4BASA

Structure of the arl6 bbs3 small gtpase from trypanosoma brucei with bound nucleotide analogue gppnp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
176
structure length
172
Chain Sequence
TKLQVVMCGLDNSGKTTIINQVKPAQHITATVGYNVETFEKGRVAFTVFDMGGAKKFRGLWETYYDNIDAVIFVVDSSDHLRLCVVKSEIQAMLKHEDIRRELPGGGRVPFLFFANKMDAAGAKTAAELVEILDLTTLMGDHPFVIFASNGLKGTGVHEGFSWLQETASRQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-RIBOSYLATION FACTOR, PUTATIVE (SMALL GTPASE, PUTATIVE)
publication title Crystal Structure of the Small Gtpase Arl6/Bbs3 from Trypanosomabrucei.
pubmed doi rcsb
source organism Trypanosoma brucei treu927
molecule tags Hydrolase
total genus 56
structure length 172
sequence length 176
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4basA00
4MUAA 4ESVA 1DBSA 3LDAA 1RRFA 5CIQA 3U44A 1ZINA 3LW8A 4Q7LA 2AN9A 5IHPA 5JZVA 4GBMA 2NO6A 4JLNA 4S35A 1Z3IX 5F2EA 1Z06A 4M1MA 3RRYA 2P3SA 5DGXA 2W2VA 1E2EA 3RS3A 4G5QA 1A4RA 5CB8A 4Q18A 3UMRA 4NCJA 3TW8B 3VQTA 3H0KA 4HZUB 1SVOA 5FI1B 4HLUA 2C98A 4B3CA 4DLRA 1NN0A 1VCOA 3K0AA 1P73A 1NIPA 4CYMA 3LVRE 5HTKA 4MGZR 3GLGB 5IK2D 2KBEA 1X1RA 4ACAA 4A9AA 4LHWA 4RZXA 5AUPB 5KTYA 3B9QA 3T12A 2RGAA 4B3DA 1YRBA 2FMXA 2XTNA 3BFXA 2YKGA 1GNQA 1VG1A 3T5GA 2JLUA 2RGEA 3KB1A 1AIPA 5EUMA 3ZYCA 1ZM4A 2REBA 3EASA 1UM8A 3AF3A 2QAJA 4JJZA 3QVUA 4PX9A 2BKEA 1XCMA 2JJ1D 2C77A 3GJ4A 1CRQA 3B8HA 2QPAA 2MMGA 2BBSA 4DUGA 2GHIA 4WBSA 3RABA 4D25A 2VSOA 1KO4A 1W2HA 2D62A 1WXQA 2OBNA 3QEOA 1E2NA 1OYYA 4CEHA 1ZIOA 4RFVA 3OF5A 1IXRC 1R7RA 1LFDB 1AK2A 3LQQA 1X8KA 4JLAA 4P31A 4NKRA 1XPUA 4FWTA 2ODBA 4LC1A 5HZKA 2QGNA 3W9YA 3FPAA 4ERNA 3GLIA 3MMPA 5E7JA 4BPBA 1S4QA 2ANBA 4DSNA 3EZ7A 2FPLA 1XTRA 5F9HA 2QROA 3EIQA 1FFHA 4M1WA 1DG1G 2H1LA 2HUPA 2ZJOA 3B1VA 2NTYC 3TSWA 3M0EA 3OESA 4KSCA 2W58A 2IYSA 3IPXA 3U7FB 3VAAA 4EPTA 2XNDA 4QBGB 4M1YA 4Q4HA 1CR4A 4LYHA 4AY2A 4GZMA 4A1FA 2YHSA 4HAXA 4V0MA 4B3BA 1OFHA 1U81A 1N6KA 4O3MA 2BBTA 4LBWA 1TQ6A 1TQ2A 1F48A 2G1KA 5AJYA 1WE2A 4LUCA 2QG6A 1YHNA 4TZ0A 2JJ2A 3A4NA 4EFLA 1N6NA 1I4DD 1X6VA 4PO8A 4BLOA 1KSFX 2IHYA 4II7A 1IN4A 1PJRA 2IYQA 2QAGA 4DB4A 2JLWA 4BFVA 4B3GA 4XD7A 4DC9A 3LXRA 3ADDA 2RAPA 2C95A 3L82B 2O8BA 1UDXA 4V03A 2XB2A 1HE8B 2IW3A 1D2EA 1E0AA 1DO2A 1SVIA 1G8YA 4C0LA 1R0YA 4IHQA 3AVVA 1G3QA 3ZZTA 4CZ2A 4CEIA 4MKFA 1IN6A 1H8EA 2ZJ2A 4Q1AA 4Q9LA 2H57A 2QP9X 3ZQJA 3O8CA 3AVOA 5AUOB 4MYTA 4DEYA 1E79D 3U60B 4C2UA 4BASA 5IDVA 2XJ9A 3EPHA 4QC2A 1DOAA 3TUZC 3A4LA 5EQTA 3Q5EA 4HUQA 2OAQ1 3TKLA 3U7HB 1OH5A 1X3SA 2X1VA 2J87A 1NKSA 3F8TA 1FW6A 4NCIA 1SXJE 2G3YA 1YVDA 4EFNA 1IY2A 2ZI4A 4YMTA 5J4VA 3AKYA 5KO2A 2WWXA 1HE1C 1Y3AA 2WJJA 4ZV4A 2NG1A 4E07A 3K0EA 1TADA 4XVRA 3K09A 5K8UA 3IHWA 4WXPA 4KV9A 3ETLA 4Q5IA 1JQJC 2Y8EA 5IK2A 4DVGA 3EG5A 4I4LA 3UIEA 2FOLA 5FPKA 5L3SB 4HDOB 1NBME 4L5BA 1WBDA 3L0OA 4Q7JB 2GCOB 3QJYA 1JEEA 1J99A 3OEHD 2R8RA 3FMFA 4PC6A 5FOTA 5JJLA 1XP8A 1LW7A 2PJZA 2FNAA 5E95A 1NL3A 4QM6A 2A7QA 1E9SA 1GRRA 1TF2A 4LJ6A 2EYQA 1OSNA 3T1VA 1NMXA 4B2IA 3TK1A 1WBBA 3V9PA 1YKSA 1NIJA 3F0TA 3GJ3A 4KU4A 3IQWA 5KDDA 1JECA 4B33A 2EWWA 2R6AA 1KTVA 1BMFA 2GEVA 1CS4C 3PVSA 4RFSA 2B92A 2EYUA 2VP6A 2YV5A 2O8FB 1UADA 1WQ1R 4NBSA 2CCKA 3OFND 3VTKA 4JJKA 3ZLJA 2F9MA 4NMMA 1UBCA 2V9PA 2ZANA 1XBTA 3DEFA 4EPRA 2DFNA 2H16A 4X8LA 1AZTA 3KL4A 3I32A 3AVWA 1OV4A 3KUDA 2XZLA 3SQWA 4JLMA 2ZJ8A 3D3QA 4QFMA 1E9DA 1W1WA 2O5VA 1CP2A 4XTRA 4B6EA 1N25A 4Q1CA 2KE5A 4KLNA 2IYLD 4DRZA 3FHCB 5EUQB 4LCBA 5BYJA 3GFOA 1Z5ZA 3LY5A 4QJ4A 2OT3B 3WNCA 2FPMA 2VA8A 5JFGA 1H65A 3W3AA 3C41J 3HYRA 2FF7A 1RJ9A 4NYJR 4RCYA 1D2NA 2G1JA 2WWYA 4M0LA 5M04A 1JAIA 1W0JD 2Z83A 3HDTA 4B47A 3MRSA 3CWZA 4TQUS 4NL4H 1E0SA 3TW4A 3RVBA 2WAXA 5LPNA 2R9VA 1T9HA 3H2YA 4N3NA 1QHNA 1N6IA 4UNSA 1TEXA 1RYHA 4P3YA 1BYUA 3MJHA 3WYAA 2ZJ5A 2IYWA 2QE7A 2GVDC 2XSZD 3VNUA 1XDBA 1J8YF 4NU0A 2JASA 1EFTA 4YLGA 1DAHA 4QGHA 3DZDA 4D82A 1XD8A 4YMVA 1LS6A 2RKOA 2CJWB 3NIBA 1W44A 2AHOA 4GNKA 1DAFA 1XTJA 1D2MA 2BMFA 3B1YA 2PZGA 1U99A 1AS0A 2C8VA 2GEDA 4K46A 1F5NA 1XCPA 4ITRC 3ZVNA 2ZRCA 3T5DA 3FVQA 4RD6A 1KNQA 3H1TA 4JVNA 4MH0R 1NKTA 1QBKC 3E70C 4PHFA 3R9IA 1R0ZA 3B5JA 4Q21A 4FINA 1P2VA 2FE4A 2ZE7A 3E2IA 1S1MA 3SBEA 1VHLA 2ODEA 4RSGA 4NYMR 2EVWX 3W5JA 4M1TA 5JS7A 1P60A 3EWSA 2WHXA 3ZZUA 2V1XA 4HDQB 4LJ5A 1Z29A 1N5LA 3VU9B 3RYTC 3TVTA 3EZFA 4MUBA 5DHAA 2GAAA 4YXWD 2DR3A 1AKEA 1EX6A 5FBRB 1MABB 1W5SA 4NZYA 4WZBE 2ZRLA 1N3BA 1UJ2A 2ASEA 2WJHA 1IN7A 1WDTA 3K1JA 2VSXA 1ZP6A 2ZI9A 3LVQE 3NEJA 4XIGS 1NJGA 1IN5A 2OCPA 1G20E 2PBRA 5DE3A 4FMDF 1FZQA 1X8JA 4QBHA 4PC7A 1Y63A 1UKEA 1M6NA 3K9LA 1VG8A 3QVVA 1Z47A 4TTPA 1OYWA 4BFWA 1X1SA 2JIZD 1I2MA 4C2TA 3CPHA 2F3TA 2D3WA 4I1UA 1NP6A 5TVKA 1E2MA 5CK4A 4BZXA 4RVCA 5FL7D 3REGA 2HLDD 3GJ8A 3KXLA 4ZO4A 3ZS9A 1F2TB 2GTPA 2IWRA 1ZUHA 4QNRA 3GLIE 1FUUA 2J7PA 4NH0A 2J0QA 4UJ3A 1UFQA 4TYWA 2AWNA 3TIFA 4HYYA 4DHEA 1NY5A 1KK0A 3A1UA 4KCGA 1GRQA 1NMYA 4C0JA 3I62A 1RW4A 5CYOA 4OI2A 3K9NA 3A1VA 2ZUCA 1JBKA 3IBGA 4TWZA 1E1QD 1GVNB 3NBZC 4V0ME 1RRGA 3GJ6A 3GEEA 3QKUA 5FR2A 3QY0A 2EFEB 3QQ5A 4QJ5A 4DDUA 121PA 3C16C 4RZ3A 5JMTA 4URVR 4TL6A 2ONJA 2BM0A 1QHSA 