4BB4A

Ephb4 kinase domain inhibitor complex
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
283
structure length
265
Chain Sequence
FAKEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLYTERQRREFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFGKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EPHRIN TYPE-B RECEPTOR 4
publication title Discovery and Optimization of a Novel Series of Potent Mutant B-Raf V600E Selective Kinase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 79
structure length 265
sequence length 283
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bb4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bb4A01
4D0XA 1S9IA 3BHYA 4IVBA 4N6ZA 2VTAA 4U41A 4RFYA 3E7OA 4ITJA 4FKPA 4PL3A 3CP9A 2R3HA 5CNNA 2X0GA 4EQMA 1IAHA 3QKKA 4CYJA 1E1XA 3C7QA 1ZWSA 2XP2A 3LCDA 5E8YA 3F88A 4XMOA 1DI8A 2RFSA 3GI3A 5J9ZA 2BZJA 3DBQA 5LOHA 3CTHA 3FXZA 4K6ZA 3WYYA 5A4CA 1PXLA 2OICA 4M8TA 4H3BA 4PNIA 1ZARA 2E9PA 3HL7A 3OOMA 4D5KA 2XNOA 3DKFA 4YBJA 2YIWA 3SW4A 3RHXA 3ZH8A 5KKRB 2XM9A 4XG9A 4NT4A 2YDJA 5AUVA 1MP8A 1YOMA 1ZXEA 2O65A 2X2MA 1WFCA 3FHIA 3Q4UA 4G9CA 4AN2A 3ZO1A 3DAJA 3S95A 4AT5A 3RZFA 3GNIB 2VNYA 5BX0A 4TY1A 2QR8A 3OC1A 4S34A 4RIYA 3SDJA 3DB6A 4JBOA 1FVVA 1H07A 1NW1A 2R3JA 2O63A 2VO6A 2P4IA 4PDOA 2ITOA 2YM7A 3V6SA 3LJ0A 4W4WA 2HZ4A 4OT5A 4F0FA 2VZ6A 2JDOA 5HG8A 4P4CA 3BCEA 1M2QA 4QYGA 3T9TA 4O22A 3Q4CA 3NX8A 2IZUA 4BDIA 3R1QA 3HMNA 3D7TB 4X2GA 3FZOA 2C30A 4WNKA 2VWUA 4G16A 4O0SA 4HVIA 2C5OA 4L3PA 4U97A 3EN5A 2DQ7X 3CD3A 3KMUA 3KRJA 3EQDA 4BWXA 3QQHA 2WTKC 4RJ8A 3HMPA 3RK7A 2IO6A 3ZHPC 3GENA 4E5BA 4NWMA 3EZRA 3EQBA 1R0PA 3UC3A 5BQ0A 3OBGA 1KOAA 2KULA 4O0YA 1KSWA 3NPCA 4U79A 1STCE 3NUNA 4S31A 4AGDA 4ANOA 2XKEA 3ORXA 4B8MA 4G17A 4IM3A 1UNGA 1YI4A 2WMWA 2X39A 3D0EA 4YJVA 5L2TA 3CGOA 4H39A 4KIKA 4X3FC 5E8SA 3ORNA 3PSBA 4PTGA 2XEZA 3OCTA 3F9NA 4GIHA 1PKGA 3OY3A 4DFLA 3CE3A 3PJ3A 3W8QA 5KCVA 2OJJA 2YLEA 3CBLA 4XS2A 1WAKA 4S2ZA 2XNPA 3FI4A 2OJIA 1Q5KA 2FA2A 2B7AA 5K5NA 3KULB 2WFYA 1Q61A 5L4QA 3KCKA 4NW5A 5EQEA 4O6LA 4IACA 5EW3A 3MB6A 4RBLA 4EOMA 3O8TA 2OH0E 2CJMA 2GHGA 1TVOA 3LM0A 2PK9A 5F94A 3TNWA 3E62A 3HECA 5CSXA 1H8FA 4CTCA 3L8SA 2CCIA 4FV8A 4FSQA 2X9EA 5T3QA 5TE0A 3ZLYA 5BUEA 4AAAA 4YPSA 1DAWA 2YDKA 4FSTA 4HJOA 4KABA 1W7HA 3GOPA 4FIIA 2W1DA 1V0BA 2VRXA 3FLNC 5AA8A 1M52A 2RGPA 4U3ZA 4LQMA 4EHVA 4FNYA 3PG1A 4GK3A 4BTJA 5KZIA 4ASXA 3NCGA 2P2HA 5AR4A 1H1SA 2OZOA 2X9FA 4NSTA 3T9IA 5HO7A 1IASA 1XO2B 3UMWA 2WTWA 3E87A 4NFMA 4D2SA 3G0EA 3ZBXA 3CQUA 3OTVA 4CYIA 5IPJA 2OO8X 1P2AA 4O21A 2H8HA 4EJNA 3HDMA 4MYGA 5CSHA 4QP1A 5E1EA 5BVNA 3QTZA 2VTIA 1FMOE 5JH6A 5IA0A 4E6QA 1YOJA 1ZMWA 4JBVA 4ENXA 1R0EA 4WHZA 1LR4A 1ZYLA 2W7XA 3UYSA 4R5YA 1BI7A 3QQLA 4LV5A 3WF8A 4ZAUA 4ZJVA 4CKIA 4AGWA 4QMNA 3MS9A 3KXZA 3QKMA 5A54A 5HU3A 1P4OA 5GNKA 1URWA 5EG3A 4H36A 5HD4A 4IAIA 3EL7A 2BRMA 2JAVA 4N0SA 4WSYA 2YEXA 4O81A 3S3IA 3G33A 4X6RA 3UOKA 4L3JA 5IA1A 2Z8CA 4XLVA 5IH6A 5CSVA 4ZJIA 4N57A 2VX1A 4K0YA 3ZOSA 4F6SA 2Z7LA 5CQUA 3ZFXA 2OK1A 2UW8A 4KSPA 1OIUA 5HEZA 5TO8A 2BZHB 2J2IB 4V04A 4D1SA 5JMSA 4Z7HA 5IA2A 5J5TA 3ZXZA 5CU3A 5AM6A 3O0GA 3V04A 4U9AA 2PVKA 3QC9A 4UN0C 3MI9A 3RK9A 4AS0A 2BAJA 5M4FA 5CENA 5BVWA 4ZY6A 4XG8A 1R78A 4G3GA 3TKIA 3UIMA 4FSRA 4UYNA 4CD0A 2BALA 1BUHA 2WEVA 3C1XA 3K5VA 4HYSA 2YHVA 3KREA 3B2TA 4F9YA 2CSNA 2PY3A 3BEAA 2UW6A 3RZBA 4PV0A 1W82A 4DAWA 2JFLA 1FVTA 4NJDA 5M56A 2ZVAA 3M2WA 4E5AX 2HZ0A 2C3IB 4OTHA 2OFVA 4J52A 4B4LA 2BAKA 2BPMA 3UP7A 3COHA 4FSUA 5CXZA 3K2LA 4IAYA 4GYGA 5HI2A 2I40A 3BE2A 4X21A 4DEAA 4F64A 2GQRA 2Z02A 3LPBA 3C4EA 1OB3A 4O96A 1Y6BA 4UEUA 3BHHA 4OTDA 2BIYA 2G01A 5HCXA 2YISA 4E26A 2C0IA 2XK3A 3GU7A 3LFBA 4PTCA 3L8XA 5AP0A 5HOAA 4DH1A 4HVHA 3TUBA 4BI1A 3IO7A 3F82A 5GIOE 4FZFB 4RIXA 2C6IA 4TZRA 4ACGA 2HWPA 2FSOX 2HZIA 3QD3A 4I20A 4KS7A 4AT4A 4EHGA 4YHTA 1CMKE 2PVLA 3BYOA 3RHKA 3R7GA 3ORMA 2BFXA 4GT3A 4LRMA 2G1TA 3AC4A 3UQGA 5AADA 3A4OX 3KC3A 4ZZOA 5IQIA 3OCBA 1OUKA 1TQIA 4F63A 4CTBA 2PL0A 3MWUA 4FV1A 3TUCA 4BKZA 2W4KA 3F3ZA 4E3CA 4E4NA 3NYVA 3Q5ZA 3WIGA 5HICA 5AV4A 3G6GA 3SXFA 4Y83A 4H58A 5A46A 4FG8A 3LFCA 4K9YA 4G6LA 4O7SA 2VGOA 2QKRA 3SLSA 1YRPA 3RKBA 5D1JA 3TN8A 4ORKA 4AOIA 1URCA 3DNDA 4IDVA 4RX7A 4EK3A 1WVYA 4L44A 2ZB1A 5IDNA 2C6LA 5HD7A 5BNJA 4EH4A 3OHTA 2OF4A 2ZDTA 1EH4A 1WMKA 3PVUA 4FT9A 4GU6A 3FZRA 4K1BA 4NM5A 4D58A 4V01A 3HV3A 3PP1A 4F70A 4QQTA 3FYJX 1OL6A 2HYYA 3B8QA 2X1NA 5D9HA 5M09A 3SXRA 2PMNX 3WE8A 2J0MB 3ZM9A 5AIRA 3Q5IA 4FV3A 5BMSA 3VIDA 4FVRA 3QHRA 5E1SA 4ANBA 4BYJA 5JGDA 3OZ6A 3BI6A 1MQBA 3VW6A 3CXWA 3ITZA 4I22A 4MXYA 2XS0A 3OW4A 3MVMA 3OCGA 3N4TA 4D9UA 3W8LA 4FZ7A 3RMFA 5AAFA 4F7JA 5FTGA 4TYIA 1GIHA 2ACXA 2F7EE 2B9IA 2O5KA 2UW5A 1GZNA 5CLPA 3NW7A 4FK6A 3R9DA 4BIEA 5AFVA 3VS7A 1G3NA 5B7VA 2XKFA 4XCUA 3VBQA 3OS3A 1XH6A 3L9MA 4CFXA 4IWOA 3KEXA 4R7HA 3EJ1A 5AV1A 3VULA 3LCSA 4MEDA 5ICPA 3IQ7A 3KF7A 1Z57A 2YA9A 2ZM4A 4CZYB 4C4FA 1O6KA 5AP4A 5HHWA 4CG8A 5G6VA 1JQHA 4UV0A 4XP2A 5ETAA 4B99A 4O7LA 2PVHA 1YXUA 1Q8TA 4R7BA 3FYKX 1BMKA 3ZLXA 4I23A 1SM2A 4DGGA 1FOTA 2VWZA 4ZSGA 4JQ8A 3FMMA 2PPQA 4FKWA 2HENA 1VYZA 