4BA9A

The structural basis for the coordination of y-family translesion dna polymerases by rev1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
114
structure length
104
Chain Sequence
GPHMHKKSFFDKKRSERASNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA POLYMERASE KAPPA, DNA REPAIR PROTEIN REV1
publication title The Structural Basis for the Coordination of Y- Family Translesion DNA Polymerases by Rev1
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 40
structure length 104
sequence length 114
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4ba9A00
2LSGA 3VU7H 2LSIA 4BA9A 4GK5E 2LSYA 2LSKA 4FJOA 2LSJA 4EXTA 2N1GA 4GK0E
chains in the Genus database with same CATH superfamily
4HN9A 1HR0T 4EZ4A 2A9UA 4U2ZA 1G73A 3PUGA 3IA3A 4CQIA 4AIUA 2YOEA 4I50E 2W63A 3EI0A 2ZMAA 2XQ7A 1HF8A 4AQYT 1OWAA 3RIUC 3ONLC 3B13A 1W9RA 1KNPA 1IBLT 4MBQA 3OTOT 3QB5K 2BDEA 3NWIA 3ZKRA 4AKRB 2L9QA 3CPZA 1BR1A 2KSRA 2E8IA 3OKQA 4U31A 3SWHA 4ILCA 2YU1A 5ABGA 3HL6A 3K8PC 4P1NA 2X9YA 2XJ7A 1LKXA 3I0QA 3AXJA 2D5UA 3IEEA 4A98A 2LOSA 4XZCA 4EV6A 3FZKB 2NP9A 3CQGB 5AQKB 2JIWA 2LSGA 2BVMA 2WBLA 3IBPA 1UCUA 5JR9B 3QK6A 3ZJ1A 3DP7A 5AQJB 3N2KE 4PK5A 3UULA 3P4WA 4ILUA 4KHZF 2ACXA 2CPTA 3KINB 4JLEA 4TWDA 3MA9A 4C90A 4JI8T 4CN4A 4H9OC 3IF8B 2VWAA 3AEGA 2YU2A 4IL9A 3NRYA 2VKOA 5FP3A 2J1DG 1HCIA 4P0BA 2YDSA 4NXMT 2UU9T 3NVOA 1WLXA 2JJ9A 3RH3A 5LJNA 2W4XA 3OBVE 2KMFA 4GK0E 4ILAA 5IUXA 2CXDA 2E2AA 5JTGA 3T8OA 5J1GA 1NAFA 5LHGB 4HFIA 4KP3C 3I0OA 5HCJA 4A97A 3IHRA 3RIFA 3RIAA 3E08A 2XAGB 5JREA 2XZEA 4Z91A 3CX7B 2I6HA 2CHOA 4ZI3C 5LJMA 5LMNT 4KX6A 4ISSA 4ERRA 3AE7A 2EHOA 4U7IA 3BK9A 2LSYA 3MK7C 5L4EA 2NOXA 2OLTA 4L5GA 3EHZA 3ZJ2A 4O2AE 1UGOA 4DBQA 5C2TA 2JMKA 2WDVA 3AVSA 2LLYA 2LKGA 2NTYA 3JC6D 5EK4A 1FIOA 5FXWA 3JADA 4OYJA 1FMVA 3ZC1A 4O8SA 4LFBT 4DV6T 5JDGA 2IC9A 1XMOT 1MMAA 3CIRA 2NWBA 4OHFA 3AA0B 3ZC0A 3LBXA 3V5UA 4GK5E 3AVRA 3PUYF 4AQFA 4HFHA 5AQHB 3A5XA 2E5LT 2VVSA 3LFMA 5HEUA 3ZYLA 3FXEB 1MIYA 2HN1A 2V7IA 1MMGA 5JR9A 4JYAT 4DR1T 3QB5A 3RF1A 4IE5A 2C5JA 1XWMA 4EAHA 3VRAA 3RX6A 2LEHA 3CK6A 4DMWA 1VOMA 3K3QC 3W15B 3P4PA 4OYKA 5JH7E 1JNZA 2XQ3A 4AXPA 1N34T 3EDUA 1UX5A 2XQ9A 4ILBA 3PTRB 2XQ4A 2WCAA 4DVDA 3Q5EA 5FXXA 3WI3A 2DHRA 4YY3T 4CN1A 2CXLA 3AE9A 1HFAA 5J2TE 5AQTB 2VKJA 2X0HA 3ZT7A 1KNZA 1FJGT 2CM0A 5L4HA 2DLRA 4LF6T 2H88A 1VRBA 3N9OA 5LYJE 3ZMUB 1N33T 5C8YE 2CA5A 3KVBA 2BBJA 3P8CD 5L47A 3C4ZA 5L3EB 3JAEA 1OEDA 4AKHA 2WU2A 3HA4A 1M7KA 3NZQA 2W66A 4I4TE 4G63A 4HFEA 4JI6T 3L39A 3JAFA 3C64A 4YTMA 4O2BE 2LOPA 2CWOA 5H6QB 3RRCA 4QXBB 3PUVF 1WR0A 3LK3B 4BAYB 3I1AA 4PJNA 2LE8A 3C4XA 1BR4A 5HEHA 3K1SA 5AQVB 4EXTA 1WRDA 5FY7A 3O1IA 3KBUA 4HWIB 5FVLA 2YKSA 3RC3A 1YW0A 2CRBA 4CXWA 4QWNB 2XPKA 5LBMA 1ZV4X 2NW8A 5DABA 4UVCB 5L3FB 4DV7T 2YK0A 2C5KT 4UXNB 4HTEA 4NUUA 5LP6E 4UR9A 3CQXC 3PUSA 4IDOA 4KHPT 1GQEA 3P4QA 2BS4A 3N2OA 2GK9A 4QH5A 2WAUA 5HXSA 3OPCA 1IJ5A 2XSAA 2JQKA 4L9IA 3AXJB 2D9DA 2MTQA 1WR6A 2H7VC 2PFVA 5LNKA 3I9YA 4YHHT 3TKLB 4EYYR 5J0ZA 3ZYMA 3J9X1 4JUYA 3KV5A 4CXXA 3CX8B 4A5XA 4EGWA 2K3WA 4Z90A 5HXRA 3PJAA 2YEVC 3CQCB 5LOVE 3AE3A 4BJMA 3G06A 4EZHA 2XASB 3AEAA 2IDOB 4YFSA 2V7KA 4HFDA 3JC6C 2H7OA 5L3BB 4HFVA 4PJJA 4ZZCA 3RLFF 1X79A 4FJOA 2IAKA 2MAWA 1KF6A 4GIWA 2WB5A 2WM9A 2KWHA 2C5IT 1D1CA 2V7JA 3N9QA 4YXDA 4AKIA 2XTLA 4EEDA 4UV8B 5TAOA 4LFCT 4H9NC 4TV9E 3PUWF 5HEGA 1D0YA 3WAJA 4CXYA 1HNWT 3LK42 4ZEYA 2WDRA 3RYCE 4HGAA 4IDNA 4ZHQE 5CGMA 5FXZA 5LGTB 4IDQA 3ZMSB 1MNEA 3NKZA 4ZS3A 2WDQA 2BS2A 2FJBA 3B57A 3AEEA 2DI4A 4B3ST 3MACA 1WYCA 2V7LA 1N32T 4YLHA 3L3PA 3T1YT 4UVBB 4NIQA 3FXDB 3PU3A 2CBJA 4UV9B 2UXNB 4I0UA 3C4WA 3ZSTA 4B3MT 2CCQA 5FY0A 3CKDA 2VB6A 4X66T 3UTKA 3VKHA 3VRBA 1X9BA 3LBXB 5EK2A 4LF9T 3HKCE 2JMHA 4H9SE 1NENA 5BR8T 2CHNA 1XZYA 3AEFA 3PJAJ 4DR2T 4BA9A 2BZBA 3OJAA 5AQRB 3D0TA 3KVAA 5HCMA 4WW0A 4M1PA 3NRXA 1Y64B 3RQWA 1KK7A 5AFUL 1IBMT 1UK5A 2XQ6A 1I6ZA 2EHOC 5CJ5A 2W67A 4QH4A 1HS7A 3E22E 3UT5E 3L8RA 4ZZBA 2LHNA 3ONJA 3DJBA 1M62A 4O4HE 2HH7A 4L0RA 1OEDE 2DNXA 3ONXA 2FJEA 2PBIA 5HYAA 2YINA 2DL1A 2KWIB 2WZIA 4DV3T 1G8XA 3K3NA 5HEOA 4JV5T 2HHHT 4PAGA 3RC8A 3E0ZA 5ADXL 2SPCA 4GKKT 3OYXA 3N9NA 4AKLA 1OEDB 4ZI2D 4GYRA 2N9DA 4DR5T 4AQFC 2VURA 2E9XD 2V26A 1QUUA 1E2AA 3B5MA 3AA1B 3OYZA 2W00A 4H9QC 4DV4T 4IT4A 3ZCJA 2OA5A 