4BB5A

Free-wilson and structural approaches to co-optimising human and rodent isoform potency for 11b-hydroxysteroid dehydrogenase type 1 11b-hsd1 inhibitors
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
263
structure length
263
Chain Sequence
b'FRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPLVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPSRKILEELYSTSYNMDRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
publication title Free-Wilson and Structural Approaches to Co-Optimising Human and Rodent Isoform Potency for 11Beta-Hydroxysteroid Dehydrogenase Type 1 (11Beta-Hsd1) Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 98
structure length 263
sequence length 263
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4bb5A00
4OJNA 3W8DA 1I10A 4E32A 5F1OA 2PZJA 4DBZA 1J0XO 3IUPA 4IMRA 4BNXA 3GH3A 3H7AA 3E82A 4FS3A 1ORRA 1PJSA 2PKQP 3WG9A 1EQUA 3KSUA 3O8QA 1NVMB 1P44A 3L4SO 5A03A 3PYMA 3UCFA 4XGNA 1ZW1A 1T1RA 3UXYA 4BNKA 1PJ3A 2EKQA 3MJVA 1WMAA 2E82A 2EGHA 1S6YA 4YTEA 4CMBA 1E1NA 3OEYA 3AW9A 4L4RA 1Q0QA 5TLSA 3PJFA 1RWBA 1T4BA 4NZ9A 3V8BA 1NWCA 5DCYA 3KM0A 3LVFO 4J1SA 4KTVE 6ADHA 3ZNPA 2P4QA 5CG1A 1QYCA 3PHIA 4OOEA 1AUPA 2HCTA 4IDBA 1PJBA 1XELA 2EP5A 1IPEA 2BELA 3GVIA 1SMKA 4DYDA 5TJHA 4XKJA 2VCYA 2BGMA 5AVOA 4YJHA 3ETEA 1ISIA 5G0WA 1U3VA 3I9MA 1YB1A 1D7OA 4ND4A 4HWKA 5F3RA 1KEPA 3ZHXA 3NX4A 5KJCA 4FOOA 3NRCA 1NPDA 4Q3BA 2YYYA 1W8DA 4D0RA 5H83A 2FSVA 2NQ8A 2C2XA 2B36A 4L75A 2G76A 4P38A 3IJPA 1P74A 3PXXA 4CJXA 1HE3A 3PJEA 1VL6A 3OSUA 4ND5A 3UOGA 2O7SA 1I5RA 3TOXA 4FFRA 2HDHA 4KDEA 3V1TC 4NJOA 4RVHA 2CVOA 3TRIA 3FWNA 1I30A 1Q7CA 4IDFA 1YONA 1MG5A 1X0XA 3DDNA 1I8TA 4RVDA 3ENNA 4PLYA 4F46A 4IBOA 2B83A 2XOXA 4ALIA 2QRJA 1VSUA 3RUDA 1LA2A 1WZEA 1LNQA 2OUIA 2AEMA 1NQAO 1NHGA 3KEOA 4IQ0A 3U5TA 4EGFA 1MFPA 3WXBA 1KYQA 1WLYA 2X8LA 3KRTA 4XR9A 2PTGA 3DHNA 2YHIA 1MUUA 1JQBA 1WW8A 2EHDA 1QYWA 4CQMB 4TRRA 1EQ2A 3K9QO 2I6TA 4D3FA 4WOKA 4B3IA 1MV8A 3D5TA 3DR3A 3KLMX 4E13A 4YT4A 2FN7A 3F3SA 3JQ8B 4Z9YA 1HYEA 4Q9NA 3ZWNA 4DC1A 2P68A 4DPKA 4XIJA 2VYVA 3E5MA 5COAA 2CDAA 2C7VA 4E2XA 4ZGWA 2ZQZA 5EESA 1NP3A 1FXSA 1UXIA 3I3OA 1I3NA 1KETA 5DULA 3DZHA 2VYND 2Q1SA 1YOVA 1EUCA 3R6DA 1TVEA 1VJ1A 4E3ZA 2X86A 3I4CA 1YGYA 2FR1A 4LN1A 3ZNNA 3OEWA 4ILKA 4OXNA 2O3SA 4JXKA 4B4VA 5I7VA 3QLJA 1JDJA 2HMWA 1T2AA 3DC2A 1EBFA 3G1TA 4MVJM 3KOUA 3UUWA 3DZFA 1LTHR 4CMIB 3FBTA 4RVGA 4F45A 4A2CA 5IJZA 4D45A 3JQ7A 5IN4A 3PDUA 2J5RA 5JMWA 2GSDA 2GN8A 1HDCA 4YAIA 1NBOA 1OC2A 1YL5A 1HTBA 2ZTUA 1ISHA 3BTSA 1ADCA 1DJNA 5GMOA 1E7RA 4S1VA 3G17A 3LLSA 3I1JA 3JTMA 4Y8VA 3GG2A 3SLGA 4A10A 1OC4A 3FHLA 1E6WA 4PLPA 3D0OA 3JD4A 3SLKA 5JC8A 4R54A 2GDZA 1LDBA 1F14A 2WM3A 4NH4A 3IL2A 3WFJA 3QVTA 4MOWA 3BMCB 2CNBA 1D8AA 4NBVA 3JCZA 1BDBA 2OORA 4I08A 4IGEA 1OI7A 2ILTA 4WLVA 3LQFA 1TI7A 4DBVO 5A04A 4XR4A 2CD9A 4NNJA 2ZB7A 2CDCA 3WGIA 1WVGA 3WLFA 3C7CB 3DB2A 5T57A 4GH5A 4YB8A 1VJTA 4URFA 1C0KA 1I0ZA 2Y66A 4ND3A 1N9GA 3FPLA 1RPNA 3BAZA 4DWVA 5IZCC 4K6CA 1EUDA 1TT5B 3WGOA 4DC0A 4MKZA 4HFMA 4PLFA 3V2UA 4JX8A 4BV8A 2X7HA 4QXMA 3KLPX 4XYMA 1GV0A 3JD1A 4L4SA 2C59A 3RBVA 3SVTA 3ZWAA 4RVSA 3QWHA 2AMFA 1E7MA 1QMGA 1O89A 4KOAA 3AU8A 3KYCA 4OM8A 4ZQEA 3B1FA 1QV6A 3VPHA 1GQ2A 4MKRA 5GY7A 1IE3A 1ULSA 4BO3A 3WGYA 3R0IA 1PJLA 3AM3A 2P5UA 4M8SA 4PLCA 1G6KA 3AUAA 3WQQA 2X5JO 4IGFA 3DBHA 4PG7A 4J4TA 1AHHA 3FNEA 3ZWXA 1HL3A 5ER9A 3I5MA 4NFHA 1DC5A 2PWZA 4EEZA 1Z7EA 4TKLA 4CM3A 1SC6A 5HRUA 3L0DA 3ZWCA 1M2WA 3NDRA 2RBEA 2IODA 1SB8A 1NQ5A 4OHUA 2VNAA 5JY1A 2QX7A 3ONEA 2VHXA 5DBFA 1D4FA 1TEHA 4NHEA 2CUKA 4XYLA 3PVZA 1AN9A 4R9RA 1R4MA 2B69A 3WWYA 1PJCA 2J6IA 1WDLA 2YY7A 5THKA 4BNFA 2EJVA 3ZWYA 1B2LA 1YQGA 3TL3A 2BI7A 3PFFA 1LLDA 4QO7A 1M67A 4TRNA 1E3WA 4DIFA 1BVRA 4DREA 3Q0EA 3H3JA 4K6FA 3QVSA 1A27A 1VI2A 1FF9A 4J7CA 4N18A 2PH3A 4JK3A 1MA0A 3MTGA 5KVSA 1GTMA 2AE1A 1LDEA 1HLDA 2DVMA 4R9SA 5CDSA 3RCBA 1P33A 2J3JA 3D3WA 2R2GA 3I9JA 4JBHA 1P9LA 1RJWA 1IHYA 1C1XB 4S3MA 3GFBA 1QRRA 3L4BA 4FW8A 2YJZA 3TZHA 3DL2A 4J1QA 3MOGA 3P2YA 2D5CA 2BFAA 3U62A 3WGZA 4J91A 3UFXA 1KVQA 2WYWA 1VLLA 2ZB4A 4BGVA 1EE9A 1NFRA 2Y1FA 3WIEA 4J4BA 3BMOB 1HE5A 1PZEA 1W4ZA 4RPHA 3AI2A 4NI5A 4QFDA 4GX2A 1H2HA 4Q3AA 3JQAB 4WLEA 4RVFA 4DTIA 3NJ8A 5JAMA 1XHLA 4GSKA 4YAEA 1PZFA 1UZMA 1Z6ZA 3GT0A 4GKVA 4F6CA 4ZICA 4RPGA 5B1YA 5IDXA 2G5CA 1QR6A 4IIUA 1DRVA 1Y8QB 4ZQBA 1C1DB 2VN8A 1X15A 4K26A 4UULA 3RFXA 3WBFA 3D64A 3HHPA 3ITDA 4BS9A 3QWIA 3PYXA 4CMAA 5DN9A 4J7UA 5L45A 4Y6RA 1MLDA 1K6IA 4IDCA 3RU9A 5I9MA 4J2HA 1N2SA 3DXFA 5COBA 2C7GA 2OP0A 3F5QA 4BQRA 4AL4A 4MP3A 1BHSA 4NQZA 4DQVA 4ZN6A 1DIBA 1H6AA 4LSWA 3PDJA 3O03A 1NVGA 3HZZA 3RASA 3X2EA 2O50A 5TX7A 1PSDA 3HG7A 5ENVA 2ZYDA 3EVNA 1U2GA 2AQHA 3F4BA 3JQGB 3ROMA 3WYBA 2NU9A 2RHCA 3ZH2A 1FJHA 1SPXA 1MG0A 1NWHA 2A9FA 4B8WA 5IFLA 1TB4A 4U5QA 2BMAA 3E9QA 3HWRA 1KS9A 3GGPA 1L1FA 2VUUA 5IAAA 4HNHA 4GL4A 1MGOA 3GNQA 3JSAA 4D42A 3PZRA 2W2KA 4HFJA 4PZEA 1PJQA 3NTOA 4U7WA 2OZPA 1NX6A 3JQEA 4ALNA 3WYCA 1KEWA 4XZ3A 1SAYA 3D5QA 2HRZA 1K89A 1WNTA 2ZJ0A 1CETA 4IDGA 4J9VA 4XYGA 1HLPA 4RJTA 2GN6A 1R4MB 1T4DA 4HY3A 2O4UX 3VAZA 