4BASA

Structure of the arl6 bbs3 small gtpase from trypanosoma brucei with bound nucleotide analogue gppnp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
176
structure length
172
Chain Sequence
TKLQVVMCGLDNSGKTTIINQVKPAQHITATVGYNVETFEKGRVAFTVFDMGGAKKFRGLWETYYDNIDAVIFVVDSSDHLRLCVVKSEIQAMLKHEDIRRELPGGGRVPFLFFANKMDAAGAKTAAELVEILDLTTLMGDHPFVIFASNGLKGTGVHEGFSWLQETASRQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-RIBOSYLATION FACTOR, PUTATIVE (SMALL GTPASE, PUTATIVE)
publication title Crystal Structure of the Small Gtpase Arl6/Bbs3 from Trypanosomabrucei.
pubmed doi rcsb
source organism Trypanosoma brucei treu927
molecule tags Hydrolase
total genus 56
structure length 172
sequence length 176
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4basA00
2E87A 1ZM7A 3O8BA 3EARA 2IYSA 1Z07A 4FMDB 4BFYA 1E9AA 3SJCA 4AC9A 1N6NA 4D25A 2YWFA 1HY3A 2P5TB 4JBYA 3ZS9A 3BB3A 1IXZA 2FPKA 2FMXA 2ZSBA 3OHMA 3OFNA 2QTHA 4LHWA 5FL3A 1KO8A 4C0HA 1N5KA 1S0UA 1U2RA 2ZI4A 3BB4A 4BLQA 4B44A 4DLWA 4EFLA 1N6LA 3PCRB 4AK9A 4B43A 4DB2A 2KE5A 4MGYR 1LS6A 1E9BA 3DZ8A 1XTIA 3ND9A 3WBKA 2OUKA 3K53A 4LHYA 3EWAA 1Z47A 2FJUA 3E5HA 5EP1A 2XZPA 3OE7A 1E2LA 1ZIPA 2GRJA 4P33A 3FFBA 3ZYCA 5HR5A 4C9BA 1DAMA 3OAAD 4GSYA 2FWRA 4M21A 2QROA 1RPZA 4YQFA 4AG5A 5JWHA 8OHMA 2IEZA 1W48A 3RLFA 1LFDB 5C4MA 1YQTA 4M9ZA 1IJFA 1SXJA 4KFTA 5FUYA 1LS1A 3VR3A 5L3SA 2WVJA 1IAQA 2KBFA 1VHTA 2WJJA 4POAA 1JXMA 3RRNA 2A5DA 5CK5A 5H68A 1ZW6A 1CR4A 3LW7A 4XWKA 4PC6A 4ZDJA 4LHXA 2ZE8A 1OFTA 2IUSA 2I3BA 3CB4A 2X2FA 3W6OA 5JLJA 3RC8A 4TL8A 2CL6X 1E2GA 1FPMA 3WBJA 2GCOA 1XMIA 2ZRPA 3EZ2A 4I1OA 5DI9A 1EK0A 4M2LA 3WMEA 2GNOA 4LJ5A 3LY5A 2WV9A 4GMXA 1WE2A 3AH8A 5HCNA 4MYUA 4XD7D 4Q4JA 3VFDA 3ASZA 4ZDKA 2ZREA 3IBYA 3L0OA 2WICA 4DDWA 4HZUA 1U9IA 5JJIA 3FFAA 3GFTA 4UXJA 3WMGA 1PLKA 3F3YA 5KUTA 4BPBA 4TQUS 4Z1MA 1S1CA 1P75A 2GJKA 4QBHA 3Q85A 3FOZA 2FE4A 1Z3IX 4HDCA 4AYTA 1P9WA 4JSTA 3RHFA 1IY0A 4D4JA 3SQXA 4A82A 1OPXA 1O3YA 3RWMB 5FPSA 4PC7A 3U6BA 3QVVA 2QTFA 3RSOA 1ZAKA 3D3QA 1DO2A 2D7DA 5EE0A 2NO6A 5LD2B 2RMKA 1JALA 2IWRA 4D4LA 3CNLA 4AKIA 2CVHA 1S3GA 4DZZA 4A2WA 3VQTA 4C0SA 1DG1G 2XITA 2IL1A 4JLBA 4OQXA 4RSGA 1E1QA 1OKKD 3K70B 4Q5IA 5CLQA 1XPOA 1LF0A 3AVPA 2VHUA 1NN5A 2VBCA 1E2EA 4XTCS 2MMGA 4YMTA 3GLGB 3I3SR 3HYTA 4X8MA 2WOOA 2G88A 3BH0A 1C4OA 3K0AB 3E1SA 3VHLB 3VR2A 2XGJA 3MCAA 2EVWX 2OBNA 4HAYA 2IUUA 3TLXA 4JKYA 1NL3A 4BRWA 1NY5A 2ZI7A 3THYB 4URZR 3A1TA 1G4UR 4JLNA 1FOEB 4F38A 4G0NA 2Q0HA 4B76A 2HT1A 1YZGA 1T0HB 2SHKA 4OQMA 3NBXX 5GVRA 2QMHA 4GRAA 3CLVA 4EQ6B 2REBA 4DWJA 1WMSA 2GZDA 5BWMA 2CDNA 3QKTA 4OJQA 5TVKA 1QF9A 2LCFA 3BC1A 2QRZA 1AZSC 1ZCBA 3EZ9A 1COWA 2GVZC 4DSNA 1F2UA 5K8LA 3FKQA 3BWDD 3DDCA 3HR7A 4YXWD 1TF2A 3CUEF 3TUIC 4C0KA 4CGZA 1Q22A 4IKEA 1CXZA 3A36A 2FA9A 2A7QA 3FKSD 2EWVA 4OBEA 4EPYA 1Z2CA 2QSYA 1ZP6A 2JLWA 3V00A 2O8FB 4PXAA 1OFIA 2G6BA 3CX6A 3K0FA 4M1YA 4WIAA 1X8LA 4MDEA 3W5IA 4Q9KA 3QXJA 3TH5A 1XTRA 2JLQA 3L8YA 3T5DA 5KSZA 2QG6A 3T15A 3U3OA 2MSCB 1OHHA 4DUGA 2CK3D 4XWAA 4PPQA 5EXPA 2OXCA 1O87A 2OHFA 2XSZA 2XTZA 3GJ3A 1I4DD 5LDDC 4KBFA 4B73A 1U98A 3M6AA 4RZ2A 4NP6A 1XPUA 3AUYA 4EPVA 4EFNA 1U8AA 4M1KA 4RKEA 3KUDA 1EG7A 1KKLA 3P20A 3WP0A 2GXAA 4P4SB 1N0WA 3BK7A 2XXAA 4DBLC 2NIPA 4ZCLA 3U2QA 4TZ6A 5JEDA 1NSFA 2V9PA 1YZUA 2J5XA 2C04A 3N70A 3PUWA 1P61B 2QNRA 2FF7A 4GMDA 4NDZA 4MKHA 3MD0A 3QF7A 5KHOC 1TEVA 3NDBB 2ZRGA 1GRQA 3TAHA 4IOJA 4OI2A 3W3AA 2GCNA 5CLLA 2CHGA 4RD0A 5TDHA 3IIJA 3Q72A 5EZ5A 1ESNA 2ZUCA 4C0QC 4ZI3A 4CEIA 2WJHA 4B2IA 4BUJA 1DAFA 2W6JD 4DCSA 4W5HA 3AB3A 3SYNA 4BZXA 4LJ8A 4IXMA 3THXA 1VCMA 2QSZA 2VQSA 3LWNA 2DWQA 1I2MA 3B5JA 1XXHA 4NONA 1FP7A 1KZGB 3D6TB 1P3JA 3JVVA 1NIJA 2WZQA 5JZVA 1SHKA 2VF8A 3VAAA 3GLIE 5DYIA 3VMFA 5BN3A 3UWOA 3KTAB 2NZ8A 2QP9X 2AK2A 1J2JA 2QMOA 3Q5EA 3CRW1 5ELXA 2HXYA 1S96A 2GEUA 4R2HA 4GP6A 4DKXA 2ZVQX 3AP1A 4U7DA 4IDQA 4A0GA 1OH7A 5G41A 1M74A 3D8BA 3K9NA 3BS4A 3LQRA 4Z51A 2BM0A 4CF7A 2XZLA 5C1BA 4LJYA 1CJTC 1W0JA 1XTQA 2BBOA 4BEBA 1OW3B 1TMKA 3QPUA 4HUTA 3Q7PA 5LB2A 2F1IA 1VYVA 4G5OA 2OEPA 1A7JA 1B0UA 2ASEA 2YOHA 3AF0A 4MITA 3HPRA 4NKRA 1VCNA 2E9SA 4YDSA 1RKBA 2PH1A 1GG2A 2IYYA 2XJ9A 4UNQA 4YC7A 2ODEA 1VIYA 4Z8YA 4URUR 5JI3E 3R8FA 1OXSC 2IF0A 1HTWA 2PZGA 2JLUA 5IDVA 5J4HA 4ZCIA 1ZUHA 2FFHA 2HLDA 2ZJ2A 2CL7X 1TQDA 1E9FA 2VPPA 3KKOA 3T1TA 2WAXA 4KI0A 1E94E 5IK2A 3QKRA 4CEHA 5GJCA 4GOXA 4OI0A 2O8DB 2WJGA 4NYMR 1SULA 5LPNA 2IWHA 5P21A 2BJWA 2YKGA 5BXQC 3DO6A 3BE4A 4FWIB 2J41A 3TJZA 2ZYWX 1UKEA 4JLKA 3NH9A 1GRNA 2PT7A 2ZM5A 2ECKA 3KXIA 3AF2A 4TLDA 3ZDQA 1NVXQ 4CW7A 5FBRB 3ZD7A 1XJQA 1IHUA 1XEXB 2HCBA 2VSFA 4QFMA 3VR1A 2UZ3A 5H70A 2C95A 3IEVA 3WYAA 5FTJA 4L4UA 1ZJ6A 2GK6A 1DPFA 4HUQB 4HZIA 4R9UC 4TWZA 4A2QA 2MMCA 3DKVA 1PUIA 4DVGA 5K8IA 2P67A 2F3RA 2FU5C 2XNDA 2ZR7A 2YINC 3B1VA 4LJAA 1KI6B 1BO6A 1P73A 2W0SA 4IJMA 1BYIA 1UPTA 1VKJA 1R5NA 3QEOA 1SKYB 4E07A 2A9KA 4UNNA 4BFVA 3ZQJA 4WAUA 3I8XA 5EJEA 2GBLA 4LYFA 4Q02A 2QM7A 4PZYA 3ZVMA 1IY2A 4WW0A 4EPWA 3M4YA 1CJMA 3I62A 3AUXA 4PHTA 1X3SA 4LWZA 1GL9B 2AFHE 5GJVC 2FPMA 1R0ZA 3SU8A 5A0FA 1NSTA 1NJFA 1F6BA 3I32A 1EFCA 1F48A 