4BA9A

The structural basis for the coordination of y-family translesion dna polymerases by rev1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
114
structure length
104
Chain Sequence
b'GPHMHKKSFFDKKRSERASNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA POLYMERASE KAPPA, DNA REPAIR PROTEIN REV1
molecule tags Transferase
source organism Homo sapiens
publication title The Structural Basis for the Coordination of Y- Family Translesion DNA Polymerases by Rev1
rcsb
total genus 40
structure length 104
sequence length 114
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4ba9A00
2LSGA 3VU7H 2LSYA 4GK5E 2LSJA 4GK0E 2N1GA 2LSIA 2LSKA 4EXTA 4FJOA 4BA9A
chains in the Genus database with same CATH superfamily
5JTGA 2D9DA 4PNIA 1WLXA 2MTQA 1LVKA 2BG9C 2NP9A 2ZLYA 4P1NA 4YTMA 2XAJB 3RHWA 3ZEFB 1YD8G 3KV9A 4ILBA 1G73A 1HTJF 1FMWA 4DO0A 4HWDA 4UF0B 2FBWA 4MALA 3ZMVB 3E22E 1D0YA 2KSRA 3FHNA 3F31A 3CVRA 3FBZA 5CJ5A 1HX1B 4PK6A 3QB5K 2WB5A 5HWXA 3FXDB 1WCRA 2HH7A 4HGAA 5LJMA 2A72A 4LF9T 4WZXA 3C98B 3SRZA 4G2AA 4EEBA 2XUEA 1WYBA 3CIRA 4F8HA 2ZM0A 2JMHA 3RI5A 2CBJA 3EI0A 2MPKA 4EIWA 2XAHB 1QLBA 2OA5A 3I1AA 4IDQA 1NWMX 4FJOA 5HEGA 5HXRA 2YEVC 4CQIA 3AEDA 5FXVA 4IE5A 2NWBA 3UT5E 1XWMA 5AFUL 1WR0A 2ES0A 3ONJA 2QA7A 2VQET 4EYYR 2PFVA 2ODUA 2CA5A 3KDSE 3C4XA 1N34T 3DP7A 3DTOA 4COFA 4DNDA 4CI3B 5L3CB 3GMIA 3ZSTA 5LHGB 4H9PC 2IC6A 2KZ7B 4QHOA 5FXWA 4JI4T 4JI7T 1Y64B 1XDOA 1IBKT 2X9HA 3EABA 3AE1A 3K8PC 2CPTA 3NVOA 4GIWA 1HR0T 3EDUA 1UGOA 3UU6A 4U74A 3HKEE 5ETWA 1MNEA 5FYMA 3SS1A 1QUUA 1OWAA 3KBUA 4DR2T 4YY3T 5ABEA 2M6BA 4PK5A 3N2GE 1V9DA 3ETUA 1LKXA 3SFEA 4TWHA 3JAFA 5JDHA 4O4LE 2Y48B 3AE6A 1QSDA 2V1DB 3PTRB 2B1EA 4TN7B 2XAQB 1W0BA 3BK9A 5FY1A 4H63V 2DHRA 4UV8B 5HEOA 5HEUA 2XQ6A 4ZI2C 2VVSA 4IL9A 5AQFB 1D1BA 4U72A 3WAJA 5CFBA 4P09A 2BBHA 5F8PA 3MXZA 4HN9A 3N5LA 3W15B 4ISTA 4UXNB 2X66A 3AAEB 2LSJA 4JEHB 2L8KA 4B6XA 5LJNA 2H89A 2H3RA 4A98A 4LFBT 2N2NA 2D0UA 3B13A 2IMLA 4UVCB 4JV5T 4H9SE 4DIDB 4PJLA 2KWHA 3I0QA 3TLSA 2IUBA 4PJNA 4UF0A 3RH3A 1T72A 5FL0A 1XZYA 1IJ5A 2CWYA 1ZV4X 2IIUA 5AQQB 3R6NA 4KUMB 5EK2A 4UVAB 2LOPA 5KX5E 2RP4A 4UELA 2WZHA 3LJCA 5L3DB 1DU2A 5J2TE 4DV0T 1X79A 2Q9QA 2KLQA 4GYSA 2BDEA 1KEYA 3OBVE 1T8BA 2L9QA 2MYSA 2ACXA 4KI0F 4PJMA 5L4HA 4DV5T 5DQWA 2YDSA 3JAEA 2LJLA 3EHZA 2B76A 4GOUA 4HE8A 4NIQA 4DMWA 2XQ7A 4P0AA 2WDQA 4X1YE 5LA6E 5LGUB 1VOMA 2VL8A 1M7KA 4LFAT 2WY2A 2V6XA 4NUUA 1M62A 3RYHE 4YHJA 2BG9B 3MJXA 1FMVA 3T8OA 4CN6A 3NBXX 4B3TT 2C5JA 2Y8DA 4LF8T 3NWIA 4EB6E 5JH7E 4X62T 3HKDE 4WBNE 3N9NA 5AQKB 5KDMC 2WSSV 4A97A 2M67A 4BJNA 5LCYA 2F4VT 5A1LA 1IAPA 2HPJA 1U5PA 2FJAA 2X67A 3AXJA 4QX8B 4WBOA 2WMNA 3IEEA 3R84B 3RX6A 4IL4A 1WFDA 4HFDA 1UURA 2HN1A 3N9LA 3UUBA 3QUJA 2NW7A 2Z6EA 3KV4A 2XQ8A 4DR1T 2V7IA 3M3ZB 3KINB 1HNWT 1N33T 2LLYA 3PUAA 3H3AA 1ZP0A 3D0TA 4DV4T 2UUBT 5HEJA 1W0AA 4AKGA 1EZ3A 1ZEEA 3AAAB 4K0KT 5LOVE 4I0UA 1XNQT 3O4XE 3P50A 3FXEB 5GONE 2OV9A 3KFWX 2M6IA 2UXXB 4A5XA 3UU4A 4MLKA 4G63A 4HFHA 2WBLA 4QWNB 4EAHA 4X66T 2EHOC 3OTOT 4AI6A 1ZOYA 2V5DA 3Q2MA 1YW0A 2XJ7A 3ZT6A 3A8YC 3M65A 3GA8A 4EEDA 5AQLB 4ILCA 2VWAA 4AQFA 4H9RC 4OX9T 3MKDA 2D2SA 4AKIA 3FBLA 5HAXA 4AXPA 4TV8E 3ZCJA 4KX6A 3U78A 2CE7A 4X65T 5LMNT 4DUYT 2EHOD 4IREA 2IDOB 2VKOA 4O4JE 4WNKA 3UFGA 2V6YB 4HWFA 2V7MA 4QXHB 4ZI3D 4O4IE 5AQHB 3ZPOA 1NEKA 2WQYA 3AE3A 4TX5A 3ZN1B 4X5TA 1LRZA 4UIGA 4I4TE 4YFSA 4C91A 5LNKA 4LF4T 3ZLIA 2BKPA 5EK4A 3AB3B 3AEBA 3EUHA 5L3EB 5BMVE 2WAUA 2IHR1 2J62A 3AE8A 4L5GA 4JI2T 1YQ3A 4O2BE 3FZLB 3V5SA 3N2KE 3UTKA 5FY0A 1T7SA 3AE5A 3ANWB 1VRBA 3Q5DA 4P0BA 4AQGA 3AA0B 2NW9A 3OKQA 5JQGE 4F6RC 2G0UA 3BQLA 5FXXA 1W09A 3AECA 4Z8XA 4QXCB 5AQPB 3N9PA 3H37A 4IE4A 3PUZF 3CX8B 2JQKA 2H7OA 2E9XA 3KV6A 2R6GF 2ACZA 4LMLA 5ABGA 3AAIA 5EK3A 3F57A 1T98A 2NW8A 2XZEA 4EYUA 3RRWA 4AISA 1J1JA 5LXTE 3VRBA 2KT9A 2W66A 3K1SA 5LP6E 3AXJB 4NPPA 4CXWA 2E2AA 2WP9A 1OEDA 5LBQB 4EGWA 1IBLT 1IBMT 5LGTB 3ANWA 1UX4A 2J1DG 1YQ4A 3LBXA 3LDQB 4ILUA 5AQVB 3AE7A 4AQYT 5LGNB 2ZMAA 2XQ5A 3MZKB 4HWIB 4O2AE 2WDVA 3O1IA 3AA1B 2YDRA 2BG9A 3VHLA 2UUAT 4DBQA 5HCMA 2N1GA 4ERRA 4WW0A 2WU5A 4B3RT 2DLRA 3IF8B 2LM9A 1KNPA 2GK9A 2AXDS 5C2TA 3PUXF 2V7JA 3PJAJ 1WRDA 3P4WA 2KWIB 4TV9E 5C8YE 5LHIB 2A9UA 2NOXA 4QH5A 4ZEYA 3N9OA 2XAFB 3BQIA 4EZHA 3P4PA 1KNRA 3PJAA 