1P1KA 1JVBA 4BL5A 2FPIA 3DOCA 2Y1OA 3M2TA 3E9MA 2DT5A 3CE6A 4AG3A 2BFOA 1XG5A 4XWYA 1Y6JA 3BYZA 4W7HA 4LMRA 3HDQA 3I9LA 3GLQA 5IXYA 1EVYA 2Y05A 1NFQA 1SEPA 1HDRA 1T2FA 1ISGA 2AHRA 1DC4A 1DPGA 1U8FO 3NDJA 1GDHA 1B7GO 5TJ9A 2FHSA 2W90A 3LLVA 2JKVA 3INRA 3NT2A 3ZNOA 1GPJA 3QJ5A 2VYNA 4IQGA 2D5AA 1C0PA 2HSDA 3PIDA 2EXXA 2G82A 1SOVA 2PGJA 5C37A 3E03A 1J5PA 1EK5A 3M1AA 5BNTA 1PJ2A 4HFRA 2JFFA 3OJEA 3AY6A 3C8MA 1DIAA 4WLFA 1LDMA 4WNCA 4A03A 2CDBA 1QLHA 3D1LA 3ZWBA 1BXKA 2W2LD 4CODB 1V8BA 4A27A 4K9DA 4R1TA 2P4HX 4RF2A 2H63A 1HSOA 1GEGA 4YJGB 1OMOA 1MFZA 1A7KA 4E6PA 1EDZA 4HV4A 4A73A 2B4RO 1F8FA 1ZXLA 3AM5A 1HXHA 1UAYA 4IJUA 2G1UA 4YJFB 9LDTA 1LRLA 3HADA 5L4SA 4FFNA 3L9XA 3GHYA 1R16A 2GASA 3ETDA 3V2HA 5HWSA 3GN2A 2WE8A 4KMSA 5TF4A 4UEKA 4GPD1 1I01A 3S2FA 2A4KA 3ICPA 4R3WA 2F00A 1EBUA 5JO0A 4P22A 4YACA 3VVBA 1D1TA 4I9NA 2YV2A 4BMNA 5B4TA 3ZI0A 2Q2QA 5DOVA 1F8GA 3ZWMA 2FZEA 2FZWA 4PG6A 1NPTO 1XQ6A 1L7DA 3WWZA 3BTVA 2DKNA 2OMEA 1ONNA 2VUSA 1EUZA 3U4HA 3DAFA 2X4GA 1SB9A 3CH6A 2ZYAA 4KQXA 3UH1A 3KB6A 5KVCA 1VL0A 1GEEA 4KDFA 3VKVA 3EHEA 2TMGA 3DOJA 5AXDA 3A9WA 3ANMA 3RSHA 2X5KO 3PWKA 4GI2A 4J6FA 4D3SA 1N1GA 3IIEA 7ADHA 1H0KA 4C4OA 3FCOA 1NASA 3ST7A 2GF2A 4IMPA 4Q3NA 3VHRA 3MJEA 5LCXA 1WZIA 3KTDA 2GR9A 2C29D 2JCYA 3PTZA 5DT9A 1CF2O 2VQ3A 2EW2A 3A1NA 3QE3A 1ADGA 1QXSA 4TVOA 2LDBA 4CM9D 3IS3A 1PL7A 2FPGA 3FTNA 3CPSA 5T64A 5KTKA 2WDZA 2FY8A 4XQCA 1GY8A 3ZU2A 4NG5A 3RWBA 1HT0A 1X7HA 1CDOA 4E21A 4LGVA 3OFSA 3U4DA 4IDEA 3E5RA 1LI4A 3GMSA 2PD3A 3H9EO 3OH8A 1PQUA 3PK0A 4OH1A 1JTVA 2V65A 4YRAA 3D3EA 1QLJA 3RD5A 3VDRA 3ZHZA 2ET6A 4JIGA 4QECA 3GRKA 3NEPX 4R1SA 2HJSA 2VOJA 3WS7A 3IP3A 5DP2A 3AUTA 4N5LA 4PG4A 4I8XA 4U8GA 1KERA 4OL9A 2YUTA 3H9GA 5A06A 1E1KA 4AJHA 4DYVA 4ONEA 2CSUA 2YW9A 4ZQFA 2GYYA 4WCFA 3AI1A 5DCUA 1B8UA 2I3GA 1Z82A 1CWUA 4J90A 4P4NA 4AJEA 5BQFA 1DXYA 4YQZA 1V3TA 1WPQA 4LK3A 4YT8A 1ISFA 2QQ5A 4NJMB 3WFIA 3MJ4A 1XLTA 4Y67A 3T7CA 2O2YA 4GLOA 4XD2A 1M76A 3NJ4A 1DFGA 3ZU4A 1E7WA 1EMDA 3AFNA 1PGQA 1S7CA 4KUEA 4XA8A 4CM8A 1E5QA 1YQXA 3ZV6A 3WOHA 1YBVA 4XJTA 1GQYA 3COSA 4Q3EA 2F1KA 4JBIA 1I32A 2NLOA 2JCXA 4BO7A 2D8AA 2UV8A 5KVVA 3JYNA 4XEHA 5KJFA 3UCEA 5KWEA 2DPHA 1O95A 1K3TA 1PTJA 3ABIA 4JBGA 3PEFA 3LSYA 2PGDA 3IQDB 2BRUA 1R37A 1I24A 1NTOA 3JYOA 3H3FA 5IZ4A 1E7SA 2IZ0A 4EI2A 5FEUA 5JDIA 4P4GA 4IZIA 4PLZA 1U1IA 4FGWA 2IZ1A 4NBRA 4OSOA 3OHSX 3N7UA 3GUYA 3AM4A 1YVEI 1O0SA 4NBWA 2VZ0A 3AI3A 1PR3A 4GQAA 3K92A 5JSFA 2DU8A 3KYDB 4J43A 1PEDA 4HXYA 3WJAA 2EIHA 1P1RA 4OO3A 1DC6A 3L6EA 2OGUA 1P45A 3QSGA 4IS2A 3H65A 1VRWA 3HE3A 3PHLA 3WIDA 4L8VA 5TNXA 4KUGA 4XYBA 3JYQA 4PZDA 5THQA 2WSBA 5L7WA 2B5WA 2JAPA 4GKBA 5BNIA 3L4BC 4FJ2A 4MPDA 3AWDA 3S2GA 4CM1A 1JWAB 3IOYA 1MX3A 2IEDA 4BO4A 3PHGA 5KKCA 1R4NA 2O23A 3B6ZA 3S1LA 4BO1A 1ADBA 2A94A 4TQGA 3KSDO 3C1AA 3VPGA 3H9UA 4TZTA 1NQTA 4D41A 4MVJD 3CXRA 2JD1A 4U0KA 2VUTA 1C0IA 2D4AA 3VC7A 1OOEA 2UVDA 3GAZA 1BG6A 1UZNA 1B26A 3SC6A 1LSJA 2NU6A 5F1KA 4LRSB 4CQLA 1N7HA 1NXQA 1X0VA 3ZV5A 5TT1A 4WK6A 4IDDA 5TQVA 3RUFA 4I5EA 2IYPA 2Q2WA 3G49A 1U5CA 5FI5A 4DMLA 3LT1A 3EGOA 5T8KA 1K6XA 4PLTA 4D44A 3ZGYA 3LT4A 1KVRA 3CSDA 4D46A 2P9EA 1T1SA 2ZYGA 1TLTA 4K1LA 4NIMA 5A3VA 4BGEA 6LDHA 1UAGA 2A35A 4YRBA 1QG6A 4TRMA 1GADO 3PIIA 3AJRA 3GNSA 3HDYA 4WEQA 4FBGA 3U9LA 7MDHA 2EV9A 3DBRA 2JHGA 2WYVA 4DIBA 2CF5A 3WSWA 4TROA 1IHXA 4YBZA 4CLRA 1P0FA 2YDXA 1YL6A 1QV7A 3DO5A 1PJTA 2ZIZA 2BH9A 1I3MA 1HYGA 3AUSA 1DHRA 2RIRA 4Y98A 2X0RA 2Y1DA 4DRYA 5DCWA 3JV7A 2UYYA 3JD3A 1CEQA 1PX0A 1Y8RA 3DBVO 1HEUA 4GAEA 4RDHA 5DF1A 4BNVA 5C7LO 4CM5A 2HKIA 2C82A 3W6UA 5CFZA 4J4HA 1YS4A 3BMQA 1EVIA 2NV6A 2W2LA 3L77A 5JDCA 2CFCA 3KEQA 2I67A 1E3LA 4OYRA 1O94A 3TWOA 1GQQA 1ZNQO 4UREA 3GVCA 4HX5A 4BUCA 1FMCA 4R3NA 4CMGA 1RM3A 1TA4A 2PLAA 1P1FA 4AJOA 1RYDA 1IOLA 4L74A 4BV9A 3LC7O 4MVJG 4RF3A 4RQTA 4TWRA 3MCVA 2WEKA 1SEVA 4MO2A 5EPOA 3DAGA 4E0BA 4P4LA 4XYEA 2TMDA 1QYDA 4UVGA 3ROKA 3O8QB 4YJDA 4UVEA 3ZZNA 3UAGA 3E48A 4FJ1A 1U7TA 1UXGA 2HMVA 4J0FA 2HRBA 3TOZA 5A9RA 3TNLA 2IEBA 1PQPA 4NK5A 1KY4A 5A9SA 1ZMTA 4KQWA 2V6GA 5L4LA 1H6BA 1HDYA 3QRWA 1J49A 4CMEC 2VRCA 1MC5A 2Q1WA 1OFGA 4JLWA 5BSFA 3RUCA 1H6DA 4TSKA 3GPIA 2PD6A 3ROQA 3SC4A 4XCVA 4DPMA 2PY6A 2Y0CA 3I6QA 4LRTB 5FI3A 2W4QA 3I9OA 4XGIA 2HJRA 2Y67A 1LDNA 1ZK2A 2PKQO 3JQ9C 2IXAA 3QIVA 4AICA 4YJHB 5IF3A 3GZNA 4O63O 2Y1EA 3GAFA 1NNUA 3ZWOA 4PG8A 4Z9XA 1B0AA 4WCDA 5KNLA 3DZKA 1A4UA 3AK4A 1MC4A 5IXSA 4NR0A 3ETGA 1DBVO 3EZLA 5L51A 4FDAA 3CINA 1Y5RA 2I99A 1FDVA 5U4QA 2I76A 3OM9A 4RO0A 3F9IA 2GERA 3HDHA 3S2IA 4BKOA 4CM9A 3RUIA 3A14A 3OJ0A 1EFKA 1ML3A 1PR9A 2WD7A 1KC1A 5COQA 3QVOA 4FFMA 4YA6A 1KEVA 3DMTA 3JD2A 4LVUA 2C2YA 3X2FA 4R51A 1Z7BA 4IQ8A 1P77A 1RYEA 2WMDA 3EDMA 5ILOA 3A28A 3ADPA 4ALJA 3DBRB 2B35A 4J0EA 3OECA 1F0YA 3MWEB 3OIFA 4FQ8A 4FCCA 3FRJA 3RJ9A 4BMSA 1MXFA 4XQEA 5CPBA 4PLHA 3RI3A 3Q9UA 3QVXA 4ZHSA 5F5NA 4N7RA 2RH8A 4BGUA 5GZ6A 5AXAA 4H3VA 3AU9A 5EQFA 1L7EA 5L7YA 2YHIB 1GUFA 4WJZA 3C85A 4O6VA 4YEDA 8LDHA 4HBGA 1XIVA 5JYEA 4IXWA 1PJ4A 1M75A 1V6AA 1ZJYA 5T67A 1LU9A 3ICCA 4ZQGA 3VH3A 2XAAA 1VSVA 3K6JA 1R0LA 2IXBA 1JA9A 1XA0A 2DM6A 1GUYA 4BOYA 