1P72A 1N25A 4RFSA 1IN8A 3J81k 3V4RA 4QBIA 2FSGA 2HCJB 5JEEA 1XCMA 2GF0A 3HP1A 1CBUA 3FMPB 1R4AA 1RJ9B 3NIBA 1RRPA 2DB3A 4WXPA 1T3HA 3TSZA 3Q8XB 5AUOB 4HDOB 2Z6VA 3UG7A 3AEZA 1B23P 4DHEA 3W3ZB 5CYPA 1BIFA 2BHRA 4DLRA 1KO4A 2BOVA 4DCUA 4QGFA 4R2IA 4TN1A 4Q4AB 2OCYC 5JRJA 4KFRA 3KKMA 1FP6A 2XJ4A 4MDFA 2P3SA 1E0AA 1UADA 4KJZA 3U4QA 1NBMA 1GOTA 3FTQA 3OIVA 5DH9A 3JZMA 4DLYA 3P4YA 2P0EA 3EC2A 5B58C 5KNDA 5FTKA 4HLUA 4MYTA 4H1UA 5G3YA 5F9FA 3U7FB 3CO5A 1GKYA 2G83A 2GJ9A 3AVOA 4TYYA 1SZPA 2W6ID 3H86A 3CZPA 5BQ5A 3FGNA 4TT3D 4MGIR 4F92B 1JR6A 2IHYA 3IIMA 2NO0A 2B8TA 1AS3A 5SZJA 4K46A 2JJ1A 1E32A 4QG7A 3W34A 1W49A 3GJ7A 1FUUA 4KCGA 2KBEA 4ASUA 4Q9IA 4E22A 2BCGY 5JMTA 1SXJC 3G5UA 4NL4H 2DBYA 5J4LA 2CL0X 4HAWA 5DISB 3SEAA 3D31A 3VU9B 2OLKA 5DE3A 5L3QB 1YHNA 1DBSA 4G3XA 4DSTA 4X8LA 2H8KA 3SYKA 2JJ2D 4YLGA 1T5LA 1S8FA 3RS2A 3EZ6A 2ZSDA 5DYGA 3RDPA 4Q9JA 1TEXA 5DSZA 1IN6A 5EE3A 2A3RA 2P6RA 4MKGA 5KOYA 2HJGA 1G17A 3TBKA 3R9IA 4HATA 4Q1BA 2IX3A 4DDVA 1G19A 2LKDA 4JYCA 1G6OA 5D3QA 3FMOB 3BFKA 3AP3A 3CF2A 3MUFA 5K8TA 4RFVA 2C2HA 3QVUA 1GKIA 3CKLA 3K09A 1F2TA 1TQ4A 1TX4B 4IOMA 2V3CC 2G1KA 3C16C 4JL6A 1U9IC 1N6OA 4LV8B 5DI3A 1GNRA 4URXR 2ZU6A 1G21E 2FFAA 4XJXA 4F4CA 3MAAC 1NMXA 2PJRA 1D8TA 2JEOA 3DPUA 1ANKA 2PZEA 4H9GA 4M53A 4MA4A 4KXFB 1UDXA 4CEJB 4QNRA 4DDTA 4TZ0A 3P32A 1R10A 1SVWA 1DAEA 3B6EA 4RZXA 3T34A 2WWYA 1QDEA 1E96A 4DB4A 4BLOA 2HT6A 4M8NE 2BBTA 4IFBA 1W36D 1D6JA 4PSKA 4AI6A 5CM9C 3LVQE 4IRUB 3R7WA 4AY2A 4CVNA 1N6RA 1D9ZA 3U44B 4QJ5A 4K81B 1XEWY 2XTNA 1J8YF 3IO5A 3OF5A 4ERNA 1W2HA 1SVKA 2IS6A 3U3KA 3EPHA 3OIUA 1HH4A 1VG0B 4L9WA 3Q7QA 4WVFA 1KZ7B 1GSIA 2WJYA 4Q1FA 4PC3A 2VP9A 4M9QA 4NCKA 4QHYA 4ZV4A 2HXSA 4L8GA 2ODNA 4IEIA 4M1TA 4BZPA 4TSFD 1G3RA 1KI4A 1AQUA 1DADA 1DS6A 3L8ZA 3SQWA 1ZNWA 2PLFA 4BFUA 4MGKR 1GWNA 5TY0A 5FI0B 2ZRFA 3NEYA 3EIQA 1XEWX 3PEWA 2Z83A 1FL9A 4OHYA 2VF7A 3MGCA 2C5LA 4PO9A 2Q3MA 4FXPA 1Z83A 2QT1A 1E9SA 1N6IA 4R98A 3SFZA 3OFND 3LRPA 1KKMA 2C9CA 2H92A 2V7QA 3A1VA 3OEEA 4Q66C 3ICQB 4AURA 2FSHA 5F2EA 3AVVA 3FMIA 4B3CA 1Z06A 4BECA 3ZH9B 2IUTA 4D4MA 4O3MA 5F9HA 1YZNA 3QF4B 4JIMA 1SVMA 4Q9LA 3GLIB 3B9PA 1Z5ZA 1IN4A 2ORIA 1AM4D 2FSFA 3C5HA 3QXHA 1CP2A 1GL6A 1QVRA 5BN5A 3BIFA 1IONA 2ZUBA 2V4ZA 5JS7A 2F9MA 5DIFA 3ZLJA 2JLVA 2ZI3A 4Q00A 3TAUA 1MKYA 4QJ3A 3I5XA 3TW8B 1MABB 1W0KA 2NPIA 2FFBA 3TUZC 1WBDA 2J0UA 4S35A 1M2OB 1CJKC 5FH9A 1JI0A 4O2LA 1SXJD 1U94A 3BXZA 5IF9A 2O8CB 3LX5A 1XNJA 2QI9C 3WHLA 2B7BA 2VSOA 1MO6A 2WWHA 3TVDA 2XEXA 1G3IA 1ZM2A 2ZJOA 4QGHA 3LBNA 4KAXA 3AKCA 4M1MA 1L4YA 2WWFA 4RZ3A 4WOPA 1LB1B 2QQ0A 3B85A 5D3MA 3E2IA 1UKZA 1XEFA 1E98A 3CNOA 1FMJA 1Z0DA 3IQWA 5AJWA 1R6BX 2ONJA 1FNMA 3KL4A 3NC1C 3OZXA 4URWR 1D5CA 3KKNA 1I4TD 1H8EA 1W47A 1NVUQ 3L43A 3VKWA 1UDWA 1X8KA 1ZNXA 4C7OB 1H65A 1AK2A 5L8VA 4ACBA 1W4AA 4LYHA 4NCJA 3UXMA 1R0WA 2R2AA 3CWZA 2EW1A 2GTPA 2Z0MA 4NMMA 2ORVA 4G5GA 3RS7A 2AL7A 2WBLC 5H1YA 4TMWA 4D81A 1M7HA 2FV8A 4O2RA 2QGZA 2VTKA 3QG5A 4KHZA 4MRSA 5LB4A 1JB1A 3QIAA 4IDNA 1HQCA 3QJYA 1KAOA 1KI2A 1JJVA 1M8PA 1P4SA 4LJ7A 1HT2E 2ATXA 2IYVA 3B82A 2VLIA 2IYRA 5FPKA 4ACAA 1YE8A 2JA1A 3K1JA 1W2GA 2GK7A 3GLFA 1P60A 1E4VA 1RYHA 4RD6A 4BLTA 2Q9BA 1CR1A 4FD2A 1CR2A 1A5TA 3WY9A 1XXHE 4FIDA 1NRJB 2ZRJA 2NQ2C 3RRZA 5CB8A 1G64A 2NO9A 3KDSE 3WRYC 1NVWQ 4BLSA 4LV6A 4LSGA 3GJ4A 5G53C 5HKKD 3ZS8A 1TAGA 3GFOA 2V6JA 3RVBA 2ZRIA 2FEOA 3QKUA 3THOA 4EKDA 1JPJA 4LGMA 4QC2A 4JVNA 4KLNA 2CLSA 1NIPA 4CIDA 3GJ5A 5AK0A 1Q3TA 4B33A 4BRUA 1T9HA 1T3SA 4RJLA 2ZRBA 1CKEA 2P6UA 4DEXA 1GUAA 5C46F 1DG3A 1KGDA 2C99A 2CJWB 2G0TA 3FVQA 3IILA 4ARZB 3ECCA 3KXLA 3GLHB 2VYFA 1UEJA 2QAGA 1DEKA 1ODFA 3VHXA 4IDHA 5KSOA 4TYPA 3U3JA 1G5RA 1DAHA 1XMVA 2ERYA 3F8TA 1E0KA 4LBVA 4QL3A 5B2ZA 1DAIA 5EE5B 2ANCA 1J7KA 5JRZA 4ZPXA 3FWYA 3UPUA 1R5OA 1GRRA 1COWD 1E2DA 4IOLA 3B7GA 1RRGA 2O8EA 2ZRDA 4FMCB 2X2EA 4M22A 2W83A 1E2MA 1E9EA 2ZJAA 1EFRD 2CXXA 4GI7A 3WNDA 5E4FA 2AWNA 1OJLA 1D2EA 5DO9A 4JVLA 1RFLA 4JVSB 4GNKA 1AGRA 4LX0A 1T8UA 1KO5A 4QXAA 2QGNA 1SQ5A 3UMRA 5B30A 2EQBA 2GHIA 3BFXA 2L0XA 1AGPA 3L2OB 2YOGA 3AM1A 4DIEA 1IBRA 2YNMA 5JWRA 5DHFA 2AX4A 3O47A 1A1VA 2VHJA 3NHAA 1JAIA 3H0KA 4KO8A 1UBEA 1OHHD 4DUGD 5JCPA 2DHRA 4PZLA 2RAPA 3UKDA 4LJ4A 3WXMA 4DCVA 3ADDA 2A5YB 4LC0A 1T5IA 4EAQA 2XSZD 2WWXA 4Q21A 1IOZA 4CRWB 3TW4A 1KAGA 2Q3HA 2JLRA 1KSHA 2EFEB 4R7ZA 1KY2A 1RIFA 3S1AB 1E1RA 5JJLA 4BLPA 4FCWA 1XJ0A 5E7JA 3THYA 1KI7A 1S3SA 1IM2A 4GOJA 2BDTA 4I1UA 4B71A 3JVUA 3KKQA 5EUQB 4AYWA 4JLVA 1HURA 4AIIA 4I99A 2GDJA 4Q01A 5HE8A 3WNBA 4PFSA 1U8YA 3EZFA 1HYQA 3QNUA 4BWYA 4FMDF 4L16A 2GBLC 4A0HA 2YOFA 3DM5A 3NDPA 3AVYA 4A6PA 4QBFA 1KK2A 5GVSA 4YMSA 2OE2A 1WB9A 3EZ7A 2FG5A 2NMVA 1SXJB 1PLJA 1E2QA 1LW7A 2HUPA 4NBSA 2EFCB 4B32A 4A9AA 3B13B 4ZO4A 3SS8A 1M6NA 1JR3D 5G3ZA 2V1XA 3ASYA 1TQ6A 5KTYA 5KNCA 2J0QA 1E2KA 1GZSA 3A1UA 4NYMQ 4B47A 4UNSA 2W58A 2D2EA 5SZHB 4Q7LA 3U60B 3BH7A 3IEUA 3GEEA 4A0RA 4WBSA 1KHTA 4HEJA 5JI2E 2GCOB 5M04A 3RANA 3NBFA 4JVMA 4MRNA 4URYR 5KYKA 1UBGA 2KWIA 1D2NA 4EJSC 2OESA 2DY1A 1QHIA 3K9HA 4DLSA 2MSDB 4JL8A 3MJHA 4V0OA 4MUBA 1KIMA 4PPGA 2R9VA 2QE7D 1LF5A 4HZUB 5C18A 3CNNA 1AS2A 2Q6TA 4OHVA 