4BAXA

Crystal structure of glutamine synthetase from streptomyces coelicolor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
344
structure length
344
Chain Sequence
HMTFKAEYIWIDGTEPTAKLRSKTKIITAAPAGLDALPVWGFDGSSTNQAEGSSSDCVLKPVFSCPDPIRGGEDILVLCEVLDTDMTPHPSNTRAALAELSERFAAQEPVFGIEQEYTFFKGTRPLGFPEGGFPAAQGGYYCGVGSDEIFGRDVVEAHLENCLKAGLGISGINAEVMPGQWEFQVGPLAPLEVSDQLWVARWLLYRTAEDFEVSATLDPKPVKGDWNGAGAHTNFSTKAMREGYDAIITAAESLGEGSKPMDHVKNYGAGIDDRLTGLHETAPWNEYSYGVSDRGASVRIPWQVEKDGKGYIEDRRPNANVDPYVVTRLLVDTCCTALEKAGQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMINE SYNTHETASE
publication title Structure of Glutamine Synthetase from Streptomyces Coelicolor
rcsb
source organism Streptomyces coelicolor
molecule tags Ligase
total genus 101
structure length 344
sequence length 344
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2012-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 4baxA01
3.30.590.40 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Creatine Kinase; Chain A, domain 2 4baxA02
1FPYA 3FKYA 1F52A 2D3CA 4HPPA 2WGSA 3ZXRA 4ACFA 4LNKA 2D3BA 2QC8A 4LNFA 4XYCA 2GLSA 1HTQA 2WHIA 2LGSA 2BVCA 1LGRA 3ZXVA 1HTOA 1F1HA 2OJWA 4S0RA 4LNNA 2D3AA 4BAXA 3NG0A 4LNOA 2UU7A 4LNIA 4S17A
chains in the Genus database with same CATH superfamily
1A5RA 5T8IA 1E6EB 2NCNA 4BFRA 4OZBA 3M3JA 4DBGA 1V1OA 2XK5B 1VRAB 2L3ZA 4BKSA 4W9LA 2J53A 2ZVNA 3RPFC 2L05A 5E6JA 3DOWA 4HKQA 1SBBB 3P2BA 2IJ0A 1SSNA 4TSSA 2MBHA 4LLGM 1P9DU 2GWCA 5E6NA 1F52A 1VDVA 1JW9D 2KLGA 3L2EA 1TS3A 3DBRB 3X0WA 2K39A 4EEWA 4C56C 5BMHA 2JX5A 4C7YA 3GE3C 1IBXA 3O13A 5G5GA 4M8MA 3URYA 4W9HA 1EM7A 1QOFA 4GB9A 1DGJA 2KQ7A 3DQVA 3RI7C 3RZFA 3W1SA 2XK5A 3QA8A 1ET9A 1QQRA 3L0WB 1WZ0A 2AX5A 1QT9A 3OJ4B 1MJDA 4E3CA 1TY2A 1P3QU 3ZUNA 2N1VA 2ZNVB 4NAWB 2REXA 2MJ3A 5D3DA 4ICVA 2WP9B 2FCMA 1J7BA 3Q8EA 4IM2A 4HKZE 3TL5A 1YOVB 1SE9A 4A3OA 4GVYA 4K7SA 3L54A 2WXHA 2DWQA 3DBSA 1L6UA 3AE2B 2LXCA 2KDEB 1WM3A 2JWUA 4YTNB 2KMAA 1I0EA 2W3RA 2WXJA 4WQOB 4K1RB 2PJHA 4S17A 4P16A 1YN4A 1NI2A 3WAPA 2V3NA 2NMQA 1M4VA 2J52A 2M17A 4MELA 2Z0EB 3NS8A 2N7JA 3CSFA 1WGKA 4HPMB 1NYRA 2DENB 4NAWA 3PRPB 3VUYA 2D33A 3T9LA 2LD9A 3C0RB 5CX3A 3PO0A 3R7RA 4M01A 2WDTB 2L7RA 3M63B 4KGSA 4JIOU 2C5LC 2WDRB 1N61A 2N7EA 4P1BC 2K1FA 3N3KB 3TEXA 2SEBD 1JCKB 4RF7A 4RF8A 3HVDA 1P7FA 2KN5A 1L4DB 1TS5A 2KHWB 4G0NB 2Y5BB 2KO3A 2RGFA 1ET6A 1MFWA 5IO9A 2XNAC 3QJZA 4RF9A 4ZHPA 1C79A 2BYVE 2Y3AA 5HHDG 4CHKA 3LN6A 5J17A 5AUIA 4NNJB 3ZVVA 1P1AA 4YXDB 4GOCA 1GC6A 1DOYA 4G50A 3MC9A 3KUCB 4USAA 5G5HA 1L2NA 1XQQA 1LXDA 1JWUD 3LYYA 3CWIA 1Y8RC 2QHOA 2KD0A 4JLCA 2INNE 3U8ZA 1GG3A 2J0JA 2BKFA 3AEFB 1ISNA 1MI0A 4GW0A 2DZKA 1I35A 2D5GA 3OAWA 4ANXA 3VR9B 1WGDA 3PS6A 1WMHB 4BKTA 1Z2MA 1V6EA 1V81A 3Q8AA 3V60A 2WNMA 3HRDD 5AZFA 1IUEA 1SEBD 3ZRFA 3ZTCA 2LGDA 1WIAA 2MWSB 4LNKA 3IG5A 3B2FA 4BBNF 1V1PB 2DAJA 3AM9A 3KYDD 4MEMA 1KLGD 4LJPB 2L8JA 4KZCA 5JZEB 1JQ4A 4JQWC 3L16A 3MHSD 4W9JA 4L2YA 3WAOA 2M1MA 2X8XX 1FM0D 5LLIA 2BGFA 1V8CA 2BS3B 1HZ5A 3NVWA 1GJZA 1WY8A 1V4GA 3CIRB 1PYWD 4A55A 2C7MB 1PUTA 1GC7A 2EMTA 2GRIA 5J2RA 4KGTA 1RRBA 4RF1A 1SB3C 1XEEA 1XLQA 4WIPA 1BG0A 3VUWA 2W82A 1TTNA 1J7CA 1WMHA 2K6QA 3MP9A 1QILA 3RFZB 1WR6E 4HPLB 4FHJA 1J8CA 1MG4A 1KF6B 4KDLB 4XX5A 4HJKA 5TSSA 1KLVA 2MSED 1V5TA 4RMAA 1QOAA 2IGHA 2KJHB 4LCDE 3DCGA 5CTRC 3Q2AC 4II2B 2M0XA 1V1PA 3DBHI 2GI9A 2D10A 1R4MI 2EMSA 1QK1A 3RT3B 2ACZB 2KFKA 2DBYA 3ZRCA 2FIFA 3PTFC 2OJRA 1ZXIA 2DX5B 1TKEA 1KFYB 4E74A 2GMIC 1XT9B 5IP4D 4KSLC 1N5WA 4TKNA 4HWIB 4LNNA 3OWEB 3QAQA 5EE1A 3DPDA 1Q1OA 2CS4A 2CJNA 4HEA1 3ENEA 3APFA 3TSSA 2LRWA 1A70A 2KOXA 1L7YA 1T0QC 1V97A 2JZZA 3U4EG 2R2QA 1XF5L 4GN1A 3B1LX 4DHJD 4DDID 3IT4B 1IPGA 1N62A 1BT0A 4NJ6A 3NZTA 3UQAA 2MBQA 3Q6BA 2ON8A 1YNTE 1V2YA 2FE8A 2NBVB 4FADA 4MSQB 1XCTL 2WHIA 3AECB 3DBRI 3DREA 3NRZA 3PZ7A 2IYDB 1K50A 2LFIA 4M02A 5H92C 3LN7A 1GB4A 3I9V1 3P42A 3B2GA 