4EK5A 3QU0A 1JOWB 1Y91A 4J96A 2CMWA 4E73A 1YXTA 3OW3A 3TACA 5FEEA 2QO2A 2X7GA 2BAQA 1BX6A 2W5BA 3ORZA 3P86A 4I6FA 4KA3A 4ERKA 1WZYA 3AC3A 3R1YA 4BDEA 5HX6A 5I9YA 2EB2A 3UZTA 5B2MA 3NWWA 3CC6A 4BB4A 3NGAA 2VWYA 2ZOQA 4YJOA 4FSMA 5CAUA 1OKVA 2C6MA 2QNJA 4GEOA 4DFNA 3OUKA 4BY9E 1QPDA 5EDQA 1JPAA 2F2UA 1YVJA 3P23A 3POZA 5BYLA 2HW6A 5CEIA 4CFWA 3BWFA 2BRBA 5D7VA 4ZS4A 3KRWA 3COKA 5CNOA 2W05A 4L8MA 3HMMA 4CKJA 3Q4TA 3GU4A 3QLGA 3OF0A 5M4CA 2JBOA 4U6RA 3NNUA 5C8MA 5JGAA 2FUMA 3TZ7A 5L6WL 3CPBA 4JRNA 5A4EA 1W0XC 2R2PA 3RAHA 5J79A 2BHHA 3IONA 1Z9XA 4LMNA 4P2KA 4ALWA 4APPA 4R3RA 4CG9A 3GT8A 1JSTA 2ZM3A 4FOCA 1PRYA 5BUIA 1UV5A 3BIZA 5LVOA 1ZMUA 2VWVA 4A9YA 3HZTA 2Z7QA 3NW5A 4FNWA 4AE9A 4BCNA 1CM8A 3SG9A 5ACKA 3SV0A 4TWNA 4AW1A 1UNHA 4UMPA 1H08A 2CGUA 3FAAA 3I0QA 3R2YA 4NM3A 3HKOA 3JY9A 2R7BA 3EWHA 1F5QA 3LW0A 4NFNA 4QPMA 4OTPA 4LRJA 2YIQA 4EOSA 5EKOA 1WCCA 4BI0A 2FYSA 4LFIA 5FP5A 2WGJA 4RJ7A 4TYHA 5C8KA 5DYJA 4CRLA 5IQBA 4BWPA 1WBOA 3BQCA 4GVAA 2PE1A 3U54A 3AD6A 3C51A 4JR3A 4XH6A 5C03A 3BV3A 4U80A 5FG8A 3RVGA 4EOQA 3KXXA 1H0VA 1P5EA 3EN7A 3P79A 4HYHA 4IFCA 5BYZA 4QMZA 2WELA 4XNEA 2WO6A 2IN6A 3ZSIA 2J0KA 4G1WA 4MK0A 2BDJA 5JEBA 4DEGA 3HYHA 3DOGA 5HLPA 2JKOA 4RA5A 5M44A 4IVDA 5ETFA 4FK3A 5JQ5A 5L6OA 4YZ9A 4BKJA 2PVYA 4YLLA 2C5NA 5F4NA 1JKLA 3BU5A 4UMQA 2GNGA 2W0JA 4FIGA 3NEWA 4UXLA 3RM7A 5IUIA 5CEOA 4MXXA 4QO9A 1OPLA 4E7WA 1SVEA 2ITZA 3WE4A 3KXMA 3R6XA 3QRIA 4FNZA 4FYOA 4GYIA 3LLTA 3NNXA 4FNXA 4M0ZA 5EYKA 5FEDA 2R9SA 4K77A 2UZNA 4FKLA 4AP7A 5IF1A 4DG0E 3UC4A 4YTCA 2B9FA 4OTFA 2ITYA 3UBDA 3PTGA 3E64A 2XRUA 5ETIA 3W2CA 3AT4A 2Q0BA 4MBJA 1ND4A 2DUVA 3KU2A 3O96A 1H00A 3MA3A 5FQDC 3OD6X 1XJDA 3W2OA 4BCOA 5HQ0A 3ZZEA 1W83A 3R22A 4YU2A 4FMQA 3QX2A 2P3GX 2OIBA 4YHFA 4JDKA 4W9WA 4ZTQA 3I6UA 3DQWA 2WNTA 2G15A 3E63A 3FV8A 3I1AA 3OP5A 3R71A 3I5NA 3IKAA 3MY1A 4OTGA 3EZVA 4CEGA 4LM5A 2YN8A 2HAKA 2W17A 3EL8A 3LFFA 4YJTA 4XYFA 3V6RA 5E8ZA 4HGTA 2OLCA 2R3GA 3QUDA 5GJFA 2WMRA 3O50A 4D4YA 2PUIA 2QOCA 1BYGA 3MFRA 2O3PA 4FTAA 2BKZA 2C5XA 3VUMA 3FXWA 4AN3A 3UYTA 3ETAA 2R64A 4RVMA 3QD2B 4F1MA 2HY81 4NKAA 4TKSA 1A06A 4JG7A 1YWNA 4FODA 4F4PA 4ASEA 5DT0A 4E6CA 1NA7A 5C4LA 4FKQA 4CNHA 2WXVA 1UA2A 4I5HA 5H3QA 2OXXA 3R7VA 4PMPA 5J9YA 4JQEA 1JNKA 2GPHA 4P5ZA 3UIBA 3VBWA 4D28A 3AOXA 3F2AA 4HW7A 5BVEA 3QCYA 3RALA 1YI3A 5BPYA 3LIJA 1DAYA 2XNEA 2YITA 3FMDA 5JFWA 3U9NA 2OW3A 2C0OA 3ZDUA 2REIA 4OW8A 4DH5A 5EI6A 2A19B 3PPZA 3IOPA 3VO3A 2WQEA 2A2AA 4WG3A 5J7BA 4FC0A 4GK2A 2BDFA 2ITUA 4CLJA 4C4JA 4QNAA 3NCZA 4EL9A 1O6LA 3P08A 1VR2A 2JBPA 4I94A 3R9OA 2QD9A 5IEXA 3LXNA 4FBXA 2BDWA 2XCHA 4RIOA 5C1QB 4ZSAA 5JQ8A 3C5IA 2QG5A 4PTEA 3R7IA 4KKEA 4GJ3A 3HV5A 2E9UA 4C3PA 4ZLZA 4HGLA 1XWSA 4XEYA 2VGPA 5KNJA 4AZTA 3LLAA 1V1KA 4O0UA 4XOYA 3DDQA 1H1WA 5HESA 3TT0A 5DNRA 3TCPA 3VJOA 5CI6A 4AA5A 1R3CA 3T3VA 4I4FA 3IW7A 1HCKA 1NXKA 4UALA 3DZOA 4DC2A 2C69A 2VD5A 3W1FA 4H05A 1RE8A 2A0CX 2B54A 2F49A 2P33A 3CCNA 3IW6A 3N4UA 4TTHB 4QPSA 3I7CA 4IDTA 4FTQA 4KINA 4BN1A 1IA9A 3ZBFA 4ZLYA 2WPAA 3KF4A 5AUWA 2WMUA 2GS2A 3F5XA 3LQ8A 3OFMA 1UKHA 4BDHA 2X2KA 4O91A 4BDCA 4OAVB 3AT3A 4XJ0A 3R02A 4IM0A 2UZLA 1M2RA 4O2PA 5H8GA 4PL4A 5KHXA 2Y4IB 4QP7A 4EI4A 4L46A 2W1ZA 3D7TA 2WMSA 5C01A 3P7CA 4M15A 4FX3A 2XIRA 3ZDIA 4ZMFA 2WTDA 2W4OA 4MCVA 3Q53A 4QMUA 3QWJA 4OUCA 5E90A 4YLKA 4U81A 3BHVA 3D5UA 5L8JA 1APME 2JIIA 2VTPA 5CT7A 5L2IA 3ORPA 4KKHA 3TZMA 2CCHA 3PLAE 5D10A 1ZY4A 2GTNA 2FGIA 5A14A 3FXXA 4FR4A 3ZRMA 4O0VA 2BILB 4K8AA 4ZMEA 2RG6A 2OWBA 3GU6A 3SX9A 4ZY4A 4M7IA 5CASA 3ODYX 2VX3A 4MHAA 5H2UA 5T68A 4BL1A 1QPCA 4DN5A 4BBEA 4EQUA 4J98A 1L8TA 3TDWA 3PA5A 4L52A 4C8BA 5H9BA 2ZMCA 4I24A 4IZ5A 4CFFA 3MH1A 3ZS5A 2GFCA 3G9NA 2R3PA 3KN6A 3QQKA 4KIPA 2G2FA 4CCBA 4EK4A 4JDIA 4CT1A 4IWDA 4R6VA 2Z7RA 4GT4A 4NIFB 4IC8A 1JKTA 4RC2A 3SKCA 3JVRA 3GVUA 3QXOA 1WBPA 1MQ4A 3KULA 4GUEA 5AP3A 3EYGA 3C4CA 4IWQA 2ETMA 5CU0A 1JKKA 1H26A 2UZWE 3D15A 1SNUA 3P0MA 3G15A 5AR8A 3KVXA 2GHMA 4NJ3A 4KRCA 2XKCA 5DH3A 4FTKA 4PQNA 2YM3A 3F5UA 5A3XA 4Y95A 4FT5A 3IDPA 3DFAA 3QX4A 5DWRA 2QCSA 4QQ5A 1J7LA 1SVGA 4R77A 2ZDUA 5IISA 3QRUA 2C68A 3A99A 4Z7GA 3UVPA 3BHUA 4GL9A 2R0IA 3NSZA 1GY3A 2W99B 3AG9A 3TL8A 4O7TA 3VQUA 5J1VA 4QPAA 3OVVA 2R7IA 3MFUA 1YQJA 4J8MA 3VS3A 4AE6A 5HE2A 4CQGA 3WZUA 2AYPA 5LWNA 2F7ZE 4HPTE 2WIPA 5DRDA 3TNIA 4G3FA 2YZAA 3NW6A 4L67A 2UZEA 3FQHA 5TKDA 5K4IA 4CKRA 2YCSA 5E8TA 5AV3A 4TW9A 5I9UA 2BROA 5HZNA 4ZP5A 2WMQA 1Z5MA 1OZ1A 2GTMA 2V55A 2YACA 2JITA 3UNJA 4AA0A 4ZXTA 3R7UA 3WI6A 4BCFA 3KMWA 3NMUF 3UDBA 5JGBA 3V01A 5HG7A 3CY2A 2VO0A 1OMWA 3NYXA 4HYUA 3LFSA 4QTCA 3UO4A 2C3KA 4CFMA 3V5TA 3DKCA 4NKSA 2PVRA 3SA0A 4U45A 3GCUA 3LCOA 4MVFA 4RWLA 5AUXA 5KMJA 4FTIA 4YZNA 5EQPA 3RCDA 3IW4A 3NVKI 4UXQA 3LKMA 2F7XE 2YAKA 4LOOA 4MF1A 5HIDA 2XF0A 3VS6A 4I6BA 3ZM4A 4EEVA 3TG1A 4AU8A 4FICA 4CFNA 2R3QA 4BDBA 4JVGA 1CSNA 1B6CB 1OITA 4FF8A 3VBXA 5JFSA 5DPVA 3BEGA 2OH4A 2CLQA 2UW3A 3QRKA 4IVCA 4W4VA 1PXJA 4YBKA 4DITA 3SXSA 4FUXA 4YUQA 5AJQA 4X7QA 4HNIA 4ZZNA 4FEUA 2R3MA 2RF9A 4C38A 5AAEA 2WMAA 1OM1A 4MNEB 3QZHA 5ANIA 1PW2A 4DGNA 4G5PA 2GU8A 4MTAA 2CN5A 4O0WA 3RPVA 3SRVB 2YCFA 3IK3A 