4BB5A

Free-wilson and structural approaches to co-optimising human and rodent isoform potency for 11b-hydroxysteroid dehydrogenase type 1 11b-hsd1 inhibitors
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
263
structure length
263
Chain Sequence
FRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPLVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPSRKILEELYSTSYNMDRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
publication title Free-Wilson and Structural Approaches to Co-Optimising Human and Rodent Isoform Potency for 11Beta-Hydroxysteroid Dehydrogenase Type 1 (11Beta-Hsd1) Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 98
structure length 263
sequence length 263
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4bb5A00
3S2GA 1YQXA 2BFAA 3E9NA 3FR8A 5JDCA 4J3FA 4QFCA 5IN5A 5JC1A 2AEFA 1F12A 1ID1A 3W4KA 5BSFA 2IZ1A 1KVQA 2J3HA 4QXMA 4XR9A 3W8EA 1JKJA 1Z6ZA 2CDCA 1JW9B 3D3WA 2O4UX 2NTVA 1P0CA 2I76A 3SC4A 1BRMA 4URFA 5CP8A 4YAEA 5G2OA 3MJTA 1HDXA 4I5GA 2W4QA 2OBNA 2V6MA 1IZ0A 5KJ1A 3UKOA 5B4TA 1UUFA 3GAFA 4PIVA 3TFOA 4GH5A 1B14A 3WBFA 3JQFC 4MVJP 3ICPA 2GN9A 4I5FA 4LISA 1VSVA 5COAA 2XPCA 1QYWA 4FW8A 4PZEA 4I5DA 4R1SA 1XIVA 3PRJA 3UCFA 4HV4A 5LDHA 1J0XO 1AXGA 1PSDA 3PJGA 2AQIA 1RYDA 3S55A 1C0KA 2E4AA 3PPIA 3QP9A 4PCVA 2Z5LA 5EJ2A 3AOEC 4RDIA 4TZTA 4AJPA 3W6ZA 1VL0A 3NYWA 4ZRMA 3ZGYA 3FNEA 1Y8QB 3G49A 1KY5A 2WD8A 1YDWA 2H63A 1KEVA 1DC5A 5LCXA 3WQRA 2IRWA 5J23A 3GFBA 3UW3A 1H0KA 2OUIA 3MTJA 3U4CA 3MWDB 1WDLA 3BMNB 3R1IA 4BO9A 5KWEA 1MXFA 3HHPA 1VL8A 3MOIA 3LU1A 2PGDA 3RSHA 4I9HA 3FPLA 1HLPA 4Q3DA 3W6UA 3OJEA 1H9AA 2X4GA 1BW9B 4ZQHA 3OSUA 4EGFA 1F14A 5A9RA 2AQHA 3V2UA 2AE2A 2QYTA 1QG6A 3EYWA 5L4NA 4NPCA 3Q2IA 9LDBA 5DULA 3UFXA 1CWUA 4XKJA 1C1DB 3TL2A 1A7KA 1EMDA 3GFGA 4TMFA 4DPKA 5HA5A 5JMPA 3I4FA 3SX2A 4WLVA 3QLJA 1MP0A 2Q1WA 4B4VA 3PLNA 3DZBA 1XU9A 2DVMA 3C24A 4IIUA 4RVGA 4WOJA 4YYZA 3UGKA 1IPEA 5A9SB 2RH8A 2VOEA 1FDSA 1PWZA 1U5CA 3K73O 3O4RA 1XYGA 2XF8A 1DHRA 1EQUA 4JX8A 3GDGA 1YBAA 4N54A 5T64A 3JTMA 4G65A 4EBFA 2VNSA 4XYLA 1AGNA 3DFUA 1LXCA 1YH3A 3PTZA 4E2XA 3ZCXA 4PG4A 3LT2A 2X6TA 4YJHB 1R4NB 4YJFB 4ONEA 4J2OA 4WLOA 4XQ9A 3RUIA 5TSDA 2YFHA 4AJHA 1ZMTA 4RPHA 3S2FA 4O0LA 1YXMA 2AE1A 2GERA 2X23A 2GF2A 1ARZA 4RO0A 3D7LA 4B3JA 4AJ1A 3D5QA 1ZUD1 1YVEI 4Z0TA 3OM9A 1H6DA 5H82A 1PWXA 2VYVD 4FFPA 4M8SA 5LDGA 5F1PA 4GLLA 4Q39A 3GGGA 1GL3A 1QRRA 1X1TA 3LT1A 2NUAA 1D3AA 5KVSA 2A92A 1NPYA 4XRRA 4BGEA 4LK3A 3C8MA 3D3WB 3ZNPA 1K3TA 2PZLA 3PYLA 3KTDA 2GD1O 2NADA 1T24A 5KJFA 2YY7A 3WSWA 4ZICA 5JAZA 4B3HA 5KCZA 2CSUA 4ZVVA 4P22A 3WX0A 1R0KA 3BAZA 3I9MA 2O48X 3ABIA 3ZV5A 3VZQA 4WJZA 3D0OA 3V2GA 3ZWXA 4NG5A 4U6SA 2EJVA 3DOOA 3JYOA 4NHEA 3OH8A 1YRLA 3WTBA 2CF5A 5B4UA 5K9ZA 1X1EA 4AJ4A 5TQVA 1YDEA 3F47A 4BB6A 4Z0HO 1EFKA 4TKMA 1D8AA 1ONPA 1DOHA 3IS3A 3Q1LA 4DMMA 5L7TA 3TWOA 4A73A 1O94A 4Z3KA 2CNBA 4WGGA 5A5FA 4GSKA 1P31A 2WSBA 5BNFA 3OQBA 2BI7A 4S1VA 1UDAA 1P77A 5G0SA 3IQDB 2DTXA 3HDJA 4R68A 1GADO 3SXPA 3DO5A 3N74A 3WGYA 1Y9AA 3I6IA 1N92A 3KHUA 3IC5A 1ZSNA 2NLOA 4JCOA 3DHEA 4UVHA 4FSHA 1GQ2A 4J0EA 1GZ6A 3OIDA 3K5PA 2FRDA 2EEZA 5T67A 2Y05A 3FF4A 1GQQA 4XYMA 4DIFA 3NV9A 3ASVA 5FYDA 2C29D 1M67A 2JJYA 2AEMA 3CINA 3ZZNA 4PN3A 5K6AC 2EGHA 2FR0A 1VL6A 1X0VA 2XXJA 1GYPA 3D1LA 3L6EA 3GT0A 1F17A 2P9CA 4QUKA 5JAQA 2PNFA 3JQ9C 1T2EA 1PIWA 4D79A 1YQGA 3AWDA 4BGVA 1A9ZA 1ZEJA 1BXZA 1PS0A 2AA3A 2OZPA 3OIFA 3H5RA 5TS3A 2P5YA 1ML3A 