4BATA

Structure of a putative epoxide hydrolase t131d mutant from pseudomonas aeruginosa.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
296
structure length
296
Chain Sequence
DPLLPGFDYLTLHTSAARLRVAVKGSGPPLLLLHGYPQTHLAWHRIAPRLAEDYSVVLADLRGYGESRALDEEGADYSKAALARDQLETMGQLGFERFAVIGHDRGARVGYRLALDHPQAVAAFVSLDVVPILDNWAAVNKVFALNAYHWFLLAQPYDLPERLIGADPEHFLDYTLRRMAQGRDIYHPQALESYRRAFRDPAVRHAMCEDYRAAVGVDADADQADRDAGRRLQCPVQVLWQERPYAAGQHPLEIWKTWAGQVEGAAIGASHMLPEDAPDAVLEHLLGFLASHREAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Putative Epoxide Hydrolase T131D Mutant from Pseudomonas Aeruginosa.
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Hydrolase
molecule keywords PROBABLE EPOXIDE HYDROLASE
total genus 114
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2012-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4batA00
2BUBA 4WJLA 3G7NA 1JMKC 3E4DA 2QVBA 4P93A 3NGMA 3R3YA 4Y2QA 5DNVA 3WL7A 5E2IA 1FFDA 1LBSA 3HI4A 5ALWA 2PVSA 3I2JA 2RAUA 2WU4A 1EINA 1UOPA 4PV7A 3CCBA 3HC7A 4OCZA 5DTJA 4KAAA 4BC0A 4ZREA 5AOBA 3SWWA 1W1IA 1MO2A 3Q8WA 4JEIA 4FBLA 4DSZA 1Y37A 1IUNA 1IZ8A 2O2HA 5JIBA 1JJBA 3KWJA 3BJRA 1BU8A 2WTMA 3V1MA 3ZWQA 3IIIA 1BN6A 1JJIA 2Z8XA 5FOQA 3PUHA 3FVRA 4H7JA 4MQMA 2CJPA 4EY6A 2OCLA 2OGZA 2WFZA 5ALEA 2PX6A 1VJ5A 1AQLA 1YB7A 3I1YA 3BE8A 3OG9A 3WA6A 4BCDA 2RI6A 2YYSA 3PE6A 4QZVA 1VA4A 5CH3A 2OAEA 2XQJA 2WKWA 2XMRA 3ZI7A 5IVKA 2HA7A 4HRXA 4PF1A 2WIFA 2BUAA 4UFOA 5AO9A 1XZMA 1THGA 2VAXA 4B7ZA 4FMPA 5CXXA 3D2BA 4MYSA 2WUEA 2DSNA 5D3KA 3G0BA 1VE7A 1G5FA 5LKRA 2HU7A 1G66A 1JT2A 1FFAA 5FXMA 3ESDA 3DKRA 1FSSA 1Y7IA 5EIEA 2VA9A 1EK1A 5IKXA 4Q34A 3DL4A 3BF8A 5K3AA 2XMCA 1F6WA 1EVEA 4HS9A 4CIBA 4C6HA 4Y2VA 5LZ5A 5AI4A 2XMGA 4RE5A 5JALA 3MVEA 3KOOA 2GZRA 1R50A 4WY5A 4KR0A 2WG0A 1UK9A 2XUOA 1XLWA 2WHQA 3KD2A 1CUDA 5K5EA 2WFLA 1K6EA 1ZJ4A 2O2GA 3SK0A 2ZYIA 5J3JA 1CUCA 5E4TA 4RE6A 1MT3A 2QXTA 4H18A 3F98A 3OM8A 4WFIA 2XLBA 3ESBA 4B81A 1LNSA 3OPMA 3FBWA 4DMFA 2GYUA 1VOTA 2PU5A 3OURA 3M82A 2B9VA 4AB1A 1CVLA 4OUKX 4BTLA 1E5TA 4QDXA 1W4LA 4BZZA 5HZGA 1X2BA 3B12A 4V2IA 3C6ZA 2WJ3A 4J3JA 4OB7A 2PSJA 2OAGA 1XZGA 3QVMA 3I28A 3O4JA 1GZ7A 4BDSA 4WFJA 1EB9A 3FCXA 1UKCA 4K6GA 1SCKA 3QM1A 2VAVA 4NMWA 5HKBA 2OLEA 3I6MA 1AC5A 4BAZA 3WJ2A 4DSAA 3WK8A 1CUGA 4KAJA 1Q0ZA 3QPDA 1H2YA 2OCGA 5K3DA 3NOXA 3V1LA 2XUKA 1NX9A 5H3HA 3V48A 3VDXA 1LPNA 2NW6A 4QE3A 1FJ2A 1YA8A 4B0PA 1LZLA 4UFNA 4J0DA 4H7IA 3VKFA 1ORVA 1BEZA 1BROA 4Q3KA 3WIOA 2DQZA 2XMQA 4MEBA 3WMRA 1U65A 3I2FA 3R40A 1H2WA 4ROTA 5EI5A 2JGEA 4P92A 1LPSA 3WKDA 4Y2UA 4G5XA 3ESCA 3WWEA 2Z5GA 4W1QA 4DMHA 4X00A 5ALMA 4G9EA 2QUAA 1C7JA 2C58A 4G4GA 3DQZA 1WB6A 1J07A 5JAUA 4FNGA 3U1TA 1EH5A 1YS2X 2VQ6A 4X90A 4QDTA 2IIVA 2DHCA 3JYHA 1L7RA 1Z68A 1CPYA 5AM2A 2FUKA 1QONA 3K6KA 2XQIA 3G9UA 2FX5A 2HFJA 2AXEA 2OGTA 1THTA 2IITA 1CLEA 1RP1A 1Q83A 2WM2A 3AILA 5CRIA 3WKAA 5ALYA 1VE6A 5DLPA 2V98A 4FFWA 3PF8A 3R3ZA 4QEKA 4H77A 2UZ0A 3OC0A 1BCRA 1XZJA 1QIIA 2XUFA 3E1GA 3GROA 2ROQA 3LLCA 4BAGA 2HA5A 4FHZA 2QRUA 4PSCA 4PQEA 3TRDA 2HU5A 4LXGA 4LYDA 3STXA 1ODSA 5HQ3A 4WDQA 1B6GA 4AO7A 1WM1A 2FJPA 2P8SA 3WK7A 2XLCA 1AGYA 2WIJA 1UWCA 4X3CA 3O0DA 5AOCA 4J0IA 4AN0A 1VKHA 2Z3WA 1QO7A 4WY8A 2ZYHA 3T52A 2HU8A 2VJBA 2AJLI 1EHYA 3QPAA 4QLAA 4H7HA 2RONA 2V97A 3M81A 4DMCA 1A88A 5T4BA 3P2MA 5AI5A 5ALIA 4G4IA 1QFMA 4E15A 1WHTA 3BJMA 1XLVA 2G5PA 5C7YA 5AICA 4MEAA 2JIDA 3M83A 3H1BA 1XZIA 1G42A 1X70A 1XRMA 4OYLA 1DX6A 5I7UA 3RARA 4QDUA 1ACLA 5HFNA 3B3QA 5FV4A 5A71A 4GW3A 5CT5A 5EHZA 4GLBA 3G9XA 2QUBA 4AN1A 3LIIA 5CTAA 4UHFA 2WU3A 1DX4A 1E66A 3IUMA 1HDEA 4UFPA 3S2ZA 2C5FA 1XQXA 1JKMA 1GGVA 3K2IA 3IULA 4GECA 3I2KA 5EHNA 3AUKA 3WKCA 1NU6A 3FWHA 4KRYA 1WB5A 5ALHA 1MJ5A 4BBZA 4G8DA 5DYTA 3R0VA 3QBJA 1A8UA 1ZD4A 3AZQA 3H1AA 1HQDA 2C5GA 3BF7A 4H7FA 1TCBA 4AZ0A 4CG1A 2QMQA 3GFFA 4IQ4A 2JGIA 3D2CA 4M0EA 5AIBA 3HLKA 3HEAA 5ALXA 2JGJA 4ZV7A 5CT9A 3ESAA 2RHWA 5JAOA 2GBGA 5HQ3B 4CG3A 4J0CA 3W04A 1E3QA 3BIXA 5HCUA 2QS9A 4AX4A 4KE8A 5A62A 2J3DA 5FP0A 2I3ZA 4UBMA 5AI8A 4QDOA 2PU7A 5ALLA 3KDAA 2V96A 4Y2TA 2I03A 4UHDA 1MAHA 2CEKA 3FYUB 4B6GA 5AKEA 5LKAA 5HF8A 5BV7A 3D5EA 1H2XA 1TIBA 1K8QA 1TCAA 3DYIA 1P0PA 3TJMA 1MAAA 5LYYA 3D59A 1PFQA 2WFMA 3DD5A 4IH1A 2CUTA 4U2DA 1BS9A 4WCVA 2JEZA 3DCNA 3GZJA 3HSSA 2ZYSA 4Q3LA 3G0DA 3W2TA 5C8VA 2PUJA 4G8BA 1MX1A 3W05A 2BUCA 2Y2UA 2VTVA 3VXKA 1JJFA 3EIOA 4BYMA 1XRLA 4TGLA 3HRHA 4B85A 3ZV7A 1GT6A 2AJBA 4FTWA 2HA3A 3AJAA 2XMZA 4UPDA 4CCYA 5CT8A 4GXNA 1EK2A 4LIPD 5ALVA 1E8NA 1XFDA 1QIDA 2HIHA 1EDBA 1T2NA 4KYVA 4WFKA 1WOMA 1SOMA 3G0GA 1P0QA 4J7AA 1LPMA 4KJXA 3WL8A 2YXPX 4QLOA 1DT3A 1JFRA 1ZIYA 4EBBA 5D3ZA 3LIPA 4LYEA 2I3DA 3RLIA 5KREA 1F0PA 3G0IA 2D0DA 3I2GA 1QIEA 3ED1A 3JWEA 2WG1A 1EDEA 5ALSA 3F9CA 3GUUA 3D3NA 1UT6A 1QGED 4C89A 3WLAA 4U2BA 1Q84A 1YR2A 5JD4A 4AO6A 3VVLA 1ZGBA 3C87A 3ZLVA 4BB0A 2E3JA 5YASA 4BCCA 3FVTA 1YSCA 1CUUA 5HF5A 1DWQA 2WTNA 1CUVA 1BN7A 2HA0A 4G1FA 4NZZA 3ICVA 3W9UA 1CV2A 1DQZA 2ZVDA 4CFSA 4TPKA 4K2AA 5C81A 1ZI8A 2H1IA 4ITVA 4GEGA 1DT5A 3DEAA 1XZAA 5AM0A 1C7IA 1YAHA 2ORYA 3GBSA 3IA2A 1WB4A 3WKEA 5ALJA 5AKGA 1OCEA 1J1IA 1ISPA 2PUHA 1U8EA 