4BA9A

The structural basis for the coordination of y-family translesion dna polymerases by rev1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
114
structure length
104
Chain Sequence
GPHMHKKSFFDKKRSERASNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structural Basis for the Coordination of Y- Family Translesion DNA Polymerases by Rev1
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords DNA POLYMERASE KAPPA, DNA REPAIR PROTEIN REV1
total genus 40
structure length 104
sequence length 114
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4ba9A00
2LSIA 4GK5E 2LSKA 3VU7H 2LSJA 4GK0E 4BA9A 2LSYA 4FJOA 2N1GA 4EXTA 2LSGA
chains in the Genus database with same CATH superfamily
4DR3T 3N9PA 4WYVA 5FKYA 3KV9A 3GWHA 3I0OA 1SA0E 1FEWA 3CMLA 1OXZA 5AQVB 5L3BB 1UK5A 3AEDA 3G06A 5KXJA 2V6XA 2I59A 3ABVA 5AQJB 5CA0E 1D0ZA 2LHRA 1HFAA 2Y6XA 4H63V 3ZC1A 5L3DB 1SHZC 4AKHA 4OX9T 3PUYF 2JIWA 3ZYKA 5FVKA 3KVBA 4JI2T 2NTXA 2FJEA 4X1IE 3NWIA 2EHOB 1T98A 3PJAJ 4ZI2C 2C5IT 2HH7A 2LHNA 1IJ5A 1G8XA 3T8OA 2KT9A 5LGNB 3NRYA 2XQYA 4PFOA 3K8PC 5L4HA 3D0TA 1OWAA 2JQ9A 3KVAA 4DV3T 4BJNA 1BR1A 4GKJT 2CHNA 2D0TA 2HHHT 4JI6T 3MACA 4EZHA 4DBRA 3R84B 4AKLA 1XMOT 4B3RT 2DWGA 2VK9A 3ETUA 3AE6A 3PU3A 3PUVF 5KX5E 5JRCB 2X67A 1UCUA 1XWMA 3AAEB 3H3AA 3P4PA 4TN7B 5AQKB 2ACXA 2WDQA 3WAKA 2E9XD 4O2BE 4IE0A 3RH3A 4YSZA 3FBLA 4IDNA 4ZOLE 1OEDE 1I6ZA 2XQ9A 3C4ZA 3IHRA 3LG7A 2JJ9A 3AXJA 3UUMA 2XM2A 3FZMB 4TWDA 4U3CA 3CKDA 2BKOA 2KMFA 4KMCA 4ZI3C 5FP3A 3RKGA 3RRCA 4DR2T 3FHNA 4O4LE 1J1JA 2PTFA 2Q9QB 3LDQB 1MNEA 4CN4A 2ACZA 1IBKT 4MALA 2ZLYA 5LP6E 4AKGA 3PUZF 1WR6A 2EHOC 3HI2A 1US7B 3UUBA 2BS2A 3F31A 1E7PA 1YW0A 2NP9A 2DL1A 4YJ3E 5FXZA 4HFHA 5HXCA 2NW7A 3C98B 4KBMB 4B3MT 5LG4A 4P09A 5JR9C 4DR1T 3AAAB 2WM9A 4WZXA 4DV7T 2I6HA 4ZS3A 3AXJB 2D9DA 2VB6A 2UXXB 3JCFA 3KINB 3KV6A 3QOFA 5H6RB 5J1GA 4B3TT 5JH7E 2WWUA 3FZLB 4CI2B 2XAGB 4IL9A 3CX6B 4UV9B 4ISSA 3VRBA 2ODUA 2YU1A 1HG2A 2YEVC 1NEKA 2KWHA 3PURA 4U7YA 5A1LA 4AKIA 3ZMSB 1L0VA 1SE7A 4DIDB 4EAHA 4UVCB 4PK5A 2E8IA 4LF5T 2QYWA 2W2UA 2CBIA 2WQYA 2MYSA 3AB3B 3AA0B 1BR2A 1G73A 3ANWA 3EAMA 3M3ZB 3NBXX 4H63H 2VURA 4V1Av 5AQQB 2Q9QC 2WU2A 2V5CA 4UVAB 2V7KA 3AECA 2XTLA 5M4YA 2IIUA 3KDSE 1Y64B 4H9OC 4DV4T 2XQ3A 3RGLA 3RYFE 5LB7B 4IHJE 3VU7H 4EOZB 5JTGA 3UU3A 1MIWA 4JI8T 4PFPA 5FYMA 4UELA 4YTPA 4O4HE 1WFDA 2YINA 2WMOA 5JR9B 4H9RC 3P4SA 4EGWA 2IC6A 2VKDA 2A3DA 2M6BA 5HWXA 2KZ7B 5JRCA 1IJ6A 3ANWB 2LOPA 2X0LB 4NUUA 3ESLA 3OYXA 3DJBA 4OHFA 3VR8A 3CQCB 2J4GA 3RQWA 2WS3A 2H89A 3ZT7A 1YQ3A 2OLTA 3K1SA 1WCRA 3P4QA 4HWIB 4ADZA 2ES0A 4GOUA 4F6RC 5LHGB 5LBMA 3AAIA 2JQHA 3KFWX 1NAFA 1N36T 4ILCA 2LM2A 1W0AA 3N9QA 3P8CD 4KUMB 4O4JE 2QVAA 5J2TE 3N5LA 1HX8A 4Z8XA 3RYIE 1U5PA 3HL6A 3M65A 3KBTA 3PE0A 2NW9A 4DMVA 1KNZA 3N9OA 3QNUA 4UEMA 5AQSB 3DP7A 4B3ST 5HEOA 4YJ2E 5ABEA 1FJGT 1UX5A 4A97A 4EYUA 4ZZBA 5AQGB 3RPUA 2CXLA 4K0KT 2CHOA 3AE9A 1XNRT 4MLKA 2W4XA 1JNZA 2A9UA 2G0UA 3EDVA 2XQ8A 4UXNB 2E2AA 3TLUA 2L9QA 4LF6T 3BQIA 2KINB 1W09A 3NZQA 4K0UA 3RRWA 5LXTE 1DU2A 2WAUA 4IIJE 4X1YE 4I55E 2UUCT 4U7IA 1KNPA 3P50A 4TNVA 5HEGA 4WBNE 1HNWT 3H37A 3BQLA 5LOVE 3PUXF 5HXSA 4JI1T 2DWKA 3QK6A 3AEEA 5GONE 4HFBA 2CLYC 2QA7A 4GYRA 4L9IA 4C90A 4BAYB 5ABFA 1XNQT 3B13A 2NOXA 2W0GA 4I4TE 2LOSA 4LMJA 4PAGA 4YLHA 3ZJ2A 3C4WA 2MAWA 2BBJA 5C8YE 5BR8T 4X65T 4OFZA 3ZMVB 4A5XA 4TWFA 3HA4A 3UU8A 5KMGP 1D1CA 4HKAA 4CN1A 3RIUA 5HEHA 2XZEA 5E0OA 3CK6A 2R6GF 4DUZT 1MMGA 1FMWA 1O3XA 3AEGA 3JADA 2D2SA 1XDOA 2WSSV 3ZSTA 1S94A 2W62A 4YY3T 2ODVA 3KBUA 4H9PC 4JI4T 5DJQC 2IC9A 4E7ZA 4QXBB 2LSIA 3OKQA 3Q5WA 4PW8A 3GN5B 3TLTA 5C3JA 5LG3A 1HTJF 2K9AA 3BQKA 5FY1A 3UU4A 3K3NA 3QB5A 3AE5A 2WCAA 3RIFA 3ZMUB 2HPLA 4DBQA 4HN9A 3F57A 1IZNB 1W9RA 2WZIA 4YSXA 2CLYB 4FJOA 3V5UA 4B6XA 2X51A 2RP4A 2YN6A 5JDLA 3AVRA 2L3LA 2CXFA 1MMDA 4F8HA 1BR4A 2JQQA 2UU9T 4Q25A 2CXDA 3HKBE 3MKDA 2X0HA 1UURA 1X79A 3AA6B 2B1EA 1MNDA 2VKOA 4FI5A 4KX6A 3R6NA 4PJJA 3SFDA 5FL1A 5F5WA 2IW5B 5AQTB 5JR9A 1J5ET 4UF0B 4NXNT 4HWFA 4OYJA 4UV8B 4CQIA 5JDHA 2FUPA 3TLWA 5AQMB 2YU2A 3CQGB 2LRLA 3NVOA 2VQET 4CXYA 5IWAT 4L0RA 3CX8B 3MXZA 5DABA 3C51A 1KEYA 3N2KE 5HEUA 5FL0A 2WWVA 3ZSSA 3O1IA 3IBPA 4HEAA 5FXWA 5HCJA 5AQPB 2BDEA 3U3IA 5L3EB 3HKCE 2E5LT 1EZ3A 4QWNB 4NPPA 4J2CA 3JAEA 5CB4E 4YTNA 4ZI7E 3HR0A 