3Q3MC 3ZJVA 4A3PA 2UWQA 3MC8A 2N1WA 3BYYB 1OEYA 4HLEA 1P52A 1D5ZC 1BUIC 4MH8A 1G6JA 1RYJA 4BG4B 2L00B 1RM6C 3VXWA 4GIVA 2JF5A 2LGIA 1P50A 3NVYA 1EWCA 2INPE 4RF0A 3ZXVA 2BW2A 1WI0A 1XO3A 2I2YA 2KDBA 1L0XB 3DWMA 2IGDA 3W5UB 5KHOA 3D32A 2I1JA 5C2TB 1SXTA 3RNAC 5BYQA 5EDSA 1NENB 3UF8A 4RGTA 3CSTA 2G1EA 3NUHB 1C4CA 4LK0M 2WLBA 3ZW3A 3X23A 3IG8A 3QARA 4NPNA 3ECIA 2GBMA 1WH3A 1YN5A 2LJIA 3AE3B 4REZA 1WYWB 3M95A 1FIQA 2A5UA 1ZDXA 3APDA 2GBNA 3PHWB 2LUEA 1WGGA 2NTTA 4BG4A 4G3XB 4BOSC 5J99A 4KV2A 1S3SG 2KTFA 2RPQA 4AJWA 3VTWA 5C23A 3V6CB 1SD0A 5CHWA 2WX0A 1FCCC 4W9CA 1J7AA 3DHIC 3VTVA 3LXFA 1E9MA 4WJPA 4K81A 2LZ6A 4TV3A 5D3IB 2ZPYA 1OTRB 5FR3A 1F77A 5FR6A 2BS4B 4GU2A 1VZ7A 2ASQA 2K22A 1QOGA 4YSXB 4BOZB 1OEYJ 3BINA 2OHFA 3VVWB 2E3TA 4MACA 3IAS1 2YEPF 3ETRA 2DAFA 5AEKB 3TJPA 1ZUD2 3BK2A 2INCC 4F8CB 2BB6A 3C19A 2KTRB 4HJGE 1JRUA 2BPSA 3W9CB 2WYQA 3SEBA 5D2MB 5IA7A 1AW7A 3VFKA 2KDMA 2AEHA 3MFGA 2IZVB 1FPYA 2IY1B 3RNGC 4FN2A 1TIFA 3HIZA 1VCBA 3MJ5A 3AB5A 3ZLZA 3ML9A 2KNBA 3AEBB 1PQSA 2RPVA 4H2AA 3V62A 3PV1A 1VZ6A 3HHMA 4ZRPA 2BYTA 3QK0A 2KMMA 3AI5A 2FAZA 1R7SA 3KUZA 4PS8A 1E90A 4NY0A 1UUPA 2KVZA 2N0SB 5EE0A 3Q3FA 2KAJA 3WAMA 5HFYA 2BB5A 1YMHE 1RFKA 2J4XA 3WANA 1NBFC 4BKSD 2C7NB 2KTRA 3I5JC 1E5WA 2DLBA 2FIDA 2V1YA 5HG2A 3SFDB 2VZKD 2JQRB 3IAM1 2M0AA 4OW0A 4JWSC 1V86A 3NOBA 2WXQA 4FHKA 3OJ3A 3ZXRA 3ZQ4A 3FAHA 2BTEA 4J6IA 4JGHB 3RNFC 5DPSA 3P4QB 4FA6A 1UH6A 2DYOA 1VA6A 4W9IA 3MJWA 2N9KA 1N63A 3M10A 2NTSA 3NVZA 3Q69A 2NVUI 5I4DA 3NZSA 3GP7A 4N59A 4F1SA 1NDDA 2WWZA 2JZPA 3BWUD 4ZDVA 2O6VB 4MGIE 3RZWC 1NVID 2CHZA 1OQYA 4KIKA 1K8RB 4AQ7A 1P98A 2Y5PA 1R8GA 3AEAB 1Y56A 3WA0A 3UIOB 3JU6A 5D6JB 2MHJA 4AOFA 2ZJDA 3DBLB 1UNSA 4YL8A 5IKCM 2N9PC 1ZPSA 4K7UA 3TBLD 4OZCA 2GBRA 3AE4B 4P1CC 3VH4B 2FUG1 1F2RI 4A20A 3RUIB 2V4IB 1F0ZA 3J9CA 4RGNA 1FNUA 3RCZA 2Z8LA 2WXKA 3U30A 1HQRD 1F1HA 3RNCC 2CR5A 2OJWA 2LGXA 3Q3JA 3AXCA 1CZPA 4A6QA 3ZKJC 5JHBA 2KZRA 2MX2A 1I7HA 1P0RA 2B3AA 2O6VA 2PE9A 1WE7A 4ANWA 3IFWB 1WJ4A 4I6LB 4PS7A 2AL3A 3AMZA 3ZJUA 1SE2A 2XN9C 1GPXA 1OQQA 1FEHA 3L2DA 2L83A 4HK2A 3R3MA 1GAQB 3VAWA 1TKYA 1NYQA 1D5MC 3Q8CA 1AWDA 1AARA 1AYFA 2MRPA 1RAXA 1ZW7A 2PLPA 2WX1A 3A9KA 1SGHA 1TZ1A 1M94A 4XC2A 4DWFA 3BVMA 2DZJA 4IC7B 4IM3A 4EZJA 5CHFA 1K51A 1WE6A 3I3TB 2PPHA 4P6VF 2IGGA 2IO0B 3MC0B 1JWAD 1WJ6A 2ONQA 1E10A 1PFDA 3L13A 4OHJA 1OQRA 3IXSA 4HPPA 2WU2B 3EFUA 4JL9A 4XYCA 2DYMA 2IO3B 1FFVA 3SHQA 1FO4A 1TBEA 3DHHC 1KJTA 3QC8B 1T0SC 3B6RA 2FCNA 2PMVA 1OFFA 4K3CA 2LRUA 5AUKA 1MVKA 2MJEA 4MGKE 3EECA 4PYZA 2J0KA 3L10B 2PKOA 3C8YA 4RH6A 5E6PA 2J7QB 4LTUA 4W9DA 3DVGY 4ARIA 1WJNA 3V61A 1ENFA 3AEDB 4W9EA 3GB1A 2GLSA 3DVNV 1N5XA 2NR2A 1FXTB 2LUMA 3R66C 4WWPA 3QQ8B 2JRIB 2YEPB 2R61A 3AU5A 1HZ6A 1EO6A 3VRAB 1ZKHA 1NEKB 2BYEA 2WXMA 4K7WA 2M19A 5EE3A 2IDYA 4GVZA 1UD7A 2PW9A 2LASA 4HROA 2DZMA 2KC2A 3TEZA 1PGXA 2WDVB 2FCQA 3H7PA 4WJOA 4XDCA 1BMLC 1VR9A 4B0EA 3RNEC 1IGDA 2KFKB 2N9LA 3TUOA 2INDC 2FBWB 5CHVC 3MTNB 3DVGX 3ABVB 1S1QB 3KWVA 3SD5A 4Q2RA 2L0TA 5AZGA 3H9DA 1YQ4B 1CK1A 1WFYA 3JVZX 2QSDA 2RMMA 1Z5SB 1RWSA 3A1QB 1KLUD 3NZ3A 1GB1A 3BYTB 1ZDVA 5FK9C 1GOZA 2BQQA 2GB1A 4O1NA 2IO2B 2LWPA 1T3QA 1TY0A 2LEKA 3PT2B 3EA6A 1V5OA 4IUMB 3UGBB 2DZIA 2BBCA 2ZPNA 4HVBA 2QEJC 1WWTA 1TKGA 3OG5A 4RCOA 3LDZE 5BO4B 2PTLA 2ZCCA 4TQ1A 2K25A 2KX3A 3VR8B 4MM3A 4AS1A 5BYRA 2Z0DB 1B9RA 2KWVB 4TMAB 1ESFA 4AM1A 4A8XC 1C9FA 1K52A 3RN9C 2WXNA 2N7DA 2JYTA 1YN3A 5LXIB 4CQNA 1VD2A 2AQ1B 3A1QA 4HDQA 1PGBA 2OOBB 1L5PA 3BZDB 2CHXA 4NJ7A 3PLVA 1KOTA 1SE4A 2KQSA 4GDKB 4HCPB 4EKUA 4PT5A 1EF1A 3MHZA 1DOIA 1D3ZA 1C4PA 2AWTA 2UU7A 2WXGA 2VH1A 5C3JB 1C3TA 3EC8A 3B0AA 4IWQA 1N60A 3N9YC 2JSVX 2KYWA 2CU3A 2NPTB 4FULA 2CKHB 4BVUC 1D4BA 3DWGC 5DPWA 3E56A 4AWJA 5HI1A 3DBLI 2I1KA 2JY6A 3KQ4A 5DPRA 4GDLA 4ZHOA 3L4PA 4NQKE 3U2SC 4EOYA 3DHGC 2GBKA 2RSUA 3H6NA 4RFBA 2FCSA 4MDKE 4MJSA 4W9KA 2MCNB 1WXAA 2BWES 1WM2A 2XBBC 1R4NB 3AH7A 2K6DB 