5G4LA 3TZCA 4TRJA 3VZSA 2O3JA 3JQDA 4E12A 2O3QA 2P9GA 1XU7A 1WXDA 3EY4A 3UICA 4IM7A 4QFCA 3ZHYA 1U9JA 1BXZA 1A5ZA 4KWIA 3F1KA 4XB1A 3Q6IA 4GMGA 1G0NA 1YOVB 1JAXA 3WNQA 3DOOA 4C7KA 3IC5A 2J3HA 2NU8A 4E31A 1T2EA 2CMDA 4M54A 4W7IA 3DTTA 3VPFA 3W4KA 1PGNA 2PR2A 3K96A 4E2WA 4WGGA 1H9BA 4DQXA 3H4VA 2AQIA 2QZZA 4R68A 3WTCA 4AJ2A 5CEEA 5IN5A 2C0CA 1HDXA 2PZMA 2IE0A 3KUXA 4LCJA 2ZCUA 1R15A 4XB2A 1OBFO 4BKUA 4WCFC 3VTFA 2Q46A 2ZK7A 3JQ7B 4J1TA 1KOLA 1YE3A 1N92A 4BHTA 1GYRA 3CIFA 5A9TA 3QV1A 1DAPA 2Q99A 4LMPA 5F5LA 1PS9A 2YV1A 2VWHA 1YH3A 3GEGA 5CEJA 4AJ4A 2ZKLA 4WLNA 4GVXA 3ASUA 2WD8A 3ADOA 4NDNE 4YR9A 4MIOA 4U6QA 4XRRA 3C1OA 1VJ0A 5TC4A 4CPDA 2Q4BA 4KZPA 1Y9AA 1FK8A 5HA5A 4TKMA 1YB4A 3W4IA 5JY6A 3H9JA 2QRKA 3Q1LA 3NGLA 3RFVA 1A7AA 2Q4EA 3CMCO 4CLOA 2AEJA 2DQ4A 2GCGA 4JJIA 1ISJA 5I7FA 1E3JA 1ZKMA 5JCJD 5A02A 1HWYA 4JP2A 3N74A 4MVJA 2RCYA 4CQMD 2WD7B 2NUAA 1UXKA 1N9GB 3VZRA 3GVHA 4N5MA 3PRJA 5JDIC 3BMNA 4Q3CA 5G4KA 1NAIA 4CMKA 4PLGA 1UR5A 2X9VA 5CPFA 2AQ8A 2QG4A 3PQEA 5JPIA 5IDWA 2NU7A 3DQPA 4NFYA 3AOEA 2GLXA 1YQDA 1PU2A 2BKAA 3K2EA 4YT5A 5L95A 3EC7A 1H93A 2NVBA 3BHJA 3ZDFA 1PQWA 4I5GA 2NACA 3KYCB 4W82A 3VZQA 1UH5A 1PL8A 5KJ1A 1DLIA 5U1PA 1D1SA 5T6BA 1XEAA 4LSMA 1R0SA 5BNFA 1NPYA 2IRWA 4XX0A 2IDZA 3B1JA 1DOHA 2CVZA 2UUPA 4KP7A 4UUPA 2HMTA 2O3RA 2X22A 3DBHB 1B8VA 4AJNA 1JKIA 1O6ZA 3UHAA 4QTZA 3TFOA 1U28A 1W6UA 5I8ZA 2D59A 2AE2A 3G3EA 3QHAA 5CDYA 3EUWA 1CQIA 3FSRA 5AQ1A 2Y0DA 3NGXA 4YVFA 3IDSA 2O4CA 4NMHA 3BTOA 1EFLA 2NNLD 1HE2A 3ZV3A 3NT5A 1A9YA 1UJMA 3U0BA 2XF8A 3DBLA 2B0JA 3C7DB 3NTRA 1Q7GA 4RZIA 2ZB8A 2FP4A 1A71A 3V2GA 2J3IA 4INAA 5FFFA 4II3A 4BO0A 5I8WA 1K0UA 3OJLA 1PS0A 1XCBA 5K9ZA 4BKPA 1M6HA 5T8KC 1E3WB 4R5MA 3RBXA 2Q3EA 3P7MA 4HKTA 2OL4A 1Q0HA 4OAQA 4HNGA 1KBZA 3E9NA 4XDZA 5ER6A 1LQTA 1NR1A 3PWZA 2EW8A 2JFGA 5CEFA 1VL8A 3LC2O 1T26A 5FYDA 3K73O 3OBBA 1U3WA 2PK3A 2QYTA 2GGSA 3RUAA 2FR0A 1DFHA 3D3WB 4IZHA 1XQ1A 1JAYA 2NVUA 4GX0A 1A9ZA 4NPCA 1BGVA 1DO8A 1WDKA 1U4SA 1UXHA 2VOEA 3QP9A 2H6EA 1XSEA 4CUZA 5HS4A 4D7AA 3GVXA 3HFSA 5AOVA 2WE7A 4NFSA 5TT0A 4GX5A 5JCXA 2GNAA 1SBYA 1ZK4A 4Y6SA 5DNAA 3FR8A 1NHWA 2Y68A 3TN7A 3BHMA 1LBEA 1JVSA 4O5OA 1SCUA 1OAAA 5G0UA 2NTVA 2SCUA 4BQPA 5TGDA 4RCVA 1T2CA 5JE8A 3JYLA 5JDCC 3S2EA 3IP1A 5BSGA 4W6ZA 3VH4A 2NTNA 2DAPA 3UCXA 2BLLA 1UZLA 5KJEA 2V6BA 4BKRA 1H9AA 2E48A 3DFUA 2DFDA 4QT0A 4YPOA 1ZFNA 3U09A 2EJWA 2VHYA 3A06A 4H16A 3EYWA 1LLCA 1E77A 4R41A 3DFZA 3PLNA 1E0DA 2C5EA 3U4IA 5LDHA 3GN1A 1GYQA 4IJVA 3PWSA 5G4KB 4O59O 2Z5LA 1I2CA 3D4NA 5B12A 3RC1A 5KIAA 4BIIA 4FOSA 1LLUA 1V35A 1PZHA 4RF4A 2VRCD 2UUOA 4ND2A 4UUNA 5HBRA 1G0OA 4E5KA 1NQOA 4H7PA 4OGWA 1A4IA 4YAJA 2X0JA 3HB4X 2X23A 4R1NA 5KKAA 4RV9A 3D4PA 2Z1NA 1LJ8A 1I3LA 2E4AA 4I1IA 4J7XA 2HLPA 1KC3A 4MVJI 3F6YA 3GUCA 1GZ3A 1LRKA 1X7DA 3TZKA 3V5NA 1VPDA 3RJ5A 1C0LA 2YDYA 3EVTA 4KUHA 3RKUA 1T25A 5CDUA 1VE9A 1YBMA 5IZCA 4YAGA 4DLAA 2EGGA 3OQBA 2H1SA 2NWQA 3VKUA 2PZKA 1ZSVA 1JN0A 2R00A 2XPCA 1E3EA 1K5HA 1NVTA 5JAIA 2W2KB 2HK9A 4FFPA 2BGKA 2RAFA 3RUHA 4UAGA 2YV3A 2H5LA 4DUPA 3GMDA 3TZ6A 3TDKA 4R16A 5HM8A 5GZ1A 4ZA2A 1GAEO 2H9IA 2DBRA 5ITVA 2FWMX 2BI8A 3PYLA 1LRJA 2P2SA 3OQ6A 4E4YA 1F17A 3CTMA 3IKTA 3WSVA 3GK3A 5JAZA 2OOSA 2PFGA 2X0NA 4XJSA 5DDIP 3JQAD 3OIGA 2PV7A 2X5OA 3LYLA 5L7TA 3DMTC 1SOWA 4YT2A 3K30A 3IJRA 5JW6A 1X1TA 4CM7A 3KXDA 1HE4A 5EN4A 1I2ZA 3DHEA 4A26A 5EIOA 3OICA 4R5HA 2O2SA 4FN4A 1PIWA 4PN3A 3QW2A 3LDHA 4CLHA 3FNHA 1TXGA 3VH1A 2WJPA 3DTYA 3BTUA 3C1TA 5IDYA 3LF2A 1V9LA 5CAEA 1Z45A 4CM6A 1LC0A 3NAQA 3I23A 5JYDA 1DJQA 2B5VA 2DUUA 3FBGA 3H5NA 4HUJA 4YQYA 3T4EA 5HTOA 3PLRA 4BNUA 3SX2A 4Q39A 4QEDA 4TZKA 3ITKA 3DZGA 1K6JA 2JJYA 1JW9B 1DB3A 2VTEA 2HK7A 4E2ZA 1CIVA 3SJUA 3EZYA 4RPKA 3HB5X 3ULKA 4I9UA 4MIEA 3G0OA 3PZBA 3WQSB 4W9NA 1F12A 4CR8A 4BO8A 2QZ9A 3GOHA 1ZH8A 1B16A 2DTEA 4PFJA 1AHIA 1YB5A 1MP0A 3MZ0A 3ZV4A 1W0CA 4FC6A 1MB4A 4RDIA 2X0IA 3VVCA 1Q0LA 1C3VA 3NKLA 1X1EA 2IYOA 4YAKA 4O1MA 4HFNA 3GDOA 4AJKA 4ZVVA 1FDSA 2FOIA 3DAPA 1E92A 3GG9A 3H8VA 5JO9A 3PFWO 4BNJA 1U7HA 2W8ZA 2WTBA 2P5YA 1RM4A 3HFGA 3WNVA 4WEOA 4EBFA 4FFOA 2VWPA 3R3SA 3W4JA 3RC2A 1ENYA 2QIOA 4BGIA 5JCJA 1J4AA 2PD4A 3AFMA 3SJ7A 3MEQA 1QYXA 2OBYA 1P3DA 4JN6B 4CQMA 3Q9NA 4YYZA 2P9CA 3L07A 2D1YA 4IS3A 4E5NA 2YQ4A 4GWKA 3GF4A 2V7PA 4DGSA 1NAHA 3OMLA 3JQ8A 3H2ZA 5B37A 1IUKA 4DIOA 4ESOA 3H5RA 4J9UE 5CDGA 4BNNA 5A5FA 1A72A 4Z3DA 1LDGA 2HMUA 3UVEA 4PRKA 3EMKA 4II2A 3EK2A 4IPTA 3MTJA 2J3KA 1ZIDA 2X6TA 2ZATA 3F1LA 3H2SA 5MDHA 2A92A 1E1LA 4UVIA 1ID1A 4FSHA 2YZ7A 3DZIA 3PP8A 4XIYA 3GDFA 4LVCA 4OXKA 1YDEA 4EJ6A 1BDMA 4ZRNA 2D0IA 3WMXA 1XR3A 1FDUA 1VC2A 4XDYA 2X58A 2OFPA 4HADA 1LSSA 1IZ9A 4YWJA 2NVWA 2DPGA 4R01A 4CMIA 3M2PA 1TT7A 4Z0PA 1X7GA 2X1HA 3FNFA 4JNKA 3WDSA 2VT3A 4Z3KA 2DTXA 2ZTMA 4Q3DA 1I2BA 1Z74A 1WAMA 2OBNA 2GPTA 4PRLA 3G1UA 2NM0A 1NR7A 3ZU3A 3PGJA 3D7LA 3VPSA 2PGLA 5ITWA 3TFQA 3AOEC 1EVZA 1GCUA 3HDJA 1UDBA 4MVJH 1HDOA 3BMCA 3LF1A 1FDTA 4PVDA 4B4OA 3JQFA 4WCFB 4D0SA 3PHJA 3DWFA 3ZU5A 4J2OA 4CV2A 5DZSA 3U3XA 3ANLA 4UVHA 2CVQA 3I9NA 4BNGA 1ARZA 1AXGA 5JC1A 4GLLA 4CR6A 1ENPA 5K6AA 2Y1GA 5KVQA 1Z73A 4E33A 1DRUA 1TT5A 4RL6A 