1CDOA 3ZHBA 3L6OO 3M2PA 4MP8A 3OETA 2G17A 4MDHA 4YRDA 5IDXA 1V0JA 3VKUA 1PJBA 3JQDA 1C3VA 4J9VA 4CODB 1JKFA 1B16A 4LSWA 4YQZA 4J2HA 2UDPA 3HSKA 2C20A 4MVJG 2JKVA 3DWFA 3GN2A 1EK6A 3MTGA 1I33A 4RF2A 4L4SA 3ZWPA 1B26A 1H9BA 3PVZA 1JVSA 3GLQA 4YRAA 1SB8A 4YAJA 3JQCA 1ZFNA 2VRBA 4NBWA 2VHXA 4IY1A 3ZV6A 4FD3A 4CR8A 1PL8A 1U5AA 1WW8A 2FR1A 3PQDA 5DBFA 3SBOA 2OBYA 1H93A 1DIGA 4UUNA 4DVJA 1UDBA 1NX6A 4J9UE 1M6WA 2HMSA 3ROMA 5IN4A 3PGJA 1U2GA 2O3QA 2YV1A 2AQKA 2BI8A 5G0UA 4XJSA 3NDJA 1IZ9A 4OGWA 1WZEA 4KDFA 3L9XA 5CAEA 4BMVA 3NEPX 2HUNA 4M87A 4Y8VA 4CMIA 1NPTO 1U4OA 3WSVA 3L0DA 3IUSA 4FGSA 1KIFA 2IZ0A 5ADHA 1PJ3A 5ILGA 1C14A 3JQBC 3ROQA 3GA0A 1B8PA 4IDBA 4GMGA 4D0SA 3ZU4A 3PYXA 3RFTA 3ZU3A 4BKPA 1ZCJA 4IMRA 2YJZA 3C85A 1LBEA 4ZD6A 1PX0A 4IBOA 2OXIA 3QSGA 3GG9A 3RI3A 1W8DA 5GZ1A 4JBGA 3K6JA 1DLIA 3QVOA 1LNQA 4PLCA 3ORFA 2D2IA 3LDHA 3INRA 3TF5A 5I9NA 4NIMA 2X9NA 4YXFA 1PJ4A 4EUHA 3DHNA 4WLEA 1A72A 1GZ3A 5DDIP 4J4BA 4K9DA 4RLHA 4YJGA 2ZJ0A 3H9EO 1H6CA 4RGBA 5IZCC 5TJHA 3HQ4O 2EP7A 5KTKA 4A27A 1YB4A 4HY3A 2X58A 3F5QA 1VM6A 1MA0A 1P1IA 2O50A 2UUOA 4P4NA 3IJPA 5A02A 5L7WA 1O9BA 5AXDA 1EK5A 4Z9YA 2DBQA 1ZKMA 3KLPX 3SLKA 2IEBA 3AY6A 3DFZA 3AM3A 3D64A 4BO5A 1DFGA 3V1YA 4WCFC 3VH1A 2QW8A 2YYYA 2DPGA 5AOVA 3ZH2A 3ZI0A 4GVLA 4MJLA 2SCUA 5GZ3A 3QWFA 4Q3AA 1GR0A 1C0LA 2EG9A 3UHAA 1C0PA 1GY8A 4R01A 3A4VA 1NFQA 1UXHA 1KS9A 4W9NA 1NBOA 3EVNA 1WMBA 4E6PA 1ZBQA 3VDQA 3QWBA 3VOSA 1YS4A 2HKIA 1GU7A 2H1SA 2ZB3A 4WUVA 3E1KA 2B0JA 3ICCA 3MWEB 1E7YA 3DEYX 3JD2A 3WJ7A 4R9SA 3ZWOA 1CQIA 2PLAA 1WVGA 2P2SA 3AFNA 3EMKA 4DGSA 1GQYA 2FPIA 3FTNA 3H5NA 3RIHA 4YRBA 3GR6A 3DXFA 3F1KA 5F5NA 4FBGA 4BS9A 3HG7A 2QIOA 2P4HX 4UVEA 3HZZA 1AHIA 2ZIZA 4NBTA 4DYVA 2X9GA 4OXNA 3V2HA 3T4XA 1UXKA 1K2WA 2NWQA 5ER9A 4BNIA 3AUSA 4IS2A 4IDGA 2WM3A 4XWYA 3P2OA 2DT5A 3BTOA 1GPJA 2H5LA 3C7CB 3RQSA 3RBXA 1Q0HA 3WYCA 5C37A 4F3YA 1NAIA 4LMRA 4TRNA 2FSVA 2YV2A 1SEPA 5IDYA 5DT9A 3TN7A 3T7CA 1TT7A 1LC3A 2NTJA 1HXHA 1LQTA 4EUEA 3QVTA 5THKA 3EGOA 1M66A 1LEHA 6ADHA 5KVVA 3FNGA 1M76A 3V1UA 1N1EA 1UH5A 3CUKA 2DU8A 4AJLA 4CM6A 4WLFA 3GRKA 5TT1A 5AQ1A 3D4OA 4XIJA 1GD1O 2C0CA 1O8CA 4CMIB 1GV1A 1GYRA 1H6BA 1LDGA 2RHRA 4FFOA 3TZHA 4ZA2A 3LQFA 1ZMOA 3VKVA 2FSSA 3B1FA 3PLRA 1LDMA 1U8XX 2R00A 5JLAA 4PVDA 2D5AA 2PD3A 3OECA 5AXCA 5HWSA 5JS6A 3C1TA 1I10A 1RM3A 3MJEA 2VTEA 4WNIA 2QZZA 3C7DB 1OC2A 5DP1A 3KZVA 4PG8A 2G82A 5IXYA 3U4HA 4CQMA 3ZWBA 5A9TA 3MCVA 3FNFA 1DC3A 4DL9A 4HWKA 2WD7A 3GGPA 3QVWA 1E1NA 1EBFA 1U4SA 3DOJA 4BNYA 5CEFA 4H3VA 1H5QA 4IJWA 4IQ8A 4FOSA 3VAZA 4LVUA 1DRVA 2Q4EA 4YA6A 1I2ZA 3FWZA 4M49A 4XGNA 1DIHA 4JJFA 2QRLA 3H2ZA 4RPGA 5JDCC 4DUPA 4D3FA 2HJRA 4OO3A 1L1FA 4YJGB 1Y7TA 1JAXA 3GVCA 2A35A 5TJ9A 1NQ5A 1SZJG 3PQFA 2HMUA 5COQA 5F1OA 4MKXA 1DAPA 4OXYA 1YE3A 4YR9A 1NQOA 3ZWAA 1U28A 2I9PA 2IODA 4OSPA 4Y67A 1ZO8A 1K6IA 3RJ9A 3K30A 4J90A 4NMHA 3K92A 1Y1PA 5U4QA 4NJOA 3ULKA 4QQRA 2PWZA 4E5PA 5I7VA 2HAEA 1Z74A 5T6BA 2BGLA 4IZIA 3I9LA 3HWRA 1QR6A 2Y1CA 1SCUA 4MINA 4XJTA 4Y6RA 3WICA 1U3UA 2EV9A 3WG9A 5ER6A 2BRUA 1E3EA 1IE3A 4D44A 1TA4A 4FS3A 4BNUA 4OKNA 7MDHA 3WFIA 2B4TO 4WECA 1R37A 1RM4A 1ZJYA 4J1TA 2X8LA 4B4UA 1G0NA 5A3JA 3GVXA 2C59A 5DNAA 4W99A 4L74A 1NWHA 4CR7A 3DAPA 3EVTA 4I9NA 2EW8A 1P1KA 3UCEA 4IQGA 2HSDA 3GG2A 2NACA 2JAHA 1KEPA 3K2EA 2A4KA 3RU7A 4IPTA 2PGLA 1BMDA 4O59O 3E5RA 1HDRA 1B3RA 3PHHA 1K6JA 1XKQA 5I8ZA 1B8UA 1PEDA 4HXYA 4M54A 5CDSA 4Q3NA 2NU8A 4Y6PA 4GQAA 1Y81A 4EEZA 4AJ2A 1LTHR 