4BAXA

Crystal structure of glutamine synthetase from streptomyces coelicolor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
344
structure length
344
Chain Sequence
HMTFKAEYIWIDGTEPTAKLRSKTKIITAAPAGLDALPVWGFDGSSTNQAEGSSSDCVLKPVFSCPDPIRGGEDILVLCEVLDTDMTPHPSNTRAALAELSERFAAQEPVFGIEQEYTFFKGTRPLGFPEGGFPAAQGGYYCGVGSDEIFGRDVVEAHLENCLKAGLGISGINAEVMPGQWEFQVGPLAPLEVSDQLWVARWLLYRTAEDFEVSATLDPKPVKGDWNGAGAHTNFSTKAMREGYDAIITAAESLGEGSKPMDHVKNYGAGIDDRLTGLHETAPWNEYSYGVSDRGASVRIPWQVEKDGKGYIEDRRPNANVDPYVVTRLLVDTCCTALEKAGQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMINE SYNTHETASE
publication title Structure of Glutamine Synthetase from Streptomyces Coelicolor
rcsb
source organism Streptomyces coelicolor
molecule tags Ligase
total genus 101
structure length 344
sequence length 344
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2012-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 4baxA01
3.30.590.40 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Creatine Kinase; Chain A, domain 2 4baxA02
2WGSA 2GLSA 1F52A 4LNIA 4LNOA 3NG0A 4ACFA 4LNKA 3ZXRA 4LNNA 1HTOA 1HTQA 2WHIA 1F1HA 3ZXVA 2LGSA 4LNFA 4HPPA 4S17A 1LGRA 4BAXA 4S0RA 2D3AA 2UU7A 2D3CA 2OJWA 1FPYA 2D3BA 2BVCA 2QC8A 4XYCA 3FKYA
chains in the Genus database with same CATH superfamily
2KZRA 2RPVA 4IKGA 1XLOA 3SD5A 2PTLA 5DPRA 3H7PB 4B0MA 4FJZA 3AE4B 5AEKB 3DWMA 4K7UA 4HEA1 5IAAC 2SAKA 2OHFA 2BW2A 2NBVB 1C79A 4C80A 2GWDA 2G1EA 3JYUA 1UWXA 2JRHA 3W1SC 4XYCA 4XDDA 4WAAA 1M15A 3BYTB 1E10A 1KM7A 2KXJA 5TR5A 4YTPB 3JU6A 2FAZA 3P4PB 2LJ5A 2WHIA 2IJ0A 1JWSD 4JWSC 3L54A 3P4QB 2N9XA 1YJIA 1X1MA 2IGGA 2K6DB 4ARCA 1FNUA 3GB1A 3AE8B 5DCNA 3WAMA 4C56C 2YVCA 3HIZA 3KUCB 2JX5A 4ANVA 1PDXA 2C5LC 5EE3A 3HVZA 2J53A 4LCDE 3RNBC 1IP9A 4AJYB 3WAOA 4YL8A 4C4VA 2FCQA 5H8YE 1E0ZA 5C23A 3V6EB 2IGHA 2LFIA 2ONQA 4DHJD 1FD6A 1D5MC 1EUVB 1EO6A 2VH1A 3NS1A 4EE2A 3RZFA 3A9KB 1QF6A 2NR2A 4KSKC 2MW5A 2EKIA 2LGIA 1GB4A 4KV2A 1E8YA 2RDGA 3PGEA 1WJUA 3L2DA 4PS8A 4FN2A 1WJ4A 3ZTCA 3LDZE 4LNNA 3S2AA 4BBNF 4XWTA 4K3CA 4W9LA 4KGRA 1E9MA 2CJOA 2MP2A 2IBIB 1IGCA 2IO1B 2MH7A 2ZW0A 3JW0X 4OVVA 4HCNB 1WJNA 2K22A 1F9JA 2X38A 3VRAB 2DNFA 3HHMA 1ZUD2 2LVOA 2V4LA 3ML9A 2BS4B 1C9FA 1XXGA 3N3KB 4I6PA 1ET6A 2JQRB 2D32A 2M4NA 2WXKA 3W1SA 4GDKA 3RI7C 4B9KA 1YOVB 2ICIA 3OG5A 4MH0E 5D3IB 2G4DB 1WR6E 3W2DA 2L52A 4XWWA 1SIFA 4RNAA 2E6XA 3VHTC 3W9CB 2K9XA 2CJNA 3RYTA 2PKOA 4J6IA 2L7RA 2W82A 1SE3A 4WH4A 3KUDB 3E9SA 2KTRA 2IZVB 3TEYA 4Z9MA 2V3PA 2KWUB 1QOGA 3ZLZA 3KLSX 3ZVVA 1VLBA 3APDA 1L0VB 2LGXA 4EFOA 2Q5WD 4PS7A 4A90A 4TQ1A 2LUEA 2JF5A 1WH3A 2MJ3A 4MEMA 3SHQA 3NVYA 4DXAB 3DVGY 1WSPA 4OZBA 5KHOA 3PRPB 1FCCC 2FIFA 3R7RA 4EOYA 2K25A 3IFWB 3HK0A 2JU6X 2ZVOA 2DHZA 3PZDA 3IG8A 1RFKA 4WQOB 1P52A 3AULA 2KFKB 2PMVA 4C00A 1XLQA 1I4QA 4MSQB 4OVZA 5GMVA 2BVCA 1JMLA 1FIQA 2UYZB 3JU5A 2GB1A 4RCOA 2RDBC 1A70A 2K8BA 1RFAA 3HRDD 2G9HD 1KOTA 4BKSA 4W9DA 2VZKB 4A3PA 1OFFA 1ZDXA 2L00B 1NI3A 1D5XC 1YIWA 1WGYA 3N9YC 2KQ7A 4ACFA 4GXBA 3LN6A 3DBRB 1UBIA 1N5WA 4ZDVA 1CZPA 5E6PA 1V1OA 2KHWB 1SGHA 3U30A 1OEYJ 2HE7A 2M1MA 3UGBB 2D3CA 3M3JA 2PVGC 2BWFA 1UZXB 4LNOA 4JLCA 4GGQA 1UGJA 1V5OA 1PQSA 2A5UA 1JALA 2LASA 1WWTA 2WDRB 5D94A 3UIOB 3DVNV 3ZJUA 3A9KA 2IO0B 4S17A 2WLBA 2R61A 4BG4B 5JHBA 3VDZA 2GMIC 1VD2A 1IBXA 2KACA 3EA6A 2WXNA 4KIKA 4RGNA 2KD0A 2GI9A 2X8XX 4GMVA 4GB9A 4HWIB 4AP4C 2KVRA 3BK2A 1WXQA 4WIPA 4CYEA 1C1YB 4YSZB 1UH6A 1JW9D 1XLPA 3GZNI 4II3B 1TS3A 4QAYA 1J7AA 2JUOA 4DXFA 4JWUC 2UU7A 2WYQA 2WQYB 2RDHA 1ZOYB 4ZRQA 3I57A 2AQ1B 4B95A 2OJRA 4JE3B 2J42A 1V80A 1P9DU 1VRPA 1L0YB 2ZNVB 1TY0A 3ZGZA 3ETRA 5GXGB 1OQYA 2MJDA 3L13A 1Q5WB 3J9CA 3MHZA 3WA0A 1EU3A 1K53A 4BVUC 2ZCCA 1MPEA 4KGTA 3JPZA 4WURA 3EGRA 4REZA 2XEWA 2M56B 1L5PA 3W5VB 2KJ6A 2GBRA 3BVGA 2WXOA 4Q2JA 3I63C 3ZDMC 3DCGA 2C7NB 2KMAA 3X0WA 3B2GA 2PVOD 2FUHB 1V5TA 1UUPA 4R3DA 2MJEA 2KTFA 1I4HA 4MSMB 5BYRA 1KLVA 