4CM8B 1RM0A 2EG9A 1UDCA 1OZAA 5L3ZA 3VZPA 2HU2A 4B7XA 1GD1O 2GD1O 1IB6A 3W6ZA 2ZQYA 4L76A 4M87A 1IZ0A 4NU5A 2Q2VA 1E6UA 1CQJA 5DBIA 1KVUA 1GR0A 2VHWA 3CEAA 2HQ1A 5A05A 3S55A 3U49A 3I4FA 1ZO8A 5TSDA 3IKVA 4MP8A 3PI7A 5ICMA 2ZTVA 3GY0A 1RM5A 4CUKA 3MJCA 1H94A 2OO5A 4QQRA 3PJDA 3M1LA 1YBAA 2FPPA 3WTBA 2FMUA 4QSMA 1U3TA 4RVUA 4R1UA 3OP4A 1U8XX 4N54A 4DXHA 5FWNA 4CMHA 2Q50A 4P8RA 4DLBA 2HO5A 4AJ1A 1BSVA 3F5SA 1ZZEA 2Y93A 1GU7A 3ONDA 2VTDA 1P31A 4MIYA 1UP7A 1HDZA 3F46A 4RLHA 5G0SA 1HZZA 2DC1A 5G2OA 2NTJA 5DOZA 3D4OA 3E1KA 1JKJA 3PJGA 1Y5MA 3AOGA 3KV3O 4B8ZA 2PNFA 2HMSA 3CZMA 2DBZA 4D79A 1ENZA 1K2WA 2EKLA 5I9LA 1XYGA 1Y9EA 3FR7A 4NBTA 2I9PA 4WLUA 3ZNQA 4BNTA 2OP1A 3GDGA 4B3HA 2NQTA 1R4NB 3ANNA 3K31A 4FPXA 1YKFA 3WGQA 1ZUD1 4YDRA 1PGOA 1V3VA 4Z9FA 2E49A 5AXCA 2DUWA 3RAJA 1N1EA 3RKRA 3HN7A 1EVJA 4G81A 3HQ4O 1LDYA 4BNLA 1UDAA 3RC9A 3KETA 3Q2IA 2JD2A 1YRLA 2GO1A 2Q45A 4R4JA 1IULA 5I7SA 4OQYA 2EP7A 2XXBA 1WP4A 2QHXA 3LT0A 4L0QA 4RLSA 4ZRMA 4CL8A 1DFIA 5ES3A 4FIZA 4CQLB 3F4LA 4JCOA 1HZJA 2ZCVA 3FF4A 1H2BA 1O9BA 2GRAA 4Y6PA 1C1XA 4ITUA 3GHHA 3RC7A 5T5QA 4FD3A 2VZ8A 1VM6A 1WWKA 1Y7TA 5C7IO 1YJQA 4ND1A 4CM4A 3WGHA 4CMCA 4WPGA 2VRBA 2OHXA 4FFLA 1E1MA 4HP8A 3UF0A 2P91A 4KTTE 4PVCA 4PZCA 2Z95A 1QP8A 4IIVA 3C7AA 4B79A 2YHUA 3B20A 1UUFA 3T4XA 1X14A 1HSZA 4XQGA 3WICA 2V6MA 3BMOA 4WE3A 4G65A 5ILGA 1ZVMA 3ASVA 3UN1A 3ZWWA 3QWFA 3G79A 3OJFA 3HN2A 2QW8A 2QRLA 3JQAA 3PQDA 5DBGA 4ALMA 1HKUA 1ZK0A 4IJKA 4RQUA 2BHLA 4CLRB 4CL3A 4M86A 2RHRA 1ZJZA 3O4RA 2O3UA 4L4XA 3O9ZA 4MINA 3NDIA 5BSEA 1ZEMA 4GGPA 3GGGA 4J16A 5A5EA 1GV1A 2C07A 3UGKA 1DIHA 1Y8QA 2FR8A 3IMFA 1C1DA 4F6LA 1UXJA 1U5AA 1N5DA 4JROA 1P1IA 1XWFA 2R00C 2POQX 2AXQA 4M89A 1SO8A 3P2OA 4GSLA 4RPLA 2FRDA 3MOIA 1Y8RB 1YXMA 1PS8A 2FSSA 1ONOA 4CLXA 1NFFA 3KHUA 4MJLA 3BMQB 2DBVO 2X9GA 3GEDA 4WECA 3ONFA 4NK4A 4Z0TA 4YRDA 4MVJP 4BMVA 1UP4A 2B4TO 3E18A 3QVWA 1YJ8A 3JQGA 1X13A 1CRWG 3IAHA 1R0KA 3O38A 4M55A 3ZWVA 4JJGA 3H5AA 2JAHA 4O0LA 2BD0A 2ZTLA 1J6UA 3HNPA 3GQVA 2OXIA 2O7QA 1CJCA 4PGFA 1MXHA 1BRMA 1R12A 2PA3A 2W98A 3ENKA 3Q2KA 1IY8A 4E5YA 3LZ6A 1GCOA 2CY0A 3RVDA 1DSSG 4ZQHA 3BA1A 3HJAA 4OXYA 3SXPA 2I65A 5LDGA 2J8ZA 3OA2A 4IINA 4J49A 3CKYA 5JFOA 2NSDA 2GZ2A 1JWBB 4UUMA 4WASA 1GZ6A 1SZJG 1B3RA 2RH4A 4LISA 5A9SB 2O3TA 1ZEJA 4EW6A 4GMFA 3QWBA 4NBUA 3CZRA 5GZ3A 2EERA 1GUZA 3KVOA 4AJPA 4UEJA 2WYUA 3DZJA 3JD0A 1B3BA 3JQBA 5F21A 3I52A 3GRPA 1ZMOA 5FF9A 3NV9A 4W4TA 3HUDA 1E6EA 3BHIA 4L73A 4RORA 5CHEA 1V3UA 3LK7A 3TQHA 1YWGO 2D2IA 2Q1UA 3P19A 5C7OO 4OMUA 4PLVA 3VH2A 3OETA 4RZHA 4FJ0A 1AXEA 2E37A 3NUGA 3ON5A 2AG5A 4DA9A 5B4VA 4CMJA 2C20A 2I3AA 3MJSA 2HK8A 3GGOA 4LCEA 1P1HA 3GZNB 1BMDA 1F06A 1G1AA 1Y81A 4OIMA 2VWQA 3UW3A 5H81A 3GFGA 5H82A 2O48X 5JAQA 4W9NC 3RBZA 2G17A 4M49A 4EITA 5U9CA 3PHHA 2DFVA 1E3IA 1DRWA 1KY5A 1XKQA 3EW7A 3H6KA 3PGXA 1XGKA 2D3TA 3FPCA 4U6SA 3B70A 3I83A 3L9WA 4WLOA 1JKFA 4JGBA 4JJFA 4W99A 4GGOA 4BB6A 1BXGA 1P0CA 1I3KA 3EAGA 4X54A 1NYTA 4CM4B 4TMFA 3ORFA 4DPLA 3DZBA 4CV0A 1IL0A 1IPFA 1UP6A 3CMMA 1H5QA 4E5PA 4R69A 4TVBA 2C54A 2GUGA 1Y1PA 3GC6A 4YJGA 2AW5A 2YFQA 4EUFA 5L9AA 3Q11A 4IY1A 3ZN2A 4DL9A 1O8CA 2C5AA 2Y99A 4EDFA 3OIDA 1PZGA 2X9NA 3GA0A 5AYVA 3R3JA 4YJFA 3ZCXA 3BXXA 1GFSA 1Q2XA 1LUAA 1KIFA 3RQSA 5ICSA 1T24A 2Y0EA 1KVSA 1PWXA 4PG5A 1I33A 3FI9A 5K0ZA 3AUUA 2HAEA 3GPDG 4CLDA 3IUSA 3STHA 5CDTA 5AXBA 4AJIA 1DHTA 3FNGA 2CZCA 5BT9A 3NT4A 3LT2A 3WR5A 1JLLA 2V6FA 4AJJA 2GN9A 4AFNA 3TF5A 4BNWA 4OKIA 4ID9A 4AVYA 3I9KA 3WMWA 4DQUA 3NTQA 5L40A 1ULUA 4BVAA 4DLLA 3A4VA 2PKRA 5ADHA 4GBJA 1GZ4A 4IDAA 3T7EA 1XDWA 3HSKA 4OOFA 4D43A 4M1QA 1O5IA 5EQDA 4CLEA 1GYPA 2BGLA 3VOSA 4B7CA 1JU9A 1PGJA 1HETA 1P1JA 3WB9A 4IJWA 4UUOA 3ZWPA 4EZBA 3FD8A 3DMYA 1CERA 5LC1A 4CUJA 2ZJ1A 4KWHA 2EWMA 4QO8A 2GN4A 2YQ5A 3ZHBA 4Y9DA 4E5MA 5DP1A 4ROSA 1QYVA 4MP6A 3K2BA 4ALLA 5EERA 3RIHA 5KCZA 1IYZA 2EF1A 3PQFA 1LXCA 4WKGA 4QUKA 2DLDA 4B3JA 3R1IA 2YFHA 3BZUA 5CP8A 5JXWA 3JQFC 3OJOA 3FTPA 4MDHA 4BNHA 2I66A 3GVPA 1QKIA 2J5QA 4E2YA 5TS3A 4BO5A 3DEYX 5C3MA 4PLWA 3DHYA 1U2DA 2Z1MA 2GZ3A 1C14A 1BWSA 4ZJUA 5K6AC 1ISMA 2LDXA 4K28A 4CR7A 3V1YA 1VKNA 2BFMA 2EKPA 5MGBA 4XQ9A 3WBBA 2Y1CA 3V1UA 1ONPA 3JQCA 4G2NA 5KOIA 4RF5A 3WLEA 3QQPA 5G0TA 4U0JA 5EINA 3LU1A 4Z0HO 4BKQA 3TL2A 5L4NA 3OA0A 5B4UA 4CMEA 4CLOB 2I5PO 1DIRA 3INTA 4FB5A 1BXGB 5BSHA 3RUEA 4RPJA 4I5FA 4B7UA 3E6AA 3TPCA 2DTDA 1WMBA 2JCVA 4BNMA 3ROPA 1N8KA 3NYWA 1Q7BA 5ENDA 5G0VA 3U4CA 3AY7A 4WUVA 3FWZA 3VPXA 4PCVA 4NJMA 3BMNB 3LC1O 5JMPA 1EDOA 3KZVA 3B1KA 3JQ9A 3F47A 4UVDA 2EEZA 3QA9A 2VYVD 1U3UA 1EEHA 3L6OO 5IG2A 5JBIA 1R6DA 1YO6A 2Q49A 4JP3A 2HUNA 4YXFA 3I6IA 4I5DA 3WYEA 4AJLA 3Q3CA 2E6UX 1NM5A 1HYHA 3K8ZA 1KEUA 3WGGA 1LC3A 3JQ6A 1GPDG 3VDQA 2AA3A 2JFHA 1V0JA 4LW8A 1ZCJA 1BW9A 4WOJA 4Z6KA 1CYDA 1WDMA 4GWGA 5EJ2A 3DONA 5EL0A 1D3AA 1I36A 1ZK3A 2CF6A 1VKOA 1DAOA 2NADA 5A3JA 1M6WA 1HDGO 1QSGA 2UDPA 2VT2A 1LEHA 3GNTA 4E30A 3TSCA 3GR6A 1DIGA 1YL7A 1Z75A 4XRGA 3VTZA 4PIVA 5BR7A 3KYBA 3KYDA 1B15A 4IXTA 4L9RA 2VNSA 1H6CA 3W8FA 4MKXA 3PPIA 3DBLB 2GZ1A 4FR5A 4OKNA 4D3DA 4EYEA 4N5NA 1R66A 2B37A 1ZBQA 2PZLA 3MJTA 2VHZA 2JL1A 3WGTA 