1ADBA 2ZK7A 3DB2A 5CG1A 2CD9A 4I08A 3ZV4A 2C54A 4ALJA 3Q9NA 3RBVA 4IDFA 4O1MA 4AFNA 4MIEA 1FDWA 4KZPA 4D41A 1FDTA 4XYEA 3FBGA 4CM8A 5K0ZA 2AW5A 3WMXA 1V8BA 1JN0A 3V5NA 1BTOA 4B79A 4BNHA 5JY6A 1DSSG 3CSDA 4BKQA 1W73A 5A9SA 3RKUA 3RUHA 1L7DA 3H2SA 5F5LA 3DZHA 2GLXA 1PL7A 4A03A 1OC4A 2VUTA 4CJXA 1QYVA 4BNNA 1CQJA 2P68A 3H9QA 4FGWA 2E82A 1ULSA 2ZB8A 1WXDA 2VN8A 3RUFA 5IG2A 5DCWA 3ZHXA 2Y0CA 3JD0A 4XB2A 1HDCA 1J49A 3HN7A 1I8TA 4UEJA 3ZWMA 2BF7A 1I30A 4NQZA 3AM5A 3SVTA 1DC6A 1DIBA 4TKLA 4TRMA 1RM0A 2VZ8A 3SC6A 1VJTA 4BO1A 4WLUA 5BSGA 3OP4A 4HP8A 3QVSA 4DA9A 4PRLA 1E3LA 4PG7A 5JAMA 3AM4A 1P45A 3EDMA 4CQMB 1E3IA 5IJZA 4R5HA 2WWRA 3JV7A 3IDSA 3EW7A 1XU7A 3B70A 4I9UA 2FOIA 4RPLA 4QFDA 3WIDA 4E5NA 2WD7B 1IYZA 1DRUA 2AG8A 3E5MA 2DQ4A 4M55A 3B6ZA 1U1IA 4QECA 1NPDA 3TOZA 5CEEA 3KEOA 4BNLA 3ZW9A 1N5DA 4E21A 2VHZA 4EJ6A 4FC7A 3FRJA 3PZBA 4WKGA 3WR5A 5T5QA 2HQ1A 1A5ZA 3Q11A 4L9RA 3RUEA 4EUFA 3FWNA 1JU9A 2OORA 3JQ6A 2JD0A 3OA2A 3RVDA 3HB4X 1V3UA 3RWBA 3WS7A 9LDTA 2PKQO 3PI7A 2PD4A 2OFPA 3L07A 4EJ0A 2YUTA 4EW6A 5L4SA 1PQUA 4MP6A 3W8FA 1I24A 3MEQA 5GZ6A 5KVQA 3AW9A 3I52A 2HK9A 2CVZA 2BHLA 1U2DA 4JBIA 3KSZO 4OH1A 2WYWA 1PGPA 2RHCA 4FB5A 3L4BC 2PZMA 2VHYA 4RV9A 1Z82A 3VH4A 1PS8A 2GZ3A 4IJUA 3LT0A 1JDJA 3OEYA 1X0XA 4ID9A 2AMFA 4CV1A 1LRKA 4CM4A 1HL3A 1MUUA 3F9IA 4PVCA 1NNUA 4UUOA 5CDTA 3BIOA 4L4XA 2Y1DA 3RFXA 2A94A 4IJKA 3GMDA 4BUCA 3VPXA 2YHUA 4YT2A 1LA2A 4HADA 1VLLA 3DTYA 1NVGA 5U9CA 2UV8A 2Y1EA 1ZXBA 1DBVO 3UVEA 3D3EA 5BNIA 1XG5A 3G1TA 5AVOA 4CV0A 3K9QO 2VWQA 1X7GA 3TNLA 4CLOB 5HRUA 5U1PA 3WYEA 1R6DA 1MGOA 4L4RA 3CXRA 4G81A 1T2FA 2D5CA 3M1LA 1XLTA 5JCXA 1GTMA 1HDGO 5IFLA 3T7EA 4AG3A 2FP4A 1L7EA 4EYEA 4YQYA 5DBGA 4MVJD 3LVFO 4CM8B 5F3RA 1NVMB 4GX2A 1GUZA 2IYPA 1VC2A 2D4AA 1QORA 3UF0A 1DO8A 2P4QA 1Z73A 4LN1A 1P74A 3ASUA 1XELA 1VSUA 3ONFA 3VPSA 4KUGA 3H9JA 4ALLA 2GASA 3HJAA 4XDYA 2QZ9A 3ENNA 2EERA 4ZJUA 4UAGA 4YVFA 2GUGA 2EF1A 2I3GA 1WZIA 2J3KA 3WQSB 3ITKA 5F21A 2O7QA 2JFFA 1S6YA 3NTQA 5JSFA 1WDMA 2VWGA 1V3VA 3ST7A 3GAZA 1KERA 1PGNA 4RVUA 3LT4A 5IAAA 4QO8A 3FPCA 4J43A 1LSOA 2O2SA 1PJCA 3KSUA 3DMTA 3CMCO 2RCYA 2CMDA 2Z1MA 3K96A 3KV3O 4L8VA 4ND1A 4RF3A 1X15A 4JP2A 2BGKA 3DZGA 4UEOA 3RU9A 4U6QA 4FR5A 1LJ8A 4HX5A 1VRWA 4IDEA 4B8ZA 1XA0A 5KKCA 5CFZA 1BHSA 4JGBA 3WGOA 1HRDA 1RM5A 2GN6A 4YAIA 1LX6A 2CFCA 3PEFA 3GEGA 4CM7A 4FFMA 5JBIA 1XDWA 4MIOA 3FCOA 2DBVO 1PQWA 1YOVA 3G0OA 4OOEA 4RF5A 1QYDA 3ZNOA 4Z3DA 4IIVA 1Q7CA 3BTSA 1I32A 3QA9A 1BGVA 2CVQA 4U7WA 1I3LA 3QRWA 4JQCA 1K0UA 1I2BA 3KXDA 1QYCA 3TSCA 2GO1A 2J8ZA 3COSA 3NKLA 3O26A 4BGUA 2PZJA 3FD8A 4XYBA 2I65A 1VJ1A 2D0IA 4GAEA 2NU6A 2V65A 5I7EA 1K89A 4OL9A 5ES3A 3BMCB 3JQFA 1VI2A 1WDKA 2C7VA 1U9JA 1NFFA 4TROA 3MOGA 1VPDA 3EUWA 3W1VA 4PG6A 2OHXA 3TPCA 3VTFA 4R41A 1HDZA 2E48A 2DM6A 2WEKA 2OP0A 1PZFA 3FBTA 4P38A 4L0QA 4RDHA 1NHGA 3AOEA 4CM4B 2EKPA 3U4IA 4WK6A 3GEDA 2HRBA 1Q0QA 1DXYA 1UXIA 1E3JA 1A4UA 1UR5A 4E30A 5ITVA 4NU5A 5HS4A 2LDXA 1ZIDA 4MVJE 5L7YA 3U5TA 1DEHA 1SOVA 2R2GA 1WWKA 4IINA 4R1TA 2BH9A 4DYDA 1KC3A 3QY9A 3AI3A 3LF1A 5KJ6A 1WPQA 4ZU3A 1U3WA 3GVHA 1OFGA 4C7KA 2JAPA 1DFHA 1PTJA 4OSOA 2ZYDA 1MC5A 4NBRA 1LI4A 2GSDA 3AJRA 2BLLA 1SO8A 4XD2A 1MXHA 5KVCA 1N7HA 2NQTA 3BXXA 1EUZA 3AUAA 3D5TA 3NT5A 3PFWO 1YBMA 2Z1NA 3AUUA 1EVIA 4IZHA 5EN4A 3H4VA 3GUYA 4QEDA 3L9WA 5A5EA 2AEJA 1E3WA 1PJTA 3NAQA 4OKIA 1BDBA 3AY7A 3LC2O 5DF1A 3F5SA 4U0KA 5DOVA 4Q3EA 5L3ZA 4XEHA 1PZEA 4CPDA 3PHGA 2EWMA 2RBEA 4OIMA 2JD1A 4HFRA 