4AQGA 2R6GF 2Y8DA 1BR0A 3KV6A 5JR9C 1W0AA 2WP9A 2FJAA 4PJLA 2L3LA 3UU5A 3RGLA 2QA7A 3QUJA 3V5SA 2CLYB 4NXNT 4LMKA 2UXDT 1T8BA 2KLQA 2Y48B 3UUNA 5CA0E 4O4IE 1OXZA 4TNWA 4LFAT 4WBNE 4PJMA 2CE7A 4WBOA 5FVKA 1D0ZA 3N9LA 4WYVA 4JI4T 1ZEEA 1HG2A 5ETWA 5HWXA 3AEBA 4PK6A 3AAEB 5LG4A 4J2CA 2B1EA 4P0AA 3UU6A 2IMLA 3RHWA 3JCFA 4JEUB 2XQYA 2JQQA 3VR9A 4QKNA 3CX6B 1B7TA 1OEDC 5JDLA 2JRKA 1KEYA 2YDQA 1D1AA 2FBWA 4FI5A 2M6IA 2CMRA 4JI1T 2WQYA 4LF5T 4G2AA 4MHCA 3N9MA 2Z6EA 4IE0A 1UX4A 3CVRA 1SUMB 3O1HA 3RYIE 3MKDA 4DIDB 3TLSA 1Z0PA 2A3DA 1R8IA 1W09A 2XAHB 1YQ4A 2WWUA 2NW7A 2KZ7B 2X9WA 2V5CA 2ACZA 4H63H 4IE7A 2V5DA 2H89A 5AQIB 5J2UE 4YSYA 5A1LA 2XAJB 1SA0E 3AAIA 2OV9A 1ZHCA 3GA8A 2WY2A 2E9XB 3FZLB 2UXBT 3TLUA 5KXJA 4I43B 3QC9A 2LSKA 3P4SA 5AQGB 3UUMA 4X20E 5AQUB 2VASA 2Q9QA 2L8KA 2XAFB 3U3IA 3Q5XA 4MALA 1UUSA 5JDNA 1CHUA 2RP4A 2RPAA 4K0KT 2W61A 1W0BA 3K3OA 3NZPA 5FXVA 3L09A 4X64T 2LM9A 1E7PA 3AA6B 3UUBA 3QOFA 3GMIA 3X1DA 3QNUA 5AQMB 2RA1A 4ANJA 2BS3A 3I9WA 4H63V 3ZT6A 3AEDA 4ISTA 5HXCA 2I59A 2VQET 3ANWB 1DU2A 2VVNA 2LT3A 3WAKA 4X1YE 4DV2T 3UU3A 4PK4A 1S94A 4LF7T 2IUBA 2AE9A 2MOZA 5AQLB 3LK2B 4IE6A 4I55E 4JI3T 2E9XC 4PFOA 2X67A 5LHIB 1L0VA 1CUNA 2CWYA 5L3GB 5KX5E 1IBKT 4GKJT 5LB7B 1SHZC 3ESLA 4IE4A 5FYMA 4TV8E 5LGNB 1Z8UA 2A2FX 2XQ8A 3R84B 4JEHB 2BG9A 2VK9A 4YT0A 4F6RC 3EAMA 4P09A 4DBRA 4H9PC 1YXRA 4UELA 4PW8A 3LSVA 3BQIA 3RKOA 3P50A 4ZXLA 4DR6T 2AXDS 3ZMVB 2V7MA 1D1BA 5L3CB 1YD8G 2X68A 3HKBE 2P9BA 1I94T 2CXFA 4H9RC 5L2LA 4JI0T 1VCTA 4JI2T 3R6NA 5C3JA 3PUQA 4LMJA 1D0XA 2VKHA 4HKAA 3SFDA 2D0UA 3EABA 1HG5A 3Q2MA 3FB2A 2KXPB 5F5WA 3AE5A 3SRZA 5AQFB 3U78A 2NW9A 3ZN1B 4U7YA 3M3ZB 2X9XA 4XBFB 2E9XA 2K24A 3BQKA 4HE8A 4GYSA 3PURA 3MZKB 2UXXB 3H3MA 2VQFT 1J5WA 4ZS2A 4EB6E 2XY8B 4N78D 4HEAA 3H37A 2LHRA 4XAXB 3UFGA 3S4UA 3SS1A 2Q9QD 4B3TT 2N2NA 5ABFB 3Q9DA 4YSXA 4KI0F 4EOZB 5E0OA 5JDQA 3UQ4A 2M6BA 3N2GE 4UVAB 2LRKA 2H3RA 3ZT5A 3AAAB 5HXHA 1LRZA 3AE4A 3VKGA 5JDFA 3GN5A 2LRLA 2D2SA 1JNRA 3BQLA 5HXEA 3ANWA 3ZMZB 1T7SA 2N1GA 4O4LE 4U72A 4Q25A 1EZ3A 4IREA 3AB3B 3KDSE 4PNIA 5JDHA 1NWMX 2PTFA 1HX1B 2X9HA 4EIWA 2IW5B 1T98A 3AA7B 5LA6E 1KFYA 4OX9T 3T1HT 4CI2B 3UQ7A 3MXZA 4DR4T 2HN2A 1WCRA 4DR7T 4QX7B 3LDQB 4B3RT 4HFCA 3HI2A 2LJLA 2HPJA 4CZZB 3RPUA 2JQHA 4IDPA 3KV4A 4U74A 4ADZA 3AE2A 3HR0A 4B6XA 1H7CA 4TN7B 5DQWA 3ETVA 3ZEFB 3P7IA 3P4RA 2LM2A 3TLTA 4QXCB 4U3CA 3F2EA 3KV9A 5LHHB 3VR8A 3CMLA 5M4YA 4X5TA 4NPPA 2WMOA 3Q5DA 4LMLA 2XAQB 4TWHA 2QYWA 1YQ3A 5AQNB 1ZKEA 2FJDA 5F3JA 5LMUT 4DV1T 2DWKA 2X0YA 4DO0A 1U5PA 5LGUB 2XM2A 3FHNA 3F57A 3ETUA 4KMCA 2BBHA 4CI3B 5HAXA 2IC6A 3PU8A 4QX8B 4OK0A 2UUAT 4QHOA 3RIUA 1HNZT 3NBXX 2ZM6T 5FL1A 2Q9QB 5FKYA 5GONE 5KDMC 1T72A 1J1JA 1U4QA 4QH1A 2V1DB 2YDRA 2I0MA 3ZSSA 2X66A 4AI6A 5JRCA 2XM1A 4UF0A 3J7Yq 5ABFA 2V6YA 3EUHA 4DR3T 4TX5A 2W0GA 1IJ6A 3AECA 3LJCA 5HEJA 2MPKA 5L3DB 1VCSA 1QSDA 1SE7A 1E1HB 1NEKA 5FY1A 5CFBA 2XSBA 3PUXF 3CWZB 4K0UA 4MLKA 3DTOA 2BG9E 2BVLA 3FZFB 4HWFA 4TUYE 4F8HA 2ZM0A 2QGSA 3FZHB 2K5BB 2FUPA 4KUMB 3UFEA 4CN6A 1XNQT 4A56A 2W2UA 2UUBT 3N5LA 2Q9QC 3LG7A 5ABHA 5AQOB 3UU4A 4ZI7E 2IHR1 2BG9B 2V6XA 4YJ3E 4JI5T 5BMVE 4DUZT 4X62T 2DWGA 2LSJA 2ES0A 1N36T 5AQPB 4U2YA 2MBGA 2CEAA 4UEMA 1KNRA 3C50A 3KFWX 2WWVA 3TLVA 2BKOA 3O1JA 2JQ9A 2ZM8A 1S35A 3VHLA 2DCFA 3GWHA 1LVKA 1XDPA 2IIUA 5CA1E 4HWCA 1FMWA 1ZOYA 2XQAA 2QVAA 3RKGA 2Y6XA 2UXCT 3PDYA 4PFPA 3UUXB 5FMNA 1YKEB 2CLYC 5CB4E 3ZMTB 2J47A 3HKEE 3ZLIA 1Y01A 4MFRA 4WNKA 2K9AA 2ZM2A 3PV0F 4AISA 2VL0A 2UUCT 4V1Av 1LVFA 4E7ZA 2PJQA 1BR2A 1J5ET 2KT9A 1HNXT 3RI5A 1FEWA 4JI7T 3AE6A 2VL8A 2X0LB 1MNDA 3ZPOA 2D0TA 5IWAT 2F4VT 2J62A 4U33A 1HTJF 4HFBA 4IDZA 2E5VA 2BG9C 4EYUA 4BJNA 1XNRT 4YTNA 1US7B 2VKDA 4IHJE 1HX8A 4IGUA 2XQ5A 3RRWA 4X65T 2G0UA 4KBMB 4YJ2E 3SOLA 4DV0T 1ZP0A 4WZXA 2WU5A 2LSIA 4YHJA 5IHYA 3GN5B 2KINB 1MMNA 3FZMB 2ZLYA 1MIVA 2PG8A 4DUYT 2HPLA 1AJ3A 1V9DA 5ABEA 2JPFA 4ZI2C 3H3AA 2EHOD 5EZYE 4YTPA 4X1IE 5H6RB 4YSZA 5FNVE 2QRXA 4X1KE 4DMVA 1YKHB 4UIGA 4COFA 4IIJE 5AQQB 4TWFA 3UU8A 5JQGE 4ZOLE 3EDVA 3C98B 3ZYKA 5IYZE 2WMNA 3A8YC 3FBLA 2M67A 4CI1B 4C91A 1IZNB 4LF8T 3VU7H 5JDMA 3Q5WA 1XMQT 1O3XA 2ODUA 2BKPA 2ODVA 2J4GA 1QLBA 4IL4A 5LBQB 3O9XA 1XDOA 4O4JE 2A72A 1WYBA 3AE8A 3PUAA 4OFZA 3ZCIA 2NR4A 2YN6A 4AKGA 5EK3A 4HWHA 4ZI3D 2B76A 3OVUA 3SFEA 2NTXA 2BKNA 3RYHE 3KBTA 5LCYA 4QXHB 1WFDA 3HKDE 2MYSA 2WZHA 4TZ4C 3MJXA 5F8PA 3F31A 4GOUA 5JVDE 3A7MA 4NUVA 4LF4T 1MIWA 3N9PA 3RYFE 3ZN0B 3O4XE 2C0SA 2V8SV 1UURA 2XUEA 4Z8XA 2KNDA 5JRCB 3PUZF 2W62A 4UF0B 4ASKA 3RQUA 2V6YB 5DJQC 3PE0A 3M65A 5DQVA 4E7SA 3AE1A 3TLWA 2XHEB 2WS3A 2CBIA 2K48A 2X51A 2LKHA 5FL0A 5LG3A 3ABVA 4TNVA 3FBZA 2EHOB 5AQSB 1MMDA 4DV5T 3C51A 5LXTE 1IAPA 2WSSV 4JBWF 4HWDA 5KMGP 5HWYA 4DNDA 3EVYA 4EEBA