3T1OA 3CPEA 5ANRB 4DDTA 2QMHA 3UKDA 4A2PA 4IVPA 4TMTA 3CLVA 5SZHB 1P7CA 1W0JA 2NO1A 3GJ0A 2YWGA 4XJXA 4CEJA 3LAWA 1MO4A 4BFYA 2A5JA 4LJ7A 4B71A 3KQLA 1P9NA 4Q66C 5J4HA 1E2DA 4B48A 2BVNA 4OHYA 4NONA 2ERXA 1SHKA 4QBIA 3U2QA 1G9XA 3I3SR 2QENA 4FXPA 4US2R 3BB1A 4OQFA 4HATA 2ZE8A 4OJKA 2XSZA 3KXKA 2CNWD 3RRNA 3UG7A 3U44B 1L7VC 1ZJ6A 2FZLA 1U8ZA 2QEQA 2O8DA 3EC2A 2WSSA 3FDIA 2FGJA 2DPXA 5DH9A 2V8OA 3SC3A 3KJEA 4G3XA 1S0UA 4TYYA 3QUSA 4PC1A 5KDOA 1DS6A 1E1RD 4JS0A 4TTRA 2DFKB 1T0JB 1ZM7A 4OHXA 3S1AB 4UQOA 821PA 1XX6A 1G7CA 3QKTA 4W5HA 2EWVA 3ZIAD 3IGFA 721PA 4BRWA 2BMDA 2PZFA 1QVRA 1WB9A 2GJ9A 1VCMA 3G5UA 4QHYA 4CVNA 1KMQA 4DLUA 3VKWA 2DB3A 3D8BA 1NF3A 2C04A 2VF7A 3K0AB 3MWKA 5DISB 3VR2A 1NVWQ 3ZD6A 4TT3A 2H18A 2KWIA 2REOA 4OJQA 4B35A 5LD2B 2I3BA 1TX4B 4KSBA 5EE1A 3B1WA 3ADKA 1KKMA 4IVQA 5LB2A 4IFBA 1HQYE 2KI5A 3AF1A 1RPZA 2CL0X 2IT1A 3GLFE 3EWAA 1COWA 3PUWA 1SGWA 2CLCX 3QXCA 3ICEA 3RLFA 1XU4A 2XOKD 1A7JA 4YXWA 1P72A 5L3VA 3TJZA 2ZEJA 3SN6A 1TU4A 1XMIA 4MYCA 1KK2A 4MKHA 3X1XA 3THYA 4KVAA 4AYTA 4QGFA 3NKVA 1G8GA 1RZ3A 2IYUA 4GRAA 4TLBA 5FOUA 1OT3A 1IXZA 2JDID 4MQBA 4NHOA 1OLOA 1X86B 2JIZA 3LWNA 2Q3FA 3GLIB 1DG3A 3HU3A 4ILEA 5GADl 3FHOA 4W7SA 1KI6A 1ZUIA 2ZJBA 3PEVA 5FL7A 1MT0A 1YZNA 2HLDA 1KO1A 4OI0A 3UK6A 3U7EB 1IY1A 2XXAA 3DOFA 4JBWA 2VHJA 4NYJQ 2O8CA 1DPFA 4Q4HB 1DAMA 1WF3A 1DAIA 3LBNA 1XPOA 2QUZA 1E2FA 1NMZA 2FFHA 3BK7A 2E1RA 3N2EA 4C0KA 4D80A 1L2TA 2RGNC 1ESMA 4I1SA 4KFSA 2WPDA 1CF4A 3QI2A 2WV9A 2C96A 4LX0A 3WP0A 4TQAA 3CX8A 4DLTA 2GDJA 1E1QA 1G7SA 4H9GA 2AK3A 1RKBA 3F3YA 2OXRA 3AEZA 1SXJA 3L0SA 2VP9A 3WYFA 2BIFA 1IJFA 2QAGB 2RMKA 1P3JA 3QXJA 2Z5FA 5EP4A 3PUXA 3NC1C 2QRZA 3BWDD 4DLSA 3SYKA 2OSBA 3NH9A 5FUVA 5AWFC 1II9A 3BH7A 1AS3A 2F7SA 3Q85A 4H1VA 1W5TA 3GLHA 1W49A 1N0WA 2QTFA 2ZR0A 2ZRAA 3GMTA 3K0CC 2ZPTX 4DT1A 1GDDA 1NBMA 2W83A 1SKYE 1ZU5A 2VF8A 4P0TA 5DI9A 3QENA 3IIMA 3B85A 4CEIB 2IC5A 2ZAOA 4CT4B 1RRCA 3HU2A 3ZQ6A 5JECA 1G21E 2AKYA 1Q57A 2W6JD 2AR7A 1LNZA 2VYFA 4Q03A 1HV8A 3FKSA 4NYMQ 1R5BA 4JLJA 3VNVA 2VL7A 4XOIA 1QDEA 4UNQA 1RYFA 4A6XA 1IBRA 2ONKA 3ADBA 5H8WA 3Q5DA 4HUQB 1J70A 4OQNA 2YOGA 4Q47A 4OKSA 5G41A 4KO8A 4N0EA 4D4KA 2C03A 2JLZA 1II8B 2WTUA 3SEAA 3IBYA 4WXRA 2P6UA 1XZQA 1AGRA 3SQXA 3T35A 1WMSA 3CRRA 1FMLA 5EXXA 1UKZA 3CRVA 1IAQA 3FB4A 1QZXA 3FFAA 4LBVA 1KDTA 2FSHA 4BLPA 2BM1A 5GVRA 4TTQA 5FOWA 4EAQA 1EK0A 3PG5A 2ZE5A 3D31A 1PLLA 2W6IA 2XZPA 5TDHA 4D4JA 5KOYA 5L8VA 5G40A 1QHHA 1W36B 4RY2A 3SOPA 1I2DA 2FWRA 4TL7A 4RD4A 4U7DA 5TB5A 1MKYA 1VYVA 2XOKA 2XJ4A 4LK2A 1OHHA 2BDTA 4A2WA 4DCVA 2J9RA 4IDQA 3ZS8A 4BZQA 3IQXA 4KBGA 1N0VC 1AN0A 1X8LA 4M1SA 1B0UA 3WMGA 2IK8A 2QRNA 2J1LA 5C46F 1II0A 4OQLA 4A8JA 5KYKA 1LS1A 1WA5A 2QU8A 3KX2A 2ZITA 1KI3A 4Z1MD 4KITB 3I5YA 5F98A 3LBIA 3Q7PA 2ZSBA 2RGDA 1IXSB 1KOFA 2JLVA 5CIWA 4KJZA 1Q12A 3D6TB 4FCVA 4FN5A 1W2GA 1YR8A 2VHCA 2N42A 3DKPA 3FMOB 1CLUA 4QG7A 4UXJA 2F1HA 1EGAA 1G18A 4MGYR 4Q7KA 2GJ8A 3QSYA 1UKYA 2WKQA 3KB2A 2ZR9A 1XNJA 3P4XA 1UKVY 4BLSA 1T3HA 3C8UA 3Q7QA 4C0QC 2VEDA 4PSVA 2XB4A 2ZREA 3PFIA 1RVDA 3IEUA 4DJTA 1P9WA 3R9XA 1UEIA 3THXB 2ZE6A 2HCJB 3SFZA 1ZU4A 1HURA 1T0HB 3BIFA 2JLRA 3WY9A 1A82A 2YOFA 2VP2A 1RJ9B 2B8TA 4JT2A 2F55A 4MDFA 1FUKA 4XVQA 4PTLA 2AD5A 1ZM9A 2PLRA 2G77B 4TN1A 2ZSEA 2BHRA 2HT6A 3AVPA 5B30A 1CU1A 1Z6GA 1Q3TA 2GETA 2Q0HA 3TGPA 2QA5A 4LHXA 4GOXA 3U4QA 1XEXB 2AKAB 1Z0JA 5HCNA 3IIKA 5B58C 5EXTA 2J41A 4PZLA 2OCAA 5BN3A 3U61B 5FR1A 2ATXA 2ZRHA 5FTKA 3AV0B 4ZI3A 4X8MA 1OXVA 2A5YB 1R5OA 1CIPA 1SVWA 3DHWC 2DWOA 5FUXA 3RC8A 4DCUA 4EDHA 5A0FA 4TMWA 4AD8A 1W7AA 2ZJYA 1OH7A 3AUYA 1AGPA 4HAVA 2BC9A 1NVVR 3ZVRA 2ZI5A 1XB2A 2Z6VA 3LV8A 5AJWA 3QE0A 3DZ8A 4LHYA 4LYFA 1G3IA 3I1FA 4M8NE 1AM4D 3C5HA 4QRHA 3SU8A 5DI3A 2IYYA 1KK3A 1KIMA 4MDEA 1T8TA 2IWHA 2VLIA 3DM9B 1UBFA 3QPVA 1P75A 3IKJA 3L2OB 3B9PA 2YWFA 2ZU0C 2ZRIA 3PEYA 2QL6A 4AK9A 3FKQA 1KZ7B 1VG9B 2R6DA 1EFCA 3KDSE 4TSFD 4TMZA 3RC3A 4EJSA 3VMFA 1E94E 5CJ2A 4PAMA 1Q1ZA 4W5WA 1KI4A 4DSTA 3NDPA 2H5EA 2EQBA 4A2QA 4F92B 2J5XA 5CYPA 2CLDX 1R10A 1KJYA 1SKQA 1SULA 2ZU6A 1JXOA 3KTAA 3OIUA 2NPIA 4TYPA 5H68A 1GZSA 4P4TA 2HYIC 1JR3A 4GI7A 4P33A 1AJEA 1MO5A 4EPXA 1MO6A 3W3ZB 1G16A 2YINC 1E0JA 3FGNA 4ZCMA 5FTJA 5E7MA 1P4SA 1U94A 4F4IA 3NBFA 4Q01A 4Z54A 3A58B 3J81k 3SDZA 2P5SA 4ZDJA 4GSYA 2FEOA 1KY3A 5EE5B 421PA 1E2QA 4KODA 1XXHE 1OF1A 2CK3A 4JMPA 1N6LA 1ZD1A 3SBDA 4MRSA 2FSFA 4AKGA 2FPKA 4GFDA 1U98A 1ZAKA 2CEAA 1E2HA 2YVUA 1RC8A 2WJYA 1OH6A 3FFBA 521PA 4KHZA 1DVRA 4HAWA 4FMDB 5TMPA 2V6IA 2CE7A 1VKJA 2OG2A 2QPOA 4Q19A 4GP6A 4R2IA 3K9HA 4YMUA 4GOJA 1DAGA 4X8HA 2JATA 3DVLA 3G82C 4PHHA 3R8CA 2QORA 4HZIA 2A5FA 4DCNA 1XD2A 5EP1A 4GMDA 2QSYA 4M9SA 3T34A 3DMDA 2H17A 3LA6A 4DLYA 1AA9A 2BMEA 4W9MC 3BJIC 1Z6YA 1P2UA 1SVSA 2VP5A 2D4HA 2QGZA 2Q9CA 2J0SA 1K5GA 3PUZA 4LC0A 4D2IA 5KNBA 3X1DA 2PMKA 2PMDA 4CEJB 4D81A 4PPGA 2QM8A 3P32A 621PA 1KDPA 2SHKA 3TH5A 2BJWA 1QG4A 3VFDA 2E9SA 2O0KA 4JLVA 3NWJA 2RGGA 1E2PA 1G41A 1KMHA 3GLFA 3L8ZA 3GLHE 3LO5A 5KNDA 2P6NA 2V54A 2HYDA 1S96A 5JWHA 3SE0A 2HXSA 4LPSA 4BFSA 1GG2A 5FPYA 1OIWA 4AI6A 4NCKA 3KQUA 2D74A 2QNRA 4R98A 1HYQA 5JJKA 4QNMA 4ASUD 2J3EA 