4D45A 1ZEMA 2B36A 4CM9A 4GKBA 1KEUA 1Z75A 2E49A 3VZRA 1V9LA 2DTDA 1HZJA 2I3AA 1RPNA 2EKLA 4PLFA 3IKTA 1EDZA 2VT2A 3CEAA 3OQ1A 2OL4A 3EZYA 3OHSX 3ZWYA 1LSSA 4NFYA 1I2CA 1NASA 5A4DA 3DAGA 2HDHA 1LLUA 1P33A 4AJOA 1T25A 1LC0A 4YWJA 2J3IA 3LF2A 3RJ5A 1GUFA 3ADOA 3JYPA 1HE2A 3CTMA 1ENYA 3CIFA 3TZCA 2BFPA 4Y9DA 1JA9A 5JY1A 2PK3A 3QW2A 4JP3A 4II2A 2WTBA 1C1XA 2YQ4A 3CKYA 5H83A 4NZ9A 4XQEA 4J7CA 2B35A 4XQGA 1LDNA 3ETEA 1UXGA 1PGOA 1KC1A 1ISFA 4CLRA 2AG5A 2JFGA 3M6IA 4RJTA 3B1KA 3P2YA 1AXEA 2EHDA 2BELA 2AHRA 4ZQFA 4B7CA 3RAJA 1HEUA 4CM5A 2V6GA 3WWZA 5C7OO 2OP1A 2DBRA 2FZEA 2WE7A 4INAA 3A1NA 1Y8RB 3GNTA 3JD4A 1BDMA 4R54A 1YOVB 1XEAA 3HFSA 2E6UX 3E82A 2NQ8A 4CMGA 2J5KA 3I9NA 4BNWA 4R1UA 3ANNA 4AJJA 5A3VA 1I01A 4YAKA 3N7UA 1NP3A 2J5QA 2G0TA 3GK3A 2O3TA 4IJVA 4BKUA 1Y5RA 3FNHA 3TOXA 2FMUA 3OICA 5TLSA 3ROKA 5TC4A 2PKQP 1AUPA 2BKAA 1DRWA 4JXKA 1ORRA 4Q3BA 3BZUA 4MP3A 4CLEA 3TL3A 5TF4A 3KSDO 2R00C 4J0FA 2I6TA 1NM5A 1XGKA 1YB1A 1P1HA 2G1UA 4EZBA 4YPOA 3Q0EA 3RCBA 2UAGA 1PQPA 2O23A 3NT2A 3PJDA 5ILOA 4CQLA 2EGGA 4ZHSA 3RC2A 3NRCA 2Q1UA 2C2XA 3KRTA 4WLNA 1DB3A 4PLVA 4DLAA 3Q3CA 2Y1OA 3F4BA 3WDSA 1B2LA 5JDIA 3JCZA 1H2HA 3BMOA 4ALMA 4NBUA 3R3JA 3RC1A 3PHLA 2H9IA 3NDRA 3P7MA 5JAIA 4LCEA 2Q50A 3RC9A 1E6UA 1UP6A 2CDBA 4DLBA 2ZB7A 3W8DA 3GMSA 5JE8A 4FN4A 1O6ZA 4RPKA 3OBBA 4F45A 3IUPA 4NU6A 3ZN2A 1ZK0A 4NFHA 4GKVA 1T2AA 1ZNQO 3PDJA 3OMLA 4GI2A 1ULUA 4NK5A 4BNZA 3I9KA 2FR8A 1IHXA 2I67A 1IUKA 2W2KA 1E3WB 5ICSA 5MDHA 4LRTB 4XB1A 1LSUA 3DZJA 3JQ9A 4RVDA 2YW9A 3VDRA 5L53A 1PS9A 3INTA 4GWGA 3EZLA 3I4CA 4YTEA 3GVIA 4PLYA 4PZDA 5KKAA 1E7WA 1UZNA 3PYMA 4W7HA 5EL0A 4KP7A 4OQYA 3LK7A 4IGFA 1YBVA 3MZ0A 4CMJA 1GCOA 3H9UA 5COBA 1QLJA 3E48A 1TI7A 2OMEA 2WJPA 2X5OA 3INGA 4UULA 2C5AA 5TIIA 1SMKA 4R51A 3TZKA 1R16A 4I1IA 4CMCA 1Q7BA 3HFGA 4O5OA 2ZCUA 2O3SA 3H6KA 4WEOA 3TQHA 4BNGA 2GRAA 5JPIA 5G0WA 4FQ8A 1MG5A 3ADPA 4PGFA 3O8QA 1XCBA 3WBBA 1BVRA 1C1XB 1MFPA 4R4JA 2B5WA 3H3JA 5L9AA 3WOHA 2VHWA 4RVHA 1J6UA 5AXBA 2W2LD 4CLRB 3ZHYA 2JHFA 4L73A 4I5EA 2Y0DA 1DC4A 1U7HA 4RORA 2B83A 4RQUA 1F0YA 4EI2A 4N5NA 1DIAA 3NT4A 5EPOA 3FI9A 1T1RA 4TZKA 2Q4BA 3OFSA 2G5CA 2D3TA 2Q3EA 3ZW8A 5FF9A 3BHJA 4BL5A 2O3JA 3NX4A 2QQ5A 3ZDFA 2C07A 2IDZA 4TVBA 1E6EA 1JTVA 1NQAO 1ZW1A 3AUTA 2QHXA 3ETDA 3PGXA 4CMKA 1NTOA 1M75A 5IDQA 1ZK3A 4OYRA 1P0FA 2V7PA 3WQQA 3I9OA 4FJ1A 3DOCA 5IXSA 4U0JA 1GPDG 1W0CA 2X22A 3DBRB 4NBVA 5DZSA 3WNVA 1ZXLA 4HBGA 1WLYA 5CDYA 1LQUA 4CM3A 3OA0A 4YEDA 1Y9EA 4CV2A 4E2WA 1BXGA 2ZQYA 3MJCA 3NGXA 5DBIA 2BMAA 4Z9XA 2OO5A 4BO8A 4DIOA 3JQAD 2NVWA 4CQLB 1I36A 3ANLA 2IEDA 1D1TA 2AQ8A 1IY8A 1IOLA 1C0IA 4BNVA 1ADCA 2RIRA 1DJNA 3I83A 3L6DA 4HNHA 4Z9FA 2CF6A 2HJSA 3JQ7A 2Q45A 3JQGA 3BMOB 4CLXA 4E12A 4GX1A 4MVJI 5HTOA 1MB4A 3AY3A 4WNCA 1VKOA 3DMYA 1FXSA 4PLPA 3QHAA 4AVYA 1I5RA 4BNKA 4B3IA 2J6IA 1EE2A 4CL3A 2FY8A 4DC1A 1Y6JA 3V1TC 1IL0A 4K1LA 1BSVA 3QWHA 4XCVA 3HDHA 3KETA 4XA8A 5B37A 3E03A 4P8RA 3IP1A 1OBFO 4XDZA 3GHHA 3WGZA 1P1FA 2NTNA 1PJSA 4IGEA 4DPMA 2W2KB 2FPPA 4FFLA 1VKNA 2POQX 4CM1A 1B8VA 1Q7GA 4L76A 3NJ8A 3C3XA 3O03A 4K6CA 1HZZA 1AN9A 4BVAA 3LYLA 4AL4A 4AJKA 5I8WA 4KUEA 2NNLD 3S1LA 4J1NA 2X5KO 1T26A 5G0TA 1CRWG 1A9YA 4QTZA 4CR6A 2BD0A 3H65A 4KTVE 1KVUA 4DREA 1EVYA 1SOWA 3VVCA 2DAPA 1A7AA 2JCXA 2Q1TA 3B1JA 4HFJA 5C7IO 2NU7A 4CLOA 4RZIA 1NFRA 1EE9A 3DBVO 4IXWA 1YJQA 1TB4A 1Z45A 2DLDA 2PD6A 3KB6A 1MFZA 4XR4A 5CPBA 3PJFA 3H9GA 3WGHA 1I0ZA 4NK4A 3WIEA 4X54A 2ZJ1A 4YB8A 1UZMA 3U4DA 