chains in the Genus database with same CATH topology
4HN9A 1IJ5A 2V1DB 2X9WA 4L9IA 4IE7A 4H63H 4EZ4A 1G73A 3PUGA 2MTQA 4CQIA 1WR6A 2H7VC 4I50E 5J2UE 2W63A 2PFVA 5LNKA 5A1LA 2XAJB 2X66A 4AI6A 2ZMAA 3I9YA 5JRCA 4UF0A 3TKLB 4EYYR 1SA0E 3AAIA 3J7Yq 1HF8A 1ZHCA 3GA8A 3ZYMA 3EUHA 1OWAA 3J9X1 3B13A 2E9XB 4TX5A 4JUYA 2W0GA 3KV5A 4CXXA 4MBQA 1IJ6A 4I43B 3LJCA 3QC9A 2LSKA 5L3DB 2BDEA 3CX8B 1QSDA 4AKRB 2L9QA 5HXRA 3UUMA 1E1HB 2YEVC 4X20E 3CPZA 2VASA 1BR1A 5FY1A 2Q9QA 3CQCB 2E8IA 5LOVE 4BJMA 4EZHA 3OKQA 2XASB 2L8KA 2XAFB 4YFSA 2V7KA 3CWZB 3JC6C 4K0UA 3SWHA 2YU1A 2H7OA 5L3BB 4HFVA 3HL6A 4MLKA 4PJJA 3K8PC 3DTOA 3U3IA 3Q5XA 2BVLA 1X79A 4MALA 2X9YA 1LKXA 4FJOA 2IAKA 3I0QA 4TUYE 5JDNA 4GIWA 2D5UA 2ZM0A 3IEEA 2QGSA 2LOSA 4XZCA 2RP4A 2WM9A 2W61A 2KWHA 2C5IT 1D1CA 2K5BB 3K3OA 2NP9A 3CQGB 2V7JA 3NZPA 3N9QA 4AKIA 2LSGA 5FXVA 3L09A 2XTLA 4KUMB 3UFEA 2BVMA 2LM9A 3AA6B 2WBLA 3IBPA 4A56A 1UCUA 5JR9B 3GMIA 4UV8B 3QK6A 5TAOA 3N5LA 2RA1A 3ZJ1A 2Q9QC 3LG7A 4ANJA 3DP7A 4H9NC 3I9WA 4ZI7E 4TV9E 3N2KE 4H63V 4PK5A 3UULA 4ISTA 4ILUA 5HXCA 4YJ3E 2ACXA 5BMVE 2I59A 1D0YA 3WAJA 3ANWB 4CXYA 2LT3A 3KINB 3LK42 2DWGA 2LSJA 2ES0A 3WAKA 4JLEA 4X1YE 3MA9A 2MBGA 2CEAA 4UEMA 3RYCE 4HGAA 4PK4A 4C90A 4ZHQE 1S94A 3C50A 3KFWX 4H9OC 5FXZA 3O1JA 5LGTB 3IF8B 2MOZA 2VWAA 2ZM8A 1S35A 2YU2A 3NRYA 3LK2B 2VKOA 3VHLA 5FP3A 4IE6A 2DCFA 2J1DG 1LVKA 1HCIA 3GWHA 4I55E 3ZMSB 4P0BA 1MNEA 5CA1E 2E9XC 4ZS3A 4PFOA 1FMWA 2X67A 5LHIB 3B57A 1CUNA 2Y6XA 2CWYA 2DI4A 5L3GB 1WLXA 3PDYA 5KX5E 3MACA 4PFPA 3UUXB 1WYCA 2JJ9A 2V7LA 5FMNA 3RH3A 1YKEB 2CLYC 5LJNA 1SHZC 3ESLA 4AKGA 4YLHA 5CB4E 3OBVE 2KMFA 4IE4A 5FYMA 4TV8E 3ZMTB 3HKEE 4GK0E 5LGNB 2CXDA 2A2FX 3R84B 4JEHB 3L3PA 3ZLIA 3T8OA 5J1GA 1NAFA 4UVBB 5LHGB 4KP3C 4MFRA 4WNKA 3I0OA 2VK9A 3IHRA 3FXDB 2K9AA 2ZM2A 3E08A 4V1Av 3PU3A 2XAGB 4F6RC 1LVFA 4UV9B 2UXNB 4E7ZA 5JREA 2PJQA 1BR2A 4P09A 2KT9A 3C4WA 3CX7B 4DBRA 1FEWA 4H9PC 4UELA 4ZI3C 2CCQA 4PW8A 3BQIA 5LJMA 3RKOA 4ISSA 2VL8A 5FY0A 2X0LB 3CKDA 4ERRA 3ZMVB 2V7MA 2VB6A 1D1BA 3UTKA 5L3CB 1YD8G 1MNDA 3VKHA 3ZPOA 2D0TA 2EHOA 2X68A 3HKBE 2P9BA 3LBXB 5EK2A 3BK9A 2LSYA 2CXFA 3HKCE 2JMHA 3MK7C 4H9SE 1HTJF 4H9RC 4IDZA 5L2LA 4EYUA 4BJNA 2NOXA 3R6NA 1US7B 3PUQA 1D0XA 2VKHA 4HKAA 4L5GA 2D0UA 3ZJ2A 4O2AE 2VKDA 4IHJE 1HG5A 3Q2MA 4DBQA 3FB2A 1HX8A 2KXPB 2BZBA 2JMKA 4IGUA 4BA9A 3RRWA 3SRZA 3U78A 2NW9A 2G0UA 3OJAA 4KBMB 3D0TA 3AVSA 3ZN1B 4YJ2E 3SOLA 3KVAA 4WW0A 4M1PA 3NRXA 1Y64B 2X9XA 4XBFB 2E9XA 2LSIA 2K24A 2NTYA 3JC6D 1KK7A 4YHJA 5IHYA 5AFUL 5EK4A 1FIOA 3GN5B 5FXWA 2KINB 3BQKA 4OYJA 2EHOC 1FMVA 4HE8A 3ZC1A 4O8SA 4GYSA 3PURA 1HS7A 3MZKB 2UXXB 5JDGA 1MMNA 2IC9A 3E22E 3UT5E 2ZLYA 1MMAA 2LHNA 1MIVA 2NWBA 2PG8A 4ZS2A 4EB6E 4OHFA 3DJBA 2HPLA 3AA0B 3ZC0A 1AJ3A 3LBXA 3V5UA 4O4HE 1V9DA 4N78D 4HEAA 2HH7A 4GK5E 3H37A 3AVRA 4AQFA 4L0RA 2JPFA 2LHRA 2DNXA 4XAXB 3ONXA 3S4UA 2PBIA 3A5XA 3SS1A 4ZI2C 2Q9QD 3H3AA 5HYAA 2EHOD 2YINA 3LFMA 2N2NA 5EZYE 3Q9DA 2KWIB 4X1IE 3ZYLA 1G8XA 3K3NA 3FXEB 5H6RB 5FNVE 4EOZB 5E0OA 1MIYA 5JDQA 3N2GE 4PAGA 4X1KE 4UVAB 3RC8A 4DMVA 1YKHB 2V7IA 4UIGA 2H3RA 3E0ZA 5ADXL 2SPCA 3AAAB 1MMGA 5JR9A 3OYXA 5HXHA 1LRZA 4IIJE 3VKGA 3N9NA 5JDFA 4IE5A 3GN5A 2C5JA 4AKLA 2D2SA 5JQGE 4ZOLE 4EAHA 4ZI2D 3EDVA 4GYRA 2N9DA 3RX6A 3C98B 2LEHA 3BQLA 3ZYKA 4DMWA 4AQFC 1VOMA 3K3QC 5IYZE 3ANWA 4OYKA 3W15B 3ZMZB 5HXEA 5JH7E 4O4LE 2E9XD 2N1GA 2WMNA 3FBLA 2M67A 4U72A 4AXPA 3EDUA 4CI1B 2V26A 4C91A 1IZNB 1EZ3A 1UX5A 1QUUA 3VU7H 3AB3B 3KDSE 4PNIA 5JDMA 5JDHA 1NWMX 3PTRB 3Q5WA 3AA1B 3OYZA 1O3XA 2W00A 2ODUA 4H9QC 2X9HA 4DVDA 5FXXA 4EIWA 2IW5B 3WI3A 3ZCJA 2OA5A 1T98A 3AA7B 4AQGA 2Y8DA 2DHRA 5LA6E 2CXLA 2ODVA 1BR0A 4CI2B 3KV6A 5JR9C 1HFAA 5J2TE 2VKJA 1KNZA 2CM0A 3MXZA 2DLRA 5LBQB 3O9XA 4PJLA 4O4JE 2L3LA 2A72A 1WYBA 1VRBA 2QA7A 4QX7B 3PUAA 3N9OA 4OFZA 3ZCIA 5LYJE 3ZMUB 5C8YE 3HI2A 2LJLA 3QUJA 3V5SA 2CLYB 2CA5A 2HPJA 