1W0JD 4FCTA 2C9OA 5FBVB 3LNCA 1EFHA 1LTQA 1WP9A 1NBME 3RYTC 1IN5A 1C1YA 2HJVA 4CT4B 1G291 1NI3A 3I1FA 4DLUA 5EZ6B 2WHXA 2ZYUX 5JFGA 2UVQA 2R8RA 3UIEA 3KJHA 2JAQA 4P3YA 4FINA 1KSGA 3MLEA 2OBMA 4Q4LA 4MGZR 1NMZA 4V03A 2WSMA 2OCAA 4PO1A 3U61B 3IHWA 2NO1A 1U0JA 2X77A 2HLDD 2D3WA 1KK1A 2ZSAA 4UNRA 5IK2D 2QA5A 3LVRE 3T06B 3TR0A 3HU2A 3GMTA 4D0GA 2ODBA 2EYUA 3LH5A 521PA 3UK6A 2R6CA 3TNFA 2RGGA 2R6AA 4TMKA 1SKQA 2BBSA 2CEAA 2DFTA 3I8SA 1L7VC 4HLQB 1AZTA 4MUAA 3HU1A 3NG1A 2I1VB 4KYUA 3OIYA 1XU4A 3A37A 4B2LA 5E95A 3X1WA 5SZIA 1AIPA 3AQ4A 4QHTA 5J40A 1RYFA 2QMEA 2GJSA 5CB6A 4OYHA 4JLMA 1PUJA 4DCTA 3TUJC 2DFKB 3AV0B 2ZJYA 2CCKA 3R8CA 3K09C 2J9RA 3C15C 3BERA 4Q4HA 1F2UB 1QRAA 4KU4A 4TMZA 1ZMXA 1FTSA 2QEQA 2JCSA 3ZZ0A 3QBTA 4A8JA 4KVGA 4JLOA 3QPVA 2JLSA 2ZIAA 5AUNB 621PA 2VL7A 2H7VA 3UATA 4LYAA 1QHXA 3AF4A 4TYNA 5JHGB 2RGAA 2ZU0C 2W2VA 2ZRNA 3VX3A 3K0FB 3F0TA 2XNSA 3QUSA 5FR1A 4C0JA 2AWOA 3JZAA 2A78A 1Z0FA 1NMYA 3NWJA 4C0LA 1ZM9A 3KXKA 4O0MA 1ZD1A 3PIRA 1Q21A 1VYTA 3LBHA 1FUKA 1UM8A 5G40A 2AD1A 2B92A 3Q5DA 3PUYA 4MKIA 4ZI2A 1TQ2A 3ZIAA 2ZRKA 1YR6A 4XVQA 1G3QA 2O8DA 2BMDA 4YONB 4LHVA 4GFDA 1KMQA 2ZYTX 1E2HA 4MRPA 4FN5A 4WZ6A 2J87A 2VA8A 5KO2A 4IEEA 4NH0A 3THWA 3RS4A 1A4RA 2PT5A 2XXAB 1FFHA 2V54A 4G01B 4KFSA 2WIAA 5B57C 4JZKA 4H1VA 4A1FA 2ZJBA 3SC3A 1ESMA 2JJ8A 5HZHA 2FH5B 4B3XA 2R6DA 3E70C 1BMFA 2PMKA 2ZSEA 821PA 4BGDA 4YXWA 2J7PA 3VTKA 2P5SA 1ZM3A 4B2PA 1XTJA 1NBMD 2OXRA 2OG2A 3QEJA 4F4JA 3CH5A 2NTYC 1NLFA 3U3RA 2FZLA 3PQCA 2ZXUA 3Q9LA 2J46A 1Z6GA 5J4YA 3TQFA 1Q57A 4X8HA 5EXSA 1G8PA 1XZQA 2HYDA 2YC4C 4EPRA 2WMNB 4BEJA 5HZKA 1PVOA 1LVGA 3RNLA 1MO4A 3DHWC 1OB5A 2C98A 2BV3A 1XFAA 1XRJA 1NG1A 1TNDA 2JJ1D 4Q7MB 4TL6A 4TL7A 4PHGA 3RSLA 1C9KA 1KO7A 4ASUD 3GJ0A 2YC2C 5JSZA 2ZJZA 1J90A 4F7WA 4BE7B 4OHXA 4IVPA 1F5NA 1SVOA 2KJQA 2OFWA 4B3BA 3KKPA 4F93B 3GPLA 1ONBA 3B1XA 1XP8A 2WSSA 2Q9CA 2YYZA 4F4IA 3AVQA 3HPQA 3VNVA 1RJ9A 1CIPA 4TL9A 1NLYA 1W5TA 3REFA 3TR5A 1H8HD 2YWGA 2C9YA 1P5ZB 3QY0A 3SNHA 2IXEA 1WXQA 4PO8A 1UBCA 3ZD6A 2F7SA 3RRMA 3IBGA 3EASA 1W36C 3ZZUA 4DXAA 3KX2A 4UNPA 4OK5A 1JXOA 4M4SA 1E3MA 1KMHA 1MR3F 3PUXA 1UKYA 4PAQA 3W8NA 2V1UA 5GJWC 1T6NA 2A30A 2DWPA 4XH9B 3PEVA 2GEDA 3RWOA 5SZKB 2NOAA 3IO3A 1AKEA 1T3LA 3K0CC 4TTQA 2WPDA 4CEHB 4AKGA 4KODA 3LX8A 2G0NA 1TUIA 1JEDA 3O8DA 1QHYA 2WOJA 3IIKA 3SBEA 1SGWA 5JHHB 1MRSA 5KSPA 2RGEA 2JIZA 3EA0A 1AS0A 3DMDA 1K5GA 3BD9A 1JECA 3FB4A 2RGNC 4Q1CA 1DELA 2ZROA 3CX8A 3GLFE 1HEIA 1QHNA 5FFMA 5BYKA 5EE1A 1LV7A 5L3QA 3CPHA 4Q7JB 2F1HA 3LLUA 1I2DA 4KYIB 2OM2A 2D74A 4WZBE 1IJEA 1YU9A 1OXVA 4CDGA 3ZJYA 3NTUA 4B74A 4RVCA 1FNNA 4LJ9A 2QORA 1N0VC 3F5FA 1K5DA 1NP6A 3OIWA 4BFXA 2FFQA 3FHOA 5AUQA 1ZRHA 1ZU4A 1EX7A 2A5JA 4KVAA 2CVFA 3EPJA 3X1YA 5FOXA 1G8GA 4BFWA 4RD1A 2QAGC 1G18A 2OAP1 2F55A 3QXSA 2P65A 3UG6A 2OAQ1 4U00A 3PEYA 4W9MC 4P31A 2ZAOA 1WF3A 2A5FA 3IPXA 2OFXA 4PHFA 4D0LB 1GM5A 3ONWA 4V0KA 3PV0A 3OEHA 1QVAA 1OYYA 1QHHA 1XCGB 1X6VA 2F6RA 1HE8B 3H2YA 1OXUA 3OEED 4LY6A 3U5ZB 4HAZA 4HLCA 5EP2A 3P4XA 3WYFA 4CEJA 2O52A 2N42A 4P4UA 1DO0A 4JS0A 2ZI6A 4I1VA 4JT4A 3KB1A 4DJTA 4MRRA 4M1WA 1DARA 2WWIA 5HE9A 1XD2B 1F3OA 1MO5A 5FL7A 3R9XA 2EFGA 4XVUA 3NBZC 1KI1A 4OJKA 3LAWA 4LRWA 5DGXA 4GZMA 1MV5A 1CJVC 3I72A 1JAHA 3MMPA 2PLRA 2R44A 4JT2A 4EJSB 3PEUA 4HDQB 4B35A 1Z6TA 2F43B 3BB1A 4LBZA 2ZQ5A 2JLYA 4LPSA 221PA 4UXHA 2GZHA 2OSBA 2QP4A 1MH1A 4D80A 3U4QB 3K0SA 3BH6A 2GETA 4C2TA 2YV5A 4MRVA 2REXB 3CF0A 4HB0A 4A36A 1Q1EA 1DVRA 2XOKD 3EAQA 4QRHA 1P62B 3QENA 1EWRA 1IN7A 4JL5A 1ZUIA 5A4JA 2PX0A 2YWEA 5KNBA 5IRCD 4RCYA 4ZIRB 3EX7C 1H8ED 1YJ5A 2F1JA 4TMTA 1HT1E 1E0JA 5AWFC 1US8B 1N5IA 1XD8A 4HYYA 4IDPA 5CM8B 4GDFA 2FOLA 1P2VA 4E5UA 3QKSB 1DAKA 1JJ7A 2AHOA 1WRBA 2ONKA 1ZYUA 4S2EA 1KO1A 4RD3A 3X1ZA 4NE2A 4X8OA 1GITA 1K6MA 5DN6D 3QF4A 2IS4A 3VX4A 3L0SA 4OK6A 3GFPA 4AKEA 4LYJA 3ZVLA 4XSGA 2JDIA 3TMKA 3SR0A 2J45A 3W8RA 1VPLA 2B8WA 2P6NA 4II7A 3VNUA 3PJRA 4URVR 5FTMA 5KU1A 1UEIA 2QQEA 4CZ2A 1E2IA 5EP4A 1EFTA 3RS5A 1VG8A 2CHVA 1QHSA 3PVSA 1OH5A 1N6HA 2V55B 2DWOA 1VYUA 2ZE5A 3RS0A 2LKCA 2IYTA 2REOA 3PUZA 3HJNA 1R8SA 3AGPA 1NKTA 1F2TB 4WA7A 4LV5B 1SHZA 5EXXA 5FOSA 2F3TA 3W6NA 4JYBA 4DIDA 3EWSA 5FBWB 1EESA 3MSXA 1FZQA 1U81A 3CRQA 5J4VA 2RB4A 4LCBA 1VCOA 2FSIA 4V0LA 3SHWA 5AJXA 2VRWA 1G7SA 3C4JA 1EXMA 3CR7A 4HB2A 3OE7D 2CNWA 3VR4A 3MWLA 4DSUA 5FUWA 2GESA 1OYWA 3LBIA 1QG2A 1SVIA 1L4UA 1E99A 1G3MA 4Q47A 1I4LD 5DNYB 2QBYA 3UWKA 1KOFA 1JPNA 2CMKA 4UJ3A 5TXGA 4D26A 2IHBA 1KK3A 4W5JA 2I4IA 1T91A 1Q1QA 1OXXK 2JJ2A 2GJ8A 2QY9A 4L15A 1RVDA 4JBWA 5FOVA 2YZ2A 2YVUA 3KUCA 1II8B 2IXGA 2IC5A 1Z8FA 1OH6A 3GJ8A 1IXRC 2VP0A 2EU8A 1P6XA 4LI0A 4EFMA 5EQTA 4GOKA 721PA 4DDUA 1VG9B 3ND8A 3ZVNA 2CE7A 2R6GA 3ZGXA 1ZNYA 3B2EA 2IYLD 3I73A 2Q9AA 3A1WA 2GXUA 2IEYA 1JNYA 2HEIA 3I5YA 1NN3A 2VHTA 3I4LA 1W5SA 4GT1A 2ODWA 2QU8A 4G5RA 2VP4A 2QPAA 2QN6A 5BN4A 1KDPA 5J5CA 1ZNZA 1KI9A 4OHWA 1A2KC 1KJWA 4P32A 2IA5A 3P26A 2RHDA 1JQJC 1OIWA 1RW4A 2YJTD 3CRRA 2XTMA 5CDFA 1NF3A 2BMFA 2CJWA 1FQKA 3SJBA 1E1RD 4YMVA 3B1WA 4AG6A 4A8JC 5JBQA 4Z1MD 3H1TA 3QQ5A 3GLHA 4JSYA 3ZVRA 4BLRA 1NG9A 2OZEA 2EYQA 4DSOA 1J70A 4A0FA 2QUZA 