1WXVA 1PDXA 4GDKA 2JZ3B 2QCZA 5LNK1 2KJ6A 3Q3OC 5IAAC 3VHTC 2W3SA 3WIMA 3S2AA 5H8YE 4DQOC 3P4PB 3UIPB 1GNUA 2KQ4X 5D7GA 2MQJA 3ZYYX 3IHPC 2K5PA 2NPTA 1E7VA 2EKEC 3N20C 5JH5C 4C4VB 3W2DA 3VRBB 4JX1C 2L1AA 4IOIE 2KVRA 2JUOA 3IBEA 4D2KA 2GWDA 4US8A 2G4SA 3JPZA 1LM8B 4AP4C 4WJQA 1VLBA 3HM3A 3NZUA 2HTME 2G9HD 2MW5A 3U52E 1UWMA 1Q5WB 1TS4A 3JSVB 1WX7A 2LI5A 3CF6E 5HKHA 2KWUB 3TEWA 3T3OA 4FJYA 4Q2JA 2RD0A 2B76B 5DPTA 2AQ2B 4HCNB 5BYSA 3RYTA 1C78A 3PREA 1YX6B 1E8YA 3HK0A 3L17A 3QX1A 2O2VB 1WRIA 4C4VA 4JWUC 2MLBA 2D07B 1C4AA 2PVGC 1WX9A 3KUDB 2LHDA 2QMTA 4DXGA 3V05A 4M0WB 3RMKC 3R2IA 1SJHD 3UI3A 3JSVA 4NAMA 3ZTDA 1SIJA 4KKIA 1L6VA 2JXXA 2D11A 2LJ5A 3ZNGC 2M8SA 4RM8A 2K8HA 2D3BA 1AN8A 1J19A 3ZJTA 3A33B 2WXIA 1I4GA 3GOEA 2J1QA 2KXJA 2JRHA 2MBEA 3QCAA 1P7EA 1FRRA 1V80A 2CU1A 3HM6X 2L52A 3NVVA 1UGJA 2O2VA 3H7SA 1C1YB 1M15A 3JYUA 1TYGB 3ZGZA 1ZXHA 3NS1A 2H88B 3KVFB 4XZ4A 4WWNA 3NHEB 1YQ3B 3M62B 4LDTB 1I4XA 2CJOA 4KIKB 1QLBB 4KKJA 1TZOA 3RNBC 1T0YA 3Q8FA 3N1ZC 1HA5A 2TSSA 2W54A 2KJRA 4G11A 3SDLC 4TUUA 4YTMB 1YJJA 4W9GA 3SFEB 4FJVB 4M8NA 2ZEQA 3V6EB 4M0WA 2OEDA 2AYOB 2BF8B 4NQLB 2KT7A 3U7ZA 1E8WA 3PZ8A 5GMVA 2D2QA 1NI3A 1UBIA 4CYEA 4E71A 3W1SC 2WGSA 3O65B 4RM9A 1OGWA 2JWZA 4LNFA 4CO7A 1QZEA 3GZNB 2FUHB 2C9WB 1TJEA 3BK1A 3P4SB 4TQ0A 3WCQA 1U4AA 1T0RC 2G4DB 1V49A 3QIJA 3KYCD 1FXIA 1YX5B 3IVFA 4OVZA 2MP2B 3NG0A 3R2TA 4EZLA 4L1BA 2MBOA 3V3XA 2LXAA 5BMGA 2JVCA 2LVPA 4IKGA 4C80A 1G0WA 3ML8A 1WJUA 3EHVA 5J9AA 1XXGA 5KHQA 1TT4A 1QOBA 3HUIA 1C77A 5BMIA 2EKIA 4L23A 2WU5B 2DYBA 4FJZA 2PIAA 3A9KB 3EGRA 3H8HA 2MH7A 2KWCA 2O6VD 2PE6B 4IM0A 4HDOA 5C1ZA 5D94A 4X57B 2ZNVC 1IGCA 4BAXA 1C76A 4LNOA 2MP2A 1MG8A 3ZNID 3RULA 4AUQC 4YTPB 2LGYA 2V3PA 1FNWA 1UWXA 3DDCB 3APCA 4KVGB 1L0VB 2HTHA 1QH4A 4YSYB 3QWZB 2UYZB 2AQ3B 1HXYD 5FKAC 1UGMA 3R8BA 3PLUA 2AL6A 3AE9B 3N30A 4PS3A 4EE2A 1H4RA 2BT6A 1LFDA 2KDIA 2CRKA 2L76A 2K9XA 1WGYA 2GBJA 1MPEA 4EUTA 4LJOB 2I38A 3LJ3A 1WZ3A 3Q14C 1WGHA 1I4HA 1WGRA 3AE8B 3AN1A 4B6WA 1E8XA 2BKRB 1JWSD 3W5VB 1CQVA 2RDGA 3ZO5B 3FILB 1B1ZA 5DCNA 1FXAA 5JXVA 2LMCA 4K3BA 2X38A 2J0MA 3AULA 4ASWC 1R4NI 1D6EC 3UINB 3TEYA 4KSKC 1JWMD 4DXFA 5L83A 4BKGA 1BXTA 1CMXB 3ALBA 3FKYA 2L32A 2N9EB 4MGYE 1I42A 1V9JA 3PPAA 2RDBC 5EE9A 3DRBA 4J3OD 4FBJB 2RR9A 1TT5B 2V4LA 2A4ZA 4C7ZA 1LO5D 1YIWA 2KN4A 1XLNA 3H7PB 2V9HA 4YWGG 4MH0E 4DHZB 4GLSC 2BYFA 3PRZA 3R7QA 1L4ZB 1KH0A 3ZDTA 3EUB2 2HE7A 2WXLA 3FILA 4II3B 2JXTA 1JMLA 1XCQL 3PZDA 4HRSA 3FC4A 3VTUA 2DNFA 1TS2A 2BS2B 5IOIA 4GMVA 1WX8A 1YD8U 2NS5A 2WQYB 5G2NA 4JPSA 1E7UA 1FNVA 1JROA 1HEZE 3TMPB 2N4FA 1T5XD 2CHWA 1ZP0B 3K9PB 1HE8A 2QIEB 1WXSA 1LQBA 1STEA 4W9FA 2QJLA 4FXCA 2YLMA 2NBUA 2WXPA 2GOWA 2LGSA 1MHXA 1EUVB 5TR5A 2D32A 3BY4B 1KTKA 3LB8C 2E6XA 2EELA 4EZKA 3GE8C 2MA9B 1SIFA 1EU3A 3KH0A 2KMCA 1VZ8A 4RGOS 2KC1A 4IWOA 3PVLA 4HXDA 3SR6A 4IW0A 1F9JA 4MM3B 4ZRJA 2BVCA 2JYEA 2L0FA 3A4SC 4OVVA 2ZCBA 1U6RA 2W55A 2G3QB 4ARCA 2K8BA 1PGAA 2IO1B 1SE3A 3AU4A 3EFCA 3E9SA 2HJ8A 2VRRB 2HD5B 3PRMB 2BWFA 3AEGB 2LVQA 1FCLA 2JT4B 4GW2A 3KLSX 4WQMA 4KDIC 1ZOYB 3AEEB 2JPHA 4AJYB 2MBBB 3HVZA 2DHZA 4B95A 4QAYA 5J18A 3RD2A 2H89B 3CMMB 1ZE3D 3Q3NC 3ZNZB 3NJTA 3VDZA 2QDFA 1F2RC 2V0GA 2KKCA 1WF9A 2K3UA 1FD6A 3GS2A 2VH2A 3AE5B 3ZIMA 1QKZA 4P7IA 2ZW0A 4ZYSA 4XGAB 4XE0A 1HTOA 1FFUA 4M00A 1FMAD 1VJKA 4ZOHC 4B0MA 4GDLB 1ROEA 1YJ1A 1XD3B 2WS3B 3IT6B 1KM7A 4MJSB 4A9AA 3VH3B 2M56B 3N1YC 4N9F4 2FNJB 4DHJB 3GZNI 4WAAA 2ZVOA 4NZLB 3H1UA 4S0RA 1YQBA 3LVWA 2KANA 3K9OB 1UZXB 1CRKA 2WXRA 1KRHA 2KLCA 4ZRIA 1JRPA 4N58A 4ZRKA 2HJ1A 3ONSA 3I57A 2JU6X 3DVNU 4ZRQA 4IG7B 1J0GA 1LGRA 4MGZE 4XDDA 2D3AA 3QHTA 4GXBA 1WXMA 5GXGB 2PEAA 4B9KA 3P1MA 3ZNHB 2R2OA 2QC8A 2MJDA 4WWMA 4PYUA 2IPKD 3AE6B 1WRDB 1SF0A 1D5XC 2J42A 1IP9A 1UF0A 3PSEB 3Q8BA 2NBWB 2Z59B 2D3GA 3UQBA 2SAKA 1MHHE 3N32A 4DHZE 4LNIA 3BIID 2K8CA 2WXOA 4WH4A 1T6BX 4ZYNA 4EFOA 2M4NA 1ACCA 3AE7B 3B08A 2N9XA 1N6ZA 3N1XC 2HDEA 3JW0X 