5FKJA 3ILSA 4AZ3A 5CT6A 5ALOA 1MX5A 1QZ3A 1CUHA 5JASA 5KWJA 3PF9A 3WK9A 2VF2A 2V9ZA 2EDAA 4OU5A 5ALTA 1HPLA 4DIUA 1CUJA 4JNCA 3A6ZA 4YK7A 1MPXA 2G63A 4JH0A 1I6WA 2FJ0A 1JU4A 3F67A 2OG1A 1H23A 4N8DA 2XQGA 3ICWA 3WL5A 3C6YA 1DWPA 3C6XA 3HJUA 2WIKA 4RPCA 1BEEA 2HADA 5CH8A 1QFSA 2QTBA 4KACA 4IO0A 1XZHA 3IUJA 2PSHA 2WHRA 4Y2PA 1HKHA 2PSEA 3WJ1A 3L1JA 1U4NA 1J06A 3WI7A 2WFLB 4K5QA 2HA2A 3BDVA 4DGQA 2HFKA 3PUIA 1TQHA 1TKRA 3A2NA 2K2QB 4QDZA 1E8MA 2QR5A 4N8EA 2X5XA 3IVMA 1N5MA 1P0MA 2XUIA 3G9TA 3PDCA 3D0KA 2VJAA 2PBLA 1CUWA 2CB9A 3R3WA 1KEZA 1XRRA 1F8UA 1LZKA 2BGRA 1M33A 3A2MA 5FPPA 1VZ2A 4OB6A 4EHBA 4ARAA 3O4HA 5HK9A 1DWOA 1W6RA 1MX9A 1YS1X 4LKOA 3TEJA 4L0CA 4MYDA 3DS8A 2Y1KA 2ZSHA 4NS4A 3W9BA 5LP1A 1HL7A 1VZ3A 5EHQA 5AK4A 5JZSA 4ZXFA 2JF0A 2C7BA 5DJ5A 2ECFA 4FOLA 4XVCA 3EBLA 2VATA 5JAPA 4OSEA 5AHXA 2XE4A 4ZRDA 5CBKA 3BDIA 3PFCA 3IDAA 2PSDA 2AJDA 4C4ZA 3QH4A 1CUXA 5A2GA 3HXKA 2HL6A 5K3FB 5DWDA 7YASA 4BCBA 2ACEA 3C70A 1BE0A 2OGSA 4BVKA 3KXPA 4UUQA 1ZJ5A 3IBTA 3I6ZA 5AP9A 1YB6A 1QTRA 4BRZA 5EGNA 1SC9A 3WL6A 3AIMA 4HXFB 2QXUA 3H2HA 1XQVA 2XMDA 3LP5A 3H19A 3IUNA 1DTEA 5ALQA 4H7KA 4KRXA 2VT6A 1XZBA 3CN9A 4PW0A 1GPKA 1QE3A 5HFAA 1UOQA 4Q82A 2WQZA 1IUPA 2H7YA 2BGNA 1WHSA 3FCYA 5SYNA 1L7AA 5I8PA 1QIFA 5ALNA 1N5RA 2WUFA 5D6OA 5LZ9A 3N2ZB 4LXIA 4L72A 3R3XA 4N5IX 1AUOA 5IVDA 1AMNA 4AXBA 2Y6VA 3AZOA 4K6KA 4C88A 1R4ZA 3ZPXA 2WSLA 4X7BA 3O95A 2CBGA 5CMLA 4C4XA 4MWSA 4FDMA 2B4KA 1TAHA 5HK8A 5BOVA 4FLEA 4HVTA 5FUMA 4TVKA 4Q05A 2ZJFA 1JMYA 4ZWNA 5EFZA 1IVYA 2ZJ6A 5T4EA 2J3QA 3AFIA 2Y6UA 4UHBA 3STYA 1K5PA 1T4MA 3MGAA 2PSFA 2HRRA 4LXHA 2JEYA 4KE7A 5A7HA 2RIPA 5K3CA 1ZI6A 3F8SA 3C8DA 2WUDA 4F60A 5EHXA 2Y2VA 4Y2RA 4KAFA 4F5ZA 4NVRA 2OQVA 4OB8A 3FSGD 3O9VA 1F0NA 4LHEA 3A2LA 4FLFA 1XKTA 3EQ7A 3WWOA 5K3EA 1GXSA 4OYYA 4BP9A 4QWWA 1UZAA 1ODTC 5AKJA 1UKAA 4UHHA 1XROA 5AKYA 1CUAA 4UBJA 2G4LA 2G5TA 5HF9A 3QZUA 3DL7A 4BP8A 4EA6A 4CIAA 2Q0XA 3CN7A 2OQIA 4HAIA 3H04A 5DYYA 1CRLA 1USWA 3HABA 4U2CA 3R3VA 4B9AA 2QZPA 2DHEA 5C8ZA 4X91A 4BC1A 4OU4A 2DQYA 3UUFA 5AKLA 2JBWA 3MUOA 1ACJA 1IUOA 5HF6A 3DJYA 3STUA 3SX4A 3E3AA 2Z3ZA 3RKSA 3W06A 5CURA 1JU3A 2HM7A 4J0JA 3BIWA 4X95A 3H2GA 5I9IA 2H7CA 2X76A 4B80A 1KU6A 4DTCA 5K3BA 4J0KA 1GQRA 3H0CA 4S0XA 4H0CA 1U2EA 3RM3A 4JYPA 4Z49A 3V1NA 4A16A 1YASA 2OXEA 3GA7A 4G4JA 1VXOA 4PSDA 4B84A 1W75A 4C4YA 1J2EA 1MTZA 3HZOA 3O9MA 4AQDA 1ORWA 5EIAA 4U2GA 3H17A 4YASA 2VEOA 1R9NA 4QWMA 2WILA 3O4GA 1FFEA 5ALUA 2CKMA 1UXOA 4H35A 1S8OA 1DINA 1O6GA 4DNOA 1LPOA 4BATA 3R3UA 4GBGA 5AM1A 3KWFA 4UBKA 5IH7A 1ZOIA 2WJ4A 5HKAA 2VSQA 3FYUA 1VLQA 4F0JA 3DKKA 5ALZA 3STTA 3G9ZA 5LLSA 3DDUA 5CW2A 2C4HA 5JADA 1GKLA 2R11A 5A7GA 3FLAA 2O7RA 4WDRA 3WK6A 2AJCA 4XWGA 2DR0A 4PNZA 4UBNA 4BDTA 5ALDA 3QMMA 1K4YA 1LPBB 5A7FA 3C45A 1LBTA 4N8SA 3D4LA 5AK3A 4HZGA 2RHTA 3N0TA 3M3DA 2I78A 5E4YA 1QIJA 1XZLA 2WUGA 4J03A 1QLWA 4FWBA 5DYWA 3L1IA 4ZGBA 4DLNA 1XRQA 2W6CX 3CCCA 4E46A 2QKYA 1JI3A 4H7EA 1RWQA 2JGKA 3VJLA 4UBIA 4GHWA 5DNUA 4B0OA 6YASA 3K9BA 1CUSA 3OOSA 2XUQA 5D7BA 2XUJA 1ZD3A 2O7VA 5AM4A 4Y2SA 3DOIA 1ZIXA 2OPHA 3E0XA 3FYTA 2OCIA 2XQKA 5LZ8A 4A23A 2PL5A 1QIMA 3DYVA 2GYWA 4B83A 2WJ6A 5EIHA 3D7RA 2CMFA 5LZ7A 2W22A 3HACA 2BFNA 3U0VA 1QTIA 5JARA 5FLKA 4BVLA 5ALRA 4X6UA 4PO3X 3WYNA 5JZBA 2VT7A 3ZLUA 4EY8A 2PM8A 1IMJA 1X2EA 5C8XA 3MUNA 3H2IA 4DNQA 1QIGA 4DMKA 4UBLA 1GPLA 2YH2A 2ACKA 5KBYA 4L3WA 1UFOA 4Y9SA 1VXRA 4XX1A 1FFCA 3WZLA 2XUPA 2BCEA 4BE9A 1CUBA 2GBCA 5ALGA 2YASA 4RNCA 5FDFA 1C4XA 4MXDA 3HYSA 4X94A 3B5EA 2JGMA 1GKKA 5AKKA 4INZA 1XQWA 1UK8A 4DYHA 4X6XA 4U2EA 3Q0TA 3WA7A 5FPQA 2WG2A 2EDCA 2R8BA 3C5WP 4X85A 3F96A 2D5LA 4ARBA 5AM5A 1R3DA 3C6BA 4CG2A 3STWA 5DNWA 4O08A 1W76A 3QMWA 3SC2A 3PICA 1MNAA 1XZEA 1HLGA 3BL8A 2HRQA 4EY5A 2DHDA 1NU8A 1SCQA 4W1PA 4XJVA 4OPMA 4YX9A 2H9YA 3LCRA 5JATA 1DQYA 2J4FA 5JD5A 1A7UA 1WPRA 2RGUA 3JW8A 3G02A 4ETWA 3NUZA 4B9EA 5CH5A 4X71A 3I1IA 3FOBA 5T4HA 1EXWA 1XZDA 3AIOA 3QPCA 1LPPA 3R41A 1R9MA 4M0FA 2XI4A 3UMJA 1R1DA 3AIKA 2B61A 1ZD2P 3I2HA 2J4CA 3DNMA 3GELA 1R88A 2B20A 1ZI9A 4EB0A 2BKLA 3EQ9A 1G4HA 2PKYX 4XIIA 4IH9A 5AKZA 2C0PA 5AK5A 1EA5A 4CCWA 4C01A 3NWOA 4OD0A 1IZ7A 3VJMA 4BVJA 1L7QA 4Y2JA 3IURA 4ZI5A 3BWXA 3H18A 3EF3A 4E11A 1EI9A 2HDWA 1AURA 1XKLA 3PI6A 3I2IA 4AMYA 1W52X 4QNNA 5BWBA 2QJWA 4U2FA 4HXGA 5IVHA 5ALPA 2VJDA 1K63A 1ETHA 1D07A 1LPAB 1EB8A 3WWCA 1VA5A 2XUAA 1QOZA 1SFRA 1QIHA 2ONCA 2C0QA 2XT0A 3QITA 1LLFA 4K6HA 5JYCA 3WWPA 1TK3A 3T4UA 2IX9A 5JD6A 3PFBA 4MWTA 5LIPA 5ISMA 2BAGA 4B82A 1OXMA 5AIAA 2HA4A 4A5SA 1H2ZA 2GBIA 3QMVA 1WCYA 3WK4A 3ANSA 4GWLA 1KU0A 5AI0A 2QJRA 2ZSIA 5K3FA 4PSUA 1A8QA 1LGYA 1B41A 1ZD5A 3STVA 3X3HA 4UHCA 3WQHA 3WIBA 3CXUA 1ZGCA 2WIGA 5KWIA 2GBFA 1UOOA 1CUIA 4G9GA 4M0MA 3DLTA 4BTVA 4BZWA 1P0IA 1GPNA 4QA9A 4IH4A 5ALFA 5AOAA 4FBMA 5IVIA 1CEXA 1E89A 3IUQA 2QT9A 1MN6A 3WZMA 1YAJA 1PJAA 4JYMA 4I19A 5AJHA 1AX9A 2VJCA 3FAKA 4C87A 5CT4A 4DNFA 3F97A 1CUEA 1N1MA 4L9AA 1CUZA 4X97A 2LIPA 4EUSA 1CUFA 1CR6A 4FLMA 4P08A 3VISA 3BXPA 2XMSA 3KSRA 4AO8A 3RK4A 1RYYA 4I4CA 1CUYA 4G8CA 2WLSA 3ZLTA 4DNPA 1A8SA 5LZ2A 2WHPA 3H2JA 2XQFA 1CFJA 3WWDA 2GYVA 3C5VA 3EQ8A 3V9AA 3FLBA 3OTQA 