5DHAA 2GWHA 2Z43A 1VDZA 3N2EA 1RE0A 4NZYA 2WKQA 2O8BB 2GJAA 4TMVA 2ZUDA 2OCBA 121PA 4TTRA 1YZQA 1E9RA 3EA5A 3HDTA 4D4KA 1XPRA 4KITB 4QM6A 4NPHA 1G5PA 1ZCAA 2GVDC 4B6FA 2CHQA 2GAOA 1FX0B 2W00A 4DT1B 3CX7A 3WYGA 2FDCA 4GZLA 3A4MA 3SZRA 1BH2A 2XB2A 4ITRC 2OV2A 3C7KA 3CF6R 3FDIA 1N6KA 3IQXA 4LOAA 5IT5A 1E1QD 3KFVA 1OB2A 1G5TA 2PX3A 1GFIA 3CPJB 4OQNA 2AKAB 4OI1A 2V6IA 4CT5A 3K8YA 1GP2A 2QMUA 3VKHA 2EFHB 3QI2A 2J0VA 2CCGA 1E6CA 1PV4A 1PJRA 1X86B 3EG5A 2PEYA 3DVLA 1DTSA 1OSNA 5FPTA 1XZPA 2AXPA 2WKPA 1E79A 3H4MA 1UJ2A 2GKSA 4JLJA 2XAUA 3IHLA 4XWOA 1NNEA 1W36B 2GF9A 4YMWA 1KSJA 4GP7A 2CBZA 2ZJ8A 2G3YA 4PQRA 4B3DA 3S1AA 3M0EA 1CR0A 2Z5FA 3KJGA 4C30A 3K9LA 4HAVA 4V02A 2J0SA 1KI3A 1XMJA 3ZQ6A 3PUVA 4BASA 4IOKA 1R7RA 5AUPB 1GILA 3LLMA 3HWSA 1N0UA 3EW9A 4JKIA 1LNZA 4PHHA 1XBTA 3FMFA 4V0NA 4G5QA 3GLFB 3CW2A 4NCIA 5TV2A 3GEHA 3BOSA 1HUQA 4LC1A 4MYCA 4US1R 1SKYE 3SJZA 2ZI9A 2WMOB 1WDTA 4Q48A 4AD8A 4ESVA 1Z22A 1OFHA 3U7EB 3UMSA 5CITA 3AVUA 4BFSA 5CIQA 2QT0A 3FHCB 5KDDA 3L0IB 2ZAMA 4C0AC 3GLGA 4HAUA 1ZUNB 2GCPA 2ZRAA 1W7AA 3K0AA 2ZRHA 4RKFA 1EWQA 4PPFA 1YZTA 2NZJA 4U5XA 2FNAA 1OF1A 2J1LA 3CWQA 1MOZA 3SI7A 4XVRA 5DLQC 1U99A 3SFVA 1HE1C 5KPJA 1IQPA 4P4TA 1VCIA 2GAAA 2QTVB 1ZD8A 4TTPA 4FW9A 3IPYA 3TE6A 2K5UA 4EQ6A 2QAGB 1G9XA 1ZC3A 2OCPA 5L3RA 2PEZA 2WWGA 3K9GA 1U0LA 3HYRA 2Y8EA 2XB4A 1TF7A 3AGQA 3KB2A 4US2R 4MQBA 4Z8XA 5AJVB 1DE0A 3V9PA 5CYOA 5L3SB 1N6PA 2QRNA 5FOWA 2O8EB 4QHSA 3TRFA 1J99A 5FTLA 1ZC4A 2E1RA 2WJIA 2J3EA 3MWYW 4IW3B 2YHSA 2NO7A 4DCNA 3A6PC 2O8FA 1YR7A 4Q19A 1VHLA 3N5CA 2C96A 1XMSA 4EDHA 1KK0A 1P9NA 3ETLA 2BMEA 1VG1A 5HKKA 1CTQA 5EXTA 1W4RA 2J59A 2NG1A 3AKEA 1V5WA 2VHCA 2IT1A 3RS3A 4PC1A 3D7MA 3R9WA 2KI5A 3N2IA 4LBWA 5HCIA 4Q4JB 3ZIAD 4F91B 4FMCF 3KQNA 4JMPA 2JATA 4TLBA 3TSWA 1HA3A 4A6XA 1Q20A 1TU3A 4NYJR 4P4SA 1A2BA 1ZD9A 4RZUA 2R65A 4HLUC 4GBMA 2ZS8A 3IDQA 4B48A 2IS2A 1TADA 5JS8A 1BYUA 1YRAA 4KSCA 4TLCA 2BVNA 3OAAA 1G7TA 2RKOA 2HF9A 4BFZA 4AKHA 3PXGA 2HF8A 2IYQA 2VP5A 4XTRA 5CJPA 1E2PA 3WP1B 3PENA 4WZAE 3EIEA 2C03A 1KJZA 1UKVY 1GDDA 2QP3A 1BMFD 1YKSA 2IYXA 4M9SA 2JASA 2J7PD 2UZIR 3CPEA 4E03A 3UMFA 4IVRA 4NYIR 4ZDWA 1E0SA 1EFRA 4FWTA 5FOTA 2ATVA 4O25A 4TLAA 2G9NA 4AYXA 3WHKA 1DOAA 2OLJA 1RRFA 3KJIA 4NCNA 5FBQB 3WMFA 1E2JA 4PAMA 5UKDA 1A82A 1XTKA 3KTAA 3B60A 4FI3C 2PJZA 1LY1A 2ZEJA 4GPTA 3MWKA 3DM9B 5JCZA 2RCNA 3PG5A 1GAJA 4TQAA 5CK4A 4XD7A 2GA8A 1GKUB 2PMDA 2ZTSA 5BYJA 1TL7C 2BEKA 4OL0A 2FPLA 2PCLA 3X1XA 5H8WA 1Z0IA 4JJZA 1CS4C 2IW3A 1Z08A 4D2IA 1Q44A 5GADl 3AF3A 5K8UA 2W2XA 3FPAA 4Q1EA 1X1RA 1CEEA 3QOFA 4QM7A 5FOUA 3CR8A 4JLPA 3BRWD 2WSSD 4EUNA 3KJEA 1E9DA 3PITA 4NHOA 4BFTA 3NEJA 2KSQA 1E9CA 4V0MA 3LXXA 3G82C 2H57A 2XNDD 1GTVA 2QPTA 3MWJA 3NBYC 4I81A 2W2TA 5AJYA 2OO7A 4UKDA 1W4CA 1G1MA 1WQ1R 2ZETA 1TTTA 2LWIA 2X8AA 2H1LA 1GL7A 4YDHB 3B1YA 2QM8A 3CM0A 4QGAA 3BORA 3W90A 1WBBA 5A5GA 2NGRA 3PR1A 5AR1A 2TMKA 1P9RA 2FGJA 3C8UA 5E3HA 3QPWA 4M1OA 3T1OA 2H17A 2IYZA 1ETUA 2AK3A 2PZFA 4OQLA 5HTKA 4QJ4A 3LO5A 4OQFA 1OKKA 1JR3A 3MRSA 3EPLA 4XIGS 1XTSA 1QZXA 1ELOA 1S9DA 2D06A 2PCJA 4ILEA 5CIWA 2WPDD 1AKYA 2AFIE 2ERXA 1XF9A 2G77B 3ZZTA 4PZZA 4HSEA 4KBGA 1GIAA 1AA9A 4DRZA 4C0BA 3GEIA 4EPTA 2JIZD 3NXSA 2VP2A 4NTZA 3VKGA 1OXTA 1U90A 3TGPA 4PSAA 1P2TA 1XEXA 3AVWA 1KTVA 1FTNA 4HI0E 3O8CA 1MT0A 4M1SA 4NU0A 4B3FX 2CE2X 1FW6A 1G8HA 4DC9A 4PTLA 3SJAA 2OFOA 2QE7A 4HUQA 4R71A 2PL3A 3SHFA 1S1MA 1NLZA 2RGXA 2GXQA 2X1VA 1UBFA 3QE0A 2DPXA 2ZPTX 3LW8A 4Q4HB 4CEIB 3FKSA 2H5EA 2HDNB 1AN0A 4A8JB 4QOSA 1D9XA 3IKJA 2FZ4A 1KI6A 5JWOA 3THXB 4FCVA 4PQYA 4US0R 3QXXA 4L9SA 1Q0UA 1IY1A 1XXHB 2OILA 1E4YA 4LUCA 4Q1AA 4Q1DA 2ZE6A 4RCZA 3SN6A 3T1QA 4BQSA 1XJCA 3CONA 1AJEA 4LPKA 4NCHA 2CK3A 3A4NA 2KB0A 4PAOA 5HPYB 3KQKA 4Z54A 3CZQA 3KFXA 1NJGA 1OIXA 3OEHD 5FPHA 3SDZA 3PFIA 5FI1B 1S2MA 3BFVA 2VO1A 5L3VA 2UKDA 4DLXA 1YZKA 4Q7KA 2B7CA 3DMNA 2D4HA 5AJZA 3RABA 1G7CA 4OHZA 1II0A 2VIIA 3B1ZA 2RGDA 3HU3A 3BJIC 2W0MA 3NH6A 2IXFA 3V4FA 2EFDB 1KJYA 1KDOA 1KY3A 3THWB 5ANRB 1T0JB 2BKEA 2CCJA 1Q1ZA 2IF2A 5FL7D 1NVVQ 1CRQA 3KQLA 1FQJA 1NN0A 1YRBA 4ABYA 4TYWA 1ZINA 1Z0AA 5FUXA 2ZR9A 4KFUA 5KSYA 4QNMA 4N1AA 4Q4AA 3DOFA 1XD9A 1W4BA 4M0LA 3LXRA 2JGNA 1KNQA 2BMJA 4UQOA 4GL2A 1M34E 1Z6XA 2OT3B 1OH8A 4HB4A 2HYIC 4RY2A 3BBPA 5JJKA 2W6JA 4Q18A 1G20E 2DR3A 2QENA 4QBGB 3GP8A 1OLOA 3CRMA 3IGFA 1E2FA 1W44A 2AR7A 4LDJA 3AVTA 4B3GA 1RZ3A 3QKRB 5CDFE 5KDOA 2C77A 4DEYA 1TUEA 1Z63A 5FUVA 2IBMA 2ZR0A 1PLLA 3GLHE 1CLUA 4UXIA 4HB3A 2ZJ5A 1MRNA 1OV4A 2QL6A 2MSEB 4ON9A 4I4LA 2WKRA 2YWHA 3VR5A 1QHGA 1G8YA 1Z29A 3EIHA 4TYQA 3VU9A 4D0NA 2EWWA 3B78A 5JSZB 1M7GA 1S4QA 1TPZA 3W5JA 4ZKDA 1WA5A 2V8OA 2VH5R 1T4GA 1TF5A 2WJVA 2ZSFA 4OKSA 4RD2A 2C78A 2JDID 2BKUA 1XD2A 2BM1A 3RC3A 2VEDA 3ADBA 2D7CA 2ANBA 2DCUA 4XOIA 2H16A 3QBVA 2ZYVX 2ZS9A 4KSBA 4P0TA 1ZVQA 1FMLA 4EJSA 5B64A 4OI4A 4C4PA 3Q3JB 4TQ9A 2F43A 1Z0JA 5FTNA 1CULC 3OESA 1CJUC 1J8MF 2AN9A 1NN1A 1KMHB 1EX6A 1V43A 2HV8A 1G7RA 3DL0A 3ADKA 3CIOA 3LV8A 2WIBA 1BOFA 1VTKA 1SVSA 3GJ6A 2V7QD 4A4DA 4PC2A 3U3MA 4B34A 1D2MA 1NY6A 1UAAA 2IK8A 1ZBDA 4RFSB 1JQLB 4J0QA 4ZIRA 2RHMA 5E7IA 3U7HB 1VIAA 3LDAA 2BBWA 2DYKA 