4LNKA 4JQWC 4P1BC 4AQ7A 1LM8B 5J9AA 1RYJA 3FAHA 3M95A 2L76A 2O6VB 1FFUA 2NTSA 3IAM1 2RD0A 1V4GA 1F2RC 2MRPA 3RMKC 1TS2A 4M8NA 1WZ3A 1TBEA 2BGFA 3U4EG 1P3QU 4GOCA 2J0KA 2KFKA 1CMXB 1WGRA 4MH8A 4IM3A 3P63A 5HFYA 3V60A 1F52A 1BT0A 3U2SC 2XN9C 2A4ZA 5IOIA 2KVZA 3SFEB 3PZ8A 1GNUA 3LYYA 4ZYSA 3ZUNA 3KW5B 1V1PB 3DHGC 2MX2A 3ONSA 3IXSA 2EMTA 4BKSD 2Y5BB 3T9LA 1YJJA 1D3ZA 3VFKA 3GE3C 1KLUD 1K52A 1V49A 3MC8A 3PT2B 1C77A 2DYOA 2K6QA 2Y5PA 2MWSB 2ZCBA 3Q3FA 1IGDA 5D2MB 3QHTA 2WU5B 3PRZA 1JRPA 1KJTA 4LLGM 1V8CA 1TS4A 2L05A 2ON8A 3OAWA 4XE0A 3WALA 2W54A 3U7DA 2KDMA 3HUIA 4OZAA 3DVGX 5BO4B 2KJRA 2WXQA 2L0FA 4DBGA 4DWFA 4BG4A 4KX6B 1C4PA 4YXDB 2PJHA 3ZXRA 3DDCB 3IBEA 1WXAA 5HG2A 3TIXA 4A55A 3VH4B 4BBNC 1WZ0A 1HZ5A 4RM8A 3TEZA 1VZ7A 4MT5A 2LUMA 1ET9A 1FXTB 5D7GA 1ZPSA 2Z0DB 1OEYA 2PPHA 2N4FA 2NPTA 4KDIC 4KKJA 1YX6B 5D6JB 2DBYA 1GAQB 3AEGB 5G2NA 3ZNID 1QH4A 2O2VB 4LDTB 4DDID 4A6QA 2AWTA 3SU8X 3KYDD 2ASQA 4WWNA 4M00A 4IWPA 5AUKA 1OGWA 4E74A 3C19A 3AE9B 3LB8C 1FRRA 5I4DA 2KJHB 2LRWA 3RN9C 2TSSA 1WYGA 1L6UA 5FR6A 2YLMA 3AE5B 4LNFA 3RPFC 3L2EA 2PEAA 1R4MB 4ZRIA 1GOZA 4MJSA 1DGJA 4WAFA 2JYEA 1TZ1A 3IG3A 3RCZA 3I9V1 2I38A 1NVID 3DBLB 4N9F4 1RWSA 4IWQA 3GOEA 2BYFA 1TJEA 4FADA 2BQQA 3PHWB 1EF5A 4M01A 3APCA 1JCKB 4FBJB 4ASWC 1U6RA 1RM6C 3JSVB 1XO3A 1CQVA 1YD8U 3Q8BA 1ZDVA 1PUTA 2N7EA 1KFYB 3K9PB 2L0TA 4MM3A 3ALBA 1VR9A 2J7QB 3DBHB 1K51A 3AV8A 3QC8B 2DZJA 2O6VA 3JQ3A 4NQKE 2XNAC 5FK9C 2KANA 3CMMB 4MGIE 1WI0A 2IO3B 1T0YA 4AUQC 3NVZA 2I1KA 1VRAB 2LZ6A 1WGKA 3H9DA 1Z2MA 3ZQ4A 4A8XC 2REXA 3B08A 3DHIC 2QSDA 3M63B 5KHQA 4AJWA 2FNJB 1UWMA 2QJLA 3V6CB 4K7SA 1KRHA 5DPWA 2NBUA 3NZSA 3PLUA 3Q3NC 2BB5A 2JSVX 1R4NI 2INPE 4B6WA 2QC8A 1C4CA 3AEAB 3Q8CA 3P4SB 2ZZPB 2DZIA 2AL3A 1PGBA 3ENEA 1XD3B 5C2TB 2FCSA 4IG7B 1TIFA 2DAFA 3A9JB 2LVQA 4WWPA 3RD2A 4CHKA 1CK1A 2LMCA 3BVMA 3DBRI 4P1CC 4KGSA 3QIJA 3LJ3A 5J18A 1SJED 4WJOA 1D5ZC 2Y5CA 2IGDA 1JROA 1TGZB 4EEWA 4NQLB 3UINB 1XCQL 2D10A 1HTQA 3W1YA 3ZXVA 2DLBA 3RNAC 3LVWA 2OOBB 4HK2A 4GW0A 1R7SA 2HJ1A 3RNCC 3VAWA 1RLFA 1TT5B 4KZCA 4W9HA 5FR3A 1HZ6A 3OJ4B 1JWBD 1NBFC 4RMAA 5JH5C 3D32A 3PVLA 2JZ3B 2ACZB 4F8CB 1WXMA 4A3OA 4EUTA 2KYWA 4K3BA 3ZW3A 1SD0A 3NJTA 2JWUA 1PGXA 2MCNB 1BXTA 1N63A 3Q14C 2K8HA 3Q3MC 1YN4A 3AE3B 2LXAA 1F2RI 3MFGA 2C9WB 2WNMA 1UBQA 4KZ0A 4LJPB 2GBNA 1BG0A 3RNGC 3PHXB 1ZKHA 4OZCA 4XDCA 2LWPA 1Q0WB 4IC7B 3TUOA 1Z5SB 2V0GA 1UD7A 3ZRFA 1WR1A 3URYA 2RPQA 4F1SA 5JHAA 5LXHA 1HE8A 1GB1A 4ZRPA 1CJEA 2NVUI 3CSTA 2O2VA 1G0WA 2UWQA 2LEKA 3DBSA 4TSSA 5L95C 1HQRD 2INCC 3CWIA 3H7PA 2GRIA 5T8IA 3V61A 2HTME 3Q8EA 3KWVA 2L32A 1TS5A 5G5HA 1L7YA 3AH7A 1YQ4B 3QA8A 1U4AA 4HPPA 1ZW7A 3Q3OC 4DHJB 2LGYA 2GLSA 4C7YA 4LK0M 3A4SC 1SSNA 4YTMB 3U52E 2WXGA 1GC7A 3N1YC 2IDYA 1E7VA 1E8ZA 3TMPB 3GS2A 4A9AA 1FMAD 1K50A 3PSEB 3M10A 3EHVA 2WWZA 4YWGG 1N62A 4RH6A 5LLIA 5EE0A 2BKFA 2WS3B 3UQBA 1N5XA 3EECA 1GPXA 4RF9A 1E6EB 2M19A 1RRBA 4ARIA 2L3ZA 2MBBB 3Q8AA 2Y3AA 2LD9A 4ZRJA 2D11A 1LFDA 4EZLA 4GDLB 3DQVA 3R2TA 2D3AA 4GLSC 3QARA 1WXVA 4ITKA 1Y56A 3T8MA 5IP4D 3B0AA 1T0RC 3O13A 2KQ4X 1TY2A 1YMHE 3PREA 5H92C 4FJYA 4AM1A 3HM3A 4NJCA 5HHDG 2G45B 3DVNU 1NYQA 2DYMA 3NOBA 4YSYB 2FCNA 2PE9A 2WXHA 1B9RA 3FC4A 2D33A 1FEHA 4PK1A 4K81A 1QLBB 2M17A 3MJWA 5BMIA 4WWMA 2KK8A 1MJDA 4W9CA 1QK1A 1WMHB 1N60A 3OWEB 3QK0A 3SFDB 3ZKJC 1XF5L 2KWDA 1WFYA 4JIOU 3AM9A 3I5JC 1I4GA 3Q2AC 5MPOA 1I4PA 5G5GA 2MHJA 4DXGA 1D4BA 2L1AA 2NMQA 2KKCA 2DX5B 2LRUA 4BKTA 1ESFA 3DRBA 1MHXA 2INNE 3ZTDA 2D3BA 3AECB 3KYCD 1STEA 1E8WA 2BF8B 4HCPB 3AE2B 2EKEC 1QOFA 2WXJA 1SB3C 4GU2A 2JRIB 4MGYE 3VUWA 2C7MB 1WRDB 2W3SA 3ZRCA 4US8A 2DYBA 4GSWA 1BUIC 1JWAD 5HKHA 1V2YA 2LJIA 4G0NB 3AI5A 3TCAA 4HROA 3PTFC 1ZGUB 4M02A 1EF1A 2ZEQA 5J99A 2KT7A 3ABVB 4OW0A 4ZHPA 3KH0A 3V05A 4JGHB 2BB6A 1S1QB 5EE9A 3X23A 1FRDA 3NHEB 5EDSA 3H8HA 1CRKA 1M94A 4P16A 2KX3A 5G55A 2E3TA 2YEPF 1P7EA 4US9A 4TKNA 3BWUD 5L83A 3WANA 3PRMB 3ZNZB 2FE8A 