2Z60A 3JUHA 3VNTA 4A7CA 4F99A 3E8DA 3L1SA 2OF2A 4ZTLA 3F7WA 3S4QA 3T8OA 3BLHA 3GB2A 4FV4A 4XLIA 4CVAA 4O7WA 5FUTA 4FEXA 2E2BA 3PY1A 2GMXA 2QOFA 3G5DA 4AOTA 4AW0A 5CANA 3C0IA 3D14A 4CSVA 5FM3A 2X8DA 5KMKA 3ZFMA 1A9UA 3FMKA 3R21A 5CQWA 3TZ8A 4C2WA 4M67A 3OG7A 2WQNA 5CTPA 4H1MA 4F9AA 4A9TA 1UU8A 3AQVA 4FZ6A 5LVNA 4U0IA 1ZRZA 4HCUA 1FVRA 3MVLA 4FV6A 4FTJA 5A4LA 4YTFA 4EONA 2JDSA 1F0QA 1JSUA 5BVFA 4RA4A 3QQJA 3UGCA 2PU8A 2HIWA 4TT7A 3ULZA 3QFVA 3LXKA 3CTQA 5F1ZA 4JBQA 4AZWA 3OCSA 4EWHA 4YO4A 2OKRA 4D5HA 3F5PA 3PVGA 5CT0A 3UNKA 3SGCA 5LMKA 4TWOA 3DTWA 5K0KA 4BDFA 3OBJA 3UODA 3HEGA 3P78A 3Q6WA 2ESMA 5IUHA 1RDQE 3BGPA 5EM7A 1A48A 3PXKA 5AWMA 1HOWA 4AT3A 3Q9WA 4WD5A 4IHPA 4UWBA 5FM2A 4FT0A 3JPVA 4UWCA 4WRSA 4FA2A 1Q8UA 3FZPA 1BL6A 4WNMA 5GINE 2ONLC 1JAMA 4BWKA 2YM5A 4FTUA 2J0LA 3ANQA 4F9BA 3Q04A 3KN5A 1NVRA 3H9FA 4G31A 2IWIA 4FKIA 2UZDA 4QYYA 4FT3A 4JIAA 4RSSA 4DINA 1MUOA 4IAAA 2R3FA 2WB8A 3CQWA 1P14A 4EOLA 5HBHA 4F6UA 2QODA 4TWPA 2DYLA 1V0OA 3F3WA 3N4VA 3PLSA 2J0JA 3R8UA 5HVJA 1H1PA 3MN3A 3DAEA 4GW8A 2VTNA 3LHJA 3CJGA 3BWJA 3VRYA 3ACKA 4D4VA 3HV7A 4G6NA 3A62A 5HLWA 4CMTA 3HX4A 2C6KA 3U87A 2R5TA 3NYNA 5JZJA 1ZOEA 2W9ZB 5CALA 1QPEA 4TYEA 2WOUA 3IW5A 3MY5A 2VO3A 2KTYA 3E8NA 3EFLA 4YGAA 4TNBA 5ANEA 5KZ0A 4O86A 2PZRA 2ITPA 2UUEA 2R3NA 2FSTX 3QYZA 4JDHA 1ATPE 2HW7A 2BZIB 4L68A 4IXPA 3QL8A 4ITIA 3LZBA 3U55A 1PXPA 3A4PA 3HV6A 4ANNA 4QP4A 5HGIA 3U6JA 3FZ1A 3UG2A 2QVSE 4YZCA 3F61A 3OY1A 4XP3A 3W2QA 4UZHA 2AUHA 2PE2A 3GBZA 3JVSA 4F9CA 4NM7A 4RZWA 5J95A 4HGEA 3I6WA 3PUPA 1JSVA 4I5PA 3V5QA 3VUGA 4A4XA 4D4SA 1KV2A 3EFJA 3KRRA 3LMHA 4GKHA 3MFSA 3UIXA 2UZOA 1H27A 3AC2A 3B8RA 3GQIA 3HVCA 3W2SA 5HU9A 1IAJA 4QMXA 3WIKA 1YKRA 1ERKA 5FXRA 3FI3A 4O0RA 3NIEA 4ALVA 5KKRC 3ZRLA 4C34A 4M68A 2OXDA 4ACMA 2I7QA 3LQ5A 3MVJA 3QKLA 4U43A 2RL5A 2VUWA 3M1SA 3UNZA 1G8SA 2J4ZA 5EHYA 1YWVA 4E4LA 2EXCX 1OECA 3F2RA 5ANGA 5KHWA 3GC7A 4N6YA 2H34A 4II5A 3FY0A 2GQGA 1VYWA 4BCIA 3QF9A 3EYHA 4FI1A 4FG7A 2CDZA 3DLZA 1W8CA 4DBNA 5CU2A 1QMZA 3VC4A 4KBCA 3W55A 1OL7A 4S30A 3KQ7A 4QMLA 5IA3A 4WBBB 5FXQA 4HCTA 3GFWA 4JR7A 4U8ZA 5I9VA 2VWXA 4OTQA 3C0GA 4WSQA 3SQQA 4IB5A 4LGHA 5IQEA 4IZYA 3PSDA 4CZUA 4BF2A 1AQ1A 3HNGA 4O27B 1PMUA 5I4NA 5KMLA 4P90A 4KB8A 1FGIA 3MESA 1YI6A 2G9XA 2JD5A 2I0EA 4GV1A 4C2VA 2PULA 5DFPA 2AC5A 2PSQA 2XEYA 3PIXA 4BCMA 2BMCA 4BR3A 4WRGA 3A2CA 5DE2A 2WMTA 4XV1A 3T3UA 2VTLA 4FIJA 5KMOA 2VWWA 4I41A 1YHVA 2ITTA 4ZTRA 4C3FA 4F7SA 2O2UA 3FKOA 3BBTB 4LL5A 4YJPA 1GIIA 2IPXA 3QBNA 3MPMA 3TV4A 1P4FA 4ZSEA 4OGRA 3LMGA 5AP1A 4ASDA 3GUBA 4LL0A 3ORKA 5C26A 3HDNA 4FTMA 2YAAA 3IG7A 4CT2A 5HORA 5CVGA 2JIUA 4QT1A 2QU5A 3EH9A 3QTUA 4LYNA 1PF8A 3PXZA 2WHBA 2Z7SA 2QOBA 3PXRA 5LVPA 3FL5A 5K0XA 3DA6A 5CEMA 5M51A 3I60A 3FEGA 2B52A 1Q3DA 3MPTA 1FMKA 2OBJA 5AMNA 4QTDA 3NUSA 2NPQA 4DFUA 3RNYA 4CZTA 3DJ6A 1J3HA 4XRJA 3QUEA 4L01A 2RG5A 4YNOA 1ZZ2A 3V8TA 3JXWA 5EM8A 4G5JA 2BRHA 5FBNC 4JIKA 4RG0A 2FSLX 1B39A 2PTKA 1J7UA 4FEWA 3FSKA 3C4XA 5DI1A 3C5UA 3COIA 3S2PA 3A7FA 3C13A 4FEQA 2BKKA 3FBVA 2NRUA 4I5MA 4RPVA 3F3UA 4JX3A 2YM6A 5AP5A 4B6LA 5E92A 4IC7A 1W84A 1NVSA 5JKGA 5JT2A 2PWLA 5J8IA 5LMBA 1TQMA 5EOLA 3IDBA 4EOOA 1SNXA 2IZTA 3QD0A 4J95A 3W18A 4L42A 4A06A 1GZOA 2EXMA 2R3OA 3MIYA 4C02A 1JKSA 1TQPA 5HTBA 4K33A 4WBOA 3OROA 5CY3A 4EYMA 5AM7A 4BIDA 4QQJA 4G3DA 3LE6A 3M42A 3GCSA 1U59A 3FWQA 2V5QA 5HX8A 4FTLA 3ZONA 3V8SA 2EXEA 4U3YA 3NAYA 5E91A 4GCJA 4BTKA 5GIPE 3JS2A 4C61A 2I0VA 3K3IA 3D83A 3ELJA 4XHKB 4ENYA 4Y85A 3EQIA 1Q8ZA 4Y5QA 4G3EA 4AWIA 3PXFA 1WVXA 3NUYA 1SZMA 4I3ZA 2OFUA 4R5SA 4YNEA 3WZDA 3Q2JA 3V5PA 1PXKA 1KV1A 3PG3A 2ZM1A 4PDSA 2XZSA 2RSVA 3PWDA 4BCJA 3H0ZA 4IZAA 2YABA 5CZHA 4DHFA 2VTMA 4AACA 4OTRA 3WF9A 1VZOA 1ZZLA 2BCJA 5E9EA 2RFNA 3C4ZA 3TTIA 3U4UA 3BYUA 2QO7A 4FSZA 3TXOA 2YWVA 2X2LA 4PPCA 1WBWA 2XCKA 3KXHA 3QA8A 5IKWA 4AFJA 4PRJA 4JJRA 1CKPA 3Q52A 5A9UA 3K5UA 4DG2E 2WD1A 3FPQA 2C6OA 4BZDA 3DY7A 4FTCA 3UOJA 4L45A 3PIYA 3II5A 3QTXA 4HYIA 5IQCA 2BR1A 2XMYA 4H1JA 3U8WA 4K18A 4QP2A 2B4SB 3PE2A 5EH0A 4O38A 1BLXA 3A7HA 4NUSA 4JDJA 4C37A 4GRBA 3BYMA 2CNUA 1H0WA 4PPBA 2GS7A 4WNPA 3FC1X 3DGKA 3TZ9A 5CWZA 3PZHA 2X6DA 4OBPA 4RIWB 5AUZA 1XQZA 2E9OA 4YTHA 4E6DA 3QRTA 4ERWA 2A1AB 3ZYAA 4YJUA 4D9TA 3C4FA 4L00A 3G51A 1MRVA 3LVPA 4GS6A 4B0GA 3WOWA 4D2TA 4NYEA 3CY3A 3P1AA 3SW7A 1OKZA 2I0YA 5C8NA 3I81A 4WOVA 4I4EA 1K3AA 3NIZA 4FV5A 5IA4A 1PHKA 4IB1A 2Y9QA 2ITXA 2NP8A 2DS1A 3OWKA 4IX5A 4HCVA 3MH3A 4O7ZA 3R00A 4P5QA 3RNIA 4HPUE 4F0IA 3R1SA 2QC6A 2CGWA 5LJJA 1AGWA 3R9HA 3PJ2A 4X6QC 2YM4A 2QOLA 4FV0A 3S1HA 2XK8A 2G2IA 3O8PA 4RWKA 3R04A 4YO6A 4FVQA 5KMNA 1U4DA 2VAGA 2XUUA 4XV2A 5A4QA 4BKYA 1REKA 4MF0A 2ZV8A 2X4ZA 4UY9A 5HVYA 2ZAZA 3E3BX 3PPKA 3ZO3A 3ET7A 4BI2A 4BTMA 3PYYA 3VHEA 5LMKC 5HNBA 4MXOA 3PVBA 3D94A 3CPCA 4IX4A 2P0CA 2GNHA 2J9MA 3LXPA 2PZIA 4M12A 3UMXA 3C4WA 2BFYA 4FKRA 3HUCA 4X3JA 2ZV7A 5EDRA 3V5JA 4AZSA 4D4RA 3OT8A 2VWBA 2YCQA 1FQ1B 1OPJA 5HCYA 2CKPA 3P4KA 4UB7A 3VS1A 3COMA 3HP5A 4UZDA 1QL6A 4I21A 1H25A 1Q8WA 2VWIA 5DT4A 5ANKA 3RBWA 3FMNA 5B2KA 3V5LA 5DR2A 2HZNA 3HA6A 4RT7A 3VS2A 3ZFYA 1U46A 4ZY5A 2QR7A 5CEKA 1PYEA 4AUAA 4EH6A 