ B;  4HN9 A;  4ADZ A;  2C5K T;  1MMG A;  3IBP A;  4YFS A;  1LVF A;  4ZZC A;  5HAX A;  5IHY A;  4UEL A;  1T8B A;  4DR6 T;  4QHO A;  5L4H A;  3N9M A;  2C5I T;  4UV8 B;  5TAO A;  5HCJ A;  5FY7 A;  1ZOY A;  5LB7 B;  4DBQ A;  4QH5 A;  2VKJ A;  3QUJ A;  5JR9 B;  3ZPO A;  2XSA A;  2BKP A;  2UXB T;  4LF4 T;  2LE8 A;  2BG9 C;  2C0S A;  1LVK A;  3V5S A;  2VK9 A;  3UFE A;  2XY8 B;  3OTO T;  3HKD E;  1E7P A;  4TWF A;  2BS3 A;  4HFB A;  1OED E;  3OBV E;  3AVR A;  3ETV A;  3QB5 K;  5LMU T;  3PUS A;  4JI4 T;  4IDZ A;  2WBL A;  3PE0 A;  2N9D A;  2E2A A;  1LRZ A;  4WNK A;  3H3A A;  2YK0 A;  1T7S A;  4IE4 A;  4H9S E;  4DV4 T;  2WZI A;  3JC6 C;  2V1D B;  2M67 A;  2UXC T;  3N9L A;  3I9Y A;  1HG2 A;  1ZV4 X;  4PFO A;  1FMV A;  2VWA A;  1HNW T;  4IDO A;  4H9R C;  1HF8 A;  3BQK A;  3ZCI A;  1MMN A;  4X1I E;  3S4U A;  2VL8 A;  1HNZ T;  4I43 B;  3ZC1 A;  3PDY A;  5AQH B;  4HFD A;  4DMV A;  5EZY E;  4HFH A;  1SA0 E;  4CN4 A;  1SE7 A;  4EZ4 A;  5AQO B;  4QXC B;  5AQF B;  4H9Q C;  4PNI A;  4ZS3 A;  4DV1 T;  1N36 T;  4Z91 A;  2I0M A;  5JR9 A;  3PTR B;  2V7J A;  3IEE A;  4HFE A;  2MAW A;  4LF9 T;  5FKY A;  1IAP A;  3CPZ A;  1N32 T;  3ZN0 B;  3AXJ B;  3IHR A;  2YEV C;  3LJC A;  4X65 T;  2BS2 A;  5KMG P;  2ACX A;  3ZLI A;  5JTG A;  4DUZ T;  4LF7 T;  3AE9 A;  3P4S A;  2BDE A;  4NIQ A;  2CWY A;  1IJ6 A;  3PV0 F;  3RX6 A;  1U5P A;  3EHZ A;  1UX5 A;  4X62 T;  2FUP A;  1VOM A;  3RIA A;  3UTK A;  2BS4 A;  4QX7 B;  1Y64 B;  3AA1 B;  1HTJ F;  2XJ7 A;  4OYK A;  5HXC A;  2KIN B;  3PJA J;  5ABF B;  4JI7 T;  2LSY A;  4LFC T;  4CI2 B;  2KND A;  4I50 E;  2YDR A;  3NWI A;  1N33 T;  1CUN A;  2UUB T;  3PU3 A;  5FVL A;  4MBQ A;  5JVD E;  2LKG A;  5JR9 C;  3MKD A;  3VRA A;  3I9W A;  3VHL A;  2QGS A;  3K3O A;  4EEB A;  4H9N C;  4TNW A;  1O3X A;  4HE8 A;  3T8O A;  4ISS A;  1UGO A;  3RH3 A;  4Q25 A;  4JI6 T;  5BR8 T;  5EK3 A;  4KI0 F;  3OYZ A;  5M4Y A;  2WSS V;  1IBM T;  4CI1 B;  5FXZ A;  3AEG A;  1D0X A;  3N9P A;  1KFY A;  1OWA A;  3ABV A;  2LEH A;  1UUR A;  3FZF B;  3C98 B;  3PUQ A;  1S94 A;  1NEN A;  2B1E A;  2HN2 A;  5AQI B;  4OK0 A;  2VKO A;  4WYV A;  3HR0 A;  1V9D A;  3UU8 A;  3V5U A;  3I0O A;  5LHG B;  1US7 B;  2WQY A;  1FJG T;  3M3Z