5EK3A 3RPUA 3KVBA 4CZZB 3P8CD 3KV4A 3C4ZA 5L3EB 4U74A 4ZI3D 2KLQA 2Y48B 2NTXA 3UUNA 5CA0E 4O4IE 4AKHA 1OXZA 3RYHE 3HA4A 3KBTA 4ADZA 4WBNE 5LCYA 4PJMA 2CE7A 4WBOA 3NZQA 3HR0A 1D0ZA 4B6XA 4QXHB 3N9LA 3HKDE 1H7CA 4TN7B 4I4TE 1ZEEA 1HG2A 4G63A 5DQWA 5ETWA 5HWXA 2MYSA 3ETVA 3ZEFB 4PK6A 3P7IA 3AAEB 5LG4A 4TZ4C 4QXCB 4J2CA 2B1EA 3F2EA 3C64A 4P0AA 3KV9A 3MJXA 5F8PA 4O2BE 2LOPA 5LHHB 3F31A 4GOUA 2CWOA 5H6QB 5JVDE 3RRCA 3CMLA 4QXBB 4JEUB 5M4YA 2XQYA 2JQQA 4NUVA 1MIWA 2WMOA 3N9PA 3LK3B 4PJNA 3I1AA 4BAYB 3RYFE 2LE8A 2XAQB 3C4XA 3ZN0B 4QKNA 1BR4A 3CX6B 1B7TA 3O4XE 1ZKEA 2C0SA 5JDLA 2JRKA 1D1AA 4EXTA 2XUEA 1WRDA 5FY7A 3O1IA 4Z8XA 5F3JA 2KNDA 3KBUA 5JRCB 2W62A 4UF0B 4ASKA 2DWKA 4DO0A 1U5PA 5LGUB 3FHNA 5DJQC 3F57A 3PE0A 3ETUA 3RC3A 1YW0A 3M65A 4FI5A 4KMCA 5DQVA 4E7SA 2CMRA 4CXWA 4QWNB 2XHEB 4G2AA 4MHCA 1ZV4X 3N9MA 5LBMA 2Z6EA 4IE0A 4CI3B 1UX4A 2K48A 5HAXA 2NW8A 2X51A 2IC6A 3CVRA 3PU8A 4QX8B 5DABA 4UVCB 5L3FB 4OK0A 4QHOA 2YK0A 3O1HA 3RYIE 2C5KT 4UXNB 3MKDA 3NBXX 4HTEA 4NUUA 5LP6E 2Q9QB 5GONE 3CQXC 3FBZA 2EHOB 5KDMC 1Z0PA 3PUSA 2A3DA 1MMDA 1U4QA 3C51A 5LXTE 1IAPA 2WSSV 2XAHB 2WWUA 3N2OA 5KMGP 2GK9A 2NW7A 5HWYA 4DNDA 2WAUA 2KZ7B 5HXSA 3EVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSG A;  3VU7 H;  2LSI A;  4BA9 A;  4GK5 E;  2LSY A;  2LSK A;  4FJO A;  2LSJ A;  4EXT A;  2N1G A;  4GK0 E; 
#chains in the Genus database with same CATH topology
 4HN9 A;  1HR0 T;  4EZ4 A;  2A9U A;  4U2Z A;  1G73 A;  3PUG A;  3IA3 A;  4CQI A;  4AIU A;  2YOE A;  4I50 E;  2W63 A;  3EI0 A;  2ZMA A;  2XQ7 A;  1HF8 A;  4AQY T;  1OWA A;  3RIU C;  3ONL C;  3B13 A;  1W9R A;  1KNP A;  1IBL T;  4MBQ A;  3OTO T;  3QB5 K;  2BDE A;  3NWI A;  3ZKR A;  4AKR B;  2L9Q A;  3CPZ A;  1BR1 A;  2KSR A;  2E8I A;  3OKQ A;  4U31 A;  3SWH A;  4ILC A;  2YU1 A;  5ABG A;  3HL6 A;  3K8P C;  4P1N A;  2X9Y A;  2XJ7 A;  1LKX A;  3I0Q A;  3AXJ A;  2D5U A;  3IEE A;  4A98 A;  2LOS A;  4XZC A;  4EV6 A;  3FZK B;  2NP9 A;  3CQG B;  5AQK B;  2JIW A;  2LSG A;  2BVM A;  2WBL A;  3IBP A;  1UCU A;  5JR9 B;  3QK6 A;  3ZJ1 A;  3DP7 A;  5AQJ B;  3N2K E;  4PK5 A;  3UUL A;  3P4W A;  4ILU A;  4KHZ F;  2ACX A;  2CPT A;  3KIN B;  4JLE A;  4TWD A;  3MA9 A;  4C90 A;  4JI8 T;  4CN4 A;  4H9O C;  3IF8 B;  2VWA A;  3AEG A;  2YU2 A;  4IL9 A;  3NRY A;  2VKO A;  5FP3 A;  2J1D G;  1HCI A;  4P0B A;  2YDS A;  4NXM T;  2UU9 T;  3NVO A;  1WLX A;  2JJ9 A;  3RH3 A;  5LJN A;  2W4X A;  3OBV E;  2KMF A;  4GK0 E;  4ILA A;  5IUX A;  2CXD A;  2E2A A;  5JTG A;  3T8O A;  5J1G A;  1NAF A;  5LHG B;  4HFI A;  4KP3 C;  3I0O A;  5HCJ A;  4A97 A;  3IHR A;  3RIF A;  3RIA A;  3E08 A;  2XAG B;  5JRE A;  2XZE A;  4Z91 A;  3CX7 B;  2I6H A;  2CHO A;  4ZI3 C;  5LJM A;  5LMN T;  4KX6 A;  4ISS A;  4ERR A;  3AE7 A;  2EHO A;  4U7I A;  3BK9 A;  2LSY A;  3MK7 C;  5L4E A;  2NOX A;  2OLT A;  4L5G A;  3EHZ A;  3ZJ2 A;  4O2A E;  1UGO A;  4DBQ A;  5C2T A;  2JMK A;  2WDV A;  3AVS A;  2LLY A;  2LKG A;  2NTY A;  3JC6 D;  5EK4 A;  1FIO A;  5FXW A;  3JAD A;  4OYJ A;  1FMV A;  3ZC1 A;  4O8S A;  4LFB T;  4DV6 T;  5JDG A;  2IC9 A;  1XMO T;  1MMA A;  3CIR A;  2NWB A;  4OHF A;  3AA0 B;  3ZC0 A;  3LBX A;  3V5U A;  4GK5 E;  3AVR A;  3PUY F;  4AQF A;  4HFH A;  5AQH B;  3A5X A;  2E5L T;  2VVS A;  3LFM A;  5HEU A;  3ZYL A;  3FXE B;  1MIY A;  2HN1 A;  2V7I A;  1MMG A;  5JR9 A;  4JYA T;  4DR1 T;  3QB5 A;  3RF1 A;  4IE5 A;  2C5J A;  1XWM A;  4EAH A;  3VRA A;  3RX6 A;  2LEH A;  3CK6 A;  4DMW A;  1VOM A;  3K3Q C;  3W15 B;  3P4P A;  4OYK A;  5JH7 E;  1JNZ A;  2XQ3 A;  4AXP A;  1N34 T;  3EDU A;  1UX5 A;  2XQ9 A;  4ILB A;  3PTR B;  2XQ4 A;  2WCA A;  4DVD A;  3Q5E A;  5FXX A;  3WI3 A;  2DHR A;  4YY3 T;  4CN1 A;  2CXL A;  3AE9 A;  1HFA A;  5J2T E;  5AQT B;  2VKJ A;  2X0H A;  3ZT7 A;  1KNZ A;  1FJG T;  2CM0 A;  5L4H A;  2DLR A;  4LF6 T;  2H88 A;  1VRB A;  3N9O A;  5LYJ E;  3ZMU B;  1N33 T;  5C8Y E;  2CA5 A;  3KVB A;  2BBJ A;  3P8C D;  5L47 A;  3C4Z A;  5L3E B;  3JAE A;  1OED A;  4AKH A;  2WU2 A;  3HA4 A;  1M7K A;  3NZQ A;  2W66 A;  4I4T E;  4G63 A;  4HFE A;  4JI6 T;  3L39 A;  3JAF A;  3C64 A;  4YTM A;  4O2B E;  2LOP A;  2CWO A;  5H6Q B;  3RRC A;  4QXB B;  3PUV F;  1WR0 A;  3LK3 B;  4BAY B;  3I1A A;  4PJN A;  2LE8 A;  3C4X A;  1BR4 A;  5HEH A;  3K1S A;  