2KWVB 3MC9A 1HTOA 3RULA 2K3UA 2LHDA 3DPDA 2XBBC 3N30A 4JL9A 1MFWA 1A5RA 4IW0A 2MEKA 1YQ3B 2R2OA 1TZOA 3AEFB 3APFA 2ZJDA 1NDDA 1GJZA 1HEZE 3P4RB 3VH3B 2WXIA 1D6EC 4HXDA 4XGAB 3DBLI 2GBMA 4G50A 4M0WB 2ZNVC 3QJZA 4C4VB 2KC1A 3HM6X 4K7WA 4I6LB 4BAXA 2M0XA 3QX1A 4TQ0A 1PYWD 2BBCA 3UIPB 1L2NA 2K5PA 2K0PA 3C0RB 1NYRA 4KSLC 4NAWB 4IM2A 4H2AA 2KLCA 1FFVA 1F1HA 1P0RA 1WM3A 1I4RA 2WDVB 3RNEC 2R2QA 2PE6B 3DBHI 1AYFA 2J0MA 1OQRA 2FIDA 3ZJVA 2JPHA 1BMLC 3T3NA 3EUB2 4KVGB 1VDVA 2J1QA 1TT4A 1FNVA 1L0XB 2MP2B 3V3XA 3LN7A 3BZDB 4GDLA 4N6EB 4HLEA 3NZ3A 3MJ5A 2FUG1 3ZO5B 1E8XA 5CHFA 2N0SB 2BKRB 3DHHC 2KNBA 2MBEA 1C76A 5LXIB 5EE1A 3KVFB 4BFRA 3P42A 4IDIA 2QEJC 2J52A 3GZNB 3SDLC 1EU4A 2SEBD 2Z59B 2KWCA 2W3RA 5CHVC 5CTRC 3TBLD 2DZKA 3PO0A 3P2BA 4RF0A 4HVBA 4FHJA 4BKGA 1FM0D 2LI5A 1DYQA 4DHZE 1KH0A 1P1AA 1WMHA 1J19A 3L16A 3PV1A 2W9NA 3AB5A 3TL5A 1F77A 2KTRB 1FXIA 2ZVNA 2JZPA 4WWOA 3V62A 2G4SA 3TEXA 3NVWA 2NTTA 3WIMA 2KDEB 4RM9A 4FXCA 2M8SA 2ZW1A 4YTNB 4L1BA 2LHEA 1C3TA 3B1LX 4FLHA 4I6NB 4K1RB 3IT4B 1UF0A 1V81A 2JXTA 2K39A 1TYGB 2KX0A 3LXFA 4TUUA 2CKHB 1YN5A 3BK1A 1T0QC 1XLNA 1I35A 1WE6A 1WX8A 4BZAA 2JXXA 3NRZA 4AS1A 2IY0B 3PS6A 3R3MA 3AEBB 2NBWB 4YSXB 2WXPA 4BOZB 3UQAA 1JRUA 4GIVA 3VR8B 2GBKA 3FKYA 3LVVA 2C60A 3BIID 2WX0A 3MC0B 1I42A 3DWGC 4PS3A 2WXRA 3ZIMA 3WAPA 1SXTA 3ECIA 3A1QB 2WXLA 1XT9B 4KKIA 1J7BA 3VUYA 2PIAA 3VTVA 1WRIA 4YT0B 3RT3B 2N9PC 1NEKB 4J3OD 1MVKA 1ISNA 4BHLA 3AE6B 1ACCA 1I7HA 1J8CA 2MBHA 5E6OA 1WGHA 3R8BA 1WM2A 3AN1A 3FILB 3ML8A 1QKZA 4W9GA 2BWES 3WCQA 5BMHA 1GC6A 4M0WA 2CHXA 2MA9B 2Z0EB 2BTEA 1FNWA 2CRKA 1V97A 1N6ZA 3A33B 2NCNA 4MACA 2RGFA 1SE4A 3IG5A 4DHZB 1KLGD 4JPSA 2JT4B 4OHJA 4W9KA 4WJNA 4O1NA 4NAWA 1IUEA 2RSUA 1XQQA 4NJ6A 2V1YA 5HI1A 2H88B 1V1PA 1LGRA 1T0SC 4LJOB 1IBXB 3T3OA 2MQJA 2WX1A 4KIKB 4DQOC 2CHZA 2AX5A 2FCMA 2KN5A 4IM0A 1ZP0B 3NG0A 1LQBA 4WJQA 2VZKD 4ICUA 4USAA 2WDTB 2K8CA 1MG8A 3SR6A 2KO3A 3HVDA 3AEDB 4ZOHC 3IT6B 2PLPA 4RGOS 4ANXA 2JYTA 2AYOB 3EFCA 5DPSA 2G3QB 3NUHB 1SEBD 2XK5B 1P7FA 1JQ4A 3NVVA 1E7PB 2N1WA 2B3AA 4PT5A 1TKEA 4X57B 1G6JA 1WIAA 2KLGA 4XC2A 2YEPB 1NI2A 4W9FA 1YNTE 4NNJB 2ZPYA 3L4PA 2WU2B 2MLBA 2WP9B 3Q69A 4DK5A 5AUIA 1S3SG 3CSFA 3ZYYX 5IKCM 2IY1B 2QIEB 3TEWA 1YN3A 4RF7A 1T6BX 3DREA 4ICVA 4Q2RA 2BPSA 2WXFA 2K1FA 2JVCA 2BYTA 3L17A 3ZNGC 2DAJA 2JZZA 1KF6B 1V6EA 3SEBA 1TKYA 1TTNA 3W5UB 1WJ6A 3VTUA 4MDKE 1ROEA 5IN7A 1Q10A 3CIRB 4W9EA 4ZRKA 4A20A 1WF9A 4ZYNA 3BVZA 2QILA 5IA7A 1PFDA 2RMMA 4G3XB 4ZHOA 2AQ3B 4L2YA 4IWOA 4FHKA 2CHWA 2J4XA 3VRBB 5JZEB 1SJHD 3OJ3A 1EWCA 1WX9A 1QZEA 5C1ZA 3GE8C 4N59A 1VZ6A 2MBQA 5D3DA 1GG3A 2ZPNA 5J2RA 4W9IA 2IYDB 1P50A 4EZKA 3L0WB 2H89B 3AE1B 4RF6A 5BYQA 1EM7A 3VQIA 3TJPA 1T5XD 3Q8FA 3P1MA 3PPAA 2DZMA 2AQ2B 2J0JA 2BS3B 2N9LA 4CO7A 5TSSA 3PLVA 3KWLA 3EC8A 1WGGA 3ZJTA 2I1JA 4P7IA 1YJ1A 1XCTL 1AW7A 3JSVA 3R7QA 2QMTA 2W55A 5E6NA 2CU1A 1WE7A 3N20C 3A1QA 2KDIA 3N1ZC 3TSSA 1QT9A 1H4RA 4F7ZA 1LXDA 3AU4A 1R4NB 2PW9A 2EMSA 1M4VA 1SIJA 3AXCA 3N1XC 1E7UA 3K9OB 4MGKE 2O6VD 4MGZE 4PYZA 3BINA 1KTKA 3B2FA 5JXVA 1E5WA 1DOYA 2INDC 1Q1OA 3FILA 3BY4B 1MG4A 2VH2A 2V4IB 1YX5B 3I3TB 2QHOA 1VCBA 4LTUA 1N61A 1IPGA 1QOAA 2LVPA 1LO5D 1L4DB 2L83A 1C4AA 1R8GA 2AL6A 3MP9A 1UGMA 4EKUA 1SF0A 1RAXA 2N7DA 5BMGA 2NS5A 4RFBA 4KDLB 3R66C 3L08A 3A9JA 3UI3A 3H6NA 4GVZA 1XEEA 3RFZB 2OJWA 2AEHA 4ANWA 2D07B 2CR5A 1J0GA 1FO4A 3A4RA 2JY6A 2N7JA 4GN1A 4AWJA 4GW2A 1E90A 1I4XA 5BYSA 2KMCA 4HKQA 3VUXA 2LGDA 4HJKA 2NPTB 4M8MA 2VRRB 1OTRB 4D2KA 4ANUA 3KQ4A 1WYWB 3RUIB 1ZXIA 1T3QA 2DENB 1FPYA 1AN8A 2JWZA 2WXMA 2V3SA 3AEEB 4GVYA 3GP7A 1WXSA 2BS2B 4LNIA 5CX3A 2XK5A 3QWZB 3KUZA 1L4ZB 1ENFA 3NZUA 3U7ZA 2L8JA 4C7ZA 1K8RB 2KFJA 3B6RA 3QCAA 3DOWA 4HPLB 3OLMD 3L2EB 1SE2A 1SE9A 1Y8RC 1WGDA 4PYUA 1VA6A 4MJSB 1FXAA 4E71A 1ZXHA 1QQRA 3CF6E 3IAS1 3QQ8B 1RL9A 4W9JA 3AU5A 2QCZA 4WJPA 4NJ7A 1FCLA 3H7SA 2HDEA 4NZLB 2GOWA 4II2B 4IUMB 2V3NA 3PZ7A 2DWQA 2CS4A 2IO2B 2D2QA 