5HWYA 5HYAA 4JBWF 4HE8A 3ZCJA 3HKDE 5J2UE 5JDGA 3RLFF 4X5TA 2J1DG 4UF0A 4QH1A 4PJMA 3UUXB 4HWDA 5LCYA 3RIAA 2D0UA 3SS1A 3UT5E 3FBZA 2WU5A 2E5VA 5FNVE 3P4WA 2UXBT 2JMKA 3FZKB 1N34T 2BG9C 1ZOYA 4G2AA 1QSDA 2V26A 1S35A 3EABA 4U72A 3ZPOA 3N2GE 1VCTA 3KV4A 4AISA 4YHJA 1ZV4X 2KXPB 4GIWA 3AEBA 5LNKA 3PJAA 3LK42 4MBQA 4X64T 2CEAA 1XZYA 2VKHA 2LKGA 2WMNA 3GMIA 4HFVA 4KP3C 2LSJA 2X9WA 2W66A 3FZHB 1V9DA 2SPCA 2JPFA 2W67A 4QH5A 3J7Yq 4DVDA 4UVBB 3AA7B 2LKHA 4CI3B 4KI0F 4WBOA 4HWCA 4X1KE 3U78A 4CXWA 5LJMA 4YFSA 5ABFB 2UUAT 5L4EA 2CCQA 4CN6A 5FMNA 2UUBT 4JI0T 2XAHB 2I0MA 3K3OA 4PK4A 1LRZA 2H88A 1YD8G 2BBHA 2IHR1 3Q9DA 4BA9A 5L3CB 2BG9E 2C0SA 4N78D 3QUJA 2LRKA 3LBXB 1ZKEA 3NRXA 3EDUA 1R8IA 3O4XE 2FJDA 2XAQB 4DV1T 4XAXB 2XQ6A 2CBJA 2Y48B 3EUHA 2BKNA 1BR0A 5ADXL 4YTMA 3C4XA 2W61A 4ILAA 2M6IA 4ERRA 4EIWA 1M62A 4ZHQE 4AIUA 2CM0A 2W63A 5JVDE 1I94T 3F2EA 1WRDA 2K3WA 3ZC0A 4PJLA 1IBMT 3GN5A 2X0YA 4HWHA 3IA3A 3PUGA 4LF4T 1N32T 3OTOT 2IDOB 4LF8T 5IHYA 3ZYMA 4LF9T 5AQNB 3IEEA 1CUNA 2K48A 1FIOA 4U2ZA 4EV6A 2XUEA 4TV8E 2YKSA 2VWAA 2DNXA 1OEDC 4Z91A 2PG8A 4XBFB 1UUSA 4ZZCA 1Y01A 4EEBA 3AE8A 4QH4A 5AQRB 1KK7A 4A98A 3I9YA 3K3QC 4BJMA 3PV0F 2XJ7A 3OPCA 1D0YA 1JNRA 2LLYA 1YKEB 2PBIA 3EI0A 3I9WA 2XASB 1MMNA 3IF8B 3OVUA 4ZS2A 3VRAA 3MA9A 4EYYR 5CFBA 2XY8B 3CX7B 4EB6E 3N9MA 2BS4A 5JQGE 4AQGA 5LHIB 2CMRA 4PK6A 5JREA 4O4IE 4JI7T 3UUNA 3ZEFB 2ZM6T 2XAFB 3N9LA 3ZLIA 2X9HA 3P4RA 2AE9A 2KWIB 4I50E 1HX1B 2VASA 5H6QB 4X62T 3E08A 4HFCA 4DNDA 3JC6D 1Z8UA 3BK9A 5LA6E 3RF1A 3RHWA 3CIRA 2LEHA 3C64A 4DV6T 2M67A 4IGUA 3AE3A 2V7JA 1ZEEA 4ASKA 3TKLB 4NXMT 1M7KA 4I43B 3VKGA 2OA5A 2CPTA 2VL0A 4LMLA 3Q5EA 4LFCT 2XSAA 2LT3A 2X68A 3L39A 5HXHA 3ONLC 4M1PA 2XQ4A 4DV5T 3CQXC 3L09A 4H9SE 3ZN0B 5L47A 1IBLT 2A2FX 3NZPA 4GK5E 2JMHA 5F8PA 2B76A 5IYZE 2C5JA 4AQFC 4E7SA 3VKHA 1HNZT 1UGOA 2P9BA 2AXDS 4EXTA 1B7TA 4U31A 1X9BA 2JQKA 4IT4A 2GK9A 2D5UA 3UFGA 3J9X1 4JI5T 4JUYA 3VHLA 3ETVA 3EHZA 2IMLA 3ZN1B 4DV2T 4WW0A 4PJNA 2V8SV 5FXVA 3N2OA 3SWHA 5LGTB 3V5SA 3LK3B 4DO0A 4XZCA 2JRKA 4MHCA 2IUBA 2MOZA 2RPAA 2CA5A 5CA1E 2N2NA 2V5DA 5IUXA 4A56A 2LSKA 2WZHA 1MMAA 3AEAA 3RQUA 2YOEA 5EK2A 2F4VT 1Z0PA 3TLSA 3UULA 2DCFA 2PFVA 2PJQA 3DTOA 1W0BA 3PUWF 2V6YB 4JEHB 3SRZA 5CJ5A 5LMUT 1U4QA 1MIVA 2DI4A 2YDRA 3LBXA 2WP9A 4ILBA 1YQ4A 4U74A 5AQIB 5FY0A 3ZMZB 1NENA 4P0AA 3W15B 2VKJA 3Q5DA 1HNXT 4JYAT 2Q9QD 2J62A 4AQYT 5TAOA 1KNRA 3RI5A 5JDQA 2N1GA 2DHRA 2YDSA 3SFEA 4G63A 3RYCE 5HAXA 2BG9A 1T7SA 2C5KT 2IAKA 1LVKA 2LSGA 2V6YA 2WDVA 1NWMX 3OBVE 3OYZA 5EK4A 3AVSA 2E9XB 4H9NC 2WBLA 1WYBA 4ANJA 3T1YT 3HKEE 2QRXA 2VQFT 2WB5A 1GQEA 2DLRA 3MK7C 3MJXA 1HG5A 2BVMA 2YDQA 1YXRA 3QB5K 3ZYLA 5CGMA 3A7MA 3LK2B 4H9QC 4HGAA 3S4UA 4PNIA 4MFRA 4IREA 5FXXA 4TX5A 4P1NA 3AEFA 5AQOB 3UQ4A 2BZBA 4QX7B 5AFUL 3PUSA 2E9XA 4LMKA 2LM9A 2L8KA 2EHOD 3MZKB 2VVSA 3PTRB 2HN2A 2H7VC 5ABHA 3T1HT 4GKKT 4TNWA 4YSYA 2X9XA 1VCSA 1D1BA 2QGSA 4CZZB 2MTQA 1ZHCA 3AE4A 2KSRA 3PUAA 3P7IA 2K24A 3LFMA 5ETWA 4KHZF 5FVLA 4IDZA 5HCMA 1D0XA 4ZI3D 2XQAA 5KDMC 2X9YA 4JV5T 1T72A 3SOLA 5JDNA 2XAJB 3B57A 3FZFB 3PUQA 1T8BA 1XMQT 1E2AA 2LE8A 5HXRA 3UU6A 3E0ZA 2UXDT 2NW8A 4U33A 2CRBA 2E9XC 3AA1B 2W00A 5JDFA 1D1AA 2MBGA 3RIUC 3ZCIA 3RC3A 3Q2MA 4DR6T 1H7CA 4CI1B 3ONJA 4LFBT 1HR0T 1HS7A 3L8RA 5AQHB 2YK0A 4IDOA 3AE7A 2KNDA 5ABGA 3FXEB 2BKPA 4YHHT 4DR4T 3ZMTB 1VOMA 3ZKRA 2K5BB 1E1HB 2X66A 3I0QA 3O1HA 2XM1A 4ILUA 5LGUB 4TUYE 1OEDA 3AE1A 3CWZB 4HFEA 1SUMB 4Z90A 2KLQA 2CWYA 3N9NA 3UFEA 4QX8B 1WYCA 4GK0E 1LKXA 2Y8DA 4IE7A 3WI3A 3ZJ1A 5L2LA 4OYKA 4KHPT 4OK0A 1VRBA 4C91A 4CXXA 1ZP0A 2EHOA 2XQ7A 3EVYA 5LHHB 5LJNA 2VL8A 4TZ4C 3B5MA 5LBQB 4AI6A 4X20E 1MIYA 2UXNB 2V7LA 3FXDB 5L3GB 3O9XA 2XHEB 1LVFA 3RX6A 2NR4A 2V7MA 2BVLA 3FB2A 3A8YC 4TV9E 1KF6A 5DQWA 4DR5T 1QUUA 2HN1A 1OEDB 3UTKA 3UU5A 2ZM2A 3C50A 1YKHB 3NKZA 4JEUB 4YT0A 2LJLA 4DMWA 2A72A 3CPZA 2V7IA 3AE2A 4IE5A 2V1DB 5EK3A 4HFDA 2VVNA 4UR9A 2CWOA 5JDMA 2XSBA 4DUYT 3JC6C 3ONXA 4IDQA 4LF7T 4IDPA 4ZXLA 4JLEA 3L3PA 4GYSA 2ZM8A 4P0BA 3VR9A 1AJ3A 2ZMAA 5DQVA 4EZ4A 3LJCA 3PDYA 3CVRA 4IE6A 2H7OA 4ISTA 5FY7A 3TLVA 5AQFB 2Q9QA 4AXPA 5L3FB 2Z6EA 2ZM0A 4I0UA 2BG9B 4WNKA 1WR0A 2J47A 3JAFA 2FJBA 4QKNA 4QHOA 4AQFA 4X66T 1KFYA 3QC9A 4HTEA 4L5GA 4EEDA 5F3JA 3PU8A 3X1DA 4O2AE 2UXCT 2N9DA 4LFAT 3OJAA 4AKRB 3Q5XA 3I1AA 4IE4A 1WLXA 3H3MA 4U2YA 2BS3A 4O8SA 4JI3T 2NWBA 4DV0T 2XPKA 3RYHE 1FMVA 3GA8A 4DR7T 3RKOA 1IAPA 5AQUB 2FBWA 1XDPA 2HPJA 3KV5A 2FJAA 4UIGA 2LSYA 4YXDA 5AQLB 5LMNT 4QXHB 3RC8A 5EZYE 5LYJE 5HEJA 4NIQA 3O1JA 5C2TA 2WY2A 1CHUA 4NUVA 1J5WA 2XQ5A 3A5XA 4ZEYA 2H3RA 4IL4A 4COFA 3ZT6A 1HCIA 2WDRA 2NTYA 1UX4A 5BMVE 5HXEA 2RA1A 1HF8A 4TWHA 3WAJA 4ZI2D 3LSVA 4QXCB 3UQ7A 3E22E 3ZT5A 1N33T 2MPKA 5J0ZA 2CE7A 1QLBA 4HFIA 2OV9A