5AQV B;  4EXT A;  1WRD A;  5FY7 A;  3O1I A;  3KBU A;  4HWI B;  5FVL A;  2YKS A;  3RC3 A;  1YW0 A;  2CRB A;  4CXW A;  4QWN B;  2XPK A;  5LBM A;  1ZV4 X;  2NW8 A;  5DAB A;  4UVC B;  5L3F B;  4DV7 T;  2YK0 A;  2C5K T;  4UXN B;  4HTE A;  4NUU A;  5LP6 E;  4UR9 A;  3CQX C;  3PUS A;  4IDO A;  4KHP T;  1GQE A;  3P4Q A;  2BS4 A;  3N2O A;  2GK9 A;  4QH5 A;  2WAU A;  5HXS A;  3OPC A;  1IJ5 A;  2XSA A;  2JQK A;  4L9I A;  3AXJ B;  2D9D A;  2MTQ A;  1WR6 A;  2H7V C;  2PFV A;  5LNK A;  3I9Y A;  4YHH T;  3TKL B;  4EYY R;  5J0Z A;  3ZYM A;  3J9X 1;  4JUY A;  3KV5 A;  4CXX A;  3CX8 B;  4A5X A;  4EGW A;  2K3W A;  4Z90 A;  5HXR A;  3PJA A;  2YEV C;  3CQC B;  5LOV E;  3AE3 A;  4BJM A;  3G06 A;  4EZH A;  2XAS B;  3AEA A;  2IDO B;  4YFS A;  2V7K A;  4HFD A;  3JC6 C;  2H7O A;  5L3B B;  4HFV A;  4PJJ A;  4ZZC A;  3RLF F;  1X79 A;  4FJO A;  2IAK A;  2MAW A;  1KF6 A;  4GIW A;  2WB5 A;  2WM9 A;  2KWH A;  2C5I T;  1D1C A;  2V7J A;  3N9Q A;  4YXD A;  4AKI A;  2XTL A;  4EED A;  4UV8 B;  5TAO A;  4LFC T;  4H9N C;  4TV9 E;  3PUW F;  5HEG A;  1D0Y A;  3WAJ A;  4CXY A;  1HNW T;  3LK4 2;  4ZEY A;  2WDR A;  3RYC E;  4HGA A;  4IDN A;  4ZHQ E;  5CGM A;  5FXZ A;  5LGT B;  4IDQ A;  3ZMS B;  1MNE A;  3NKZ A;  4ZS3 A;  2WDQ A;  2BS2 A;  2FJB A;  3B57 A;  3AEE A;  2DI4 A;  4B3S T;  3MAC A;  1WYC A;  2V7L A;  1N32 T;  4YLH A;  3L3P A;  3T1Y T;  4UVB B;  4NIQ A;  3FXD B;  3PU3 A;  2CBJ A;  4UV9 B;  2UXN B;  4I0U A;  3C4W A;  3ZST A;  4B3M T;  2CCQ A;  5FY0 A;  3CKD A;  2VB6 A;  4X66 T;  3UTK A;  3VKH A;  3VRB A;  1X9B A;  3LBX B;  5EK2 A;  4LF9 T;  3HKC E;  2JMH A;  4H9S E;  1NEN A;  5BR8 T;  2CHN A;  1XZY A;  3AEF A;  3PJA J;  4DR2 T;  4BA9 A;  2BZB A;  3OJA A;  5AQR B;  3D0T A;  3KVA A;  5HCM A;  4WW0 A;  4M1P A;  3NRX A;  1Y64 B;  3RQW A;  1KK7 A;  5AFU L;  1IBM T;  1UK5 A;  2XQ6 A;  1I6Z A;  2EHO C;  5CJ5 A;  2W67 A;  4QH4 A;  1HS7 A;  3E22 E;  3UT5 E;  3L8R A;  4ZZB A;  2LHN A;  3ONJ A;  3DJB A;  1M62 A;  4O4H E;  2HH7 A;  4L0R A;  1OED E;  2DNX A;  3ONX A;  2FJE A;  2PBI A;  5HYA A;  2YIN A;  2DL1 A;  2KWI B;  2WZI A;  4DV3 T;  1G8X A;  3K3N A;  5HEO A;  4JV5 T;  2HHH T;  4PAG A;  3RC8 A;  3E0Z A;  5ADX L;  2SPC A;  4GKK T;  3OYX A;  3N9N A;  4AKL A;  1OED B;  4ZI2 D;  4GYR A;  2N9D A;  4DR5 T;  4AQF C;  2VUR A;  2E9X D;  2V26 A;  1QUU A;  1E2A A;  3B5M A;  3AA1 B;  3OYZ A;  2W00 A;  4H9Q C;  4DV4 T;  4IT4 A;  3ZCJ A;  2OA5 A;  4AQG A;  2R6G F;  2Y8D A;  1BR0 A;  3KV6 A;  5JR9 C;  1W0A A;  2WP9 A;  2FJA A;  4PJL A;  2L3L A;  3UU5 A;  3RGL A;  2QA7 A;  3QUJ A;  3V5S A;  2CLY B;  4NXN T;  4LMK A;  2UXD T;  1T8B A;  2KLQ A;  2Y48 B;  3UUN A;  5CA0 E;  4O4I E;  1OXZ A;  4TNW A;  4LFA T;  4WBN E;  4PJM A;  2CE7 A;  4WBO A;  5FVK A;  1D0Z A;  3N9L A;  4WYV A;  4JI4 T;  1ZEE A;  1HG2 A;  5ETW A;  5HWX A;  3AEB A;  4PK6 A;  3AAE B;  5LG4 A;  4J2C A;  2B1E A;  4P0A A;  3UU6 A;  2IML A;  3RHW A;  3JCF A;  4JEU B;  2XQY A;  2JQQ A;  3VR9 A;  4QKN A;  3CX6 B;  1B7T A;  1OED C;  5JDL A;  2JRK A;  1KEY A;  2YDQ A;  1D1A A;  2FBW A;  4FI5 A;  2M6I A;  2CMR A;  4JI1 T;  2WQY A;  4LF5 T;  4G2A A;  4MHC A;  3N9M A;  2Z6E A;  4IE0 A;  1UX4 A;  3CVR A;  1SUM B;  3O1H A;  3RYI E;  3MKD A;  4DID B;  3TLS A;  1Z0P A;  2A3D A;  1R8I A;  1W09 A;  2XAH B;  1YQ4 A;  2WWU A;  2NW7 A;  2KZ7 B;  2X9W A;  2V5C A;  2ACZ A;  4H63 H;  4IE7 A;  2V5D A;  2H89 A;  5AQI B;  5J2U E;  4YSY A;  5A1L A;  2XAJ B;  1SA0 E;  3AAI A;  2OV9 A;  1ZHC A;  3GA8 A;  2WY2 A;  2E9X B;  3FZL B;  2UXB T;  3TLU A;  5KXJ A;  4I43 B;  3QC9 A;  2LSK A;  3P4S A;  5AQG B;  3UUM A;  4X20 E;  5AQU B;  2VAS A;  2Q9Q A;  2L8K A;  2XAF B;  3U3I A;  3Q5X A;  4MAL A;  1UUS A;  5JDN A;  1CHU A;  2RP4 A;  2RPA A;  4K0K T;  2W61 A;  1W0B A;  3K3O A;  3NZP A;  5FXV A;  3L09 A;  4X64 T;  2LM9 A;  1E7P A;  3AA6 B;  3UUB A;  3QOF A;  3GMI A;  3X1D A;  3QNU A;  5AQM B;  2RA1 A;  4ANJ A;  2BS3 A;  3I9W A;  4H63 V;  3ZT6 A;  3AED A;  4IST A;  5HXC A;  2I59 A;  2VQE T;  3ANW B;  1DU2 A;  2VVN A;  2LT3 A;  3WAK A;  4X1Y E;  4DV2 T;  3UU3 A;  4PK4 A;  1S94 A;  4LF7 T;  2IUB A;  2AE9 A;  2MOZ A;  5AQL B;  3LK2 B;  4IE6 A;  4I55 E;  4JI3 T;  2E9X C;  4PFO A;  2X67 A;  5LHI B;  1L0V A;  1CUN A;  2CWY A;  5L3G B;  