1DDOA 3C24A 1LX6A 4GX1A 4ZU3A 1E7QA 1DC3A 2BF7A 1M66A 4IUYA 4OQZA 4YCAA 3MWDB 4B4WA 5TIIA 5L53A 4EUHA 3KSZO 3E8XA 9LDBA 5IDQA 2DBQA 3KBOA 3L6DA 3TZQA 5J23A 4EEXA 1EK6A 1SNYA 2UAGA 2WWRA 4DVJA 1U4OA 3INGA 4FGSA 2BFPA 1XU9A 4BB5A 3SBOA 1ZK1A 3P5SA 3W8EA 2QYSA 1ZXBA 3O26A 3KO8A 3WX0A 3WJ7A 1PWZA 2JD0A 3W1VA 4MVJF 4A5OA 2IZZA 4RGBA 1W73A 2ZB3A 2NVUB 4CV1A 5C5IA 4CV3A 1DLJA 1YDWA 4BNYA 1AGNA 1EE2A 3S8MA 4FC7A 3M6IA 5A1TA 1ZSNA 4A0SA 1ADFA 1EZ4A 3JYPA 4F3YA 3RU7A 3WQRA 3UKOA 3ZW8A 1B14A 3OQ1A 4GVLA 4C7JA 1PGPA 4NU6A 4QX6A 2G0TA 5F1PA 4A7PA 4B4UA 4BNZA 3TJRA 5KJ6A 4J1NA 2AEFA 2R6JA 4EUEA 8ADHA 1E7YA 4ALKA 1N7GA 2VWGA 1E5LA 4BO6A 1AE1A 1ZSYA 2XXJA 1Q1NA 2JHFA 2Q1TA 4XGKA 4ZD6A 4BNIA 1LLQA 2B4QA 4H15A 5EMHA 3H9QA 4EJ0A 3ZW9A 1KVTA 3N58A 5HS6A 3QWAA 3C3XA 5I7EA 3BIOA 1LQUA 1T2DA 1PL6A 4MVJE 1HRDA 2AG8A 3CUKA 1BTOA 2VHVA 4BO2A 1ENOA 1FDWA 3QY9A 3RROA 5I9NA 1HF3A 3GZ4A 1RKXA 4EJMA 5JS6A 3SEFA 1GL3A 4UEOA 3OF2A 5JLAA 1DEHA 1LSUA 1E3SA 3AY3A 4G5HA 2AQKA 4JQCA 1B8PA 2PH5A 2J5KA 1LSOA 1BVUA 2VZ9A 5JNLA 4BO9A 4WNIA 3FN4A 1QORA 4I9HA 4DMMA 1BW9B 3GEMA 4OSPA 5CG2A 3K5PA 4J3FA 5TRTA 3JQBC 5A4DA 3RFTA
chains in the Genus database with same CATH superfamily
2FW1A 2DHQA 2NZWA 2ZSDA 3DC7A 3ZQ4A 4OI4A 3S1AB 3U3JA 3BHNA 5F1OA 5FI0B 4I55A 4K3UA 1R0BA 2X5XA 3WL8A 4W1PA 3H7AA 2AMJA 3PPWA 4OX9Y 3MINA 4RU1A 1ORRA 1TMOA 2QY9A 1IBRA 1C3JA 1CB0A 3JPWA 3ZJVA 3FG9A 4Z7JA 2KYRA 5CDFA 1P44A 3NHRA 5A03A 3UCFA 1KI3A 4XGNA 3P97A 2J7KA 4DNPA 5C31A 4YP1A 4Y0AA 1QKKA 1U99A 2DHRA 5IM5A 1G7RA 1YK0A 2CMHA 1S6YA 1W49A 2QX8A 4L4RA 3OEYA 3AW9A 4EHAA 1Q0QA 4MUMA 1G66A 4CKEB 1ZXXA 4C6SA 4EB3A 3DA8A 3ENQA 1ZRSA 2YCBA 3KLNA 3QBJA 4KQKA 4Y2UA 1BDHA 1T0IA 1KAQA 5BOSA 1S8OA 3KUKA 2RARA 3PNBA 4QATA 3TLGB 4KTVE 4GQBA 4LWZA 4FE3A 2P4QA 3ZNPA 3T7RA 2R7AA 3M8KA 1N7JA 2YZNA 2RMKA 3QUQA 1V5WA 2AD5A 2P78A 1YZHA 3GVIA 3HB7A 4LJYA 1COWD 1NE7A 2R44A 3JX9A 3D54D 4S1PA 4G5SA 5E4TA 3MRXA 4J03A 4K6HA 5TJHA 3LQ4A 4DYDA 1XN1A 4IHJF 4F9EA 5JASA 3IOBA 4ND4A 3T5PA 1KYVA 4FOOA 1GZUA 2WT9A 3BXGA 3MCWA 4B84A 4LHVA 1NPDA 1AUXA 3R8FA 1YZQA 3PU6A 1NE2A 1W8DA 4L07A 1JR3E 1PR2A 3PRKE 1BIFA 1BJKA 4PNZA 4WA7A 5EP1A 4RJ2A 4NYJQ 3EXHC 1NVDA 1V26A 4LJRA 2B36A 5JZSA 1BEEA 4L75A 5C4IA 4RK4A 1OV6A 1UBCA 5E1DA 1MX5A 1YR3A 1DUSA 3MD9A 3PXXA 5BYBA 5KYGA 2HWXA 3KAJA 5SV2A 3OSUA 3I42A 1RQPA 3EZNA 2J7PA 4X0EA 3I09A 4UAJA 1BHO1 2ATCA 5AI5A 2FN8A 1AUOA 2HDHA 1CUIA 1NVBA 2CLMB 2V98A 4R8VA 3V1TC 4E5UA 3MLEA 5CT8A 3ANSA 5FWYA 4QTYA 1U9CA 4QBFA 4IDFA 2Q8PA 1I8TA 1A8PA 2GARA 1NMYA 3ENNA 4QXPA 2IXTA 3PVSA 5CX1B 1D04A 1S8FA 3C8DA 1GA4A 3T52A 1J39A 4B73A 1C9JA 1FQWA 2EFGA 1OXUA 3JARA 1TUEA 3B6MA 4HTFB 3RUDA 3NM5A 1LA2A 1WZEA 4BJ1A 4QU8A 5A5GA 2XKAA 4K2HA 2L17A 4CBVA 1NQAO 4H77A 3R6GA 1NRWA 3WV5A 1ORIA 1IG0A 4JOCA 5TQ2B 4AX4A 2WJHA 3F2VA 3FPAA 2GPYA 4EGFA 1MFPA 3N7TA 4HG2A 2Y1XA 1KYQA 4FKBA 1PV1A 1PSZA 2FGKA 1N5RA 4NAVA 1J23A 2DFPA 1EH5A 4ZT4A 1ZX1A 3JALA 4U2KA 3N39C 4KBFA 1OH5A 5B53A 1WW8A 3D3NA 1OXMA 3AUXA 1LTQA 2EHDA 1TJ3A 2JBAA 3SVLA 2G1KA 1RTKA 1E60A 1UFRA 4WMLA 1PVOA 3K9QO 3VKHA 3HKCA 4KVAA 4ZVNA 4EMBA 1J90A 1QGOA 4BTVA 4RTJA 2FUG6 1JI3A 3DR3A 3VR4A 5CVUA 3KLMX 4BLWA 3DNFA 3MSXA 1ESDA 1UFOA 1JHYA 4RKYA 3JQ8B 4RGYA 4Z9YA 3ZWNA 3PEYA 2PEYA 3SYLA 4JVSB 3DSRA 3E5MA 4X1IA 5COAA 4ZDJA 3H4IA 1RYFA 2EIXA 4E2XA 4M0FA 5JPDA 1VKZA 1FXSA 1UXIA 4RADA 4UBLA 1R88A 4Y6QA 2ASVA 3R2JA 3VDNB 1U8ZA 4KMRA 2HC9A 3CLUC 5B2ZA 5FOTA 2HD4A 3PFKA 2Y92A 1YOVA 4JXXA 1GPMA 1EK0A 1M6NA 3EGEA 5LU8A 1TVEA 3IQXA 4E3ZA 3DL4A 3EF0A 3I4CA 2XRFA 1R8XA 4UFNA 5BMVF 3LMKA 4QTUB 5F7OA 3ZNNA 3IAS1 3STTA 4BTEA 3WK8A 3OEWA 3G2NA 4ILKA 2DWUA 4L3OA 4B4VA 1M72A 2YY5A 2WAXA 4M7OA 3ZGOA 4E3WA 2JI4A 1RHKA 9MHTA 3IDFA 4ZZ3A 1W85A 1Z5ZA 2IQIA 3FBTA 2JIZA 3A1FA 4RVGA 3B5IA 4D45A 3JQ7A 3FDXA 5IN4A 5JMWA 1MQAA 2CHFA 3KWJA 4GPEA 2H57A 2VDPB 5FTWA 1NBOA 1OC2A 2HFJA 1YL5A 1HTBA 3FHJA 1KKLA 1V4VA 1ISHA 2ZW9A 4WKOA 3WGVA 4JYMA 5ESXA 4S1VA 5JVDF 3G17A 3L6UA 3EWSA 1RIIA 3M70A 2DPLA 2WFLB 3GG2A 3NHSA 3SLGA 5HP4A 2C3UA 2ASEA 1OC4A 3LGAA 3I72A 1ES9A 4CDGA 5BR8B 2X0KA 4PLPA 4FFBB 4NEQA 3CONA 1F2UA 1LDBA 5HOQA 3CUSA 2W2OA 1SUPA 2WM3A 2I4LA 4PZYA 1RHRA 2Q5HA 2P0AA 4IVQA 1LI7A 4HQRA 4MOWA 3JCZA 4X65B 3ORSA 4UAVA 4IGEA 5CM2Z 3KZKA 2ZCJA 4UHEA 4HNSA 1GPH1 2GESA 3OZIA 2PBLA 2CD9A 1C2YA 3R5JA 4XR4A 2ZB7A 3T94A 3WLFA 3DB2A 5D87A 5AM4A 5T57A 3O3MB 3WY9A 5B3KA 3ML1A 1XN4A 2WA1A 4YYEA 5JYBA 3P96A 2Z5FA 4FKMA 1HK7A 2BMEA 3EVDA 1N9GA 1SCKA 2I3DA 2WQ7A 2ZTHA 3BAZA 2HEGA 1A4XA 2D8MA 3AF1A 3O1LA 2HBZA 3RODA 4MEAA 1XRRA 4MKZA 3WGOA 5MHTA 4PLFA 4JX8A 1Y3DE 4QE3A 4MUFA 1QFZA 1XZDA 2DY0A 1JJ7A 1FL9A 3EEIA 4BV8A 1WHTB 2B6HA 2XCSB 3JD1A 4MR7A 1UJNA 1SVIA 2KJQA 3CLHA 4Q01A 5FNVF 1VPLA 2KW5A 1CE8A 1EXDA 3CPEA 4FMCB 2JK0A 1H42A 3LYAA 3N8IA 1TU3A 3JATB 3P8ZA 4OJTA 2N9UA 4FONA 2AYYA 2GM5A 2OAP1 1CUSA 2RH9B 4BO3A 1A2QA 1OPRA 2CL5A 1H2XA 2GPNA 3QLEA 1D9ZA 3BGWA 4Y2RA 3R0IA 2WIJA 3YASA 3AM3A 3PGMA 1SVKA 2Q3BA 3A2MA 3O5AA 4LNUB 2I7DA 3DQQA 1KBOA 1N0IA 5H8WA 2B0CA 4PG7A 2Q5QA 3JRWA 4R2LA 2PX8A 4IQ4A 3ZWXA 1OYOA 4AC9A 5E6RA 3NRJA 1GAWA 2B30A 4MWOA 5DGIA 