1WP4A 5L4LA 1PU2A 1HSZA 3DR3A 4BIIA 2GGSA 5BR7A 2B4QA 7ADHA 4PZCA 4WCDA 3O8QB 1CIVA 3WLFA 1MV8A 1SPXA 3OJFA 4J6FA 3FHLA 3RUAA 1HE3A 1YKFA 2VRCD 3IJRA 3NDIA 3ZWCA 2B69A 2EP5A 2CVOA 3QV1A 1I3KA 1JWBB 2PTGA 4J4HA 3PHJA 5I9MA 4XGKA 3HDQA 5EINA 3WGGA 1O89A 5HBRA 4ESOA 3VH2A 3E9MA 2CUKA 1EQ2A 4AICA 2HMVA 4RF4A 4O63O 3WYBA 2A9FA 4Y98A 3LLSA 1XSEA 4Z6KA 5JYDA 4XIYA 1ZK2A 2NU9A 3I23A 2EIHA 2Y0EA 4R9RA 3SLGA 1TLTA 1KVSA 2HMTA 1E1MA 3HE3A 3DL2A 3KM0A 4OXKA 3RASA 3I3OA 3RUDA 3N58A 2CDAA 3PWKA 4LCJA 4XRGA 1XR3A 3UCXA 3WXBA 1Q0LA 2WMDA 5ITWA 4BNJA 1BXGB 3NTOA 4JJIA 3DMTC 2DUUA 3DQPA 4FPXA 2VYND 1G0OA 3PHIA 4ND5A 3RC7A 5DCUA 1T1SA 1R0SA 1EZ4A 2HU2A 4R1NA 3L4SO 4E13A 4CMHA 4RZHA 2XXBA 4XGIA 2IXBA 4GX5A 3ANMA 5KNLA 3PWSA 2PA3A 5G0VA 1U3TA 5TRTA 3AOGA 3JQGB 3JQ7B 3BMCA 2GN8A 1D1SA 1CETA 3DZFA 4BO7A 1KETA 4XX0A 4BV8A 1P9LA 1KEWA 4D0RA 1NVTA 4WCFB 5EQFA 1YONA 5JCJD 2ZQZA 3AI2A 2F00A 3OQ6A 3UAGA 4DBVO 3CH6A 2X0NA 2ZCVA 4BNXA 4YACA 1SNYA 1X13A 3G1UA 3W4JA 3KYCA 4CMEA 2YDXA 3IIEA 3OJOA 4MVJA 5DCYA 2C7GA 2BGMA 2X86A 1E0DA 2JFHA 4CLDA 2F1KA 2RAFA 4BOYA 1ZK1A 2H6EA 4M1QA 1W6UA 4BNTA 1P3DA 4E33A 2EXXA 5JMWA 1JQBA 4ND3A 4N5LA 4PRKA 5DP2A 1ZVMA 4WE3A 1LLQA 3FSRA 1CJCA 3IP3A 3JQ8B 4F6CA 3ZWWA 5HM8A 1D7OA 4W4TA 1A4IA 5KJEA 4YCAA 3GY0A 2Y1FA 3LLVA 4JN6B 2DUWA 3I6QA 3ZWNA 4XZ3A 1YO6A 3U0BA 2C5EA 1EFLA 1PZGA 3R6DA 1LLDA 3TZ6A 4ZN6A 4U5QA 4NFSA 3B20A 1HWYA 3K31A 2QRJA 2P91A 4FJ2A 3U3XA 5JO9A 1BWSA 2Q2QA 3H5AA 5T8KA 1U7TA 3WGIA 1N8KA 1FMCA 4DBZA 2Y66A 2VYVA 1F8FA 3EK2A 3ENKA 2WE8A 5FEUA 3BMQB 2DC1A 1N9GB 4AJEA 2D1YA 3KLMX 3QVXA 2X0IA 3H7AA 3DBHA 1HYGA 5FI5A 1NHWA 4TRRA 3ZWVA 3PZRA 4A5OA 2VT3A 4A10A 1UZLA 1HKUA 3H3FA 2PGJA 3HDYA 4CLHA 4RL6A 2PV7A 3C1OA 3QQPA 1HF3A 3IOYA 5C7LO 2YHIA 3PK0A 1ISGA 4BMNA 4GBJA 4HFNA 1KVRA 3BTVA 3OEWA 3W4IA 3BHIA 4PLHA 5EERA 2HK7A 2D59A 3BHMA 4TRJA 2NVUA 2I5PO 4KMSA 1O0SA 3VTZA 2OOSA 1ONOA 1YB5A 2ET6A 4J16A 4OAQA 4I8XA 1FDVA 1E6WA 4II3A 3GUCA 1HT0A 1UDCA 4EITA 4UVIA 3VZPA 4Z0PA 1FDUA 4GL4A 4NNJA 3KYDA 4R5MA 4E5MA 1EUCA 2ZTVA 3CMMA 1Y8RA 4JROA 4DTIA 1Q1NA 3Q6IA 1P1RA 4NJMA 4BO6A 4RPJA 1E7QA 3VH3A 3ONEA 3GC6A 1YJ8A 3P19A 2XOXA 3WGQA 4DQXA 1ADFA 1J5PA 2DFDA 4E5KA 3IL2A 5CHEA 8LDHA 4QX6A 1CF2O 1ISMA 4PG5A 5EESA 3HB5X 3Q9UA 4DIBA 3PXXA 1MG0A 1QYXA 3CPSA 3EAGA 4OOFA 1T4BA 5HS6A 2PR2A 1K6XA 5C3MA 3GF4A 3BYZA 1FF9A 1G6KA 4BMSA 4YAGA 3L4BA 4G5HA 2Q99A 3RROA 8ADHA 4UEKA 4WPGA 1IPFA 4N5MA 2IE0A 3DZIA 5ENDA 4RVSA 3KYCB 2YV3A 1ADGA 3O9ZA 2TMGA 3DTTA 1DPGA 2FN7A 1PJQA 1R4MA 5A05A 5FWNA 3VZSA 3QJ5A 4AJIA 5CDGA 1DIRA 2BFMA 3PJEA 1ZSVA 1W4ZA 2JHGA 1QLHA 3FTPA 4DPLA 2Y93A 4K6FA 3QE3A 1WMAA 3GEMA 4MOWA 2I99A 4IM7A 1U8FO 1YQDA 4IUYA 3RKRA 3LZ6A 4WOKA 1PJLA 1T4DA 4ND4A 5DN9A 1VJ0A 1F8GA 2Y1GA 3ZHZA 1O5IA 1UXJA 2IXAA 2PKRA 4ZQEA 5MGBA 2ZTLA 1KVTA 1TVEA 4YDRA 1AHHA 1SAYA 4GX0A 5CEJA 2JL1A 3M2TA 1BVUA 3JD1A 4RCVA 3DONA 1ENPA 3CZMA 1LSJA 2Q2WA 4KWIA 3SJUA 1MC4A 5TNXA 4TWRA 1GAEO 1PR3A 2Q1SA 5JDIC 2PH5A 3HADA 4BNMA 4CUKA 3WFJA 4KQXA 4LSMA 3F6YA 4MKRA 1MX3A 2D8AA 1EVZA 4IS3A 5AYVA 3V8BA 4BO4A 3I9JA 5JO0A 1LRJA 1GYQA 1QMGA 1GDHA 2GN4A 4FCCA 1YWGO 1QXSA 1NWCA 3GVPA 3GZ4A 4YJDA 4IMPA 4B4WA 1G1AA 1E1KA 3VVBA 1E92A 3UICA 1LLCA 5ENVA 5CPFA 3X2EA 1QSGA 4EDFA 2O3RA 4R16A 4W9NC 3DZKA 2C2YA 1QV7A 3DBHB 4KUHA 3F4LA 4HNGA 4KOAA 4W7IA 5T57A 1RYEA 4A7PA 4CUJA 3DHYA 3S2IA 1XQ6A 1PR9A 4A2CA 2FWMX 1U3VA 2R6JA 4ND2A 2VTDA 3JD3A 3D4PA 4BQRA 3WJAA 1SBYA 1B3BA 4B4OA 1A71A 