1E8ZA 2LVOA 1EF5A 1WXQA 4DK5A 4DDGD 1H8CA 4JE3B 1I4PA 4KX6B 3PGEA 2K0PA 4XWWA 4YT0B 4GSWA 1RLFA 1JALA 3BVGA 5JHAA 1HTQA 1JWBD 5IN7A 2ICIA 3AV8A 3TIXA 4WAFA 1Q0WB 4BZAA 3A9JB 4GGQA 3U7DA 1WYGA 3VQIA 4A90A 3W1YA 1RFAA 1RL9A 1VRPA 2W9NA 3JQ3A 1IYFA 2ZZPB 4MT5A 5L95C 1XLPA 1XLOA 1WSPA 2D3CA 4I6PA 2Y5CA 3AE1B 4I6NB 4BHLA 1FRDA 3TCAA 4N6EB 2KDFB 3SU8X 2V3SA 3A4RA 2LHEA 2C7HA 4XWTA 2KK8A 3B9JA 3I63C 1EWYC 1Q10A 1DYQA 4Z9MA 4ANVA 4IWPA 3VUXA 3P63A 3WALA 1SJED 4ACFA 3KWLA 2G45B 3PHXB 1QF6A 2IY0B 4NJCA 3T8MA 2WXFA 3ZDMC 3A9JA 1TGZB 4MSMB 4YSZB 1X1MA 4ITKA 2YVCA 4UDUC 4F7ZA 1L0YB 4BBNC 1ZGUB 4OVUA 3BVZA 4WWOA 1CJEA 2C60A 2MEKA 4PK1A 2KX0A 3P4RB 3LVVA 4KZ0A 3IG3A 5LXHA 3L08A 4ANUA 3KW5B 4RNAA 1I4RA 2KWDA 4RGMA 2QILA 4ICUA 1K53A 4FLHA 4IDIA 1E7PB 1YJIA 3DBHB 3T3NA 2VZKB 2ZW1A 1R4MB 1WR1A 4RF6A 3OLMD 5AZHA 1UBQA 1UELA 2KFJA 4OZAA 4R3DA 5MPOA 2PVOD 4DXAB 4URKA 1GUAB 2Q5WD 2KACA 3L2EB 4KGRA 1DOXA 4LDTD 5G55A 2WDQB 4WJNA 3NY5A 5E6OA 2XEWA 1IBXB 2RDHA 4US9A 1E0ZA 4C00A 3JU5A 2IBIB 4WURA 1I4QA 1EU4A
chains in the Genus database with same CATH topology
1FPYA 3FKYA 2GWCA 1F52A 2D3CA 4HPPA 3LN6A 1V4GA 2WGSA 3ZXRA 4ACFA 4LNKA 3IG5A 2D3BA 2QC8A 4LNFA 4XYCA 2GLSA 1HTQA 2WHIA 1R8GA 2LGSA 2D32A 1VA6A 2BVCA 1LGRA 3ZXVA 1TT4A 1HTOA 1F1HA 3LVVA 3LN7A 2OJWA 4S0RA 4LNNA 3IG8A 2D3AA 4BAXA 2GWDA 3NG0A 2D33A 4LNOA 2UU7A 3LVWA 3NZTA 4LNIA 4S17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FPY A;  3FKY A;  1F52 A;  2D3C A;  4HPP A;  2WGS A;  3ZXR A;  4ACF A;  4LNK A;  2D3B A;  2QC8 A;  4LNF A;  4XYC A;  2GLS A;  1HTQ A;  2WHI A;  2LGS A;  2BVC A;  1LGR A;  3ZXV A;  1HTO A;  1F1H A;  2OJW A;  4S0R A;  4LNN A;  2D3A A;  4BAX A;  3NG0 A;  4LNO A;  2UU7 A;  4LNI A;  4S17 A; 
#chains in the Genus database with same CATH topology
 1A5R A;  5T8I A;  1E6E B;  2NCN A;  4BFR A;  4OZB A;  3M3J A;  4DBG A;  1V1O A;  2XK5 B;  1VRA B;  2L3Z A;  4BKS A;  4W9L A;  2J53 A;  2ZVN A;  3RPF C;  2L05 A;  5E6J A;  3DOW A;  4HKQ A;  1SBB B;  3P2B A;  2IJ0 A;  1SSN A;  4TSS A;  2MBH A;  4LLG M;  1P9D U;  2GWC A;  5E6N A;  1F52 A;  1VDV A;  1JW9 D;  2KLG A;  3L2E A;  1TS3 A;  3DBR B;  3X0W A;  2K39 A;  4EEW A;  4C56 C;  5BMH A;  2JX5 A;  4C7Y A;  3GE3 C;  1IBX A;  3O13 A;  5G5G A;  4M8M A;  3URY A;  4W9H A;  1EM7 A;  1QOF A;  4GB9 A;  1DGJ A;  2KQ7 A;  3DQV A;  3RI7 C;  3RZF A;  3W1S A;  2XK5 A;  3QA8 A;  1ET9 A;  1QQR A;  3L0W B;  1WZ0 A;  2AX5 A;  1QT9 A;  3OJ4 B;  1MJD A;  4E3C A;  1TY2 A;  1P3Q U;  3ZUN A;  2N1V A;  2ZNV B;  4NAW B;  2REX A;  2MJ3 A;  5D3D A;  4ICV A;  2WP9 B;  2FCM A;  1J7B A;  3Q8E A;  4IM2 A;  4HKZ E;  3TL5 A;  1YOV B;  1SE9 A;  4A3O A;  4GVY A;  4K7S A;  3L54 A;  2WXH A;  2DWQ A;  3DBS A;  1L6U A;  3AE2 B;  2LXC A;  2KDE B;  1WM3 A;  2JWU A;  4YTN B;  2KMA A;  1I0E A;  2W3R A;  2WXJ A;  4WQO B;  4K1R B;  2PJH A;  4S17 A;  4P16 A;  1YN4 A;  1NI2 A;  3WAP A;  2V3N A;  2NMQ A;  1M4V A;  2J52 A;  2M17 A;  4MEL A;  2Z0E B;  3NS8 A;  2N7J A;  3CSF A;  1WGK A;  4HPM B;  1NYR A;  2DEN B;  4NAW A;  3PRP B;  3VUY A;  2D33 A;  3T9L A;  2LD9 A;  3C0R B;  5CX3 A;  3PO0 A;  3R7R A;  4M01 A;  2WDT B;  2L7R A;  3M63 B;  4KGS A;  4JIO U;  2C5L C;  2WDR B;  1N61 A;  2N7E A;  4P1B C;  2K1F A;  3N3K B;  3TEX A;  2SEB D;  1JCK B;  4RF7 A;  4RF8 A;  3HVD A;  1P7F A;  2KN5 A;  1L4D B;  1TS5 A;  2KHW B;  4G0N B;  2Y5B B;  2KO3 A;  2RGF A;  1ET6 A;  1MFW A;  5IO9 A;  2XNA C;  3QJZ A;  4RF9 A;  4ZHP A;  1C79 A;  2BYV E;  2Y3A A;  5HHD G;  4CHK A;  3LN6 A;  5J17 A;  5AUI A;  4NNJ B;  3ZVV A;  1P1A A;  4YXD B;  4GOC A;  1GC6 A;  1DOY A;  4G50 A;  3MC9 A;  3KUC B;  4USA A;  5G5H A;  1L2N A;  1XQQ A;  1LXD A;  1JWU D;  3LYY A;  3CWI A;  1Y8R C;  2QHO A;  2KD0 A;  4JLC A;  2INN E;  3U8Z A;  1GG3 A;  2J0J A;  2BKF A;  3AEF B;  1ISN A;  1MI0 A;  4GW0 A;  2DZK A;  1I35 A;  2D5G A;  3OAW A;  4ANX A;  3VR9 