2EEPA 5F4ZA 4FNMA 2H7XA 4Y2XA 4KE9A 1XZFA 1FFBA 3C43A 5BWCA 2OCKA 3V1KA 5ESRA 5AH0A 1BRTA 2GZSA 1Q0RA 4BAUA 1PV1A 2ES4A 2DCMA 2Z8ZA 2HA6A 4UHEA 5FRDA 3WK5A 4IHAA 5JZ9A 4W9RA 1TRHA 2PPLA 1XLUA 1BCSA 3IB3A 2XUHA 1HBJA 2QM0A 5AI9A 4YPVA 3D2AA 4GDMA 2BJHA 3G0CA 4Y2YA 3LS2A 2AJ8A 1CQZA 2O2IA 3UUEA 3WYDA 1QO9A 3C8HA 5DTIA 3S8YA 1E8DA 1XQYA 3FSGA 4HXEB 3FLEA 3I6YA 5AI6A 4I3FA 1AZWA 4MQLA 4EY7A 4FFVA 4Q3OA 5A6VA 4RGYA 1O6FA 1ODCA 3YASA 5AM3A 3O4IA 4BE4A 2XUDA 4P9NA 5AKHA 5ALKA 1UK7A 3FYUC 1WPXA 2XUGA 3A70A 2WIDA 1EVQA 3G8YA 4J0HA 4W1SA 3QYJA 3L1HA 1TCCA 4X6YA 1XZCA 1AKNA 2HHAA 4UBOA 5SYMA 2WHPB 4GI1A 4MJ3A 4HRYA 2X8BA 1OILA 1H22A 4F21A 1SCIA 1CQWA 2DFPA 2XDWA 5JAHA 5AKXA 4X92A 4CI9A 4N5HX 1GQSA 1XRPA 2XMBA 1Y7HA 1EX9A 5T4FA 4EZIA 4DM7A 1MU0A 3ANTA 1XRNA 5E4JA 2QOEA 4E14A 1QJ4A 4W63A 1CIJA 3H2KA 1N8SA 4Q1VA 4D9JA 2ZJ7A 3AINA 4KE6A 4KEAA 4AMZA 5AKIA 1XZKA 3WKBA 4HTAA 4X93A 3AZPA 3VVMA 2JGFA 3VJKA 1UK6A 2CZQA 1MNQA 5LZ4A 4J0GA 4W1RA 4FKBA 1QIKA 1DU4A 2JGLA 5CXUA 3DOHA 5JANA 4ZV9A 4Y7DA 3TGLA 4BRSA 4EY4A 1YA4A 1ZICA 1UKBA 1EDDA 2XB6A 4H7DA 5AK6A 4JUIA 2ZYRA 4CCYB 1YCDA 3FNBA
chains in the Genus database with same CATH superfamily
1HG1A 1Z15A 2BUBA 2AYXA 4J1TA 4AMBA 3AKYA 2BJWA 2P11A 4BO7A 3PC8C 1G4UR 2O8DA 1GARA 3KOXA 5HUJA 3L06A 1OUMA 3JPWA 4NBSA 4EM6A 3I01A 3RVBA 3I04M 1V45E 3I9FA 2GRAA 5KWEA 2JKZA 3B3AA 2NP6A 3IKTA 2PVSA 1N6KA 3GD7A 3UAZA 2F3RA 1EIWA 1Q1ZA 4B3CA 3GK3A 4HTFB 2WU4A 1EFLA 1EINA 1UOPA 4PIMA 5EMKA 1RXSA 1CR4A 2IP2A 4G37A 1H1DA 1G7TA 1I3LA 3HC7A 1GZVA 1G3RA 2EJCA 3LL4A 1GHTA 3NU1A 4MHOA 4PS1A 4B5KA 1JSLA 3DAGA 1LNQA 1P74A 2YJ5A 3I6IA 1N0HA 1EKXA 3CA8A 2BDEA 3FPSA 4RW0A 5AOBA 1W1IA 1MO2A 1U7UA 1NE7A 3NV7A 3TFWA 3TZCA 3FROA 2ZRKA 4JEIA 5C1OA 5JNRA 4HDAA 2W2QA 1C41A 3SR0A 2LNDA 1Q7CA 1FY2A 3M6IA 1X1QA 3Q2KA 3AR4A 3PXEA 1IJKA 1QR2A 4EB8A 3NV9A 3AJDA 2HKIA 2QZ4A 3PHLA 4Q03A 5TVGA 3TLAA 4ER6A 4PSAA 1YZKA 3KDSE 1IXSB 2NSDA 3HSKA 4E1AA 5JIBA 2ZYUX 1JJBA 4IOMA 2J07A 2VBCA 4JXJA 4KXUA 3GIDA 3TW8A 5I48A 3K9FC 4RPLA 4TWZA 3TEMA 1H8ED 4HADA 3ICQB 3IIIA 1QHYA 3FY4A 4CLDA 1NSTA 1OX4A 4LRSB 5FOQA 2VJKA 2QEQA 2IUFA 4DV1B 4MQMA 2CJPA 3ZLJA 2JCYA 4G0VA 4B2PA 1S4QA 1WABA 2OVBA 2YN4A 4FHDA 3X1XA 3IE0A 1D2MA 2O8EA 1UFRA 2RAFA 1QRRA 1GO2A 3NBQA 4LYGA 2XVZA 3VPDA 2OGZA 3SQWA 4M9RA 2P68A 4KQ9A 4R8KA 1LDNA 1VJ5A 3OE7D 3OAAD 1BGWA 1AKVA 4B44A 5TPZD 4B8YA 2QX6A 1DKQA 1PT7A 2FUEA 3LGAA 3VKHA 4DPMA 2FN4A 4JUBA 4MJXA 1IB0A 3D6JA 2L2QA 1Z82A 1I2AA 3RUDA 4M0UA 4C4OA 2W6OA 3UKJA 1W48A 2W93A 3ZI7A 2Z1NA 5CCEA 1UF9A 2W2KB 2I34A 5B4VA 1CRZA 3RYHA 1Q14A 3O8OB 5J40A 1T8TA 2HA7A 4IMJB 1MC5A 4RZQA 4WE3A 1EQAA 4HRXA 4YYZA 5BQFA 2I80A 2BUAA 1YJ8A 3C1UA 3O1JC 3T1VA 1LWOA 1D0VA 4O2RA 1EWYA 1RMYA 4UFOA 1ZJYA 2C98A 1I24A 5AO9A 4BXOB 1THGA 4D26A 5LWHA 2YMLA 2VAXA 1QNFA 3BMCA 1ARZA 1V6AA 5DHQA 4Z5XA 1CXZA 5IWAB 3D2BA 3D7KA 3OE4A 4IXWA 1VI2A 2BFCA 1VE3A 4MYSA 5ERXA 5D3KA 3WHLA 4LOKA 2FGKA 4MICA 4XGIA 3FYHA 4IS2A 1G5FA 5IT0A 2DKFA 5LU8A 5LKRA 2MINA 1Y33E 3MB5A 1RYDA 2TSYB 2ZI9A 5FXMA 3S5UA 1Y7IA 5G4LA 2R4TA 3DMGA 3RQIA 1EK1A 4E09A 4E2ZA 3KLBA 5EIEA 3FNFA 3P52A 4C0XA 4CCSA 1ZR4A 4FGWA 2PZKA 4U2KA 1XDDA 4L2IA 3BF8A 3CJQA 1Q1QA 2QHXA 3CH5A 3JQ7B 4L27A 1RADA 3VH2A 3OPQA 4DCSA 3NATA 4G5GA 5BV2P 3JQGB 4DJDC 6GPBA 1U7DA 2PA3A 2PRJA 3L4SO 1K6JA 4HS9A 4ZPXA 1GM5A 1KHTA 1V8ZA 3O7WA 2RARA 4KRGA 1YI8A 1KORA 1GFZA 1KMIY 5G53C 3GG9A 2IHYA 5ES3A 3A9UA 5HIIA 4GE0A 1K5DA 4YP5A 4KBFA 1MVOA 2QX7A 2PZLA 2XMGA 3LVRE 4HWOA 1R6AA 1U2DA 2WSYB 2QORA 2YIJA 3D4BA 5LB4A 5A4DA 5K0BA 2FTKE 3WYCA 4NL4H 5DISB 3NT5A 3MVEA 4A2CA 4AZTA 4E51A 3TBKA 4N5NA 1R50A 3QXHA 4KODA 1C30B 2TYSB 4PAOA 5C4GB 2B0CA 2QP4A 5D6NA 4C4PA 3RAFC 4GI7A 4KR0A 2WG0A 4X8MA 2XE6A 4JKYA 1LS6A 3OM9A 4R1UA 4RA6A 1MHTA 1ESNA 2WHQA 1PR4A 1OYWA 3JQQA 4A8PA 1JQDA 3KQKA 1UMBB 1E4EB 5SV2A 1XEWY 2C82A 2CDRA 1G64A 2PBRA 5K5EA 4O4LA 3KR0A 2BHLA 1SG0A 5ESWA 4UPVA 4C0JA 3CRNA 3FG9A 1CVIA 2F67A 1VHQA 1OJLA 2PA0A 1ZM4A 1BS1A 1ZJ4A 3C98A 3QX7A 2BZSA 5DH9A 2O2GA 2WZDA 2W70A 1SQFA 4OBWA 1T9CA 4RAOA 5FTJA 2B8NA 2A33A 3AHIA 1OWPA 5IDXA 2AK3A 2HAEA 4ER0A 3KTDA 3RWBA 4BMZA 4WFQA 2V7EA 4RE6A 3H8VA 5IXJA 4QYWA 1XDGA 1AV7A 4H18A 1KYZA 4YXWA 3F98A 1I6LA 5FNVF 1SJ9A 1Z37A 2DPXA 4TSKA 2XLBA 3ESBA 3VBEA 1N8TA 1WPGA 4IZ6A 5F51A 3LPDA 4D0GA 1J2YA 3A8TA 4QBKA 1XA0A 3NXSA 3MYRA 4J2TA 3JATA 3OPMA 4U00A 3E22A 3UB4A 2IE8A 3V4PB 2Q5JA 4FGSA 1YBMA 3PVSA 2G04A 2JNWA 4HVLA 1E5XA 4ZZ2A 2RGYA 4TRNA 3W3ZB 3WNDA 1V7CA 3OURA 2DKOA 1X92A 2YJ4A 4CWAA 2DETA 1WUKS 4LF5B 3QU2A 4C0BA 5LQAA 2QTNA 1IJFA 3A6HA 1DSSG 2X0IA 1T43A 4UARA 4OUKX 2FQXA 4BNIA 4BTLA 4E07A 1WEKA 4F6LA 1KO5A 2XIQA 3PQ4A 1N2BA 3A1WA 4ZO9A 3IFSA 4ZK2A 5I7FA 2XGGA 3BB1A 1DIOB 1KYYA 2G0AA 3HFGA 3ZEIA 1WDWB 821PA 3A6JA 3K0BA 4CMJA 2ZM5A 4B34A 4ALKA 3MXTA 3NVAA 4B4KA 5NLLA 4FE4A 2X0FA 1E2KA 2BIFA 2HSZA 2EHJA 1F5SA 1GEEA 3SJCA 4JHLA 3DOUA 3KKZA 1MZVA 2QUIA 4Q7EA 3DC7A 3SQMA 3EZ9A 3WNVA 5CJ2A 1N75A 3WLRA 1QM5A 1BE8A 4BDSA 3FCXA 4DWOA 4F6CA 2OK7A 3QM1A 4GNKA 4NMWA 3BH7A 1RU3A 5TJ9A 2OLEA 3NLLA 4Z4IA 1CQIB 2QJTA 3P0RA 2VK1A 5JWRA 2GASA 2WABA 3A6GA 1BX0A 4OIFA 3WJ2A 4HDKB 