2GR9A 2YHIB 1OZAA 2B4RO 1I3MA 1X14A 2DBZA 3G17A 3Q2KA 3UH1A 2PZKA 3PIDA 4CUZA 4BO0A 1XWFA 3PFFA 4BB5A 3GDOA 2HLPA 4PFJA 3P5SA 1LU9A 3JYNA 3GNSA 1CEQA 2DTEA 2NVUB 4KQWA 5EMHA 4D3SA 4PLTA 2OGUA 1SEVA 4GGPA 1ISJA 3GGOA 1E3SA 2UVDA 5A04A 4OQZA 1KOLA 2WYUA 4DRYA 2FPGA 5JC8A 1V35A 5G4KA 4MO2A 4D46A 2G76A 4CMAA 4BNFA 4E5YA 1N1GA 3VPGA 3KYDB 1MLDA 3S8MA 4IDDA 2VWPA 2NVBA 2EKQA 4NJMB 4ILKA 4JK3A 4DC0A 2GNAA 1T2CA 1P44A 1DJQA 1O95A 2VZ0A 1ZK4A 1LDBA 2GDZA 4F6LA 4UVDA 5KIAA 1M2WA 4J7XA 3GZNA 2UYYA 3H8VA 2HMWA 2PY6A 4A0SA 1M6HA 5B4VA 1FJHA 4D43A 1T2DA 1DLJA 5IZ4A 4H15A 3PDUA 4YT5A 2ZTUA 3LSYA 5JXWA 5KJCA 3NUGA 4O6VA 2CY0A 1ENZA 2ZATA 4DQVA 2VOJA 3NGLA 4KDEA 4CM9D 1ZJZA 5IDWA 4H16A 3C1AA 3DBRA 1HSOA 4E2YA 1I3NA 3S2EA 4J1SA 1S7CA 4MPDA 2NM0A 1IHYA 3A9WA 1K5HA 4J49A 5JYEA 1Y5MA 4A26A 2YDYA 3EHEA 1TXGA 3RUCA 1E5LA 2YQ5A 2NSDA 3AFMA 1B15A 1IULA 1R4MB 4R3WA 1ISHA 1BXKA 1EUDA 1Z7EA 3OJ0A 1Z7BA 3KBOA 2BFOA 4JBHA 3ROPA 2W8ZA 4OM8A 4RLSA 2GPTA 4E32A 2VQ3A 2DPHA 3GHYA 1E77A 5ICMA 4M89A 4FOOA 4R69A 2Q49A 4DQUA 4Y6SA 4BKOA 4ZQGA 2E37A 2C82A 4TVOA 5GY7A 2WYVA 4MVJH 4OMUA 5H81A 4C7JA 4MVJF 3UN1A 4ZGWA 3GQVA 4TSKA 5C5IA 1V3TA 2HO5A 3AI1A 4PLZA 3ZU2A 1HTBA 3UUWA 2X0JA 4L75A 1TT5A 1HE4A 1A27A 3DC2A 5K6AA 4KTTE 3TRIA 3WTCA 3L77A 4ALKA 1HDOA 2GZ2A 2GYYA 2EW2A 2ZB4A 5IF3A 4GGOA 3LC7O 1ONNA 5L95A 4IXTA 3KEQA 3E8XA 5THQA 5BNTA 2W2LA 1E7SA 1E7RA 2P9EA 3OF2A 4MIYA 1GEGA 4ROSA 1X7HA 3AK4A 2V6BA 1ENOA 4ITUA 4EEXA 4QT0A 2QG4A 1EEHA 3CZRA 1OAAA 3KO8A 4J7UA 4J1QA 5A03A 4G2NA 4S3MA 4QSMA 3WB9A 2VHVA 2ILTA 1NYTA 4MVJM 3IKVA 4RVFA 2VUSA 4Q9NA 4F46A 4W6ZA 5JFOA 4ALNA 3UXYA 3E9QA 2HK8A 3QIVA 4D7AA 1N2SA 1UP4A 1SC6A 4PLGA 4QO7A 1QP8A 3GDFA 4D3DA 4LMPA 1H94A 4GSLA 4FFNA 3R0IA 4CMBA 5BT9A 4M86A 5I7SA 5BSEA 1XQ1A 2JCVA 2Q2VA 5GMOA 1HETA 4WASA 2I66A 4OHUA 3OJLA 3DBLA 2GZ1A 3ZV3A 2RH4A 2X7HA 4HKTA 3ZNNA 4YT4A 4D42A 1YL6A 4JJGA 3JQAA 1X7DA 4YBZA 5G4KB 3TDKA 1D4FA 3BTUA 1QKIA 5L45A 5EIOA 5JW6A 4LW8A 1P1JA 3A28A 3WGTA 1HDYA 1YGYA 5G4LA 2B5VA 3NTRA 1UP7A 4FC6A 1HYHA 3ITDA 4WEQA 3GZNB 3ZU5A 5BSHA 5A1TA 3JQBA 5BQFA 3RD5A 1EDOA 1E5QA 2Y67A 4XYGA 3PQEA 4RQTA 1GZ4A 4ZQBA 1NR1A 1R12A 4Q3CA 4UREA 1NR7A 2ZYGA 4B7UA 5L51A 1ISIA 1YL7A 4W82A 4XQCA 3JQEA 4PLWA 1PGJA 4BHTA 2O7SA 3TZQA 3NJ4A 2AXQA 4UUMA 4HFMA 6LDHA 1GCUA 1KY4A 1DFIA 4B7XA 3FR7A 5JNLA 1IB6A 1LDYA 5B12A 2JD2A 3AU9A 1JWAB 1NXQA 1H2BA 3F3SA 4NDNE 4NR0A 1OMOA 5I9LA 4K28A 3DAFA 1GUYA 2ZKLA 2LDBA 3GN1A 3U09A 4P4GA 3TFQA 3PIIA 2PFGA 2X5JO 5FI3A 3LC1O 3R3SA 3JYLA 5TX7A 4BV9A 1HLDA 3FN4A 3RFVA 4BO2A 3SJ7A 5IZCA 5CDUA 2QYSA 1WAMA 1PGQA 1ZSYA 2ZTMA 1YL5A 2IYOA 3M1AA 5AXAA 2V6FA 4DLLA 3WNQA 4KWHA 5TGDA 1B0AA 1JAYA 4N7RA 4NI5A 1V6AA 1R15A 5F1KA 2JCYA 3QWAA 4UVGA 4WCFA 1HYEA 4H7PA 2VUUA 2X9VA 1JVBA 3WWYA 1LDEA 4DMLA 4BKRA 4GWKA 4ZRNA 1RWBA 1LUAA 2Y68A 1N7GA 2X1HA 3IAHA 2YFQA 3EY4A 1H6AA 2W98A 3KUXA 3VPFA 1GV0A 1TT5B 5KOIA 3F46A 1UAYA 4E0BA 3IMFA 3GPDG 2QX7A 4IQ0A 3GH3A 2HRZA 1KYQA 2PH3A 4LRSB 1WNTA 4AJNA 4E4YA 2VRCA 4IDAA 1QV6A 2P5UA 1ZZEA 2B37A 1PZHA 5TT0A 2VCYA 4E3ZA 4LGVA 4R3NA 3VC7A 4BQPA 4UUPA 3U9LA 3HN2A 1TEHA 3BA1A 3JQ8A 4MKZA 3CE6A 2X0RA 4J4TA 4CMEC 3I1JA 3SEFA 4CQMD 2XAAA 3STHA 2VNAA 4DXHA 5EQDA 4IDCA 4BGIA 1Y8QA 3C7AA 4K26A 1JLLA 2NV6A 1FK8A 3K8ZA 4GLOA 5CG2A 3MJVA 4OJNA 3F1LA 3HNPA 1LRLA 4JNKA 3ON5A 3VPHA 3BMNA 2UUPA 1OOEA 3EC7A 2WDZA 2DFVA 4NH4A 1OI7A 2Z95A 2J3JA 4J91A 3RBZA 2O3UA 3A06A 4GMFA 3OIGA 4DWVA 1SB9A 3GOHA 1PL6A 3PWZA 