5ABFA 1J5ET 1ZKEA 3K3OA 2VVNA 2W0GA 3B5MA 4ZXLA 4GKJT 4QXBB 3L39A 4ZI2D 3MK7C 5JDNA 4GKKT 2LRLA 1HG5A 4UV9B 4ZHQE 3KVAA 1J5WA 2LKHA 3ABVA 4ILAA 1HFAA 3L8RA 4U7YA 5AQSB 3RQUA 4BJMA 2H88A 5HYAA 2X9YA 5LHHB 2CXDA 2KINB 4L9IA 2X0LB 5CGMA 5LMUT 4ZI3C 5JREA 4DR4T 2XAGB 3PUSA 5LYJE 3KBTA 4YSZA 2X9XA 2DCFA 1BR4A 2WS3A 2UXNB 4AKRB 2Y6XA 2VKHA 3KVBA 2UXBT 4JI1T 2V26A 5H6RB 3CX6B 3LK2B 2OLTA 4QX7B 3FZHB 3KV5A 2BVMA 4NXMT 5FVLA 1XNRT 4X1KE 5EZYE 2DNXA 3C51A 4JI5T 4DVDA 2LKGA 2XASB 5ABFB 5JDQA 2E5VA 2CWOA 1HS7A 4DV7T 3RYCE 5CB4E 4CI1B 4HEAA 2W00A 3ZMUB 1X9BA 2W2UA 3QOFA 4JUYA 4UR9A 2PJQA 4XZCA 2A2FX 4CN4A 5HXSA 3OJAA 5IWAT 1S94A 5JR9A 5AQJB 3DJBA 1NENA 2XM1A 4YHHT 2JIWA 2XQ9A 4TUYE 5AQUB 3J7Yq 4IDPA 2DWGA 3LK42 4QKNA 4LFCT 1D0ZA 3RIUA 1KK7A 3I9WA 1MIVA 3QNUA 4LF6T 4ZOLE 1I6ZA 3CKDA 1CHUA 3IHRA 1HCIA 3VR9A 1D1CA 5FKYA 3U3IA 4EZ4A 4JYAT 4AKHA 1OEDB 4BAYB 2WDRA 4DV3T 4LMKA 5IUXA 3PV0F 2AE9A 3L09A 4YJ3E 2XPKA 3RKOA 4B3ST 5AQRB 4HKAA 2W63A 4IDNA 3ZMSB 1Y01A 3ZT5A 3C4ZA 3UU5A 2L3LA 2E9XB 3EDVA 4YTNA 3RIUC 2JJ9A 1NAFA 4CXXA 4ZZBA 1UCUA 4U31A 1N32T 3CPZA 4L0RA 3ZYMA 4TNVA 3J9X1 2J47A 2XTLA 4IHJE 4NXNT 2YU1A 3ZKRA 4EV6A 3ZMTB 4DV1T 2Q9QB 5FL1A 3UQ7A 1MMDA 4PK4A 4AQFC 2XSAA 2QGSA 1Z8UA 2A3DA 1IZNB 1MIYA 1HF8A 2IC9A 2W62A 4H9OC 4OHFA 5HXHA 2XQ3A 4HTEA 1KNZA 1KF6A 4IT4A 5AQIB 1SE7A 3ZT7A 2FJDA 4N78D 4DV6T 4JI0T 4XAXB 1U4QA 4JI8T 4V1Av 4ZS2A 3P4RA 3WAKA 1MMAA 2YN6A 5LG4A 5DABA 1YKHB 3FZKB 4C90A 5JR9B 5FY7A 2CHOA 2V6YA 2FUPA 2W4XA 4HFBA 1B7TA 4UVBB 1SHZC 2LOSA 3PDYA 2LSKA 1CUNA 4HWCA 4CZZB 3SWHA 5BR8T 3CQGB 2JQQA 3LSVA 3A5XA 3E0ZA 3O1HA 4HFIA 4NUVA 5C3JA 3I0OA 5HWYA 5FP3A 3F2EA 3NZQA 1FEWA 3CQXC 2BKOA 3ZJ1A 1MNDA 2NTYA 3ETVA 3B57A 2CMRA 4TWDA 3RGLA 2JQHA 4QH4A 3VU7H 2YKSA 3CK6A 5ABHA 1SA0E 2VK9A 3PUVF 5HXEA 2ZM2A 3K3QC 3BQKA 4AKLA 4EXTA 1BR0A 2C0SA 4H63H 2DI4A 2JPFA 4HFCA 3PUYF 4KP3C 2CLYC 4Z91A 5L3GB 2XQYA 1UK5A 4GYRA 5LB7B 3Q5WA 1G8XA 2MAWA 1MMGA 2XM2A 3FB2A 5FXZA 3ZC1A 3CX7B 4ZZCA 2LHRA 1D1AA 3AEAA 1BR1A 3I9YA 3MACA 5DJQC 3VKHA 3AVRA 4GK5E 4PW8A 2YINA 4X1IE 3TLWA 3Q9DA 1OXZA 5FVKA 2WM9A 1AJ3A 4HFVA 2LSGA 3C4WA 3S4UA 4YJ2E 4TWFA 1H7CA 2VB6A 3OPCA 2HHHT 4I55E 3RYIE 2P9BA 2KXPB 4PJJA 2JMKA 3A7MA 5TAOA 2QVAA 3PU8A 2MBGA 3TLTA 3VR8A 5JDLA 1HG2A 3C50A 2KNDA 1MIWA 2LT3A 2NTXA 2XQ4A 3QC9A 3EVYA 3CQCB 4IGUA 3SFDA 2BKNA 4WYVA 4DBRA 3IA3A 2ZM6T 4DUZT 2CXLA 5AQMB 5CA0E 1WYCA 3O1JA 3G06A 3NKZA 4IE0A 3MA9A 3WI3A 3P8CD 2CHNA 2CBIA 2RA1A 4UEMA 3ZYLA 3ZN0B 2LSIA 1SUMB 4E7ZA 2K48A 1ZHCA 4TNWA 5KMGP 3ZJ2A 4KHZF 5J0ZA 4H9QC 2X9WA 2X0HA 4U7IA 5HXCA 3RRCA 3P4QA 4H9NC 3UQ4A 4EOZB 1IJ6A 3H3MA 2VQFT 3UUNA 1GQEA 1US7B 2BS2A 5IHYA 3TKLB 4CXYA 3T1HT 1LVFA 3AE2A 3RLFF 3HI2A 3AVSA 4BA9A 4XBFB 3QB5A 2J4GA 3P7IA 1D0XA 2N9DA 2V8SV 2DL1A 4X64T 5L3BB 3OVUA 4OK0A 2NR4A 4YXDA 3NZPA 4IE7A 2EHOB 5KXJA 2IW5B 4I43B 1WR6A 2WU2A 3FZFB 4K0UA 3RF1A 3PUGA 3VKGA 2WMOA 3GWHA 2VKJA 3AEGA 3LK3B 3RPUA 4E7SA 5M4YA 3ZMZB 3QK6A 5JVDE 3AEEA 2CM0A 5DQVA 1BR2A 1R8IA 3JC6D 1E1HB 3EAMA 3AA6B 3PUQA 4U33A 2I59A 2K24A 3FZMB 3PUWF 4U2YA 3SOLA 2K5BB 3TLVA 3RC8A 2Q9QD 1L0VA 5AQOB 4JI6T 4Z90A 3JC6C 2W61A 3N9QA 4IDOA 4DR6T 4DV2T 5J2UE 4ADZA 3UFEA 2MOZA 1YKEB 4CN1A 4A56A 3HA4A 3HKBE 4U3CA 3RKGA 3X1DA 5L4EA 2E9XD 3CWZB 3PURA 5JRCB 3O9XA 1OEDE 2EHOA 4YLHA 3OYXA 2BBJA 3ONLC 2JQ9A 2LEHA 2LM2A 4O4HE 5LG3A 2DWKA 2K3WA 2D5UA 4M1PA 3JADA 4KMCA 2YDQA 4MHCA 2V5CA 4PFPA 2V7KA 2WCAA 5L3FB 1HNXT 2UUCT 2PBIA 3Q5XA 4ZS3A 4DMVA 2ZM8A 2YOEA 2SPCA 3LBXB 1XMQT 1JNRA 3ONXA 3GN5B 3AA7B 3AEFA 1E7PA 3HR0A 3NRYA 3PE0A 2QRXA 3PU3A 4HWHA 4IIJE 4IE6A 4CI2B 4JBWF 1XMOT 4FI5A 4ISSA 5H6QB 3P4SA 3T1YT 1N36T 1YXRA 2BS3A 2LSYA 2IAKA 3JCFA 4J2CA 3RYFE 2CLYB 3UU8A 4ZI7E 5L2LA 2JRKA 5AQTB 1W9RA 3OYZA 5JDMA 3ESLA 5CA1E 1E2AA 4LF7T 5FNVE 2K9AA 5AQGB 1MMNA 4GK0E 5HCJA 4YSXA 4OYJA 1VCSA 2LHNA 3UUMA 2D0TA 3UULA 4YTPA 2YK0A 4KHPT 3UU3A 1I94T 2BZBA 2BVLA 2PG8A 2BG9E 3L3PA 5F5WA 3ZCIA 5ADXL 2LE8A 2VASA 2WWVA 4YSYA 2WZIA 3E08A 2XY8B 4DR3T 3VRAA 4JI3T 5AQNB 5JR9C 4LMJA 2X68A 1S35A 4HFEA 5L47A 1JNZA 2UXDT 2LRKA 2E8IA 4ASKA 2X0YA 2HPLA 3RIFA 5JRCA 3HKCE 3RIAA 4U2ZA 5HEHA 2QYWA 2FJBA 3K3NA 4PAGA 5FMNA 1VCTA 2ODVA 2WWUA 2YU2A 2PTFA 2CRBA 1O3XA 2XSBA 3AE4A 3HL6A 3LFMA 3ZYKA 3N9MA 4ANJA 3IBPA 1OEDC 2KMFA 2UXCT 4MFRA 3UUXB 1FIOA 4B3MT 4KBMB 1HNZT 3AE9A 2RPAA 2FJEA 4DR5T 3Q5EA 1XDPA 2XHEB 5F3JA 1UUSA 3N2OA 1Z0PA 2VURA 2X51A 2VL0A 4YT0A 2XQAA 3V5UA 4OYKA 4IDZA 2E9XC 2E5LT 2VKDA 4OFZA 2CXFA 2I0MA 4PFOA 4AIUA 4TZ4C 2V7LA 5E0OA 2C5IT 1FJGT 1KFYA 1HX8A 3RQWA 2CCQA 2CEAA 3RC3A 2I6HA 5J1GA 4X20E 2Q9QC 4LF5T 3ZC0A 4QH1A 2BS4A 4JLEA 1UX5A 4JEUB 5JDGA 4I50E 5IYZE 2W67A 2C5KT 3CMLA 4Q25A 4DR7T 4MBQA 5JDFA 5LBMA 4O8SA 3NRXA 3GN5A 3TLUA 3ZSSA 3LG7A 2UU9T 2HN2A 2H7VC 3C64A