4YJ2F 4F11A 5LSAA 4LYHA 1AUQA 1PE0A 1JGTA 4IGFA 1DO2A 2FLVA 3EOBI 3H9UA 3V1LA 2GPSA 2VHXA 2GPNA 3EYAA 1DOAA 4LCBA 4YONB 4CV3A 1YB5A 1ADFA 1TIPA 1VSUA 2ANBA 2LUOA 1O2DA 3OPYB 3LO5A 1MOPA 3L4JA 1RLTA 2BEUA 3WLMA 2GZ3A 4KLZA 4R2MA 3DVAA 1UAAA 5AK0A 3PC7A 3VDRA 3JS5A 4QE3A 5K8TA 4QELA 3OE1A 4EG4A 2Q4RA 521PA 5IJ0A 3LFUA 4H7IA 1G5HA 1A1SA 1V1RA 4F2PA 3CZCA 4A8JC 1BROA 1KR2A 3MT0A 4Q3KA 4FZVA 2QZSA 2VIIA 2O19A 1ZOLA 2V0GA 3QP9A 4GYKA 4CR8A 4PHHA 2R4QA 2DQZA 4YDHB 2JK1A 1J49A 2XOEA 4Z2AA 1HDIA 1DXQA 2FFHA 2PX3A 3IKMB 4TKVB 3WMRA 4AF7A 1KH3A 1U65A 4ZN6A 1P3DA 3BK7A 3OIGA 3I2FA 3NDRA 1GTMA 2N42A 2VH2A 3UMRA 3OEWA 4RZHA 2IQIA 1JR4A 1QO0A 3I9JA 1H2WA 3C14C 3D64A 1A8HA 3ZW8A 5FJIA 1DHTA 2QWXA 1U7WA 2JGEA 4YFVA 1BE1A 3TRFA 4TLDA 4TTVA 1LPSA 3ZBUA 4YV2A 4U7JA 3Q5EA 5C1BA 4HCJA 2X2PA 1KSGA 3Q98A 1JV2B 1RLOA 1S6YA 1XZ8A 1SOAA 3NC4A 3CEMA 4FT2A 4W1QA 5EZYA 4BJHB 2PMWB 4CMGA 4DMHA 4QRDA 1PNQA 2GKOA 3ZU6A 1VSVA 3PA6A 3DGEC 1PG5A 4JDUA 5AW9A 5LXTA 4PR3A 4PNHA 3Q3VA 3V32A 4TZTA 3LLMA 4DLKA 3I92A 5FR1A 1B0UA 1J07A 3W8EA 1FDWA 1NJ2A 3RKRA 2JD2A 4WPGA 1KOFA 2YHSA 2PH5A 1BH2A 1EH5A 2WU0A 2R1VA 1AD2A 4KIJA 5BQ3A 1B6RA 4TS4A 3DDZX 4DAEA 4IG4A 1VLZA 3R6DA 1DMRA 5HCIA 3UPTA 1ZM3A 2F3QA 2DMRA 1UFQA 2XGMA 4XQ0A 4BO0A 1L7RA 1QF9A 1SXJD 3VO9A 3WTCA 5CK4A 1JE1A 1CPYA 4OYHA 3ZWWA 5AM2A 2FUKA 1QONA 4TV9B 3IPAA 1K08A 3K6KA 3TQCA 1SXJE 3C6KA 4R2IA 3WY9A 5J43A 2DLCX 2Q5QA 4MX8A 3CZ9A 4D4LA 2PLNA 4RSMA 1O9BA 2OCAA 1YI1A 1YKGA 1RRFA 3ZUPA 1PJTA 3PR1A 2HFJA 3ONWA 1EFAA 3TZLA 3FNRA 4QYIA 2VVTA 1PDVA 1THTA 5HIKA 4CXMA 3ZWBA 1T0PA 3QWHA 3TLBA 2GVDC 1NOIA 2P27A 4KX5A 1A69A 3T3DA 4BMYA 4AJ9A 2FMXA 4Z9XA 3K20A 3K5WA 4YC7A 3U3MA 5CRIA 3AILA 4CM8B 2PKCA 4BVFA 1Z08A 1Z8NA 2XZDA 1Z8FA 4ODIA 1KTIA 1YFLA 3NUQA 1VE6A 3GJ0A 1AHPA 1SXJA 2QTMA 3W9SA 3KVNA 1EX7A 3DWIA 2E1RA 2IYZA 4OA5A 1AKYA 5CDSA 1UBUS 2P40A 2UZ0A 4ZMRA 1T2AA 3FVWA 4W7IA 3CIOA 4RS4A 1FS4A 3E70C 1QHXA 4YLEA 5FUWA 1UM8A 3PNOA 2FAXA 2R9VA 4YCSA 4HV4A 4W9MC 4RVGA 4U9HS 4FVTA 3UGTA 1QAQA 2UVQA 3HJCA 4D6YA 5IC5A 1ONBA 1G2IA 1VKJA 4FHZA 1PUXA 4KPUB 1GU1A 4I1SA 2B8JA 3WFZA 1EHIA 2JAUA 3DO6A 1CY4A 1TEZA 2WSMA 4HDQB 2I2CA 1R6VA 1ZLYA 1RKXA 2ZT8A 4LYDA 3I23A 4NBTA 5IP5A 1NYLA 3C8MA 3ENZA 4Z8XA 2Q45A 2UZ1B 4H6VA 2GH1A 2AR9A 1SXIA 3NM4A 1OYVA 2EJTA 4H1TA 4PC3A 2P5TB 5AVYA 3V4LA 4RDIA 1B6GA 4LNHA 1VLHA 5GM1A 3QK7A 3VSEA 4YJ3F 4E3WA 3H8SA 3LM8A 2AX3A 2NZYA 3CEPB 2IV7A 2FJPA 4JI7B 2BTEA 5E1DA 3ENQA 3LV8A 1HMPA 4RZUA 2ZZNA 2FRDC 1B26A 4D98A 2WIJA 3KB1A 3OCXA 3EGWA 2ZAMA 3FD8A 4JR0A 5AOCA 5JS2A 1CDDA 3R5FA 3O91A 4RF2A 3MIZA 3VNAA 4N3CA 3IOMA 5A6SA 2B69A 3N8NA 4BKRA 4N3GA 3EF1A 1IM2A 3FFTA 1PFYA 4N7RA 4ZCQA 2XCUA 2PR2A 1GPJA 2GD1O 4NCBA 4LXUA 1XYYA 3EMBA 4Q1BA 4LX8A 5CU7A 1PJCA 3MJSA 3GI1A 2ZYDA 4WY8A 4W82A 5DIZA 5L3ZA 2ZYHA 5C7IO 4JI5B 3T52A 2HU8A 2X22A 2W00A 2GHRA 1LBHA 2VJBA 4UE6A 3VPCA 4DZZA 4CF7A 3D6TB 2XW6A 4CE6A 4QLAA 5EXXA 1JEDA 2WTUA 3AWDA 5CX4A 5G0UA 4MVYA 4ER3A 3M81A 1CRPA 1A88A 1AGRA 3BEOA 4BX2A 3KSAC 3ASZA 5ALIA 4L51A 1PBTA 3UGJA 2J0EA 1VRVA 1K9SA 2JBHA 1TQDA 3CNBA 4Q4AA 1CCWA 1XLVA 4ZAFA 1OPXA 3T3HA 3ZDEA 1IAQA 4QTTB 1QWOA 5ER9A 1YTUA 1HDGO 3I45A 5KYUB 1MRSA 3LVFO 1EVKA 1OFUA 3KZCA 4MEAA 4JLKA 4ZO6A 3RNOA 4D9FA 4AZSA 1SCAA 2VDMB 2XD9A 2GWHA 4JMPA 2AQ8A 1U2TA 4GZLA 3R44A 1DX6A 3EASA 4DIOA 3BGIA 1N2ZA 3OJLA 3CBGA 1SBCA 4HLCA 2BISA 5I01A 2P9JA 1YH3A 4FFDA 4M1ZA 3TZEA 4EHAA 1G98A 3AB3A 2PGIA 4EZEA 3G8AA 4XUDA 3HCAA 1U9JA 2EX4A 5C37A 2IUSA 1KQOA 2CNBA 4XRGA 4IJQA 3LSTA 2AI3A 4I81A 2CLFB 4UDOA 4PFJA 3BA6A 3KSUA 1WUYA 1KK2A 1WVMA 2EZ9A 2ZBVA 1Y9DA 4M8LA 3RJTA 2QX4A 3L4EA 4PC2A 3IQIX 4OBBA 4XXHA 3L7NA 2P9TA 3UJ7A 1WTCA 2QUBA 3EDCA 3LIIA 1N7IA 2FEXA 1UINA 1DQRA 3L5KA 1Y9ZA 721PA 2ZJYA 4QGSA 3I8XA 2O8FB 2CXTA 1M2EA 2P5SA 4QPCA 1IH8A 3F9RA 4IF4A 3K32A 2Q6IA 1JIIA 1NPDA 2ZR9A 4JLJA 3TVDA 4FMBB 5AQEA 4PZZA 4QC2A 5EMHA 2OCYC 4J07A 1VLJA 2R2GA 4U7GA 3MRVA 4W8OA 5TPWB 4RF3A 1QAMA 4UDYX 1GGVA 4AIRA 1V71A 3ADPA 2WJIA 2YYYA 1L4GA 4GECA 4TYYA 2ZSBA 1U81A 5JY6A 2QA5A 5E2AA 4OLBA 1XTPA 4IUCS 1LVUA 3INYA 3Q4GA 1Z5OA 5EHNA 1U8CB 5AVTA 5KNBD 1JHZA 1N2OA 4FJ0A 3RUIA 2K5UA 4UVHA 4ZJYA 4MVJA 5EP2A 2PS3A 4G8DA 2BOVA 1QMGA 4HH1A 1E0DA 1SZJG 1YDHA 4FQ8A 1G20B 4AY4A 1N0VC 3JQGA 1J24A 3QVUA 3D8BA 2A4MA 1XAHA 3TLEA 2P7HA 4RPJA 5KX5F 2V6FA 4XB1A 1YRWA 2K4MA 4ZD6A 1TCBA 4L3OA 4HUTA 3AF6A 4XSGA 4RHCA 3GEBA 4IQ4A 3ZTYA 3H5NA 1H2BA 3B1ZA 1OIVA 2FW9A 2F3UA 4Q3DA 4PY2A 3KVVA 2CNWD 5JZVA 4WOJA 1AT1A 1ECGA 1Q0HA 2DUUA 1NOJA 4O1MA 4MV0A 1U9ZA 3G0OA 3MCTA 4U1RA 2IVFA 3K1JA 3VPAA 2PD6A 3FGZA 4UOEA 1R0WA 1RNLA 4Q6BA 5AVVA 3KR9A 5A02A 3IMEA 1D04A 3LW7A 3VKWA 4DC9A 2RHWA 4MVJD 3QYPA 5K4GA 3H4VA 4I4NA 4RD3A 4CG3A 3V1UA 1E3QA 2AQIA 3AK4A 3AFMA 3F7NA 4B3BA 3VR2D 3MCVA 1ESEA 1M5TA 1NUTA 1THZA 1YZ3A 1GRQA 1YB1A 2HI0A 2ACWA 2QS9A 3NIGB 4KE8A 3M1YA 4MP8A 3V8BA 3ZN2A 4CMEA 4Y9DA 4EG6A 3GLFA 2EZTA 3D8SA 4Q4HB 2OXCA 2R00C 5AI8A 5FA8A 1DRVA 1X1DA 2V96A 4LTDA 3VAZA 3H87A 4UM8B 4D82A 2BSQA 2H06A 1T1JA 2ZYTX 1N33B 4N3NA 3ZD9A 2DGDA 4B6GA 1O08A 3P32A 1II8B 4D9BA 1QV9A 1ZD8A 1TKCA 5BV7A 3AV0B 2V0NA 1QHHB 2FHSA 1A4IA 5EC8A 4PG6A 