2Y99A 3VHRA 3ETGA 1GEEA 1BW9A 3I5MA 3QWIA 1UJMA 4GVXA 3KVOA 1RJWA 4B8WA 3X2FA 2P9GA 1PJ2A 3GRPA 3MJSA 3KYBA 3G3EA 3ZNQA 3BMQA 4P4LA 2O4CA 1N9GA 3HUDA 1EBUA 1E1LA 4TQGA 4EJMA 4FFRA 3E18A 1NAHA 4N18A 3DBLB 5I7FA 2FZWA 3ONDA 1HE5A 1E7MA 1CERA 5A06A 4FDAA 3UOGA 3MJ4A 1ZH8A 1DHTA 5FFFA 2FHSA 2VYNA 4LVCA 3WLEA 3JQAB 4FIZA 1C1DA 1BG6A 2IZZA 2VWHA 5T8KC 3GNQA 2DKNA 2CZCA 4CL8A 3K2BA 5LC1A 2VZ9A 2J5RA 3D4NA 3U62A 3JYQA 3AU8A 1KBZA 4CV3A 1NQTA 2TMDA 1UAGA 5L40A 3G79A 3T4EA 3O38A 4BO3A 4ALIA 3KOUA 5DOZA 1RKXA 3E6AA 5B1YA 2W90A 1VE9A 4HUJA 3U49A 3WMWA 4E31A 2HCTA 5JCJA 1DDOA 3GPIA 4E2ZA 1R66A 1XHLA 3DDNA 1Q2XA 4U8GA 2GCGA 1DAOA 2EJWA 1CYDA 3JSAA 4JIGA 2O2YA 4YJHA 2ZYAA 4JLWA 1R4NA 2QRKA 4FJ0A 4YJFA 2Q46A 1R0LA 1EVJA 3PP8A 1J4AA 3A14A 1JKIA 1F06A 4GPD1 1GFSA 1AE1A 3TJRA 4YT8A 4C4OA 1B7GO 2YZ7A
chains in the Genus database with same CATH superfamily
1NW3A 4GMHA 1I4TD 5JDCA 4D97A 1RLIA 2AEFA 4DCGA 1R9MA 2CBZA 4OSEA 1BWRA 2IZ1A 2ZIUB 3GEHA 3TNYA 3CWCA 3IERA 4D6XA 4XR9A 4YRRA 3W8EA 2HPVA 3VNSA 1QGED 2JRLA 3N76A 1XEWY 1IRXA 3QE9Y 3AVPA 1CTQA 4LZWA 2YN0A 2X7XA 4B3DA 2O4UX 1ZOIA 3AIMA 1HG0A 1I51A 4PYMA 1P7ZA 2P8JA 5FAKA 2HEGA 3ML1A 3S68A 4YAEA 5KYNA 3IE0A 1BE1A 1QTRA 2QG9A 2C9YA 3AF3A 5LXTB 3W5BA 2J7KA 3L06A 3L6CA 1UC9A 3KZXA 2H8GA 2N9UA 4KLNA 3RTBA 3AESA 1T8SA 2OAGA 2VBGA 2OGWA 2VP2A 5B4TA 5KYXB 3GAFA 3KX2A 3M3HA 4PIVA 1K7SN 4GH5A 4G4SO 1B14A 3WBFA 1N6RA 1RPAA 3JQFC 2XUGA 4IAOA 3K8OE 2VJBA 4B3MB 1J5EB 2M98A 2XPCA 1CV2A 3V9PA 4HV4A 1XIVA 3IILA 3TTYA 5LDHA 1RCFA 2ACKA 3LUFA 4YR7A 1DKMA 1MDBA 1N2GA 1PUXA 2QA5A 1C0KA 4AF6A 3JWEA 3RTEA 1Z4PX 4M6WB 1LFAA 1N5RA 4Y0VA 3D8BA 2Q3HA 4BVEA 2CNNA 2Z5LA 2MINA 4Q3OA 4TYPA 1U90A 4URZR 5EJ2A 4B1FA 4BLQA 3NYWA 1RP7A 2OYCA 2QD3A 4UMVA 1K27A 1TVKB 2ADFA 2G9UA 5TPWB 2YJGA 3K32A 4IEFB 4MI9A 3FNEA 2PL9A 3KOZA 1Y8QB 2DFPA 1O9GA 3FROA 2GH1A 4OI2A 4PGMA 4TL7A 5GM1A 4Q3LA 1WUKS 4E1AA 4D9EA 4P4SB 5C2JB 1ZH6A 2HWYA 5J23A 3GFBA 4UHBA 3UW3A 1H0KA 4LDQA 1ZU5A 3MWFA 4WOBA 5HKAA 3BMNB 5FAXA 3NHRA 4JJ8A 1MXFA 1GNTA 3MOIA 4JLDA 2I87A 3LU1A 1P75A 3TQCA 1PQYA 4P7BA 4PGGA 5CITA 1OXXK 3PCRB 1DKPA 1HLPA 1PR0A 2W2PA 1NN3A 5CCXA 1IEQA 1ZJWA 1H9AA 1BW9B 1SG6A 3CC8A 1SXIA 3EQ2A 3N0RA 1F14A 3WWOA 4RY8A 2I1VB 4B0PA 1QKKA 3SYNA 1NR5A 3ZGOA 2CEKA 4P3PA 4PO3X 1XCMA 5DGCA 2QYTA 2R1TB 5DE3A 2R5NA 5GINE 5FV7A 4NPCA 5A2GA 1H1TA 2F3QA 5AJXA 4TSRA 3B48A 3TIFA 4EHLA 1XTUA 3T7DA 5JQGB 1C1DB 1QRAA 4HB0A 5F5XA 1A7KA 4EB3A 5FUBA 3ADBA 3HKDA 1X7YA 5JMPA 1G17A 1CLEA 4OGKA 1AKVA 3OHMA 4DV2B 3E3OA 1KFBB 1O6GA 1V2HE 3B38A 2DVMA 2D6FA 1BDHA 5DHFA 1N34B 1TYBE 3HY6A 3UGKA 1OW3B 3R7WB 4F2GA 2RH8A 2FYTA 4V0QA 1PWZA 2REQA 1KAQA 4GZ6A 4G84A 2PL1A 1PFQA 2WT4A 3EIXA 5TARA 4DEXA 1EQUA 2OGZA 3TVTA 1OT3A 2FEAA 5P21A 3JTMA 1RWNA 5FHRA 4RE5A 5HVNA 4FYXA 5K1ZA 3DM5A 4L9AA 3CRZA 1H69A 1YH3A 1Q0ZA 3DFUA 4GGMX 2QLFA 2VJCA 3QG5A 4Y7DA 1UPFA 5CB8A 4DA4A 1ORIA 1FNMA 4YJHB 3PUZA 5DYIA 4CFSA 3HFJA 2H4XA 2EQ5A 4WLOA 4XQ9A 1TO1E 5EJ6A 8OHMA 2IIBA 5AKJA 2YFHA 5TSDA 5FQNA 5BW4A 3SNHA 5CM8B 4FYIA 1YXMA 2AE1A 2GERA 2GTIA 2NV2B 2X23A 5JCZA 4RO0A 4B3JA 2OCLA 3EASA 3D5QA 2WC1A 5HEKA 4QJIA 2CBGA 2P5TB 3RLFA 4HDQB 1WE2A 2EFEB 6AT1A 4ADSG 3EIQA 1L7BA 3S1AB 4Q7QA 3BD8A 5F1PA 1ZJ6A 1CY2A 3F9CA 1GL3A 1X1TA 1XTZA 1YZUA 3LT1A 4ENVA 4RADA 1JBQA 4H7KA 4M9CA 3EPPA 2YRFA 3OAAD 4JC0A 3FGZA 4OQPA 4H3HB 4FMPA 4BGEA 5KOYA 1SXJA 1D0VA 1O95C 3F90A 2C8VA 3ZQUA 1R1DA 1SUWA 3PYLA 4HRAA 3KTDA 4RIEA 5KKNB 