B;  3TKL B;  1W09 A;  5DQV A;  3AE8 A;  3AXJ A;  3NKZ A;  5CA1 E;  4U33 A;  2AXD S;  2CE7 A;  4CI3 B;  3BQI A;  3ZYL A;  2WU2 A;  3AA6 B;  1UX4 A;  5AQQ B;  4ILC A;  5FXX A;  2JQQ A;  2XAS B;  2CLY B;  2DI4 A;  4G63 A;  2IHR 1;  1BR1 A;  2HN1 A;  2Z6E A;  4EXT A;  4X66 T;  2WB5 A;  3NZQ A;  3HKE E;  3K8P C;  3PUG A;  4IHJ E;  2XQ5 A;  5LOV E;  2VVS A;  4IE0 A;  3EUH A;  4TWD A;  4YXD A;  5JRC B;  4JV5 T;  3Q5E A;  3J9X 1;  5JDL A;  2N1G A;  3RYI E;  3A7M A;  2XQ4 A;  4TZ4 C;  4NUU A;  1I94 T;  1YQ3 A;  2FBW A;  3HKB E;  3Q5W A;  2E9X B;  2IIU A;  5AFU L;  4EYU A;  2LRK A;  4AQY T;  3ZJ1 A;  2K3W A;  5EK2 A;  1IBK T;  2BKN A;  3FZL B;  3TLS A;  4UV9 B;  2ACZ A;  4UVB B;  3P4Q A;  2BKO A;  3QOF A;  1WFD A;  5DQW A;  2JMH A;  3KV9 A;  3VR8 A;  5LG3 A;  5AQP B;  4ZOL E;  3RLF F;  2XAJ B;  3AB3 B;  3HKC E;  5LA6 E;  3LG7 A;  2V6Y B;  2C5J A;  2XM1 A;  3CK6 A;  3G06 A;  2QA7 A;  3EVY A;  4IDP A;  4GYS A;  5DAB A;  5JDF A;  5HXR A;  4DR7 T;  4O4J E;  4ZI7 E;  5L3D B;  3ZSS A;  2FJD A;  2ODV A;  4GYR A;  3ZYM A;  4YSZ A;  2I6H A;  2IC6 A;  2WP9 A;  2XUE A;  2UXX B;  5AQG B;  3VKH A;  1KK7 A;  2JQH A;  4U2Y A;  5HEG A;  5LHI B;  5LGU B;  5L4E A;  2VKH A;  1M7K A;  2X0H A;  3SWH A;  5H6R B;  4YTP A;  1Z8U A;  4WBN E;  4ANJ A;  3RI5 A;  4A56 A;  2BBJ A; 
#chains in the Genus database with same CATH homology
 2WWU A;  2Q9Q D;  3N2K E;  3HKD E;  5E0O A;  2XAG B;  2XAQ B;  2JMK A;  5L3E B;  3U78 A;  4AKG A;  3SS1 A;  5JDN A;  3C4W A;  5L3C B;  4EAH A;  3FBL A;  2V7I A;  3OBV E;  5FYM A;  2ZM8 A;  2X0L B;  3AVR A;  3KVA A;  3ETV A;  1G73 A;  3KV5 A;  2JPF A;  4TUY E;  1HX8 A;  3BK9 A;  3PUS A;  4CZZ B;  4IDZ A;  4L0R A;  3ONX A;  4AI6 A;  3MA9 A;  2WBL A;  3K3Q C;  2L9Q A;  3PE0 A;  4P0B A;  2Q9Q B;  4AKL A;  2N9D A;  3FHN A;  4EOZ B;  3LBX B;  3FXE B;  4AKH A;  1LRZ A;  1UCU A;  3E08 A;  4WNK A;  3KFW X;  3H3A A;  4HEA A;  5FNV E;  5J1G A;  3UUX B;  4QWN B;  4U74 A;  1VRB A;  3C50 A;  2YK0 A;  1ZEE A;  4QXB B;  4UVC B;  4H9O C;  4U72 A;  5JRC A;  3N9Q A;  3LFM A;  4GOU A;  2Y6X A;  1YD8 G;  2LOP A;  4Z8X A;  5KX5 E;  4IE4 A;  4E7Z A;  5HXE A;  4H9S E;  3O9X A;  4EIW A;  4X20 E;  4ZI2 C;  2D0T A;  