chains in the Genus database with same CATH topology
3N9PA 3KV9A 3GWHA 3I0OA 1SA0E 1FEWA 3CMLA 1OXZA 5L3BB 1AJ3A 5CA0E 2I59A 1D0ZA 2LHRA 1HFAA 2Y6XA 4H63V 3ZC1A 5L3DB 1SHZC 4AKHA 3ZYKA 3KVBA 2NTXA 4X1IE 4ZI2C 2EHOB 1T98A 2C5IT 2HH7A 2LHNA 1IJ5A 1G8XA 3T8OA 2KT9A 5LGNB 3NRYA 2XQYA 4PFOA 3K8PC 3D0TA 1OWAA 3KVAA 4BJNA 1BR1A 2D0TA 3MACA 4DBRA 3R84B 4AKLA 2DWGA 2VK9A 3ETUA 3PU3A 5KX5E 2X67A 1UCUA 3AAEB 3H3AA 3ZJ1A 4TN7B 3WAKA 2ACXA 2E9XD 4O2BE 4IE0A 3RH3A 3FBLA 4ZOLE 3C4ZA 3IHRA 3LG7A 2JJ9A 3UUMA 3CKDA 2KMFA 4KMCA 4ZI3C 5FP3A 3RRCA 3FHNA 4O4LE 2Q9QB 1MNEA 4MALA 2ZLYA 5LP6E 4AKGA 1WR6A 2EHOC 3HI2A 1US7B 3F31A 1YW0A 2NP9A 4YJ3E 5HXCA 5FXZA 3SWHA 2NW7A 3C98B 4KBMB 5LG4A 4P09A 5JR9C 3AAAB 2WM9A 4ZS3A 3KINB 5LA6E 2VB6A 2UXXB 5J1GA 5H6RB 3KV6A 5JH7E 2WWUA 2XAGB 3CX6B 4UV9B 4ISSA 2ODUA 2YU1A 1HG2A 2YEVC 2KWHA 3PURA 5A1LA 4AKIA 3ZMSB 4EAHA 4UVCB 4PK5A 2E8IA 4CI2B 3AB3B 2MYSA 3AA0B 4PK4A 1BR2A 1G73A 3ANWA 5JRCB 3NBXX 4H63H 4V1Av 2Q9QC 4UVAB 2V7KA 2XTLA 5M4YA 3KDSE 4H9OC 1Y64B 3RYFE 3VU7H 4IHJE 4EOZB 1MIWA 4PFPA 5FYMA 4UELA 4O4HE 2YINA 2WMOA 5JR9B 4H9RC 2IC6A 2VKDA 2A3DA 5HWXA 5JRCA 2KZ7B 1IJ6A 3ANWB 2LOPA 2X0LB 4NUUA 3ESLA 3OYXA 3DJBA 4OHFA 3CQCB 4ADZA 2ES0A 4GOUA 4F6RC 5LHGB 5LBMA 3AAIA 3KFWX 1NAFA 3N9QA 3P8CD 4KUMB 4O4JE 5J2TE 3N5LA 1HX8A 4Z8XA 3RYIE 1U5PA 3HL6A 3M65A 3KBTA 3PE0A 2NW9A 4DMVA 1KNZA 3N9OA 4UEMA 3DP7A 4YJ2E 1UX5A 3RPUA 2CXLA 4MLKA 2G0UA 3EDVA 4UXNB 2L9QA 3BQIA 2KINB 3NZQA 4K0UA 3RRWA 5LXTE 2WAUA 4IIJE 4X1YE 4I55E 4WBNE 3H37A 3BQLA 5LOVE 5HXSA 2DWKA 3QK6A 5GONE 2CLYC 2QA7A 4GYRA 4L9IA 4C90A 4BAYB 3B13A 2NOXA 2W0GA 4I4TE 2LOSA 4PAGA 4YLHA 3ZJ2A 3C4WA 5C8YE 4OFZA 3ZMVB 5KMGP 3HA4A 1D1CA 4HKAA 5E0OA 1MMGA 1FMWA 1O3XA 2D2SA 2WSSV 1S94A 2W62A 2ODVA 3KBUA 4H9PC 5DJQC 2IC9A 4E7ZA 4QXBB 2LSIA 3OKQA 3Q5WA 4PW8A 3GN5B 1HTJF 2K9AA 3BQKA 5FY1A 3K3NA 3ZMUB 2HPLA 4DBQA 4HN9A 3F57A 1IZNB 2CLYB 4FJOA 3V5UA 4B6XA 2X51A 2RP4A 5JDLA 3AVRA 2L3LA 2CXFA 1MMDA 1BR4A 2JQQA 2CXDA 3HKBE 3MKDA 1X79A 4FI5A 3AA6B 2B1EA 1MNDA 2VKOA 3R6NA 4PJJA 2IW5B 5JR9A 4UF0B 4OYJA 4UV8B 4CQIA 5JDHA 2YU2A 3CQGB 4CXYA 4L0RA 3CX8B 3MXZA 5DABA 3C51A 3N2KE 3O1IA 3IBPA 4HEAA 5FXWA 2BDEA 3U3IA 5L3EB 3HKCE 1EZ3A 4QWNB 4ZI7E 4J2CA 5CB4E 3HR0A 5HWYA 5HYAA 5J2UE 4HE8A 3ZCJA 3HKDE 5JDGA 2J1DG 4UF0A 4PJMA 3UUXB 5LCYA 2D0UA 3SS1A 3UT5E 3FBZA 5FNVE 2JMKA 4G2AA 1QSDA 2V26A 1S35A 4U72A 3ZPOA 3N2GE 3KV4A 4YHJA 1ZV4X 2KXPB 4GIWA 5LNKA 3LK42 4MBQA 2CEAA 4HFVA 2VKHA 2WMNA 3GMIA 4KP3C 2LSJA 2X9WA 1V9DA 2JPFA 2SPCA 3J7Yq 4DVDA 4UVBB 3AA7B 4CI3B 3U78A 4WBOA 4CXWA 4X1KE 5LJMA 4YFSA 2CCQA 5FMNA 2XAHB 3K3OA 1LRZA 1YD8G 3Q9DA 4BA9A 5L3CB 2C0SA 4N78D 3QUJA 3LBXB 1ZKEA 3NRXA 3EDUA 3O4XE 2XAQB 4XAXB 2Y48B 3EUHA 1BR0A 5ADXL 3C4XA 2W61A 4ERRA 4EIWA 4ZHQE 2CM0A 2W63A 5JVDE 3F2EA 1WRDA 3ZC0A 4PJLA 3GN5A 3PUGA 3ZYMA 5IHYA 3IEEA 1CUNA 2K48A 1FIOA 2XUEA 4TV8E 2VWAA 2DNXA 2PG8A 4XBFB 1KK7A 3I9YA 3K3QC 4BJMA 1D0YA 2PBIA 4QX7B 1YKEB 4EYYR 3I9WA 2XASB 1MMNA 3IF8B 4ZS2A 3MA9A 3CX7B 4EB6E 3N9MA 5JQGE 4AQGA 5LHIB 2CMRA 4PK6A 5JREA 4O4IE 3UUNA 3ZEFB 2XAFB 3N9LA 3ZLIA 2X9HA 2KWIB 4I50E 2VASA 5H6QB 3E08A 4DNDA 3JC6D 3BK9A 2LEHA 3C64A 2M67A 4IGUA 2V7JA 1ZEEA 4ASKA 3TKLB 4I43B 3VKGA 2OA5A 2LT3A 2X68A 4M1PA 3CQXC 3L09A 4H9SE 3ZN0B 2A2FX 3NZPA 4GK5E 2JMHA 5F8PA 5IYZE 2C5JA 4AQFC 4E7SA 3VKHA 2P9BA 4EXTA 1B7TA 2GK9A 2D5UA 3J9X1 4JUYA 3VHLA 3ETVA 3ZN1B 4WW0A 4PJNA 5FXVA 3N2OA 5LGTB 3V5SA 3LK3B 4DO0A 4XZCA 2JRKA 4MHCA 2MOZA 2CA5A 5CA1E 2N2NA 4A56A 2LSKA 1MMAA 5EK2A 1Z0PA 3UULA 2DCFA 2PFVA 2PJQA 3DTOA 4JEHB 3SRZA 1U4QA 1MIVA 2DI4A 3LBXA 4EZHA 4U74A 5FY0A 3ZMZB 4P0AA 3W15B 2VKJA 2Q9QD 5TAOA 5JDQA 2N1GA 2DHRA 4G63A 3RYCE 5HAXA 2IAKA 2C5KT 3OBVE 3OYZA 1LVKA 2LSGA 5HXHA 1NWMX 5EK4A 3AVSA 2E9XB 4H9NC 2WBLA 1WYBA 4ANJA 3HKEE 2DLRA 3MK7C 3MJXA 1HG5A 2BVMA 3ZYLA 4HGAA 3LK2B 4H9QC 3S4UA 4PNIA 4MFRA 