2N9KA 2D3GA 4DDGD 1QILA 1R4MI 2MSED 3VR9B 3NZTA 5J17A 4AOFA 3RNFC 4RF1A 1OQQA 1JWMD 5AZHA 4LDTD 4G11A 4JX1C 4MM3B 2C7HA 2RR9A 1EWYC 5IO9A 5LNK1 3RZWC 3B9JA 2OEDA 3ZDTA 5CHWA 1V9JA 3VTWA 1F0ZA 2LXCA 4HJGE 4MELA 4NPNA 1JWUD 2KQSA 2HTHA 5AZFA 1ZE3D 1IYFA 4IOIE 3IVFA 3MHSD 2HD5B 2IPKD 3E56A 4FJVB 4HDQA 4HDOA 1AARA 2LGSA 1SBBB 3MTNB 4FA6A 1YQBA 3UF8A 5DPTA 1TKGA 1J7CA 2BYVE 1DOXA 2KDFB 3AMZA 4UDUC 2BT6A 1B1ZA 1AWDA 4P6VF 1GUAB 3M62B 4NAMA 4NY0A 4RGMA 3IHPC 2M0AA 3H1UA 2WDQB 5AZGA 1UNSA 3R2IA 1VZ8A 2WGSA 2FBWB 3JVZX 3Q3JA 1H8CA 2GBJA 4XX5A 4N58A 4E3CA 2KN4A 2KC2A 2KAJA 3N32A 3AE7B 3Q6BA 2KDBA 1QOBA 1V86A 3L10B 1I0EA 2EELA 4RGTA 4L23A 4GDKB 4S0RA 3O65B 4HRSA 2HJ8A 4BOSC 2Z8LA 4WQMA 2MBOA 2D5GA 4TV3A 5FKAC 1HA5A 2KMMA 3ZNHB 2KOXA 4TMAB 4XZ4A 5E6JA 1P98A 2N9EB 4HPMB 1C78A 3U8ZA 3VXWA 1L6VA 1PGAA 4CQNA 1VJKA 1NENB 4FULA 3NS8A 1WX7A 2BYEA 3C8YA 3NY5A 1DOIA 2QDFA 5C3JB 3VVWB 1HXYD 4OVUA 3EFUA 4URKA 1MI0A 4B0EA 1UELA 2V9HA 2CU3A 4RF8A 3QAQA 1WY8A 4HKZE 1MHHE 2N1VA 2I2YA 3BYYB 2B76B 4EZJA 2GWCA
chains in the Genus database with same CATH topology
2WGSA 2GLSA 1F52A 3NZTA 1V4GA 4LNIA 3IG5A 4LNOA 3NG0A 4ACFA 3LVVA 4LNKA 3ZXRA 3LN6A 1TT4A 4LNNA 1HTOA 3IG8A 1HTQA 2WHIA 1F1HA 3ZXVA 2LGSA 1VA6A 3LN7A 2D33A 4LNFA 2GWDA 4HPPA 4S17A 2D32A 1LGRA 4BAXA 4S0RA 3LVWA 2D3AA 2UU7A 2D3CA 2OJWA 1FPYA 2D3BA 2BVCA 1R8GA 2QC8A 4XYCA 3FKYA 2GWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WGS A;  2GLS A;  1F52 A;  4LNI A;  4LNO A;  3NG0 A;  4ACF A;  4LNK A;  3ZXR A;  4LNN A;  1HTO A;  1HTQ A;  2WHI A;  1F1H A;  3ZXV A;  2LGS A;  4LNF A;  4HPP A;  4S17 A;  1LGR A;  4BAX A;  4S0R A;  2D3A A;  2UU7 A;  2D3C A;  2OJW A;  1FPY A;  2D3B A;  2BVC A;  2QC8 A;  4XYC A;  3FKY A; 
#chains in the Genus database with same CATH topology
 2KZR A;  2RPV A;  4IKG A;  1XLO A;  3SD5 A;  2PTL A;  5DPR A;  3H7P B;  4B0M A;  4FJZ A;  3AE4 B;  5AEK B;  3DWM A;  4K7U A;  4HEA 1;  5IAA C;  2SAK A;  2OHF A;  2BW2 A;  2NBV B;  1C79 A;  4C80 A;  2GWD A;  2G1E A;  3JYU A;  1UWX A;  2JRH A;  3W1S C;  4XYC A;  4XDD A;  4WAA A;  1M15 A;  3BYT B;  1E10 A;  1KM7 A;  2KXJ A;  5TR5 A;  4YTP B;  3JU6 A;  2FAZ A;  3P4P B;  2LJ5 A;  2WHI A;  2IJ0 A;  1JWS D;  4JWS C;  3L54 A;  3P4Q B;  2N9X A;  1YJI A;  1X1M A;  2IGG A;  2K6D B;  4ARC A;  1FNU A;  3GB1 A;  3AE8 B;  5DCN A;  3WAM A;  4C56 C;  2YVC A;  3HIZ A;  3KUC B;  2JX5 A;  4ANV A;  1PDX A;  2C5L C;  5EE3 A;  3HVZ A;  2J53 A;  4LCD E;  3RNB C;  1IP9 A;  4AJY B;  3WAO A;  4YL8 A;  4C4V A;  2FCQ A;  5H8Y E;  1E0Z A;  5C23 A;  3V6E B;  2IGH A;  2LFI A;  2ONQ A;  4DHJ D;  1FD6 A;  1D5M C;  1EUV B;  1EO6 A;  2VH1 A;  3NS1 A;  4EE2 A;  3RZF A;  3A9K B;  1QF6 A;  2NR2 A;  4KSK C;  2MW5 A;  2EKI A;  2LGI A;  1GB4 A;  4KV2 A;  1E8Y A;  2RDG A;  3PGE A;  1WJU A;  3L2D A;  4PS8 A;  4FN2 A;  1WJ4 A;  3ZTC A;  3LDZ E;  4LNN A;  3S2A A;  4BBN F;  4XWT A;  4K3C A;  4W9L A;  4KGR A;  1E9M A;  2CJO A;  2MP2 A;  2IBI B;  1IGC A;  2IO1 B;  2MH7 A;  2ZW0 A;  3JW0 X;  4OVV A;  4HCN B;  1WJN A;  2K22 A;  1F9J A;  2X38 A;  3VRA B;  2DNF A;  3HHM A;  1ZUD 2;  2LVO A;  2V4L A;  3ML9 A;  2BS4 B;  1C9F A;  1XXG A;  3N3K B;  4I6P A;  1ET6 A;  2JQR B;  2D32 A;  2M4N A;  2WXK A;  3W1S A;  4GDK A;  3RI7 C;  4B9K A;  1YOV B;  2ICI A;  3OG5 A;  4MH0 E;  5D3I B;  2G4D B;  1WR6 E;  3W2D A;  2L52 A;  4XWW A;  1SIF A;  4RNA A;  2E6X A;  3VHT C;  3W9C B;  2K9X A;  2CJN A;  3RYT A;  2PKO A;  4J6I A;  2L7R A;  2W82 A;  1SE3 A;  4WH4 A;  3KUD B;  3E9S A;  2KTR A;  2IZV B;  3TEY A;  4Z9M A;  2V3P A;  2KWU B;  1QOG A;  3ZLZ A;  3KLS X;  3ZVV A;  1VLB A;  3APD A;  1L0V B;  2LGX A;  4EFO A;  2Q5W D;  4PS7 A;  4A90 A;  4TQ1 A;  2LUE A;  2JF5 A;  1WH3 A;  2MJ3 A;  4MEM A;  3SHQ A;  3NVY A;  4DXA B;  3DVG Y;  1WSP A;  4OZB A;  5KHO A;  3PRP B;  1FCC C;  2FIF A;  3R7R A;  4EOY A;  2K25 A;  3IFW B;  3HK0 