3I1A A;  3JC6 C;  4TV9 E;  4F6R C;  2V1D B;  2M67 A;  2NOX A;  2DWK A;  3KDS E;  2CEA A;  1QUU A;  1IJ5 A;  3GN5 B;  4C91 A;  4BA9 A;  3NZP A;  4KMC A;  4EB6 E;  2PJQ A;  2IW5 B;  3N9L A;  3P7I A;  3O1I A;  5KDM C;  3I9Y A;  3FBZ A;  2MYS A;  1MNE A;  4CXW A;  4UIG A;  2WMO A;  1HG2 A;  1WLX A;  1ZV4 X;  2K5B B;  2KT9 A;  4PFO A;  1FMV A;  3L3P A;  3Q2M A;  2VWA A;  4K0U A;  3AA0 B;  4KUM B;  1BR0 A;  4H9R C;  2X9X A;  1HF8 A;  2XAH B;  4H9P C;  5IYZ E;  5FP3 A;  2HPL A;  3BQK A;  1T98 A;  2K9A A;  2ZMA A;  3MXZ A;  3ZCI A;  2ES0 A;  1MMN A;  2IC9 A;  4IIJ E;  4X1I E;  1BR4 A;  3ETU A;  4EYY R;  4IST A;  5FXW A;  3S4U A;  3Q9D A;  1MIV A;  3ZCJ A;  2VL8 A;  2YU2 A;  3LK2 B;  3ZMV B;  2CLY C;  4ZI2 D;  4H63 H;  3VU7 H;  4NUV A;  4I43 B;  3CQG B;  3R6N A;  3ZC1 A;  2G0U A;  3ZJ2 A;  3PDY A;  1NWM X;  4MLK A;  4DMV A;  3GA8 A;  1E1H B;  5EZY E;  3RYC E;  1SA0 E;  4DO0 A;  2EHO D;  2IAK A;  3O1H A;  4EZH A;  4EZ4 A;  4IE6 A;  4YHJ A;  4QXC B;  3MAC A;  4CXY A;  4H9Q C;  5EK4 A;  1U4Q A;  4PNI A;  4ZS3 A;  3CX8 B;  2ZM2 A;  2PBI A;  2NTY A;  2JRK A;  1FIO A;  1HFA A;  2W62 A;  4YJ2 E;  3KVB A;  2MTQ A;  4UF0 A;  2V7M A;  3ZMZ B;  5L3B B;  3N2G E;  5F8P A;  4AKR B;  3SRZ A;  1HG5 A;  2L3L A;  5JR9 A;  2BVM A;  3PTR B;  2V7J A;  2H7V C;  3KBT A;  3N2O A;  5LG4 A;  3IEE A;  2EHO B;  5LJM A;  5LBM A;  1D0Z A;  4HKA A;  3GWH A;  3C4Z A;  2JJ9 A;  1IAP A;  5JRE A;  4ILU A;  3CPZ A;  4H63 V;  5FXV A;  3PU8 A;  4PJN A;  4JEU B;  2E9X C;  3ZN0 B;  2K48 A;  2NP9 A;  3U3I A;  3IHR A;  2YEV C;  2E8I A;  3LJC A;  4HGA A;  2OA5 A;  3ZMU B;  1Z0P A;  3RKO A;  5KMG P;  2ACX A;  3ZLI A;  4TV8 E;  2CCQ A;  2ZM0 A;  1WYC A;  4O2B E;  4HFV A;  5JDH A;  3J7Y q;  3CVR A;  4FI5 A;  3UUN A;  3Q5X A;  4WW0 A;  3OKQ A;  4FJO A;  1OXZ A;  4I55 E;  4XAX B;  1LKX A;  3ZEF B;  2BDE A;  2CWY A;  1IJ6 A;  2A72 A;  2N2N A;  1B7T A;  3FXD B;  1YW0 A;  5HXH A;  3RX6 A;  1U5P A;  2LOS A;  1UX5 A;  3R84 B;  4V1A v;  2MOZ A;  1VOM A;  3UTK A;  3K3N A;  2KWI B;  1X79 A;  4WBO A;  4CQI A;  4PK5 A;  4QX7 B;  4GK0 E;  1Y64 B;  5LHH B;  3MZK B;  3AA1 B;  2CXD A;  5JDG A;  4GK5 E;  2DCF A;  1HTJ F;  1KNZ A;  1D0Y A;  2LT3 A;  3QC9 A;  