5FXXA 4TX5A 2BZBA 5AFUL 3PUSA 2E9XA 2LM9A 2L8KA 2EHOD 3MZKB 3PTRB 2H7VC 2X9XA 1D1BA 2QGSA 4CZZB 2MTQA 1ZHCA 3PUAA 3P7IA 2K24A 3LFMA 4IDZA 4ZI3D 1D0XA 5KDMC 2X9YA 3SOLA 5JDNA 2XAJB 3B57A 3PUQA 2LE8A 5HXRA 3E0ZA 2NW8A 4EYUA 2E9XC 3AA1B 5JDFA 2W00A 2MBGA 1D1AA 3ZCIA 3RC3A 3Q2MA 1H7CA 4CI1B 1HS7A 2YK0A 2KNDA 3FXEB 3ZMTB 1VOMA 2K5BB 1E1HB 2X66A 3I0QA 3O1HA 4ILUA 5LGUB 4TUYE 3CWZB 2KLQA 2CWYA 3N9NA 3UFEA 4QX8B 1WYCA 4GK0E 1LKXA 2Y8DA 4IE7A 3WI3A 5L2LA 4OYKA 4OK0A 1VRBA 4C91A 4CXXA 5LHHB 2EHOA 3EVYA 5LJNA 2VL8A 4TZ4C 5LBQB 4AI6A 4X20E 1MIYA 2UXNB 2V7LA 3FXDB 5L3GB 3O9XA 2XHEB 1LVFA 3RX6A 2V7MA 2BVLA 3FB2A 4TV9E 5DQWA 1QUUA 3UTKA 2ZM2A 3C50A 1YKHB 4JEUB 2LJLA 4DMWA 2A72A 3CPZA 2V7IA 4IE5A 2V1DB 5EK3A 2CWOA 5JDMA 3JC6C 3ONXA 4JLEA 3L3PA 4GYSA 2ZM8A 4P0BA 2ZMAA 5DQVA 4EZ4A 3LJCA 3PDYA 3CVRA 4IE6A 2H7OA 4ISTA 5FY7A 2Q9QA 4AXPA 5L3FB 2Z6EA 2ZM0A 4WNKA 4QKNA 4QHOA 4AQFA 4HTEA 3QC9A 4L5GA 5F3JA 3PU8A 4O2AE 2N9DA 3OJAA 4AKRB 3Q5XA 3I1AA 4IE4A 1WLXA 4O8SA 2NWBA 3RYHE 1FMVA 3GA8A 3RKOA 1IAPA 2HPJA 3KV5A 4UIGA 2LSYA 4QXHB 3RC8A 5EZYE 5LYJE 3O1JA 4NUVA 3A5XA 2H3RA 1HCIA 2NTYA 1UX4A 5BMVE 5HXEA 2RA1A 1HF8A 3WAJA 4ZI2D 4QXCB 3E22E 2CE7A 5ETWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSI A;  4GK5 E;  2LSK A;  3VU7 H;  2LSJ A;  4GK0 E;  4BA9 A;  2LSY A;  4FJO A;  2N1G A;  4EXT A;  2LSG A; 
#chains in the Genus database with same CATH topology
 4DR3 T;  3N9P A;  4WYV A;  5FKY A;  3KV9 A;  3GWH A;  3I0O A;  1SA0 E;  1FEW A;  3CML A;  1OXZ A;  5AQV B;  5L3B B;  1UK5 A;  3AED A;  3G06 A;  5KXJ A;  2V6X A;  2I59 A;  3ABV A;  5AQJ B;  5CA0 E;  1D0Z A;  2LHR A;  1HFA A;  2Y6X A;  4H63 V;  3ZC1 A;  5L3D B;  1SHZ C;  4AKH A;  4OX9 T;  3PUY F;  2JIW A;  3ZYK A;  5FVK A;  3KVB A;  4JI2 T;  2NTX A;  2FJE A;  4X1I E;  3NWI A;  2EHO B;  1T98 A;  3PJA J;  4ZI2 C;  2C5I T;  2HH7 A;  2LHN A;  1IJ5 A;  1G8X A;  3T8O A;  2KT9 A;  5LGN B;  3NRY A;  2XQY A;  4PFO A;  3K8P C;  5L4H A;  3D0T A;  1OWA A;  2JQ9 A;  3KVA A;  4DV3 T;  4BJN A;  1BR1 A;  4GKJ T;  2CHN A;  2D0T A;  2HHH T;  4JI6 T;  3MAC A;  4EZH A;  4DBR A;  3R84 B;  4AKL A;  1XMO T;  4B3R T;  2DWG A;  2VK9 A;  3ETU A;  3AE6 A;  3PU3 A;  3PUV F;  5KX5 E;  5JRC B;  2X67 A;  1UCU A;  1XWM A;  3AAE B;  3H3A A;  3P4P A;  4TN7 B;  5AQK B;  2ACX A;  2WDQ A;  3WAK A;  2E9X D;  4O2B E;  4IE0 A;  3RH3 A;  4YSZ A;  3FBL A;  4IDN A;  4ZOL E;  1OED E;  1I6Z A;  2XQ9 A;  3C4Z A;  3IHR A;  3LG7 A;  2JJ9 A;  3AXJ A;  3UUM A;  2XM2 A;  3FZM B;  4TWD A;  4U3C A;  3CKD A;  2BKO A;  2KMF A;  4KMC A;  4ZI3 C;  5FP3 A;  3RKG A;  3RRC A;  4DR2 T;  3FHN A;  4O4L E;  1J1J A;  2PTF A;  2Q9Q B;  3LDQ B;  1MNE A;  4CN4 A;  2ACZ A;  1IBK T;  4MAL A;  2ZLY A;  5LP6 E;  4AKG A;  3PUZ F;  1WR6 A;  2EHO C;  3HI2 A;  1US7 B;  3UUB A;  2BS2 A;  3F31 A;  1E7P A;  1YW0 A;  2NP9 A;  2DL1 A;  4YJ3 E;  5FXZ A;  4HFH A;  5HXC A;  2NW7 A;  3C98 B;  4KBM B;  4B3M T;  5LG4 A;  4P09 A;  5JR9 C;  4DR1 T;  3AAA B;  2WM9 A;  4WZX A;  4DV7 T;  2I6H A;  4ZS3 A;  3AXJ B;  2D9D A;  2VB6 A;  2UXX B;  3JCF A;  3KIN B;  3KV6 A;  3QOF A;  5H6R B;  5J1G A;  4B3T T;  5JH7 E;  2WWU A;  3FZL B;  4CI2 B;  2XAG B;  4IL9 A;  3CX6 B;  4UV9 B;  4ISS A;  3VRB A;  2ODU A;  2YU1 A;  1HG2 A;  2YEV C;  1NEK A;  2KWH A;  3PUR A;  4U7Y A;  5A1L A;  4AKI A;  3ZMS B;  1L0V A;  1SE7 A;  4DID B;  4EAH A;  4UVC B;  4PK5 A;  2E8I A;  4LF5 T;  2QYW A;  2W2U A;  2CBI A;  2WQY A;  2MYS A;  3AB3 B;  3AA0 B;  1BR2 A;  1G73 A;  3ANW A;  3EAM A;  3M3Z B;  3NBX X;  4H63 H;  2VUR A;  4V1A v;  5AQQ B;  2Q9Q C;  2WU2 A;  2V5C A;  4UVA B;  2V7K A;  3AEC A;  2XTL A;  5M4Y A;  2IIU A;  3KDS E;  1Y64 B;  4H9O C;  4DV4 T;  2XQ3 A;  3RGL A;  3RYF E;  5LB7 B;  4IHJ E;  3VU7 H;  4EOZ B;  5JTG A;  3UU3 A;  1MIW A;  4JI8 T;  4PFP A;  5FYM A;  4UEL A;  4YTP A;  4O4H E;  1WFD A;  2YIN A;  2WMO A;  5JR9 B;  4H9R C;  3P4S A;  4EGW A;  2IC6 A;  2VKD A;  2A3D A;  2M6B A;  5HWX A;  2KZ7 B;  5JRC A;  1IJ6 A;  3ANW B;  2LOP A;  2X0L B;  4NUU A;  3ESL A;  3OYX A;  3DJB A;  4OHF A;  3VR8 A;  3CQC B;  2J4G A;  3RQW A;  2WS3 A;  2H89 A;  3ZT7 A;  1YQ3 A;  2OLT A;  3K1S A;  1WCR A;  3P4Q A;  4HWI B;  4ADZ A;  2ES0 A;  4GOU A;  4F6R C;  5LHG B;  5LBM A;  3AAI A;  2JQH A;  3KFW X;  