5KX5 E;  1IBK T;  4GKJ T;  5LB7 B;  1SHZ C;  3ESL A;  4IE4 A;  5FYM A;  4TV8 E;  5LGN B;  1Z8U A;  2A2F X;  2XQ8 A;  3R84 B;  4JEH B;  2BG9 A;  2VK9 A;  4YT0 A;  4F6R C;  3EAM A;  4P09 A;  4DBR A;  4H9P C;  1YXR A;  4UEL A;  4PW8 A;  3LSV A;  3BQI A;  3RKO A;  3P50 A;  4ZXL A;  4DR6 T;  2AXD S;  3ZMV B;  2V7M A;  1D1B A;  5L3C B;  1YD8 G;  2X68 A;  3HKB E;  2P9B A;  1I94 T;  2CXF A;  4H9R C;  5L2L A;  4JI0 T;  1VCT A;  4JI2 T;  3R6N A;  5C3J A;  3PUQ A;  4LMJ A;  1D0X A;  2VKH A;  4HKA A;  3SFD A;  2D0U A;  3EAB A;  1HG5 A;  3Q2M A;  3FB2 A;  2KXP B;  5F5W A;  3AE5 A;  3SRZ A;  5AQF B;  3U78 A;  2NW9 A;  3ZN1 B;  4U7Y A;  3M3Z B;  2X9X A;  4XBF B;  2E9X A;  2K24 A;  3BQK A;  4HE8 A;  4GYS A;  3PUR A;  3MZK B;  2UXX B;  3H3M A;  2VQF T;  1J5W A;  4ZS2 A;  4EB6 E;  2XY8 B;  4N78 D;  4HEA A;  3H37 A;  2LHR A;  4XAX B;  3UFG A;  3S4U A;  3SS1 A;  2Q9Q D;  4B3T T;  2N2N A;  5ABF B;  3Q9D A;  4YSX A;  4KI0 F;  4EOZ B;  5E0O A;  5JDQ A;  3UQ4 A;  2M6B A;  3N2G E;  4UVA B;  2LRK A;  2H3R A;  3ZT5 A;  3AAA B;  5HXH A;  1LRZ A;  3AE4 A;  3VKG A;  5JDF A;  3GN5 A;  2LRL A;  2D2S A;  1JNR A;  3BQL A;  5HXE A;  3ANW A;  3ZMZ B;  1T7S A;  2N1G A;  4O4L E;  4U72 A;  4Q25 A;  1EZ3 A;  4IRE A;  3AB3 B;  3KDS E;  4PNI A;  5JDH A;  1NWM X;  2PTF A;  1HX1 B;  2X9H A;  4EIW A;  2IW5 B;  1T98 A;  3AA7 B;  5LA6 E;  1KFY A;  4OX9 T;  3T1H T;  4CI2 B;  3UQ7 A;  3MXZ A;  4DR4 T;  2HN2 A;  1WCR A;  4DR7 T;  4QX7 B;  3LDQ B;  4B3R T;  4HFC A;  3HI2 A;  2LJL A;  2HPJ A;  4CZZ B;  3RPU A;  2JQH A;  4IDP A;  3KV4 A;  4U74 A;  4ADZ A;  3AE2 A;  3HR0 A;  4B6X A;  1H7C A;  4TN7 B;  5DQW A;  3ETV A;  3ZEF B;  3P7I A;  3P4R A;  2LM2 A;  3TLT A;  4QXC B;  4U3C A;  3F2E A;  3KV9 A;  5LHH B;  3VR8 A;  3CML A;  5M4Y A;  4X5T A;  4NPP A;  2WMO A;  3Q5D A;  4LML A;  2XAQ B;  4TWH A;  2QYW A;  1YQ3 A;  5AQN B;  1ZKE A;  2FJD A;  5F3J A;  5LMU T;  4DV1 T;  2DWK A;  2X0Y A;  4DO0 A;  1U5P A;  5LGU B;  2XM2 A;  3FHN A;  3F57 A;  3ETU A;  4KMC A;  2BBH A;  4CI3 B;  5HAX A;  2IC6 A;  3PU8 A;  4QX8 B;  4OK0 A;  2UUA T;  4QHO A;  3RIU A;  1HNZ T;  3NBX X;  2ZM6 T;  5FL1 A;  2Q9Q B;  5FKY A;  5GON E;  5KDM C;  1T72 A;  1J1J A;  1U4Q A;  4QH1 A;  2V1D B;  2YDR A;  2I0M A;  3ZSS A;  2X66 A;  4AI6 A;  5JRC A;  2XM1 A;  4UF0 A;  3J7Y q;  5ABF A;  2V6Y A;  3EUH A;  4DR3 T;  4TX5 A;  2W0G A;  1IJ6 A;  3AEC A;  3LJC A;  5HEJ A;  2MPK A;  5L3D B;  1VCS A;  1QSD A;  1SE7 A;  1E1H B;  1NEK A;  5FY1 A;  5CFB A;  2XSB A;  3PUX F;  3CWZ B;  4K0U A;  4MLK A;  3DTO A;  2BG9 E;  2BVL A;  3FZF B;  4HWF A;  4TUY E;  4F8H A;  2ZM0 A;  2QGS A;  3FZH B;  2K5B B;  2FUP A;  4KUM B;  3UFE A;  4CN6 A;  1XNQ T;  4A56 A;  2W2U A;  2UUB T;  3N5L A;  2Q9Q C;  3LG7 A;  5ABH A;  5AQO B;  3UU4 A;  4ZI7 E;  2IHR 1;  2BG9 B;  2V6X A;  4YJ3 E;  4JI5 T;  5BMV E;  4DUZ T;  4X62 T;  2DWG A;  2LSJ A;  2ES0 A;  1N36 T;  5AQP B;  4U2Y A;  2MBG A;  2CEA A;  4UEM A;  1KNR A;  3C50 A;  3KFW X;  2WWV A;  3TLV A;  2BKO A;  3O1J A;  2JQ9 A;  2ZM8 A;  1S35 A;  3VHL A;  2DCF A;  3GWH A;  1LVK A;  1XDP A;  2IIU A;  5CA1 E;  4HWC A;  1FMW A;  1ZOY A;  2XQA A;  2QVA A;  3RKG A;  2Y6X A;  2UXC T;  3PDY A;  4PFP A;  3UUX B;  5FMN A;  1YKE B;  2CLY C;  5CB4 E;  3ZMT B;  2J47 A;  3HKE E;  3ZLI A;  1Y01 A;  4MFR A;  4WNK A;  2K9A A;  2ZM2 A;  3PV0 F;  4AIS A;  2VL0 A;  2UUC T;  4V1A v;  1LVF A;  4E7Z A;  2PJQ A;  1BR2 A;  1J5E T;  2KT9 A;  1HNX T;  3RI5 A;  1FEW A;  4JI7 T;  3AE6 A;  2VL8 A;  2X0L B;  1MND A;  3ZPO A;  2D0T A;  5IWA T;  2F4V T;  2J62 A;  4U33 A;  1HTJ F;  4HFB A;  4IDZ A;  2E5V A;  2BG9 C;  4EYU A;  4BJN A;  1XNR T;  4YTN A;  1US7 B;  2VKD A;  4IHJ E;  1HX8 A;  4IGU A;  2XQ5 A;  3RRW A;  4X65 T;  2G0U A;  4KBM B;  4YJ2 E;  3SOL A;  4DV0 T;  1ZP0 A;  4WZX A;  2WU5 A;  2LSI A;  4YHJ A;  5IHY A;  3GN5 B;  2KIN B;  1MMN A;  3FZM B;  2ZLY A;  1MIV A;  2PG8 A;  4DUY T;  2HPL A;  1AJ3 A;  1V9D A;  5ABE A;  2JPF A;  4ZI2 C;  3H3A A;  2EHO D;  5EZY E;  4YTP A;  4X1I E;  5H6R B;  4YSZ A;  5FNV E;  2QRX A;  4X1K E;  4DMV A;  1YKH B;  4UIG A;  4COF A;  4IIJ E;  5AQQ B;  4TWF A;  3UU8 A;  5JQG E;  4ZOL E;  3EDV A;  3C98 B;  3ZYK A;  5IYZ E;  2WMN A;  3A8Y C;  3FBL A;  2M67 A;  4CI1 B;  4C91 A;  1IZN