2J5EA 1OIRA 3PZEA 4YMJA 4OBOA 3LQ3A 4YJNA 2C6DA 4PP9A 5DMZA 1H01A 4EK6A 2C3LA 2WU6A 3FI2A 1JLUE 2UW9A 5HG5A 2JKQA 3DZQA 3Q96A 4ACDA 4QMMA 2RFEA 4YC3A 2V22A 3ORTA 3NZ0A 3JR1A 3OUNB 3E92A 4IAZA 2XK6A 3GU8A 2YFXA 3AD4A 4R7IA 4WUAA 3GXLA 4F1TA 4EH2A 2WOTA 4XX9A 5E8WA 4XRLA 2JGZA 2OI4X 3P9JA 4JS8A 5DT3A 3F3VA 4BICA 4J97A 1Q8YA 2BIKB 4N4SA 4L9IA 5LARA 3UPZA 4ASZA 4DEEA 3QCQA 5IQAA 5E8UA 3NYOA 4IAKA 2ITVA 4NIFA 4Q9ZA 4Y8DA 5JRQA 3EQFA 4QYFA 4BCPA 3IECA 4R78A 1GZ8A 3TM0A 3AMBA 3MGYA 4WUNA 5I0BA 2PYWA 3KVWA 3VF8A 3FJQE 2VTJA 4NCTC 5FWKK 1Y8GA 2QONA 1J1CA 4Y73A 4QTEA 4LGDA 2QOOA 4KBKA 4BHZA 4JI9A 4O7RA 5AR7A 2ONLA 3UO5A 4A4OA 1OL2A 2XVDA 4TWCA 1UWJA 4Z16A 2VTOA 3QZGA 2XK7A 4FKGA 4RVLA 4M3QA 4C4HA 5AA9A 5F9EA 4M66A 1UU7A 2R3IA 3G2FA 2IVTA 3QZFA 4BTFA 3FPMA 3NR9A 3DT1A 4QTAA 4TN6A 2ZB0A 2YM8A 4YLJA 3FMJA 4FKJA 3UVQA 3OXZA 3U6IA 2WMXA 3BHTA 4IM2A 2V62A 3NUPA 1B38A 2QLQA 3VHKA 5LCKA 3W33A 3D5VA 3BLRA 2OZAB 4IB0A 5GZ9A 4KSQA 3RK5A 3WZJA 4I6HA 3N51A 4BCGA 5EHLA 4OR5A 1PMVA 5DVRA 4I92A 4S32A 3D7ZA 4KKGA 2EWAA 5L8KA 3AT2A 4D0WA 2CNVA 2UZUE 4L6QA 3BBWA 4EKKA 3W10A 4RJ5A 4ZEGA 5ANOA 2F2CB 4DG3E 2BHEA 3LCKA 1Q99A 2RIOA 4QYHA 4BCQA 5DN3A 1OL1A 5CEQA 2VTSA 3DXQA 4RX5A 3G0FA 3RM6A 1KE7A 3BPRA 4BDGA 4C3RA 3A8XA 4OLIA 3MJ1A 4RX8A 5I3RA 4R8QA 3ZSGA 3E88A 4J8NA 2W4JA 3PWYA 5JSMA 5IQHA 3BU3A 3H3CA 2ERZE 3GCQA 3HRBA 4WG4A 2RFDA 4HOKA 4Q2AA 1ZLTA 2J6MA 2W9FB 3FDNA 5DGZA 5BMMA 1LEWA 1QCFA 1WBVA 2XNGA 3QGYA 3RCJA 4DEHA 4E20A 5ITAA 4RC3A 4V0GB 2E9NA 4MD8E 5EM5A 3LFDA 4AGUA 5AV0A 3ATTA 2XNBA 3G6HA 3QLFA 5HBEA 4QRCA 4CMOA 2QQ7A 4L3LA 3I0OA 4JT3A 2LAVA 3TEIA 5I5ZA 4U5JA 4AZEA 3DBFA 4WA9A 3OWJA 2CGVA 5I9XA 5TR6A 4MNEA 4F7LA 3HMIA 4FKOA 4AW2A 4CV9A 3JYAA 2J90A 4ANLA 4JQ7A 4EUTA 5C4KA 4D1XA 4U7ZA 5EI8A 4PMSA 3CJFA 2IZRA 3DB8A 5EW9A 2QI8A 4A07A 5LQFA 3HAVA 4BRXA 3EIDA 3SRVA 4C36A 3SOAA 1U5RA 5A6OA 4FL2A 4ZTSA 2X6EA 1E1VA 3OTUA 4GJ2A 1QPJA 3R9RA 4MXCA 2BZKB 2GS6A 5DLSA 3HRCA 3U9CA 4EOJA 1WBNA 4W9XA 3KXGA 3TWJA 1J1BA 5L3AA 1H1RA 1LUFA 5CAOA 3QD4A 4MBIA 2QOKA 4NZWB 1PMNA 1OIYA 4JRVA 5HIEA 5DOSA 3PFQA 4U44A 5BVDA 3O7LB 2ETRA 4OBQA 1OGUA 4FSWA 4MBLA 4XP0A 3PRFA 4FZDB 3FC2A 3VBTA 3AC1A 2EU9A 4O7YA 2WTKB 5TF9A 5TOZA 3ZUTA 1XBCA 4F09A 3V3VA 4AOJA 3KK8A 4F08A 4O82A 3PXQA 4BGHA 3UZPA 5IQFA 3UP2A 2O0UA 1S9JA 4D2WA 4C35A 2C5YA 4PMTA 4ZSLA 3G9LX 5BVOA 4ARKA 5KX8A 4ANQA 2HXQA 2XBAA 1PJKA 5CSPA 2QURA 3DCVA 4JXFA 3ANRA 4TRLA 4QMOA 4X3FB 5F20A 5IMXA 4MKCA 1BL7A 3C50A 3GCPA 3M11A 4WKQA 3P7AA 3TUDA 4I0SA 4H3PA 4YSJA 4FKUA 3FHRA 1CKJA 4J53A 4BCHA 4QQCA 4FIEA 2C6EA 4MWHA 2PMOX 3E93A 3GOKA 4EH5A 2X7FA 3PXYA 4AG8A 2W1HA 3AC8A 4LOQA 4M0YA 4TXCA 3ZUUA 4EBWA 3SVVA 5G1XA 2CHLA 4JG8A 4NTSA 4DTBA 3WF6A 3FLWA 2XH5A 4EBVA 3MW1A 3UZRA 5CAQA 1KUTA 5C27A 2Y4PA 3MDYA 3SD0A 1NT2A 2Z2WA 4QP3A 3W32A 3PDTA 4QMVA 2BRNA 3VVHA 3C9WA 3VBVA 5M53A 3DBCA 3FQSA 3FZTA 3IGOA 4ZJJA 4O2ZA 4C58A 4BIBA 4YURA 5LVLA 3DDPA 5FLFA 3HV4A 3MB7A 3PIZA 4XBRA 1J7IA 4FZAB 1T46A 2JEDA 4RQKA 3FLYA 2XK4A 4XBUA 4MNFA 2YIRA 2ZMDA 3ROYA 3TIYA 4KS8A 2C6TA 4RVKA 5DBXA 3PY3A 2ITWA 4KD1A 3UOHA 1GJOA 3AMAA 2ZYBA 3TKUA 4DH3A 3C0HA 4DEIA 4TYJA 5HNIX 2HCKA 4AW5A 4B8LA 3MV5A 4QYEA 5GJDA 5CF6A 4C7TA 2FVDA 3DJ5A 4DA5A 2EUFB 2Q83A 5EW8A 5LVMA 2IZSA 2W06A 4EUUA 4HVGA 2C5VA 2XJ1A 4KAOA 2IW8A 3MPAA 3QQUA 3UIUA 2GNFA 2XM8A 2NRYA 4I93A 3I5ZA 4MWIA 4EOIA 1UVRA 5L6PA 4RMZA 3P7BA 4XUFA 1W98A 2X8IA 4PNKA 1OL5A 1ZAOA 5IH5A 3D9VA 1LP4A 3R7OA 2WTJA 4C4GA 5IH4A 4FTRA 1Q41A 2F9GA 4IADA 3GFEA 3JY0A 4YC6A 3SAYA 4AN9A 2ITNA 4W4XA 2XB7A 4B9DA 3THBA 4USEA 3WILA 2GQSA 3LM5A 4BZOA 2OU7A 4Q5HA 1VJYA 4ONAA 1Q3WA 3A7JA 3H0YA 1M7QA 1RQQA 5EK7A 4ITHA 4K2RA 5CF5A 4PDPA 3EN6A 1GAGA 2WTVA 4D2VA 2GNLA 2B55A 5LMAA 4PMMA 5E4HA 3GGFA 3MTFA 4D1ZA 4DE4A 3EFWA 5DHJA 2VTRA 4W8EA 4YC8A 4ANMA 5KBQA 2C47A 1AD5A 2PZ5A 2UZTA 2IW6A 4BZNA 4FTNA 3RGFA 3TJDA 2JAMA 3G90X 3RAIA 2Y4IC 5EM6A 2QHNA 3MTLA 1Q24A 2QO9A 3ROCA 5FRIA 5IEYA 2JC6A 3ZTXA 4RQVA 5IQGA 3NNVA 4IJ9A 3MY0A 5FD2A 1I44A 4J71A 3BU6A 3NDMA 5M55A 3VUIA 2CNQA 2O8YA 2WMVA 3KRLA 4JAIA 4O0XA 3RPRA 1DM2A 3ZC6A 3Q9XA 1ZYSA 3E8EA 1U54B 2UVXA 3EQCA 4HZSA 4Y72A 3ZZWA 3NUAA 2VO7A 3KKVA 3PA3A 3Q60A 3H10A 4WIHA 1GZKA 4QD6A 3HP2A 3R73A 4FUYA 4HNFA 1SMHA 2XRWA 3OWLA 3F2NA 2YLFA 4JBPA 4W8DA 3KA0A 3QCSA 5CX9A 4RJ4A 2C4GA 3EQHA 4M69B 1LPUA 4IEBA 3ZUVA 4QMQA 4O7VA 1OKYA 4R1YA 4EWQA 1OI9A 3ZU7A 5AR3A 4FVPA 2JLDA 3NNWA 3E3PA 4FG9A 4PWNA 4XG2A 4I0TA 1WBSA 3VUKA 2Y7JA 3UE4A 4M84A 4ZTNA 4M14A 2VNWA 2VTHA 3F3TA 4A9SA 4C57A 3TDVA 4C59A 4TYGA 1TKIA 4J1RA 5K4JA 4NL0A 3FY2A 3O2MA 3VRZA 3MSSA 2EVAA 5EYDA 1G5SA 2FSMX 3F7ZA 3EN9A 3GP0A 4F65A 2PMIA 5AUUA 4XV9A 2Y8OA 1YDTE 1XH8A 1FINA 4FOBA 3RPYA 1PXIA 4W4YA 4MXZA 4BDDA 2EB3A 3OEFX 4QNYA 5AR5A 4RGJA 3QTIA 5K5XA 4FV2A 3DLSA 3H9OA 2HELA 3L9PA 3EQPA 3QYWA 4JAJA 1UU3A 3ZC5A 3LAUA 5CI7A 3DFCB 3QZIA 3PY0A 1CTPE 4X2NA 5I9WA 3UOLA 3VJNA 3DQXA 5AP7A 2IVSA 4GFMA 4IANA 4O7NA 4YJQA 4IAFA 5DEYA 5ANJA 2OG8A 1JVPP 1M2PA 5GZ8A 3MA6A 3CD8A 3R28A 1JBPE 1ZYCA 5ETCA 5CF4A 3BYVA 3GCVA 1SVHA 2ZV9A 2J51A 1YHSA 5IA5A 2WMBA 3DJ7A 2B9JA 3AD5A 2RKUA 4LOPA 4NK9A 