1NAF A;  1N36 T;  4ILC A;  2LM2 A;  1W0A A;  3N9Q A;  3P8C D;  4KUM B;  4O4J E;  2QVA A;  5J2T E;  3N5L A;  1HX8 A;  4Z8X A;  3RYI E;  1U5P A;  3HL6 A;  3M65 A;  3KBT A;  3PE0 A;  2NW9 A;  4DMV A;  1KNZ A;  3N9O A;  3QNU A;  4UEM A;  5AQS B;  3DP7 A;  4B3S T;  5HEO A;  4YJ2 E;  5ABE A;  1FJG T;  1UX5 A;  4A97 A;  4EYU A;  4ZZB A;  5AQG B;  3RPU A;  2CXL A;  4K0K T;  2CHO A;  3AE9 A;  1XNR T;  4MLK A;  2W4X A;  1JNZ A;  2A9U A;  2G0U A;  3EDV A;  2XQ8 A;  4UXN B;  2E2A A;  3TLU A;  2L9Q A;  4LF6 T;  3BQI A;  2KIN B;  1W09 A;  3NZQ A;  4K0U A;  3RRW A;  5LXT E;  1DU2 A;  2WAU A;  4IIJ E;  4X1Y E;  4I55 E;  2UUC T;  4U7I A;  1KNP A;  3P50 A;  4TNV A;  5HEG A;  4WBN E;  1HNW T;  3H37 A;  3BQL A;  5LOV E;  3PUX F;  5HXS A;  4JI1 T;  2DWK A;  3QK6 A;  3AEE A;  5GON E;  4HFB A;  2CLY C;  2QA7 A;  4GYR A;  4L9I A;  4C90 A;  4BAY B;  5ABF A;  1XNQ T;  3B13 A;  2NOX A;  2W0G A;  4I4T E;  2LOS A;  4LMJ A;  4PAG A;  4YLH A;  3ZJ2 A;  3C4W A;  2MAW A;  2BBJ A;  5C8Y E;  5BR8 T;  4X65 T;  4OFZ A;  3ZMV B;  4A5X A;  4TWF A;  3HA4 A;  3UU8 A;  5KMG P;  1D1C A;  4HKA A;  4CN1 A;  3RIU A;  5HEH A;  2XZE A;  5E0O A;  3CK6 A;  2R6G F;  4DUZ T;  1MMG A;  1FMW A;  1O3X A;  3AEG A;  3JAD A;  2D2S A;  1XDO A;  2WSS V;  3ZST A;  1S94 A;  2W62 A;  4YY3 T;  2ODV A;  3KBU A;  4H9P C;  4JI4 T;  5DJQ C;  2IC9 A;  4E7Z A;  4QXB B;  2LSI A;  3OKQ A;  3Q5W A;  4PW8 A;  3GN5 B;  3TLT A;  5C3J A;  5LG3 A;  1HTJ F;  2K9A A;  3BQK A;  5FY1 A;  3UU4 A;  3K3N A;  3QB5 A;  3AE5 A;  2WCA A;  3RIF A;  3ZMU B;  2HPL A;  4DBQ A;  4HN9 A;  3F57 A;  1IZN B;  1W9R A;  2WZI A;  4YSX A;  2CLY B;  4FJO A;  3V5U A;  4B6X A;  2X51 A;  2RP4 A;  2YN6 A;  5JDL A;  3AVR A;  2L3L A;  2CXF A;  1MMD A;  4F8H A;  1BR4 A;  2JQQ A;  2UU9 T;  4Q25 A;  2CXD A;  3HKB E;  3MKD A;  2X0H A;  1UUR A;  1X79 A;  3AA6 B;  2B1E A;  1MND A;  2VKO A;  4FI5 A;  4KX6 A;  3R6N A;  4PJJ A;  3SFD A;  5FL1 A;  5F5W A;  2IW5 B;  5AQT B;  5JR9 A;  1J5E T;  4UF0 B;  4NXN T;  4HWF A;  4OYJ A;  4UV8 B;  4CQI A;  5JDH A;  2FUP A;  3TLW A;  5AQM B;  2YU2 A;  3CQG B;  2LRL A;  3NVO A;  2VQE T;  4CXY A;  5IWA T;  4L0R A;  3CX8 B;  3MXZ A;  5DAB A;  3C51 A;  1KEY A;  3N2K E;  5HEU A;  5FL0 A;  2WWV A;  3ZSS A;  3O1I A;  3IBP A;  4HEA A;  5FXW A;  5HCJ A;  5AQP B;  2BDE A;  3U3I A;  5L3E B;  3HKC E;  2E5L T;  1EZ3 A;  4QWN B;  4NPP A;  4J2C A;  3JAE A;  5CB4 E;  4YTN A;  4ZI7 E;  3HR0 A;  5HWY A;  5HYA A;  4JBW F;  4HE8 A;  3ZCJ A;  3HKD E;  5J2U E;  5JDG A;  3RLF F;  4X5T A;  2J1D G;  4UF0 A;  4QH1 A;  4PJM A;  3UUX B;  4HWD A;  5LCY A;  3RIA A;  2D0U A;  3SS1 A;  3UT5 E;  3FBZ A;  2WU5 A;  2E5V A;  5FNV E;  3P4W A;  2UXB T;  2JMK A;  3FZK B;  1N34 T;  2BG9 C;  1ZOY A;  4G2A A;  1QSD A;  2V26 A;  1S35 A;  3EAB A;  4U72 A;  3ZPO A;  3N2G E;  1VCT A;  3KV4 A;  4AIS A;  4YHJ A;  1ZV4 X;  2KXP B;  4GIW A;  3AEB A;  5LNK A;  3PJA A;  3LK4 2;  4MBQ A;  4X64 T;  2CEA A;  1XZY A;  2VKH A;  2LKG A;  2WMN A;  3GMI A;  4HFV A;  4KP3 C;  2LSJ A;  2X9W A;  2W66 A;  3FZH B;  1V9D A;  2SPC A;  2JPF A;  2W67 A;  4QH5 A;  3J7Y q;  4DVD A;  4UVB B;  3AA7 B;  2LKH A;  4CI3 B;  4KI0 F;  4WBO A;  4HWC A;  4X1K E;  3U78 A;  4CXW A;  5LJM A;  4YFS A;  5ABF B;  2UUA T;  5L4E A;  2CCQ A;  4CN6 A;  5FMN A;  2UUB T;  4JI0 T;  2XAH B;  2I0M A;  3K3O A;  4PK4 A;  1LRZ A;  2H88 A;  1YD8 G;  2BBH A;  2IHR 1;  3Q9D A;  4BA9 A;  5L3C B;  2BG9 E;  2C0S A;  4N78 D;  3QUJ A;  2LRK A;  3LBX B;  1ZKE A;  3NRX A;  3EDU A;  1R8I A;  3O4X E;  2FJD A;  2XAQ B;  4DV1 T;  4XAX B;  2XQ6 A;  2CBJ A;  2Y48 B;  3EUH A;  2BKN A;  1BR0 A;  5ADX L;  4YTM A;  3C4X A;  2W61 A;  4ILA A;  2M6I A;  4ERR A;  4EIW A;  1M62 A;  4ZHQ E;  4AIU A;  2CM0 A;  2W63 A;  5JVD E;  1I94 T;  3F2E A;  1WRD A;  2K3W A;  3ZC0 A;  4PJL A;  1IBM T;  3GN5 A;  2X0Y A;  4HWH A;  3IA3 A;  3PUG A;  4LF4 T;  1N32 T;  3OTO T;  2IDO B;  4LF8 T;  5IHY A;  3ZYM A;  4LF9 T;  5AQN B;  3IEE A;  1CUN A;  2K48 A;  1FIO A;  4U2Z A;  4EV6 A;  2XUE A;  4TV8 E;  2YKS A;  2VWA A;  2DNX A;  1OED C;  4Z91 A;  2PG8 A;  4XBF B;  1UUS A;  4ZZC A;  1Y01 A;  4EEB A;  3AE8 A;  4QH4 A;  5AQR B;  1KK7 A;  4A98 A;  3I9Y A;  3K3Q C;  4BJM A;  3PV0 F;  2XJ7 A;  3OPC A;  1D0Y A;  1JNR A;  2LLY