2O0JA 2JJ1A 2GXAA 3TRFA 2X2FA 4TMVA 3QF7A 3ZVLA 2BBOA 4Q1EA 2ZUBA 5EXSA 1EFRD 1TQ4A 4ABYA 2DBYA 2ODNA 2E87A 2PT7A 4OQMA 4WOPA 4EIWA 3L43A 1LB1B 2ODWA 3BB3A 3MCAA 4HLCA 1LTQA 3AF0A 4GP7A 5HKKD 4GZLA 2BCGY 4A0FA 5CDFA 4TZ6A 2F43A 3QG1A 4TSFA 2K5UA 4Q4AA 4XH9B 1YZQA 2IXFA 3AF2A 1SVLA 4ACBA 4BECA 5L3QA 1F2UA 3NC0C 1DO0A 3CX7A 3SJZA 1XEWY 4PR0A 3SYNA 1GL6A 4BLRA 1KDRA 4KFUA 3DO6A 1HQCA 2GXQA 1TU3A 5BQ5A 4UNRA 1Q3HA 2ATVA 4DDWA 4L8GA 4LV5B 4E03A 3THYB 2QP4A 1OFIA 5BWMA 3QF4A 3BH0A 2O52A 2RGNA 1NN3A 1QRAA 3LRPA 2UZIR 2IXEA 4EQ6A 5JEEA 2HJVA 3K9GA 1KAGA 4N0DA 4A82A 2OBLA 1M74A 1QVAA 4C9BA 2QMOA 4PZYA 3W90A 1S8FA 1OFUX 2VHUA 3GCGA 5A4JA 1KI6B 3BGWA 1MR3F 2DWQA 4DCTA 2GF0A 1F6BA 5JHGB 3GEIA 2ZYVX 3WP1B 3WYGA 2XXAB 4D4MA 1TPZA 3W6NA 4ARZB 1FPMA 2ZI6A 5AJVB 3RDPA 3AB3A 1BIFA 4XSHA 2FG5A 3ASYA 2EFCB 2CVFA 1XPRA 1CR2A 5FFMA 2JLYA 2J0UA 1G5PA 1I4TD 3K0CA 2DFLA 3KJIA 3NEYA 4HZUA 4CRWB 1S3SA 2X19A 2W0MA 1YZTA 4JLOA 3E1SA 3HPRA 2CDNA 2O8EA 3ND8A 5CLLA 1E79A 3KXIA 5K8LA 5BN4A 4AKHA 4EKDA 4M9QA 1KAOA 1SXJB 3QXXA 3IO5A 3CWQA 1CULC 4TYNA 1M7HA 2PCLA 4AC9A 4ZIRA 4EPVA 2IYRA 5KSZA 2OESA 3R20A 4US0R 2EW1A 2QT1A 3BRWD 1ZNWA 1A1VA 2R6CA 3CF2A 1NVVQ 5DIFA 4BFZA 2QQEA 1VCNA 3GLHB 4PFSA 1T4GA 4PO9A 2HV8A 3TAHA 4DT1B 1N6RA 2PX3A 4JBXA 4A92A 2IBMA 1TTTA 1XMSA 1T3LA 1B23P 2VRWA 3DOEA 1E9RA 1M8PA 1ZCAA 2VSFA 4PZZA 1A5TA 2ZSAA 4BFUA 5CITA 3N70A 4GPTA 3DPUA 4E09A 2FV8A 1KYIA 2JCSA 3PXGA 2WBLC 4Q9HA 3CH5A 4Q02A 1BOFA 2OM2A 2PEYA 1WRBA 3LW7A 3CONA 3OEHA 4RKFA 4AURA 1GM5A 2H8KA 4P32A 3TQFA 1NY6A 4RCZA 5JCZA 4ASUA 3IIJA 4B32A 4ZDKA 2OE2A 3QPUA 4BLQA 1DTSA 1HY3A 4IOLA 5KSPA 2QZ4A 1TF5A 2NGRA 2B6HA 3CH4B 3C15C 4E5UA 1EFRA 2GBLC 1U9IC 1XJCA 1XTIA 1Q22A 1G1MA 3BERA 4H1UA 3FE2A 3EXAA 4OK6A 3U3OA 5CB6A 2ZXUA 4DWJA 1XF9A 1XMJA 3AF4A 4YDHB 1KY2A 2UKDA 3RSOA 3P26A 4EPWA 2OFWA 1H8HD 2REXB 3K53A 2GXUA 5EXPA 3OFNA 3LX5A 3Q8XB 4IDNA 4KVGA 3X1ZA 2OFXA 2AX4A 1N5JA 4JT4A 4BZPA 4NYIR 3V4FA 2FSGA 1Z2CA 1N6PA 2ZSFA 4D0LB 2OCYC 1QHHB 2BWJA 3RWMB 4KXFB 3AM1A 2GZAA 2FSIA 3AP3A 3TQCA 1KI1A 4TMKA 2RCNA 1HTWA 4KI0A 3AP2A 1W4AA 4URUR 2RGXA 1ZNZA 4Q1FA 3DMNA 4L4UA 1CJMA 1JR3E 1EFHA 2A78A 3OIYA 2IS1A 3TSOA 221PA 3GJXC 1GAJA 1LVGA 1E0KA 4CT5A 4A8JB 4OHZA 5JCPA 4L15A 4LPKA 1XTQA 5JWOA 3T61A 3NBYC 3AVXA 4K81B 4A15A 2J7KA 2HXYA 1E4VA 5UKDA 1E9EA 2KB0A 5GJBA 4ZCIA 3RRZA 2ZRGA 2QAGC 2ZRFA 1T91A 4JVLA 4C0AC 3FMPB 2JLSA 2AXNA 3QBVA 4LHZA 3MJRA 4DSUA 2PX0A 3ONWA 1SVMA 1VIYA 2PZEA 3BBPA 3KKNA 4FCWA 5FUYA 5HE8A 5SZKB 1FQJA 1OIVA 4CDGA 1KSJA 1R5NA 1TNDA 2OUKA 2V1UA 4MKGA 3BH6A 4UXIA 2NIPA 4IRUB 4OYHA 2JLQA 5JRZA 3MGCA 5DYGA 1NRJB 4A6PA 2NZJA 3CR7A 3OE7D 2QTHA 5CM8B 2CCGA 3MLEA 1UBGA 3TUJC 1ETUA 2WWWA 4IW3B 4NCHA 5DHFA 1Z0FA 1K8RA 5EE9A 4OL0A 4TLCA 2OLKA 4NDZA 5FH9A 4KYUA 5L3SA 5AK0A 4Q1BA 2X2EA 2WSMA 4DSOA 3U4QB 3A1SA 2GCOA 3UATA 1K5DA 4RZUA 1N2CE 4Y0VA 4BUJA 4WZ6A 1E96A 2FFQA 2QN6A 5J4KA 3PIRA 4G1UC 1E32A 1G7TA 5HE9A 2VHQA 4AG5A 1A2BA 1HH4A 1CJUC 1KI2A 3CNLA 1TUIA 4BGDA 1FTNA 1FNNA 1E69A 2IL1A 3K09C 2J59A 2VP4A 1OKKD 3FMIA 3P27A 4WW0A 1GFIA 4PXAA 2ZR7A 2LKDA 3D7MA 2LWIA 1XTKA 4LJAA 1ZNYA 2QP3A 2IUUA 4CF7A 5KDLA 3I8XA 5FI0B 1Q44A 1W36C 3CRMA 5DI3B 4CEHB 3K70B 1UPTA 4JIMA 2CCJA 3OEED 2IYXA 1SQ5A 1XXHA 4MRPA 4G0NA 2ZJAA 3U3JA 1E3MA 3GJ7A 2P5TB 4NE2A 1L4YA 5KHOC 3ZJYA 1S3GA 4UJ5A 1GKIA 3U3RA 4IDOA 5GVSA 1NJFA 5JRJA 1TMKA 2CE2X 2OAP1 3KQKA 3HR7A 4O2RA 1LY1A 2ECKA 4NPHA 4KFRA 4EJSB 3VKHA 1W48A 3C7KA 3O8BA 4O2LA 2VTKA 3LBHA 1H8HA 4HSEA 1GKUB 2BCJQ 5CDFE 4U5XA 1IN8A 2ZRBA 4ZKEA 1QF9A 4V0OA 1OXTA 3SHWA 1N6HA 4V0KA 5FBWB 2P6RA 3NG1A 3VHXA 4TYQA 2BMJA 4I81A 4LOAA 4JL6A 1E9AA 5IRCD 1S9HA 3FWYA 1JQLB 3ADCA 3SJBA 4QJ3A 2FZ4A 2Q6TA 1BO6A 1YRAA 3JVUA 4D4LA 2MSEB 3K0FA 3H86A 4RJLA 2OXCA 2C2HA 1YZGA 4JL8A 4EUNA 4XWOA 5SZIA 1NLZA 3H4MA 2D06A 1F3OA 2GXSA 4KFTA 4HAUA 4JL5A 4PQFA 2O8BB 1GWNA 4IEIA 3PQCA 2BEJA 2G9NA 1C4OA 3MWYW 4LSGA 4FD2A 1G7RA 3V4RA 1FMJA 2D2FA 3KZ1E 2AXPA 2WJVA 1FP7A 3EA5A 1XRJA 3MUFA 3P20A 3SJCA 4R71A 3LNCA 1Z83A 2C9OA 2ZYTX 3N5CA 3ND9A 2NO9A 1Z22A 2Q3HA 4JYBA 3RS5A 1NSTA 3QXSA 1D5CA 1YR7A 3MFYA 3OIVA 5FL3A 5G3ZA 2GK6A 3EARA 4DIEA 3GP8A 2CNWA 1OFTA 2OHFA 2Q9AA 4YDSA 3SNHA 3W5IA 1OH8A 2HF8A 3UG6A 2R2AA 1NNEA 1GRNA 5TV2A 3VKGA 1EXMA 1XD2B 3OE7A 1GL9B 3U3MA 1OXSC 4DXAA 1E1RA 2V7QD 4OI4A 5FTNA 3BOSA 3LH5A 4G5SA 3UXMA 4TQ9A 4DKXA 3ZIAA 1NG9A 2NO7A 1ZVQA 3GD7A 2HDNB 4PC3A 5B57C 3MWJA 1DEKA 4IOJA 2JJ8A 4IFEA 1KMHB 3GLFB 4FWIB 4DIDA 2KSQA 5AR1A 4B2LA 1Z8FA 4B44A 4G5OA 4O25A 2X8AA 3OZXA 3KJHA 3P1JA 4ZCLA 4BFXA 3M4YA 2ZSDA 2FX3A 3CRQA 3EPLA 3VR4A 2VHTA 4L9SA 5E7IA 4LDJA 4MGKR 1XJ0A 1Z6XA 1XD9A 1T6NA 4DLXA 2CHQA 5EE3A 4JSTA 3ZDQA 5BN5A 2XITA 1F2TA 3LLMA 5JS8A 2XAUA 2ZVQX 3NHBA 4Q4JA 4R7ZA 4K8OA 4NYIQ 2OO7A 4RFSB 4P4UA 3OEEA 1VECA 4S2EA 2GK7A 4C0HA 4A36A 1S1CA 3QNUA 4LJYA 5CK5A 2IF2A 2JDIA 3PR1A 1JNYA 4P4SA 3QKRA 3DM5A 1J7KA 1Z63A 4QXAA 3BS4A 2D7DA 3SYLA 3RWOA 2PLFA 3A37A 2QMUA 3U5ZB 5LDDC 2CMKA 5F9FA 4Q4AB 2ZUDA 1N0UA 1J8MF 2JJ2D 5K8IA 2C9CA 3RS4A 1SVKA 2Z4SA 4PPQA 4M1OA 1F2UB 5L3QB 3KUCA 1IONA 1XZPA 2FDCA 1V43A 2YC4C 3GJ5A 4M2LA 3BC1A 4LZZA 4RD2A 