chains in the Genus database with same CATH topology
4PNIA 1WLXA 2MTQA 1LVKA 2ZLYA 2NP9A 2XAJB 3ZEFB 1YD8G 3KV9A 1G73A 1HTJF 1FMWA 4DO0A 4UF0B 4MALA 3ZMVB 3E22E 1D0YA 3FHNA 3F31A 3CVRA 3FBZA 4PK6A 5HWXA 3FXDB 2HH7A 4HGAA 5LJMA 2A72A 3C98B 3SRZA 4G2AA 2XUEA 1WYBA 2ZM0A 2JMHA 4EIWA 2XAHB 2OA5A 3I1AA 5HXRA 1NWMX 4FJOA 2YEVC 4CQIA 5FXVA 4IE5A 2NWBA 3UT5E 5AFUL 2ES0A 2QA7A 4EYYR 2PFVA 2ODUA 2CA5A 3KDSE 3C4XA 3DP7A 3DTOA 4DNDA 4CI3B 5L3CB 3GMIA 5LHGB 4H9PC 2IC6A 2KZ7B 4QHOA 5FXWA 1Y64B 2X9HA 3K8PC 4GIWA 3EDUA 4U74A 3HKEE 5ETWA 1MNEA 5FYMA 3SS1A 1QUUA 1OWAA 3KBUA 4PK5A 5JDHA 3N2GE 1V9DA 3ETUA 1LKXA 4O4LE 2Y48B 1QSDA 2V1DB 3PTRB 2B1EA 4TN7B 2XAQB 3BK9A 5FY1A 4H63V 2DHRA 4UV8B 4ZI2C 3WAJA 1D1BA 4U72A 4P09A 5F8PA 3MXZA 4HN9A 3N5LA 3W15B 4ISTA 4UXNB 2X66A 3AAEB 2LSJA 4JEHB 2L8KA 4B6XA 5LJNA 2H3RA 2N2NA 2D0UA 3B13A 4UVCB 4H9SE 2KWHA 3I0QA 4PJNA 4UF0A 3RH3A 3R6NA 1IJ5A 2CWYA 1ZV4X 5EK2A 5KX5E 4KUMB 4UVAB 2LOPA 2RP4A 4UELA 5L3DB 3LJCA 5J2TE 1X79A 2Q9QA 2KLQA 4GYSA 2BDEA 3OBVE 4PJMA 2L9QA 2MYSA 2ACXA 5DQWA 2LJLA 4GOUA 4HE8A 4DMWA 4P0AA 4X1YE 5LA6E 5LGUB 1VOMA 2VL8A 4NUUA 3RYHE 4YHJA 3MJXA 1FMVA 3T8OA 3NBXX 2C5JA 2Y8DA 4EB6E 5JH7E 3HKDE 4WBNE 3N9NA 5KDMC 2WSSV 2M67A 4BJNA 5LCYA 5A1LA 1IAPA 2HPJA 1U5PA 2X67A 4QX8B 4WBOA 3R84B 3RX6A 2WMNA 3IEEA 3N9LA 3QUJA 2NW7A 2Z6EA 3KV4A 2V7IA 3KINB 3PUAA 3H3AA 3D0TA 4AKGA 1EZ3A 1ZEEA 3AAAB 5LOVE 3O4XE 5GONE 3FXEB 3KFWX 2UXXB 4MLKA 4G63A 4QWNB 2WBLA 4EAHA 4AI6A 2EHOC 3Q2MA 1YW0A 3M65A 3GA8A 2VWAA 4AQFA 4H9RC 4AKIA 3MKDA 2D2SA 3FBLA 5HAXA 4AXPA 4TV8E 3ZCJA 3U78A 2CE7A 2EHOD 4WNKA 4O4JE 2VKOA 4ZI3D 2V7MA 4QXHB 4O4IE 3ZPOA 4TX5A 3ZN1B 1LRZA 4UIGA 4I4TE 4YFSA 4C91A 5LNKA 3ZLIA 5EK4A 3AB3B 3EUHA 5L3EB 5BMVE 2WAUA 4L5GA 4O2BE 3V5SA 3N2KE 3UTKA 5FY0A 3ANWB 1VRBA 4P0BA 4AQGA 3AA0B 2NW9A 3OKQA 5JQGE 4F6RC 2G0UA 3BQLA 5FXXA 4Z8XA 4QXCB 3N9PA 3H37A 4IE4A 3CX8B 2H7OA 2E9XA 3KV6A 3AAIA 5EK3A 3F57A 1T98A 2NW8A 4EYUA 3RRWA 5LXTE 2KT9A 5LP6E 4CXWA 5LBQB 5LGTB 3ANWA 1UX4A 2J1DG 4ILUA 3LBXA 5LGNB 2ZMAA 3MZKB 4O2AE 3VHLA 3O1IA 3AA1B 4DBQA 2N1GA 4ERRA 4WW0A 2DLRA 3IF8B 2GK9A 2LM9A 2V7JA 4TV9E 1WRDA 5LHIB 2KWIB 5C8YE 2NOXA 3N9OA 2XAFB 3BQIA 4EZHA 3ZC0A 1ZKEA 3K3OA 2W0GA 4QXBB 4ZI2D 3MK7C 5JDNA 1HG5A 4UV9B 4ZHQE 3KVAA 1HFAA 5LHHB 5HYAA 4BJMA 2X9YA 2CXDA 2KINB 4L9IA 2X0LB 4ZI3C 5JREA 2XAGB 3PUSA 5LYJE 3KBTA 2X9XA 2DCFA 1BR4A 2UXNB 4AKRB 2Y6XA 2VKHA 3KVBA 2V26A 5H6RB 3CX6B 3LK2B 4QX7B 3KV5A 2BVMA 4X1KE 5EZYE 2DNXA 3C51A 4DVDA 2XASB 5JDQA 2CWOA 1HS7A 3RYCE 5CB4E 4CI1B 4HEAA 2W00A 3ZMUB 4JUYA 2PJQA 4XZCA 2A2FX 5HXSA 3OJAA 1S94A 5JR9A 3DJBA 4TUYE 3J7Yq 2DWGA 3LK42 4QKNA 1D0ZA 1KK7A 3I9WA 1MIVA 4ZOLE 3CKDA 3IHRA 1HCIA 1D1CA 3U3IA 4EZ4A 4AKHA 4BAYB 4YJ3E 3L09A 3RKOA 4HKAA 2W63A 3ZMSB 3C4ZA 2L3LA 2E9XB 3EDVA 2JJ9A 1NAFA 4CXXA 1UCUA 3CPZA 4L0RA 3ZYMA 3J9X1 2XTLA 4IHJE 2YU1A 3ZMTB 2Q9QB 1MMDA 4PK4A 4AQFC 2QGSA 2A3DA 1IZNB 1MIYA 1HF8A 2IC9A 2W62A 4H9OC 4OHFA 5HXHA 4HTEA 1KNZA 4N78D 4XAXB 1U4QA 4V1Av 4ZS2A 3WAKA 1MMAA 5LG4A 5DABA 1YKHB 4C90A 5JR9B 5FY7A 4UVBB 1B7TA 1SHZC 2LOSA 3PDYA 2LSKA 1CUNA 4CZZB 3SWHA 3CQGB 2JQQA 3O1HA 3A5XA 3E0ZA 4NUVA 3I0OA 5HWYA 5FP3A 3F2EA 3NZQA 1FEWA 3CQXC 3ZJ1A 1MNDA 2NTYA 3ETVA 3B57A 2CMRA 3VU7H 1SA0E 2VK9A 5HXEA 2ZM2A 3K3QC 3BQKA 4AKLA 4EXTA 1BR0A 2C0SA 4H63H 2DI4A 2JPFA 4KP3C 2CLYC 5L3GB 2XQYA 4GYRA 3Q5WA 1G8XA 5FXZA 1MMGA 3FB2A 3ZC1A 3CX7B 2LHRA 1D1AA 3I9YA 1BR1A 5DJQC 3MACA 3VKHA 3AVRA 4GK5E 4PW8A 2YINA 4X1IE 3Q9DA 1OXZA 2WM9A 1AJ3A 4HFVA 2LSGA 3C4WA 3S4UA 4YJ2E 1H7CA 2VB6A 4I55E 3RYIE 2P9BA 2KXPB 4PJJA 2JMKA 5TAOA 2MBGA 3PU8A 5JDLA 1HG2A 3C50A 2KNDA 1MIWA 2LT3A 2NTXA 3QC9A 4IGUA 3EVYA 3CQCB 4DBRA 2CXLA 5CA0E 1WYCA 3O1JA 3WI3A 4IE0A 3MA9A 3P8CD 3ZYLA 4E7ZA 2RA1A 4UEMA 3ZN0B 2LSIA 2K48A 1ZHCA 5KMGP 3ZJ2A 4H9QC 2X9WA 5HXCA 3RRCA 4EOZB 4H9NC 1IJ6A 3UUNA 5IHYA 1US7B 