B;  4LF8 T;  3VU7 H;  5JDM A;  3Q5W A;  1XMQ T;  1O3X A;  2ODU A;  2BKP A;  2ODV A;  2J4G A;  1QLB A;  4IL4 A;  5LBQ B;  3O9X A;  1XDO A;  4O4J E;  2A72 A;  1WYB A;  3AE8 A;  3PUA A;  4OFZ A;  3ZCI A;  2NR4 A;  2YN6 A;  4AKG A;  5EK3 A;  4HWH A;  4ZI3 D;  2B76 A;  3OVU A;  3SFE A;  2NTX A;  2BKN A;  3RYH E;  3KBT A;  5LCY A;  4QXH B;  1WFD A;  3HKD E;  2MYS A;  2WZH A;  4TZ4 C;  3MJX A;  5F8P A;  3F31 A;  4GOU A;  5JVD E;  3A7M A;  4NUV A;  4LF4 T;  1MIW A;  3N9P A;  3RYF E;  3ZN0 B;  3O4X E;  2C0S A;  2V8S V;  1UUR A;  2XUE A;  4Z8X A;  2KND A;  5JRC B;  3PUZ F;  2W62 A;  4UF0 B;  4ASK A;  3RQU A;  2V6Y B;  5DJQ C;  3PE0 A;  3M65 A;  5DQV A;  4E7S A;  3AE1 A;  3TLW A;  2XHE B;  2WS3 A;  2CBI A;  2K48 A;  2X51 A;  2LKH A;  5FL0 A;  5LG3 A;  3ABV A;  4TNV A;  3FBZ A;  2EHO B;  5AQS B;  1MMD A;  4DV5 T;  3C51 A;  5LXT E;  1IAP A;  2WSS V;  4JBW F;  4HWD A;  5KMG P;  5HWY A;  4DND A;  3EVY A;  4EEB A; 
#chains in the Genus database with same CATH homology
 4HN9 A;  1IJ5 A;  2V1D B;  2X9W A;  4L9I A;  4IE7 A;  4H63 H;  4EZ4 A;  1G73 A;  3PUG A;  2MTQ A;  4CQI A;  1WR6 A;  2H7V C;  4I50 E;  5J2U E;  2W63 A;  2PFV A;  5LNK A;  5A1L A;  2XAJ B;  2X66 A;  4AI6 A;  2ZMA A;  3I9Y A;  5JRC A;  4UF0 A;  3TKL B;  4EYY R;  1SA0 E;  3AAI A;  3J7Y q;  1HF8 A;  1ZHC A;  3GA8 A;  3ZYM A;  3EUH A;  1OWA A;  3J9X 1;  3B13 A;  2E9X B;  4TX5 A;  4JUY A;  2W0G A;  3KV5 A;  4CXX A;  4MBQ A;  1IJ6 A;  4I43 B;  3LJC A;  3QC9 A;  2LSK A;  5L3D B;  2BDE A;  3CX8 B;  1QSD A;  4AKR B;  2L9Q A;  5HXR A;  3UUM A;  1E1H B;  2YEV C;  4X20 E;  3CPZ A;  2VAS A;  1BR1 A;  5FY1 A;  2Q9Q A;  3CQC B;  2E8I A;  5LOV E;  4BJM A;  4EZH A;  3OKQ A;  2XAS B;  2L8K A;  2XAF B;  4YFS A;  2V7K A;  3CWZ B;  3JC6 C;  4K0U A;  3SWH A;  2YU1 A;  2H7O A;  5L3B B;  4HFV A;  3HL6 A;  4MLK A;  4PJJ A;  3K8P C;  3DTO A;  3U3I A;  3Q5X A;  2BVL A;  1X79 A;  4MAL A;  2X9Y A;  1LKX A;  4FJO A;  2IAK A;  3I0Q A;  4TUY E;  5JDN A;  4GIW A;  2D5U A;  2ZM0 A;  3IEE A;  2QGS A;  2LOS A;  4XZC A;  2RP4 A;  2WM9 A;  2W61 A;  2KWH A;  2C5I T;  1D1C A;  2K5B B;  3K3O A;  2NP9 A;  3CQG B;  2V7J A;  3NZP A;  3N9Q A;  4AKI A;  2LSG A;  5FXV A;  3L09 A;  2XTL A;  4KUM B;  3UFE A;  2BVM A;  2LM9 A;  3AA6 B;  2WBL A;  3IBP A;  4A56 A;  1UCU A;  5JR9 B;  3GMI A;  4UV8 B;  3QK6 A;  5TAO A;  3N5L A;  2RA1 A;  3ZJ1 A;  2Q9Q C;  3LG7 A;  4ANJ A;  3DP7 A;  4H9N C;  3I9W A;  4ZI7 E;  4TV9 E;  3N2K E;  4H63 V;  4PK5 A;  3UUL A;  4IST A;  4ILU A;  5HXC A;  4YJ3 E;  2ACX A;  5BMV E;  2I59 A;  1D0Y A;  3WAJ A;  3ANW B;  4CXY A;  2LT3 A;  3KIN B;  3LK4 2;  2DWG A;  2LSJ A;  2ES0 A;  3WAK A;  4JLE A;  4X1Y E;  3MA9 A;  2MBG A;  2CEA A;  4UEM A;  3RYC E;  4HGA A;  4PK4 A;  4C90 A;  4ZHQ E;  1S94 A;  3C50 A;  3KFW X;  4H9O C;  5FXZ A;  3O1J A;  5LGT B;  3IF8 B;  2MOZ A;  2VWA A;  2ZM8 A;  1S35 A;  2YU2 A;  3NRY A;  3LK2 B;  2VKO A;  3VHL A;  5FP3 A;  4IE6 A;  2DCF A;  2J1D G;  1LVK A;  1HCI A;  3GWH A;  4I55 E;  3ZMS B;  4P0B A;  1MNE A;  5CA1 E;  2E9X C;  4ZS3 A;  4PFO A;  1FMW A;  2X67 A;  5LHI B;  3B57 A;  1CUN A;  2Y6X A;  2CWY A;  2DI4 A;  5L3G B;  1WLX A;  3PDY A;  5KX5 E;  3MAC A;  4PFP A;  3UUX B;  1WYC A;  2JJ9 A;  2V7L A;  5FMN A;  3RH3 A;  1YKE B;  2CLY C;  5LJN A;  1SHZ C;  3ESL A;  4AKG A;  4YLH A;  5CB4 E;  3OBV E;  2KMF A;  4IE4 A;  5FYM A;  4TV8 E;  3ZMT B;  3HKE E;  4GK0 E;  5LGN B;  2CXD A;  2A2F X;  3R84 B;  4JEH B;  3L3P A;  3ZLI A;  3T8O A;  5J1G A;  1NAF A;  4UVB B;  5LHG B;  4KP3 C;  4MFR A;  4WNK A;  3I0O A;  2VK9 A;  3IHR A;  3FXD B;  2K9A A;  2ZM2 A;  3E08 A;  4V1A v;  3PU3 A;  2XAG B;  4F6R C;  1LVF A;  4UV9 B;  2UXN B;  4E7Z A;  5JRE A;  2PJQ A;  1BR2 A;  4P09 A;  2KT9 A;  3C4W A;  3CX7 B;  4DBR A;  1FEW A;  4H9P C;  4UEL A;  4ZI3 C;  2CCQ A;  4PW8 A;  3BQI A;  5LJM A;  3RKO A;  4ISS A;  2VL8 A;  5FY0 A;  2X0L B;  3CKD A;  4ERR A;  3ZMV B;  2V7M A;  2VB6 A;  1D1B A;  3UTK A;  5L3C B;  1YD8 G;  1MND A;  3VKH A;  3ZPO A;  2D0T A;  2EHO A;  2X68 A;  3HKB E;  2P9B A;  3LBX B;  5EK2 A;  3BK9 A;  2LSY A;  2CXF A;  3HKC E;  2JMH A;  3MK7 C;  4H9S E;  1HTJ F;  4H9R C;  4IDZ A;  5L2L A;  4EYU A;  4BJN A;  2NOX A;  3R6N A;  1US7 B;  3PUQ A;  1D0X A;  2VKH A;  4HKA