1US8A 3O8RA 1KNXA 2JLZA 4ZKEA 3TVTA 2VHQA 3IUYA 2CNWD 4CYMA 4XSHA 1CRPA 2O0KA 3QKSA 2ZI5A 2RGBA 3A1SA 1L8QA 3B9QA 3NHBA 4Q9HA 5LD2C 3X1DA 1W0KD 3U44A 4TMXA 2A2ZA 4G5SA 1R5BA 2WAYA 1E69A 4LBYA 3AVXA 1YR9A 4AWXA 1Y63A 2N1BA 3TQCA 1SXJE 3K70C 2NPFA 1HV8A 1QBKC 4EPXA 1X8JA 3P1JA 1BKDR 2G1JA 4DLTA 2DFLA 4HAXA 5TB5A 4BZQA 4JLAA 1N2CE 1H8HA 5F3WB 1KYIA 2BC9A 3BAFA 3CH4B 3I92A 3GLGE 1SVLA 2J7KA 1XWIA 4IVQA 5TARA 2JLXA 4WXRA 2ORWA 1S9HA 1W46A 3EXAA 4M9XA 2O5VA 2Q3FA 3MG9A 2ZVPX 4I1SA 4KLZA 5KDLA 4IXNA 2BJVA 1AQYA 4JBXA 3A4LA 3UANA 3G0HA 3SYLA 4IFEA 4QGGA 3AKDA 2RH5A 1GNQA 4L5BA 3P27A 1NKSA 1YR8A 3L0PA 2AXNA 3FYHA 3M1IA 1WCV1 4LHZA 1L2TA 1QHHB 2OBLA 2IYUA 4PQFA 5CJ2A 3MJRA 3KZ1E 5J4KA 5JECA 3GLIA 2VP6A 1TU4A 2BWJA 4OK3A 4C3ZA 3SOPA 4Q03A 3WNCA 3RRYA 1UFQA 2Z4SA 2R62A 4PPNA 1N5JA 1E2NA 1BS1A 4U02A 4D82A 1MABA 1Z6YA 1W1WA 1KDTA 3T12A 1NVVR 3X2SA 1G8FA 4PR0A 1EGAA 3TKLA 2BCJQ 1G41A 2GXSA 2O8CA 2C8VA 3RAPR 3HR8A 1OT3A 2WM9B 4HLDA 2QZ4A 5E7MA 3C5CA 4RD4A 1RC8A 3TIFA 1Z6AA 3MFYA 5FPYA 1KSFX 1II8A 2GZAA 4JLDA 4UJ5A 1R2QA 4PX9A 3B8HA 3ADCA 1Z2AA 3W6PA 3T5GA 4E09A 4JJKA 1EFUA 1GNPA 4K8OA 5DI3B 1XCPA 1JBKA 421PA 2BEJA 2W6IA 2RGCA 5GJBA 2BIFA 1XB2A 4TT3A 3C41J 1VMAA 4W5WA 2WWWA 4DLVA 3A58B 5LBIA 2FN4A 3FE2A 4C2UA 2PBRA 4C7OA 3I61A 2I1QA 3LA6A 5EE9A 3DZDA 2CLCX 2QAJA 2VSXA 1E79D 1PZNA 1Q1BA 1YZLA 1IXSB 1YVDA 4LK2A 4N3NA 5EP3A 4YMUA 2AD5A 1OFUX 2WTUA 1U8ZA 1MO3A 4DLZA 3R7WB 2IYWA 1VECA 2O0HA 1GVNB 1N5LA 3LQQA 4G1UC 1CF4A 3LD9A 3EPKA 2CLDX 3GD7A 3QG1A 2ZRCA 3T35A 1P7CA 1U0HC 5F98A 4TLEA 1P2UA 4A92A 2ZE7A 2H18A 1M7BA 4KV9A 4MKFA 4A2PA 3DKPA 5J47A 1KDRA 3NKVA 1Q3HA 3SBDA 2O8BA 3L82B 1XDBA 2F1RA 5FBLB 3KQHA 2AKYA 1OIVA 4D6PA 4N0EA 4MYHA 4ZCMA 4EIWA 2D62A 4PANA 4IHQA 3AKYA 1FX0A 4DT1A 1QG4A 2GEVA 3NVAA 1Y3AA 6Q21A 3AP2A 3SE0A 3GCGA 3BGWA 5C4GB 3FHTA 3CBQA 3K70D 2P2LA 3C14C 4Y0VA 2GILA 1R0XA 1XX6A 3TK1A 2IS1A 3U7GA 1M1YE 3WRXC 5KPDA 4NYJQ 4LJ6A 4ARZA 1RRCA 4W7SA 1R0YA 4B75A 2XOKA 3REGA 3R20A 3W9YA 5C2JB 5BW8A 2ZRLA 3A8TA 5IHPA 1UF9A 1Z28A 3DEFA 4N0DA 2Z4RA 3TSOA 1G16A 1Q12A 1R8QA 2D2FA 4IDOA 3DOEA 4V0ME 1OE0A 2FX3A 1II9A 2XZOA 2N46A 2O0JA 3H84A 1ZM4A 2ZANA 1G6HA 4ZDIA 2J0UB 4FMBB 1JEEA 1ZU5A 3GQBA 4A15A 2QPOA 2Q21A 5DN6A 2ZRMA 4QKQA 1X1SA 4LZZA 5FR2A 4PSVA 2QBYB 3T1VA 3T61A 2A5GA 1T8TA 4Y0AA 2F9LA 3NC0C 1DAGA 4NYIQ 4ESHA 1G4AE 3K0EA 3K0CA 2ZS7A 1KI8A 5TMPA 1Z0KA 2ZITA 3EC1A 4MH0R 2FEMA 3VR6A 2B21A 1G3UA 2X19A 1JR3E 3AF1A 3QXCA 2XX3A 1P2SA 5EUMA 1ZIOA 3U6KA 4TSFA 3ICEA 2B6HA 2DFNA 2R6FA 1K8RA 5D3MB 3GJXC 3QSYA 2FGKA 1HQYE 1N3BA 2RGNA 3CRVA 4B6EA 1CU1A 3LFUA 1F60A 3KQUA
chains in the Genus database with same CATH superfamily
2V7UA 3VNQA 3GBSA 4HS4A 1E9AA 4AC9A 1N6NA 4ZAZA 2ZIVB 3HACA 1HY3A 2P5TB 1AA6A 5AHRA 1ZUNA 4I6JA 2ZSBA 4LXHA 4D0RA 3RYIB 5EMLA 1DJMA 3I6YA 4LHWA 1JTVA 3J7TA 1MGOA 4C0HA 1DBIA 1SBHA 2CLHB 3BB4A 4U63A 4DLWA 4G1MB 3PFKA 2PPLA 3NGXA 2KE5A 4REQA 1ML3A 1QQ6A 1LS6A 1OU4A 2OHVA 1I0ZA 2PXCA 3DFMA 4Y6GB 5LQCA 2FRDA 3E5HA 4JQZA 1N33B 2RHTA 1XRRA 1ZIPA 4P33A 1QP7A 4P9NA 3OPMA 4C9BA 3A3OA 5JYCA 4JUCA 1E1YA 3OH8A 4AG5A 1ZXXA 3NHRA 3K5IA 2VOJA 5JWHA 1JJBA 3N0XA 2G8NA 3RLFA 2PO7A 1HOXA 1Y4UA 2HTFA 1SXJA 2QD5A 1IRIA 1ESEA 4PXYA 3VZBA 3G9ZA 4WZBB 5TC4A 1XVUA 3WL4A 3DEKA 5L3SA 2WVJA 1CZLA 2J09A 1E66A 5DP1A 3G85A 5FLXA 2WU8A 6PFKA 3BTOA 1TM1E 1ZW6A 2ATEA 1CR4A 4XWKA 3IMFA 4PC6A 1JHXA 2ZBDA 2DLNA 3LL7A 3OZIA 4TTTS 2ZE8A 4WADA 3DDUA 4ZVTA 4J3NA 4B5LA 2IUSA 2PRYA 4JC0A 3ISTA 1L7OA 2X2FA 3IIEA 4G0MA 5JLJA 3L0DA 3EBLA 2DP4E 4LMAA 3WBJA 4Z0TA 1KEEB 2GCOA 1ML4A 1XMIA 4I1OA 4IEFB 4D0GA 2V3VA 1EK0A 2B1QA 4M2LA 1ZH4A 1F7VA 3A10A 3CMCO 1EVQA 5BQPA 1TDJA 4D3YA 5REQB 1OD6A 1WE2A 2NXWA 3VISA 5HCNA 4YN3A 4AJOA 3LHKA 1GZHB 3MJCA 1QCCA 4GM4A 4J1TA 4R4JA 3VM6A 2GZ3A 1G21A 3VPXA 4UM7A 3W5AA 1JKJA 2JVJA 4O2AF 2PUTA 3H8VA 3IR7A 3QA9A 1VMEA 3L0OA 1EVIA 3LK7A 3SM9A 3M5CA 2MYUA 4HZUA 4P8RA 1BXRB 2UZ0A 3GFTA 4U2KA 4UM5A 4WXEA 3GRCA 1GUZA 3WMGA 3H9EO 1P0MA 3F3YA 4B1FA 4TQUS 4HZGA 5TPWB 1GLNA 1P75A 4GLJA 1NTRA 5FJIA 4QBHA 4UQLA 3FOZA 3LP6A 2QM0A 3IE1A 1I9GA 3ND5A 2G07A 5E3JA 2PVPA 4Y98A 3HVIA 3RUEA 1P9WA 5LN1A 4C4SA 3AUFA 5H3CA 2O2GA 1VPVA 3FNHA 1FS4A 4D4JA 3WLPA 1E1CB 1O3YA 1FFGA 5TT0A 3RV3A 3RWMB 4IP0A 3ZHVA 2CV2A 3U6BA 3LCJA 3D54D 3QVMA 1U2DC 4AO6A 1I4OA 5GZ1A 3D3QA 1DO2A 1VMKA 1NTOA 3PDHA 3K9QO 4FKMA 2H2GA 5AQ1A 3VH1A 3B6IA 2RMKA 1JALA 5JCOA 5CVTA 1Q15A 5JAPA 2FMUA 1DLJA 5CGZA 3HHEA 5AKXA 4EELA 3GLUA 2XUGA 4OD0A 3D3WA 3WB0A 2WI8A 1B6GA 3C6XA 3OLCX 3VDQA 1KETA 2G9ZA 4MRMA 4OQXA 1VGRA 3LXMA 4GYWA 1BN7A 1OKKD 1QYRA 2HU5A 5BO5A 5JQGA 2X9NA 3G9XA 4XTCS 4YMTA 4H2DA 4L4ZA 2MMGA 3F1KA 5AHXA 2XVMA 3HYTA 2WOOA 4X8MA 4U39A 5HIIA 3TLJA 2ZT5A 4ZVRA 1DRKA 1GT91 2H08A 3PPWA 1WSAA 5F12A 5JFGA 4KLAA 1LQTA 4NAUA 3QUQA 2PA3A 1NY5A 2QMZA 2ZI7A 3THYB 2HHJA 3HFRA 4M99A 1OFUA 3E3AA 3LFHA 4PZDA 3M5WA 4F38A 4EY5A 4JLUA 1PJZA 3ZLTA 1YZGA 2HT1A 4CQMD 1RADA 4JNCA 5ADUS 1CUCA 2IHJA 4EQ6B 2OHGA 3E9CA 2C4NA 3VBCA 4DCMA 1XZHA 1ECLA 4LCEA 4OJQA 4K6OA 3HVUA 4Y1EA 2LCFA 3S68A 4WGGA 2IPXA 1ZCBA 5SY9A 4CTMA 2W71A 1WOYA 4GVLA 5ES3A 5K8LA 3F6PA 