1GTVA 1IOZA 1Z6AA 4RD0A 2QMEA 5J40A 2F1RA 3B7GA 4XD7D 4Z51A 2IS6A 1FNMA 2CBZA 4LV8B 1E98A 1G8PA 1R0XA 1TUEA 3L0IB 4JLPA 1E2IA 2ZRDA 3EA0A 3FOZA 4YMSA 3QF4B 5JSZA 2NOAA 2VQSA 1N6OA 1KK1A 1VCIA 4FW9A 4DLWA 2BEKA 1E2KA 4EQ6B 3CIOA 1CR0A 3OAAD 3WHKA 5DYIA 2V3CC 1Z0IA 2PJRA 2WWGA 1U8AA 2WVJA 3EIHA 4TLEA 5D3MA 1H8ED 5JWRA 3QKSA 5A5GA 2C78A 4G5RA 5CM9C 5FTLA 1SKYB 2O0HA 4ESHA 2GJKA 4LV6A 5JLJA 3K8YA 1NLYA 2F1IA 3IILA 3PEWA 1WCV1 4LWZA 2EFHB 4US1R 2QQ0A 5KPJA 3UPUA 4Q7MB 1KJZA 1EWQA 1D9XA 1KHTA 1G8HA 1D9ZA 2HF9A 1AZSC 1KO7A 3KQHA 4FI3C 3AGQA 3S1AA 4B75A 4PC2A 5TXGA 2UVQA 4KYIB 5DNYB 2J0UB 4IJMA 1IQPA 4O0MA 5GJCA 1JI0A 4F7WA 4I99A 1JEDA 1Q1QA 4WVFA 2O8EB 5AJXA 3TVDA 5FOXA 2CVHA 2W6JA 3BORA 3PUVA 3X1YA 3THWA 4HI0E 2IXGA 1UAAA 2NPFA 4IEEA 3EW9A 4XSGA 1FX0A 3IEVA 2GF9A 1E2LA 2ZIAA 4YC7A 3CO5A 3EPJA 2V7QA 4ZIRB 1QHGA 4XVUA 3A4MA 1KI9A 1ZBDA 3X2SA 3WBKA 1XWIA 4JSYA 1C1YA 2R44A 4Z8YA 3AP1A 1W36D 1HA3A 2H7VA 3C5CA 1E9CA 1G6OA 4HB3A 4LJ9A 3B2EA 5FBVB 3R7WA 2O8FA 4IOKA 2HEIA 1N5KA 2GBLA 1U9IA 5FBLB 3RNLA 2W2XA 5C4GB 4OHVA 1ZM2A 2W0SA 2RHMA 3AVQA 1CJKC 4HAYA 4GMXA 1ZC3A 1BMFD 1JJ7A 2AD1A 4NP6A 4I1VA 1XMVA 4GL2A 3MD0A 5HZHA 1L8QA 3SR0A 2D2EA 4Z8XA 3PV0A 4UNNA 4Y0AA 2R65A 2ZJZA 4M53A 4PQYA 4LYJA 1P6XA 2F9LA 3R8FA 4Q00A 1FL9A 2GJAA 3NH6A 3WXMA 2C99A 2G88A 1UBEA 1GILA 2R62A 2BJVA 1OW3B 2OLJA 4HEJA 4IVRA 4MRNA 3CPJB 1ZC4A 2WJIA 1OJLA 1MO3A 1QHXA 1ZCBA 3EZ9A 1AKYA 3H84A 3KKOA 4OHWA 1OB2A 4XTCS 4G01B 5AUNB 4URWR 5J4LA 1VG0B 3AVUA 1UDWA 2UZ3A 3ASZA 3BFKA 4AG6A 3I73A 2ZRKA 4Q4LA 4BLTA 2Z4RA 4Z1MA 1YU9A 5LB4A 2P65A 2V6JA 3RRMA 3VR6A 3ZH9B 1VPLA 2DHRA 2J46A 3AUXA 2N1BA 3B13B 3RS2A 3T06B 2TMKA 4R9UC 3WMEA 4MKIA 1W4BA 5TY0A 4F4CA 3TUIC 3EIEA 4BE7B 2FH5B 1ELOA 4LJ8A 4M22A 1U0JA 4CIDA 1A2KC 3RS0A 1ZNXA 1Q21A 3FHTA 2W00A 4WZAE 1R2QA 4A0RA 4IDPA 2DYKA 4BWYA 5BXQC 5EP2A 3UWKA 2RH5A 8OHMA 2OBMA 1LF5A 1T3SA 5FBQB 4AYWA 2XNSA 2BBWA 4AIIA 1G4UR 4IXNA 2QE7D 1G3RA 3VX3A 2XTMA 3CUEF 1HT1E 3SHFA 1J90A 3OAAA 2ZM5A 4C4PA 2QSZA 3M1IA 3QIAA 4F4JA 1J2JA 1KGDA 5JJIA 1SXJC 1DAEA 3I5XA 1G6HA 2WMOB 1US8A 1G8FA 2H92A 5FOSA 5CJPA 1Z28A 2WOOA 1WP9A 1IM2A 3JZAA 2W2TA 4YMWA 1DELA 2B21A 2WKRA 2MSDB 5B64A 3CB4A 3W8RA 4B2PA 3I61A 2D7CA 3B82A 4RKEA 4UNPA 5H70A 1OB5A 4ZDIA 4D6PA 1U0HC 4C7OA 1II8A 1VIAA 2O8DB 4BQSA 2GJSA 4C3ZA 2FFAA 3A8TA 4JYCA 4HDCA 2WIAA 2WMNB 5C4MA 1RFLA 1LV7A 1KO5A 3CR8A 1N5IA 1U2RA 3LLUA 5HPYB 3MWLA 5FPSA 3CKLA 4TLAA 1E9FA 1YQTA 3I92A 2JLXA 3CZQA 3T1QA 4F93B 5BYKA 3ICQB 2F6RA 4FMCB 5TARA 1G19A 1NN1A 3B60A 4LY6A 2WIBA 3K0SA 2IYZA 2XZOA 2JGNA 3N2IA 4URXR 3SI7A 2WJGA 1FTSA 5EZ6B 4GOKA 2FA9A 3CNOA 1JXMA 1V5WA 4POAA 1GNPA 5C2JB 1CXZA 4LI0A 2GKSA 1EX7A 5JEDA 1R8SA 4LBYA 2AK2A 1TAGA 5B2ZA 2GCPA 2QBYA 5GJWC 4QHTA 2OZEA 3TR0A 1I4LD 4B43A 1BH2A 4JBYA 1OPXA 1ANKA 1EWRA 3O8RA 2GZDA 3BD9A 2P0EA 2B7CA 3WNBA 2HCBA 4B73A 2J7PD 4PSAA 4Q9JA 2X77A 4QGGA 4JVMA 3CF6R 1P9RA 1MRNA 3WRXC 1MOZA 3LFUA 1W0KD 4M21A 3EPKA 1XXHB 2J0VA 4GT1A 3OIWA 4QM7A 3GQBA 3QOFA 3KKMA 2OFOA 4RD1A 1G3UA 1NI3A 2IUSA 2ZI3A 3KKQA 4Q48A 4MYUA 4LRWA 1HEIA 1TQDA 4A8JC 1CR1A 2WOJA 3F5FA 4Q9IA 1R4AA 3G0HA 3O8DA 2GA8A 5C1BA 2ZVPX 3THXA 2IEYA 2WWFA 2A5GA 5EP3A 3A1WA 2O8CB 1YR6A 2EFDB 4AKIA 1ZW6A 1OE0A 3PUYA 3KQNA 1HUQA 3SFVA 3VX4A 3Q3JB 1M1YE 1EFUA 4EPYA 2ZTSA 3CM0A 3SZRA 2HT1A 3BAFA 4OQXA 3A1TA 1LF0A 1XEXA 1BKDR 1S2MA 2GESA 3K0FB 4WAUA 3Q9LA 2P67A 1UEJA 1SZPA 3BFVA 4WIAA 3GLGA 4PPFA 3U7GA 1CJTC 1XCGB 4ZI2A 2YZ2A 3MAAC 3R9WA 3B78A 1ZD9A 2Z43A 1VYUA 1DAKA 2FJUA 3L8YA 4QHSA 2ZS7A 3T1TA 3NDBB 1KNXA 2RB4A 4B3XA 2VPPA 2WSSD 4JKIA 1G64A 1YR9A 4MRRA 2FGKA 2GEUA 4B76A 1CRPA 5E3HA 2CHGA 4HLUC 3QXHA 3P4YA 3W34A 2QY9A 4ON9A 2ZRJA 3UWOA 2CL7X 2NZ8A 2DFTA 5BW8A 5KSYA 4HLDA 4I1OA 2XX3A 4LBZA 4JZKA 2PCJA 5LD2C 1ZM3A 3KJGA 4FMBB 1GKYA 1P62B 3OHMA 2R6FA 3U6KA 1R6BX 4XWKA 1YZUA 2G83A 4TT3D 1D6JA 1KKLA 2YC2C 4BFTA 2JA1A 2GRJA 3TE6A 1VHTA 3L0PA 2Z0MA 1GUAA 3EC1A 4D0NA 1E2GA 3ZVMA 1AQYA 4OBEA 4MA4A 5E4FA 4HUTA 4B3FX 5FUWA 1COWD 2I4IA 4OK3A 2AWOA 4Q1DA 1E4YA 4F38A 4DLZA 4PANA 2A5DA 5G3YA 1PV4A 3EZ2A 3K70C 1SHZA 3VR1A 2Q21A 4U02A 4NTZA 1BS1A 1Z0KA 1G4AE 2FU5C 3HPQA 1EESA 5AUQA 2IS2A 5HKKA 3RHFA 3NXSA 4W5JA 1Q1EA 5AJZA 5HCIA 4KAXA 3HU1A 2MMCA 1GITA 2JAQA 1IHUA 3BXZA 2B8WA 4R2HA 2XGJA 3QBTA 1HT2E 1Q1BA 5D3QA 2VP0A 4EJSC 2YJTD 1OIXA 2PL3A 4HB2A 3I72A 1VYTA 3JVVA 2NMVA 1JR6A 4JVSB 1DE0A 3WMFA 2FEMA 5J5CA 2I1QA 3WHLA 3QPWA 2WM9B 2PEZA 3RANA 4G5GA 2ORVA 2F3RA 2FFBA 2OILA 4XWAA 3CRW1 4AWXA 1G17A 2ZRMA 1VMAA 1OXUA 4Q4JB 4PPNA 2OCBA 1G5RA 3WRYC 2GZHA 5K8TA 4U00A 1NSFA 4DLVA 1W0KA 2NQ2C 1L4UA 1R0WA 2PH1A 1AQUA 4P4SB 2ZROA 3MG9A 3QKRB 4DZZA 2WPDD 1W46A 1R8QA 2CXXA 4UXHA 4MGIR 1Z6TA 2RHDA 3HYTA 5C18A 4EFMA 3EAQA 5EE0A 4FMCF 4V0NA 2WZQA 2XEXA 4LHVA 5KPDA 1SXJD 1KSHA 4N1AA 3VR5A 1W4CA 1P5ZB 3PJRA 1P2TA 3C4JA 2ORIA 3SS8A 2QPTA 1OXXK 4JKYA 4QGAA 1CJVC 2G0TA 4NCNA 5DSZA 4C0BA 2DY1A 2J45A 4TL9A 3SJAA 2CL6X 3GEHA 3AKCA 3HR8A 1FOEB 1T5IA 1GIAA 5DN6D 4YONB 2JEOA 1UF9A 4PQRA 5JSZB 4PAOA 1NBMD 1O87A 1Z07A 3DKVA 4HLQB 4KLZA 2YOHA 4J0QA 4A4DA 2Q3MA 3RSLA 5ELXA 1TF7A 2R6GA 3NVAA 2YNMA 3TNFA 5D3MB 4QOSA 