B;  1WGD A;  3PS6 A;  1WMH B;  4BKT A;  1Z2M A;  1V6E A;  1V81 A;  3Q8A A;  3V60 A;  2WNM A;  3HRD D;  5AZF A;  1IUE A;  1SEB D;  3ZRF A;  3ZTC A;  2LGD A;  1WIA A;  2MWS B;  4LNK A;  3IG5 A;  3B2F A;  4BBN F;  1V1P B;  2DAJ A;  3AM9 A;  3KYD D;  4MEM A;  1KLG D;  4LJP B;  2L8J A;  4KZC A;  5JZE B;  1JQ4 A;  4JQW C;  3L16 A;  3MHS D;  4W9J A;  4L2Y A;  3WAO A;  2M1M A;  2X8X X;  1FM0 D;  5LLI A;  2BGF A;  1V8C A;  2BS3 B;  1HZ5 A;  3NVW A;  1GJZ A;  1WY8 A;  1V4G A;  3CIR B;  1PYW D;  4A55 A;  2C7M B;  1PUT A;  1GC7 A;  2EMT A;  2GRI A;  5J2R A;  4KGT A;  1RRB A;  4RF1 A;  1SB3 C;  1XEE A;  1XLQ A;  4WIP A;  1BG0 A;  3VUW A;  2W82 A;  1TTN A;  1J7C A;  1WMH A;  2K6Q A;  3MP9 A;  1QIL A;  3RFZ B;  1WR6 E;  4HPL B;  4FHJ A;  1J8C A;  1MG4 A;  1KF6 B;  4KDL B;  4XX5 A;  4HJK A;  5TSS A;  1KLV A;  2MSE D;  1V5T A;  4RMA A;  1QOA A;  2IGH A;  2KJH B;  4LCD E;  3DCG A;  5CTR C;  3Q2A C;  4II2 B;  2M0X A;  1V1P A;  3DBH I;  2GI9 A;  2D10 A;  1R4M I;  2EMS A;  1QK1 A;  3RT3 B;  2ACZ B;  2KFK A;  2DBY A;  3ZRC A;  2FIF A;  3PTF C;  2OJR A;  1ZXI A;  2DX5 B;  1TKE A;  1KFY B;  4E74 A;  2GMI C;  1XT9 B;  5IP4 D;  4KSL C;  1N5W A;  4TKN A;  4HWI B;  4LNN A;  3OWE B;  3QAQ A;  5EE1 A;  3DPD A;  1Q1O A;  2CS4 A;  2CJN A;  4HEA 1;  3ENE A;  3APF A;  3TSS A;  2LRW A;  1A70 A;  2KOX A;  1L7Y A;  1T0Q C;  1V97 A;  2JZZ A;  3U4E G;  2R2Q A;  1XF5 L;  4GN1 A;  3B1L X;  4DHJ D;  4DDI D;  3IT4 B;  1IPG A;  1N62 A;  1BT0 A;  4NJ6 A;  3NZT A;  3UQA A;  2MBQ A;  3Q6B A;  2ON8 A;  1YNT E;  1V2Y A;  2FE8 A;  2NBV B;  4FAD A;  4MSQ B;  1XCT L;  2WHI A;  3AEC B;  3DBR I;  3DRE A;  3NRZ A;  3PZ7 A;  2IYD B;  1K50 A;  2LFI A;  4M02 A;  5H92 C;  3LN7 A;  1GB4 A;  3I9V 1;  3P42 A;  3B2G A;  3Q3M C;  3ZJV A;  4A3P A;  2UWQ A;  3MC8 A;  2N1W A;  3BYY B;  1OEY A;  4HLE A;  1P52 A;  1D5Z C;  1BUI C;  4MH8 A;  1G6J A;  1RYJ A;  4BG4 B;  2L00 B;  1RM6 C;  3VXW A;  4GIV A;  2JF5 A;  2LGI A;  1P50 A;  3NVY A;  1EWC A;  2INP E;  4RF0 A;  3ZXV A;  2BW2 A;  1WI0 A;  1XO3 A;  2I2Y A;  2KDB A;  1L0X B;  3DWM A;  2IGD A;  3W5U B;  5KHO A;  3D32 A;  2I1J A;  5C2T B;  1SXT A;  3RNA C;  5BYQ A;  5EDS A;  1NEN B;  3UF8 A;  4RGT A;  3CST A;  2G1E A;  3NUH B;  1C4C A;  4LK0 M;  2WLB A;  3ZW3 A;  3X23 A;  3IG8 A;  3QAR A;  4NPN A;  3ECI A;  2GBM A;  1WH3 A;  1YN5 A;  2LJI A;  3AE3 B;  4REZ A;  1WYW B;  3M95 A;  1FIQ A;  2A5U A;  1ZDX A;  3APD A;  2GBN A;  3PHW B;  2LUE A;  1WGG A;  2NTT A;  4BG4 A;  4G3X B;  4BOS C;  5J99 A;  4KV2 A;  1S3S G;  2KTF A;  2RPQ A;  4AJW A;  3VTW A;  5C23 A;  3V6C B;  1SD0 A;  5CHW A;  2WX0 A;  1FCC C;  4W9C A;  1J7A A;  3DHI C;  3VTV A;  3LXF A;  1E9M A;  4WJP A;  4K81 A;  2LZ6 A;  4TV3 A;  5D3I B;  2ZPY A;  1OTR B;  5FR3 A;  1F77 A;  5FR6 A;  2BS4 B;  4GU2 A;  1VZ7 A;  2ASQ A;  2K22 A;  1QOG A;  4YSX B;  4BOZ B;  1OEY J;  3BIN A;  2OHF A;  3VVW B;  2E3T A;  4MAC A;  3IAS 1;  2YEP F;  3ETR A;  2DAF A;  5AEK B;  3TJP A;  1ZUD 2;  3BK2 A;  2INC C;  4F8C B;  2BB6 A;  3C19 A;  2KTR B;  4HJG E;  1JRU A;  2BPS A;  3W9C B;  2WYQ A;  3SEB A;  5D2M B;  5IA7 A;  1AW7 A;  3VFK A;  2KDM A;  2AEH A;  3MFG A;  2IZV B;  1FPY A;  2IY1 B;  3RNG C;  4FN2 A;  1TIF A;  3HIZ A;  1VCB A;  3MJ5 A;  3AB5 A;  3ZLZ A;  3ML9 A;  2KNB A;  3AEB B;  1PQS A;  2RPV A;  4H2A A;  3V62 A;  3PV1 A;  1VZ6 A;  3HHM A;  4ZRP A;  2BYT A;  3QK0 A;  2KMM A;  3AI5 A;  2FAZ A;  1R7S A;  3KUZ A;  4PS8 A;  1E90 A;  4NY0 A;  1UUP A;  2KVZ A;  2N0S B;  5EE0 A;  3Q3F A;  2KAJ A;  3WAM A;  5HFY A;  2BB5 A;  1YMH E;  1RFK A;  2J4X A;  3WAN A;  1NBF C;  4BKS D;  2C7N B;  2KTR A;  3I5J C;  1E5W A;  2DLB A;  2FID A;  2V1Y A;  5HG2 A;  3SFD B;  2VZK D;  2JQR B;  3IAM 1;  2M0A A;  4OW0 A;  4JWS C;  1V86 A;  3NOB A;  2WXQ A;  4FHK A;  3OJ3 A;  3ZXR A;  3ZQ4 A;  3FAH A;  2BTE A;  4J6I A;  4JGH B;  3RNF C;  5DPS A;  3P4Q B;  