3SX0A 2AFIB 4KKVA 3NKVA 4C5CA 2EJCA 5K0BA 3OPVA 4URZR 3DFIA 2VHCA 3N70A 3K8YA 3N0XA 4QNMA 5IUKC 5AD1A 4M0PA 4KN8A 3D2LA 3L2OB 1MAUA 1E79D 1THMA 1ST3A 2RBEA 3H5TA 2PRJA 1NQ5A 3F8WA 2VNAA 1OLUA 4BFUA 4MLZA 5DBFA 2LW7A 4PR3A 2GHRA 4A1OA 4YRTA 1BHQ1 2I80A 4LDNA 1MAAA 2CUKA 3I2FA 4GP9A 3LBFA 1UM8A 1T5BA 1BFKA 1QFJA 1PJCA 2J6IA 2YY7A 4WSOA 2P4SA 1MENA 3ZWYA 1B2LA 5G40A 4LHXA 4MQLA 1VHWA 1U80A 5A7HA 3TL3A 2A9QA 1E2JA 2OQRA 2C92A 2ZAYA 4TRNA 4KH1A 5AO9A 3FCXA 3NBMA 1E3WA 2FMFA 1TMGE 4GXNA 4QOIA 3OCYA 5AVUA 2WHPA 4DREA 1K7CA 3H3JA 3IULA 4S1NA 2J46A 4DCSA 4KI7A 2GK3A 4BFZA 1S3FA 1P29A 2I6XA 4O2AA 4IKOA 3B6JA 2FI1A 4HEA1 5JBNA 2UYOA 3MTGA 4C88A 3DBIA 1FYVA 3IHWA 1TDJA 2AS0A 2FB9A 2E4XA 2O5RA 5HM6A 1O58A 4R9SA 2ATEA 5ERGB 4DSAA 2B3DA 5CDSA 2PUJA 1XEFA 2WJ3A 2A33A 4EMUA 2C83A 3RCBA 2R2GA 3AQ4A 4L5YA 1L7OA 4Q9IA 5EIHA 3SKXA 3U3DA 7MHTA 1P9LA 1RJWA 2R8BA 1B6RA 3Q2OA 4M1KA 4WFQA 1IRIA 1CY4A 4KFSA 4MMZB 3FGNA 4BBZA 1D7AA 3HKEB 3OEED 4AMVA 3I1FA 3QEAZ 1YDGA 1JPNA 1MB2A 4L72A 1EXMA 2J5BA 3MPOA 5ANRB 1QRAA 3WGZA 3T1OA 2IVFA 4J91A 3LNCA 5IM4A 1RMQA 4UTXA 1OKKA 4KDCA 1OWPA 2JVKA 3NHWA 1N6RA 1P60A 4N0EA 1KORA 3BMOB 4RPHA 3AI2A 3KPJA 2DLNA 1SC9A 4K1XA 3VYRB 4RABA 4MICA 4Q3AA 2EOAA 1Q95A 2Z3WA 1P2UA 4I99A 4Q3LA 4RVFA 3U4GA 4YAEA 1PYOA 1UZMA 3EARA 4HDCA 4GKVA 4JJ8A 4KAJA 3IMKA 2BR3A 4KG7A 2I1LA 4X94A 3FX2A 1XJQA 3A6KA 1QGYA 2G5CA 1QR6A 3H11B 2JLSA 2FW6A 1RJFA 1Y8QB 2OCDA 4ZQBA 1C1DB 1EUDB 1NTRA 5JANA 1CB7A 4FDLA 1QX4A 4D3XA 1XVVA 4BS9A 3QWIA 4YI5A 3VR6H 2QE7D 4E7PA 3KQNA 4FTWA 5I48A 1KDVA 3EF3A 4IJQA 1MLDA 1RP1A 5LQNA 3CG0A 1XF1A 3HCFA 3D59A 3TXXA 2E0IA 4IZ6A 4ETMA 3PSHA 3GFFA 3FCUB 4DQVA 4AL4A 1YZVA 3CXUA 1VCNA 1CQXA 2IYTA 1TZMA 2W2XA 4TKUA 5EMLA 5IVIA 4DB4A 1GZ5A 3F97A 2NSYA 2Z8YA 4OBEA 2R6R1 2O50A 5E7JA 3K9BA 1PSDA 3B6KA 2H9YA 3HG7A 4BMPB 2YWGA 2FOXA 4BBJA 3IT0A 1NVKA 2AQHA 3GGCA 621PA 4X6UA 1Y1TA 1G59A 1E1RD 2ZBRA 4OQMA 4AKHA 5TMDA 5K09A 2HV8A 3L8FA 4IJ6A 1W35A 2A1TS 2AFRA 3QLVA 2WB2A 4GUDA 2A9FA 3M7IA 3RGWS 1VYHA 3K70B 1PR4A 3GRAA 1TB4A 2P3OA 3IBCA 1S2LA 1ULTA 1EPUA 2O14A 2Q0HA 1V16B 4RH3A 2O2ZA 1KS9A 1M1YE 3GGPA 2JIOA 3FPFA 3ZDZB 3EOAI 1L1FA 1J56A 2VUUA 4BKMA 3QTTA 2CNDA 4QGAA 3R9KA 2ZUEA 4JA0A 1I13A 1A8UA 2R1VA 3PZRA 4NYJR 1VYUA 1M2EA 4JLDA 5H3CA 3RUPA 2C7PA 1GGHA 5LZ7A 3BKXA 3IBSA 4BVLA 1DU4A 1W93A 5BNZA 1FUEA 2AFIE 5D1NA 5KU1A 5LMUB 3NTOA 1NX6A 3JQEA 2JLRA 2ZXEA 1N5MA 2VJCA 3WYCA 4B7ZA 3F3YA 4IDGA 1K89A 3K5IA 3U4QB 2VA9A 1XXLA 4NYIQ 2PRZA 2BY4A 2GN6A 3WGMA 3REOA 1CUFA 4YIHA 5HBGA 2O4UX 3VAZA 4Q12A 5DNDA 2FPIA 4G5OA 5ALYA 3EMDA 1R10A 3DOCA 3M2TA 1ISPA 2OR3A 4RCZA 5AM1A 2DT5A 1R6AA 4L1KA 4N40A 2RB5A 2ZT6A 2GEDA 1G5FA 1QTRA 3UM9A 2XGJA 2GK6A 3N5CA 2FN9A 3BYZA 4W7HA 4LMRA 2QTTA 3AINA 1QGDA 1NFQA 4ZTBA 4TMKA 1SK9A 4RLFA 4EB6A 3ASZA 3PX7A 1HT3A 1U8FO 3SC2B 1AZWA 5H5JA 3X1ZA 3BD6A 5TJ9A 3LLVA 3K6SA 2PBFA 2B9EA 4JBXA 4GZ5A 3INRA 4C3UA 5HHTA 5KTPA 1CP2A 3RSQA 3AKYA 5JJLA 3GJZA 4AMGA 4YCJA 1SM4A 3C74A 5T3UA 4RETA 2D5AA 4JYPA 4DUGA 1G5HA 5B2FA 2O8VA 2EXXA 2G82A 1SOVA 2QROA 4XTRA 4YV2A 4U7FA 5BSUA 1SCDA 3WA7A 1KYXA 3L8EA 4G25A 2FFHA 1QNLA 1I4TD 3G5AA 5AOAA 5C8XA 1J5PA 1EK5A 1AQ6A 1GKKA 1X8LA 3KUCA 5BNTA 1QF6A 1KKUA 2JBWA 2JFFA 3M5WA 3OJEA 4EA9A 1YE8A 1DIAA 4FT2A 2J41A 2ZVJA 4QUEA 3WMGA 3UAZA 1WKVA 3T5MA 4CODB 2B7CA 2B21A 1V8BA 4GPBA 1O94D 2LKCA 2NXWA 3UQYS 5AUOB 2JKYA 2FH5B 5CA1B 2KI5A 5CB4A 4YJGB 1P7WA 3ER8A 2WJ4A 3PC2A 1A7KA 1TUIA 4W9RA 4E6PA 3ZJYA 3AVUA 5EKUA 2B4RO 1F8FA 1RBZA 1Y3FE 3A58B 3PGVA 1NATA 4LJ4A 1EK1A 1DWUA 3W5JA 1VHJA 3Q41A 4IJ5A 3S8EA 3G9ZA 4UMVA 1DCKA 3FCEA 3PQ5A 1V8PA 4EKEA 5J3JA 3EW9A 1SCQA 1PJAA 2GI4A 1NSFA 1QIMA 1E4EA 4H1TA 4JBYA 3W6OA 4KJXA 1R4AA 3CR3C 2AOXA 2VJDA 3NHJA 2WJJA 5F64A 3RFCA 4X20A 4DCJA 5KNBD 2JDID 1IVNA 4EQ6A 5JNSA 4GPD1 3DB1A 1YIDA 2A4KA 3ICPA 1LFAA 4I4LA 2O8DA 1GGKA 4B74A 2GPAA 2J9FB 2WF5A 4B17A 3TZEA 4D92A 5JO0A 4A0FA 3BFXA 4HYQA 5D8DA 3OUTA 4REOA 3MS7A 1COZA 2YV2A 4Z4QA 4HAWA 2A9OA 4DM7A 1ELOA 3KSRA 3LXXA 1NPTO 1XQ6A 1L7DA 4PG6A 4RSRA 5BYJA 4HWTA 4YV0A 1MJNA 2OMEA 4QGHA 1MABB 3GRZA 2Z8ZA 1EUZA 3LHIA 1OU4A 4RY9A 1J2YA 1G4UR 1L4LA 1QH0A 4AT1A 1KJ9A 1R8SA 2D3WA 4V2UA 4AZ3A 4JA2A 3IEKA 3VKVA 1WTCA 2JFOA 5H3HA 3CW9A 1JNXX 2R47A 3KOMA 3RF7A 2X5KO 4D3SA 2R79A 2PM8A 5KOYA 5A71A 4Z1MA 5BN3B 1RCTE 3ZHQA 5AW1A 1H0KA 1G55A 4LY0A 4C4OA 2ORIA 3IIMA 3NB0A 3FCOA 3PQ6A 4EUNA 2QMYA 3C7TA 5CLGA 4B3DA 1QC5A 1B42A 3MJEA 4OPMA 1WZIA 3NHPA 1WB5A 2ZJ2A 5SZIA 3DQZA 1A88A 5JCOA 4OTZA 1NLZA 1S2OA 2VSQA 1CF2O 2LV8A 2EW2A 3QE3A 3R0JA 3AEUB 4TVOA 5DHPA 3LLCA 3R74A 5CDHA 2Q3HA 4MR9A 4JLVA 3BB1A 2FFQA 2QSUA 1GPLA 1ZLYA 4EKNB 9ATCA 3Q40A 4EY5A 1SRRA 2IXDA 2CMFA 3CPSA 3ZGVA 2A9PA 1RZVA 2GVNA 2XDYA 2WKRA 3PIRA 5T64A 1KPIA 2FY8A 4JB0A 2PYDA 2Z9DA 4NG5A 4TQ9A 3RRXA 4B80A 4NECA 1C7RA 1JT2A 2CCKA 2BM0A 5K03A 1C29B 3OFSA 1YZGA 1QO7A 4P5DA 3U4DA 5HPYB 3GMSA 3A1SA 4GXTA 4ZV4A 3DR5A 3VR5D 3A1EA 4QUBA 3AP3A 1LH0A 2V65A 4JASB 1X74A 1WZUA 3OLCX 5DTRA 2CDRA 4YRAA 3IILA 5CHYA 1QLJA 3RD5A 2W70A 4FK8A 3THYA 3H4MA 3T0GA 1T5DX 5HQ3A 4YJ3F 2OZKA 4KQ1A 4M8IA 4ZAFA 3WS7A 5JFGA 1ZH2A 4ETIA 2WUGA 