4O1OA 4KWPA 4OTWA 3TV6A 4UMRA 4J7BA 2OJGA 1WBTA 2W5HA 3O17A 3O71A 3TIZA 4KIQA 3Q2MA 2V7OA 3QTQA 2BVAA 4GMYA 1OKWA 4HGSA 4PF4A 3O51A 3I4BA 4LG4A 1Y57A 2IVUA 4R3PA 5IQDA 2R4BA 1V0PA 5JFVA 1IA8A 4BBFA 4NCTA 4IBMA 3ZXTA 2X8EA 4KUJA 1XBAA 3AXWA 3ID6C 4DLIA 5M57A 3DAKA 4DT8A 2YWPA 3FSFA 2WTCA 3MH2A 5B0XA 4ZTMA 3FLSA 5C9CA 3IW8A 3CR0A 3ORIA 4O6EA 2OIDA 3DTCA 4U40A 3R8ZA 1GOLA 1OBDA 2HOGA 3ATSA 2C0TA 2J50A 2GNJA 1NVQA 3R63A 3Q9YA 3OEZA 4GK4A 5DA3A 1KE5A 4XG3A 4EK8A 5CF8A 4LRKA 3UQCA 5DG5A 3IOKA 2YIYA 4UMTA 5TT7A 4ACCA 1REJA 4BDKA 4QMTA 3BKBA 3BLQA 3BV2A 5LCJA 1OBGA 3KCFA 2HXLA 4TPTA 4BGQA 3R01A 4GUBA 5HNGA 5IEVA 2C3JA 1KE8A 4WG5A 4EHEA 4C33A 5T6KA 4GKIA 3DPKA 3I79A 5JZNA 3ENMA 4Z9LA 4OTIA 2W1IA 2ITQA 4RIYB 4FEVA 5FTQA 2GDOA 4JL9A 1ZOGA 1BI8A 2VTTA 4AGCA 4EORA 3ORLA 5JRSA 5M4IA 4ZZMA 3QUPA 4F6WA 3R30A 1IEPA 5CVFA 4DYMA 2XIZA 4IB3A 5M07A 4RIWA 3PRIA 3H30A 4NEUA 3FKNA 5AP2A 3A8WA 4GIIA 3LFNA 5HCZA 3RINA 4E4MA 4TNDA 3OT3A 3QALE 1KE6A 4RFMA 3FZSA 5J87A 3VW8A 4DCAA 1FBNA 4G2FA 1Q97A 3L9LA 3RTPA 4ANSA 3CSVA 1PXMA 2R3RA 2UW7A 2XK9A 5K9IA 1O6YA 2VX0A 3FUPA 4G6OA 3VF9A 4HVSA 3FMHA 1LEZA 3IGGA 2YZLA 4RZVA 4QP8A 2WIHA 2NNWB 4B7TA 3PJCA 4YPDA 2PZYA 3KFAA 3HGKA 3SHEA 4RFZA 4DTAA 4DGMA 3RP9A 1YHWA 4KIKB 1DI9A 2GFSA 4WO5A 3LFEA 3DKOA 3RPSA 4FKTA 4S33A 2A27A 3Q3BA 4QMPA 4PPAA 3UVRA 3ZO4A 3O7LD 4BYIA 4CMUA 3BRBA 4USFA 3P5KA 1E9HA 2QOQA 2V0DA 5CVHA 4DCEA 5H8EA 3F66A 2XJ0A 4PP7A 3PP0A 3QGWA 5FP6A 3MBLA 2WQMA 3HRFA 4FTOA 2B53A 4ZIMA 3GC9A 4MD9E 5AV2A 5D11A 5HE3A 4DF3A 4FIFA 1KOBA 1H28A 3ACJA 2HK5A 4JX7A 2H6DA 4MH7A 4YJRA 5CU4A 3ZLWA 3V51A 2VN9A 1UWHA 2WTIA 4F9WA 1OUYA 4DGLC 4RWIA 4BGGA 4GFOA 2W1FA 1KE9A 1FPUA 5EYMA 2PVMA 4BCKA 5CS6A 3W16A 3H9RA 4IQ6A 3MVHA 2XIKA 3KXNA 1YWRA 2X4FA 4MQ1A 4KIOA 4F0GA 4MX9A 3W2PA 5AEPA 2XIXA 4XOZA 1RJBA 1XR1A 4PY1A 3RWQA 4FKSA 3DK3A 4RX9A 2P55A 3GU5A 3ZO2A 3REPA 5HTIA 2YJRA 4MXAA 3ZLSA 3ZEWA 4Z3VA 2UW0A 4ID7A 4DH7A 4AXAA 1F3MC 4QTBA 4LV8A 4APCA 3ALOA 3QTSA 4YHJA 5AX3A 3BYSA 3RWPA 3DXNA 3QRJA 4G9RA 3DV3A 3PPJA 5JFXA 1WVWA 3EHAA 4FGBA 4E5WA 5CEPA 3FLZA 3WARA 4FKVA 2XNMA 3MH0A 3ERKA 5EOBA 4RLLA 4UBAA 3W2RA 4EJ7A 1H24A 2UZVA 5AR2A 3UPXA 4X2KA 3VUTA 4X2JA 4AQCA 4UWYA 4NW6A 5HO6A 1GIJA 3BX5A 3MYGA 4ZLOA 4V05A 5EFQA 4LMUA 3HUBA 2CN8A 3OMVA 4L7FA 4M13A 5K3YA 5L2QA 4L7SA 5EYCA 4YSMA 5DR6A 5B2LA 4I1ZA 3PE1A 5KMIA 2X81A 3QXPA 2IW9A 4LGGA 3CTJA 2OJ9A 3S0OA 2E9VA 1YDSE 3U6HA 4DBXA 2DWBA 2CKEA 5J7HA 4IX3A 1IG1A 4X0MA 5A6NA 2G2HA 4Y46A 4E1ZA 2UW4A 2OZAA 5AUYA 3I7BA 2Q0NA 2XBJA 2B1PA 1XH4A 1ZYDA 3U51A 4IX6A 1Y8YA 2R3KA 2WAJA 2UV2A 3Q9ZA 4QP9A 2WEIA 2XYUA 3R8PA 3IS5A 5HE1A 4F7NA 1R1WA 4RRVA 4XG7A 2CKQA 5JN2A 2ETKA 3KMMA 4FTTA 4PUZA 4P7EA 4I6QA 2C1BA 2CGXA 5EKNA 5GJGA 2FO0A 4BFMA 3EQRA 3VS5A 3KB7A 3ALNA 3Q32A 3D2IA 4GG7A 3CEKA 3O23A 4C0TA 4KNBA 1NY3A 5IDPA 5IG1A 5FBOA 2R3LA 4QMWA 1OPKA 4DEDA 2XJ2A 3V8WA 1O9UA 4YR8A 4UX9A 1FGKA 1GNGA 4IMYA 3F5GA 5M06A 2JIVA 3WZKA 3ZCLA 4ALUA 4CFUA 4IVAA 4V0GA 3Q6UA 2PZPA 3UJGA 2O64A 3RAWA 4GVJA 4RIXB 5CAVA 5BVKA 4ZK5A 4RJ6A 4BDJA 4YZMA 5HTCA 2OGVA 3QHWA 2H96A 4H3QA 4A9RA 3CQEA 1K2PA 2UVYA 3A7IA 5IU2A 2HWOA 3VN9A 4FGRA 4CCUA 5KBRA 4GU9A 3FLQA 5IUGA 5DR9A 1XHAA 3WBLA 2IG7A 4HVDA 4RWJA 4MQ2A 5HO8A 4AX8A 4EYJA 4JG6A 3FL4A 2PE0A 3SOCA 4IZ7A 2C1AA 3AMYA 4K11A 4AFEA 3ODZX 4IH8A 2FB8A 2QHMA 5CSWA 2QLUA 5IMEA 3EOCA 3GC8A 2OXYA 4AZVA 5FXSA 2WQOA 5LXMA 3R7YA 4GSBA 5KUPA 2GHLA 4Z55A 2FH9A 4E4XA 2PMLX 4IW0A 3L8PA 2JKKA 3FE3A 4J99A 2WQBA 3SG8A 3CKXA 3KY2A 4DGOA 3RI1A 2XYNA 4RLKA 4I0RA 2AC3A 3QTRA 4DTKA 5I9ZA 4FL3A 3KGAA 4EC9A 2ZV2A 4FIHA 3QQGA 3CLYA 4GG5A 1ZYJA 2BUJA 4C4EA 5FDPA 4DFBA 1CDKA 1MRYA 4N70A 3VUHA 3ZEPA 3UQFA 2ERKA 3LJ1A 2GSFA 5E7RA 3GEQA 4AZFA 5M08A 3BGQA 3ULIA 1L3RE 2XNNA 3LFQA 3BGZA 4JNWA 4L53A 3A7GA 3TNPC 4FT7A 3DNEA 3HMOA 4XV3A 4EQCA 5HBJA 5ACBC 3EQGA 3VWAA 2IVVA 4GT5A 5J9LA 3HAMA 4MD7E 2R0UA 2F57A 4FL1A 3VAPA 2BTRA 4EOPA 4EZ3A 3EKKA 2W1CA 4NTTA 4QP6A 3NVMB 1YOLA 4JLCA 4X3FA 5HVKA 1YW2A 5FGKA 3U4WA 2CPKE 1YDRE 4BVUA 2GNIA 1IRKA 1PMEA 2HY0A 2UVZA 5DEWA 3NS9A 3A60A 3QC4A 2WKMA 4YZBA 2IJMA 4DEBA 3UO6A 4DT9A 3FI8A 1U5QA 4D2RA 5CAPA 5EI2A 3R7EA 1I09A 4IFGA 3S00A 4G3CA 4ZSJA 5EHOA 5J5SA 3N9XA 3PA4A 5JK3A 4A9UA 3DS6A 3H4JA 2Y6MA 4EH8A 3NLBA 4BHNA 3FMEA 3DU8A 2SRCA 4KBAA 5D12A 1ZOHA 4LUDA 3R0TA 5IZFA 1PXNA 4C4IA 5D7AA 3POOA 3WF5A 3CIKA 3R1NA 3TJCA 3OXIA 5M4UA 2WZJA 4ZTHA 4NH1A 4FSNA 4IWPA 5E8VA 2B0QA 4USDA 5AIKA 2NO3A 2H9VA 3R8MA 3ZSHA 3OXTA 3VQHA 2W5AA 4NU1A 4ZOGA 1K9AA 3CS9A 3TI1A 3IDCA 3F69A 3LCTA 1ZY5A 5HE0A 2QU6A 5KO1A 4DLJA 4F1OA 2PVNA 3CKWA 4CV8A 4R3CA 1SYKA 2P2IA 3EB0A 3EKNA 3RPOA 1CKIA 1VEBA 3B2WA 3KK9A 4DH8A 4EZ5A 5EDPA 1PKDA 3LFAA 4XG4A 1UKIA 1YXSA 3IPHA 3ENHA 2JFMA 3HA8A 4D55A 4O0TA 4Q9SA 2OSCA 2B9HA 4OT6A 2PUPA 1XKKA 1T45A 4CLIA 3K3JA 4GH2A 4RC4A 4LI5A 2YJSA 3AC5A 1ZMVA 3DBDA 1UU9A 2OIQA 4XG6A 4O84A 2XA4A 2J5FA 4R1VA 3R8LA 5L2SA 5HKMA 4FE2A 4CFVA 1M14A 2XKDA 5GHVA 1G8AA 2VTQA 3QA0A 4Y5HA 1PY5A 2XIYA 3D5XA 4A4LA 3PJ8A 5DIAA 3TNHA 1RW8A 3O8UA 3LMIA 3L8VA 5H8BA 4BDAA 2A4LA 1M7NA 3E5AA 4PX6A 5HLNA 2I1MA 1PYXA 3Q4ZA 3MJ2A 5F95A 1XH7A 