A;  2JU6 X;  2ZVO A;  2DHZ A;  3PZD A;  3IG8 A;  1RFK A;  4WQO B;  1P52 A;  3AUL A;  2KFK B;  2PMV A;  4C00 A;  1XLQ A;  1I4Q A;  4MSQ B;  4OVZ A;  5GMV A;  2BVC A;  1JML A;  1FIQ A;  2UYZ B;  3JU5 A;  2GB1 A;  4RCO A;  2RDB C;  1A70 A;  2K8B A;  1RFA A;  3HRD D;  2G9H D;  1KOT A;  4BKS A;  4W9D A;  2VZK B;  4A3P A;  1OFF A;  1ZDX A;  2L00 B;  1NI3 A;  1D5X C;  1YIW A;  1WGY A;  3N9Y C;  2KQ7 A;  4ACF A;  4GXB A;  3LN6 A;  3DBR B;  1UBI A;  1N5W A;  4ZDV A;  1CZP A;  5E6P A;  1V1O A;  2KHW B;  1SGH A;  3U30 A;  1OEY J;  2HE7 A;  2M1M A;  3UGB B;  2D3C A;  3M3J A;  2PVG C;  2BWF A;  1UZX B;  4LNO A;  4JLC A;  4GGQ A;  1UGJ A;  1V5O A;  1PQS A;  2A5U A;  1JAL A;  2LAS A;  1WWT A;  2WDR B;  5D94 A;  3UIO B;  3DVN V;  3ZJU A;  3A9K A;  2IO0 B;  4S17 A;  2WLB A;  2R61 A;  4BG4 B;  5JHB A;  3VDZ A;  2GMI C;  1VD2 A;  1IBX A;  2KAC A;  3EA6 A;  2WXN A;  4KIK A;  4RGN A;  2KD0 A;  2GI9 A;  2X8X X;  4GMV A;  4GB9 A;  4HWI B;  4AP4 C;  2KVR A;  3BK2 A;  1WXQ A;  4WIP A;  4CYE A;  1C1Y B;  4YSZ B;  1UH6 A;  1JW9 D;  1XLP A;  3GZN I;  4II3 B;  1TS3 A;  4QAY A;  1J7A A;  2JUO A;  4DXF A;  4JWU C;  2UU7 A;  2WYQ A;  2WQY B;  2RDH A;  1ZOY B;  4ZRQ A;  3I57 A;  2AQ1 B;  4B95 A;  2OJR A;  4JE3 B;  2J42 A;  1V80 A;  1P9D U;  1VRP A;  1L0Y B;  2ZNV B;  1TY0 A;  3ZGZ A;  3ETR A;  5GXG B;  1OQY A;  2MJD A;  3L13 A;  1Q5W B;  3J9C A;  3MHZ A;  3WA0 A;  1EU3 A;  1K53 A;  4BVU C;  2ZCC A;  1MPE A;  4KGT A;  3JPZ A;  4WUR A;  3EGR A;  4REZ A;  2XEW A;  2M56 B;  1L5P A;  3W5V B;  2KJ6 A;  2GBR A;  3BVG A;  2WXO A;  4Q2J A;  3I63 C;  3ZDM C;  3DCG A;  2C7N B;  2KMA A;  3X0W A;  3B2G A;  2PVO D;  2FUH B;  1V5T A;  1UUP A;  4R3D A;  2MJE A;  2KTF A;  1I4H A;  4MSM B;  5BYR A;  1KLV A;  4LNK A;  4JQW C;  4P1B C;  4AQ7 A;  1LM8 B;  5J9A A;  1RYJ A;  3FAH A;  3M95 A;  2L76 A;  2O6V B;  1FFU A;  2NTS A;  3IAM 1;  2RD0 A;  1V4G A;  1F2R C;  2MRP A;  3RMK C;  1TS2 A;  4M8N A;  1WZ3 A;  1TBE A;  2BGF A;  3U4E G;  1P3Q U;  4GOC A;  2J0K A;  2KFK A;  1CMX B;  1WGR A;  4MH8 A;  4IM3 A;  3P63 A;  5HFY A;  3V60 A;  1F52 A;  1BT0 A;  3U2S C;  2XN9 C;  2A4Z A;  5IOI A;  2KVZ A;  3SFE B;  3PZ8 A;  1GNU A;  3LYY A;  4ZYS A;  3ZUN A;  3KW5 B;  1V1P B;  3DHG C;  2MX2 A;  3ONS A;  3IXS A;  2EMT A;  4BKS D;  2Y5B B;  3T9L A;  1YJJ A;  1D3Z A;  3VFK A;  3GE3 C;  1KLU D;  1K52 A;  1V49 A;  3MC8 A;  3PT2 B;  1C77 A;  2DYO A;  2K6Q A;  2Y5P A;  2MWS B;  2ZCB A;  3Q3F A;  1IGD A;  5D2M B;  3QHT A;  2WU5 B;  3PRZ A;  1JRP A;  1KJT A;  4LLG M;  1V8C A;  1TS4 A;  2L05 A;  2ON8 A;  3OAW A;  4XE0 A;  3WAL A;  2W54 A;  3U7D A;  2KDM A;  3HUI A;  4OZA A;  3DVG X;  5BO4 B;  2KJR A;  2WXQ A;  2L0F A;  4DBG A;  4DWF A;  4BG4 A;  4KX6 B;  1C4P A;  4YXD B;  2PJH A;  3ZXR A;  3DDC B;  3IBE A;  1WXA A;  5HG2 A;  3TIX A;  4A55 A;  3VH4 B;  4BBN C;  1WZ0 A;  1HZ5 A;  4RM8 A;  3TEZ A;  1VZ7 A;  4MT5 A;  2LUM A;  1ET9 A;  1FXT B;  5D7G A;  1ZPS A;  2Z0D B;  1OEY A;  2PPH A;  2N4F A;  2NPT A;  4KDI C;  4KKJ A;  1YX6 B;  5D6J B;  2DBY A;  1GAQ B;  3AEG B;  5G2N A;  3ZNI D;  1QH4 A;  2O2V B;  4LDT B;  4DDI D;  4A6Q A;  2AWT A;  3SU8 X;  3KYD D;  2ASQ A;  4WWN A;  4M00 A;  4IWP A;  5AUK A;  1OGW A;  4E74 A;  3C19 A;  3AE9 B;  3LB8 C;  1FRR A;  5I4D A;  2KJH B;  2LRW A;  3RN9 C;  2TSS A;  1WYG A;  1L6U A;  5FR6 A;  2YLM A;  3AE5 B;  4LNF A;  3RPF C;  3L2E A;  2PEA A;  1R4M B;  4ZRI A;  1GOZ A;  4MJS A;  1DGJ A;  4WAF A;  2JYE A;  1TZ1 A;  3IG3 A;  3RCZ A;  3I9V 1;  2I38 A;  1NVI D;  3DBL B;  4N9F 4;  1RWS A;  4IWQ A;  3GOE A;  2BYF A;  1TJE A;  4FAD A;  2BQQ A;  3PHW B;  1EF5 A;  4M01 A;  3APC A;  1JCK B;  4FBJ B;  4ASW C;  1U6R A;  1RM6 C;  3JSV B;  1XO3 A;  1CQV A;  1YD8 U;  3Q8B A;  1ZDV A;  1PUT A;  2N7E A;  1KFY B;  3K9P B;  2L0T A;  4MM3 A;  3ALB A;  1VR9 A;  2J7Q B;  3DBH B;  1K51 A;  3AV8 A;  3QC8 B;  2DZJ A;  