1Z08A 3AUTA 4P7FA 1OHHD 4I7EA 5ALWA 5ED0A 4KPYA 1J1IA 2WTMA 4OFWA 4OYHA 1BVYF 5A06A 2QDKA 1E1KA 5B3AA 1GN9A 2R6AA 2VNIA 5IT4A 2RJOA 3F98A 3LPMA 1JSZA 4NFLA 4U7PB 2VSYA 3MJFA 4IH9A 4EH1A 1JV2B 4JXJA 3IT3A 2W71A 4OG2A 3L0BA 4J90A 1HG1A 1K86A 1MTOA 1ZA2A 2MSDB 2R4QA 2UVPA 4W8OA 4YQZA 2C96A 1V3TA 1WPQA 5E6SB 5JH7B 4DA4A 5FOXA 1ISFA 4EW3A 1PVDA 1QIKA 4V0LA 1GCIA 5TVKA 4IRXA 4NJMB 5D85A 4BLVA 3MJ4A 3T7CA 4Y67A 3Q8LA 2BUCA 2NTEA 3LGXA 3AM1A 4UM7A 2ZSJA 1OLXA 3NJ4A 2IV3A 5ARCA 3F7NA 3ID6C 3OT1B 1OT3A 1NJ6A 2PKYX 3AFNA 4HDRA 1FTQA 1H22A 3NS7A 4FINA 4KGDA 4X1YB 1Z07A 4TVKA 3WOHA 1AF4A 1FB5A 1EP9A 1VRCA 2F1KA 3MMPA 1I32A 4JBIA 4PAQA 1V6SA 5HEKA 5CITA 2D8AA 2I33A 1KDOA 4XEHA 1JZSA 1MQSA 2HY7A 3BD9A 1WBJB 2CXHA 1QFSA 3C3CA 3DLCA 2JFNA 1J9ZA 1K3TA 1NW8A 2EQBA 2QAGC 2QJFA 2C5BA 1R18A 3PEFA 3QKRB 4D8TA 1T9KA 1SCBA 2PGDA 5TF0A 2KS6A 3HMQA 1UBNA 1L5WA 4N03A 4WZAE 2NMVA 2QMOA 3Q0IA 3UAVA 3KFLA 2H2WA 5IZ4A 1E7SA 4UXJA 4IIJF 4IDPA 1U1IA 1L4HA 2NV0A 2QP4A 3NWOA 4OSOA 4XDHA 2YN2A 3GUYA 1F8XA 3GPCA 1YVEI 2ONKA 3N7UA 3VM6A 3J81k 1XZLA 3AI3A 4R0MA 4CT0A 4EG8A 1CJMA 1XALA 4WKNA 1PEDA 2ETXA 1R0ZA 3R4VA 1JHAA 2EIHA 5DNUA 4OO3A 1U6KA 2LCIA 1Y37A 2OV1A 2O8CA 4Q7QA 1LPMA 4M9SA 2OGUA 3RABA 5FBWB 1H9CA 1ZN7A 5LJIA 1NBMD 1VRWA 3HE3A 3G5MA 5TGZA 4PQFA 3VYSB 2BCGY 3BILA 3AFIA 4FGKA 4BWFB 3KB1A 1M10A 5L7WA 3SMVA 1XP5A 4KQGA 4GC9A 1P0MA 5BNIA 4FDMA 2XTNA 1M6VB 4JQZA 2QTGA 3TUIC 4UAUA 1ZUNA 4ZTUB 4KVFA 4LNAA 4ZC8A 3EQ6A 5JROA 1MX3A 1ACJA 3PHGA 1AT1A 4BO4A 2FE1A 5HIKA 4BO1A 1G6OA 4LYDA 4OGLA 5EP3A 4YMGA 5H7XA 1OFUX 3VPGA 5BORA 1Y1LA 4GNRA 4F1KA 2HJHA 2A1UB 4U0KA 4BB9A 1UOQA 2Y77A 3K0EA 1JG7A 1YDHA 1RJ9A 3NOOA 4IIYA 3VC7A 1U0JA 3HACA 3UPDA 1BG6A 1NRJB 2P3SA 1NNI1 1B26A 4HDSA 5GONB 2MU1A 4F06A 1JE0A 3B9PA 2V97A 1CJTC 3LUCA 5DM60 4FCWA 3ETJA 1TA0A 1YZTA 2I2CA 1YFJA 1R64A 3D7SA 4MRMA 1YQQA 5EJFA 4CEHA 1D8TA 1JDTA 1OXSC 5BSKA 4LGCA 4IDDA 1IBSA 1QLWA 4M1OA 1V39A 4GHWA 2W7TA 3OD1A 4DEYA 4D44A 1ZR4A 2F59A 2OZLA 2Z8XA 4BLTA 2FOLA 3RBAA 5EZYF 1G60A 2VF7A 2ZWVA 2EFDB 4CF4A 4F12A 3FLAA 3N05A 2P9EA 4X6YA 2Y0BA 1YVUA 1LF5A 3G2PA 4YREA 1HMYA 4YRBA 1X1CA 4QICA 2QZPA 3RRNA 3PIIA 3GNSA 3CGWA 4BWVA 1NL3A 5IPFA 3DE3X 2F55A 2A1IA 3SNHA 3ADBA 4NARA 2WYVA 1IOVA 4DIBA 3QEBZ 1HEIA 2G4CA 4CLRA 1GT91 3ZDAA 4YLGA 1KAHA 3E53A 4ZYLA 1WB4A 2VQSA 3QLVC 2OCXA 3B1VA 3DD5A 4ZQIA 3ZI7A 1DKRA 1VMIA 4B1FA 1DAEA 3G6WA 4Y2JA 5FAXA 4OI1A 4ZZ2A 1XNRB 4C7MA 5J5AA 3TH5A 4MARA 3E0QA 4UE3S 2RIRA 3KJEA 1V8FA 3B36A 3HU2A 3T9DA 4PRYA 1KR2A 1WXQA 2EBWA 4HN4B 1SKYB 2WLSA 1UJ6A 2Q28A 1OBCA 4JC5A 5AVJA 1X38A 2XCUA 5JD3A 4RDHA 5DF1A 4ETNA 1TW2A 2PJUA 4WNYA 2GZHA 1D6SA 2C82A 1PR0A 2HKIA 3OIVA 4J4HA 4UTOA 4GRIA 1YS4A 1EWTA 3PENA 4QTTB 4YP7A 4B6EA 1CRZA 4KPUB 1RADA 2I67A 2RHGB 2W48A 3ETHA 3KEQA 4OYRA 5IEBA 5IBQA 4UREA 1YTUA 4HX5A 4BUCA 1FMCA 1IB0A 1JAHA 3T1YB 4CKXA 2G06A 5EA2A 4FEEA 2ADMA 1H3NA 1EIZA 2Z08A 4N9WA 1RYDA 4PZPA 4DQ0A 4ERNA 1NT4A 1O2DA 2RAPA 3HYRA 4PIPA 4RF3A 4RQTA 4QRDA 4TWRA 4WGFA 5DCLA 5ICFA 3ELUA 4LXUA 1KEKA 2FFAA 1OJ7A 2OO3A 4XLLA 2P5TB 3P45A 3P4UA 3ZW7A 1VG0B 2FUG1 3BXZA 4YJDA 3CLTC 5FPHA 4B3SB 1QR2A 4K6GA 1M1XB 1U7TA 1UXGA 2IYXA 4J0FA 4KQHA 4L5BA 1JB1A 5A9RA 5I9IA 3TNLA 2IEBA 3TAXA 2R3SA 1IN7A 1O6GA 4BQQA 3CLUD 3PQ2A 4IHKA 1ZMTA 3C2QA 4AJ9A 3IOMA 3ESBA 3P0JA 3ZIAD 1FFCA 5FKJA 5BPHA 5L4LA 1J49A 1RJGA 2VS1A 2JFXA 5B1DA 3CF6R 2F9MA 3E15A 2H29A 2BAGA 1VSTA 3BN3A 1H2FA 3BXOA 5E3IA 3RUCA 3UWPA 4CKCA 4F8YA 4V1CA 4TYYA 1CS0A 4IFEA 1EYZA 1Z12A 3FNIA 5K3SA 5WRFA 3T38A 4DPMA 4L5IA 3CH5A 5JTUA 2ZI9A 3PPYA 4LRTB 4ER3A 1GGEA 3I9OA 4XGIA 4Y6GB 5LXTB 1EJ2A 4IFTA 5IF9A 1LDNA 2WHXA 2PKQO 4QGGA 3SQWA 1EK2A 3HVUA 2P6NA 4KSYA 1II9A 4YJHB 3STWA 1JHPA 5IF3A 1BX3A 3EGVA 1QZ3A 3KB8A 2PT9A 4O63O 5TMBA 3GAFA 3AB3A 4DXAA 3H6HA 5KNLA 2ZRQA 1QOZA 1KH3A 5K3OA 1C9DB 1YUBA 4MI9A 2XGSA 4YAWA 1NM5C 3TGWA 3AK4A 5IXSA 1DBVO 4HN9A 4FZVA 1FQJA 2ZBGA 1SD5A 3DO8A 2FF7A 4Y0NA 5IAKA 1SU8A 1Y5RA 2D2XA 1OD6A 2JS7A 4G84A 5U4QA 4RA6A 3J80A 2XKBA 2GERA 2GLTA 1PBTA 4LQLA 5AUPB 4UM8B 4KXYA 5EZSA 3OJ0A 4YWHA 3SBXA 2WD7A 5KKNB 3LI2A 1ZGBA 2BR4A 4FNMA 1RZRA 1C9MA 1L4KA 3P52A 2QK4A 1BA3A 5K0JA 3OKAA 3L7MA 4S05A 3QVOA 4JOSA 5L3RA 1CHDA 1RI3A 4LVUA 4D3ZA 2A84A 4FOLA 3U7GA 3LLUA 1P77A 1FP4B 2GA8A 3JWHA 1JIUA 1OH7A 4C05A 2O1XA 4OBWA 1RYEA 2CE2X 4UZFA 3PF9A 5EJ9A 3RV4A 2VHEA 3A28A 4ALJA 3HBFA 2B35A 2PA0A 4MTCA 4UNIA 2WVJA 4ARIA 3EOZA 2FEKA 5H3LA 1SVWA 2P75A 1KFJB 3Q15C 4JT4A 4FCCA 1GP2A 3IUBA 3S27A 1BS2A 1GAJA 1OY1A 3FTCA 1C7ZA 3MPUA 1BOOA 3SXUB 2C2BA 1T4CA 1VDZA 2GKSA 4RKRA 4XDGA 3RI3A 1GQOA 1R1DA 3OHMA 4O2LA 1XEXA 5F5NA 4DIMA 1R9MA 3L7CA 1W7AA 4N48A 4ZFNA 4D98A 5BWOA 3HU5A 1D07A 3FDZA 3AU9A 5JCOC 1L7EA 2QMEA 1HNZB 4HQFA 5E6UB 8LDHA 4HPXB 1E64A 4GRDA 1E66A 3KE9A 1V6AA 3L40A 2ERXA 2OGSA 4LECA 4S1OA 1YASA 3BD8A 4NNOA 2DRIA 2VLIA 3ICCA 4ZQGA 4M7PA 5TEVA 4L4UA 4RIEA 3K6JA 5C51B 3WHPA 2YNMD 1SKYE 3WKEA 1IN6A 4BJ5A 2DM6A 1WXGA 1OFTA 1CUGA 3LA6A 1GUYA 3G0DA 4ZVUA 4DCTA 3EUEA 2VJPA 3QBDA 2FX2A 4G5YA 2X0DA 4E11A 1JHMA 4TRJA 2O3JA 2YXBA 5F33A 2O3QA 2W6IA 3BDVA 5JSKA 2VEDA 5A7GA 5CYFA 2AH5A 3E3LA 