4C7MA 4YAUA 2W2LA 1H2XA 3L8CA 4N6GA 4R8VA 1RWBA 4KVFA 1F14A 4WEOA 2C4NA 3EISA 1QS0B 4LRWA 1P0PA 2G80A 2HYIC 2EU8A 3GDOA 4B40A 1RZUA 1WDMA 4KZPA 3D59A 1PFQA 1X1EA 3TQHA 2BH2A 4F3TA 1RJDA 3INTA 2AT1A 5KO2A 3DD5A 1K4MA 2Q0SA 1SC4A 4I3HA 1LA2A 5F7XA 1NI4B 4QUKA 4ZOEA 3GZNB 4IXMA 4FZ5A 4OLHA 3GZJA 1JQ5A 3JR3A 3LSYA 4TXHA 1N0IA 8OHMA 2JAPA 4MQFA 3GJ8A 1FSZA 2UZIR 1EBBA 2ZZKA 2JJ1A 5DN9A 1YF3A 3P97A 1VKOA 2A9JA 1T5LA 1CQJB 1MGPA 4A0SA 2ODAA 3CF2A 5G4KB 3ZVMA 1W8IA 2J6HA 2PUJA 2NO9A 1UIMA 2QU8A 3BMNA 3PDJA 1SEPA 4LZJA 4DIKA 2W2LD 1RLJA 4M60A 3RANA 1S2MA 4WMLA 3WV5A 2BEWB 2DVMA 2VPTA 5T5QA 4EI2A 2OHXA 1SXGA 1A2KC 3JV7A 4QGBA 2R6JA 3U56A 1LTQA 2PHZA 2KM1A 5IX8A 3G5LA 3KEQA 4HAXA 4C30A 3KJFA 5E6RB 1JR3A 4KV9A 3HRHA 2Z04A 4B85A 2J33A 2MTBA 2B9EA 2C2BA 2PJRA 2HA3A 3ROQA 3K35A 2XMZA 4UPDA 4ITUA 1A72A 4CCYA 2R5WA 4DJEC 3LQFA 3RHZA 3AG6A 1ZH4A 1ZCZA 3AYXB 4TTPA 5AW3A 1JYFA 2X9GA 1PZMA 2D2FA 5BR8B 2DBRA 1E8NA 1XFDA 1J97A 1WXHA 2YXEA 3Q6IA 3WOVA 4TYWA 1R0RE 2CKDA 2AEMA 4EH1A 2OHVA 4DLSA 4YWJA 5IT4A 2X2OA 4WFKA 1GADO 4LRYA 4H9GA 2WQ7A 4GQAA 1ZC3A 1DBWA 1SOMA 4TTTS 4G5SA 1P0QA 1MXFA 3B1VA 2QN2A 3MWKA 1C8BA 1RQ7A 1T1IA 3UXYA 3VQTA 4KJXA 1RAIA 4IXTA 4PLZA 1M6VB 5ADVA 1AUXA 1GG2A 4E70A 2I66A 1C1YA 1JFRA 3GA5A 5ESDA 3ORRA 4GKBA 3UT0A 3JAMA 4UTZA 2ZJOA 4X41A 2I3DA 2XKBA 2YQ5A 5AD1A 4I55F 4FOOA 3ZDFA 2D6FA 2XCTB 4TLMB 4CKBA 4LZLA 3ZDRA 4BLVA 4WA7A 5CIWA 5PGMA 3W6ZA 2PUEA 5KS2A 4OHUA 1CYDA 2GD2A 1UDBA 1MQ8B 5EMMA 4CR7A 4YRIA 3NONA 5CLHA 1EDEA 1Q1BA 3RPEA 1DJMA 3R75A 2H4HA 4WBNB 1YB4A 4OHWA 1KNXA 3RHFA 2C5EA 3ISJA 5IJ0B 3W9YA 4YV1A 1MJNA 3GUUA 3EEYA 3G2IA 3D3NA 1XTVA 1W581 3ABZA 4JL8A 3C8ZA 4PBRA 1JHOA 3U3OA 1FX0A 5HCNA 2H1RA 2LCFA 4MS3B 1Q84A 5TRTA 3KPUA 1FDRA 2R7MA 3OM1A 1WW3A 2W0MA 1NXTA 2ZYGA 3JASB 3PL5A 1O6ZA 1P1HA 1M1YB 2CYBA 3VVLA 2PJDA 3AH8A 2JFBA 4M89A 1NQ5A 1RLMA 1IRIA 1JPUA 2VBIA 3PRHA 1Y3BE 2CUKA 4LQDA 4ZT4A 3H5AA 5HG0A 5J5AA 4JV5B 1PZNA 3SYKA 5EWMB 4MWZA 1K27A 3Q7PA 1A5BB 5FPKA 3IT0A 4J6EA 1UQRA 2IYOA 1DWQA 4O2BF 2AZTA 3N5KA 1BN7A 4LSZA 3ZD7A 4G1FA 1P5ZB 4CDRA 3K0HA 1C1DA 2CHQA 2O1XA 4N3BA 4UOQA 3A4IA 1GGEA 1UP6A 1G18A 4NZZA 4BVAA 1FRZA 4TSFD 3WXBA 1XPRA 3CEHA 1TAUA 1DQZA 2HQ1A 3OCYA 4JB8A 3ZCXA 1P45A 1S3GA 1KP9A 1FW8A 4QGHA 1N0WA 4YB8A 3TH5A 2GM5A 4CUJA 5BN3A 5AW6A 4V0MA 3FNIA 4K2AA 3TCNA 4FI3C 3MA0A 4ZQFA 2PT7A 1KJ9A 2H1IA 3QVSA 2QAGB 3EXHC 4U8HA 2YXBA 5CCDA 2YFQA 2JG3A 3MMNA 2QSYA 3PNLA 1EIZA 3W5HA 4DQXA 3S81A 3VR5H 3IA7A 1IMOA 3PDWA 4WLOA 1TDJA 3HJHA 3OJ0A 3GPLA 5HIAA 5KNLA 2VBFA 4GLJA 1RFGE 5DP1A 4O6VA 4F38A 1U0TA 1E92A 1VGQA 3REOA 1BAPA 1ONPA 1CQXA 3RASA 3GGDA 3WKEA 4C03A 2QG9A 4U0JA 1Z6ZA 1BDJA 1XALA 2IL1A 3WSWA 1ISPA 3GCDA 1D2RA 1G8FA 2XTNA 3ADDA 2VK8A 2Y9MB 2LBPA 2ALJA 4JQYA 2IS1A 2FMKA 5JY1A 3ILSA 2Z95A 3NYQA 1C1XA 2E4WA 5LA6F 4MW0A 5ALOA 5JNSA 1CUHA 1N6PA 3QMPA 1JBEA 2FHPA 4ARZB 5BOSB 5IC4A 2VDQB 5JASA 4G4SO 2D4HA 5KWJA 3CFYA 5LYJF 2FSVA 2D4AA 1PLJA 3IKVA 4DDVA 1E1KA 3LWBA 3T5DA 4OGFA 3RVSA 3WP1B 3PEEA 5BURA 3OQIB 4D99A 1GCIA 1VP9A 5LVAA 3MTQA 3JYNA 3EGIA 1NATA 1WB9A 5EEGA 1JHXA 2HXSA 4TN5A 5G3YA 1HPLA 3VUEA 4JNCA 4K8OA 1DEXA 3FMIA 2VHTA 3DCIA 3P4YA 2B8EA 2XJ4A 1AKMA 1DRUA 2G63A 4R9UC 4YRRA 1Z4JA 1JYSA 2X4DA 1Z0UA 2GD6A 3H8WA 3ROZA 3U19A 4N01A 3F67A 2JASA 2QY9A 3EHEA 3TBHA 1N5JA 5K45A 4LTMA 2UXDB 2WM8A 3ICWA 3TECE 4D02A 4RTRA 3SC6A 3OT5A 2LCQA 4ARCA 4UXHA 1NMYA 2CV2A 3MERA 1Y1TA 4B74A 3C6XA 3HJUA 3OFSA 2WIKA 4KFUA 4RPCA 2A1TR 5FBRB 3KYCA 4YUXA 5HJEA 4FFOA 5F2NA 4I4TB 3L01A 3O73A 2QQEA 1JIVA 3K8YA 2QTBA 4WWHA 1CJTC 4KVAA 1ISMA 1ES9A 2Z9CA 4IO0A 2PSHA 2Y67A 2WHRA 4O4JF 4FSHA 2FWBA 1GVNB 2EW1A 2B34A 1U8YA 3B8EA 4MPTA 5JSKA 1Y81A 2RC6A 1HYQA 2RK6A 4X24A 2IWRA 5GIPE 3VC2A 1JEQA 1X15A 3WI7A 3UTDA 3VTFA 3NASA 1TMGE 5EL0A 5C52B 1V16A 2WFLB 4GP7A 1YQGA 2HA2A 4L7VA 5GGYA 1YR3A 3W5IA 3CVVA 5F3WB 4QEZA 2W90A 1NMZA 1G17A 4YAIA 2P6RA 4YCAA 2HFKA 3F4KA 5BNWA 1XMPA 3PEFA 1HNNA 2NVBA 5AVOA 2QPTA 1TQHA 2HLDA 4ML3A 3A2NA 1E9RA 4UJ3A 2YR0A 1V95A 2DAPA 3W7AA 2GGSA 3P27A 3WB1A 1E8MA 5FWAA 3WBBA 4JUAA 3O90A 3TKAA 3TL2A 1C3VA 4IVQA 1K5HA 4N8EA 1NKSA 2HBYA 2RJ3A 3IVMA 4H3HB 1N5MA 1P0MA 2K7FA 2IGBA 1EUDA 4INAA 5EZYF 4LSWA 5H4GA 3TI9A 2WT9A 1RW4A 1JWAB 1EFKA 2PBLA 2CB9A 4ND1A 3BYZA 4L0DA 3VYVA 5JHGB 1XRRA 1A50B 1F8UA 5LFAA 2CFIA 1RE0A 1LZKA 2BGRA 1M33A 3ZW7A 4Z7JA 1SHUX 2FUG1 4QGGA 2E5LB 2JFOA 4AS2A 5FPPA 4NCKA 5BMVB 2ZBRA 4G97A 4IR7A 5GONF 4EKIA 4OJQA 1MX9A 4LKOA 5DOVA 5BRNA 2JCXA 5IJ9A 2FSSA 4L0CA 1IYZA 2C07A 2HMAA 3IEMA 4DLUA 4DB2A 4IIJF 4BS9A 3SNHA 4Z1OA 1PO7A 3VSCA 5IBQA 1R5BA 4F4HA 5J2TA 1MOQA 2OBLA 2VOEA 2HF7A 2J0UA 2OKGA 4XE5A 2ZSHA 4X61A 4ZVKA 4CTOA 5T7BA 1G9TA 1OD6A 1VIAA 3OIWA 2VQEB 4NS4A 3OFVA 1FNBA 3DF9A 1R5JA 3IQZA 4KQIA 1N1GA 1E1NA 2J87A 2O0MA 1WXWA 3AI7A 4A6DA 4EHFA 5BY2A 3ASYA 1PR1A 2P3SA 5K6AA 5GIOE 3GEGA 5LD2B 4DR6B 3ZGVA 2AOUB 2QRMA 7AT1A 3GRZA 2IWHA 1YZTA 2C7BA 1J23A 1O97D 2W4QA 3DULA 2E18A 1V2HE 1P6XA 3GU3A 3KNZA 4V02A 4M9CA 1P7WA 4IMIB 3EBLA 2VATA 4N12A 3A1SA 3SOPA 5BN3B 1ZYUA 8LDHA 1RFLA 5FUVA 2ODTX 3THYA 4I1PA 3ERCA 4I1IA 1E0SA 1T25A 2FZ5A 1K3TA 3SQLA 3UKOA 4NJMA 3T34A 