3TKLB 4CXYA 1LVFA 4XBFB 3HI2A 3AVSA 4BA9A 3P7IA 1D0XA 2N9DA 5L3BB 4OK0A 3NZPA 4IE7A 2EHOB 2IW5B 4I43B 1WR6A 4K0UA 3VKGA 3PUGA 2WMOA 3GWHA 2VKJA 3LK3B 3RPUA 4E7SA 5M4YA 3ZMZB 3QK6A 5JVDE 2CM0A 5DQVA 1BR2A 3PUQA 3JC6D 1E1HB 3AA6B 2I59A 2K24A 3RC8A 2K5BB 2Q9QD 3JC6C 2W61A 3N9QA 5J2UE 4ADZA 3UFEA 2MOZA 1YKEB 4A56A 3HA4A 3HKBE 2E9XD 3CWZB 3PURA 5JRCB 3O9XA 2EHOA 4YLHA 3OYXA 2LEHA 4O4HE 2DWKA 4M1PA 2D5UA 4KMCA 4PFPA 4MHCA 5L3FB 2V7KA 2PBIA 3Q5XA 4ZS3A 4DMVA 2ZM8A 2SPCA 3LBXB 3ONXA 3GN5B 3AA7B 3HR0A 3NRYA 3PU3A 3PE0A 4IE6A 4PJLA 3SOLA 4IIJE 4CI2B 4FI5A 4ISSA 5H6QB 2LSYA 2IAKA 4J2CA 3RYFE 2CLYB 4ZI7E 5L2LA 2JRKA 3OYZA 5JDMA 3ESLA 5CA1E 5FNVE 2K9AA 1MMNA 4GK0E 4OYJA 2LHNA 3UUMA 2D0TA 3UULA 2YK0A 2BZBA 2BVLA 2PG8A 3L3PA 3ZCIA 5ADXL 2LE8A 2VASA 3E08A 5JR9C 2X68A 1S35A 4ASKA 2E8IA 2HPLA 5JRCA 3HKCE 5FMNA 3K3NA 4PAGA 2YU2A 2ODVA 2WWUA 1O3XA 3HL6A 3LFMA 3ZYKA 4ANJA 3N9MA 3IBPA 2KMFA 4MFRA 3UUXB 1FIOA 4KBMB 2XHEB 5F3JA 3N2OA 1Z0PA 2X51A 3V5UA 4OYKA 4IDZA 2E9XC 2VKDA 4OFZA 2CXFA 4PFOA 4TZ4C 2V7LA 5E0OA 2C5IT 1HX8A 2CCQA 2CEAA 3RC3A 5J1GA 4X20E 2Q9QC 4JLEA 1UX5A 4JEUB 5JDGA 4I50E 5IYZE 3CMLA 2C5KT 4MBQA 5JDFA 5LBMA 4O8SA 3NRXA 3GN5A 3LG7A 2H7VC 3C64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSG A;  3VU7 H;  2LSY A;  4GK5 E;  2LSJ A;  4GK0 E;  2N1G A;  2LSI A;  2LSK A;  4EXT A;  4FJO A;  4BA9 A; 
#chains in the Genus database with same CATH topology
 5JTG A;  2D9D A;  4PNI A;  1WLX A;  2MTQ A;  1LVK A;  2BG9 C;  2NP9 A;  2ZLY A;  4P1N A;  4YTM A;  2XAJ B;  3RHW A;  3ZEF B;  1YD8 G;  3KV9 A;  4ILB A;  1G73 A;  1HTJ F;  1FMW A;  4DO0 A;  4HWD A;  4UF0 B;  2FBW A;  4MAL A;  3ZMV B;  3E22 E;  1D0Y A;  2KSR A;  3FHN A;  3F31 A;  3CVR A;  3FBZ A;  5CJ5 A;  1HX1 B;  4PK6 A;  3QB5 K;  2WB5 A;  5HWX A;  3FXD B;  1WCR A;  2HH7 A;  4HGA A;  5LJM A;  2A72 A;  4LF9 T;  4WZX A;  3C98 B;  3SRZ A;  4G2A A;  4EEB A;  2XUE A;  1WYB A;  3CIR A;  4F8H A;  2ZM0 A;  2JMH A;  3RI5 A;  2CBJ A;  3EI0 A;  2MPK A;  4EIW A;  2XAH B;  1QLB A;  2OA5 A;  3I1A A;  4IDQ A;  1NWM X;  4FJO A;  5HEG A;  5HXR A;  2YEV C;  4CQI A;  3AED A;  5FXV A;  4IE5 A;  2NWB A;  3UT5 E;  1XWM A;  5AFU L;  1WR0 A;  2ES0 A;  3ONJ A;  2QA7 A;  2VQE T;  4EYY R;  2PFV A;  2ODU A;  2CA5 A;  3KDS E;  3C4X A;  1N34 T;  3DP7 A;  3DTO A;  4COF A;  4DND A;  4CI3 B;  5L3C B;  3GMI A;  3ZST A;  5LHG B;  4H9P C;  2IC6 A;  2KZ7 B;  4QHO A;  5FXW A;  4JI4 T;  4JI7 T;  1Y64 B;  1XDO A;  1IBK T;  2X9H A;  3EAB A;  3AE1 A;  3K8P C;  2CPT A;  3NVO A;  4GIW A;  1HR0 T;  3EDU A;  1UGO A;  3UU6 A;  4U74 A;  3HKE E;  5ETW A;  1MNE A;  5FYM A;  3SS1 A;  1QUU A;  1OWA A;  3KBU A;  4DR2 T;  4YY3 T;  5ABE A;  2M6B A;  4PK5 A;  3N2G E;  1V9D A;  3ETU A;  1LKX A;  3SFE A;  4TWH A;  3JAF A;  5JDH A;  4O4L E;  2Y48 B;  3AE6 A;  1QSD A;  2V1D B;  3PTR B;  2B1E A;  4TN7 B;  2XAQ B;  1W0B A;  3BK9 A;  5FY1 A;  4H63 V;  2DHR A;  4UV8 B;  5HEO A;  5HEU A;  2XQ6 A;  4ZI2 C;  2VVS A;  4IL9 A;  5AQF B;  1D1B A;  4U72 A;  3WAJ A;  5CFB A;  4P09 A;  2BBH A;  5F8P A;  3MXZ A;  4HN9 A;  3N5L A;  3W15 B;  4IST A;  4UXN B;  2X66 A;  3AAE B;  2LSJ A;  4JEH B;  2L8K A;  4B6X A;  5LJN A;  2H89 A;  2H3R A;  4A98 A;  4LFB T;  2N2N A;  2D0U A;  3B13 A;  2IML A;  4UVC B;  4JV5 T;  4H9S E;  4DID B;  4PJL A;  2KWH A;  3I0Q A;  3TLS A;  2IUB A;  4PJN A;  4UF0 A;  3RH3 A;  1T72 A;  5FL0 A;  1XZY A;  1IJ5 A;  2CWY A;  1ZV4 X;  2IIU A;  5AQQ B;  3R6N A;  4KUM B;  5EK2 A;  4UVA B;  2LOP A;  5KX5 E;  2RP4 A;  4UEL A;  2WZH A;  3LJC A;  5L3D B;  1DU2 A;  5J2T E;  4DV0 T;  1X79 A;  2Q9Q A;  2KLQ A;  4GYS A;  2BDE A;  1KEY A;  3OBV E;  1T8B A;  2L9Q A;  2MYS A;  2ACX A;  4KI0 F;  4PJM A;  5L4H A;  4DV5 T;  5DQW A;  2YDS A;  3JAE A;  2LJL A;  3EHZ A;  2B76 A;  4GOU A;  4HE8 A;  4NIQ A;  4DMW A;  2XQ7 A;  4P0A A;  2WDQ A;  4X1Y E;  5LA6 E;  5LGU B;  1VOM A;  2VL8 A;  1M7K A;  4LFA T;  2WY2 A;  2V6X A;  4NUU A;  1M62 A;  3RYH E;  4YHJ A;  2BG9 B;  3MJX A;  1FMV A;  3T8O A;  4CN6 A;  3NBX X;  4B3T T;  2C5J A;  2Y8D A;  4LF8 T;  3NWI A;  4EB6 E;  5JH7 E;  4X62 T;  3HKD E;  4WBN E;  3N9N A;  5AQK B;  5KDM C;  2WSS V;  4A97 A;  2M67 A;  4BJN A;  5LCY A;  2F4V T;  5A1L A;  1IAP A;  2HPJ A;  1U5P A;  2FJA A;  2X67 A;  3AXJ A;  