2BEVB 1ILEA 3AP2A 5AHOA 5HUJA 3V8QA 4QFCA 4DLWA 4PO3X 4JQSA 2TMKA 2ZIXA 1B41A 4XB1A 1G0NA 3CJQA 1GM5A 3BXPA 3GLSA 3KHSA 1KFCB 4AU1A 5BRJA 3VU8A 5IS2A 2FW0A 3KPYA 5BY2A 1B2RA 1L5OA 4C7KA 1N8TA 3ZEIA 4YDHB 2CMDA 4Q1BA 1OT5A 2HO4A 3K15A 4ZVQA 3VPFA 3LFUA 4V3CA 5EUBA 1PGNA 2PR2A 3K96A 1KOGA 2IYEA 1FNSA 4WGGA 2EL7A 3MWLA 4L7VA 2AQIA 3AR2A 2QZZA 2V0CA 3C6QA 4R68A 4XD7D 4KODA 5F23A 2C0CA 1MJHA 2QVCA 4WFKA 2IE0A 3OPYA 3P9PA 3ZHCA 4BKUA 2HM7A 4R8RA 1E9FA 4DG8A 3I8SA 5EMMA 2IEGA 2XUIA 3I1YA 1N92A 5H02A 5A9TA 1P6XA 5AMXA 1Z6YA 3DOFA 3O8OB 4QBGB 4POOA 3ZVKA 2ZUBA 3HJFA 1YH3A 2XQGA 1U63A 3INNA 2Z04A 3DE2X 3R9WA 3KB2A 1DNPA 4Z4EA 3FAKA 3K05A 2R2AA 4RUKA 3ADOA 2GA9A 4DLNA 1CULC 4U6QA 2C88A 2KB0A 3V1LA 3C1OA 3ZCPA 1VJ0A 4QELA 3IAEA 1Q1EA 4U6NA 4YUVA 4JBWA 3PPVA 2VZLA 2V7XA 5AW5A 3FOWA 5EUMA 3LQ1A 3AT1A 4JR1A 4PTYA 3R6TA 3U40A 3UK1A 1T5TA 2F1OA 1Q0RA 2QGFA 2V4UA 4FMCF 3H9JA 4WADA 3W4IA 5JY6A 1HQDA 3HYTA 3Q1LA 4RFLA 3UANA 4ZVLA 4DDWA 1OLSB 2Q4EA 3MOSA 2RHDA 4X24A 3TIGA 3D2AA 4WFJA 4EL5A 5I7FA 4NBKA 1ZKMA 1Q1BA 3ZGZA 4D8WA 3KVYA 2WMNB 5JCJD 5A02A 1LS1A 4JP2A 1MKYA 2REBA 3VNRA 5IULC 4CCAA 1EJ6A 3ET5A 4FCTA 2WWWA 4NRDA 4JNCA 4P1ZA 5GVSA 2NUAA 2XZTA 4IOMA 2QL7A 3VZRA 4PPFA 1BC5A 2BZSA 4C43A 3BMNA 1QB8A 1PRYA 1R5JA 3KQTA 3K09A 4DMHA 4NHOA 4V0RA 4HEJA 4XJVA 2B2NA 4BFLA 2V9CA 3Q87B 5LQMA 4RZ2A 1OILA 2ETVA 2D0PB 4LC0A 1JXAA 4JI0B 3GXOA 4ML3A 2Q9CA 3AOEA 1YD7A 3EIUA 3OM1A 3DXYA 1LK7A 4BZXA 1TLLA 2GLXA 5J1SB 4YT5A 2BKAA 2ACWA 2ORYA 4KO3S 5AKZA 5L95A 1MAHA 1PBNA 3ZDFA 2QWXA 1PQWA 4I5GA 4ZGBA 1CUAA 1LPOA 3EAFA 5KJ1A 1W36C 2W6JA 4NCHA 5BSMA 1D1SA 4MS3B 1R0SA 4KN6A 1KARA 2ZUVA 3GBSA 3ND6A 1I4DD 5FNZA 2K2WA 3WIOA 3WYDA 4GECA 3B1JA 3K1YA 2CVZA 4KP7A 1GRRA 5F12A 3A3OA 4I3HA 2W22A 1AZLA 4URUR 2O3RA 4NS1A 3DBHB 3C8HA 3VUEA 3VYTB 3WLKX 2AN9A 1JKIA 1PYGA 4H08A 2HCJB 2FZGA 3TFOA 1U28A 4X95A 3B53X 1UMDB 1MX1A 4JI8B 5CDYA 3FSGA 1WVIA 3UWKA 1CQIA 3IALA 4G36A 2CHVA 2Y0DA 4BDSA 1QANA 1TEVA 2Z9CA 4R8SA 3G85A 3BTOA 2NNLD 4DDHA 6NULA 4OBXA 2NX2A 2YN4A 3UMVA 1JPUA 3ZCVA 4URVR 4ZHQA 3EZ2A 3NT5A 1ABBA 1PHRA 4HR7A 4AN4A 3CZAA 1X3SA 2WSYB 4MB0A 1HQYE 4NENB 3NTRA 4X6LA 4GOMD 4RZIA 2VF8A 2ZI3A 1H69A 1LX7A 5TPWA 4UTPA 1M0TA 2ZB8A 2D62A 3BWVA 5J4LA 1FVHA 4RJLA 1WSBA 3V2GA 1ECBA 1HFKA 2J3IA 1F6WA 4INAA 5E7MA 4D6XA 4ZI3A 1SQSA 1UPFA 2H4XA 2F1RA 4EWLA 3A0UA 4BKPA 1M6HA 3RBXA 3S7TA 2Q3EA 4A91A 2VAPA 3RIGA 3AESA 4HNGA 4RD4A 1DCFA 1TMKA 2JJMA 3E9NA 4XIFA 5ER6A 2ODEA 1NR1A 3T9FA 1WDWB 3I2JA 4DV3B 1TAUA 1Z0UA 2V5UA 3FMPB 1YI1A 4P53A 3LC2O 3WLIA 5PNTA 5K8TA 4Y9RA 3D6HA 5JSZB 1SA0A 1O77A 4M83A 3A8TA 2WI8A 2QYTA 4NTZA 1PK7A 1DFHA 5AJYA 1WM1A 3E9EA 4YUZA 4CEJA 1JAYA 4UQOA 4JZYA 2VOEA 5KTSA 1WDKA 1AH2A 3QP9A 4C03A 1XSEA 4CUZA 2WHQA 2XY4A 5IJAA 2QUBA 3GVXA 3HFSA 5E7QA 2J07A 3G2IA 3V8PA 3H3XA 3BSWA 1NUTA 2ID9A 4I50A 1GG5A 1SBYA 1FXWA 1WMDA 1XWIA 1ZH0A 2AYZA 2DQKA 2QB5A 1DAGA 2IZOA 2PSFA 2NZJA 4LJ8A 3BHMA 3TTWA 3GLVA 3O1JC 1JVSA 4UUAA 3L0PA 2IHVA 4MAMA 3ELWA 3UJ3X 4BWGA 2R68A 4BQEA 2Q3FA 2VP2A 1CXZA 4U7GA 1T2UA 3WWDA 3ZVNA 1TRHA 4LHZA 4PPYA 4OQQA 4BQPA 4E70A 4KRGA 3RS5A 1P72A 2ZSEA 1WG8A 3DOEA 3IP1A 2LP4Y 4EIWA 5BPFA 1NIJA 1BJRE 3UCXA 2XCLA 1UZLA 3WL4A 2V6BA 3VVMA 5H16A 5CFNA 1VA4A 2DFDA 2IIQA 4EB8A 1E2DA 1M8KA 1ZFNA 3A6LA 1LVGA 2WPDD 4NCNA 5EHQA 4DSNA 4EI9A 1CYEA 1MAVA 2HHLA 1HPLA 1Y6ZA 5ALVA 5EMJA 4TLMB 3PDCA 1G21E 1K97A 2ORED 5KQGA 1HO3A 4UASA 5IBPA 3EH2A 5EQTA 3ZDRA 5HZKA 4US2R 3QPBA 5EI5A 2V0NA 1KOJA 3KQPA 3RC1A 5JR3A 4BIIA 2VJBA 5ITSA 1CG6A 4GG1A 1DJMA 2IPXA 2KX7A 5KMGA 2PJZA 3KL2A 4OHYA 4J0JA 4H7PA 2QW0X 5HF6A 4QYIA 1A4IA 4YAJA 2XAUA 3HB4X 3FTDA 3HHEA 4WN3A 4RV9A 3EA4A 3GCDA 1XVUA 2PS9A 2WC1A 3L04A 5DLPA 1GDDA 4PQGA 1LJ8A 1I3LA 3VYVA 5C8VA 4O25A 3VI4B 1KC3A 4MVJI 1SXJB 3GUCA 1GZ3A 1M34A 1W44A 1WCWA 4FFWA 3GJ5A 3TM5A 2OHGA 4F56A 1VPDA 2XX3A 3P71T 3D1VA 2XUHA 4CETA 5LFAA 1Q74A 1YZ3A 1AA9A 1DUVG 3N1UA 2ZM5A 1AIPA 5JPCA 2VG8A 2HCBA 4BQSA 2F3QA 2CLDX 4JEUA 5JS2A 3M4ZA 1Y5LA 5KNBH 2P9JA 5LBUA 4LBWA 4B8YA 3FPKA 2IZ6A 3X1DA 5NULA 4DLAA 2EGGA 2IYFA 4IOJA 3WL5A 4H17A 2L18A 1GN8A 3VKUA 3M4YA 3L18A 1Z6TA 1ZSVA 3IBTA 1W96A 2QLMA 3EVGA 3OUUA 1BFDA 2Q5IA 4N6NA 1M2JA 2QW1A 2XPCA 1R7RA 5LLSA 5HQTA 1MZPA 1HKHA 4QDJA 1E3EA 4IV8A 1SKAA 2H1WA 1JEYB 1XTZA 4AECA 1D0IA 1DARA 3O8DA 2YWBA 2HK9A 3OIWA 4FFPA 2BGKA 1TYBE 4WY2A 2QMHA 2NPIA 3D1JA 4JI5B 4DUPA 1YA6A 1Q15A 1Z4QA 2ATIA 4LXIA 1U2RA 3O8CA 1YRWA 4G0XA 1CVLA 4EY6A 3ANTA 5HM8A 1NA5A 3MHTA 2W8BB 2K87A 4YMHA 2H9IA 5ITVA 1RYHA 1VBFA 3L5OA 4I8IA 4US0R 3PYLA 4AN0A 4TYNA 4EHJA 1NONA 4ZT7A 3OEHA 4Q37A 5EPEA 2AZMA 4B81A 1FTYA 3LJKA 5C52B 2FRVA 2XMDA 1EWYA 4AM8A 4TL7A 2X0NA 4H0NA 1I4LD 5K1ZA 1EX1A 5DDIP 2BFCB 1X7ZB 3JQAD 1Q0UA 2V3WA 4GWLA 3LYLA 2X5OA 1JSLA 2IUUA 5CA1F 2ZOSA 4AUKA 1Y3IA 2FWNA 3AEZA 3IJRA 1TUBB 4X7MA 5BOVA 4IIDA 5JW6A 1QP4A 1ORDA 3OX1A 4X85A 1NURA 3TQFA 1KI1A 1QIGA 3WIVA 4PN3A 4OXIA 5HRAA 4N1AA 3K9CA 3LDHA 4OHPA 1PR1A 3DWGA 4CLHA 1EB9A 3BRQA 1AZTA 2WJPA 3DTYA 5IDYA 3TO5A 2AG0A 2XB9A 4Z4CA 4BECA 2B2XA 5B7QA 1V9LA 5CAEA 3AEYA 3SNKA 4AXBA 1LC0A 4Y2VA 1EHYA 1LPSA 1A0OA 1FBNA 2HA3A 5JYDA 1DJ