3ZD7A 2ERYA 3QKSB 5JHHB 4HB4A 1QHIA 1ZD8A 3IO3A 3CX6A 3PEUA 5L3RA 1PVOA 2CHVA 3CZPA 3FKSD 4ZDWA 4DBLC 4D26A 1KSGA 3PENA 3QEJA 3U6BA 1NVXQ 3LD9A 4A0GA 3C14C 4MYHA 3UMSA 4F91B 1E2JA 6Q21A 1W47A 1QG2A 2QM7A 5SZJA 4URZR 2WAYA 2ZYUX 2MSCB 1GOTA 4DB2A 2WWIA 3ECCA 2ZRNA 1CKEA 4LJ4A 2PT5A 1Z0AA 5DO9A 1CTQA 2G0NA 1RRPA 1QHYA 2L0XA 3AH8A 2IEZA 1YE8A 2ZS8A 1XTSA 1T8UA 2ZETA 4AYXA 4DEXA 3THWB 1KO8A 1ONBA 2A3RA 1FX0B 2KBFA 2EU8A 3NBXX 4L16A 2OV2A 1JB1A 1P2SA 4QL3A 2W6ID 5LBIA 1ODFA 2IA5A 3X1WA 1VDZA 1EG7A 2YYZA 4DCSA 1JPJA 3M6AA 3AQ4A 5KUTA 2IX3A 2BV3A 3WNDA 3KKPA 1OHHD 2Q9BA 3R7WB 2IHBA 4Q9KA 3IPYA 1E6CA 4HAZA 4M1KA 2WWHA 1PUIA 4M4SA 1M7GA 2CLSA 4RZ2A 1NN5A 2IF0A 4PSKA 4ZPXA 1PUJA 1YZLA 4FCTA 2LKCA 1U90A 2VO1A 5DLQC 1YJ5A 4PAQA 3A6PC 1G5TA 1E9BA 1W4RA 2FN4A 3KTAB 5FPHA 4UKDA 4YQFA 4QKQA 3LXXA 3PCRB 1FQKA 5EJEA 1AS2A 3IDQA 5JBQA 1TEVA 2ORWA 3DL0A 4IXMA 2V4ZA 1E99A 3CF0A 5KNCA 2A2ZA 2IUTA 4B6FA 4B34A 2HJGA 2BKUA 3EZ6A 3LX8A 2P2LA 4ARZA 1KJWA 3B6EA 2V55B 4C0SA 3U3KA 1XFAA 5CLQA 4HB0A 2B7BA 3E5HA 2EFGA 3BE4A 4RD3A 2AFIE 3IHLA 3ZGXA 1MH1A 2N46A 5J4YA 3W8NA 5FOVA 4PHGA 3W6OA 5F3WB 2VBCA 1XEWX 2CJWA 1ZYUA 1MRSA 4OI1A 3VR3A 4E22A 2GVZC 2ZS9A 1ZRHA 3I4LA 1XJQA 1ZMXA 4L9WA 2ZQ5A 3FYHA 1ESNA 3HJNA 1VTKA 3JZMA 1KI7A 1BYIA 1ZUNB 4CGZA 1PZNA 3CBQA 1C9KA 1F60A 3TBKA 1G291 3GFPA 5JI3E 4A0HA 1NLFA 3O47A 2AL7A 3AKEA 4MRVA 5EZ5A 3REFA 3V00A 3GFTA 4JLDA 3KFVA 3HP1A 4JLBA 5IF9A 2DWPA 5DN6A 3TAUA 1GSIA 4V0LA 1M7BA 1D8TA 2DCUA 5HR5A 1Z08A 1ZIPA 2QT0A 3AGPA 1G3MA 1M34E 1Z0DA 5JI2E 2AFHE 1NVUQ 3GLGE 3VU9A 2RGCA 3CNNA 2GILA 3TMKA 3I8SA 3GPLA 1US8B 4WA7A 1M2OB 5KSOA 2NO0A 3BB4A 1JAHA 1MABA 3VHLB 1NG1A 4DUGD 1MV5A 3Q72A 1RIFA 5FTMA 2KJQA 4OK5A 1O3YA 3WBJA 1FP6A 1PLKA 5H1YA 3A36A 3K70D 1Q0UA 2YWHA 2A30A 2IYVA 4C7OB 4URYR 4C30A 1CBUA 2ANCA 2YWEA 2OEPA 1OKKA 1KZGB 4IDHA 3NTUA 4LGMA 4IKEA 1K6MA 4TLDA 2QI9C 1JALA 4FIDA 4AKEA 1KDOA 5G53C 4QBFA 1GL7A 1RE0A 4V02A 3T15A 3ZZ0A 2GCNA 2BOVA 4ZKDA 2ZYWX 2ZI7A 2ZAMA 3TLXA 2F1JA 2G6BA 3AKDA 1IY0A 2XNDD 2GNOA 4BRUA 3DDCA 1CEEA 3EX7C 2C5LA 2IYTA 4IOMA 4X8OA 2IS4A 3MSXA 5GJVC 3RS7A 3THOA 2A9KA 1JR3D 4B74A 1XEFA 3TR5A 1T5LA 4TMXA 1DARA 1GP2A 2F43B 1P61B 3W6PA 4BEJA 3AVTA 2RGBA 3PITA 5KU1A 3IUYA 3AVYA 4MITA 2I1VB 2LCFA 4CW7A 1JPNA 3RAPR 1TL7C 3HWSA 3UANA 1DADA 3UMFA 3CW2A 4BEBA 5J47A 2QBYB 2ZRPA 4D0GA 4M9XA 1YZKA 5FPTA 5P21A 1KI8A 2VH5R 4KBFA 4DDVA 4LYAA 1GNRA 4TL8A 1JJVA 4M9ZA 2CK3D 2WICA 1U8YA 4PHTA 3NHAA 3QG5A 1U0LA 4JLKA 4GDFA 2GAOA 1IJEA 2VIIA 3LQRA 1Q20A 5IT5A 2GWHA 2WKPA 3B1XA 1Z2AA 3TSZA 3FTQA 2QTVB 3B1ZA 2XTZA 4PO1A 3KFXA 1S9DA 1PLJA 2C9YA
chains in the Genus database with same CATH superfamily
3ILHA 2O3UA 1DBSA 3LUJA 4OUKX 3H6HA 1RRFA 2HCRA 1C30A 4REQB 3UWDA 4IZOA 2OYSA 1CUUA 2GEKA 1ZINA 3BK1A 3LW8A 3QX7A 3DEZA 5DNAA 5IHPA 2W2OA 3FPLA 1CRLA 2G67A 4JLNA 1Z3IX 3FUWA 4J0HA 4TKZA 1WWKA 1KQFA 1B8OA 1DRVA 2P3SA 2EZUA 1E2EA 1OCEA 1N5RA 4BTVA 4IG4A 4Q18A 5IM5A 1VJ0A 1RYNA 4UCFA 4KX3A 5FI1B 1JV2B 3IP3A 4GX1A 5JXJA 1U2GA 1WCIB 2JKYA 2Y05A 1UZAA 2PUBA 4KPEC 4UDNA 4S04A 1YJXA 2HA6A 5DULA 3RVPA 3ZCXA 4OM8A 4U63A 1NIPA 5HZGA 4L57A 2P4EA 2OZKA 1H4SA 4BX9A 1PL7A 1GKKA 1M8KA 5IK2D 4CL0A 1S89A 1BRMA 2Q3JA 2PYIA 2XRFA 2O7NA 3IKLA 5BV8A 4WMLA 3B9QA 3T12A 5JS6A 3UMYA 1HOXA 1YRBA 2FMXA 3BFXA 5JR3A 1PAUA 1K27A 1EQ2A 1M9NA 1ZONA 3HO1A 5E1BA 2RGEA 4EK9A 3BHIA 4KH1A 2REBA 3BSWA 1UM8A 5C0OE 3WKDA 2JJ1D 3PF8A 1G20A 2C77A 3ORHA 3B8HA 4MUNA 4NZPA 2Y6UA 2QPAA 2MMGA 4KO2S 3OPYB 3MOSA 3W1VA 2A0FA 1UPBA 4Y1RA 4F46A 1UL1X 1WPGA 2D62A 5JY6A 5DTJA 1GSAA 2J30A 4UM9B 1JHVA 1QQTA 3C3XA 1E2NA 1OYYA 1QFJA 3ET5A 3QEOA 1J9GA 3OIGA 3QWAA 3L92A 1LFDB 1Q16A 1R6UA 1AK2A 1ZRNA 2M2IA 1P7VA 3DBLB 4JODA 4P31A 5JQGB 3L93A 4FWTA 2HU5A 3HGQA 5TS2A 2CUZA 2QGNA 5D7BA 5BVGB 3FPAA 1NP3A 1AO0A 4LVCA 1YQUA 1D4ZA 1GXSA 2QM3A 2AHRA 4KYVA 1MA0A 2Z9DA 3WG9A 3WKEA 3EIQA 2V0NA 4IV5A 4RF2A 4CI9A 1E6KA 1Y8QA 1DG1G 5HDQA 2ZB3A 3M0EA 2W58A 2IYSA 4IF4A 5TVGA 4RXMA 4EEXA 1T29A 4EPTA 3IP1A 1PJQA 1TYZA 4U2DA 4M1YA 4Q4HA 1CR4A 4F2HA 4AY2A 1N92A 3LQ2A 1GTJ1 1YC5A 1OYOA 2YBEA 2YHSA 1OFHA 1TQ8A 3EAFA 1XCOA 3GUYA 2Z6UA 4K1XA 4A5OA 4A73A 4O3MA 1H6DA 5CBPA 3PC8C 2BBTA 4TV9B 1TQ6A 2G1KA 3HI6A 3CSDA 2QG6A 3MMSA 1P0FA 3CGWA 3HGTA 4RPLA 1N6NA 5KAMA 2Y77A 3INNA 3UKOA 5AFSA 5BY2A 3TFOA 5IAOA 2Z6AA 2QAGA 1TAHA 1EVZA 3DHYA 3F90A 1ZXBA 4RORA 4G0OA 4MNTA 3PICA 4TLMB 4XD7A 2QTLA 1Q84A 1DBPA 3LXRA 4YAFA 3OVMA 4DC9A 5A1TA 4GHWA 2C95A 1P91A 2ACKA 5F78A 3HUTA 2NAFA 1BJTA 2QAIA 4WJLA 4TVKA 3UW3A 1JILA 4OXNA 3STYA 2NU8A 2BR3A 3DCYA 3SHTA 4BKQA 1BW9B 1D2EA 1EE9A 2D5CA 1E0AA 1U0FA 2HPZA 4AJOA 1SVIA 4WXHA 3JSXA 3EMBA 3NOOA 4F45A 3NANA 3SSAA 2H2GA 4J16A 3ZZTA 4CZ2A 3Q2KA 4HQKA 1UMDA 3LK6A 4MKFA 4E70A 4BVKA 2XUFA 5FWYB 4O8ZA 3ZQJA 1FNCA 5AUOB 1VBKA 1E79D 1V1MA 3PR2B 2IHKA 4A0QA 4N8SA 3T1YB 4DRXA 2WWVD 4QC2A 4QEKA 3TUZC 3OCVA 4XCVA 1I2BA 3H65A 3JYPA 3IT1A 3Q5EA 3E5MA 4WCFC 1OH5A 4LDQA 2UUPA 2J87A 1QIHA 3TL6A 1FW6A 2XLCA 2P68A 1VE5A 2GYYA 3EGDB 3EBPA 3AL3A 4ND8B 5B58T 4KXNA 4DCPA 1NX9A 4YMTA 5J4VA 2R00C 5HF5A 2Y67A 3GMIA 4CHTA 4A6DA 5ARBA 4RADA 2Y76A 3OLXA 