4QX8 B;  4WBO A;  2WMN A;  3IEE A;  3R84 B;  3RX6 A;  4IL4 A;  1WFD A;  4HFD A;  1UUR A;  2HN1 A;  3N9L A;  3UUB A;  3QUJ A;  2NW7 A;  2Z6E A;  3KV4 A;  2XQ8 A;  4DR1 T;  2V7I A;  3M3Z B;  3KIN B;  1HNW T;  1N33 T;  2LLY A;  3PUA A;  3H3A A;  1ZP0 A;  3D0T A;  4DV4 T;  2UUB T;  5HEJ A;  1W0A A;  4AKG A;  1EZ3 A;  1ZEE A;  3AAA B;  4K0K T;  5LOV E;  4I0U A;  1XNQ T;  3O4X E;  3P50 A;  3FXE B;  5GON E;  2OV9 A;  3KFW X;  2M6I A;  2UXX B;  4A5X A;  3UU4 A;  4MLK A;  4G63 A;  4HFH A;  2WBL A;  4QWN B;  4EAH A;  4X66 T;  2EHO C;  3OTO T;  4AI6 A;  1ZOY A;  2V5D A;  3Q2M A;  1YW0 A;  2XJ7 A;  3ZT6 A;  3A8Y C;  3M65 A;  3GA8 A;  4EED A;  5AQL B;  4ILC A;  2VWA A;  4AQF A;  4H9R C;  4OX9 T;  3MKD A;  2D2S A;  4AKI A;  3FBL A;  5HAX A;  4AXP A;  4TV8 E;  3ZCJ A;  4KX6 A;  3U78 A;  2CE7 A;  4X65 T;  5LMN T;  4DUY T;  2EHO D;  4IRE A;  2IDO B;  2VKO A;  4O4J E;  4WNK A;  3UFG A;  2V6Y B;  4HWF A;  2V7M A;  4QXH B;  4ZI3 D;  4O4I E;  5AQH B;  3ZPO A;  1NEK A;  2WQY A;  3AE3 A;  4TX5 A;  3ZN1 B;  4X5T A;  1LRZ A;  4UIG A;  4I4T E;  4YFS A;  4C91 A;  5LNK A;  4LF4 T;  3ZLI A;  2BKP A;  5EK4 A;  3AB3 B;  3AEB A;  3EUH A;  5L3E B;  5BMV E;  2WAU A;  2IHR 1;  2J62 A;  3AE8 A;  4L5G A;  4JI2 T;  1YQ3 A;  4O2B E;  3FZL B;  3V5S A;  3N2K E;  3UTK A;  5FY0 A;  1T7S A;  3AE5 A;  3ANW B;  1VRB A;  3Q5D A;  4P0B A;  4AQG A;  3AA0 B;  2NW9 A;  3OKQ A;  5JQG E;  4F6R C;  2G0U A;  3BQL A;  5FXX A;  1W09 A;  3AEC A;  4Z8X A;  4QXC B;  5AQP B;  3N9P A;  3H37 A;  4IE4 A;  3PUZ F;  3CX8 B;  2JQK A;  2H7O A;  2E9X A;  3KV6 A;  2R6G F;  2ACZ A;  4LML A;  5ABG A;  3AAI A;  5EK3 A;  3F57 A;  1T98 A;  2NW8 A;  2XZE A;  4EYU A;  3RRW A;  4AIS A;  1J1J A;  5LXT E;  3VRB A;  2KT9 A;  2W66 A;  3K1S A;  5LP6 E;  3AXJ B;  4NPP A;  4CXW A;  2E2A A;  2WP9 A;  1OED A;  5LBQ B;  4EGW A;  1IBL T;  1IBM T;  5LGT B;  3ANW A;  1UX4 A;  2J1D G;  1YQ4 A;  3LBX A;  3LDQ B;  4ILU A;  5AQV B;  3AE7 A;  4AQY T;  5LGN B;  2ZMA A;  2XQ5 A;  3MZK B;  4HWI B;  4O2A E;  2WDV A;  3O1I A;  3AA1 B;  2YDR A;  2BG9 A;  3VHL A;  2UUA T;  4DBQ A;  5HCM A;  2N1G A;  4ERR A;  4WW0 A;  2WU5 A;  4B3R T;  2DLR A;  3IF8 B;  2LM9 A;  1KNP A;  2GK9 A;  2AXD S;  5C2T A;  3PUX F;  2V7J A;  3PJA J;  1WRD A;  3P4W A;  2KWI B;  4TV9 E;  5C8Y E;  5LHI B;  2A9U A;  2NOX A;  4QH5 A;  4ZEY A;  3N9O A;  2XAF B;  3BQI A;  4EZH A;  3P4P A;  1KNR A;  3PJA A;  5ABF A;  1J5E T;  1ZKE A;  3K3O A;  2VVN A;  2W0G A;  3B5M A;  4ZXL A;  4GKJ T;  4QXB B;  3L39 A;  4ZI2 D;  3MK7 C;  5JDN A;  4GKK T;  2LRL A;  1HG5 A;  4UV9 B;  4ZHQ E;  3KVA A;  1J5W A;  2LKH A;  3ABV A;  4ILA A;  1HFA A;  3L8R A;  4U7Y A;  5AQS B;  3RQU A;  4BJM A;  2H88 A;  5HYA A;  2X9Y A;  5LHH B;  2CXD A;  2KIN B;  4L9I A;  2X0L B;  5CGM A;  5LMU T;  4ZI3 C;  5JRE A;  4DR4 T;  2XAG B;  3PUS A;  5LYJ E;  3KBT A;  4YSZ A;  2X9X A;  2DCF A;  1BR4 A;  2WS3 A;  2UXN B;  4AKR B;  2Y6X A;  2VKH A;  3KVB A;  2UXB T;  4JI1 T;  2V26 A;  5H6R B;  3CX6 B;  3LK2 B;  2OLT A;  4QX7 B;  3FZH B;  3KV5 A;  2BVM A;  4NXM T;  5FVL A;  1XNR T;  4X1K E;  5EZY E;  2DNX A;  3C51 A;  4JI5 T;  4DVD A;  2LKG A;  2XAS B;  5ABF B;  5JDQ A;  2E5V A;  2CWO A;  1HS7 A;  4DV7 T;  3RYC E;  5CB4 E;  4CI1 B;  4HEA A;  2W00 A;  3ZMU B;  1X9B A;  2W2U A;  3QOF A;  4JUY A;  4UR9 A;  2PJQ A;  4XZC A;  2A2F X;  4CN4 A;  5HXS A;  3OJA A;  5IWA T;  1S94 A;  5JR9 A;  5AQJ B;  3DJB A;  1NEN A;  2XM1 A;  4YHH T;  2JIW A;  2XQ9 A;  4TUY E;  5AQU B;  3J7Y q;  4IDP A;  2DWG A;  3LK4 2;  4QKN A;  4LFC T;  1D0Z A;  3RIU A;  1KK7 A;  3I9W A;  1MIV A;  3QNU A;  4LF6 T;  4ZOL E;  1I6Z A;  3CKD A;  1CHU A;  3IHR A;  1HCI A;  3VR9 A;  1D1C A;  5FKY A;  3U3I A;  4EZ4 A;  4JYA T;  4AKH A;  1OED B;  4BAY B;  2WDR A;  4DV3 T;  4LMK A;  5IUX A;  3PV0 F;  2AE9 A;  3L09 A;  4YJ3 E;  2XPK A;  3RKO A;  4B3S T;  5AQR B;  4HKA A;  2W63 A;  4IDN A;  3ZMS B;  1Y01 A;  3ZT5 A;  3C4Z A;  3UU5 A;  2L3L A;  2E9X B;  3EDV A;  4YTN A;  3RIU C;  2JJ9 A;  1NAF A;  4CXX A;  4ZZB A;  1UCU A;  4U31 A;  1N32 T;  3CPZ A;  4L0R A;  3ZYM A;  4TNV A;  3J9X 1;  2J47 A;  2XTL A;  4IHJ E;  4NXN T;  2YU1 A;  3ZKR A;  4EV6 A;  3ZMT B;  4DV1 T;  2Q9Q B;  5FL1 A;  3UQ7 A;  1MMD A;  4PK4 A;  4AQF C;  2XSA A;  2QGS