A;  1YKE B;  2PBI A;  3EI0 A;  3I9W A;  2XAS B;  1MMN A;  3IF8 B;  3OVU A;  4ZS2 A;  3VRA A;  3MA9 A;  4EYY R;  5CFB A;  2XY8 B;  3CX7 B;  4EB6 E;  3N9M A;  2BS4 A;  5JQG E;  4AQG A;  5LHI B;  2CMR A;  4PK6 A;  5JRE A;  4O4I E;  4JI7 T;  3UUN A;  3ZEF B;  2ZM6 T;  2XAF B;  3N9L A;  3ZLI A;  2X9H A;  3P4R A;  2AE9 A;  2KWI B;  4I50 E;  1HX1 B;  2VAS A;  5H6Q B;  4X62 T;  3E08 A;  4HFC A;  4DND A;  3JC6 D;  1Z8U A;  3BK9 A;  5LA6 E;  3RF1 A;  3RHW A;  3CIR A;  2LEH A;  3C64 A;  4DV6 T;  2M67 A;  4IGU A;  3AE3 A;  2V7J A;  1ZEE A;  4ASK A;  3TKL B;  4NXM T;  1M7K A;  4I43 B;  3VKG A;  2OA5 A;  2CPT A;  2VL0 A;  4LML A;  3Q5E A;  4LFC T;  2XSA A;  2LT3 A;  2X68 A;  3L39 A;  5HXH A;  3ONL C;  4M1P A;  2XQ4 A;  4DV5 T;  3CQX C;  3L09 A;  4H9S E;  3ZN0 B;  5L47 A;  1IBL T;  2A2F X;  3NZP A;  4GK5 E;  2JMH A;  5F8P A;  2B76 A;  5IYZ E;  2C5J A;  4AQF C;  4E7S A;  3VKH A;  1HNZ T;  1UGO A;  2P9B A;  2AXD S;  4EXT A;  1B7T A;  4U31 A;  1X9B A;  2JQK A;  4IT4 A;  2GK9 A;  2D5U A;  3UFG A;  3J9X 1;  4JI5 T;  4JUY A;  3VHL A;  3ETV A;  3EHZ A;  2IML A;  3ZN1 B;  4DV2 T;  4WW0 A;  4PJN A;  2V8S V;  5FXV A;  3N2O A;  3SWH A;  5LGT B;  3V5S A;  3LK3 B;  4DO0 A;  4XZC A;  2JRK A;  4MHC A;  2IUB A;  2MOZ A;  2RPA A;  2CA5 A;  5CA1 E;  2N2N A;  2V5D A;  5IUX A;  4A56 A;  2LSK A;  2WZH A;  1MMA A;  3AEA A;  3RQU A;  2YOE A;  5EK2 A;  2F4V T;  1Z0P A;  3TLS A;  3UUL A;  2DCF A;  2PFV A;  2PJQ A;  3DTO A;  1W0B A;  3PUW F;  2V6Y B;  4JEH B;  3SRZ A;  5CJ5 A;  5LMU T;  1U4Q A;  1MIV A;  2DI4 A;  2YDR A;  3LBX A;  2WP9 A;  4ILB A;  1YQ4 A;  4U74 A;  5AQI B;  5FY0 A;  3ZMZ B;  1NEN A;  4P0A A;  3W15 B;  2VKJ A;  3Q5D A;  1HNX T;  4JYA T;  2Q9Q D;  2J62 A;  4AQY T;  5TAO A;  1KNR A;  3RI5 A;  5JDQ A;  2N1G A;  2DHR A;  2YDS A;  3SFE A;  4G63 A;  3RYC E;  5HAX A;  2BG9 A;  1T7S A;  2C5K T;  2IAK A;  1LVK A;  2LSG A;  2V6Y A;  2WDV A;  1NWM X;  3OBV E;  3OYZ A;  5EK4 A;  3AVS A;  2E9X B;  4H9N C;  2WBL A;  1WYB A;  4ANJ A;  3T1Y T;  3HKE E;  2QRX A;  2VQF T;  2WB5 A;  1GQE A;  2DLR A;  3MK7 C;  3MJX A;  1HG5 A;  2BVM A;  2YDQ A;  1YXR A;  3QB5 K;  3ZYL A;  5CGM A;  3A7M A;  3LK2 B;  4H9Q C;  4HGA A;  3S4U A;  4PNI A;  4MFR A;  4IRE A;  5FXX A;  4TX5 A;  4P1N A;  3AEF A;  5AQO B;  3UQ4 A;  2BZB A;  4QX7 B;  5AFU L;  3PUS A;  2E9X A;  4LMK A;  2LM9 A;  2L8K A;  2EHO D;  3MZK B;  2VVS A;  3PTR B;  2HN2 A;  2H7V C;  5ABH A;  3T1H T;  4GKK T;  4TNW A;  4YSY A;  2X9X A;  1VCS A;  1D1B A;  2QGS A;  4CZZ B;  2MTQ A;  1ZHC A;  3AE4 A;  2KSR A;  3PUA A;  3P7I A;  2K24 A;  3LFM A;  5ETW A;  4KHZ F;  5FVL A;  4IDZ A;  5HCM A;  1D0X A;  4ZI3 D;  2XQA A;  5KDM C;  2X9Y A;  4JV5 T;  1T72 A;  3SOL A;  5JDN A;  2XAJ B;  3B57 A;  3FZF B;  3PUQ A;  1T8B A;  1XMQ T;  1E2A A;  2LE8 A;  5HXR A;  3UU6 A;  3E0Z A;  2UXD T;  2NW8 A;  4U33 A;  2CRB A;  2E9X C;  3AA1 B;  2W00 A;  5JDF A;  1D1A A;  2MBG A;  3RIU C;  3ZCI A;  3RC3 A;  3Q2M A;  4DR6 T;  1H7C A;  4CI1 B;  3ONJ A;  4LFB T;  1HR0 T;  1HS7 A;  3L8R A;  5AQH B;  2YK0 A;  4IDO A;  3AE7 A;  2KND A;  5ABG A;  3FXE B;  2BKP A;  4YHH T;  4DR4 T;  3ZMT B;  1VOM A;  3ZKR A;  2K5B B;  1E1H B;  2X66 A;  3I0Q A;  3O1H A;  2XM1 A;  4ILU A;  5LGU B;  4TUY E;  1OED A;  3AE1 A;  3CWZ B;  4HFE A;  1SUM B;  4Z90 A;  2KLQ A;  2CWY A;  3N9N A;  3UFE A;  4QX8 B;  1WYC A;  4GK0 E;  1LKX A;  2Y8D A;  4IE7 A;  3WI3 A;  3ZJ1 A;  5L2L A;  4OYK A;  4KHP T;  4OK0 A;  1VRB A;  4C91 A;  4CXX A;  1ZP0 A;  2EHO A;  2XQ7 A;  3EVY A;  5LHH B;  5LJN A;  2VL8 A;  4TZ4 C;  3B5M A;  5LBQ B;  4AI6 A;  4X20 E;  1MIY A;  2UXN B;  2V7L A;  3FXD B;  5L3G B;  3O9X A;  2XHE B;  1LVF A;  3RX6 A;  2NR4 A;  2V7M A;  2BVL A;  3FB2 A;  3A8Y C;  4TV9 E;  1KF6 A;  5DQW A;  4DR5 T;  1QUU A;  2HN1 A;  1OED B;  3UTK A;  3UU5 A;  2ZM2 A;  3C50 A;  1YKH B;  3NKZ A;  4JEU B;  4YT0 A;  2LJL A;  4DMW A;  2A72 A;  3CPZ A;  2V7I A;  3AE2 A;  4IE5 A;  2V1D B;  5EK3 A;  4HFD A;  2VVN A;  4UR9 A;  2CWO A;  5JDM A;  2XSB A;  4DUY T;  3JC6 C;  3ONX A;  4IDQ A;  4LF7 T;  4IDP A;  4ZXL A;  4JLE A;  3L3P A;  4GYS A;  2ZM8 A;  4P0B A;  3VR9 A;  1AJ3 A;  2ZMA A;  5DQV A;  4EZ4 A;  3LJC A;  3PDY A;  3CVR A;  4IE6 A;  2H7O A;  4IST A;  5FY7 A;  3TLV A;  5AQF