2DHR A;  4OYK A;  3NRY A;  5HXC A;  4TX5 A;  2KIN B;  5HYA A;  1MND A;  4G2A A;  3NRX A;  1HS7 A;  2XTL A;  4O4L E;  2LSY A;  3LBX A;  3L09 A;  4CI2 B;  2KND A;  2NTX A;  3OJA A;  4I50 E;  4BJM A;  3ZYK A;  5JH7 E;  3OYX A;  2L8K A;  3HI2 A;  2RA1 A;  3KBU A;  4DMW A;  5GON E;  1CUN A;  3EDU A;  3RC3 A;  3C51 A;  4PW8 A;  2NW7 A;  3PU3 A;  2E9X A;  4MBQ A;  5JVD E;  5L3F B;  3QK6 A;  3MKD A;  5JR9 C;  2A3D A;  3I9W A;  3VHL A;  2V7K A;  2QGS A;  1SHZ C;  3K3O A;  4H9N C;  3CQX C;  5LGT B;  3DP7 A;  1G8X A;  1BR2 A;  4O4H E;  2DLR A;  5LNK A;  1O3X A;  4HE8 A;  4OFZ A;  3T8O A;  4ISS A;  2X68 A;  3GN5 A;  5CA0 E;  3ANW B;  1ZKE A;  3DJB A;  3E22 E;  3RH3 A;  5HWY A;  3ZMS B;  4JLE A;  2WAU A;  4AXP A;  2KMF A;  2W00 A;  3N5L A;  3CX7 B;  3PUA A;  3E0Z A;  5EK3 A;  2D5U A;  4C90 A;  3OYZ A;  2NWB A;  2NW9 A;  5M4Y A;  2MBG A;  2LHR A;  2WMN A;  3WAJ A;  2WSS V;  3ZC0 A;  2A2F X;  3C4X A;  4YLH A;  4CI1 B;  4DVD A;  3C64 A;  4L9I A;  4UXN B;  5FXZ A;  3JC6 D;  1D0X A;  3N9P A;  1OWA A;  3RC8 A;  2LEH A;  4PJL A;  3WI3 A;  3PUQ A;  3C98 B;  4JEH B;  1S94 A;  2B1E A;  2CXL A;  2VB6 A;  3CQC B;  4TN7 B;  2YIN A;  4AQF A;  1FMW A;  4KP3 C;  1MIY A;  3RYF E;  3ZMT B;  3UUL A;  3CKD A;  2ODU A;  4OK0 A;  2RP4 A;  2VKO A;  1NAF A;  1HCI A;  2D2S A;  3HR0 A;  1V9D A;  4DBR A;  4XZC A;  5FY0 A;  2Q9Q C;  4ASK A;  3HA4 A;  3UUM A;  5L2L A;  3V5U A;  5DJQ C;  5HXS A;  3I0O A;  5J2T E;  3BQL A;  5J2U E;  2P9B A;  3D0T A;  2LHN A;  2GK9 A;  4O2A E;  5LXT E;  5LHG B;  5L3G B;  1US7 B;  1MMA A;  5ADX L;  4PK6 A;  1FEW A;  1WR6 A;  2VKD A;  3B13 A;  2J1D G;  5LCY A;  3UT5 E;  2KXP B;  2LJL A;  3A5X A;  2ZLY A;  1YKH B;  3P8C D;  2XQY A;  2EHO A;  2V26 A;  2X67 A;  1WRD A;  3TKL B;  3AVS A;  4L5G A;  3PUR A;  5F3J A;  5DQV A;  3AAI A;  4YJ3 E;  2BZB A;  3I0Q A;  4MHC A;  2CM0 A;  4ZI3 C;  5CA1 E;  2V7L A;  3FB2 A;  4CI3 B;  2CE7 A;  3F31 A;  3BQI A;  4P09 A;  3AAE B;  3ZYL A;  2VAS A;  3AA6 B;  1UX4 A;  1D1B A;  3F57 A;  2DNX A;  2WM9 A;  3W15 B;  5FXX A;  2JQQ A;  2XAS B;  2CLY B;  2DI4 A;  3LK3 B;  4G63 A;  3AAA B;  4GIW A;  2W0G A;  4OHF A;  3RRC A;  4KBM B;  4X1Y E;  4MFR A;  4IGU A;  1MIW A;  1IZN