A;  1Z8U A;  2A3D A;  1IZN B;  1MIY A;  1HF8 A;  2IC9 A;  2W62 A;  4H9O C;  4OHF A;  5HXH A;  2XQ3 A;  4HTE A;  1KNZ A;  1KF6 A;  4IT4 A;  5AQI B;  1SE7 A;  3ZT7 A;  2FJD A;  4N78 D;  4DV6 T;  4JI0 T;  4XAX B;  1U4Q A;  4JI8 T;  4V1A v;  4ZS2 A;  3P4R A;  3WAK A;  1MMA A;  2YN6 A;  5LG4 A;  5DAB A;  1YKH B;  3FZK B;  4C90 A;  5JR9 B;  5FY7 A;  2CHO A;  2V6Y A;  2FUP A;  2W4X A;  4HFB A;  1B7T A;  4UVB B;  1SHZ C;  2LOS A;  3PDY A;  2LSK A;  1CUN A;  4HWC A;  4CZZ B;  3SWH A;  5BR8 T;  3CQG B;  2JQQ A;  3LSV A;  3A5X A;  3E0Z A;  3O1H A;  4HFI A;  4NUV A;  5C3J A;  3I0O A;  5HWY A;  5FP3 A;  3F2E A;  3NZQ A;  1FEW A;  3CQX C;  2BKO A;  3ZJ1 A;  1MND A;  2NTY A;  3ETV A;  3B57 A;  2CMR A;  4TWD A;  3RGL A;  2JQH A;  4QH4 A;  3VU7 H;  2YKS A;  3CK6 A;  5ABH A;  1SA0 E;  2VK9 A;  3PUV F;  5HXE A;  2ZM2 A;  3K3Q C;  3BQK A;  4AKL A;  4EXT A;  1BR0 A;  2C0S A;  4H63 H;  2DI4 A;  2JPF A;  4HFC A;  3PUY F;  4KP3 C;  2CLY C;  4Z91 A;  5L3G B;  2XQY A;  1UK5 A;  4GYR A;  5LB7 B;  3Q5W A;  1G8X A;  2MAW A;  1MMG A;  2XM2 A;  3FB2 A;  5FXZ A;  3ZC1 A;  3CX7 B;  4ZZC A;  2LHR A;  1D1A A;  3AEA A;  1BR1 A;  3I9Y A;  3MAC A;  5DJQ C;  3VKH A;  3AVR A;  4GK5 E;  4PW8 A;  2YIN A;  4X1I E;  3TLW A;  3Q9D A;  1OXZ A;  5FVK A;  2WM9 A;  1AJ3 A;  4HFV A;  2LSG A;  3C4W A;  3S4U A;  4YJ2 E;  4TWF A;  1H7C A;  2VB6 A;  3OPC A;  2HHH T;  4I55 E;  3RYI E;  2P9B A;  2KXP B;  4PJJ A;  2JMK A;  3A7M A;  5TAO A;  2QVA A;  3PU8 A;  2MBG A;  3TLT A;  3VR8 A;  5JDL A;  1HG2 A;  3C50 A;  2KND A;  1MIW A;  2LT3 A;  2NTX A;  2XQ4 A;  3QC9 A;  3EVY A;  3CQC B;  4IGU A;  3SFD A;  2BKN A;  4WYV A;  4DBR A;  3IA3 A;  2ZM6 T;  4DUZ T;  2CXL A;  5AQM B;  5CA0 E;  1WYC A;  3O1J A;  3G06 A;  3NKZ A;  4IE0 A;  3MA9 A;  3WI3 A;  3P8C D;  2CHN A;  2CBI A;  2RA1 A;  4UEM A;  3ZYL A;  3ZN0 B;  2LSI A;  1SUM B;  4E7Z A;  2K48 A;  1ZHC A;  4TNW A;  5KMG P;  3ZJ2 A;  4KHZ F;  5J0Z A;  4H9Q C;  2X9W A;  2X0H A;  4U7I A;  5HXC A;  3RRC A;  3P4Q A;  4H9N C;  3UQ4 A;  4EOZ B;  1IJ6 A;  3H3M A;  2VQF T;  3UUN A;  1GQE A;  1US7 B;  2BS2 A;  5IHY A;  3TKL B;  4CXY A;  3T1H T;  1LVF A;  3AE2 A;  3RLF F;  3HI2 A;  3AVS A;  4BA9 A;  4XBF B;  3QB5 A;  2J4G A;  3P7I A;  1D0X A;  2N9D A;  2V8S V;  2DL1 A;  4X64 T;  5L3B B;  3OVU A;  4OK0 A;  2NR4 A;  4YXD A;  3NZP A;  4IE7 A;  2EHO B;  5KXJ A;  2IW5 B;  4I43 B;  1WR6 A;  2WU2 A;  3FZF B;  4K0U A;  3RF1 A;  3PUG A;  3VKG A;  2WMO A;  3GWH A;  2VKJ A;  3AEG A;  3LK3 B;  3RPU A;  4E7S A;  5M4Y A;  3ZMZ B;  3QK6 A;  5JVD E;  3AEE A;  2CM0 A;  5DQV A;  1BR2 A;  1R8I A;  3JC6 D;  1E1H B;  3EAM A;  3AA6 B;  3PUQ A;  4U33 A;  2I59 A;  2K24 A;  3FZM B;  3PUW F;  4U2Y A;  3SOL A;  2K5B B;  3TLV A;  3RC8 A;  2Q9Q D;  1L0V A;  5AQO B;  4JI6 T;  4Z90 A;  3JC6 C;  2W61 A;  3N9Q A;  4IDO A;  4DR6 T;  4DV2 T;  5J2U E;  4ADZ A;  3UFE A;  2MOZ A;  1YKE B;  4CN1 A;  4A56 A;  3HA4 A;  3HKB E;  4U3C A;  3RKG A;  3X1D A;  5L4E A;  2E9X D;  3CWZ B;  3PUR A;  5JRC B;  3O9X A;  1OED E;  2EHO A;  4YLH A;  3OYX A;  2BBJ A;  3ONL C;  2JQ9 A;  2LEH A;  2LM2 A;  4O4H E;  5LG3 A;  2DWK A;  2K3W A;  2D5U A;  4M1P A;  3JAD A;  4KMC A;  2YDQ A;  4MHC A;  2V5C A;  4PFP A;  2V7K A;  2WCA A;  5L3F B;  1HNX T;  2UUC T;  2PBI A;  3Q5X A;  4ZS3 A;  4DMV A;  2ZM8 A;  2YOE A;  2SPC A;  3LBX B;  1XMQ T;  1JNR A;  3ONX A;  3GN5 B;  3AA7 B;  3AEF A;  1E7P A;  3HR0 A;  3NRY A;  3PE0 A;  2QRX A;  3PU3 A;  4HWH A;  4IIJ E;  4IE6 A;  4CI2 B;  4JBW F;  1XMO T;  4FI5 A;  4ISS A;  5H6Q B;  3P4S A;  3T1Y T;  1N36 T;  1YXR A;  2BS3 A;  2LSY A;  2IAK A;  3JCF A;  4J2C A;  3RYF E;  2CLY B;  3UU8 A;  4ZI7 E;  5L2L A;  2JRK A;  5AQT B;  1W9R A;  3OYZ A;  5JDM A;  3ESL A;  5CA1 E;  1E2A A;  4LF7 T;  5FNV E;  2K9A A;  5AQG B;  1MMN A;  4GK0 E;  5HCJ A;  4YSX A;  4OYJ A;  1VCS A;  2LHN A;  3UUM A;  2D0T A;  3UUL A;  4YTP A;  2YK0 A;  4KHP T;  3UU3 A;  1I94 T;  2BZB A;  2BVL A;  2PG8 A;  2BG9 E;  3L3P A;  5F5W A;  3ZCI A;  5ADX L;  2LE8 A;  2VAS A;  2WWV A;  4YSY A;  2WZI A;  3E08 A;  2XY8 B;  4DR3 T;  3VRA A;  4JI3 T;  5AQN B;  5JR9 C;  4LMJ A;  2X68 A;  1S35 A;  4HFE A;  5L47 A;  1JNZ A;  2UXD T;  2LRK A;  2E8I A;  4ASK A;  2X0Y A;  2HPL A;  3RIF A;  5JRC A;  3HKC E;  