2FPGB 3O5AA 1II9A 1XMQB 1TJ4A 2EX0A 3PFCA 4WN9A 3RS8A 1XO1A 3R5TA 4E3ZA 1HGXA 1JILA 1UT5A 4PEVA 2BP7A 2PSDA 3M4JA 3AKCA 1ZIPA 5EWLA 3V46A 1BHO1 2JDIA 5LXTF 4AMGA 1C8LA 4LJ7A 4YCBA 2WBLC 1YS7A 4CV1A 3HXKA 2ATCA 1Q1GA 1XGKA 2HL6A 5EPUA 1XDUA 2XYRA 4B09A 1KI1A 4KWIA 5K3FB 3TG2A 1MAVA 3DJFA 3VZPA 3S2GA 4G0NA 1BE0A 1JNXX 5CYPA 3PEWA 4B4OA 1A2QA 5K0GA 3KXPA 3NHJA 4GXRA 1V4BA 1S96A 2C4VA 1ZJ5A 4GUDA 4UUQA 3ND9A 2P9HA 5FAXA 3S2SA 3UHFA 1N6IA 4NS1A 1CHDA 4NAUA 4E94A 2H4YA 1U8XX 3W8RA 2WMNB 5AP9A 3R7SA 9LDTA 3K8OE 1YO6A 3T9DA 2FEMA 1SHKA 4M46A 4MKXA 1YB6A 4X7PA 4GX2A 3RRNA 2FQ1A 3PP8A 3TK1A 2WWRA 3RVMA 1KEKA 1K75A 1SC9A 2ZE5A 1QHGA 4HR7A 3SZGA 2QRJA 3WL6A 2J48A 4YMIA 3GVPA 3F8TA 4NOKA 2QW1A 5I4BA 2ZAOA 3FPBA 4ND4A 3HJRA 4MK4A 1UJMA 2AD5A 3AIMA 3E05A 4O02B 4XD7A 5CVTA 2V8BA 3H3FA 2X77A 5L4SA 4LJAA 1GJRA 1M83A 1V5IA 3O94A 5IDQA 1QAOA 2BCJQ 2R8ZA 2V6IA 4EYQA 4GOKA 5HZKA 1UQTA 4PC1A 2GZAA 2ZTHA 1Y4UA 1XQVA 1K6XA 1JU9A 3HCBA 2W4IA 3LP5A 4XWYA 3ST7A 3R0ZA 2PKRA 1NPTO 1Z7EA 5AHRA 1T3SA 3FX2A 5ALQA 3PX7A 4J0FA 1QE3A 4R2WA 1KOJA 5AJTA 1M8FA 4XRRA 5HFAA 4KL8S 1K66A 2FR0A 2N1MA 2O52A 2PG3A 2YQZA 4IUBS 4PLGA 4EY3A 4O63O 1DC8A 1QLJA 1HYBA 4K3UA 3VZCA 3FCYA 1GL7A 2BGNA 3L0YA 4TWRA 1L7AA 3OFKA 5SYNA 4B8ZA 5IKMA 3KV1A 1QIFA 2LWIA 3C3EA 5AXAA 1G0NA 2BMJA 4BBPA 3ESZA 3KEMA 4OX9B 2YWEA 5C34B 3BGDA 4QU9A 3SXPA 4CKWA 3U80A 1RQXA 2OFXA 4LXIA 4G0MA 4E33A 3B7WA 1KI9A 3R3XA 5ITVA 1G9XA 4M22A 1VFPA 2J3IA 1XNJA 1YGPA 2M6KA 3A6LA 5EJ5A 2FGJA 1MV5A 1D5WA 1Y8CA 4PLPA 4AXBA 1AMNA 2HZ7A 1QPBA 2Y6VA 1KRHA 4MRAA 1CF9A 3L7LA 3QWBA 3HL0A 2X4GA 4L5AA 2WU8A 4Y7CA 4BNTA 3IODA 1G8KA 4GMXA 1CJCA 4N5LA 4N9WA 4F8JA 4LZWA 1OZGA 4OHOA 2V7PA 3VVBA 4DWVA 1YR9A 4A10A 3R9WA 1TYBE 1R4ZA 1YOVB 1NF9A 4N82A 1FX1A 1KZYC 2WTAA 2P5YA 1KDZA 1QHHA 1PIWA 3OX2A 4LCJA 2AYYA 4HFJA 2GJKA 1DLJA 5F73A 3EXG2 1TYAE 1TAHA 3JYOA 3RUPA 1U8UA 5TE9A 1RI1A 3D31A 2YL2A 3ABRB 3DZBA 4DG5A 3MTGA 1JDSA 4CM3A 3L07A 5FPSA 2RD2A 2C8LA 5TQ2A 4Z1MD 4CNQA 4URXR 3ZE8A 3AM4A 4O2AF 4TVKA 3E9MA 1CE8A 1ORHA 3P4XA 4ZWNA 2LDBA 5I7RA 1AQNA 5H8WA 2FUG6 4EPWA 3AGQA 2QVYX 2ZIUB 2ORVA 3AXSA 1TA9A 3A11A 4LDPA 1ZBDA 1H93A 1NQVA 5T4EA 4KIWA 4UTVA 4ZT5A 3ZHZA 1E3TA 4E13A 4YALA 4RCVA 4XM1A 1V7ZA 3DAYA 1I0ZA 3D3QA 3E7DA 4Q6WA 2EP7A 4G2NA 2O8VA 1GGKA 2E4UA 4EJMA 3RWOA 4LV6A 1XVAA 3HU1A 3MTBA 1ECPA 2H63A 1GGJA 1H65A 1I4DD 1V1MA 3A06A 1KS9A 5LM3A 4YV7A 1D2NA 1NDUA 2BBWA 2HRRA 2QIPA 2ZOSA 3BK1A 4LXHA 1KS2A 1JHPA 3EARA 4KE7A 3BRWA 4OQNA 2D2VA 5K3CA 2IEBA 5A7HA 3SSOA 4QDJA 2D5AA 4WINA 1VHTA 1XAGA 1XD2B 4EEKA 3DBVO 1U3UA 3RK1A 1GSHA 4DN6A 5HXAA 1DQSA 3ORHA 1PFKA 3E3OA 4QVKA 3TW4A 4CKEB 5FTWA 4ABYA 5A03A 1IHYA 1MLDA 2P3LA 2QZ9A 4N65A 2P78A 4NVRA 4UHJA 2OQVA 3TB6A 1U0SY 4E0BA 4N4AA 2OORA 4ZIRB 3FSGD 4XFJA 1HDRA 1U5CA 1ETUA 1F0NA 2VS1A 2YHBA 1G6Q1 1SK9A 3K9QO 2JLWA 2J9FB 3TXXA 4OI2A 4YBZA 4A5OA 1DOHA 4YP9A 2R6DA 2P7IA 2VXOA 3AVUA 1XKTA 3EQ7A 4WOPA 3WWOA 5K3EA 3UANA 1DKLA 1GXSA 3UVEA 1G8JA 3O1IC 4BP9A 1R8JA 3OD5A 3LAWA 4QWWA 3H0KA 1RCFA 4L16A 1E2LA 2C4MA 4OQPA 3TPZA 5AKJA 4ZT2A 1UKAA 4TKMA 4UHHA 1XROA 3WHPA 4ZP1A 1Z5UA 2VHUA 2WZCA 1PJZA 2J7PD 3GCXA 3RRYA 1JDZA 1CUAA 3VA7A 2G4LA 3AVQA 5A5GA 1XEFA 1ZMBA 2C04A 1Z0JA 2JGDB 3IIEA 4ZQGA 4XPIB 4YRBA 1Q7BA 3TE6A 3AHEA 2KBFA 1DO8A 2VJMB 1JECA 2ZQZA 4B80A 1GSAA 2JVIA 3DL7A 4Q4LA 4CLRA 3BULA 3KWLA 4EA6A 1UBMS 2Q9BA 3F73A 1T5DX 3CN7A 1USKA 2OQIA 5GVSA 5B7PA 5I5EA 1ZH8A 2BFBB 5K0TA 4HAIA 2ECQA 2ODNA 1P5HA 3HABA 1XX6A 3JWHA 3P0FA 4L8WB 4MWBA 4L78A 4U2CA 4BJ3A 1UPXA 5JQGF 1DJOA 2IZZA 3DOCA 3R3VA 4IWXA 2KBEA 2DHEA 1GP2A 5C8ZA 1KJYA 1K6IA 2NYVA 1JP7A 1B42A 4WXPA 2DQYA 3H7AA 5DEIA 3DE2X 4ESOA 5CA1B 4EPTA 3U2QA 3W5CA 3MUOA 4O2AB 5IEBA 5MGBA 1IUOA 4BNHA 7GPBA 1CY6A 1TGVA 4KPGA 2B25A 5E6SA 1C3XA 1H6CA 5HILA 4IZHA 3WSTA 5CDGA 2YV1A 3NHFA 4EW6A 1IWPB 5BPFA 1ZHFA 3E3AA 3OD1A 4MQBA 2Z3ZA 1E9AA 5KWVA 5TY0A 3KIPA 2EFHB 5DI3A 1QZUA 2C84A 3H4IA 1RAHA 1TA4A 3KTOA 2J0QA 2OD2A 3FOCA 3DM5A 1KXJA 1Z36A 2Z2KA 3EH1A 3OTOB 4OFXA 2WWYA 4BLPA 4KQ6A 3PVZA 3F0TA 2D7JA 3LI2A 5H1YA 4HNVA 4RETA 3NJ8A 4M9ZA 5CG1A 4EA7A 1I2DA 4FE7A 4LV5B 1FNCA 4QICA 4XGKA 4NKRA 3JPYA 3ZZUA 1L7OA 2WWWA 1S3SA 4TTAA 4CM9A 3HDYA 3PB3A 1LDMA 4S0XA 1VIVA 2PR7A 2HJ9A 3F7MA 4F4DA 4FR2A 1QC5B 4ZAVA 1U2DC 1SCUB 4NJEB 1EK0A 4JYPA 3WB0A 2NYAA 3AR9A 3VSBA 1Y8RB 3F4BA 4IDCA 4Z49A 2Z8YM 3TCKA 2C54A 3ABIA 4EGQA 1PDOA 5KX5B 1RQ2A 1KRWA 3DHYA 1G20A 1N6OA 4LZOA 3TS1A 5KJ6A 5LWQA 2IYQA 4PSDA 2N1BA 4ZYYA 5KKNB 5IT9A 2Z0MA 4ZALA 3ZE6A 2Z2IA 1LB1B 4N7JA 3D1VA 3MJHA 3G88A 1SBZA 2FEPA 3QX8A 3LHIA 3T9FA 1AQ6A 1ZUHA 1E9VA 2V7TA 3O9MA 2ZT7A 3SGLA 3HXLA 5A3VA 4ZI2A 4U5QA 5EIAA 4RIFA 1L5LA 1P2UA 5IS2A 1WF3A 1FFWA 4CM9D 4CPDA 4DRXA 1T6BY 3B85A 4NQZA 2JFPA 3RBVA 2ID7A 3T7CA 3R4VA 5IMSA 1NULA 4AS1A 2IYSA 1P9RA 4NBUA 2VXBA 4NABA 3M5CA 4EB3A 1MHPA 1MJFA 3PK0A 1KVUA 4V0OA 3TR6A 2OZLB 3X43A 2MR6A 4L5IA 1ZOPA 1H6AA 2J6IA 3DHNA 4KIFA 1GZDA 3GB9A 5ALUA 5IH3A 3ZWKA 1NVMB 3LK7A 3U13A 1WWKA 1IEVA 3Q8XB 5A3SA 1EM6A 5KOHA 3BFXA 1ODJA 3DF7A 3WNQA 4OHMA 4LNUB 1O6GA 1NXSA 2A9RA 3J80A 4DNOA 1LPOA 3LPNA 1FXSA 1PS9A 3LDUA 5LNK1 4J4BA 2YWFA 4GBGA 2CNNA 