2O6V A;  3JQ3 A;  4NQK E;  2XNA C;  5FK9 C;  2KAN A;  3CMM B;  4MGI E;  1WI0 A;  2IO3 B;  1T0Y A;  4AUQ C;  3NVZ A;  2I1K A;  1VRA B;  2LZ6 A;  1WGK A;  3H9D A;  1Z2M A;  3ZQ4 A;  4A8X C;  2REX A;  3B08 A;  3DHI C;  2QSD A;  3M63 B;  5KHQ A;  4AJW A;  2FNJ B;  1UWM A;  2QJL A;  3V6C B;  4K7S A;  1KRH A;  5DPW A;  2NBU A;  3NZS A;  3PLU A;  3Q3N C;  2BB5 A;  2JSV X;  1R4N I;  2INP E;  4B6W A;  2QC8 A;  1C4C A;  3AEA B;  3Q8C A;  3P4S B;  2ZZP B;  2DZI A;  2AL3 A;  1PGB A;  3ENE A;  1XD3 B;  5C2T B;  2FCS A;  4IG7 B;  1TIF A;  2DAF A;  3A9J B;  2LVQ A;  4WWP A;  3RD2 A;  4CHK A;  1CK1 A;  2LMC A;  3BVM A;  3DBR I;  4P1C C;  4KGS A;  3QIJ A;  3LJ3 A;  5J18 A;  1SJE D;  4WJO A;  1D5Z C;  2Y5C A;  2IGD A;  1JRO A;  1TGZ B;  4EEW A;  4NQL B;  3UIN B;  1XCQ L;  2D10 A;  1HTQ A;  3W1Y A;  3ZXV A;  2DLB A;  3RNA C;  3LVW A;  2OOB B;  4HK2 A;  4GW0 A;  1R7S A;  2HJ1 A;  3RNC C;  3VAW A;  1RLF A;  1TT5 B;  4KZC A;  4W9H A;  5FR3 A;  1HZ6 A;  3OJ4 B;  1JWB D;  1NBF C;  4RMA A;  5JH5 C;  3D32 A;  3PVL A;  2JZ3 B;  2ACZ B;  4F8C B;  1WXM A;  4A3O A;  4EUT A;  2KYW A;  4K3B A;  3ZW3 A;  1SD0 A;  3NJT A;  2JWU A;  1PGX A;  2MCN B;  1BXT A;  1N63 A;  3Q14 C;  2K8H A;  3Q3M C;  1YN4 A;  3AE3 B;  2LXA A;  1F2R I;  3MFG A;  2C9W B;  2WNM A;  1UBQ A;  4KZ0 A;  4LJP B;  2GBN A;  1BG0 A;  3RNG C;  3PHX B;  1ZKH A;  4OZC A;  4XDC A;  2LWP A;  1Q0W B;  4IC7 B;  3TUO A;  1Z5S B;  2V0G A;  1UD7 A;  3ZRF A;  1WR1 A;  3URY A;  2RPQ A;  4F1S A;  5JHA A;  5LXH A;  1HE8 A;  1GB1 A;  4ZRP A;  1CJE A;  2NVU I;  3CST A;  2O2V A;  1G0W A;  2UWQ A;  2LEK A;  3DBS A;  4TSS A;  5L95 C;  1HQR D;  2INC C;  3CWI A;  3H7P A;  2GRI A;  5T8I A;  3V61 A;  2HTM E;  3Q8E A;  3KWV A;  2L32 A;  1TS5 A;  5G5H A;  1L7Y A;  3AH7 A;  1YQ4 B;  3QA8 A;  1U4A A;  4HPP A;  1ZW7 A;  3Q3O C;  4DHJ B;  2LGY A;  2GLS A;  4C7Y A;  4LK0 M;  3A4S C;  1SSN A;  4YTM B;  3U52 E;  2WXG A;  1GC7 A;  3N1Y C;  2IDY A;  1E7V A;  1E8Z A;  3TMP B;  3GS2 A;  4A9A A;  1FMA D;  1K50 A;  3PSE B;  3M10 A;  3EHV A;  2WWZ A;  4YWG G;  1N62 A;  4RH6 A;  5LLI A;  5EE0 A;  2BKF A;  2WS3 B;  3UQB A;  1N5X A;  3EEC A;  1GPX A;  4RF9 A;  1E6E B;  2M19 A;  1RRB A;  4ARI A;  2L3Z A;  2MBB B;  3Q8A A;  2Y3A A;  2LD9 A;  4ZRJ A;  2D11 A;  1LFD A;  4EZL A;  4GDL B;  3DQV A;  3R2T A;  2D3A A;  4GLS C;  3QAR A;  1WXV A;  4ITK A;  1Y56 A;  3T8M A;  5IP4 D;  3B0A A;  1T0R C;  3O13 A;  2KQ4 X;  1TY2 A;  1YMH E;  3PRE A;  5H92 C;  4FJY A;  4AM1 A;  3HM3 A;  4NJC A;  5HHD G;  2G45 B;  3DVN U;  1NYQ A;  2DYM A;  3NOB A;  4YSY B;  2FCN A;  2PE9 A;  2WXH A;  1B9R A;  3FC4 A;  2D33 A;  1FEH A;  4PK1 A;  4K81 A;  1QLB B;  2M17 A;  3MJW A;  5BMI A;  4WWM A;  2KK8 A;  1MJD A;  4W9C A;  1QK1 A;  1WMH B;  1N60 A;  3OWE B;  3QK0 A;  3SFD B;  3ZKJ C;  1XF5 L;  2KWD A;  1WFY A;  4JIO U;  3AM9 A;  3I5J C;  1I4G A;  3Q2A C;  5MPO A;  1I4P A;  5G5G A;  2MHJ A;  4DXG A;  1D4B A;  2L1A A;  2NMQ A;  2KKC A;  2DX5 B;  2LRU A;  4BKT A;  1ESF A;  3DRB A;  1MHX A;  2INN E;  3ZTD A;  2D3B A;  3AEC B;  3KYC D;  1STE A;  1E8W A;  2BF8 B;  4HCP B;  3AE2 B;  2EKE C;  1QOF A;  2WXJ A;  1SB3 C;  4GU2 A;  2JRI B;  4MGY E;  3VUW A;  2C7M B;  1WRD B;  2W3S A;  3ZRC A;  4US8 A;  2DYB A;  4GSW A;  1BUI C;  1JWA D;  5HKH A;  1V2Y A;  2LJI A;  4G0N B;  3AI5 A;  3TCA A;  4HRO A;  3PTF C;  1ZGU B;  4M02 A;  1EF1 A;  2ZEQ A;  5J99 A;  2KT7 A;  3ABV B;  4OW0 A;  4ZHP A;  3KH0 A;  3V05 A;  4JGH B;  2BB6 A;  1S1Q B;  5EE9 A;  3X23 A;  1FRD A;  3NHE B;  5EDS A;  3H8H A;  1CRK A;  1M94 A;  4P16 A;  2KX3 A;  5G55 A;  2E3T A;  2YEP F;  1P7E A;  4US9 A;  4TKN A;  3BWU D;  5L83 A;  3WAN A;  3PRM B;  3ZNZ B;  2FE8 A;  2KWV B;  3MC9 A;  1HTO A;  3RUL A;  2K3U A;  2LHD A;  3DPD A;  2XBB C;  3N30 A;  4JL9 A;  1MFW A;  1A5R A;  4IW0 A;  2MEK A;  1YQ3 B;  2R2O A;  1TZO A;  3AEF B;  3APF A;  