2JDRA 5EQYA 3FMLA 3D4QA 2YIXA 2J7TA 3DK7A 3QTWA 5AX9A 3PVWA 5CYIA 4TYHB 2I6LA 4PDYA 3ZRKA 3A61A 2BRGA 3DKGA 4RVTA 4UYAA 5AP6A 2VU3A 4DFYA 2CKOA 3LXLA 2JKMA 2QKWB 1X8BA 3WF7A 4ZS0A 3FKLA 1UNLA 3VUDA 4DFXE 3WZEA 2LGCA 3V5WA 4I5CA 5CXHA 4GFGA 2GCDA 3DBEA 1MRUA 2Y6OA 1H1QA 4M97A 5D41A 5FTOA 4FV9A 5KE0A 4EH3A 4CRSA 2QG7A 3F6XA 1M17A 2YDIA 3D2KA 3VS0A 5I3OA 4EKLA 2VV9A 2W1EA 1U54A 2Y0AA 3LOKA 3TNQB 4EH7A 4JOAA 5ANDA 5LWMA 3DXPA 4IJPA 4CXAA 5BYYA 2W96B 4EH9A 1XH9A 3MIAA 3MFTA 4BBMA 1XBBA 2PVFA 3BZ3A 2QOHA 2W1GA 3NUXA 2QOIA 3GC0A 4M69A 4C62A 5AUTA 4PL5A 3PJ1A 1Y6AA 4YP8A 3R2BA 3BE9A 4CQEA 5A4TA 5L8LA 4L43A 5AAGA 3UTOA 4CGAA 4LUEA 1KWPA 4KRDA 4TL0A 3R8VA 3RAKA 4EOKA 5L2WA 1YXXA 3EFKA 3GQLA 4BC6A 3DK6A 4ACHA 3L9NA 4AF3A 4EHZA 1OVEA 3NAXA 3QWKA 5CU6A 3KL8A 3AGLA 3QAME 1H4LA 5DRBA 1JWHA 3R9NA 4AA4A 4X2FA 5HIBA 4O1PA 2PUNA 2WU7A 3AGMA 3OOGA 5J1WA 1HCLA 3TV7A 5BUJA 5HG9A 3PSCA 3KRXA 1OIQA 4U42A 4E93A 4DFZE 4WT6A 2J0IA 4NM0A 1IR3A 2BTSA 3LJ2A 4MAOA 5CZIA 4EZ7A 1PXOA 4G34A 4Q5EA 4IE9A 4FYNA 3R83A 3ZMMA 3FQEA 2PUUA 2JDTA 3BELA 3UG1A 2UZBA 3VS4A 5E8XA 4D2PA 3E8CA 4E6AA 3EMGA 3TTJA 4QMSA 3WYXA 3HLLA 4OAUC 4O83A 2PVJA 4YJSA 4EC8A 5GZAA 2PHKA 3D5WA 1XH5A 5KMMA 4QOXA 4FSYA 4IIRA 4HZRA 5FEQA 4YTIA 3VBYA 4FV7A 3RJCA 2F4JA 2V7AA 2X7OA 1Q4LA 2YERA 2CLXA 4WNOA 2ZJWA 3BQRA 3QQFA 1Q62A 2I0HA 2YCRA 3SC1A 3E7VA 1J91A 1DS5A 2OJFE 3K54A 2JDVA 3NRMA 1BKXA 4QMYA 3NUUA 3TKHA 1YXVA 3CGFA 3EN4A 4UMUA 4YZDA 3QCXA 4RJ3A 5FDXA 1R39A 3OWPA 4E8AA
chains in the Genus database with same CATH superfamily
4D0XA 1S9IA 3BHYA 4IVBA 4N6ZA 2VTAA 4U41A 4RFYA 3E7OA 4ITJA 4FKPA 4PL3A 3CP9A 2R3HA 5CNNA 2X0GA 4EQMA 1IAHA 3QKKA 4CYJA 1E1XA 1G8KA 3C7QA 1XMLA 1ZWSA 2XP2A 3LCDA 5E8YA 3F88A 4XMOA 1DI8A 2RFSA 3GI3A 5J9ZA 2BZJA 3DBQA 5LOHA 3CTHA 3FXZA 4K6ZA 3WYYA 5A4CA 1PXLA 2OICA 4M8TA 4H3BA 4PNIA 1ZARA 2E9PA 3HL7A 3OOMA 4D5KA 2XNOA 3DKFA 4YBJA 2YIWA 3SW4A 3RHXA 3ZH8A 5KKRB 2XM9A 4XG9A 4NT4A 2YDJA 5AUVA 1MP8A 1YOMA 1ZXEA 2O65A 2X2MA 1WFCA 3FHIA 3Q4UA 4G9CA 4AN2A 3ZO1A 3DAJA 4FJVA 3S95A 4AT5A 3RZFA 3GNIB 2VNYA 5BX0A 4TY1A 2QR8A 3OC1A 4S34A 4RIYA 3SDJA 3DB6A 4JBOA 1FVVA 1H07A 1NW1A 2R3JA 2O63A 2VO6A 2P4IA 4PDOA 2ITOA 2YM7A 3V6SA 3LJ0A 4W4WA 2HZ4A 3W0NA 4OT5A 4AXFA 4F0FA 2VZ6A 2JDOA 5HG8A 4P4CA 3BCEA 1M2QA 4QYGA 3T9TA 4O22A 3Q4CA 3NX8A 2IZUA 4BDIA 3R1QA 3HMNA 3D7TB 4X2GA 3FZOA 2C30A 4WNKA 2VWUA 4G16A 4O0SA 4HVIA 2C5OA 4L3PA 4U97A 3EN5A 2DQ7X 3CD3A 3KMUA 3KRJA 3EQDA 4BWXA 3QQHA 2WTKC 4RJ8A 3HMPA 3RK7A 2IO6A 3ZHPC 3GENA 4E5BA 4NWMA 3EZRA 3EQBA 1R0PA 3UC3A 5BQ0A 3OBGA 1KOAA 2KULA 4O0YA 1KSWA 3NPCA 4U79A 1STCE 3NUNA 4S31A 4AGDA 4ANOA 2AEGA 2XKEA 3ORXA 4B8MA 4G17A 4IM3A 1UNGA 1YI4A 2WMWA 2X39A 3D0EA 4YJVA 5L2TA 3CGOA 4H39A 4KIKA 4X3FC 5E8SA 3ORNA 3PSBA 4PTGA 2XEZA 4O4FA 3OCTA 3F9NA 4GIHA 1PKGA 3OY3A 4DFLA 3CE3A 3PJ3A 3W8QA 5KCVA 3W0QA 2OJJA 2YLEA 3CBLA 4XS2A 1WAKA 4S2ZA 2XNPA 3FI4A 2OJIA 1Q5KA 2FA2A 2B7AA 5K5NA 3KULB 2WFYA 1Q61A 5L4QA 3KCKA 4NW5A 5EQEA 4O6LA 4IACA 5EW3A 3MB6A 4RBLA 4EOMA 3O8TA 2OH0E 2CJMA 2GHGA 4AZSA 1TVOA 3LM0A 2PK9A 5F94A 3TNWA 3E62A 3HECA 5CSXA 1H8FA 4CTCA 3L8SA 2CCIA 4FV8A 4FSQA 2X9EA 5T3QA 5TE0A 3ZLYA 5BUEA 4AAAA 4YPSA 1DAWA 2YDKA 4FSTA 4HJOA 4KABA 1W7HA 3GOPA 4FIIA 2W1DA 1V0BA 4DHJA 2VRXA 3FLNC 5AA8A 1M52A 2RGPA 4U3ZA 4LQMA 4EHVA 4FNYA 3PG1A 4GK3A 4BTJA 5KZIA 4ASXA 3NCGA 2P2HA 5AR4A 1H1SA 2OZOA 2X9FA 4NSTA 3T9IA 5HO7A 1IASA 1XO2B 3UMWA 2WTWA 3E87A 4NFMA 4D2SA 3G0EA 3ZBXA 3CQUA 3OTVA 4CYIA 5IPJA 2OO8X 1P2AA 4O21A 2H8HA 4EJNA 3HDMA 4MYGA 4DDGA 5CSHA 4QP1A 5E1EA 5BVNA 3QTZA 2VTIA 1FMOE 5JH6A 5IA0A 4E6QA 1YOJA 1ZMWA 4JBVA 4ENXA 1R0EA 4WHZA 1LR4A 1ZYLA 2W7XA 3UYSA 4R5YA 1BI7A 3QQLA 4LV5A 3WF8A 4ZAUA 4ZJVA 4CKIA 4AGWA 4QMNA 3MS9A 3KXZA 3QKMA 5A54A 5HU3A 1P4OA 5GNKA 1URWA 5EG3A 4H36A 5HD4A 4IAIA 3EL7A 2BRMA 2JAVA 4N0SA 4WSYA 2YEXA 4O81A 3S3IA 3G33A 4X6RA 3UOKA 4L3JA 5IA1A 2Z8CA 4XLVA 5IH6A 5CSVA 4ZJIA 4N57A 2VX1A 4K0YA 3ZOSA 4F6SA 2Z7LA 5CQUA 3ZFXA 2OK1A 2UW8A 4KSPA 1OIUA 5HEZA 5TO8A 2BZHB 2J2IB 4V04A 4D1SA 5JMSA 4Z7HA 5IA2A 5J5TA 3ZXZA 5CU3A 5AM6A 3O0GA 3V04A 4U9AA 2PVKA 3QC9A 4UN0C 3MI9A 3RK9A 4AS0A 2BAJA 5M4FA 5CENA 5BVWA 4ZY6A 4XG8A 1R78A 4G3GA 3TKIA 3UIMA 4FSRA 4UYNA 4CD0A 2BALA 1BUHA 2WEVA 3C1XA 3K5VA 4HYSA 2YHVA 3KREA 3B2TA 4F9YA 2CSNA 2PY3A 3BEAA 2UW6A 3RZBA 4PV0A 1W82A 4DAWA 2JFLA 1FVTA 4NJDA 5M56A 2ZVAA 3M2WA 4E5AX 2HZ0A 2C3IB 4OTHA 2OFVA 4J52A 4B4LA 2BAKA 2BPMA 3UP7A 3COHA 4FSUA 5CXZA 3K2LA 4IAYA 4GYGA 5HI2A 2I40A 3BE2A 4X21A 4DEAA 4F64A 2GQRA 2Z02A 3LPBA 3C4EA 1OB3A 4O96A 1Y6BA 4UEUA 3BHHA 4OTDA 2BIYA 2G01A 5HCXA 2YISA 4E26A 2C0IA 2XK3A 3GU7A 3LFBA 4PTCA 3L8XA 5AP0A 5HOAA 4DH1A 4HVHA 3TUBA 4BI1A 3IO7A 3NFFB 3F82A 5GIOE 4FZFB 4RIXA 2C6IA 4TZRA 4ACGA 2HWPA 2FSOX 2HZIA 3QD3A 4I20A 4KS7A 4AT4A 4EHGA 4YHTA 1CMKE 2PVLA 3BYOA 3RHKA 3R7GA 3ORMA 2BFXA 4GT3A 4LRMA 2G1TA 3AC4A 3UQGA 5AADA 3A4OX 3KC3A 4ZZOA 5IQIA 3OCBA 1OUKA 1TQIA 4F63A 4CTBA 2PL0A 3MWUA 4FV1A 3TUCA 4BKZA 2W4KA 3F3ZA 4E3CA 4E4NA 3NYVA 3Q5ZA 3WIGA 5HICA 5AV4A 3G6GA 3SXFA 4Y83A 4H58A 5A46A 4FG8A 3LFCA 4K9YA 4G6LA 4O7SA 2VGOA 2QKRA 3SLSA 