3L82B 1CY0A 3M2PA 2D13A 3UB3A 1U9CA 1BMQA 3DV2A 2X15A 4YR9A 1ZOIA 5GONA 3WGMA 2VQFB 5D86A 1VLLA 2VSQA 3AR3A 4RZ3A 5HKAA 2QNBA 2IZOA 3JZIA 3CZAA 1NQOA 3LUFA 4X1KB 5BW6B 3WDLA 4Q3AA 4CQMA 2XTZA 3KZNA 1TUBA 1WU8A 3PPXA 4IIDA 5ALZA 3ZDAA 4C0HA 3ZU2A 3A27A 5F5LA 2HRBA 1SNYA 3DDUA 1JAHA 1NN3A 2I6SA 5HYVA 3ACCA 5JADA 4U39A 3TLJA 4U02A 3BZWA 3EZGA 3WGJA 1MV8A 1E4OA 3VHLB 1Y80A 1MP0A 3TQSA 5HPYB 1TCUA 3WK6A 3KQYA 1L1EA 1K98A 1SK8A 1ZG3A 2AJCA 4JJKA 2W2NA 4YREA 3NWJA 3HI6A 1I9GA 4PE5B 1V1RB 5AJYA 4BPBA 2C9ZA 4RK0A 5ALDA 4ZT3A 2WNIA 4N8SA 2LTAA 3AGPA 2XDYA 3I53A 5EJ8A 1JQKA 3D4LA 2WQ6A 1QH0A 4WNCA 3SKYA 2POQX 2REQA 3SDZA 5JFOA 1RWMA 2CJWA 3JAKB 4OATA 3PUJA 2G88A 4YIKA 3LBYA 5D5HA 4ZGWA 2FWMX 2I78A 2JIRA 3ETEA 4JLMA 1H4VB 1O96B 1E3EA 4RMNA 4J29A 3RDPA 1D2CA 4J03A 5A4AA 1EUCB 3GAAA 4FWBA 1IN6A 4HGRA 2IYLD 1YZFA 4MB6A 3L1IA 4ZGBA 4ILKA 3SC2B 1XRQA 3O8BA 4RWZA 4TWIA 3IBYA 1BXKA 4IYJA 5CVJA 3T94A 4C6TB 5ILOA 2ZWOA 1A4RA 3TFQA 1RWQA 1ECFA 1MXHA 2YS7A 4W5RA 5JI2E 3K9BA 1SB9A 1U0OC 1KI2A 1LJ8A 1UBEA 5J58A 4NENB 4U5XA 4E7OA 1NI4A 2COUA 4PZEA 3GLGE 3F5SA 3FNHA 1TYEB 2R8XA 1WXDA 4HD8A 3PHJA 4LVOA 5IUJC 3MJTA 1NP7A 1GNSA 3PD7A 1I7LA 3SC4A 4V0LA 2IY8A 2VJYA 5F5XA 1C80A 2FDXA 2I6QA 3FYTA 5KX5A 1EE1A 2HJRA 1VLVA 3EIWA 3EQ2A 3RFFA 4X1YB 2ZBQA 1N3LA 1TTQB 2VQ3A 3EXIB 4UTNA 3ZJTA 2GYWA 2SKDA 2Q50A 3IYLW 3IAM6 4LC9A 1TVKB 4UAUA 4XCVA 1XL0A 2DUWA 2FOLA 3PXDA 5C53B 5LZ7A 2ZETA 2JFHA 3QUTA 4F4UA 1FS6A 2BFNA 1QTIA 2UYYA 5LB2A 3U0VA 1I3KA 4Q1FA 2OD7A 2KMLA 5FNVB 1G21E 2J5QA 2QTTA 2VPXA 1Q7EA 4FZ3A 2YCBA 1MGOA 5CYOA 4W6ZA 3RG2A 3AVWA 2I7CA 4X6UA 5J5CA 4CUZA 1EEXB 4GE3A 1RWKA 5K0NA 4EHIA 1MEJA 2MSNA 4CM4B 2VCHA 2IUTA 5G0WA 5DHSA 4PO3X 1ZONA 5B57C 3PEYA 3EY9A 2BFDA 2IXAA 4K9SA 1YDMA 2I99A 5IZ4A 1TUGA 1P80A 1A3CA 3TZ6A 2CE7A 3NHZA 3NNSA 4C0LA 5HMMA 5H68A 4UQLA 4Y1RB 2ZREA 2YJNA 2PX4A 3ASUA 2PUAA 3G5TA 2BFPA 1VDZA 621PA 1T0IA 2C03A 3A4MA 4D92A 4FSXA 4QM7A 3FKSD 4OFBA 1R6XA 2XYGA 3KZ1E 4Y0VA 3W7VA 3CLTD 4RZSA 1PJRA 1FRQA 2V1XA 3MLBA 1ZJ6A 3OTGA 5P21A 5EJFA 2NU8B 3WLHA 4XB6B 5EZ6B 1X2EA 3RSLA 1YU9A 1ZRNA 3Q6NA 2GEUA 4C2AA 4D0LB 2NN3C 3D1LA 5A4JA 1M2JA 4ND7A 4J3FA 1FP4B 1XJCA 4HAWA 4B6SA 2XZTA 4MI6A 3X44A 3ICOA 5C5EA 2ZAGA 3MLAA 4OO3A 5HRCA 3P2KA 4J49A 4DV7B 2NSHA 3SEZA 1SUPA 2XX3A 4YRFA 1GPLA 1GR0A 2YH2A 2ACKA 2QE7A 1KBQA 4RK5A 3NMUF 1TM1E 3U9SA 4N7MA 2A3NA 3TL6A 1AO0A 3CVXA 3R3SA 1CSEE 1VXRA 1EM8B 2C31A 4RA6B 1ESMA 3LKZA 1KEEB 3NI2A 4PYJA 2DSTA 3WZLA 4YMVA 1YL6A 2X9NA 1EZZA 3BXEA 2ABWA 2L17A 5DGIA 3S55A 5G40A 3LZ6A 2DU8A 4HQ0A 3HSYA 5IJAA 3DKIA 4DDWA 2I2BA 3DHVA 4ZAYA 1IXKA 1XU4A 5DULA 3ELYA 1SPXA 2GBCA 2QRPA 3EF0A 5FDFA 3MOIA 4KN9S 1KMHA 4MXDA 2Q27A 5JE8A 3TZKA 1E96A 5AW7A 1NLZA 3FOWA 4KQHA 4N7BA 5JDIC 1F60A 2FFQA 1ZAYA 1PW5A 3FIUA 3OZ7A 2IF2A 4Q24A 3TI7A 2FQYA 4KO8A 4OXXA 4IHJB 1JIQA 2WWHA 2VZLA 5AVJA 4ECEA 1VIYA 5CEEA 4C14A 2Q49A 4RHXA 4TQUS 2VLIA 5IW8A 3ZNNA 3R9XB 1GNRA 2ZBDA 2FPIB 1IQ0A 4GBJA 2B92A 4TLAA 3SMQA 4WBNA 3UUGA 1TC2A 2IOYA 3FFAA 3DZCA 5TEVA 5E8RA 5JJBA 4ZKEA 3N58A 4XQGA 2PBZA 3N5CA 3O2QB 3CMCO 2O5RA 5FPQA 4AG3A 3U7RA 2EDCA 2R8BA 5DRTA 4X85A 1CP2A 3BFVA 1W94A 3M9WA 1S3IA 4ARZA 2WPDD 1C8VB 1YR8A 3U3RA 4ARBA 1YUBA 4B8WA 2BBOA 1EGMB 1HWYA 2B7CA 2KWIA 1OWMA 1TO1E 5EUCA 4ACBA 3ANMA 3ODGA 3VHXA 4E5DA 1LVHA 1DAKA 2AHOA 1I2MA 3HCPA 1V37A 4WLFA 5KINB 1WL8A 1EUCA 2XEXA 4IX1A 1FJGB 121PA 3GRUA 4B7CA 5B37A 2V45A 4PGGA 3ZV3A 3AUSA 3FDXA 1WXIA 2VPZA 1OLXA 1XZEA 1HLGA 1T10A 3G59A 2V7VA 2AN3A 3QW4B 4FYPA 2DH6A 1JXOA 1H5NA 2NV0A 5EPOA 4PWZA 1Q7RA 4BY9E 4EY5A 1UXKA 5BWOA 4QPPA 1I5RA 2O8NA 2OZEA 3FPLA 3SPXA 1D4ZA 4G9BA 4CR6A 3Q7RA 3EX7C 1RDFA 4OPMA 1QYIA 1ZBQA 3ZVLA 4ZIRA 1E1QD 2D3WA 5LMZA 3LCRA 3DD1A 4XWKA 1W4AA 4CN8A 1J9GA 2FPLA 3HEBA 4CQNA 4DG8A 1KY4A 4UM9B 1HNXB 2R47A 4EDFA 3EVNA 3M4YA 4P31A 3DEIA 1A7UA 1DAMA 5EIOA 3GT4A 4YCCA 1EA7A 3HL4A 2BHSA 4ABTA 1DBRA 3UJ6A 2M98A 4CV0A 3JW8A 3LQKA 5EYPB 1B43A 3UOAB 3P2JA 4QUDA 1N5LA 1P5FA 3CZ4A 4ETWA 3KOUA 3NUZA 2B4QA 4UMEA 4YRDA 2Q4DA 1QX4A 5EMJA 4B9EA 5F76A 3SQOA 1NLYA 1JHQA 3QVOA 3I1IA 3FOBA 4HDMB 4JL6A 4WXYB 1EXWA 1XZDA 4UMDA 3AIOA 1FNDA 2EL9A 1JG3A 1XE3A 4XGNA 2EL7A 2CC2A 1E2UA 2B0JA 2BE9A 1P1BA 1I33A 2V55B 2XI4A 4M1MA 2ET6A 5FUQA 3THWB 4PYIA 4LS3A 5A9RA 2JHFA 3UJAA 2YHUA 2A7XA 3ETDA 4HPWA 3TYXA 4JR1A 1T3ZA 2HJVA 4JROA 2MYUA 1ZD2P 2BFFB 3LP8A 3I2HA 4MS1B 1AF7A 4Z6KA 4G0WA 5E7MA 2CF5A 5CW1A 3FUVA 5EE5B 3DNMA 1Y42X 5EHIA 1C9DB 3NH9A 4EB0A 1ZI9A 2AMJA 1DCTA 5I51A 2BKLA 3ZH9B 2D7DA 5I5GA 4DBLC 2OSBA 4RMIA 1KJNA 1PBNA 2FX2A 2QLMA 3OZXA 2XMPA 1W34A 1UZNA 3GT3A 3E7XA 4DCNA 2CE2X 3DTVB 1GRRA 2WYVA 5K0LA 3U4QA 1IPFA 4IH9A 2Y0EA 2ZSEA 4JJ6A 1WD7A 2VZEA 4WD3A 2P9CA 5EXTA 2MSKA 1MFZA 2HLNA 2OAQ1 4Y30A 4G89A 3G2HA 3SYRA 4CCWA 4OD0A 5AVUA 4CW7A 1IZ7A 2R1VB 3KB6A 5BP7A 1JYEA 3IURA 2GHQA 1KJQA 4OHFA 3A9TA 4YGYA 3H18A 1WXGA 3I34X 4HRAA 2X0KA 4AYTA 1VKRA 1MJGA 4QOGA 5FUBA 5LBIA 5C0OE 3OPYA 5HOEA 1IHPA 3K0AB 4INOA 4Q7MB 4Z99A 5A05A 4BQEA 5A3QA 1BOOA 1C1HA 1R16A 2HDWA 2OV1A 3HMKA 4LJSA 1GUDA 1GSOA 4BKMA 1M66A 4ZEXA 5CLLA 4XPZA 3V8QA 4COKA 3CUKA 4MUNA 4QASA 1YZUA 3FGNA 4UAJA 3D4IA 3HKDA 