2YIMA 5HTOA 1M6VB 3Q9NA 3RS9A 1QV7A 3FLBA 3PRYA 4KLAA 4XVRA 4LSMA 5AM3A 1B8UA 4WXPA 5K8UA 1KKUA 4RANA 1JPUA 4Q5IA 1CEYA 2Y8EA 3JALA 1ZMBA 5IK2A 3E9QA 3IMCA 1NBME 2HGSA 4FDAA 5BNFA 1OXMA 5DMXA 1ILEA 5AH0A 3HMKA 1X7XA 2J3QA 4HQ6A 1DDGA 4RDHA 3T3OA 2H08A 4HR7A 3QJYA 1J99A 5HIJA 4AJPA 4AVYA 1JZSA 2V98A 3FMFA 4HF7A 4PC6A 3S2IA 5KJ1A 4OATA 4ZEWA 4IILA 1LW7A 2Z2YA 2NTVA 3RVSA 4DADA 3KT6A 3MWGA 1ZVVA 2XMBA 4LJ6A 1TF2A 5ICFA 3SC4A 4YRFA 4BMCA 3T1VA 4TT8A 1RXCA 1XSEA 3CX3A 3FCSB 3MJVA 1WXWA 4B2IA 1W5AA 4FYIA 3F0TA 4KU4A 1XHFA 3IQWA 5L4LA 4BY9E 3V3TA 2EWWA 2R6AA 1XKTA 3AY6A 3FAZA 4P81A 2H1RA 2B92A 5T41A 2CYCA 5AW7A 1NDQA 2MJLA 3LLSA 3IJPA 4CLOA 2BHSA 5KEIA 2BKXA 3D3WB 3UC5A 3ASVA 3OJEA 3HB0A 1N9GB 3BE5A 3IIEA 3JASB 4JJKA 3HVJA 3QPDA 3SD7A 4CKEA 3ZLJA 1ZGAA 1XLWA 3DEFA 4UOEA 3KBOA 5DW3A 2C8JA 2H16A 1H2HA 3IPLA 1OV4A 3STHA 4NAHA 2XZLA 4QFMA 3AG5A 2DGDA 2O5VA 3ABZA 3E2PA 4URFA 3SBXA 3WJ2A 4F1KA 3QBEA 4XTRA 4F5YA 2C3YA 2KE5A 3LHDA 1G2IA 4LRXA 4MV1A 3K16A 4PPYA 2B98A 5D51S 2Q7XA 1IK6A 3HKDA 2RI6A 2O1WA 3HKBA 3DE3X 1MIOB 4DV1B 2XD4A 2D1YA 1GU0A 4NHEA 5KOJA 2VA8A 4HK4A 1VJ1A 2QL7A 4D02A 4W5QA 4J6FA 1YZYA 1M0WA 1SG9A 4DLPA 2FF7A 4NYJR 5I3ZA 1I0LA 1CQXA 1P7ZA 4EI8A 1I2ZA 4YQEA 2OMKA 1THTA 1RBQA 2G1JA 3VDMA 4JI2B 2M1ZA 1T8WA 2ZPUA 2WWYA 1R15A 4N48A 4X20A 4M0LA 3ODGA 1JAIA 1Q0ZA 4HXGA 2W2MA 3BWXA 5KNLA 4QYXA 4PYMA 1EG2A 3G79A 1ML3A 3ML1A 1XVLA 4PRKA 3T0GA 3QLTA 4TQUS 1P1RA 1WZNA 2RB5A 4GPBA 4N18A 4Z0NA 4E2ZA 4L5YA 1BMQA 3RVBA 4CMAA 4UUMA 2P3LA 1P18A 2WAXA 1Z12A 3BDVA 4N3NA 2HGZA 1C8KA 1CIVA 3ZU3A 1GSHA 1ZJ4A 3L1HA 1J1ZA 4CTKA 3MS7A 4N76A 3WYAA 3MJHA 5EZYB 3R7SA 3I42A 1A5BB 1PFGA 3KZXA 4GE3A 2IYWA 2QE7A 2GVDC 2XSZD 3VNUA 4UBKA 4EYEA 4PWYA 2HPAA 3GN1A 4L78A 1ZL0A 1EFTA 4M6WA 4YLGA 5I7RA 3DLCA 3ZWPA 4I50B 5KYXA 4Z7NB 7ADHA 3VR5H 1LS6A 1GTRA 4DAEA 1FF9A 2ZUFA 1ES9A 1BXGA 1C41A 1NJ6A 1XTJA 1F9EA 1M2JA 4RK7A 5AMXA 1TZJA 4BO3A 1K2WA 2PZGA 4DMHA 5ALQA 1QTIA 1U99A 1N0HA 1YA4A 2PL1A 3EGWA 4XYLA 1W73A 4K46A 3M1LA 2PPVA 1QTNA 4PYIA 4GUDA 3V42A 1Z4QA 2C8KA 3KUKA 4LY9A 4ZTZB 1GT6A 1R9GA 3FVQA 3QEMB 4R1PA 5AKZA 1P0QA 3NWBA 4JVNA 2O5EA 1NKTA 1QBKC 3AG6A 3R9IA 4CBVA 1SQSA 3B5JA 4FINA 2XECA 3E2IA 4QUGA 4BNIA 4MS1A 1VIDA 1VHLA 4RSGA 2E6UX 5L95A 3DQPA 1GADO 4KRGA 4M1TA 5F3RA 4OAOA 4RPKA 3EZNA 4KK3A 3WKBA 3GNLA 1GAEO 4L0MA 5DKFA 4X6YA 1QAMA 2WHXA 2Q27A 4NIMA 3HCCA 5EKTA 3RTDA 2R4TA 1QANA 4HX9A 3RYTC 4JDPA 3SYMA 5KQSA 1M2WA 1MGPA 2QN3A 1Z17A 4MUBA 5DHAA 1VGRA 3V2GA 3VPGA 4YXWD 1P2FA 2CHFA 2O0MA 1SUBA 3F6BX 3T95A 1MABB 5AYVA 1TOAA 1WHSB 4WZBE 2ZRLA 3ISVA 3UJAA 1OUMA 2JLBA 4D8XA 4KE8A 3EFEA 3EF0A 2HHJA 1JFVA 2BFFA 2W4MA 3F2IA 3K1JA 4K9NA 3CUSA 4U2CA 4XIGS 3WZ2A 3MRTA 4EW6A 2Q1XA 2QZZA 3FTPA 1JKMA 2F3UA 5DE3A 1BN6A 1J8QA 1EVEA 3A7EA 1WXFA 2PIAA 2N3ZA 4N6NA 4RHTA 4QBHA 1DBIA 2A57A 4PSDA 1Y63A 3K9LA 3QVVA 4RKWA 5K1ZA 2NU9B 2QD3A 3VBCA 4ZZ1A 1OYWA 1RDFA 1YI0A 2JIZD 4MI1A 3BCHA 3NTXA 1OILA 5AVVA 1CQIA 5EIXA 6CHYA 4FHCA 2D3WA 2P90A 2C2MA 5TVKA 2CN1A 3KVOA 4O4HF 1U1EA 1PX2A 3OOHA 2HLDD 3IJ5A 4EM6A 4INAA 1F2TB 1L7QA 2GTPA 2XCOA 4LAFA 5MFPA 3JRWA 2R11A 1USWA 4RAQA 1FRVA 3MTJA 2B3TA 2IUEA 1I3NA 3M49A 1PEAA 3NM5A 1ZKDA 4BJHB 3D0QA 1JEYB 4H0NA 1SQGA 4DHEA 1BVHA 4DA8A 1L5QA 3A1UA 3MPUA 4KCGA 4DPLA 2O5CA 4FI3F 3I62A 1E3WB 1RW4A 2PO5A 4FGLA 5EJ4A 3GRRA 1ZD5A 5CA1F 4M3NA 1JBKA 4P5EA 4A2CA 4CT0A 1E1QD 5B37A 4V0ME 2H9AA 4MV0A 5FUMA 1C29B 1SU7A 4UUPA 4NECA 1C3OB 1OU0A 2GCEA 3A2LA 4WKGA 4D3XA 4HV4A 2Z57A 3CZMA 3LC2O 3PCXA 5YASA 1TRHA 2D0DA 2HQBA 1MX9A 3F5SA 4HBZA 2V58A 2VYND 3QXGA 1YA6A 5HHTA 4G0WA 4KUGA 4RV9A 3WLOA 5ANRB 2YV1A 2VF5X 4A2PA 5NLLA 4X66B 4KRFA 2NO1A 1PZFA 2XKBA 2YHUA 2YWGA 3S2EA 3YASA 1H93A 3ELBA 3OLWA 4C5CA 1S3FA 1MO4A 3B5EA 1OZGA 4LHSA 4S1NA 5TR9A 3KKEA 4AZ0B 4LJ7A 5JV5A 2XCSB 1X14A 3KKZA 3X43A 3IP9A 4PX3A 1L7RA 2J9YB 1T0PA 1FY2A 5CA1A 2HW8A 1XYVA 2X2PA 4QQKA 1DC7A 2FI1A 2ERXA 2HTEA 4YCAA 3U2QA 3I3SR 1X9HA 3C74A 2CXHA 3N05A 4US2R 3BIXA 1ZUWA 3DWFA 4KSYA 5GOTA 3RRNA 2XSZA 4C6TA 1KRWA 2ZYRA 3SXPA 2FZLA 1PBTA 4CLRB 4RFLA 1DCTA 3UJ7A 1NRIA 5I8ZA 2WSSA 1NRXA 1NOJA 1H05A 3FDIA 2FGJA 3LSTA 2IZZA 2E0IA 3E05A 3SC3A 2PKCA 5K51A 3DBVO 1J25A 1WPXA 2FDXA 3QUSA 6GPBA 2PWZA 4X91A 3I4FA 1ODCA 3OFKA 3AEYA 3N7AA 2R8XA 4M7PA 3TPZA 4WNCA 5FLKA 3S1AB 4FNGA 3M34A 3G2LA 2ZIGA 4JBHA 5K01A 1XX6A 2DPLA 3V1NA 2C5AA 5LWQA 2CZQA 5KVVA 3UKJA 4IQGA 1WB5A 1WB9A 3M82A 3UB2A 3WLKX 3IXQA 4CKYA 4DLUA 3VKWA 2CY0A 3MWKA 5FIUA 5DISB 5I7EA 2GTHA 2HBQA 5D7NA 5EA2A 2H18A 3T7KA 3K6JA 3NIFB 4UVDA 5G0VA 4M8LA 1LLUA 4B35A 3FBWA 5K0CA 5LD2B 3GDHA 4KSBA 3ZDRA 3ADKA 1KKMA 2AT1A 3H8WA 2P1ZA 1ZHHA 4HGQA 4FBMA 2ZTVA 4IFBA 1R0KA 3AF1A 4ZAXA 2R1VB 2BFDB 4D41A 1NONA 2PLWA 2PMWB 1TYCA 5AK3A 1RM3A 3EWAA 3IE2A 2R87A 3OWOA 3OZ7A 5K2MA 3VR4D 4EF5A 5AOBA 1MVOA 2CLCX 4E6PA 3ICEA 1XU4A 2XOKD 3N8IA 4YXWA 5L3VA 2YX1A 3D3NA 5LIPA 1RTTA 3DWIA 2BP7A 3DSRA 1KK2A 3OCCA 1N1GA 4HWGA 4RLSA 3OCZA 3X1XA 4L75A 4I5IA 4IP0A 4ZVSA 5J1SB 2ID7A 16PKA 1XHEA 1JTVA 3DMFA 4HDNA 1GGFA 1YAHA 2H2HA 2QG4A 3BXXA 3E18A 3OFJA 4B4KA 4JUAA 4X7PA 2D1RA 3MJTA 5KQPA 2GBCA 4FC7A 4NG4A 2EHDA 1P4GA 3UB4A 