B;  2Q9Q A;  4AXP A;  5L3F B;  2Z6E A;  2ZM0 A;  4I0U A;  2BG9 B;  4WNK A;  1WR0 A;  2J47 A;  3JAF A;  2FJB A;  4QKN A;  4QHO A;  4AQF A;  4X66 T;  1KFY A;  3QC9 A;  4HTE A;  4L5G A;  4EED A;  5F3J A;  3PU8 A;  3X1D A;  4O2A E;  2UXC T;  2N9D A;  4LFA T;  3OJA A;  4AKR B;  3Q5X A;  3I1A A;  4IE4 A;  1WLX A;  3H3M A;  4U2Y A;  2BS3 A;  4O8S A;  4JI3 T;  2NWB A;  4DV0 T;  2XPK A;  3RYH E;  1FMV A;  3GA8 A;  4DR7 T;  3RKO A;  1IAP A;  5AQU B;  2FBW A;  1XDP A;  2HPJ A;  3KV5 A;  2FJA A;  4UIG A;  2LSY A;  4YXD A;  5AQL B;  5LMN T;  4QXH B;  3RC8 A;  5EZY E;  5LYJ E;  5HEJ A;  4NIQ A;  3O1J A;  5C2T A;  2WY2 A;  1CHU A;  4NUV A;  1J5W A;  2XQ5 A;  3A5X A;  4ZEY A;  2H3R A;  4IL4 A;  4COF A;  3ZT6 A;  1HCI A;  2WDR A;  2NTY A;  1UX4 A;  5BMV E;  5HXE A;  2RA1 A;  1HF8 A;  4TWH A;  3WAJ A;  4ZI2 D;  3LSV A;  4QXC B;  3UQ7 A;  3E22 E;  3ZT5 A;  1N33 T;  2MPK A;  5J0Z A;  2CE7 A;  1QLB A;  4HFI A;  2OV9 A; 
#chains in the Genus database with same CATH homology
 3N9P A;  3KV9 A;  3GWH A;  3I0O A;  1SA0 E;  1FEW A;  3CML A;  1OXZ A;  5L3B B;  1AJ3 A;  5CA0 E;  2I59 A;  1D0Z A;  2LHR A;  1HFA A;  2Y6X A;  4H63 V;  3ZC1 A;  5L3D B;  1SHZ C;  4AKH A;  3ZYK A;  3KVB A;  2NTX A;  4X1I E;  4ZI2 C;  2EHO B;  1T98 A;  2C5I T;  2HH7 A;  2LHN A;  1IJ5 A;  1G8X A;  3T8O A;  2KT9 A;  5LGN B;  3NRY A;  2XQY A;  4PFO A;  3K8P C;  3D0T A;  1OWA A;  3KVA A;  4BJN A;  1BR1 A;  2D0T A;  3MAC A;  4DBR A;  3R84 B;  4AKL A;  2DWG A;  2VK9 A;  3ETU A;  3PU3 A;  5KX5 E;  2X67 A;  1UCU A;  3AAE B;  3H3A A;  3ZJ1 A;  4TN7 B;  3WAK A;  2ACX A;  2E9X D;  4O2B E;  4IE0 A;  3RH3 A;  3FBL A;  4ZOL E;  3C4Z A;  3IHR A;  3LG7 A;  2JJ9 A;  3UUM A;  3CKD A;  2KMF A;  4KMC A;  4ZI3 C;  5FP3 A;  3RRC A;  3FHN A;  4O4L E;  2Q9Q B;  1MNE A;  4MAL A;  2ZLY A;  5LP6 E;  4AKG A;  1WR6 A;  2EHO C;  3HI2 A;  1US7 B;  3F31 A;  1YW0 A;  2NP9 A;  4YJ3 E;  5HXC A;  5FXZ A;  3SWH A;  2NW7 A;  3C98 B;  4KBM B;  5LG4 A;  4P09 A;  5JR9 C;  3AAA B;  2WM9 A;  4ZS3 A;  3KIN B;  5LA6 E;  2VB6 A;  2UXX B;  5J1G A;  5H6R B;  3KV6 A;  5JH7 E;  2WWU A;  2XAG B;  3CX6 B;  4UV9 B;  4ISS A;  2ODU A;  2YU1 A;  1HG2 A;  2YEV C;  2KWH A;  3PUR A;  5A1L A;  4AKI A;  3ZMS B;  4EAH A;  4UVC B;  4PK5 A;  2E8I A;  4CI2 B;  3AB3 B;  2MYS A;  3AA0 B;  4PK4 A;  1BR2 A;  1G73 A;  3ANW A;  5JRC B;  3NBX X;  4H63 H;  4V1A v;  2Q9Q C;  4UVA B;  2V7K A;  2XTL A;  5M4Y A;  3KDS E;  4H9O C;  1Y64 B;  3RYF E;  3VU7 H;  4IHJ E;  4EOZ B;  1MIW A;  4PFP A;  5FYM A;  4UEL A;  4O4H E;  2YIN A;  2WMO A;  5JR9 B;  4H9R C;  2IC6 A;  2VKD A;  2A3D A;  5HWX A;  5JRC A;  2KZ7 B;  1IJ6 A;  3ANW B;  2LOP A;  2X0L B;  4NUU A;  3ESL A;  3OYX A;  3DJB A;  4OHF A;  3CQC B;  4ADZ A;  2ES0 A;  4GOU A;  4F6R C;  5LHG B;  5LBM A;  3AAI A;  3KFW X;  1NAF A;  3N9Q A;  3P8C D;  4KUM B;  4O4J E;  5J2T E;  3N5L A;  1HX8 A;  4Z8X A;  3RYI E;  1U5P A;  3HL6 A;  3M65 A;  3KBT A;  3PE0 A;  2NW9 A;  4DMV A;  1KNZ A;  3N9O A;  4UEM A;  3DP7 A;  4YJ2 E;  1UX5 A;  3RPU A;  2CXL A;  4MLK A;  2G0U A;  3EDV A;  4UXN B;  2L9Q A;  3BQI A;  2KIN B;  3NZQ A;  4K0U A;  3RRW A;  5LXT E;  2WAU A;  4IIJ E;  4X1Y E;  4I55 E;  4WBN E;  3H37 A;  3BQL A;  5LOV E;  5HXS A;  2DWK A;  3QK6 A;  5GON E;  2CLY C;  2QA7 A;  4GYR A;  4L9I A;  4C90 A;  4BAY B;  3B13 A;  2NOX A;  2W0G A;  4I4T E;  2LOS A;  4PAG A;  4YLH A;  3ZJ2 A;  3C4W A;  5C8Y E;  4OFZ A;  3ZMV B;  5KMG P;  3HA4 A;  1D1C A;  4HKA A;  5E0O A;  1MMG A;  1FMW A;  1O3X A;  2D2S A;  2WSS V;  1S94 A;  2W62 A;  2ODV A;  3KBU A;  4H9P C;  5DJQ C;  2IC9 A;  4E7Z A;  4QXB B;  2LSI A;  3OKQ A;  3Q5W A;  4PW8 A;  3GN5 B;  1HTJ F;  2K9A A;  3BQK A;  5FY1 A;  3K3N A;  3ZMU B;  2HPL A;  4DBQ A;  4HN9 A;  3F57 A;  1IZN B;  2CLY B;  4FJO A;  3V5U A;  4B6X A;  2X51 A;  2RP4 A;  5JDL A;  3AVR A;  2L3L A;  2CXF A;  1MMD A;  1BR4 A;  2JQQ A;  2CXD A;  3HKB E;  3MKD A;  1X79 A;  4FI5 A;  3AA6 B;  2B1E A;  1MND A;  2VKO A;  3R6N A;  4PJJ A;  2IW5 B;  5JR9 A;  4UF0 B;  4OYJ A;  4UV8 B;  4CQI A;  5JDH A;  2YU2 A;  3CQG B;  4CXY A;  4L0R A;  3CX8 B;  3MXZ A;  5DAB A;  3C51 A;  3N2K E;  3O1I A;  3IBP A;  4HEA A;  5FXW A;  2BDE A;  3U3I A;  5L3E B;  3HKC E;  1EZ3 A;  4QWN B;  4ZI7 E;  4J2C A;  5CB4 