4PLHA 4ZVNA 4BN0A 3DDCA 1QNLA 3CUEF 1JMYA 3ETJA 4C0KA 3W5DA 3TFOA 2ZWVA 3LBYA 1EQ2A 1JLKA 1M6WA 1Q22A 2EC5A 3LPNA 3S81A 5IWCA 2EWVA 2J5RA 3T4UA 2AR9A 2D54A 2ZBPA 3IUPA 2ZQYA 4GEKA 1ZP6A 3Q9NA 2PGXA 4J2HA 2DRIA 2O8FB 3CX6A 2WVGA 3HUFA 1FW8A 4R0NA 4YCDA 1T8YA 4ZVKA 4Q9KA 4BNGA 3O8LA 1N9KA 4D6XA 2F64A 1JA1A 1K27A 1QLJA 1XTRA 4TKZA 3TH5A 4X45A 5I9IA 3UK7A 3DZCA 4YWJA 2FR0A 5DTIA 3NONA 4ZAFA 2H4FA 1TYCA 3OM8A 4QFDA 3U3OA 2VK4A 2MSCB 4DUGA 5BY2A 3FFXA 4XWAA 4PPQA 1JLRA 5EXPA 4IDDA 2OHFA 1MX9A 2P75A 2XTZA 2J48A 2AE1A 4C87A 3AFOA 1AK9A 3E18A 3GJ3A 1H9CA 2WZBA 5LDDC 4J1SA 1PZEA 5LQNA 3B3GA 3AEQA 4C4XA 1RCUA 3AUYA 4GWLA 2A84A 3IAUA 4EFNA 3O8OA 4M1KA 4J16A 5ESWA 2Y0PA 1GPH1 2GXAA 1WLSA 2BCEA 1D6SA 3M6FA 3F90A 3ZWPA 4TZ6A 3NKFA 3AEUA 2V9PA 5HF8A 1WB4A 4E12A 1YZUA 2CXSA 3PUWA 1PYGA 2QNRA 1CVLA 1QLHA 4GMDA 1XNRB 4DW8A 2OQRA 4KXMA 1VBMA 4NICA 4NENB 1WAMA 3H1BA 3P9SA 5DHQA 1ZI6A 3O9ZA 1IZ8A 1QB7A 3SMQA 3NQ41 4GUAA 4ND6A 4OI2A 2P4SA 5IAJA 1PGJA 2CDRA 3IIJA 1YFJA 1GARA 4JQCA 4L6CA 1D0IA 1ESNA 1ATZA 1USVA 2A9PA 2ZUCA 5AM1A 4C0QC 4ZYVA 4B2IA 5BW4A 1E3SA 2NV6A 2P4QA 9ABPA 1VLLA 1C9NA 1EM8A 5CXSA 5BR7A 1PDWA 2AN1A 3WQRA 1LSOA 5IN4A 2G8LA 4LJ8A 4Q39A 3OPVA 4MZXA 1AK1A 4V2UA 3ZX5A 3N2KB 3PNSA 5CVDA 1NSYA 3B5JA 1P74A 1SPBS 1L4KA 1C9DB 3I9JA 4CF4A 5IVDA 4KH1A 4KGDA 3WOHA 3KQUA 1P3JA 2PYDA 3GA5A 3GLIE 5CBKA 3NV7A 1CY7A 1O03A 1QR2A 2F59A 2SBTA 5DYIA 3KTAB 5E2IA 3LWDA 2NZ8A 4CQNA 4QAJA 4HUJA 1CUFA 1XVIA 3IP1A 2AK2A 3KKKA 4H6XA 3DL2A 5ULLA 4DYHA 2B98A 3AERB 2R4QA 4IMPA 3V80A 4RVOA 4KE8A 5F1PA 3WRYA 4DL9A 2PS0A 2ZVQX 3AP1A 3RSQA 4NX2A 3OQJA 5LIRA 3U4CA 1M74A 3BS4A 3JQ7A 3LQRA 4Z51A 2BM0A 2GCEA 3DOCA 4G63A 1XNQB 1W0JA 3DOHA 1XTQA 3CE6A 1YFZA 2Q1WA 2B3DA 4RH1A 4GOLD 3ESQA 5KI6A 2YHBA 2NU7A 1BHJA 3RUDA 3Q7PA 5KX5A 4QYXA 2C0PA 2UYHA 1YMUA 3WWYA 3VTZA 3TTWA 1RDFA 1A7JA 2QN1A 2YOHA 3AF0A 3A1FA 1K08A 5AXCA 3KD3A 1MOSA 3U4IA 4YDSA 1RKBA 1E4EB 2D2XA 5ER6A 2XJ9A 3RS9A 4UNQA 2ODEA 4K88A 3HGMA 1GPMA 3IUMA 4FC7A 3LK6A 2P78A 2WM3A 3CJRA 2PZGA 3ZHSA 2QVXX 2JLUA 2NZYA 1A5SB 3TWOA 5J4HA 1NJ5A 4Q16A 1JP7A 2FFHA 2RHLA 1RXVA 2UUBB 2VVTA 3E7WA 3U16A 1FFDA 2Z6QA 2OWDA 2EDAA 4BTEA 4YV0A 3T1TA 3H3FA 3UAYA 3BHJA 4XCQA 5DBHX 3TOCA 2I80A 4GOXA 2RONA 3RLIA 1RFGE 2WJGA 3G79A 5ALHA 4D43A 3C3KA 3S2YA 4EVQA 4LECA 4MB2A 4B80A 3KE9A 2K4MA 3DO6A 4I8DA 4LDQA 4CLHA 5BXQC 4HP8A 4JLKA 5DM0A 1NGSA 2ECKA 3FPBA 3KXIA 3ZDQA 1NVXQ 5FBRB 1CUSA 2HF7A 2VSYA 1F51E 2WWTA 3L8EA 4CQMB 5GGXA 2RAFA 3SZUA 2HL6A 3V1NA 1T13A 1V8FA 3MN1A 3W2HA 4X63A 4IGEA 2HCBA 1GZVA 1WXIA 2HRDA 1X7HA 2XTJA 2UZ3A 3H4TA 4FEGA 4HDMB 4LOIA 4G0VA 1AMOA 1XZJA 3WYAA 4DRXB 4BQIA 3CVYA 4L4UA 5DXAA 3HB9A 4F4UA 4R9UC 1FYWA 3VAYA 4EA9A 4A2QA 4RKQA 1PSWA 1K9SA 4IHJF 4AXXA 2P67A 2Y1XA 2F3RA 4KGXA 1L3CA 1B8UA 1U8CB 3MT9A 3HVJA 3PZBA 4LQ4A 3DNFA 3OC0A 5DW0A 2Y0BA 1BO6A 3K6KA 3ZE7A 2DULA 5CH3A 1GAEO 2GN4A 5KOIA 2EP8A 3VHQA 5HFJA 3O4GA 5B55A 5COQA 3ZQJA 2A6PA 1HMPA 3OO0A 4WAUA 5K3BA 4Q02A 5CCXA 4PZYA 3GO4A 1R0RE 1ZXLA 1EVYA 1IY2A 4EPWA 2XMZA 3C97A 1X3SA 4LWZA 1AHHA 5BQXA 2VRNA 5K3AA 5BRJA 2FPMA 3LO8A 3HWRA 2HFKA 5A0FA 3TFQA 2ADOA 2AJCA 2FW8A 1GZ5A 1IQUA 2HRRA 2P8JA 1F6BA 1WWKA 1EFCA 4RW0A 2SNIE 4QUIA 2W4MA 3EMVA 3EXHB 1IN8A 2GK4A 2WUEA 5G1PA 3FYUC 1XCMA 2GF0A 3FUXA 4FHGA 3PJGA 4IIDA 4FK8A 2VJMA 3FMPB 3D4BA 2H0RA 1GPWB 3EXG1 3V8MA 5JH7A 2CL5A 4FS8A 3IX7A 1RRPA 3ZZNA 1MJ5A 4A73A 1UH5A 1T3HA 3IODA 3Q8XB 4RK1A 1S2LA 3G7NA 3TE7A 5LJIA 4GQAA 5LA6F 1N75A 4OHOA 4EW3A 3EXFA 1M2WA 1Y6ZA 1BIFA 5GOZA 2I65A 4B84A 4ZTBA 1AUOA 4DCUA 2IHZA 3VVLA 4YUWA 3AJDA 1S3FA 1TUGA 2PLAA 1H2RS 4E3ZA 2OCYC 2M32A 2PZJA 5JRJA 4KFRA 2QYHA 3KKMA 4BJ1A 4MCIA 2XJ4A 2DQ4A 3CEJA 3I05A 3VU0A 3T52A 3O90A 4WACA 5GONF 1UADA 3BRQA 3U4QA 2F48A 1GOTA 1C14A 3OCJA 3OIVA 3RCBA 3RAFC 3P4YA 4BKQA 5J2TA 1A69A 1LLFA 1MAHA 3TEFA 5DU2A 3MPOA 4R2XA 5EXEA 5CLIA 4YMHA 3O8NA 3AONB 2XXBA 2PH3A 1S8AA 1U0SY 2ZW9A 4XI9A 5C32A 1WUKS 4Y6RA 4C2AA 4P93A 3RIHA 2Q4RA 2VCHA 3ME5A 4TT3D 2XH8A 4MGIR 2HA7A 4G6ZA 3AX6A 1YRQA 4PU0A 5IXYA 2JLZA 1ZWKA 6REQB 1FUUA 5FOVA 2EQ5A 5CVVA 3KZKA 1FRZA 1JAZA 2ZVDA 2YWCA 1Y5MA 3KUUA 4RZIA 1UDAA 4BMVA 2C59A 1BDIA 3DTNA 2DBYA 3H87A 2CL0X 2EZUA 1Q7RA 2HWXA 2YN0A 4S1NA 4EB0A 1AMUA 4RTRA 5DE3A 1MAAA 4GI1A 3WJAA 2B35A 2R66A 4G3XA 3D5TA 4OMFG 5LZ5A 3H4IA 2DE0X 3VVCA 4MUFA 2J9GA 3ESRA 2WYWA 3PFFA 4OUKX 1G2OA 3TTUA 2J08A 2JJ2D 5CEJA 5L7TA 1UJMA 4CF5A 1S8FA 4AN1A 3EZ6A 4F4HA 4S24A 2ZSDA 2PMFA 5IP5A 1H66A 2OBFA 1TEXA 4BV9A 5DSZA 1IN6A 3A9VA 1O89A 1QIHA 2ZK7A 3KQQA 3L93A 4JBNA 4U8GA 4UUNA 4X0EA 5EE3A 5IAEA 1MP0A 4N3BA 2Q8PA 3D81A 1G17A 3KHTA 3R9IA 4Q1BA 2HRZA 1BXGB 1KERA 4PV7A 2ID9A 3Q2OA 1G6OA 4FZ3A 2HIGA 4W82A 3H9UA 5G1NA 3RVJA 3BFKA 5CDUA 1F1JA 3K31A 3MUFA 3R0JA 3IP7A 2NO4A 4LQCA 1WLYA 3QVUA 2BLLA 1LDEA 1UR5A 3CKLA 1F2TA 1TQ4A 5ALYA 4EATA 5F7XA 5AKKA 2BGNA 1O95C 1U9IC 4LV8B 1RP7A 2BFPA 3ELUA 5B2FA 5M34A 2FN9A 5BQOA 4IF6A 3QUTA 1ZD2P 4XJXA 1G8AA 4CLDA 2JARA 3JQAD 3MAAC 1Y9JA 4BRSA 2C29D 4I66A 3DPUA 4BGVA 3JQQA 1ANKA 4MVCA 1ADGA 4KO4S 1UDXA 2YRFA 1XRSB 4QNRA 4DDTA 5TQ0A 3L8CA 5J9FA 4E1VA 1SCIA 4KB5A 4ZI7B 1DAEA 5C8ZA 1WPRA 