2YHIA 5C37A 1NDUA 5FOUA 3TG2A 4YALA 4AG3A 1IXZA 5HM8A 5AKIA 2VJDA 3PC8A 1YT5A 4NHOA 1OLOA 1RM4A 1GQSA 1X86B 2JIZA 2GH1A 2XBLA 1S7CA 1DG3A 3PJEA 1MT3A 1PNVA 5MN5A 1P39A 3EYWA 5A6SB 5GADl 1V5EA 2ZK7A 2O3RA 5LKAA 2ZJBA 3PFGA 4REMA 1YZNA 2HLDA 3WR5A 2DUJA 3B70A 3M4ZA 2O2IA 1BAPA 5T5QA 1W5EA 3BXEA 4M60A 1LU9A 4XB6B 4NYJQ 3RFCA 4FGJA 2PV7A 1GPMA 4JX9A 4RLQA 2R6JA 3LBNA 1D2CA 1FS5A 2FFHA 3EMDA 2E1RA 4UARA 1NQTA 3IOCA 4KEAA 1L8AA 1ESMA 4I1SA 3WK8A 1JA9A 1W35A 2ENUA 3PHBE 3E0QA 3V1TC 2WNHA 1UXOA 5IMBA 2ZYDA 3WP0A 1BCSA 1B0PA 4ZOQI 1QOQB 4TQAA 3AZQA 2H85A 2C3PA 2GDJA 1E1QA 1HGXA 1U3VA 2NZWA 4MW2A 2AK3A 4FJ0A 1QGDA 4FLMA 5K0LA 3AEZA 2NAPA 5REQA 1NYTA 3KPUA 1IJFA 4FP9A 4JJGA 3ZCVA 1SA0A 5MN6A 1P3JA 3OKAA 1TCBA 3ZU6A 1MN6A 5DGHA 3OCJA 5C3MA 2HZBA 2ZAIA 1KS2A 1HFKA 2G9UA 3I6IA 5EP4A 4FFWA 4W99A 4E5NA 3TEJA 4DLSA 1X1TA 4PM4A 3SYKA 2OSBA 2DQYA 2PFSA 2W2QA 3BKXA 3NH9A 4J0GA 2J3MA 5FUVA 4DWWA 2M6LA 3Q85A 1W5TA 3MIZA 1VKOA 1RBMA 2EFYA 3K0CC 3IVGA 4ZD6A 2C7OA 1XNRB 2ZSUA 1SKYE 1ZU5A 2VF8A 2A0YA 3V7YA 1ULAA 1FBNA 4HEQA 1A9XA 3QFTA 1UT8A 2R00A 2ZOSA 4LZNA 4LZJA 3E1KA 4JLWA 1RADA 4GKBA 1U9JA 2JH3A 1OPRA 1OFUA 2YJ4A 2ZKLA 4FKBA 4MLCA 1RRCA 4O2AB 3UJ8A 1XT6A 1G21E 2BEUA 1T34A 5KREA 4XWGA 3P2JA 1Y6FA 3KVRA 1OBCA 2YJGA 3QFRA 3AB8A 4YMLA 1GNVA 1H3NA 1LNZA 1ZI8A 3MB8A 2VT3A 4PRLA 1J6UA 1HV8A 2IDKA 4X44A 4JLJA 1KORA 1G9SA 1N2IA 3WGKA 1RYFA 4A6XA 3H04A 4LOLA 2ONKA 3ADBA 3Q5DA 1UXJA 2ZBFA 2CJPA 1NYLA 4PCLA 2H51A 2VP3A 4L4SA 4KOAA 2P6UA 3DW1X 1AGRA 3PXDA 1WMSA 4FKZA 5C32A 5CT6A 5CCDA 5EVCA 3FTEA 1EJBA 1UKZA 4ZAFA 1IAQA 3LUAA 4P3PA 5A1JA 1OU4A 4RQTA 4DQUA 3H9JA 2GN2A 2Q2NA 3HLKA 1NVAA 1NHGA 2C2XA 4WNIA 4YJDA 3FPFA 4AUNA 5FOWA 4KR7A 1EK0A 5IVDA 7YASA 2W37A 3QE9Y 3NJ8A 1PLLA 1CQJB 1X92A 3D3EA 2G71A 3WMWA 5JMWA 4BMZA 1E3JA 2J3HA 1E5QA 2XZPA 5TDHA 5JNLA 4L3OA 4D4JA 5KOYA 2N75A 3KU1A 4XYBA 4C22A 1NFQA 2FQXA 3V7WA 1JQDA 4WOBA 2YXLA 1WEKA 3EIOA 3H9UA 1I2DA 2FWRA 5HEKA 4RD4A 2ZJ0A 4YRPA 1MKYA 1VYVA 2LV8A 2XOKA 3UM9A 1ZL2A 3HYLA 1Y82A 5F5NA 4J91A 4BB0A 4KZPA 1BE1A 2ZBEA 1QCYA 4O63O 2FN3A 2I8LA 4U3JA 1B6GA 3QZUA 1IU9A 1X8LA 1L1FA 1EBBA 3HSKA 4M1SA 4O1MA 5EUBA 1V16B 5BT8A 5C46F 2J1LA 2I2CA 3Q7RA 5M5BA 1II0A 3A4TA 2HTFA 4A8JA 1TGVA 1QGZA 1LS1A 4G4JA 2H59A 3OP1A 2ZITA 1JDZA 4CIYA 1U0OC 4Y9DA 3T9AA 2WIFA 4Z1MD 3PLNA 4KITB 3I5YA 3FNHA 2I1LA 3ANYB 1S2GA 3DMGA 2ZSBA 3LBIA 4ZOLF 1SHLA 5CIWA 1VGVA 1Q12A 4LYYA 3NHRA 2QTGA 4OJNA 4WDQA 3D6TB 4ND1A 4Y18A 3GNSA 4B7UA 3C4QA 3ZEIA 2VHCA 1V2GA 4UBMA 3F7MA 5D5QA 4YY3B 1GDHA 1K08A 1Y1QA 3DKPA 3HBMA 3HNRA 2X8LA 5KTTA 2BGJA 1UKYA 4S0XA 1CY4A 4CODB 1K7FB 2BHTA 1NAHA 1UKVY 4YBZA 4BLSA 2DH6A 3LYUA 2ZREA 4U2FA 1RVDA 1WSBA 4B7XA 1W30A 3KOXA 1VB5A 3SKXA 2ZE6A 4OFWA 4PYKA 1PSZA 2H9YA 1T0HB 2FQWA 3NYIA 3O9MA 2P2YA 2VP2A 1RJ9B 4ZOLA 4JT2A 1YUBA 1HYBA 4MDFA 3OOEA 3TPCA 5BWCA 4Y6QA 1YS2X 5EN4A 5C5EA 1TT7A 1Y6ZA 5EMMA 5IJ9A 2H2FA 2JIDA 4Q6WA 4GSKA 2PLRA 3ZXSA 2G77B 1LPNA 2ZSEA 3DTVD 1VDMA 5CFQA 3AVPA 5B30A 1CJSA 5LLTA 3WGOA 2X3UA 2Q0HA 3PYMA 3TGPA 3QX8A 3DE4X 4U1RA 3STWA 3ZUGA 1M34B 5JVDF 3KU4A 5HCNA 5DX0A 4YH1A 5LDGA 3U61B 2HMYB 3N3AC 2AI3A 3KKKA 4X3CA 4X8MA 1P6UA 4W63A 1OXVA 1LBTA 3CUVA 4BKRA 3ZNOA 5GINE 3SS9X 3FH0A 3T54A 3BICA 1J0CA 4ENVA 2H1WA 1G21B 2PBLA 5G1OA 4R1TA 3E5RA 4QBTA 5EMLA 1QQ7A 4AD8A 1OH7A 2DHDA 2X7XA 2FJ0A 1T1EA 2EJUA 3RYCB 2BC9A 3I9NA 4ZI7F 2V7VA 2Y0CA 3ZVRA 4X94A 1SJ9A 3QWBA 5AJHA 2PIDA 1XB2A 1ZK2A 4LXUA 5IM4A 1GLGA 5AJWA 2D0OB 4EA8A 1W8IA 4Y67A 2EP7A 3RJ5A 3I1FA 3WGIA 5DIZA 1AE1A 1KIFA 2OA0A 2D3TA 4M8NE 3C5HA 4QRHA 1DTWA 1X7YB 5K09A 2Z2KA 3SMVA 3DKRA 2RKWA 2VLIA 2FFRA 3NORA 4ZQBA 3IVRA 1UBFA 2VT6A 1VA5A 1BFDA 3DE7X 3IKJA 3O1JC 2X6QA 3VO1A 2IU4A 1CHNA 1JIVA 3IMFA 4MJLA 4MW4A 2RBEA 4EY7A 1X42A 3CH7A 2ZRIA 3HGMA 1OC2A 2EFJA 1YNOA 3LGAA 4Q9DA 4RLFA 3TLGA 4B40A 4F4HA 1KZ7B 1CNFA 2R6DA 1DQZA 2RE8A 2GT1A 3EFOA 2HLNA 1E5TA 1RXVA 1ORVA 1TXGA 4D96A 1ZWLA 4D43A 1E94E 4PBSA 5CJ2A 2P11A 1FP4B 4OLJA 4P86A 4YTEA 4PLTA 1KI4A 4FILA 4BO0A 2G08A 4IR7A 1SCKA 4BQFA 4WKCA 2PO7A 3AI1A 2YN4A 3ZHOA 2J5XA 4RK4A 3BHNA 3OIUA 4MQEB 1V4BA 2BHNA 1USUA 1PT8A 1XWWA 2NPIA 2QRGA 2JD2A 3KTAA 1YB6A 2H52A 4J0DA 4P4TA 1JLSA 2APJA 4CQJA 2I7DA 5FB3A 3GCDA 3RPEA 3EDRA 4QOEA 2CXTA 1CF9A 1ILWA 2PT9A 1ISSA 1GGVA 1QO0A 1SD2A 2HU7A 2R751 4JC0A 4P3OA 4QYIA 2QXUA 1IHOA 1CUAA 1X1CA 2XCUA 1MQ9A 2XUDA 2ZBVA 3HDVA 2CNKA 5IC6A 4MKRA 2Y4OA 4CL2A 1U0BB 5FTJA 5CXXA 1APBA 1P4SA 2D13A 2P1RA 3H5NA 3UGJA 5E4TA 4Q01A 4F4IA 4Z54A 3A58B 2KMLA 4WI1A 2P5SA 5DMHA 5CJJA 4GSYA 1PYGA 421PA 3WYCA 3QOYA 5I9TA 2CLIB 4UREA 1KR5A 2OG1A 3DGFC 3C98A 1N6LA 2VZ9A 1UKAA 2QUBA 4MP6A 3ROXA 4QVIA 1NMEA 2FEXA 1EDBA 4PN7A 1MJHA 2V96A 1VZ2A 4GI5A 2HN9A 3HHEA 3AJDA 2C31A 5CH5A 5CURA 5LLSA 1DVRA 4HAWA 1L4FA 3BA1A 2UYOA 1N7JA 4FMDB 2FZCA 3IJEB 2V6IA 1M0SA 5TMPA 2QPOA 4NWIA 2XQGA 1B15A 2Z8YM 4Q19A 3FI9A 3WDLA 2NP7A 3RFTA 2HY7A 5AOVA 3UH1A 2OORA 4JNCA 1TZ2A 5IN5A 3ZGVA 4KNYA 4YMUA 4H7FA 1IJBA 1N1MA 3TOZA 3SY8A 3KWMA 3TZEA 2P27A 4X24A 4CQMB 1FXUA 1PJTA 1PRYA 3T34A 1VJRA 1WU7A 3W6NA 1SCIA 4E88A 2BMEA 2UZ0A 4WE3A 2CGEA 4UPDA 1DDOA 3V1LA 2NACA 2FW6A 3NGLA 