3RIA A;  4U2Z A;  5HEH A;  2QYW A;  2FJB A;  3K3N A;  4PAG A;  5FMN A;  1VCT A;  2ODV A;  2WWU A;  2YU2 A;  2PTF A;  2CRB A;  1O3X A;  2XSB A;  3AE4 A;  3HL6 A;  3LFM A;  3ZYK A;  3N9M A;  4ANJ A;  3IBP A;  1OED C;  2KMF A;  2UXC T;  4MFR A;  3UUX B;  1FIO A;  4B3M T;  4KBM B;  1HNZ T;  3AE9 A;  2RPA A;  2FJE A;  4DR5 T;  3Q5E A;  1XDP A;  2XHE B;  5F3J A;  1UUS A;  3N2O A;  1Z0P A;  2VUR A;  2X51 A;  2VL0 A;  4YT0 A;  2XQA A;  3V5U A;  4OYK A;  4IDZ A;  2E9X C;  2E5L T;  2VKD A;  4OFZ A;  2CXF A;  2I0M A;  4PFO A;  4AIU A;  4TZ4 C;  2V7L A;  5E0O A;  2C5I T;  1FJG T;  1KFY A;  1HX8 A;  3RQW A;  2CCQ A;  2CEA A;  3RC3 A;  2I6H A;  5J1G A;  4X20 E;  2Q9Q C;  4LF5 T;  3ZC0 A;  4QH1 A;  2BS4 A;  4JLE A;  1UX5 A;  4JEU B;  5JDG A;  4I50 E;  5IYZ E;  2W67 A;  2C5K T;  3CML A;  4Q25 A;  4DR7 T;  4MBQ A;  5JDF A;  5LBM A;  4O8S A;  3NRX A;  3GN5 A;  3TLU A;  3ZSS A;  3LG7 A;  2UU9 T;  2HN2 A;  2H7V C;  3C64 A; 
#chains in the Genus database with same CATH homology
 4PNI A;  1WLX A;  2MTQ A;  1LVK A;  2ZLY A;  2NP9 A;  2XAJ B;  3ZEF B;  1YD8 G;  3KV9 A;  1G73 A;  1HTJ F;  1FMW A;  4DO0 A;  4UF0 B;  4MAL A;  3ZMV B;  3E22 E;  1D0Y A;  3FHN A;  3F31 A;  3CVR A;  3FBZ A;  4PK6 A;  5HWX A;  3FXD B;  2HH7 A;  4HGA A;  5LJM A;  2A72 A;  3C98 B;  3SRZ A;  4G2A A;  2XUE A;  1WYB A;  2ZM0 A;  2JMH A;  4EIW A;  2XAH B;  2OA5 A;  3I1A A;  5HXR A;  1NWM X;  4FJO A;  2YEV C;  4CQI A;  5FXV A;  4IE5 A;  2NWB A;  3UT5 E;  5AFU L;  2ES0 A;  2QA7 A;  4EYY R;  2PFV A;  2ODU A;  2CA5 A;  3KDS E;  3C4X A;  3DP7 A;  3DTO A;  4DND A;  4CI3 B;  5L3C B;  3GMI A;  5LHG B;  4H9P C;  2IC6 A;  2KZ7 B;  4QHO A;  5FXW A;  1Y64 B;  2X9H A;  3K8P C;  4GIW A;  3EDU A;  4U74 A;  3HKE E;  5ETW A;  1MNE A;  5FYM A;  3SS1 A;  1QUU A;  1OWA A;  3KBU A;  4PK5 A;  5JDH A;  3N2G E;  1V9D A;  3ETU A;  1LKX A;  4O4L E;  2Y48 B;  1QSD A;  2V1D B;  3PTR B;  2B1E A;  4TN7 B;  2XAQ B;  3BK9 A;  5FY1 A;  4H63 V;  2DHR A;  4UV8 B;  4ZI2 C;  3WAJ A;  1D1B A;  4U72 A;  4P09 A;  5F8P A;  3MXZ A;  4HN9 A;  3N5L A;  3W15 B;  4IST A;  4UXN B;  2X66 A;  3AAE B;  2LSJ A;  4JEH B;  2L8K A;  4B6X A;  5LJN A;  2H3R A;  2N2N A;  2D0U A;  3B13 A;  4UVC B;  4H9S E;  2KWH A;  3I0Q A;  4PJN A;  4UF0 A;  3RH3 A;  3R6N A;  1IJ5 A;  2CWY A;  1ZV4 X;  5EK2 A;  5KX5 E;  4KUM B;  4UVA B;  2LOP A;  2RP4 A;  4UEL A;  5L3D B;  3LJC A;  5J2T E;  1X79 A;  2Q9Q A;  2KLQ A;  4GYS A;  2BDE A;  3OBV E;  4PJM A;  2L9Q A;  2MYS A;  2ACX A;  5DQW A;  2LJL A;  4GOU A;  4HE8 A;  4DMW A;  4P0A A;  4X1Y E;  5LA6 E;  5LGU B;  1VOM A;  2VL8 A;  4NUU A;  3RYH E;  4YHJ A;  3MJX A;  1FMV A;  3T8O A;  3NBX X;  2C5J A;  2Y8D A;  4EB6 E;  5JH7 E;  3HKD E;  4WBN E;  3N9N A;  5KDM C;  2WSS V;  2M67 A;  4BJN A;  5LCY A;  5A1L A;  1IAP A;  2HPJ A;  1U5P A;  2X67 A;  4QX8 B;  4WBO A;  3R84 B;  3RX6 A;  2WMN A;  3IEE A;  3N9L A;  3QUJ A;  2NW7 A;  2Z6E A;  3KV4 A;  2V7I A;  3KIN B;  3PUA A;  3H3A A;  3D0T A;  4AKG A;  1EZ3 A;  1ZEE A;  3AAA B;  5LOV E;  3O4X E;  5GON E;  3FXE B;  3KFW X;  2UXX B;  4MLK A;  4G63 A;  4QWN B;  2WBL A;  4EAH A;  4AI6 A;  2EHO C;  3Q2M A;  1YW0 A;  3M65 A;  3GA8 A;  2VWA A;  4AQF A;  4H9R C;  4AKI A;  3MKD A;  2D2S A;  3FBL A;  5HAX A;  4AXP A;  4TV8 E;  3ZCJ A;  3U78 A;  2CE7 A;  2EHO D;  4WNK A;  4O4J E;  2VKO A;  4ZI3 D;  2V7M A;  4QXH B;  4O4I E;  3ZPO A;  4TX5 A;  3ZN1 B;  1LRZ A;  4UIG A;  4I4T E;  4YFS A;  4C91 A;  5LNK A;  3ZLI A;  5EK4 A;  3AB3 B;  3EUH A;  5L3E B;  5BMV E;  2WAU A;  4L5G A;  4O2B E;  3V5S A;  3N2K E;  3UTK A;  5FY0 A;  3ANW B;  1VRB A;  4P0B A;  4AQG A;  3AA0 B;  2NW9 A;  3OKQ A;  5JQG E;  4F6R C;  2G0U A;  3BQL A;  5FXX A;  4Z8X A;  4QXC B;  3N9P A;  3H37 A;  4IE4 A;  3CX8 B;  2H7O A;  2E9X A;  3KV6 A;  3AAI A;  5EK3 A;  3F57 A;  1T98 A;  2NW8 A;  4EYU A;  3RRW A;  5LXT E;  2KT9 A;  5LP6 E;  4CXW A;  5LBQ B;  5LGT B;  3ANW A;  1UX4 A;  2J1D G;  4ILU A;  3LBX A;  5LGN B;  2ZMA A;  3MZK B;  4O2A E;  3VHL A;  3O1I A;  3AA1 B;  4DBQ A;  2N1G A;  4ERR A;  4WW0 A;  2DLR A;  3IF8 B;  2GK9 A;  2LM9 A;  2V7J A;  4TV9 E;  1WRD A;  5LHI B;  2KWI B;  5C8Y E;  2NOX A;  3N9O A;  2XAF B;  3BQI A;  4EZH A;  3ZC0 A;  1ZKE A;  3K3O A;  2W0G A;  4QXB B;  4ZI2 D;  