4FA6 A;  1UH6 A;  2DYO A;  1VA6 A;  4W9I A;  3MJW A;  2N9K A;  1N63 A;  3M10 A;  2NTS A;  3NVZ A;  3Q69 A;  2NVU I;  5I4D A;  3NZS A;  3GP7 A;  4N59 A;  4F1S A;  1NDD A;  2WWZ A;  2JZP A;  3BWU D;  4ZDV A;  2O6V B;  4MGI E;  3RZW C;  1NVI D;  2CHZ A;  1OQY A;  4KIK A;  1K8R B;  4AQ7 A;  1P98 A;  2Y5P A;  1R8G A;  3AEA B;  1Y56 A;  3WA0 A;  3UIO B;  3JU6 A;  5D6J B;  2MHJ A;  4AOF A;  2ZJD A;  3DBL B;  1UNS A;  4YL8 A;  5IKC M;  2N9P C;  1ZPS A;  4K7U A;  3TBL D;  4OZC A;  2GBR A;  3AE4 B;  4P1C C;  3VH4 B;  2FUG 1;  1F2R I;  4A20 A;  3RUI B;  2V4I B;  1F0Z A;  3J9C A;  4RGN A;  1FNU A;  3RCZ A;  2Z8L A;  2WXK A;  3U30 A;  1HQR D;  1F1H A;  3RNC C;  2CR5 A;  2OJW A;  2LGX A;  3Q3J A;  3AXC A;  1CZP A;  4A6Q A;  3ZKJ C;  5JHB A;  2KZR A;  2MX2 A;  1I7H A;  1P0R A;  2B3A A;  2O6V A;  2PE9 A;  1WE7 A;  4ANW A;  3IFW B;  1WJ4 A;  4I6L B;  4PS7 A;  2AL3 A;  3AMZ A;  3ZJU A;  1SE2 A;  2XN9 C;  1GPX A;  1OQQ A;  1FEH A;  3L2D A;  2L83 A;  4HK2 A;  3R3M A;  1GAQ B;  3VAW A;  1TKY A;  1NYQ A;  1D5M C;  3Q8C A;  1AWD A;  1AAR A;  1AYF A;  2MRP A;  1RAX A;  1ZW7 A;  2PLP A;  2WX1 A;  3A9K A;  1SGH A;  1TZ1 A;  1M94 A;  4XC2 A;  4DWF A;  3BVM A;  2DZJ A;  4IC7 B;  4IM3 A;  4EZJ A;  5CHF A;  1K51 A;  1WE6 A;  3I3T B;  2PPH A;  4P6V F;  2IGG A;  2IO0 B;  3MC0 B;  1JWA D;  1WJ6 A;  2ONQ A;  1E10 A;  1PFD A;  3L13 A;  4OHJ A;  1OQR A;  3IXS A;  4HPP A;  2WU2 B;  3EFU A;  4JL9 A;  4XYC A;  2DYM A;  2IO3 B;  1FFV A;  3SHQ A;  1FO4 A;  1TBE A;  3DHH C;  1KJT A;  3QC8 B;  1T0S C;  3B6R A;  2FCN A;  2PMV A;  1OFF A;  4K3C A;  2LRU A;  5AUK A;  1MVK A;  2MJE A;  4MGK E;  3EEC A;  4PYZ A;  2J0K A;  3L10 B;  2PKO A;  3C8Y A;  4RH6 A;  5E6P A;  2J7Q B;  4LTU A;  4W9D A;  3DVG Y;  4ARI A;  1WJN A;  3V61 A;  1ENF A;  3AED B;  4W9E A;  3GB1 A;  2GLS A;  3DVN V;  1N5X A;  2NR2 A;  1FXT B;  2LUM A;  3R66 C;  4WWP A;  3QQ8 B;  2JRI B;  2YEP B;  2R61 A;  3AU5 A;  1HZ6 A;  1EO6 A;  3VRA B;  1ZKH A;  1NEK B;  2BYE A;  2WXM A;  4K7W A;  2M19 A;  5EE3 A;  2IDY A;  4GVZ A;  1UD7 A;  2PW9 A;  2LAS A;  4HRO A;  2DZM A;  2KC2 A;  3TEZ A;  1PGX A;  2WDV B;  2FCQ A;  3H7P A;  4WJO A;  4XDC A;  1BML C;  1VR9 A;  4B0E A;  3RNE C;  1IGD A;  2KFK B;  2N9L A;  3TUO A;  2IND C;  2FBW B;  5CHV C;  3MTN B;  3DVG X;  3ABV B;  1S1Q B;  3KWV A;  3SD5 A;  4Q2R A;  2L0T A;  5AZG A;  3H9D A;  1YQ4 B;  1CK1 A;  1WFY A;  3JVZ X;  2QSD A;  2RMM A;  1Z5S B;  1RWS A;  3A1Q B;  1KLU D;  3NZ3 A;  1GB1 A;  3BYT B;  1ZDV A;  5FK9 C;  1GOZ A;  2BQQ A;  2GB1 A;  4O1N A;  2IO2 B;  2LWP A;  1T3Q A;  1TY0 A;  2LEK A;  3PT2 B;  3EA6 A;  1V5O A;  4IUM B;  3UGB B;  2DZI A;  2BBC A;  2ZPN A;  4HVB A;  2QEJ C;  1WWT A;  1TKG A;  3OG5 A;  4RCO A;  3LDZ E;  5BO4 B;  2PTL A;  2ZCC A;  4TQ1 A;  2K25 A;  2KX3 A;  3VR8 B;  4MM3 A;  4AS1 A;  5BYR A;  2Z0D B;  1B9R A;  2KWV B;  4TMA B;  1ESF A;  4AM1 A;  4A8X C;  1C9F A;  1K52 A;  3RN9 C;  2WXN A;  2N7D A;  2JYT A;  1YN3 A;  5LXI B;  4CQN A;  1VD2 A;  2AQ1 B;  3A1Q A;  4HDQ A;  1PGB A;  2OOB B;  1L5P A;  3BZD B;  2CHX A;  4NJ7 A;  3PLV A;  1KOT A;  1SE4 A;  2KQS A;  4GDK B;  4HCP B;  4EKU A;  4PT5 A;  1EF1 A;  3MHZ A;  1DOI A;  1D3Z A;  1C4P A;  2AWT A;  2UU7 A;  2WXG A;  2VH1 A;  5C3J B;  1C3T A;  3EC8 A;  3B0A A;  4IWQ A;  1N60 A;  3N9Y C;  2JSV X;  2KYW A;  2CU3 A;  2NPT B;  4FUL A;  2CKH B;  4BVU C;  1D4B A;  3DWG C;  5DPW A;  3E56 A;  4AWJ A;  5HI1 A;  3DBL I;  2I1K A;  2JY6 A;  3KQ4 A;  5DPR A;  4GDL A;  4ZHO A;  3L4P A;  4NQK E;  3U2S C;  4EOY A;  3DHG C;  2GBK A;  2RSU A;  3H6N A;  4RFB A;  2FCS A;  4MDK E;  4MJS A;  4W9K A;  2MCN B;  1WXA A;  2BWE S;  1WM2 A;  2XBB C;  1R4N B;  3AH7 A;  2K6D B;  1WXV A;  1PDX A;  4GDK A;  2JZ3 B;  2QCZ A;  5LNK 1;  2KJ6 A;  3Q3O C;  5IAA C;  3VHT C;  2W3S A;  3WIM A;  3S2A A;  5H8Y E;  4DQO C;  3P4P B;  3UIP B;  1GNU A;  2KQ4 X;  