A;  4L5G A;  2D0U A;  3ZJ2 A;  4O2A E;  2VKD A;  4IHJ E;  1HG5 A;  3Q2M A;  4DBQ A;  3FB2 A;  1HX8 A;  2KXP B;  2BZB A;  2JMK A;  4IGU A;  4BA9 A;  3RRW A;  3SRZ A;  3U78 A;  2NW9 A;  2G0U A;  3OJA A;  4KBM B;  3D0T A;  3AVS A;  3ZN1 B;  4YJ2 E;  3SOL A;  3KVA A;  4WW0 A;  4M1P A;  3NRX A;  1Y64 B;  2X9X A;  4XBF B;  2E9X A;  2LSI A;  2K24 A;  2NTY A;  3JC6 D;  1KK7 A;  4YHJ A;  5IHY A;  5AFU L;  5EK4 A;  1FIO A;  3GN5 B;  5FXW A;  2KIN B;  3BQK A;  4OYJ A;  2EHO C;  1FMV A;  4HE8 A;  3ZC1 A;  4O8S A;  4GYS A;  3PUR A;  1HS7 A;  3MZK B;  2UXX B;  5JDG A;  1MMN A;  2IC9 A;  3E22 E;  3UT5 E;  2ZLY A;  1MMA A;  2LHN A;  1MIV A;  2NWB A;  2PG8 A;  4ZS2 A;  4EB6 E;  4OHF A;  3DJB A;  2HPL A;  3AA0 B;  3ZC0 A;  1AJ3 A;  3LBX A;  3V5U A;  4O4H E;  1V9D A;  4N78 D;  4HEA A;  2HH7 A;  4GK5 E;  3H37 A;  3AVR A;  4AQF A;  4L0R A;  2JPF A;  2LHR A;  2DNX A;  4XAX B;  3ONX A;  3S4U A;  2PBI A;  3A5X A;  3SS1 A;  4ZI2 C;  2Q9Q D;  3H3A A;  5HYA A;  2EHO D;  2YIN A;  3LFM A;  2N2N A;  5EZY E;  3Q9D A;  2KWI B;  4X1I E;  3ZYL A;  1G8X A;  3K3N A;  3FXE B;  5H6R B;  5FNV E;  4EOZ B;  5E0O A;  1MIY A;  5JDQ A;  3N2G E;  4PAG A;  4X1K E;  4UVA B;  3RC8 A;  4DMV A;  1YKH B;  2V7I A;  4UIG A;  2H3R A;  3E0Z A;  5ADX L;  2SPC A;  3AAA B;  1MMG A;  5JR9 A;  3OYX A;  5HXH A;  1LRZ A;  4IIJ E;  3VKG A;  3N9N A;  5JDF A;  4IE5 A;  3GN5 A;  2C5J A;  4AKL A;  2D2S A;  5JQG E;  4ZOL E;  4EAH A;  4ZI2 D;  3EDV A;  4GYR A;  2N9D A;  3RX6 A;  3C98 B;  2LEH A;  3BQL A;  3ZYK A;  4DMW A;  4AQF C;  1VOM A;  3K3Q C;  5IYZ E;  3ANW A;  4OYK A;  3W15 B;  3ZMZ B;  5HXE A;  5JH7 E;  4O4L E;  2E9X D;  2N1G A;  2WMN A;  3FBL A;  2M67 A;  4U72 A;  4AXP A;  3EDU A;  4CI1 B;  2V26 A;  4C91 A;  1IZN B;  1EZ3 A;  1UX5 A;  1QUU A;  3VU7 H;  3AB3 B;  3KDS E;  4PNI A;  5JDM A;  5JDH A;  1NWM X;  3PTR B;  3Q5W A;  3AA1 B;  3OYZ A;  1O3X A;  2W00 A;  2ODU A;  4H9Q C;  2X9H A;  4DVD A;  5FXX A;  4EIW A;  2IW5 B;  3WI3 A;  3ZCJ A;  2OA5 A;  1T98 A;  3AA7 B;  4AQG A;  2Y8D A;  2DHR A;  5LA6 E;  2CXL A;  2ODV A;  1BR0 A;  4CI2 B;  3KV6 A;  5JR9 C;  1HFA A;  5J2T E;  2VKJ A;  1KNZ A;  2CM0 A;  3MXZ A;  2DLR A;  5LBQ B;  3O9X A;  4PJL A;  4O4J E;  2L3L A;  2A72 A;  1WYB A;  1VRB A;  2QA7 A;  4QX7 B;  3PUA A;  3N9O A;  4OFZ A;  3ZCI A;  5LYJ E;  3ZMU B;  5C8Y E;  3HI2 A;  2LJL A;  3QUJ A;  3V5S A;  2CLY B;  2CA5 A;  2HPJ A;  5EK3 A;  3RPU A;  3KVB A;  4CZZ B;  3P8C D;  3KV4 A;  3C4Z A;  5L3E B;  4U74 A;  4ZI3 D;  2KLQ A;  2Y48 B;  2NTX A;  3UUN A;  5CA0 E;  4O4I E;  4AKH A;  1OXZ A;  3RYH E;  3HA4 A;  3KBT A;  4ADZ A;  4WBN E;  5LCY A;  4PJM A;  2CE7 A;  4WBO A;  3NZQ A;  3HR0 A;  1D0Z A;  4B6X A;  4QXH B;  3N9L A;  3HKD E;  1H7C A;  4TN7 B;  4I4T E;  1ZEE A;  1HG2 A;  4G63 A;  5DQW A;  5ETW A;  5HWX A;  2MYS A;  3ETV A;  3ZEF B;  4PK6 A;  3P7I A;  3AAE B;  5LG4 A;  4TZ4 C;  4QXC B;  4J2C A;  2B1E A;  3F2E A;  3C64 A;  4P0A A;  3KV9 A;  3MJX A;  5F8P A;  4O2B E;  2LOP A;  5LHH B;  3F31 A;  4GOU A;  2CWO A;  5H6Q B;  5JVD E;  3RRC A;  3CML A;  4QXB B;  4JEU B;  5M4Y A;  2XQY A;  2JQQ A;  4NUV A;  1MIW A;  2WMO A;  3N9P A;  3LK3 B;  4PJN A;  3I1A A;  4BAY B;  3RYF E;  2LE8 A;  2XAQ B;  3C4X A;  3ZN0 B;  4QKN A;  1BR4 A;  3CX6 B;  1B7T A;  3O4X E;  1ZKE A;  2C0S A;  5JDL A;  2JRK A;  1D1A A;  4EXT A;  2XUE A;  1WRD A;  5FY7 A;  3O1I A;  4Z8X A;  5F3J A;  2KND A;  3KBU A;  5JRC B;  2W62 A;  4UF0 B;  4ASK A;  2DWK A;  4DO0 A;  1U5P A;  5LGU B;  3FHN A;  5DJQ C;  3F57 A;  3PE0 A;  3ETU A;  3RC3 A;  1YW0 A;  3M65 A;  4FI5 A;  4KMC A;  5DQV A;  4E7S A;  2CMR A;  4CXW A;  4QWN B;  2XHE B;  4G2A A;  4MHC A;  1ZV4 X;  3N9M A;  5LBM A;  2Z6E A;  4IE0 A;  4CI3 B;  1UX4 A;  2K48 A;  5HAX A;  2NW8 A;  2X51 A;  2IC6 A;  3CVR A;  3PU8 A;  4QX8 B;  5DAB A;  4UVC B;  5L3F B;  4OK0 A;  4QHO A;  2YK0 A;  3O1H A;  3RYI E;  2C5K T;  4UXN B;  3MKD A;  3NBX X;  4HTE A;  4NUU A;  5LP6 E;  2Q9Q B;  5GON E;  3CQX C;  3FBZ A;  2EHO B;  5KDM C;  1Z0P A;  3PUS A;  2A3D A;  1MMD A;  1U4Q A;  3C51 A;  5LXT E;  1IAP A;  2WSS V;  2XAH B;  2WWU A;  3N2O A;  5KMG P;  2GK9 A;  2NW7 A;  5HWY A;  4DND A;  2WAU A;  2KZ7 B;  5HXS A;  3EVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...