5AVXA 3N3AC 2QD4A 4LF9B 2JHFA 2C5EA 4M8NE 4G5YA 1V3VA 1YUBA 2G04A 4IFBA 4ZT6A 3VPHA 1J21A 5KOJA 1W36D 2JGDB 1KH2A 4DQXA 4JGGA 3DD5A 1XE3A 3HXKA 4DPMA 5JQWA 2MINA 1SG0A 2YZ7A 4JN6B 5H7XA 4A6EA 5L4SA 4EF6A 2P3OA 4QJ5A 5JD4A 3U44B 1R6DA 2AB0A 1W2HA 3K5HA 1TA9A 3ER6A 5U1PA 3NCTA 3CUYA 4S0ZA 5IBPA 3TI7A 2IS6A 3ZWYA 1NAHA 2QKYA 2HIHA 4FYWA 5LL6P 3K2QA 5FWYB 3JWPA 4L9WA 5FJJA 2B69A 1EYZA 3WKEA 2DX7A 4GVPA 5KNBH 3ETGA 4Q1FA 4NCKA 4N03A 4QHYA 4GWKA 2IITA 1M0WA 4I7EA 4EJ2A 3PQ7A 4BKMA 4OLJA 5M5BA 5HHTA 3ROZA 4N5NA 5ENDA 3EC7A 3GUUA 5JH7F 1G3RA 1PE0A 1DX4A 4GO1A 1C41A 3V4SA 4BFUA 5TEWA 3DZKA 4V1CB 5TY0A 1M67A 3HEMA 3NEYA 3NOQA 4ZRMA 1XEWX 3WJ7A 2G40A 2JEYA 2GM4A 3ZR4B 5IYZA 2WNHA 4P98A 4OHYA 4P36A 4Q3OA 2C5LA 3LF1A 4GOND 1K4MA 2O4UX 3MIIA 4PO9A 4ZK2A 4ENWA 2QT1A 1GXSA 3A6GA 3QNMA 1G66A 2QUIA 3SFZA 2PN1A 4QDZA 4N48A 2V7QA 1CZOA 2WEKA 2VPXA 2AMYA 4AURA 4XLZA 1UDCA 2FSHA 3BSFA 3NATA 5F2EA 3FMIA 1Z06A 2G82A 3KFLA 1N1EA 5F9HA 1A27A 1BD4A 3QF4B 3C3WA 4C29A 5CLHA 1QRTA 1A97A 3MCVA 1Z5ZA 5K3CA 4RDIA 5BMOA 1YL6A 1J0DA 5DNAA 1AM4D 5EJ4A 3C5HA 3WGIA 3H13A 1CP2A 3IEIA 3UT6A 4AROA 5BN5A 5TR9A 4ALJA 3KR0A 4QYIA 3RAEC 2IIQA 3ZLJA 3EQ9A 2JLVA 3TAUA 2QG4A 3D2BA 3FPJA 3LDFA 3U26A 1ZOIA 2QJTA 2FPUA 4OU5A 2O23A 3L7OA 4ZXPA 2ZTMA 4OTZA 2JFPA 5KTPA 3ZY2A 2VRCD 1XG5A 1VKNA 2J4FA 3IP8A 4LHSA 1U94A 3KWLA 3S2FA 3F4LA 4CTNA 4QTYA 2QI9C 2AQHA 4H4CA 1UEXC 4J0EA 5GAJA 4CQLB 4C1NA 1J0BA 3D8RA 2HA6A 3QPDA 1G3IA 1OR8A 2MSWA 3QPCA 3Q8WA 1EGHA 3HI6A 1FNBA 4MR7B 4DV7B 3S70A 2E1PA 1XN1A 1C3OB 1DJLA 2BI8A 3F9RA 3L5KA 1LB1B 2QQ0A 3B85A 4NS4A 4RZ3A 1MX1A 4AWBA 4BX3A 2A14A 2QN2A 1UKZA 4KGZA 4YJHA 1E98A 2WK1A 3RSSA 3WTCA 1Z0DA 1CUHA 1R6BX 3VGPA 4Y1FA 3K3PA 1FF9A 2NTNA 1TT5B 2BGIA 5HFNA 4D56A 3KKNA 1XGKA 1P1BA 3D8TA 2CNKA 4UARA 1PNTA 1ZNXA 4C7OB 3STUA 1T0UA 2YJNA 2PKYX 3DGEC 4ACBA 3ZNQA 2JHPA 2R2AA 1CZHA 2EW1A 2PGIA 1Z4PX 4R0VA 3PXEA 1EUDB 4G5GA 5EERA 5IJ0A 2WBLC 2GD2A 1DWUA 4TKMA 1M7HA 4MZDA 3F74A 4O2RA 2FSSA 2B8JA 3TQSA 4ALNA 1SXGA 1AXRA 1E6EA 3DC2A 3FYDA 2JA2A 3LIIA 1I0IA 2B2CA 2VDQB 4KRGA 1E5XA 4FSDA 1HT2E 2ATXA 3AI1A 2VLIA 4F86A 2IYRA 4A1OA 4IIVA 2W42A 1YE8A 3OUZA 4RQAA 3GL9A 1L6RA 1W2GA 1GQOA 1WMAA 1E4VA 3C8ZA 2XPCA 4XYLA 1Z12A 4RD6A 2NUAA 5FIUA 4BLTA 4F71A 2QTBA 5DGTA 2OVBA 1R18A 3RSHA 1IHPA 1Q0PA 2IU3A 2OORA 1MX3A 3DDSA 2A1TS 1ZISA 2ZRJA 3ZHRA 4UD6A 3HJCA 3Q9UA 1UKCA 4WNAB 2NO9A 5ENZA 5IASA 4NY1A 3STWA 2EWMA 5G53C 4CTJA 3ZS8A 1TAGA 1BEUB 1JYSA 1K7EB 4NJEA 3V2HA 1PTJC 5DKFA 1FE8A 3CVVA 3KU4A 4P7FA 2VNSA 3THOA 1VPEA 3OM1A 2QTLA 3LC1O 3L7NA 4FIZA 1JDJA 1GZ7A 2EX0A 4G5FA 4KLNA 4LGMA 1F8FA 4UULA 4B33A 1I2ZA 1DB3A 3AJ8A 3ENQA 4RJLA 1WXFA 2ZRBA 4HTAA 4UEWA 4TVKA 5E6RA 3OQMA 5JNVA 1C8KA 2CY0A 2G0TA 3R5JA 4DV6B 1JUDA 3Q7RA 5I9MA 4ECAA 1G5HA 4ARZB 3G0DA 1YXMA 5M7EA 4FMPA 3ECCA 4MQ6A 4INAA 1G9SA 4F2WA 1F8UA 4HWSA 1IAVA 4U7GA 1DEKA 1OLUB 1HE4A 1NT4A 5ALQA 4G81A 3VHXA 1PT9A 3FB1A 1EE1A 1F14A 1FVFA 1LJ8A 1R3DA 2G76A 4TUYF 4WVLA 1DAHA 2CD9A 4CL8A 5AIBA 1A8UA 3FN4A 4LBVA 4QL3A 1T9AA 3RO7A 4A16A 2ANCA 5FUQA 3A27A 1B00A 1D1PA 4QYSA 4ZPXA 4F6RB 1WKVA 1GYQA 4NBTA 1FIUA 4P4GA 4BNLA 1G98A 1RRGA 2D2IA 1P9OA 1E7SA 1QP8A 2BY4A 3O1IC 1U8TA 3D2AA 3JV7A 2ZRDA 3ANNA 2X2EA 2Q1TA 2E21A 1EFRD 2HQ1A 3WNDA 1PJ4A 4GYYA 5E4FA 2AWNA 1N9GA 1RQNA 3QU2A 4WDQA 5K0EA 3O84A 3W2IA 5IEJA 1OJLA 1D2EA 2JKVA 1QPBA 2X9LA 3AI2A 3D6FA 4PNPA 5DO9A 1RFLA 2O1SA 4MI9A 2G1UA 1FJHA 1T8UA 4LX0A 1QAMA 2QGNA 4OH7A 4R0MA 1SK8A 5KEIA 5KJ6A 4YI3A 1M5RA 3BFXA 2L0XA 2ZUUA 5HIJA 1AGPA 5BOSA 1T2DA 2CF5A 2OQIA 4BMXA 2ZSIA 4L74A 1IBRA 2XUOA 4INPA 1Y4DE 4R69A 5DHFA 5EGSA 1E61A 1PT7A 5CLFA 2VHJA 2Z04A 1B7GO 3H0KA 3I5MA 4KO8A 4NVRA 2IH2A 5EHXA 2NZ2A 4PZLA 2RAPA 3ZHQA 1NUSA 1Y6JA 3I6QA 2R48A 3IAM1 3M2TA 1T5IA 3I34X 2PH7A 3LM8A 1LWNA 1IOZA 4LGVA 1TI7A 1TYDE 1ZZEA 3TW4A 1B6TA 3NHSA 2EFEB 3IE2A 3LUAA 2X7JA 4R7ZA 3SDSA 5KNLA 2WSBA 4PLZA 4EF4A 1OZ0A 1C7JA 3U1VA 1U2EA 3NIGB 3L4BA 4KDEA 2BDTA 2ZFUA 3JVUA 1KDVA 4CR7A 4OX9Y 2REQA 4JLVA 4AYWA 4XXHA 1HURA 2RG1A 3U3XA 4GQBA 5HE8A 2XTAA 1TPYA 4UBMA 5B58T 3AIOA 3GCXA 1QH1B 5AVZA 1YUNA 3N7TA 4JKOA 2FPGA 1ZPDA 3QNUA 1Q3KA 3BXPA 2YVLA 1EWYA 4D9KA 3LP5A 4L16A 3QVOA 3ZWKA 4X41A 3AVYA 2CHEA 2GAFA 1XA4A 3KKEA 4WCFC 1H6DA 1JR4A 1XKTA 1STOA 4I50F 3ZCSA 2OE2A 2RGRA 2Q5OA 4QODA 4EY3A 3UK2A 2EFCB 1PZFA 1H6CA 4Y6OA 2Q2NA 3B13B 3FPSA 1PHPA 1X42A 1GFWA 1M6NA 1W5BA 2JFXA 3DJFA 3Q40A 2ZG6A 1WUTA 5HIAA 4QOJA 4XE5A 4KQKA 1E2KA 3IOBA 1M0EA 5L4LA 4B47A 4R1OA 1U2QA 1KH3A 1Z6PA 2SCUA 2VOEA 3W2FA 2D2EA 2C2MA 2VYNA 4ZQGA 1A0OA 1IIBA 4O4HF 4PG6A 1YRLA 5FF9A 1KHTA 3L1KA 3Q3GE 4KLCA 3DBHB 3B7PA 1KMNA 2PIAA 3URMA 4P1ZA 2F62A 4MUYA 3S2EA 5HIKA 1PHRA 3EW7A 2JFBA 4JVMA 1FUIA 3DTVD 5KYKA 3AR3A 1YI0A 4DF3A 5F5LA 2R85A 3E82A 5FA5A 3P9QA 3M83A 3K9HA 1H9AA 2RHBA 4DLSA 1F20A 3H99A 2ECPA 5DTJA 3TLBA 13PKA 1KIMA 5L53A 5L6MB 2I87A 4J0DA 5C18A 2H1IA 5AVOA 3PNQA 4OHVA 3R7AA 5EKXA 4CKYA 5JASA 4ND4A 2C9OA 1Z4LA 3DNMA 4I19A 3FNGA 3VOSA 5C81A 1DP4A 3G17A 2QQFA 1O5TA 5BVGB 1NBME 4XR9A 5AKHA 4FDAA 4AS1A 1QTQA 3NHJA 1LPAB 4CT4B 3RR2A 2XV1A 5K1ZA 4QVGA 1U7UA 3GVXA 5C7LO 2I7XA 1NI3A 2RFLA 