5D7G A;  2MQJ A;  3ZYY X;  3IHP C;  2K5P A;  2NPT A;  1E7V A;  2EKE C;  3N20 C;  5JH5 C;  4C4V B;  3W2D A;  3VRB B;  4JX1 C;  2L1A A;  4IOI E;  2KVR A;  2JUO A;  3IBE A;  4D2K A;  2GWD A;  4US8 A;  2G4S A;  3JPZ A;  1LM8 B;  4AP4 C;  4WJQ A;  1VLB A;  3HM3 A;  3NZU A;  2HTM E;  2G9H D;  2MW5 A;  3U52 E;  1UWM A;  1Q5W B;  1TS4 A;  3JSV B;  1WX7 A;  2LI5 A;  3CF6 E;  5HKH A;  2KWU B;  3TEW A;  3T3O A;  4FJY A;  4Q2J A;  2RD0 A;  2B76 B;  5DPT A;  2AQ2 B;  4HCN B;  5BYS A;  3RYT A;  1C78 A;  3PRE A;  1YX6 B;  1E8Y A;  3HK0 A;  3L17 A;  3QX1 A;  2O2V B;  1WRI A;  4C4V A;  4JWU C;  2MLB A;  2D07 B;  1C4A A;  2PVG C;  1WX9 A;  3KUD B;  2LHD A;  2QMT A;  4DXG A;  3V05 A;  4M0W B;  3RMK C;  3R2I A;  1SJH D;  3UI3 A;  3JSV A;  4NAM A;  3ZTD A;  1SIJ A;  4KKI A;  1L6V A;  2JXX A;  2D11 A;  2LJ5 A;  3ZNG C;  2M8S A;  4RM8 A;  2K8H A;  2D3B A;  1AN8 A;  1J19 A;  3ZJT A;  3A33 B;  2WXI A;  1I4G A;  3GOE A;  2J1Q A;  2KXJ A;  2JRH A;  2MBE A;  3QCA A;  1P7E A;  1FRR A;  1V80 A;  2CU1 A;  3HM6 X;  2L52 A;  3NVV A;  1UGJ A;  2O2V A;  3H7S A;  1C1Y B;  1M15 A;  3JYU A;  1TYG B;  3ZGZ A;  1ZXH A;  3NS1 A;  2H88 B;  3KVF B;  4XZ4 A;  4WWN A;  3NHE B;  1YQ3 B;  3M62 B;  4LDT B;  1I4X A;  2CJO A;  4KIK B;  1QLB B;  4KKJ A;  1TZO A;  3RNB C;  1T0Y A;  3Q8F A;  3N1Z C;  1HA5 A;  2TSS A;  2W54 A;  2KJR A;  4G11 A;  3SDL C;  4TUU A;  4YTM B;  1YJJ A;  4W9G A;  3SFE B;  4FJV B;  4M8N A;  2ZEQ A;  3V6E B;  4M0W A;  2OED A;  2AYO B;  2BF8 B;  4NQL B;  2KT7 A;  3U7Z A;  1E8W A;  3PZ8 A;  5GMV A;  2D2Q A;  1NI3 A;  1UBI A;  4CYE A;  4E71 A;  3W1S C;  2WGS A;  3O65 B;  4RM9 A;  1OGW A;  2JWZ A;  4LNF A;  4CO7 A;  1QZE A;  3GZN B;  2FUH B;  2C9W B;  1TJE A;  3BK1 A;  3P4S B;  4TQ0 A;  3WCQ A;  1U4A A;  1T0R C;  2G4D B;  1V49 A;  3QIJ A;  3KYC D;  1FXI A;  1YX5 B;  3IVF A;  4OVZ A;  2MP2 B;  3NG0 A;  3R2T A;  4EZL A;  4L1B A;  2MBO A;  3V3X A;  2LXA A;  5BMG A;  2JVC A;  2LVP A;  4IKG A;  4C80 A;  1G0W A;  3ML8 A;  1WJU A;  3EHV A;  5J9A A;  1XXG A;  5KHQ A;  1TT4 A;  1QOB A;  3HUI A;  1C77 A;  5BMI A;  2EKI A;  4L23 A;  2WU5 B;  2DYB A;  4FJZ A;  2PIA A;  3A9K B;  3EGR A;  3H8H A;  2MH7 A;  2KWC A;  2O6V D;  2PE6 B;  4IM0 A;  4HDO A;  5C1Z A;  5D94 A;  4X57 B;  2ZNV C;  1IGC A;  4BAX A;  1C76 A;  4LNO A;  2MP2 A;  1MG8 A;  3ZNI D;  3RUL A;  4AUQ C;  4YTP B;  2LGY A;  2V3P A;  1FNW A;  1UWX A;  3DDC B;  3APC A;  4KVG B;  1L0V B;  2HTH A;  1QH4 A;  4YSY B;  3QWZ B;  2UYZ B;  2AQ3 B;  1HXY D;  5FKA C;  1UGM A;  3R8B A;  3PLU A;  2AL6 A;  3AE9 B;  3N30 A;  4PS3 A;  4EE2 A;  1H4R A;  2BT6 A;  1LFD A;  2KDI A;  2CRK A;  2L76 A;  2K9X A;  1WGY A;  2GBJ A;  1MPE A;  4EUT A;  4LJO B;  2I38 A;  3LJ3 A;  1WZ3 A;  3Q14 C;  1WGH A;  1I4H A;  1WGR A;  3AE8 B;  3AN1 A;  4B6W A;  1E8X A;  2BKR B;  1JWS D;  3W5V B;  1CQV A;  2RDG A;  3ZO5 B;  3FIL B;  1B1Z A;  5DCN A;  1FXA A;  5JXV A;  2LMC A;  4K3B A;  2X38 A;  2J0M A;  3AUL A;  4ASW C;  1R4N I;  1D6E C;  3UIN B;  3TEY A;  4KSK C;  1JWM D;  4DXF A;  5L83 A;  4BKG A;  1BXT A;  1CMX B;  3ALB A;  3FKY A;  2L32 A;  2N9E B;  4MGY E;  1I42 A;  1V9J A;  3PPA A;  2RDB C;  5EE9 A;  3DRB A;  4J3O D;  4FBJ B;  2RR9 A;  1TT5 B;  2V4L A;  2A4Z A;  4C7Z A;  1LO5 D;  1YIW A;  2KN4 A;  1XLN A;  3H7P B;  2V9H A;  4YWG G;  4MH0 E;  4DHZ B;  4GLS C;  2BYF A;  3PRZ A;  3R7Q A;  1L4Z B;  1KH0 A;  3ZDT A;  3EUB 2;  2HE7 A;  2WXL A;  3FIL A;  4II3 B;  2JXT A;  1JML A;  1XCQ L;  3PZD A;  4HRS A;  3FC4 A;  3VTU A;  2DNF A;  1TS2 A;  2BS2 B;  5IOI A;  4GMV A;  1WX8 A;  1YD8 U;  2NS5 A;  2WQY B;  5G2N A;  4JPS A;  1E7U A;  1FNV A;  1JRO A;  1HEZ E;  3TMP B;  2N4F A;  1T5X D;  2CHW A;  1ZP0 B;  3K9P B;  1HE8 A;  2QIE B;  1WXS A;  1LQB A;  1STE A;  4W9F A;  2QJL A;  4FXC A;  2YLM A;  2NBU A;  2WXP A;  2GOW A;  2LGS A;  1MHX A;  1EUV B;  5TR5 A;  2D32 A;  3BY4 B;  1KTK