4IKEA 4U4AA 3JVVA 4G8JA 5DO9A 1EFPB 5ALPA 1JBKA 3D6HA 1K63A 1YK0A 3QE3A 3FMPB 1D07A 2QNIA 3CQ9A 1AO3A 1LPAB 4UXJA 5JCJA 3WWCA 4Q4JA 3RUHA 4D9NA 2QG6A 1QOZA 3Q5DA 2PRSA 1HFEL 2GPTA 3I42A 5JV5A 4G1EB 5LN1A 4IDFA 2ONCA 4QUAA 2UVPA 2H3HA 2ZJ5A 4AYWA 1EHCA 2FN8A 2OO3A 2IIBA 4GX0A 3SJUA 1WVIA 2CUNA 1R18A 3D4OA 3DO8A 4GNRA 3D6VA 1JHRA 3UMVA 2QL6A 2PE5A 5BW5A 4AY2A 1A4XA 3VZDA 5FBVB 4KWCA 2YMPA 2X5OA 1Z5PA 1C3JA 4EUHA 2I67A 1PW7A 2J3LA 2NM0A 2VF5X 4DBLE 1SKAA 2VRCD 2FPIA 4NFLA 3T4UA 2VNHA 2IX9A 3Q9UA 3PFBA 4MCJA 3KAJA 1U28A 4WACA 5HE8A 2YVQA 2OGUA 1FZTA 4PPGA 1TVCA 4EEXA 5E1OA 5ISMA 2H31A 3QXGA 3EGCA 4KQEA 5JAIA 1SUFA 2CEAA 4B82A 4LSMA 4A5SA 1H2ZA 1N1DA 4G5FA 1M6EX 2XWQA 3V00A 2GBIA 1FP1D 5CFRA 1WCYA 1VI5A 4TS9A 3HJGA 5FT9A 4L5YA 2BHRA 2ZKLA 4ONEA 1IG3A 4GWLA 2FZCA 3R8XA 4TL7A 3UW3A 1AK9A 2H65A 4JEUA 3Q9NA 5H59A 4ARSA 3IP1A 4BLRA 4M1QA 1MENA 1NIPA 1MABB 4KXMA 4U6SA 3V6MA 3WBFA 4DJTA 1SBHA 2PMKA 4URUR 1D3AA 5HIMA 1HYHA 5K3FA 2A7QA 2JLSA 1GKUB 2IELA 1JXQA 1PTJA 1TK2A 1O5OA 1OT3A 3RRXA 4NONA 3T7DA 1ZD5A 1VBNA 2VDPB 1U1EA 3TTXA 4GOOD 2XNSA 3FE2A 4P4UA 1L6IA 3A3YA 5DNDA 4GI5A 3WQHA 3BORA 5J4YA 1L3BA 1E5QA 1VQ1A 1KVRA 2SHKA 3DEZA 4PLFA 4Q9KA 3N9IA 3FPHA 5KWIA 4WZBE 4LMPA 4DLWA 3KJHA 2WU1A 2ADFA 1CUIA 2HNBA 4M0MA 4HQFA 4HVAA 4Q1EA 4ZZ1A 5KYTA 1E7SA 5H7XA 3UMMA 3JQEA 1WULS 4D4MA 4FOSA 4BZWA 4MTLA 1OB5A 1B1AA 1Z2NX 3OCJA 1XP8A 2BTOA 1P31A 2C2OA 3HDHA 4KGVA 2ZE6A 5H80A 3UWMA 1GPNA 1X80A 4AJKA 1ECCA 4JLVA 4QA9A 1LRKA 4IH4A 3IAS1 1ZUD1 2YJTD 1CDOA 1TXGA 4GRIA 4MKHA 1R9GA 2D0PB 4A03A 2H08A 5AOAA 5IVIA 2ZWMA 4D9KA 1BXGA 2DBYA 3V2GA 2QT9A 1H4QA 1MN6A 1Y6QA 1T4CB 2BLLA 5TS3A 3WQQA 3ZNPA 1ZUIA 3BA1A 2BBSA 3VR4D 4HL6A 1NRWA 2R6CA 4YUWA 4AUMA 4QX6A 3IP9A 3MM4A 3GRCA 1EVZA 1F06A 3SZOA 2DUNA 4TZ0A 1Z6PA 3FPGA 2BW0A 3RC9A 1MR3F 5FI3A 4D43A 4MUXA 4C87A 1T9GR 5DYNA 5A3JA 1YV9A 4XYEA 3FMGA 4DNFA 1RVDA 3IMFA 1P2VA 1QGAA 3FDIA 4MVWA 1O3YA 3A26A 2FW7A 2IHBA 2IOFA 5AVWA 5GZ3A 3AR2A 3WICA 5F21A 3ZJUA 3FPJA 1K3UB 1DWUA 3BJZA 2G08A 1XI2A 2VKTA 2LIPA 3IBCA 3EJWA 4LFCB 1A7KA 2DFKB 2EKQA 4DJAA 4ZI3A 3I05A 3AR8A 1OZFA 4DA6A 3LZCA 3K1ZA 1U2GA 1M76A 1GA6A 3BXPA 2HF8A 1X7HA 2O50A 2ZG6A 3GMIA 4JKIA 3KSRA 1V3QE 5HDBB 4C6SA 1E18A 3QVVA 3RK4A 3SHWA 3ZXSA 4REOA 3VR6H 1SC3A 4EAQA 1D03A 1QG0A 1OI7A 2WLSA 3BAZA 3OMWA 4S1OA 3RC7A 4UVGA 1J39A 2EZUA 1NF2A 1SCDA 3PVCA 4AVYA 2R5FA 3RYIB 4LAFA 2W71A 2XRFA 4EVIA 2GF0A 5B7NA 1CFJA 2J59A 1CC1S 2ZRLA 3EGEA 1W44A 4HC4A 3QKSB 5FNVA 3EQ8A 3LBFA 4PYLA 1ZKMA 2HGSA 3GQVA 1JJ7A 1SXJC 2ZIXA 4JYCA 5F5NA 3WIUA 2MCFA 5F4ZA 2KI5A 4HMOA 1U4SA 4MYTA 3IPXA 1PK8A 4WQMA 4BQRA 4CEIA 4Y2XA 2ZB2A 5I9LA 1FFBA 3C43A 5JS7A 2H9AA 3S29A 1F1JA 4PLTA 3CX3A 4JR2A 3PRKE 1OLUB 4JITA 2WJZB 2YBEA 2Y76A 3DOEA 1TLTA 3JQAD 4OEHA 2PUDA 5ARBA 1LC0A 2PZJA 4MZDA 4RK4A 1XG5A 4GPTA 5EKXA 1N2SA 2JIZD 5BVGA 5A5FA 3LMKA 3NDPA 3RNLA 1OA0A 1OWNA 3HZZA 4O59O 2LDXA 1XXHB 4RCZA 2DCMA 4Q9JA 4FGZA 2OCXA 1V9CA 4QUGA 1RHUA 3PNYA 4UHEA 5FRDA 4AZ0B 3KD3A 2H1VA 1QE0A 1IM5A 2QW0X 4IHAA 2QLTA 3F8WA 1YBAA 1RBQA 3IAUA 2YX1A 2ZU0C 1QHFA 1BGVA 3BCHA 4CJXA 1DDGA 4K0KB 2PPLA 3P2OA 3N0WA 4B7AA 1M3SA 1UC4B 1SQSA 1ZGGA 4EJFA 3KHSA 4L5BA 2WE8A 3JD0A 2O7QA 2XV1A 4R81A 2XUHA 3BXHA 1HBJA 1U2PA 2DPLA 4X8OA 3WIVA 4YPVA 2CXUA 4MUMA 1UBFA 3K09C 5BOSA 2RG1A 5CDFE 4NBNA 3CZRA 3CISA 2F8TA 3N2GA 4YUZA 3OECA 4JS0A 4D25A 3EUWA 3PPIA 4A92A 5IPFA 3RGWS 4BNDB 1OAOA 1SBQA 1V4NA 4NHOA 4WZAE 2PRIA 1OBVA 3EBOA 1NV8A 4D8VA 3LOPA 4CETA 1NUHA 2HDOA 3PCTA 4HGOA 4EJSA 1LSUA 3IC5A 4LK2A 1L6RA 4O2LA 1K0FA 4UUNA 3ZCSA 2NT4A 1VPDA 2IP4A 3NHLA 4BNJA 4AN4A 2PH3A 1E8DA 1XQYA 5TGZA 4KR6A 3AM1A 3EC1A 1KQNA 3EODA 3WWYA 2O0HA 4I5EA 3R8CA 1IK4A 2GMWA 2WY2D 1G21A 3OCZA 4K87A 1J5PA 2NADA 4HP8A 2EQ5A 4MUFA 1II8A 2NQ8A 4MVJI 3ZYZA 1X8KA 2IJGX 4I3FA 1AZWA 1Z2EA 4MQLA 4HFNA 4FFVA 5A6VA 1L1RA 1JEEA 3OCVA 2Q4OA 3ESYA 4ZHSA 1HLPA 1O6FA 1RJ9B 1YNOA 3PEUA 4QOEA 2LV8A 3RSFA 4ES6A 2VK4A 3U7HB 4MIYA 5CA0B 4M9UA 1FXUA 3KOMA 3V7FA 5JMWA 5EEHA 1N6RA 2XUDA 4J7UA 1G8GA 1DUSA 4YRZA 3H7IA 3FYUC 1RLUA 1HE3A 2O8BA 5BYKA 1BFKA 1DKRA 1OFHA 2VTKA 3D2LA 5K3SA 2ZWPA 1WXQA 2IDJA 5HOQA 4J0HA 1G16A 4W1SA 1XZPA 3K73O 3L1HA 2JARA 3OFNA 2O5CA 4X6YA 1PGOA 1XZCA 1K2WA 1KA9H 2XXAA 1T3GA 1CF4A 5JROA 3HYCA 2AMFA 2RFLA 4R3WA 4C29A 2L0XA 3ZCQA 3L05A 5LPNA 2F3TA 4PC7A 3BHJA 4GLLA 2GN4A 1YE3A 1LLUA 2WHPB 4MP3A 5SYMA 4EPRA 5ED4A 2ZB3A 3T1OA 4YQZA 4AWXA 2AOXA 3S2FA 1XNQB 2X8BA 4RVDA 1I4LD 2HX1A 2XNKA 1OILA 4RC9A 1CQWA 1YXMA 2VTEA 3GVHA 1S02A 4OHCA 1R4NA 2HEGA 2DFPA 2PUGA 5GOTA 2ZUVA 1IQRA 3ZIAA 2WI8A 4DRXB 2A3RA 1PX0A 3KKPA 3NEAA 1OXBB 3C1OA 3NFYA 1IVNA 2W6JD 3KYIB 1KNQA 4LK3A 1DG1G 4M7PA 4X92A 3R74A 4CI9A 1CS0A 2NPIA 5FEMA 1NN0A 2YV3A 2XTAA 2VP5A 3KT6A 3BQMB 3E9ZA 3LX8A 4FOTA 3OEHA 4NNOA 4X8LA 2PCLA 3O4FA 4F3CA 1EVIA 1S9DA 4UULA 4YS6A 3NWPA 3HN6A 4DBZA 3MPOA 4O3FA 2W2XA 1AS2A 1XRNA 2CVOA 2WZBA 3M70A 5E4JA 2QOEA 3AEUA 3Q88A 4G5HA 4E14A 3GLGB 4RULA 3AJ9A 4EJSC 4EKYA 1KXZA 2DG2A 1CK4A 3TD9A 1KDRA 1W1WA 4D46A 2P30A 1YVDA 2IT1A 4G0OA 1JHAA 4ZRNA 3V1YA 1WEHA 1PZEA 4DARA 4KN8A 2OUIA 1DCKA 1U0NA 1GYQA 3PYLA 2AUTA 1U2RA 4KEAA 3ITDA 5AKIA <