E;  3HR0 A;  5HWY A;  5HYA A;  5J2U E;  4HE8 A;  3ZCJ A;  3HKD E;  5JDG A;  2J1D G;  4UF0 A;  4PJM A;  3UUX B;  5LCY A;  2D0U A;  3SS1 A;  3UT5 E;  3FBZ A;  5FNV E;  2JMK A;  4G2A A;  1QSD A;  2V26 A;  1S35 A;  4U72 A;  3ZPO A;  3N2G E;  3KV4 A;  4YHJ A;  1ZV4 X;  2KXP B;  4GIW A;  5LNK A;  3LK4 2;  4MBQ A;  2CEA A;  4HFV A;  2VKH A;  2WMN A;  3GMI A;  4KP3 C;  2LSJ A;  2X9W A;  1V9D A;  2JPF A;  2SPC A;  3J7Y q;  4DVD A;  4UVB B;  3AA7 B;  4CI3 B;  3U78 A;  4WBO A;  4CXW A;  4X1K E;  5LJM A;  4YFS A;  2CCQ A;  5FMN A;  2XAH B;  3K3O A;  1LRZ A;  1YD8 G;  3Q9D A;  4BA9 A;  5L3C B;  2C0S A;  4N78 D;  3QUJ A;  3LBX B;  1ZKE A;  3NRX A;  3EDU A;  3O4X E;  2XAQ B;  4XAX B;  2Y48 B;  3EUH A;  1BR0 A;  5ADX L;  3C4X A;  2W61 A;  4ERR A;  4EIW A;  4ZHQ E;  2CM0 A;  2W63 A;  5JVD E;  3F2E A;  1WRD A;  3ZC0 A;  4PJL A;  3GN5 A;  3PUG A;  3ZYM A;  5IHY A;  3IEE A;  1CUN A;  2K48 A;  1FIO A;  2XUE A;  4TV8 E;  2VWA A;  2DNX A;  2PG8 A;  4XBF B;  1KK7 A;  3I9Y A;  3K3Q C;  4BJM A;  1D0Y A;  2PBI A;  4QX7 B;  1YKE B;  4EYY R;  3I9W A;  2XAS B;  1MMN A;  3IF8 B;  4ZS2 A;  3MA9 A;  3CX7 B;  4EB6 E;  3N9M A;  5JQG E;  4AQG A;  5LHI B;  2CMR A;  4PK6 A;  5JRE A;  4O4I E;  3UUN A;  3ZEF B;  2XAF B;  3N9L A;  3ZLI A;  2X9H A;  2KWI B;  4I50 E;  2VAS A;  5H6Q B;  3E08 A;  4DND A;  3JC6 D;  3BK9 A;  2LEH A;  3C64 A;  2M67 A;  4IGU A;  2V7J A;  1ZEE A;  4ASK A;  3TKL B;  4I43 B;  3VKG A;  2OA5 A;  2LT3 A;  2X68 A;  4M1P A;  3CQX C;  3L09 A;  4H9S E;  3ZN0 B;  2A2F X;  3NZP A;  4GK5 E;  2JMH A;  5F8P A;  5IYZ E;  2C5J A;  4AQF C;  4E7S A;  3VKH A;  2P9B A;  4EXT A;  1B7T A;  2GK9 A;  2D5U A;  3J9X 1;  4JUY A;  3VHL A;  3ETV A;  3ZN1 B;  4WW0 A;  4PJN A;  5FXV A;  3N2O A;  5LGT B;  3V5S A;  3LK3 B;  4DO0 A;  4XZC A;  2JRK A;  4MHC A;  2MOZ A;  2CA5 A;  5CA1 E;  2N2N A;  4A56 A;  2LSK A;  1MMA A;  5EK2 A;  1Z0P A;  3UUL A;  2DCF A;  2PFV A;  2PJQ A;  3DTO A;  4JEH B;  3SRZ A;  1U4Q A;  1MIV A;  2DI4 A;  3LBX A;  4EZH A;  4U74 A;  5FY0 A;  3ZMZ B;  4P0A A;  3W15 B;  2VKJ A;  2Q9Q D;  5TAO A;  5JDQ A;  2N1G A;  2DHR A;  4G63 A;  3RYC E;  5HAX A;  2IAK A;  2C5K T;  3OBV E;  3OYZ A;  1LVK A;  2LSG A;  5HXH A;  1NWM X;  5EK4 A;  3AVS A;  2E9X B;  4H9N C;  2WBL A;  1WYB A;  4ANJ A;  3HKE E;  2DLR A;  3MK7 C;  3MJX A;  1HG5 A;  2BVM A;  3ZYL A;  4HGA A;  3LK2 B;  4H9Q C;  3S4U A;  4PNI A;  4MFR A;  5FXX A;  4TX5 A;  2BZB A;  5AFU L;  3PUS A;  2E9X A;  2LM9 A;  2L8K A;  2EHO D;  3MZK B;  3PTR B;  2H7V C;  2X9X A;  1D1B A;  2QGS A;  4CZZ B;  2MTQ A;  1ZHC A;  3PUA A;  3P7I A;  2K24 A;  3LFM A;  4IDZ A;  4ZI3 D;  1D0X A;  5KDM C;  2X9Y A;  3SOL A;  5JDN A;  2XAJ B;  3B57 A;  3PUQ A;  2LE8 A;  5HXR A;  3E0Z A;  2NW8 A;  4EYU A;  2E9X C;  3AA1 B;  5JDF A;  2W00 A;  2MBG A;  1D1A A;  3ZCI A;  3RC3 A;  3Q2M A;  1H7C A;  4CI1 B;  1HS7 A;  2YK0 A;  2KND A;  3FXE B;  3ZMT B;  1VOM A;  2K5B B;  1E1H B;  2X66 A;  3I0Q A;  3O1H A;  4ILU A;  5LGU B;  4TUY E;  3CWZ B;  2KLQ A;  2CWY A;  3N9N A;  3UFE A;  4QX8 B;  1WYC A;  4GK0 E;  1LKX A;  2Y8D A;  4IE7 A;  3WI3 A;  5L2L A;  4OYK A;  4OK0 A;  1VRB A;  4C91 A;  4CXX A;  5LHH B;  2EHO A;  3EVY A;  5LJN A;  2VL8 A;  4TZ4 C;  5LBQ B;  4AI6 A;  4X20 E;  1MIY A;  2UXN B;  2V7L A;  3FXD B;  5L3G B;  3O9X A;  2XHE B;  1LVF A;  3RX6 A;  2V7M A;  2BVL A;  3FB2 A;  4TV9 E;  5DQW A;  1QUU A;  3UTK A;  2ZM2 A;  3C50 A;  1YKH B;  4JEU B;  2LJL A;  4DMW A;  2A72 A;  3CPZ A;  2V7I A;  4IE5 A;  2V1D B;  5EK3 A;  2CWO A;  5JDM A;  3JC6 C;  3ONX A;  4JLE A;  3L3P A;  4GYS A;  2ZM8 A;  4P0B A;  2ZMA A;  5DQV A;  4EZ4 A;  3LJC A;  3PDY A;  3CVR A;  4IE6 A;  2H7O A;  4IST A;  5FY7 A;  2Q9Q A;  4AXP A;  5L3F B;  2Z6E A;  2ZM0 A;  4WNK A;  4QKN A;  4QHO A;  4AQF A;  4HTE A;  3QC9 A;  4L5G A;  5F3J A;  3PU8 A;  4O2A E;  2N9D A;  3OJA A;  4AKR B;  3Q5X A;  3I1A A;  4IE4 A;  1WLX A;  4O8S A;  2NWB A;  3RYH E;  1FMV A;  3GA8 A;  3RKO A;  1IAP A;  2HPJ A;  3KV5 A;  4UIG A;  2LSY A;  4QXH B;  3RC8 A;  5EZY E;  5LYJ E;  3O1J A;  4NUV A;  3A5X A;  2H3R A;  1HCI A;  2NTY A;  1UX4 A;  5BMV E;  5HXE A;  2RA1 A;  1HF8 A;  3WAJ A;  4ZI2 D;  4QXC B;  3E22 E;  2CE7 A;  5ETW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...