3MK7 C;  5JDN A;  1HG5 A;  4UV9 B;  4ZHQ E;  3KVA A;  1HFA A;  5LHH B;  5HYA A;  4BJM A;  2X9Y A;  2CXD A;  2KIN B;  4L9I A;  2X0L B;  4ZI3 C;  5JRE A;  2XAG B;  3PUS A;  5LYJ E;  3KBT A;  2X9X A;  2DCF A;  1BR4 A;  2UXN B;  4AKR B;  2Y6X A;  2VKH A;  3KVB A;  2V26 A;  5H6R B;  3CX6 B;  3LK2 B;  4QX7 B;  3KV5 A;  2BVM A;  4X1K E;  5EZY E;  2DNX A;  3C51 A;  4DVD A;  2XAS B;  5JDQ A;  2CWO A;  1HS7 A;  3RYC E;  5CB4 E;  4CI1 B;  4HEA A;  2W00 A;  3ZMU B;  4JUY A;  2PJQ A;  4XZC A;  2A2F X;  5HXS A;  3OJA A;  1S94 A;  5JR9 A;  3DJB A;  4TUY E;  3J7Y q;  2DWG A;  3LK4 2;  4QKN A;  1D0Z A;  1KK7 A;  3I9W A;  1MIV A;  4ZOL E;  3CKD A;  3IHR A;  1HCI A;  1D1C A;  3U3I A;  4EZ4 A;  4AKH A;  4BAY B;  4YJ3 E;  3L09 A;  3RKO A;  4HKA A;  2W63 A;  3ZMS B;  3C4Z A;  2L3L A;  2E9X B;  3EDV A;  2JJ9 A;  1NAF A;  4CXX A;  1UCU A;  3CPZ A;  4L0R A;  3ZYM A;  3J9X 1;  2XTL A;  4IHJ E;  2YU1 A;  3ZMT B;  2Q9Q B;  1MMD A;  4PK4 A;  4AQF C;  2QGS A;  2A3D A;  1IZN B;  1MIY A;  1HF8 A;  2IC9 A;  2W62 A;  4H9O C;  4OHF A;  5HXH A;  4HTE A;  1KNZ A;  4N78 D;  4XAX B;  1U4Q A;  4V1A v;  4ZS2 A;  3WAK A;  1MMA A;  5LG4 A;  5DAB A;  1YKH B;  4C90 A;  5JR9 B;  5FY7 A;  4UVB B;  1B7T A;  1SHZ C;  2LOS A;  3PDY A;  2LSK A;  1CUN A;  4CZZ B;  3SWH A;  3CQG B;  2JQQ A;  3O1H A;  3A5X A;  3E0Z A;  4NUV A;  3I0O A;  5HWY A;  5FP3 A;  3F2E A;  3NZQ A;  1FEW A;  3CQX C;  3ZJ1 A;  1MND A;  2NTY A;  3ETV A;  3B57 A;  2CMR A;  3VU7 H;  1SA0 E;  2VK9 A;  5HXE A;  2ZM2 A;  3K3Q C;  3BQK A;  4AKL A;  4EXT A;  1BR0 A;  2C0S A;  4H63 H;  2DI4 A;  2JPF A;  4KP3 C;  2CLY C;  5L3G B;  2XQY A;  4GYR A;  3Q5W A;  1G8X A;  5FXZ A;  1MMG A;  3FB2 A;  3ZC1 A;  3CX7 B;  2LHR A;  1D1A A;  3I9Y A;  1BR1 A;  5DJQ C;  3MAC A;  3VKH A;  3AVR A;  4GK5 E;  4PW8 A;  2YIN A;  4X1I E;  3Q9D A;  1OXZ A;  2WM9 A;  1AJ3 A;  4HFV A;  2LSG A;  3C4W A;  3S4U A;  4YJ2 E;  1H7C A;  2VB6 A;  4I55 E;  3RYI E;  2P9B A;  2KXP B;  4PJJ A;  2JMK A;  5TAO A;  2MBG A;  3PU8 A;  5JDL A;  1HG2 A;  3C50 A;  2KND A;  1MIW A;  2LT3 A;  2NTX A;  3QC9 A;  4IGU A;  3EVY A;  3CQC B;  4DBR A;  2CXL A;  5CA0 E;  1WYC A;  3O1J A;  3WI3 A;  4IE0 A;  3MA9 A;  3P8C D;  3ZYL A;  4E7Z A;  2RA1 A;  4UEM A;  3ZN0 B;  2LSI A;  2K48 A;  1ZHC A;  5KMG P;  3ZJ2 A;  4H9Q C;  2X9W A;  5HXC A;  3RRC A;  4EOZ B;  4H9N C;  1IJ6 A;  3UUN A;  5IHY A;  1US7 B;  3TKL B;  4CXY A;  1LVF A;  4XBF B;  3HI2 A;  3AVS A;  4BA9 A;  3P7I A;  1D0X A;  2N9D A;  5L3B B;  4OK0 A;  3NZP A;  4IE7 A;  2EHO B;  2IW5 B;  4I43 B;  1WR6 A;  4K0U A;  3VKG A;  3PUG A;  2WMO A;  3GWH A;  2VKJ A;  3LK3 B;  3RPU A;  4E7S A;  5M4Y A;  3ZMZ B;  3QK6 A;  5JVD E;  2CM0 A;  5DQV A;  1BR2 A;  3PUQ A;  3JC6 D;  1E1H B;  3AA6 B;  2I59 A;  2K24 A;  3RC8 A;  2K5B B;  2Q9Q D;  3JC6 C;  2W61 A;  3N9Q A;  5J2U E;  4ADZ A;  3UFE A;  2MOZ A;  1YKE B;  4A56 A;  3HA4 A;  3HKB E;  2E9X D;  3CWZ B;  3PUR A;  5JRC B;  3O9X A;  2EHO A;  4YLH A;  3OYX A;  2LEH A;  4O4H E;  2DWK A;  4M1P A;  2D5U A;  4KMC A;  4PFP A;  4MHC A;  5L3F B;  2V7K A;  2PBI A;  3Q5X A;  4ZS3 A;  4DMV A;  2ZM8 A;  2SPC A;  3LBX B;  3ONX A;  3GN5 B;  3AA7 B;  3HR0 A;  3NRY A;  3PU3 A;  3PE0 A;  4IE6 A;  4PJL A;  3SOL A;  4IIJ E;  4CI2 B;  4FI5 A;  4ISS A;  5H6Q B;  2LSY A;  2IAK A;  4J2C A;  3RYF E;  2CLY B;  4ZI7 E;  5L2L A;  2JRK A;  3OYZ A;  5JDM A;  3ESL A;  5CA1 E;  5FNV E;  2K9A A;  1MMN A;  4GK0 E;  4OYJ A;  2LHN A;  3UUM A;  2D0T A;  3UUL A;  2YK0 A;  2BZB A;  2BVL A;  2PG8 A;  3L3P A;  3ZCI A;  5ADX L;  2LE8 A;  2VAS A;  3E08 A;  5JR9 C;  2X68 A;  1S35 A;  4ASK A;  2E8I A;  2HPL A;  5JRC A;  3HKC E;  5FMN A;  3K3N A;  4PAG A;  2YU2 A;  2ODV A;  2WWU A;  1O3X A;  3HL6 A;  3LFM A;  3ZYK A;  4ANJ A;  3N9M A;  3IBP A;  2KMF A;  4MFR A;  3UUX B;  1FIO A;  4KBM B;  2XHE B;  5F3J A;  3N2O A;  1Z0P A;  2X51 A;  3V5U A;  4OYK A;  4IDZ A;  2E9X C;  2VKD A;  4OFZ A;  2CXF A;  4PFO A;  4TZ4 C;  2V7L A;  5E0O A;  2C5I T;  1HX8 A;  2CCQ A;  2CEA A;  3RC3 A;  5J1G A;  4X20 E;  2Q9Q C;  4JLE A;  1UX5 A;  4JEU B;  5JDG A;  4I50 E;  5IYZ E;  3CML A;  2C5K T;  4MBQ A;  5JDF A;  5LBM A;  4O8S A;  3NRX A;  3GN5 A;  3LG7 A;  2H7V C;  3C64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...