2ZJD A;  1NDD A;  1GJZ A;  1HEZ E;  3P4R B;  3VH3 B;  2WXI A;  1D6E C;  4HXD A;  4XGA B;  3DBL I;  2GBM A;  4G50 A;  4M0W B;  2ZNV C;  3QJZ A;  4C4V B;  2KC1 A;  3HM6 X;  4K7W A;  4I6L B;  4BAX A;  2M0X A;  3QX1 A;  4TQ0 A;  1PYW D;  2BBC A;  3UIP B;  1L2N A;  2K5P A;  2K0P A;  3C0R B;  1NYR A;  4KSL C;  4NAW B;  4IM2 A;  4H2A A;  2KLC A;  1FFV A;  1F1H A;  1P0R A;  1WM3 A;  1I4R A;  2WDV B;  3RNE C;  2R2Q A;  2PE6 B;  3DBH I;  1AYF A;  2J0M A;  1OQR A;  2FID A;  3ZJV A;  2JPH A;  1BML C;  3T3N A;  3EUB 2;  4KVG B;  1VDV A;  2J1Q A;  1TT4 A;  1FNV A;  1L0X B;  2MP2 B;  3V3X A;  3LN7 A;  3BZD B;  4GDL A;  4N6E B;  4HLE A;  3NZ3 A;  3MJ5 A;  2FUG 1;  3ZO5 B;  1E8X A;  5CHF A;  2N0S B;  2BKR B;  3DHH C;  2KNB A;  2MBE A;  1C76 A;  5LXI B;  5EE1 A;  3KVF B;  4BFR A;  3P42 A;  4IDI A;  2QEJ C;  2J52 A;  3GZN B;  3SDL C;  1EU4 A;  2SEB D;  2Z59 B;  2KWC A;  2W3R A;  5CHV C;  5CTR C;  3TBL D;  2DZK A;  3PO0 A;  3P2B A;  4RF0 A;  4HVB A;  4FHJ A;  4BKG A;  1FM0 D;  2LI5 A;  1DYQ A;  4DHZ E;  1KH0 A;  1P1A A;  1WMH A;  1J19 A;  3L16 A;  3PV1 A;  2W9N A;  3AB5 A;  3TL5 A;  1F77 A;  2KTR B;  1FXI A;  2ZVN A;  2JZP A;  4WWO A;  3V62 A;  2G4S A;  3TEX A;  3NVW A;  2NTT A;  3WIM A;  2KDE B;  4RM9 A;  4FXC A;  2M8S A;  2ZW1 A;  4YTN B;  4L1B A;  2LHE A;  1C3T A;  3B1L X;  4FLH A;  4I6N B;  4K1R B;  3IT4 B;  1UF0 A;  1V81 A;  2JXT A;  2K39 A;  1TYG B;  2KX0 A;  3LXF A;  4TUU A;  2CKH B;  1YN5 A;  3BK1 A;  1T0Q C;  1XLN A;  1I35 A;  1WE6 A;  1WX8 A;  4BZA A;  2JXX A;  3NRZ A;  4AS1 A;  2IY0 B;  3PS6 A;  3R3M A;  3AEB B;  2NBW B;  4YSX B;  2WXP A;  4BOZ B;  3UQA A;  1JRU A;  4GIV A;  3VR8 B;  2GBK A;  3FKY A;  3LVV A;  2C60 A;  3BII D;  2WX0 A;  3MC0 B;  1I42 A;  3DWG C;  4PS3 A;  2WXR A;  3ZIM A;  3WAP A;  1SXT A;  3ECI A;  3A1Q B;  2WXL A;  1XT9 B;  4KKI A;  1J7B A;  3VUY A;  2PIA A;  3VTV A;  1WRI A;  4YT0 B;  3RT3 B;  2N9P C;  1NEK B;  4J3O D;  1MVK A;  1ISN A;  4BHL A;  3AE6 B;  1ACC A;  1I7H A;  1J8C A;  2MBH A;  5E6O A;  1WGH A;  3R8B A;  1WM2 A;  3AN1 A;  3FIL B;  3ML8 A;  1QKZ A;  4W9G A;  2BWE S;  3WCQ A;  5BMH A;  1GC6 A;  4M0W A;  2CHX A;  2MA9 B;  2Z0E B;  2BTE A;  1FNW A;  2CRK A;  1V97 A;  1N6Z A;  3A33 B;  2NCN A;  4MAC A;  2RGF A;  1SE4 A;  3IG5 A;  4DHZ B;  1KLG D;  4JPS A;  2JT4 B;  4OHJ A;  4W9K A;  4WJN A;  4O1N A;  4NAW A;  1IUE A;  2RSU A;  1XQQ A;  4NJ6 A;  2V1Y A;  5HI1 A;  2H88 B;  1V1P A;  1LGR A;  1T0S C;  4LJO B;  1IBX B;  3T3O A;  2MQJ A;  2WX1 A;  4KIK B;  4DQO C;  2CHZ A;  2AX5 A;  2FCM A;  2KN5 A;  4IM0 A;  1ZP0 B;  3NG0 A;  1LQB A;  4WJQ A;  2VZK D;  4ICU A;  4USA A;  2WDT B;  2K8C A;  1MG8 A;  3SR6 A;  2KO3 A;  3HVD A;  3AED B;  4ZOH C;  3IT6 B;  2PLP A;  4RGO S;  4ANX A;  2JYT A;  2AYO B;  3EFC A;  5DPS A;  2G3Q B;  3NUH B;  1SEB D;  2XK5 B;  1P7F A;  1JQ4 A;  3NVV A;  1E7P B;  2N1W A;  2B3A A;  4PT5 A;  1TKE A;  4X57 B;  1G6J A;  1WIA A;  2KLG A;  4XC2 A;  2YEP B;  1NI2 A;  4W9F A;  1YNT E;  4NNJ B;  2ZPY A;  3L4P A;  2WU2 B;  2MLB A;  2WP9 B;  3Q69 A;  4DK5 A;  5AUI A;  1S3S G;  3CSF A;  3ZYY X;  5IKC M;  2IY1 B;  2QIE B;  3TEW A;  1YN3 A;  4RF7 A;  1T6B X;  3DRE A;  4ICV A;  4Q2R A;  2BPS A;  2WXF A;  2K1F A;  2JVC A;  2BYT A;  3L17 A;  3ZNG C;  2DAJ A;  2JZZ A;  1KF6 B;  1V6E A;  3SEB A;  1TKY A;  1TTN A;  3W5U B;  1WJ6 A;  3VTU A;  4MDK E;  1ROE A;  5IN7 A;  1Q10 A;  3CIR B;  4W9E A;  4ZRK A;  4A20 A;  1WF9 A;  4ZYN A;  3BVZ A;  2QIL A;  5IA7 A;  1PFD A;  2RMM A;  4G3X B;  4ZHO A;  2AQ3 B;  4L2Y A;  4IWO A;  4FHK A;  2CHW A;  2J4X A;  3VRB B;  5JZE B;  1SJH D;  3OJ3 A;  1EWC A;  1WX9 A;  1QZE A;  5C1Z A;  3GE8 C;  4N59 A;  1VZ6 A;  2MBQ A;  5D3D A;  1GG3 A;  2ZPN A;  5J2R A;  4W9I A;  2IYD B;  1P50 A;  4EZK A;  3L0W B;  2H89 B;  3AE1 B;  4RF6 A;  5BYQ A;  1EM7 A;  3VQI A;  3TJP A;  1T5X D;  3Q8F A;  3P1M A;  3PPA A;  2DZM