A;  3LB8 C;  2E6X A;  2EEL A;  4EZK A;  3GE8 C;  2MA9 B;  1SIF A;  1EU3 A;  3KH0 A;  2KMC A;  1VZ8 A;  4RGO S;  2KC1 A;  4IWO A;  3PVL A;  4HXD A;  3SR6 A;  4IW0 A;  1F9J A;  4MM3 B;  4ZRJ A;  2BVC A;  2JYE A;  2L0F A;  3A4S C;  4OVV A;  2ZCB A;  1U6R A;  2W55 A;  2G3Q B;  4ARC A;  2K8B A;  1PGA A;  2IO1 B;  1SE3 A;  3AU4 A;  3EFC A;  3E9S A;  2HJ8 A;  2VRR B;  2HD5 B;  3PRM B;  2BWF A;  3AEG B;  2LVQ A;  1FCL A;  2JT4 B;  4GW2 A;  3KLS X;  4WQM A;  4KDI C;  1ZOY B;  3AEE B;  2JPH A;  4AJY B;  2MBB B;  3HVZ A;  2DHZ A;  4B95 A;  4QAY A;  5J18 A;  3RD2 A;  2H89 B;  3CMM B;  1ZE3 D;  3Q3N C;  3ZNZ B;  3NJT A;  3VDZ A;  2QDF A;  1F2R C;  2V0G A;  2KKC A;  1WF9 A;  2K3U A;  1FD6 A;  3GS2 A;  2VH2 A;  3AE5 B;  3ZIM A;  1QKZ A;  4P7I A;  2ZW0 A;  4ZYS A;  4XGA B;  4XE0 A;  1HTO A;  1FFU A;  4M00 A;  1FMA D;  1VJK A;  4ZOH C;  4B0M A;  4GDL B;  1ROE A;  1YJ1 A;  1XD3 B;  2WS3 B;  3IT6 B;  1KM7 A;  4MJS B;  4A9A A;  3VH3 B;  2M56 B;  3N1Y C;  4N9F 4;  2FNJ B;  4DHJ B;  3GZN I;  4WAA A;  2ZVO A;  4NZL B;  3H1U A;  4S0R A;  1YQB A;  3LVW A;  2KAN A;  3K9O B;  1UZX B;  1CRK A;  2WXR A;  1KRH A;  2KLC A;  4ZRI A;  1JRP A;  4N58 A;  4ZRK A;  2HJ1 A;  3ONS A;  3I57 A;  2JU6 X;  3DVN U;  4ZRQ A;  4IG7 B;  1J0G A;  1LGR A;  4MGZ E;  4XDD A;  2D3A A;  3QHT A;  4GXB A;  1WXM A;  5GXG B;  2PEA A;  4B9K A;  3P1M A;  3ZNH B;  2R2O A;  2QC8 A;  2MJD A;  4WWM A;  4PYU A;  2IPK D;  3AE6 B;  1WRD B;  1SF0 A;  1D5X C;  2J42 A;  1IP9 A;  1UF0 A;  3PSE B;  3Q8B A;  2NBW B;  2Z59 B;  2D3G A;  3UQB A;  2SAK A;  1MHH E;  3N32 A;  4DHZ E;  4LNI A;  3BII D;  2K8C A;  2WXO A;  4WH4 A;  1T6B X;  4ZYN A;  4EFO A;  2M4N A;  1ACC A;  3AE7 B;  3B08 A;  2N9X A;  1N6Z A;  3N1X C;  2HDE A;  3JW0 X;  1E8Z A;  2LVO A;  1EF5 A;  1WXQ A;  4DK5 A;  4DDG D;  1H8C A;  4JE3 B;  1I4P A;  4KX6 B;  3PGE A;  2K0P A;  4XWW A;  4YT0 B;  4GSW A;  1RLF A;  1JAL A;  3BVG A;  5JHA A;  1HTQ A;  1JWB D;  5IN7 A;  2ICI A;  3AV8 A;  3TIX A;  4WAF A;  1Q0W B;  4BZA A;  3A9J B;  4GGQ A;  3U7D A;  1WYG A;  3VQI A;  4A90 A;  3W1Y A;  1RFA A;  1RL9 A;  1VRP A;  2W9N A;  3JQ3 A;  1IYF A;  2ZZP B;  4MT5 A;  5L95 C;  1XLP A;  1XLO A;  1WSP A;  2D3C A;  4I6P A;  2Y5C A;  3AE1 B;  4I6N B;  4BHL A;  1FRD A;  3TCA A;  4N6E B;  2KDF B;  3SU8 X;  2V3S A;  3A4R A;  2LHE A;  2C7H A;  4XWT A;  2KK8 A;  3B9J A;  3I63 C;  1EWY C;  1Q10 A;  1DYQ A;  4Z9M A;  4ANV A;  4IWP A;  3VUX A;  3P63 A;  3WAL A;  1SJE D;  4ACF A;  3KWL A;  2G45 B;  3PHX B;  1QF6 A;  2IY0 B;  4NJC A;  3T8M A;  2WXF A;  3ZDM C;  3A9J A;  1TGZ B;  4MSM B;  4YSZ B;  1X1M A;  4ITK A;  2YVC A;  4UDU C;  4F7Z A;  1L0Y B;  4BBN C;  1ZGU B;  4OVU A;  3BVZ A;  4WWO A;  1CJE A;  2C60 A;  2MEK A;  4PK1 A;  2KX0 A;  3P4R B;  3LVV A;  4KZ0 A;  3IG3 A;  5LXH A;  3L08 A;  4ANU A;  3KW5 B;  4RNA A;  1I4R A;  2KWD A;  4RGM A;  2QIL A;  4ICU A;  1K53 A;  4FLH A;  4IDI A;  1E7P B;  1YJI A;  3DBH B;  3T3N A;  2VZK B;  2ZW1 A;  1R4M B;  1WR1 A;  4RF6 A;  3OLM D;  5AZH A;  1UBQ A;  1UEL A;  2KFJ A;  4OZA A;  4R3D A;  5MPO A;  2PVO D;  4DXA B;  4URK A;  1GUA B;  2Q5W D;  2KAC A;  3L2E B;  4KGR A;  1DOX A;  4LDT D;  5G55 A;  2WDQ B;  4WJN A;  3NY5 A;  5E6O A;  2XEW A;  1IBX B;  2RDH A;  4US9 A;  1E0Z A;  4C00 A;  3JU5 A;  2IBI B;  4WUR A;  1I4Q A;  1EU4 A; 
#chains in the Genus database with same CATH homology
 1FPY A;  3FKY A;  2GWC A;  1F52 A;  2D3C A;  4HPP A;  3LN6 A;  1V4G A;  2WGS A;  3ZXR A;  4ACF A;  4LNK A;  3IG5 A;  2D3B A;  2QC8 A;  4LNF A;  4XYC A;  2GLS A;  1HTQ A;  2WHI A;  1R8G A;  2LGS A;  2D32 A;  1VA6 A;  2BVC A;  1LGR A;  3ZXV A;  1TT4 A;  1HTO A;  1F1H A;  3LVV A;  3LN7 A;  2OJW A;  4S0R A;  4LNN A;  3IG8 A;  2D3A A;  4BAX A;  2GWD A;  3NG0 A;  2D33 A;  4LNO A;  2UU7 A;  3LVW A;  3NZT A;  4LNI A;  4S17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...