1YRPA 3RKBA 5D1JA 1W2DA 3TN8A 4AOIA 1URCA 3DNDA 4ORKA 4IDVA 4RX7A 4EK3A 1WVYA 4L44A 2ZB1A 5IDNA 2C6LA 5HD7A 5BNJA 4EH4A 3OHTA 2OF4A 2ZDTA 1EH4A 1WMKA 3PVUA 4FT9A 4GU6A 3FZRA 4K1BA 4NM5A 4D58A 4V01A 3HV3A 3PP1A 4F70A 4QQTA 3FYJX 1OL6A 2HYYA 3B8QA 2X1NA 5D9HA 5M09A 3SXRA 3NFGB 2PMNX 3WE8A 2J0MB 3ZM9A 5AIRA 3Q5IA 4FV3A 5BMSA 3VIDA 4FVRA 3QHRA 5E1SA 4ANBA 4BYJA 5JGDA 3OZ6A 3BI6A 1MQBA 3VW6A 3CXWA 3ITZA 4I22A 4MXYA 2XS0A 3OW4A 3MVMA 2IEWA 3OCGA 2ZFYA 3N4TA 4D9UA 3W8LA 4FZ7A 3RMFA 5AAFA 4F7JA 5FTGA 4TYIA 1GIHA 2ACXA 2F7EE 2B9IA 2O5KA 2UW5A 1GZNA 5CLPA 3NW7A 2XANA 4FK6A 3R9DA 4BIEA 5AFVA 3VS7A 1G3NA 5B7VA 2XKFA 4XCUA 3VBQA 3OS3A 1XH6A 3L9MA 4CFXA 4IWOA 3KEXA 4R7HA 3EJ1A 5AV1A 3VULA 3LCSA 4MEDA 5ICPA 3IQ7A 3KF7A 1Z57A 2X0QA 2YA9A 2ZM4A 4CZYB 4C4FA 1O6KA 5AP4A 5HHWA 4CG8A 5G6VA 1JQHA 4UV0A 4XP2A 5ETAA 4B99A 4O7LA 4AXDA 2PVHA 1YXUA 1Q8TA 4R7BA 1XMMA 3FYKX 1BMKA 3ZLXA 4I23A 1SM2A 4DGGA 1FOTA 2VWZA 4ZSGA 4JQ8A 3FMMA 2PPQA 4FKWA 2HENA 1VYZA 4EK5A 3QU0A 1JOWB 1Y91A 4J96A 2CMWA 4E73A 1YXTA 3OW3A 3TACA 5FEEA 2QO2A 2X7GA 2BAQA 1BX6A 2W5BA 3ORZA 3P86A 4I6FA 4KA3A 4ERKA 1WZYA 3AC3A 3R1YA 4BDEA 5HX6A 5I9YA 2EB2A 3UZTA 4AXCA 5B2MA 3NWWA 3CC6A 4BB4A 3NGAA 2VWYA 2ZOQA 4YJOA 4FSMA 5CAUA 1OKVA 2C6MA 2QNJA 4GEOA 4DFNA 3OUKA 4BY9E 1QPDA 5EDQA 1JPAA 2F2UA 1YVJA 3P23A 3POZA 5BYLA 2HW6A 5CEIA 4CFWA 3BWFA 2BRBA 5D7VA 4ZS4A 3KRWA 3COKA 5CNOA 2W05A 4L8MA 3HMMA 4CKJA 3Q4TA 3GU4A 3QLGA 3OF0A 5M4CA 2JBOA 4U6RA 3NNUA 5C8MA 5JGAA 2FUMA 3TZ7A 5L6WL 3CPBA 4JRNA 5A4EA 1W0XC 2R2PA 3RAHA 5J79A 2BHHA 3IONA 1Z9XA 4LMNA 4P2KA 4ALWA 4APPA 4R3RA 4CG9A 3GT8A 1JSTA 2ZM3A 4FOCA 1PRYA 5BUIA 1UV5A 3BIZA 5LVOA 1ZMUA 2VWVA 4A9YA 3HZTA 2Z7QA 3NW5A 4FNWA 4AE9A 4BCNA 1CM8A 3SG9A 5ACKA 3SV0A 4TWNA 4AW1A 1UNHA 4UMPA 1H08A 2CGUA 3FAAA 3I0QA 3R2YA 4NM3A 3HKOA 3JY9A 2R7BA 3EWHA 1F5QA 3LW0A 4NFNA 4QPMA 4OTPA 4LRJA 2YIQA 4EOSA 5EKOA 1WCCA 4BI0A 2FYSA 4LFIA 5FP5A 2WGJA 4RJ7A 4TYHA 5C8KA 5DYJA 4CRLA 5IQBA 4BWPA 1WBOA 3BQCA 4GVAA 2PE1A 3U54A 3AD6A 3C51A 4JR3A 4XH6A 5C03A 3BV3A 4U80A 5FG8A 3RVGA 4EOQA 3KXXA 1H0VA 1P5EA 3EN7A 3P79A 4HYHA 4IFCA 5BYZA 3KIOC 4QMZA 2WELA 4XNEA 2WO6A 2IN6A 3ZSIA 2J0KA 4G1WA 4MK0A 2BDJA 5JEBA 4DEGA 3HYHA 3DOGA 5HLPA 2JKOA 3W0OA 4RA5A 5M44A 4IVDA 5ETFA 4FK3A 5JQ5A 5L6OA 4YZ9A 4BKJA 2PVYA 4YLLA 2C5NA 5F4NA 1JKLA 3BU5A 4UMQA 2GNGA 2W0JA 4FIGA 3NEWA 4UXLA 3RM7A 5IUIA 5CEOA 4MXXA 4QO9A 1OPLA 4E7WA 1SVEA 2ITZA 3WE4A 3KXMA 3R6XA 3QRIA 4FNZA 4FYOA 4GYIA 3LLTA 3NNXA 4FNXA 4M0ZA 5EYKA 5FEDA 2R9SA 4K77A 2UZNA 4FKLA 4AP7A 5IF1A 4DG0E 3UC4A 4YTCA 2B9FA 4OTFA 2ITYA 3UBDA 3PTGA 3E64A 2XRUA 5ETIA 3W2CA 3AT4A 2Q0BA 4MBJA 1ND4A 2DUVA 3KU2A 3O96A 1H00A 3MA3A 5FQDC 3OD6X 1XJDA 3W2OA 4BCOA 5HQ0A 3ZZEA 1W83A 3R22A 4YU2A 4FMQA 3QX2A 2P3GX 2OIBA 4YHFA 4JDKA 4W9WA 4ZTQA 3I6UA 3DQWA 2WNTA 2G15A 3E63A 3FV8A 3I1AA 3OP5A 3R71A 3I5NA 3IKAA 3MY1A 4OTGA 3EZVA 4CEGA 4LM5A 2YN8A 2HAKA 2W17A 3EL8A 3LFFA 4YJTA 4XYFA 3V6RA 5E8ZA 4HGTA 2OLCA 2R3GA 3QUDA 5GJFA 2WMRA 3O50A 4D4YA 2PUIA 2QOCA 1BYGA 3MFRA 2O3PA 4FTAA 2BKZA 2C5XA 3VUMA 3FXWA 4AN3A 3UYTA 3ETAA 2R64A 4RVMA 3QD2B 4F1MA 2HY81 4NKAA 4TKSA 1A06A 4JG7A 1YWNA 4FODA 4F4PA 4ASEA 5DT0A 4E6CA 1NA7A 5C4LA 4FKQA 4CNHA 2WXVA 1UA2A 4I5HA 5H3QA 2OXXA 3R7VA 4PMPA 5J9YA 4JQEA 1JNKA 2GPHA 4P5ZA 3UIBA 3UDZA 3VBWA 4D28A 3AOXA 3F2AA 4HW7A 5BVEA 3QCYA 3RALA 1YI3A 5BPYA 3LIJA 1DAYA 2XNEA 2YITA 3FMDA 5JFWA 3U9NA 2OW3A 2C0OA 3ZDUA 2REIA 4OW8A 4DH5A 5EI6A 2A19B 3PPZA 3IOPA 3VO3A 2WQEA 2A2AA 4WG3A 5J7BA 4FC0A 4GK2A 2BDFA 3PFYA 2ITUA 4CLJA 4C4JA 4QNAA 3NCZA 4EL9A 1O6LA 3P08A 1VR2A 2JBPA 4I94A 3R9OA 2QD9A 5IEXA 3LXNA 4FBXA 2BDWA 2XCHA 4RIOA 5C1QB 4ZSAA 5JQ8A 3C5IA 2QG5A 4PTEA 3R7IA 4KKEA 4GJ3A 3HV5A 2E9UA 4C3PA 4ZLZA 4HGLA 1XWSA 4XEYA 2VGPA 5KNJA 4AZTA 3LLAA 1V1KA 4O0UA 4XOYA 3DDQA 1H1WA 5HESA 3TT0A 5DNRA 3TCPA 3VJOA 5CI6A 4AA5A 1R3CA 3T3VA 4I4FA 3IW7A 1HCKA 1NXKA 4UALA 3DZOA 4DC2A 2C69A 2VD5A 3W1FA 4H05A 1RE8A 2A0CX 2B54A 2F49A 2P33A 3CCNA 3IW6A 3N4UA 4TTHB 4QPSA 3I7CA 4IDTA 4FTQA 4KINA 4BN1A 1IA9A 3ZBFA 4ZLYA 2WPAA 3KF4A 5AUWA 2WMUA 2GS2A 3F5XA 3LQ8A 3OFMA 1UKHA 4BDHA 2X2KA 4O91A 4BDCA 4OAVB 3AT3A 4XJ0A 3R02A 4IM0A 2UZLA 1M2RA 4O2PA 5H8GA 4PL4A 5KHXA 4LV7A 2Y4IB 4QP7A 4EI4A 4L46A 2W1ZA 3D7TA 2WMSA 5C01A 3P7CA 4M15A 4FX3A 2XIRA 3ZDIA 4ZMFA 2WTDA 2W4OA 4MCVA 3Q53A 4QMUA 3QWJA 4OUCA 5E90A 4YLKA 4U81A 3BHVA 3D5UA 5L8JA 1APME 2JIIA 2VTPA 5CT7A 5L2IA 3ORPA 4KKHA 3TZMA 2CCHA 3PLAE 5D10A 1ZY4A 2GTNA 2FGIA 5A14A 3FXXA 4FR4A 3ZRMA 4O0VA 2BILB 4K8AA 4ZMEA 2RG6A 2OWBA 3GU6A 3SX9A 4ZY4A 4M7IA 5CASA 3ODYX 2VX3A 4MHAA 5H2UA 5T68A 4BL1A 1QPCA 4DN5A 4BBEA 4EQUA 4J98A 1L8TA 3TDWA 3PA5A 4L52A 4C8BA 5H9BA 2ZMCA 4I24A 4IZ5A 4CFFA 3AKJA 3MH1A 3ZS5A 2GFCA 3G9NA 2R3PA 3KN6A 3QQKA 4KIPA 2G2FA 4CCBA 4EK4A 4JDIA 4CT1A 4IWDA 4R6VA 2Z7RA 4GT4A 4NIFB 4IC8A 1JKTA 4RC2A 3SKCA 3JVRA 3GVUA 3QXOA 1WBPA 1MQ4A 3KULA 4GUEA 5AP3A 3EYGA 3C4CA 4IWQA 2ETMA 5CU0A 1JKKA 1H26A 2UZWE 3D15A 1SNUA 3P0MA 3G15A 5AR8A 3KVXA 2GHMA 4NJ3A 4KRCA 2XKCA 5DH3A 4FTKA 4PQNA 2YM3A 3F5UA 5A3XA 4Y95A 4FT5A 3IDPA 3DFAA 3QX4A 5DWRA 2QCSA 4QQ5A 1J7LA 1SVGA 4R77A 