A;  2AQ2 B;  2J0J A;  2BS3 B;  2N9L A;  4CO7 A;  5TSS A;  3PLV A;  3KWL A;  3EC8 A;  1WGG A;  3ZJT A;  2I1J A;  4P7I A;  1YJ1 A;  1XCT L;  1AW7 A;  3JSV A;  3R7Q A;  2QMT A;  2W55 A;  5E6N A;  2CU1 A;  1WE7 A;  3N20 C;  3A1Q A;  2KDI A;  3N1Z C;  3TSS A;  1QT9 A;  1H4R A;  4F7Z A;  1LXD A;  3AU4 A;  1R4N B;  2PW9 A;  2EMS A;  1M4V A;  1SIJ A;  3AXC A;  3N1X C;  1E7U A;  3K9O B;  4MGK E;  2O6V D;  4MGZ E;  4PYZ A;  3BIN A;  1KTK A;  3B2F A;  5JXV A;  1E5W A;  1DOY A;  2IND C;  1Q1O A;  3FIL A;  3BY4 B;  1MG4 A;  2VH2 A;  2V4I B;  1YX5 B;  3I3T B;  2QHO A;  1VCB A;  4LTU A;  1N61 A;  1IPG A;  1QOA A;  2LVP A;  1LO5 D;  1L4D B;  2L83 A;  1C4A A;  1R8G A;  2AL6 A;  3MP9 A;  1UGM A;  4EKU A;  1SF0 A;  1RAX A;  2N7D A;  5BMG A;  2NS5 A;  4RFB A;  4KDL B;  3R66 C;  3L08 A;  3A9J A;  3UI3 A;  3H6N A;  4GVZ A;  1XEE A;  3RFZ B;  2OJW A;  2AEH A;  4ANW A;  2D07 B;  2CR5 A;  1J0G A;  1FO4 A;  3A4R A;  2JY6 A;  2N7J A;  4GN1 A;  4AWJ A;  4GW2 A;  1E90 A;  1I4X A;  5BYS A;  2KMC A;  4HKQ A;  3VUX A;  2LGD A;  4HJK A;  2NPT B;  4M8M A;  2VRR B;  1OTR B;  4D2K A;  4ANU A;  3KQ4 A;  1WYW B;  3RUI B;  1ZXI A;  1T3Q A;  2DEN B;  1FPY A;  1AN8 A;  2JWZ A;  2WXM A;  2V3S A;  3AEE B;  4GVY A;  3GP7 A;  1WXS A;  2BS2 B;  4LNI A;  5CX3 A;  2XK5 A;  3QWZ B;  3KUZ A;  1L4Z B;  1ENF A;  3NZU A;  3U7Z A;  2L8J A;  4C7Z A;  1K8R B;  2KFJ A;  3B6R A;  3QCA A;  3DOW A;  4HPL B;  3OLM D;  3L2E B;  1SE2 A;  1SE9 A;  1Y8R C;  1WGD A;  4PYU A;  1VA6 A;  4MJS B;  1FXA A;  4E71 A;  1ZXH A;  1QQR A;  3CF6 E;  3IAS 1;  3QQ8 B;  1RL9 A;  4W9J A;  3AU5 A;  2QCZ A;  4WJP A;  4NJ7 A;  1FCL A;  3H7S A;  2HDE A;  4NZL B;  2GOW A;  4II2 B;  4IUM B;  2V3N A;  3PZ7 A;  2DWQ A;  2CS4 A;  2IO2 B;  2D2Q A;  2N9K A;  2D3G A;  4DDG D;  1QIL A;  1R4M I;  2MSE D;  3VR9 B;  3NZT A;  5J17 A;  4AOF A;  3RNF C;  4RF1 A;  1OQQ A;  1JWM D;  5AZH A;  4LDT D;  4G11 A;  4JX1 C;  4MM3 B;  2C7H A;  2RR9 A;  1EWY C;  5IO9 A;  5LNK 1;  3RZW C;  3B9J A;  2OED A;  3ZDT A;  5CHW A;  1V9J A;  3VTW A;  1F0Z A;  2LXC A;  4HJG E;  4MEL A;  4NPN A;  1JWU D;  2KQS A;  2HTH A;  5AZF A;  1ZE3 D;  1IYF A;  4IOI E;  3IVF A;  3MHS D;  2HD5 B;  2IPK D;  3E56 A;  4FJV B;  4HDQ A;  4HDO A;  1AAR A;  2LGS A;  1SBB B;  3MTN B;  4FA6 A;  1YQB A;  3UF8 A;  5DPT A;  1TKG A;  1J7C A;  2BYV E;  1DOX A;  2KDF B;  3AMZ A;  4UDU C;  2BT6 A;  1B1Z A;  1AWD A;  4P6V F;  1GUA B;  3M62 B;  4NAM A;  4NY0 A;  4RGM A;  3IHP C;  2M0A A;  3H1U A;  2WDQ B;  5AZG A;  1UNS A;  3R2I A;  1VZ8 A;  2WGS A;  2FBW B;  3JVZ X;  3Q3J A;  1H8C A;  2GBJ A;  4XX5 A;  4N58 A;  4E3C A;  2KN4 A;  2KC2 A;  2KAJ A;  3N32 A;  3AE7 B;  3Q6B A;  2KDB A;  1QOB A;  1V86 A;  3L10 B;  1I0E A;  2EEL A;  4RGT A;  4L23 A;  4GDK B;  4S0R A;  3O65 B;  4HRS A;  2HJ8 A;  4BOS C;  2Z8L A;  4WQM A;  2MBO A;  2D5G A;  4TV3 A;  5FKA C;  1HA5 A;  2KMM A;  3ZNH B;  2KOX A;  4TMA B;  4XZ4 A;  5E6J A;  1P98 A;  2N9E B;  4HPM B;  1C78 A;  3U8Z A;  3VXW A;  1L6V A;  1PGA A;  4CQN A;  1VJK A;  1NEN B;  4FUL A;  3NS8 A;  1WX7 A;  2BYE A;  3C8Y A;  3NY5 A;  1DOI A;  2QDF A;  5C3J B;  3VVW B;  1HXY D;  4OVU A;  3EFU A;  4URK A;  1MI0 A;  4B0E A;  1UEL A;  2V9H A;  2CU3 A;  4RF8 A;  3QAQ A;  1WY8 A;  4HKZ E;  1MHH E;  2N1V A;  2I2Y A;  3BYY B;  2B76 B;  4EZJ A;  2GWC A; 
#chains in the Genus database with same CATH homology
 2WGS A;  2GLS A;  1F52 A;  3NZT A;  1V4G A;  4LNI A;  3IG5 A;  4LNO A;  3NG0 A;  4ACF A;  3LVV A;  4LNK A;  3ZXR A;  3LN6 A;  1TT4 A;  4LNN A;  1HTO A;  3IG8 A;  1HTQ A;  2WHI A;  1F1H A;  3ZXV A;  2LGS A;  1VA6 A;  3LN7 A;  2D33 A;  4LNF A;  2GWD A;  4HPP A;  4S17 A;  2D32 A;  1LGR A;  4BAX A;  4S0R A;  3LVW A;  2D3A A;  2UU7 A;  2D3C A;  2OJW A;  1FPY A;  2D3B A;  2BVC A;  1R8G A;  2QC8 A;  4XYC A;  3FKY A;  2GWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...