2DSNA 3HN6A 1FIUA 2P4SA 1HFEL 2OWEA 1QF6A 3MBOA 4D81A 2QM8A 3DBRB 4FHGA 1M2OA 3TH5A 5MDHA 3AEKB 3VFDA 3CS3A 1ZK1A 1EQUA 3A6FA 4QTUB 3FR7A 4MXDA 3WMRA 3QA3E 3OPMA 1KMHA 3ND6A 2VCHA 3FSEA 3GLFA 4YFYA 3GLHE 2IW1A 3GGSA 2MYUA 5FT9A 3SE0A 1NMQA 4LPSA 1JIKA 3MLAA 5FA6A 2POQX 4AI6A 4DV0B 2LGJA 2P69A 4NCKA 3KQUA 3RHSA 2OTCA 3HCEA 2QNRA 2ICAA 4RVGA 1YIOA 2QZSA 4GPAA 4J7AA 1QX4A 1BCRA 5JJKA 1DEAA 1B4DA 5EY5B 5GWXA 1MJFA 1O08A 2O0JA 3KLOA 3HJHA 4QAQA 3TRFA 3HVIA 2EZTA 1S2DA 2VWGA 3K6SB 2BBOA 1QBGA 4PYNA 4DLAA 1K92A 2PD3A 3IQIX 3AESA 3C3CA 4ABYA 1YS7A 4U9UA 2E87A 2PT7A 4PZ0A 3MEQA 3H2KA 3PGMA 4Y3UA 3NMUF 3T5PA 1GQRA 2B1IA 4YREA 4HNTA 1RZRA 2P6PA 3RVOA 1V4NA 2WUFA 2GN1A 4RF3A 5A6VA 2IIQA 3WXBA 1ZVJA 2XCLA 3QVJA 5C1DA 5TEVA 3MCAA 2E21A 3VTAA 1MB3A 3WWEA 4CM5A 2Y93A 3AF0A 1XLTC 2BCGY 3EUFA 4A0FA 4UE3S 4TZ6A 5IDYA 3V4LA 4WGGA 4Z9YA 4Q4AA 4XH9B 2IXFA 2RSLA 3AF2A 3IE0A 4HDMA 4BECA 2GFQA 4CDMA 5L3QA 4H6XA 2Q4TA 3NC0C 3CX7A 5U4QA 2IEGA 7GPBA 1DT5A 3TAXA 2FEWB 2YJNA 3QHAA 4U2EA 1KDRA 1QK5A 3G88A 3GAFA 4URHA 2JHPA 4OIMA 3RARA 5BQ5A 3PFKA 1JLKA 4WVLA 2GASA 3R0ZA 1CEXA 5T6MA 1XVUA 1PCXA 2EW8A 5HCUA 4S24A 4DDWA 1LV8A 1DKQA 4JR1A 2QP4A 5E6RB 3THYB 2D00A 4R40A 4GLBA 3ERCA 4ZHQF 3DVAA 1NN3A 4WLNA 1BQ3A 2QS9A 3LRPA 2WQ6A 2QY6A 4CFYA 4EQ6A 3X0DA 4IWNA 2HF7A 3HV0A 3C1OA 2YQ4A 3C8HA 1DIRA 2AC4A 4N0DA 4D8VA 3O38A 5JXHA 5LJLA 4GS5A 2PUEA 1QE5A 4C9BA 5E4JA 2QMOA 4PZYA 3STTA 1L5RA 1PZEA 4F3YA 2RAUA 3T7AA 5E2IA 1OFUX 2VHUA 4X71A 1MR3F 3AR7A 1CETA 3LDFA 3M83A 3MRXA 3L0YA 1HDXA 3GEIA 3WP1B 3LJKA 3P9SA 2X9VA 4BNHA 1TPZA 3LOQA 2ATCA 1SKAA 3FPHA 5TT0A 3S7TA 1YJBA 3AB3A 1KMMA 4IWYA 3KTDA 1MAHA 4KBYA 2XUOA 2JZCA 3ASYA 2YXNA 3PQ3A 3QVOA 5EINA 3VH3A 4ZHQA 3ZDCA 2JLYA 1CUYA 1G5PA 1I4TD 2ON6A 3K0CA 3NEYA 3PDUA 3HXOA 1RHMA 1VQ1A 5H4GA 2X19A 3RU7A 5FHQA 2CDNA 3A1CA 3ORFA 5KVCA 3F6YA 4Y1GA 3UGKA 3DZIA 4A8HA 3K9FC 3SAJA 3V8QA 3FWNA 4AKHA 4E5SA 4M9QA 4AJ4A 4FDUA 2E89A 1V6AA 1SXJB 4NG5A 3ZWQA 2D5AA 3CWQA 1Q11A 4TYNA 4OHRA 5BUCA 4OHCA 3E3MA 3CR3C 3L1KA 1QIGA 2XVXA 4LXYA 3O82A 4AC9A 3D59A 4ZIRA 5BORA 4MKXA 2OESA 5KCMA 2C7BA 2REQA 2XZTA 3OFVA 1TYDE 4MS3A 3WQHA 1K68A 5IMSA 1UKCA 2A3NA 4G9BA 1PO7A 4YAJA 1RCFA 4QTZA 4HVCA 2QQEA 2P4HX 1V6CA 3GLHB 3ER9A 2YR0A 4JP1A 3C5VA 1JU9A 4K03A 4GOND 5EWJA 3H87A 1RMYA 4YP7A 1W85A 5DV9A 2IBMA 1KC3A 1Q0QA 2WHRA 3GZ4A 3PUIA 4G1EB 2JFQA 2C88A 2VRWA 1W75A 4HRAA 3HFRA 3GRPA 1G8MA 2VSFA 4LNUA 3WSWA 4PZ9A 1A5TA 2ZSAA 1SHTX 2IEBA 3N8NA 5AW8A 3HKEB 1GCGA 3DPUA 1QFMA 4EHHA 4MAMA 3LNTA 4GYWA 3ZCUA 4DNQA 2JCSA 3U4CA 3K20A 2DG2A 3MNFA 1L5GB 1VBFA 2IHNA 1BOFA 2OM2A 2PEYA 3O93A 4AURA 1XNGA 3EVEA 2O2YA 3C1TA 3IAM6 3Q6NA 2NYUA 2VNAA 4IH9A 1NY6A 1GM5A 2H65A 5JCZA 2AKEA 4LW8A 2JI9A 4YJKA 1BROA 1YMQA 3IIJA 1KOLA 2OE2A 2NP6A 1A96A 4BLQA 4OGLA 2IZ5A 4Y9SA 2B6HA 4D3DA 3VA7A 1K3FA 4FGZA 4KXVA 4LFBB 1R4MA 2FPPA 1T24A 3GOQA 5FADA 6AT1A 5EJAA 1Q22A 3MWFA 4ZQIA 3H9QA 5CB6A 4EW2A 4CMJA 2ZXUA 4NC9A 2R6HA 4GU5A 4ZP1A 1CY7A 2ALJA 2GXUA 5EXPA 3OFNA 4OHMA 3LX5A 2BGLA 4IDNA 1MQ8B 3U4GA 3LG2A 1MZPA 3AR6A 5BSTA 4E33A 3F3MA 4JT4A 1I14A 2XQKA 3ZCTA 3H1FA 4F3KA 5FEUA 3FCOA 2FSGA 3VU3A 2ZSFA 2DCMA 1LSUA 8AT1A 3RWMB 4KXFB 2NU6B 2GZAA 1X1AA 4LJRA 2FMUA 4FQ8A 1RP7A 4O0LA 4B79A 1DB3A 4KVZA 2WG2A 1YHYA 2D1QA 3GG9A 1CZUA 3AP2A 2A4KA 3QX9A 4ZVVA 1YBAA 2FG6C 3B36A 4L4UA 4AJHA 5I3CA 1CJMA 2LCQA 1FQOA 1JWBB 2VUSA 1C7ZA 221PA 2SCUB 3GJXC 3H05A 3JVDA 2GPSA 5JCPA 1WMDA 4QOGA 3JY6A 1IHXA 4YJGA 5TRTA 4A15A 1OWPA 3WB9A 2J7KA 1TJYA 3EQ7A 4B3SB 5UKDA 1E9EA 2KB0A 2Y1CA 1RM0A 2FRDC 2XE7A 5AW9A 4CUJA 3RRZA 3OM0A 3JQRA 1ZN2A 4ZCIA 4AT1A 4BBPA 1DKLA 1R4NA 1JE1A 1ADYA 4OXRA 5SY4A 4ZRMA 4EUEA 1BMDA 2AXNA 2XNHA 2W11A 1V11B 3H5LA 3QBVA 2PX0A 1QX3A 4FDMA 1FNBA 4JU9A 2YMLA 4IXTA 1H2FA 4FCWA 4HRYA 4QUIA 1QH0A 1XKLA 5DB4A 1FQJA 4RY0A 2CLKB 3NATA 4KMMA 5KYNA 1FFSA 1R6AA 5ALIA 2V1UA 2ZCJA 4MKGA 2P2DA 4X6XA 2YWRA 5C34B 2WZBA 2JBAB 3QITA 1ZRMA 3ZOZA 3R9XB 3QU5A 5ESRA 1CUVA 1NRJB 3UJCA 1CLEA 2VWHA 2NZJA 4F3CA 1AY0A 1ID8A 4UPVA 3P97A 2QTHA 1OFVA 3AUTA 2J4DA 3NDIA 1AN9A 4UAVA 3L46A 3MLEA 1UBGA 4BJ6A 3MA0A 3UMCA 4F56A 1ETUA 3T5BA 3ZXYA 5DM60 4JYAB 4RABA 4NCHA 2A86A 4LISA 1Z0FA 5EWMB 1SELA 4HFMA 5LMZA 2GEFA 1UBJS 1KARA 1M72A 3AHFA 2O4UX 4GM4A 2BI8A 1A4UA 3K30A 3O8OA 4NDZA 1RYMA 1EUQA 3QV2A 4DTIA 2H9IA 3FLMA 1S8NA 2X2EA 4OMUA 3ZCPA 2O59A 1HFJA 4JI3B 3UATA 1DL5A 4RZUA 1N2CE 2QRVB 1N57A 4Y0VA 5DPMA 4BUJA 5KMGA 1E96A 5F7ZA 2VUIB 3EF1A 4G1UC 4ZQEA 2NVUB 1RWNA 1G7TA 2VHQA 1V96A 1X7HA 4RO0A 3SKYA 4AG5A 1P5FA 1XRLA 3D4NA 2VHVA 2IZ6A 1TUIA 4KX5A 4PZEA 1RC1A 4N3BA 1UC4B 5L3ZA 2DQ4A 2VP4A 3NAMA 4G8CA 4WW0A 4CCYB 1GFIA 1Q6YA 4WESB 3C97A 1SQ0A 4FOOA 2LWIA 3H42B 4F84A 4TUYF 1PEYA 2QP3A 2QTMA 3ZNQA 4W1RA 4CF7A 5KDLA 4YXFA 3VU0A 3TRJA 2Q1YA 1PR2A 1ECCA 1Y5RA 5HQ3B 1Q44A 3BGOS 4KV7A 2WUWE 5DI3B 3NOXA 5B4UA 3K70B 1UPTA 4KQ1A 4RH1A 4ZA2A 4AP6A 2UVDA 3MN1A 4W9NC 2ZUWA 1UZMA 3DTYA 2WF8A 4YJ3F 1U7HA 2XMDA 4ZCTA 3QI7A 3U3JA 4I14A 2BEWB 3GLRA 2WUVA 4GLLA 3ZJYA 3CLHA 3EEOA 1GKIA 5GVSA 4IDOA 1IUKA 3SZ3A 1MIHA 2NYAA 1R50A 1STOA 4O2RA 1WZ2A 2WAOA 3AVUA 3TM4A 3NASA 2ECKA 2VS1A 1IPEA 4PX5A