2ZDUA 5IISA 3QRUA 2C68A 3A99A 4Z7GA 3UVPA 3BHUA 4GL9A 2R0IA 3NSZA 1GY3A 2W99B 3AG9A 3TL8A 4O7TA 3VQUA 5J1VA 4QPAA 3OVVA 2R7IA 3MFUA 1YQJA 4J8MA 3VS3A 4AE6A 5HE2A 4CQGA 3WZUA 2AYPA 5LWNA 1TZDA 2F7ZE 2WIPA 4HPTE 4I6LA 4DDIA 5DRDA 2AQXA 3TNIA 4G3FA 2YZAA 3NW6A 4L67A 2UZEA 3FQHA 5TKDA 5K4IA 4CKRA 2YCSA 5E8TA 5AV3A 4DHIB 4TW9A 5I9UA 2BROA 5HZNA 4ZP5A 2WMQA 1Z5MA 1OZ1A 2GTMA 2V55A 2YACA 2JITA 3UNJA 4AA0A 4ZXTA 3R7UA 3WI6A 4BCFA 3KMWA 3NMUF 3UDBA 5JGBA 3V01A 5HG7A 3CY2A 2VO0A 1OMWA 3NYXA 4HYUA 3LFSA 4QTCA 3UO4A 2C3KA 4CFMA 3V5TA 3DKCA 4NKSA 2PVRA 3SA0A 4U45A 3GCUA 3LCOA 4MVFA 4RWLA 5AUXA 5KMJA 4FTIA 4YZNA 5EQPA 3RCDA 3IW4A 3NVKI 4UXQA 3LKMA 2F7XE 2YAKA 4LOOA 4MF1A 5HIDA 2XF0A 3VS6A 4I6BA 3ZM4A 4EEVA 3TG1A 4AU8A 4FICA 4CFNA 2R3QA 4BDBA 4JVGA 1CSNA 1B6CB 1OITA 4FF8A 2XALA 3VBXA 5JFSA 5DPVA 3BEGA 2OH4A 2CLQA 2UW3A 3QRKA 4IVCA 4W4VA 1PXJA 4YBKA 4DITA 3SXSA 4FUXA 4YUQA 5AJQA 4X7QA 4HNIA 4ZZNA 4FEUA 2R3MA 2RF9A 4C38A 5AAEA 2WMAA 1OM1A 4MNEB 3QZHA 5ANIA 1PW2A 4DGNA 4G5PA 4AXEA 2GU8A 4MTAA 2CN5A 4O0WA 3RPVA 3SRVB 4BJJA 2YCFA 3IK3A 2Z60A 3JUHA 3VNTA 4A7CA 4F99A 3E8DA 3L1SA 2OF2A 4ZTLA 3F7WA 3S4QA 3T8OA 3BLHA 3GB2A 4FV4A 4XLIA 4CVAA 1VLRA 4O7WA 5FUTA 4FEXA 2E2BA 3PY1A 2GMXA 2QOFA 3G5DA 4AOTA 4AW0A 5CANA 3C0IA 3D14A 3BL9A 4CSVA 5FM3A 2X8DA 5KMKA 3ZFMA 1A9UA 3FMKA 3R21A 5CQWA 3TZ8A 4C2WA 4M67A 3OG7A 2WQNA 5CTPA 4H1MA 4F9AA 4A9TA 1UU8A 3AQVA 4FZ6A 5LVNA 4U0IA 1ZRZA 4HCUA 1FVRA 3MVLA 4FV6A 4FTJA 5A4LA 4YTFA 4EONA 2JDSA 1F0QA 3UDSA 1JSUA 5BVFA 4RA4A 3QQJA 3UGCA 2PU8A 2HIWA 4TT7A 3ULZA 3QFVA 3LXKA 3CTQA 5F1ZA 4JBQA 4AZWA 3OCSA 4EWHA 4YO4A 2OKRA 4D5HA 3F5PA 3PVGA 5CT0A 3UNKA 3SGCA 5LMKA 4TWOA 3DTWA 5K0KA 4BDFA 3OBJA 3UODA 3HEGA 3P78A 3Q6WA 2ESMA 5IUHA 1RDQE 3BGPA 5EM7A 1A48A 3PXKA 5AWMA 1HOWA 4AT3A 3Q9WA 4WD5A 4IHPA 4UWBA 5FM2A 4FT0A 3JPVA 4UWCA 4WRSA 4FA2A 1Q8UA 3FZPA 1BL6A 4WNMA 1ST4A 5GINE 2ONLC 1JAMA 4BWKA 2YM5A 4FTUA 2J0LA 3ANQA 4F9BA 3Q04A 3KN5A 1NVRA 3H9FA 4G31A 2IWIA 4FKIA 2UZDA 4QYYA 4FT3A 4JIAA 4RSSA 4DINA 1MUOA 4IAAA 2R3FA 2WB8A 3CQWA 1P14A 4EOLA 5HBHA 4F6UA 2QODA 4TWPA 2DYLA 1V0OA 3F3WA 3N4VA 3PLSA 2J0JA 3R8UA 5HVJA 1H1PA 3MN3A 3DAEA 4GW8A 2VTNA 3LHJA 3CJGA 3BWJA 3VRYA 3ACKA 4D4VA 3HV7A 4G6NA 3A62A 5HLWA 4CMTA 3HX4A 2C6KA 3U87A 2R5TA 3NYNA 5JZJA 1ZOEA 2W9ZB 5CALA 1QPEA 4TYEA 2WOUA 3IW5A 3MY5A 2VO3A 2KTYA 3E8NA 3EFLA 2NYAA 4YGAA 4TNBA 5ANEA 5KZ0A 4O86A 2PZRA 2ITPA 2UUEA 2R3NA 2FSTX 3QYZA 4JDHA 1ATPE 2HW7A 2BZIB 4L68A 4IXPA 3TMOA 3QL8A 4ITIA 3LZBA 3U55A 1PXPA 3A4PA 3HV6A 4ANNA 4QP4A 5HGIA 3U6JA 3FZ1A 3UG2A 2QVSE 4YZCA 3F61A 3OY1A 4XP3A 3W2QA 4UZHA 2AUHA 2PE2A 3GBZA 3JVSA 4F9CA 4NM7A 4RZWA 5J95A 4HGEA 3I6WA 3PUPA 1JSVA 4I5PA 3V5QA 3VUGA 4A4XA 4D4SA 1KV2A 3EFJA 3KRRA 3LMHA 4GKHA 3MFSA 1W2CA 3UIXA 2UZOA 1H27A 3AC2A 3B8RA 3GQIA 3HVCA 3W2SA 5HU9A 1IAJA 4JMQA 4QMXA 3WIKA 1YKRA 1ERKA 5FXRA 3FI3A 4O0RA 3NIEA 4ALVA 5KKRC 3ZRLA 4C34A 4M68A 2OXDA 4ACMA 2I7QA 3LQ5A 3MVJA 3QKLA 4U43A 2RL5A 2VUWA 3M1SA 3UNZA 1G8SA 3AKLA 2J4ZA 5EHYA 1YWVA 4E4LA 2EXCX 1OECA 3F2RA 5ANGA 5KHWA 3GC7A 4N6YA 2H34A 4II5A 3FY0A 2GQGA 1VYWA 4BCIA 3QF9A 3EYHA 4FI1A 4FG7A 2CDZA 3DLZA 1W8CA 4DBNA 5CU2A 1QMZA 3VC4A 4KBCA 3W55A 1OL7A 4S30A 3KQ7A 4QMLA 5IA3A 4WBBB 5FXQA 4HCTA 3GFWA 4JR7A 4U8ZA 5I9VA 2VWXA 4OTQA 3C0GA 4WSQA 3SQQA 4IB5A 4LGHA 5IQEA 4IZYA 3PSDA 4CZUA 4BF2A 1AQ1A 3HNGA 4O27B 1PMUA 5I4NA 5KMLA 4P90A 4KB8A 1FGIA 3MESA 1YI6A 2G9XA 2JD5A 2I0EA 4GV1A 4C2VA 2PULA 5DFPA 2AC5A 2PSQA 2XEYA 3PIXA 4BCMA 2BMCA 4BR3A 4WRGA 3A2CA 5DE2A 2WMTA 4XV1A 3T3UA 2VTLA 4FIJA 5KMOA 2VWWA 4I41A 1YHVA 2ITTA 4ZTRA 4C3FA 4F7SA 2O2UA 3FKOA 3BBTB 4LL5A 4YJPA 1GIIA 2IPXA 3QBNA 3MPMA 3TV4A 1P4FA 4MUQA 4ZSEA 4OGRA 3LMGA 5AP1A 4ASDA 3GUBA 4LL0A 3ORKA 5C26A 3HDNA 4FTMA 2YAAA 3IG7A 4CT2A 5HORA 5CVGA 2JIUA 4QT1A 2QU5A 3EH9A 3QTUA 4LYNA 1PF8A 3PXZA 2WHBA 2Z7SA 2QOBA 3PXRA 5LVPA 3FL5A 5K0XA 3DA6A 5CEMA 5M51A 3I60A 3FEGA 2B52A 1Q3DA 3MPTA 1FMKA 2OBJA 5AMNA 4QTDA 3NUSA 2NPQA 4DFUA 3RNYA 3ML1A 4CZTA 3DJ6A 1J3HA 4XRJA 3QUEA 4L01A 2RG5A 4YNOA 1ZZ2A 3V8TA 3JXWA 5EM8A 4G5JA 2BRHA 5FBNC 4JIKA 4RG0A 2FSLX 1B39A 2PTKA 1J7UA 4FEWA 3FSKA 3C4XA 5DI1A 3C5UA 3COIA 3S2PA 3A7FA 3C13A 4FEQA 2BKKA 3FBVA 2NRUA 4I5MA 4RPVA 3F3UA 4JX3A 2YM6A 5AP5A 4B6LA 5E92A 4IC7A 1W84A 1NVSA 5JKGA 5JT2A 2PWLA 5J8IA 5LMBA 1TQMA 5EOLA 3IDBA 4EOOA 1SNXA 2IZTA 3QD0A 4J95A 3W18A 4L42A 4A06A 1GZOA 2EXMA 2R3OA 3MIYA 4C02A 1JKSA 1TQPA 5HTBA 4K33A 4WBOA 3OROA 5CY3A 4EYMA 5AM7A 4BIDA 4QQJA 4G3DA 3LE6A 3M42A 3GCSA 1U59A 3FWQA 2V5QA 5HX8A 4FTLA 3ZONA 3V8SA 2EXEA 4U3YA 3NAYA 5E91A 4GCJA 4BTKA 5GIPE 3JS2A 4C61A 2I0VA 3K3IA 3D83A 3ELJA 4XHKB 4ENYA 4Y85A 3EQIA 1Q8ZA 4Y5QA 4G3EA 4AWIA 3PXFA 1WVXA 3NUYA 1SZMA 4I3ZA 2OFUA 4R5SA 4YNEA 3WZDA 3Q2JA 3V5PA 1PXKA 1KV1A 3PG3A 2ZM1A 4PDSA 2XZSA 2RSVA 3PWDA 4BCJA 3H0ZA 4IZAA 2YABA 5CZHA 4DHFA 2VTMA 4AACA 4OTRA 3WF9A 1VZOA 1ZZLA 2BCJA 5E9EA 2RFNA 3C4ZA 3TTIA 3U4UA 3BYUA 2QO7A 4FSZA 3TXOA 2YWVA 2X2LA 4PPCA 1WBWA 2XCKA 3KXHA 3QA8A 5IKWA 4AFJA 4PRJA 4JJRA 1CKPA 3Q52A 5A9UA 3K5UA 4DG2E 2WD1A 3FPQA 2C6OA 4BZDA 3DY7A 4FTCA 3UOJA 4L45A 3PIYA 3II5A 3QTXA 4HYIA