B;  2BVL A;  4QX8 B;  4UEM A;  1BR1 A;  1D1C A;  2LSK A;  3IF8 B;  5ETW A;  3O1J A;  4XBF B;  4M1P A;  2Z6E A;  4BJN A;  4EXT A;  2E9X D;  2PFV A;  2X66 A;  2Q9Q A;  3NZQ A;  5LYJ E;  2H3R A;  3ESL A;  4CXX A;  3HKE E;  2I59 A;  3K8P C;  4AQF C;  3PUG A;  5LGN B;  2DWG A;  2LSG A;  2PG8 A;  4IHJ E;  5LBQ B;  3M65 A;  4IE7 A;  4X1K E;  5LOV E;  4IE0 A;  3EUH A;  3KV6 A;  5JRC B;  2CMR A;  2X9Y A;  3J9X 1;  4QKN A;  5JDL A;  4PJM A;  2N1G A;  3RYI E;  4ZI3 D;  4TZ4 C;  5HWX A;  3LK4 2;  3HL6 A;  2W61 A;  4NUU A;  4ZS2 A;  3HKB E;  4JUY A;  3Q5W A;  2E9X B;  2HH7 A;  5AFU L;  4EYU A;  1H7C A;  2LSI A;  4HTE A;  2CA5 A;  3N9O A;  3SOL A;  2LM9 A;  3ZJ1 A;  3N9N A;  4PAG A;  4ERR A;  5EK2 A;  2EHO C;  4AQG A;  3MJX A;  4PJJ A;  4UV9 B;  4I4T E;  4QXH B;  4UVB B;  2KZ7 B;  1S35 A;  3ANW A;  4MAL A;  2XHE B;  5LJN A;  2HPJ A;  2UXN B;  3AA7 B;  5H6Q B;  1ZHC A;  4PK4 A;  5DQW A;  2JMH A;  3GMI A;  3KV9 A;  4HN9 A;  4ADZ A;  2C5K T;  3CWZ B;  5CB4 E;  4AKI A;  1MMG A;  2Y8D A;  3F2E A;  3IBP A;  4YFS A;  4ZOL E;  1EZ3 A;  4J2C A;  3MK7 C;  5LP6 E;  1LVF A;  1MMD A;  2X9H A;  2XAJ B;  4OYJ A;  3O4X E;  3AB3 B;  4ZHQ E;  5HAX A;  5C8Y E;  3CX6 B;  1WYB A;  3HKC E;  5LA6 E;  5IHY A;  5JDQ A;  4DND A;  5FMN A;  3LG7 A;  3NBX X;  4UEL A;  2C5J A;  4PFP A;  4QHO A;  2QA7 A;  3EVY A;  4BAY B;  3N9M A;  2C5I T;  3RRW A;  4GYS A;  5DAB A;  2CXF A;  4UV8 B;  5JDF A;  3WAK A;  1QSD A;  5HXR A;  4E7S A;  5JDM A;  4UVA B;  5TAO A;  2CWO A;  5FY7 A;  2NW8 A;  2X51 A;  3KIN B;  4UF0 B;  3RPU A;  4DBQ A;  4P0A A;  5FY1 A;  2VKJ A;  3QUJ A;  4O4J E;  4ZI7 E;  2H7O A;  5L3D B;  2Y48 B;  5JR9 B;  2ODV A;  5A1L A;  4GYR A;  2W63 A;  3ZPO A;  1YKE B;  3CML A;  3ZYM A;  4O4I E;  2XAF B;  2D0U A;  3RYH E;  2X9W A;  4N78 D;  2IC6 A;  3B57 A;  5BMV E;  3DTO A;  2XUE A;  2UXX B;  3VKH A;  1KK7 A;  2SPC A;  2LE8 A;  5LHI B;  4IE5 A;  5LGU B;  2VKH A;  3VKG A;  2C0S A;  2LSJ A;  3EDV A;  3H37 A;  3SWH A;  1LVK A;  1D1A A;  5H6R B;  3V5S A;  2VK9 A;  2K24 A;  3KV4 A;  1AJ3 A;  3ZN1 B;  4WBN E;  2KLQ A;  3UFE A;  4ANJ A;  2KWH A;  5JQG E;  4A56 A;  2YU1 A;  4O8S A;  4B6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...