2ZB2A 4WKOA 4Q3CA 1C0IA 3L1HA 3ERCA 2WQ6A 2R8RA 3WGTA 1KSGA 3L4EA 3QLEA 3EZLA 1EJBA 2XB6A 2WE8A 1MVLA 2P9ZA 1L3BA 4EG4A 3A1CA 3NPMA 3WHIA 1DKOA 1XDGA 4PO1A 3KAPA 2H1VA 3GN1A 2NO1A 4R41A 1U0JA 4J0FA 2HLDD 1MB4A 1Z9BA 3NYWA 4BAGA 5A03A 2JGJA 3PVCA 1BSVA 2ZSAA 4XDHA 3DEZA 4AJHA 3TNDA 3TR0A 3GRZA 1PGQA 2XWBF 3OPYI 2ODBA 3PWZA 3HVKA 4IXDA 3LH5A 3QFCA 4R8VA 1QH8A 2R6CA 4I5FA 3UK6A 2RGGA 4LMRA 4WLEA 5ARBA 5TS3A 2XWQA 3I8SA 1NQUA 2DFTA 2Q4DA 4B3IA 4LHEA 3HZHA 4D9JA 2H11A 2IY8A 2HO4A 3BE8A 4MUAA 2JJYA 3BL5A 3VYTB 2QGFA 4L0QA 2HQBA 1XU4A 5JVDA 1NLMA 3A37A 3MTBA 4CBVA 4FGUA 3AQ4A 2VZ8A 3WS7A 2PQ2A 2DHEA 3WWOA 3I28A 4JLMA 3HDQA 2W70A 5KYNA 1G4HA 2XW6A 4R3WA 2O2SA 3BHMA 1QCDA 3N59A 1PSZA 4FJ2A 5TVGA 3R8CA 1C7RA 4I8XA 1Z5VA 2Q1SA 3KYDB 4EKEA 3SEZA 4ENTA 5HJ7A 4QRDA 1EUCB 2JCSA 3P5BA 4PZ0A 4KVGA 1GGJA 2W4QA 7REQB 2FUKA 3QPVA 2ZIUB 3VSBA 5TS2A 1IOLA 4OHUA 1ZJ4A 1L4NA 4TMFA 4WY2A 4L78A 3AFIA 3AF4A 4TYNA 3HDGA 1GG5A 3TOVA 3HGTA 1BQEA 1U7TA 3F0TA 3K0FB 3QUSA 1QKJA 4XIYA 3OP4A 1AX9A 2AWOA 3GQVA 1YOVA 5EEHA 3JZAA 4KZPA 1KE2A 4KZKA 4BQRA 1N2SA 1DV1A 1KA9H 3KSZO 2DT5A 1ZM9A 3AWIA 1YT5A 1E7RA 1KQ3A 3OTHA 4EABA 1PGOA 1E5DA 3WSTA 5HZMA 1PR2A 1FUKA 2GZ2A 3BA1A 2F3SA 3FVRA 4OP2A 4R7TA 1ZN9A 3VR5D 1TQ2A 2FEXA 4RABA 4Y2XA 1ABEA 1YR6A 1W8DA 4XVQA 2Y4NA 1J06A 1OX4B 2O8DA 3V2UA 1CS0B 1MDBA 1I51A 1ZQ9A 3B3JA 2B82A 2VBGA 4LHVA 1M10A 4YONB 1KMQA 5IJWA 1E2HA 1ZOPA 2JHCA 4L2IA 5JBIA 1YWGO 2YMLA 4WZ6A 5CM2Z 1EUYA 3I83A 5HDBB 3TOZA 4ZYWA 2Q2OA 2W5UA 2PT5A 5BSRA 3E7PA 1Y8RA 4QPZA 2V54A 5A9RA 2ZIZA 3O83A 4AF6A 2X86A 1DPGA 1GTG1 3WA6A 1X9IA 2FEWB 5TGTA 1PG5A 3BYZA 1KR2A 1EM6A 2OCLA 3JVEA 2AC7A 2IPNA 2IXTA 2GN9A 2PSDA 3SEFA 3OZ7A 5D1NA 5DOVA 1O08A 4JWTA 1BMFA 2IZOA 2PMKA 4ZVLA 821PA 5J2UA 2AVDA 3KQOA 2J7PA 2OZLB 1FFWA 2P5SA 3N53A 4MMXB 4EVIA 2DTDA 1DRJA 2GLUA 3G2JA 2LGJA 1N0IA 2I7VA 2YVAA 3BJZA 1I7DA 1A9RA 1O0SA 2FQ1A 3QWAA 1NLFA 3QHPA 4KJXA 3U3RA 2X1LA 2P6PA 1MO2A 4HWRA 2ZTUA 1DIHA 3WDSA 5AVUA 10MHA 4J07A 1ORHA 2AI2A 4L3WA 5J3JA 4WFJA 1G8PA 5ALGA 5K20A 3OCYA 2F67A 1SBYA 3VBEA 1CY6A 4KQ1A 5JS2A 1GTL1 3RHSA 1O6GA 3AOEC 4Q15A 1MO4A 3DHWC 2C98A 1I5RA 1A7AA 1XFAA 2NXJA 1W76A 1E9VA 3KB6A 3GU3A 4L51A 3I12A 5LUAA 4ECEA 3HNPA 4LZPA 4J6FA 5EIOA 1JKXA 2BEUA 4AUNA 5CFPA 4DV3B 1J90A 4BMDA 3E61A 3BWEA 2CLLB 1EKXA 4YP0A 1U1IA 1BMDA 1SVOA 1Q0SA 2OFWA 3ET5A 3T5BA 3BRWA 1DBWA 4IJWA 3N1UA 2Q9CA 3N9IA 4ALLA 2HC9A 2GO1A 3HPQA 5A3VA 4DA4A 3VNVA 3ENKA 3G59A 4F85A 2DR0A 3ENZA 1GCUA 4TL9A 1NLYA 4V3BA 4L50A 2F1OA 4MWBA 1M1UA 3TR5A 3K4QA 1QO0D 3I5AA 3S8YA 1XZCA 2I03A 2JLBA 2YN2A 3ZD6A 1UBCA 4NESA 4IDEA 1KJNA 1IQ0A 1OGJA 4GC5A 4CM4A 3RRMA 3LI2A 1NMSA 3KB8A 5AD1A 3W2EA 1XKQA 2EG9A 4AJPA 2IV2X 2QHXA 2K87A 1WXXA 1XWWA 3HR4A 4OHKA 1KMHA 1KR5A 3BDVA 3PUXA 2HA5A 1UKYA 1M2GA 2L69A 4FTWA 2C2YA 3ZXSA 3G7SA 2V1UA 4RE5A 1FDVA 4IFIA 1YZVA 3DTTA 2JAWA 3PQ8A 4NQZA 5TEVA 4E2WA 3HZRA 1E5TA 4ZREA 3SS9X 4F3NA 2YDXA 2O6HA 3FHLA 2KX7A 1X1EA 5JATA 1NRWA 5I9SA 4CGYA 4R1NA 2QZPA 4UHCA 3IO3A 1NHGA 4JDPA 2CN1A 5B7GA 4YIHA 3CTMA 2WPDA 4CEHB 2J33A 4KODA 1ZS9A 3RGWS 3FGZA 2Y9PB 3WV5A 1U5AA 3OLWA 3SKXA 3O8DA 1SG6A 2II6A 4G85A 4X6YA 3URKA 3V1LA 1YQDA 2WOJA 3IIKA 2CJYA 5JHHB 1CFZA 1O94A 2JCGA 3CEPB 1UJNA 2RG7A 2RGEA 3EXEA 4LA4A 4LOJA 5TGZA 1T5HX 3DBVO 4X71A 1YV9A 2FUG6 4MS3B 2QOEA 4DNFA 2VN8A 3WTBA 2Q6VA 2H9IA 3CLSC 4BBZA 2JAXA 3GLFE 4CIYA 4PG5A 3ZKWA 1HEIA 4H1HA 1UK9A 2W22A 1QHNA 1IC6A 3V1YA 4EUKA 5BT8A 5I3CA 5BYKA 3R4CA 5EE1A 3B6JA 4GR9A 4ENQA 5L3QA 4DLLA 3NM4A 3MZ0A 1GA4A 4IIXA 3LLUA 4KYIB 2OGTA 3RI3A 1DFIA 2VPIA 3FYCA 1TK3A 4WZBE 1OXVA 3ZJYA 2OV3A 3KJFA 4B74A 1O1YA 4WBXC 2Y77A 4LJ9A 1EFVB 1J2YA 2QORA 3IV7A 3JAWB 4B0OA 3NRCA 1N0VC 3F5FA 5KTNA 5CA1F 1P81A 2CXPA 1NP6A 1QFYA 3MBOA 2IIBA 5G4KB 3WK7A 3AM3A 4BFXA 2NP6A 1L5WA 2ZB7A 2WV7A 1ZRHA 3C6ZA 3JD4A 4TPKA 1VSVA 5FUBA 4B85A 3UJNA 1QQ5A 3Q8MA 2FUCA 2CVFA 2BDEA 3DVAA 1NVEA 4L4RA 4Q12A 1G8GA 2C8LA 1T34A 2NT3A 2YJ3A 1CUBA 4J4BA 1W85A 2HK9A 3U40A 2GYWA 2OAP1 2F55A 3Q3HA 4O08A 1YK1A 3GX1A 1BWPA 2OAQ1 4YRIA 3OM0A 2BFDA 1RTTA 4OOFA 4P31A 4YQYA 4RVFA 4BNNA 4W9MC 1VI2A 2G09A 4PHFA 1KYWA 1MG5A 3ONWA 2OZPA 4CUKA 1CF2O 1WULS 1X0VA 5I7SA 3DAPA 3GMSA 1QHHA 5TB5A 1GUFA 2F6RA 3AR9A 1HE8B 3OEED 1OXUA 5AVWA 3U5ZB 4ID3A 1U3VA 2OGZA 2CFIA 4UU1A 3OJFA 4KPGA 1O6BA 2BMWA 4FFVA 4JS0A 1XUOA 2X6TA 4JT4A 4P83A 4PW0A 3A0RB 1UC5B 4K1XA 4EEXA 1HTBA 4ZGBA 5BV1A 3EQ7A 3OCCA 5FPPA 1DJNA 2X2OA 5LXTA 2WWIA 3REQA 1C9YA 1MO5A 3T4XA 5ADVA 4ARBA 4F2HA 1ZGGA 1TZMA 4LRWA 1ESZA 5DGXA 1BA2A 2BT4A 2VJOA 5G0VA 3K2BA 3SXPA 4EM6A 4G5HA 3HM9A 1M1ZA 3PTAA 4RM2A 2Y1CA 4HR7A 1P7VA 3TZQA 1W96A 2Z4TA 3CNQS 4RIHA 4XCVA 4IXTA 1XXLA 2FJ0A 3FNRA 3NALA 4LPSA 1UFOA 3JWJA 1ZRNA 1UM9B 2P35A 4NBKA 3MAJA 1MH1A 3EGOA 5IVPA 4YTEA 1S7GA 3AF6A 3KSDO 2OR3A 3I09A 4NOJA 8ADHA 5B3JC 1GTZA 1RNLA 4Y2PA 3UFXA 3D6MA 5CB4B 1TEHA 2D0IA 4ARUA 4BBAA 1X74A 3EODA 4HB0A 3MGAA 4UUMA 1EHYA 2HRQA 3NRBA 2QW0X 4MWOA 3AI3A 4PLCA 3FLBA 1DVRA 3HSKA 4YJ3A 5DLPA 4MDYA 2FWAA 1ZUIA 2YWEA 1W94A 3T95A 4LJRA 1H8ED 3RYCB 3CG4A 1D7AA 4GAEA 4J43A 2XEDA 4CMEC 5AWFC 1G5IA 2O7VA 4B7ZA 2HNAA 4IDPA 1M72A 3DQZA