5ALZA 1XRNA 4LRYA 3STYA 5J63A 4HDAA 3DGEC 4H27A 4R0VA 1PG2A 5F2NA 5KCZA 3CZQA 4ZVVA 3STWA 1BX0A 4A1FA 3OTOB 3PKIA 3GPLA 1NXXA 1M1ZA 5CW2A 1MRSA 4RKQA 3ABIA 3KTAB 1Z22A 1JFFB 3C8UA 3CZPA 3VZQA 1ORHA 5BSUA 3ZWXA 2ST1A 1A88A 4NG5A 1CUAA 5ADVA 3FWPA 3CX6A 1P17A 4NHEA 2PHZA 4LV5B 5FULA 4BEBA 1NBME 4NESA 2GPWA 2YIMA 2CHFA 1L8OA 1Q6ZA 1W5AA 1QFSA 3IQEA 4BB6A 4LHYA 1EFKA 2OC9A 1D8AA 3T5AA 1FB5A 1L6IA 4A73A 3TI7A 2O5VA 2YX1A 1WSAA 1EUYA 3OEHD 4ZO6A 3T3OA 1P31A 5BNFA 2BI7A 1CVIA 1XK7A 4I1SA 4UXJA 2FMKA 2A4MA 2XBLA 1QQ5A 5KWIA 2QRGA 2XA1A 1L4BA 4G1EB 1GADO 4JT8A 3MTEA 4IUBS 2QD2A 1W1IA 4JY7A 5HUQA 2ZUFA 4ECAA 1O8BA 3SXPA 3THRA 3IP7A 1Y3HA 3Q40A 4DT1B 2EZ4A 1A2BA 1YB6A 3G0CA 1Y7HA 5AR1A 3K6SB 3SG0A 5ALSA 1ZSNA 2J3LA 4UVHA 3I8OA 4FSHA 4TWIA 3ELUA 4DSUA 1GQ2A 1GZ6A 3IUQA 3MFQA 1V4VA 3HJHA 5JRZA 4QPZA 4XYMA 2ECPA 1X7WB 3LKBA 2G9QA 1CPYA 2G4LA 1RJFA 4DB4A 2C29D 1M67A 1NU8A 1TZ2A 2H8KA 3OZUA 2EGHA 3FDJA 2XWBF 1UBTS 2EYQA 3KDSE 5ALNA 5GTDA 5JSZA 2ATCA 4TYWA 2CLOB 3FCUB 5AHRA 1W5BA 2AX3A 1JT9A 5HP4A 1IFXA 2NSLA 2QAIA 2ZDGA 3A2LA 4CKBB 4DR4B 3JQ9C 2PMCA 4AIRA 1YQGA 3AWDA 1JEQA 2UYQA 2HNAA 4X9XA 1SFRA 4BGVA 5CA1A 1RI3A 2G8LA 1ZEJA 2P6RA 1BXZA 1PS0A 2AA3A 3A05A 5EE9A 5I9TA 3T7KA 1UBSB 3ZDZB 2NOAA 2OFWA 3H5RA 4M1WA 3RSGA 3QE2A 3LOUA 2P5YA 1BJRE 1R3UA 3OPYA 3VR3D 3M2PA 3GYGA 1QYIA 3UHOA 4MDHA 4YRDA 4P5DA 1V0JA 4L8WB 1L3CA 1ISSA 5AJUA 1A3CA 3VC1A 1W7AA 2YOGA 1VG1A 2DSNA 4J9VA 4J3JA 4KYTA 4OHZA 4YC7A 1II8B 4DMHA 3BHNA 4YQZA 3HWSA 2UDPA 4J2HA 5EKTA 4K46A 1LBTA 4MVJG 4TN1A 2GJ4A 5AW5A 1JI3A 1Z6PA 4LOKA 4RXUA 2IY9A 2OK7A 1J21A 3ZWPA 2F2TA 3RVJA 2PUTA 3KZCA 4ETIA 4YRAA 4KHZA 1TGVA 4YAJA 4C21A 1OGYA 2WF5A 2J46A 4ZC8A 1RRPA 2KYRA 1E79D 1MHPA 2W8BB 4CF5A 4I1UA 3DO8A 2K6GA 2HSGA 4U6NA 3OE1A 4FD3A 4BC0A 3VAYA 2I6FA 1MF7A 1UM9B 2BHSA 3SBOA 5KTMA 1OBHA 1H93A 1D03A 4HG2A 2Q7DA 3ESBA 3EVDA 2I2BA 4FDTA 4DCSA 4DVJA 1PFUA 3C3PA 4QYWA 4N1AA 4YBRA 2VSOA 5HKKD 5KQLA 4OTZA 2BTQA 4EX7A 3BL6A 3BXPA 2BI8A 1LF5A 1KNQA 2ATXA 4MJ7A 3NDJA 1IZ9A 4YXWA 4ZCRA 4KDFA 3LY5A 1P1BA 4Q47A 1L6RA 5CAEA 1RRFA 1FTNA 3NEPX 1IEXA 3NTUA 2D2XA 2ZB2A 2I8AA 3AHHA 4H1HA 2C4TA 2Q6IA 1GG2A 2R6GA 3DMFA 3R3XA 1OAOC 2C2ZA 4MKHA 5SZJA 3IUSA 3PT9A 4Y1FA 4DN6A 4LJ6A 1PJ3A 2PS0A 3I01M 5ILGA 3ROQA 3MD9A 1M3SA 4PX3A 4GNRA 4EH1A 2VPIA 4GMGA 4ZU1X 3ZU4A 1Z8DA 2RAVA 3PYXA 1QO7A 3RFTA 3RJTA 3ZU3A 3AVYA 1JEOA 4DV3B 1NW9B 3C85A 3UY4A 2RCNA 2OXIA 4UUQA 2ATIA 3FDZA 3RI3A 4C6TA 2DMRA 1NN5A 2X2FA 5GZ1A 4D2IA 2JLSA 3QVOA 1G8KA 2V7WA 3HCFA 4NOLA 3L82B 4N6NA 2XUOA 4B6EA 1OXBB 4KQIA 1G8HA 3D31A 3TF5A 2PBLA 1FTGA 1G98A 2AYXA 1RXYA 5FFMA 2BT4A 3N8GA 4YXFA 1SKQA 5LQRA 2FFJA 1DWPA 4BBJA 1GAXA 3E5NA 4GQIA 1IXZA 1GZ3A 4WLEA 4EG4A 1WETA 3EPJA 3R3VA 3Q8KA 4CTKA 3H9EO 4MS4B 1H6CA 1X8XA 3MMPA 1H2EA 1UOQA 2N0SA 2ZIVB 4RGBA 2FPOA 5IW8A 2PL5A 1W581 1PF7E 3IBTA 5TJHA 5EIBD 1MA0A 2M1ZA 3PCXA 5A02A 5L7WA 4Q1CA 1AQNA 3OQJA 3IAEA 4QDKA 1YRHA 3G0DA 1GKUB 3D64A 1JE1A 4X1KB 3THXB 4CF6A 3VA7A 3D7RA 2YYYA 1IN6A 2DPGA 3AUKA 3CISA 4YAOA 3ZH2A 3NEYA 1RI5A 3B3JA 1NRIA 3JZAA 3V6MA 3KPJA 2YXDA 5DHQA 1MABB 1KDVA 4OFWA 2HLNA 3QWFA 5P8WA 5GZ3A 1ZDMA 2R85A 4Q3AA 5A2QA 4L4ZA 3GJSA 3UHAA 4QYXA 4DR7B 4UE6A 2Z83A 2I8CA 2QLTA 1KS9A 2VG8A 1NBOA 2AJ8A 3LUCA 1WMBA 2X0FA 3Q8XB 3SE7A 2VSNA 4EY7A 4YUXA 2HY7A 6NULA 8ABPA 1GARA 3AR4A 3U7QA 1JE0A 1HZZC 1AKRA 1GZ5A 1HFJA 2C2OA 3QX9A 1YS4A 3QWBA 1GU7A 5BRNA 1MB0A 2ZB3A 5FI1B 1T2UA 2H2FA 4IMJB 4WUVA 5JSHA 5JAUA 2IOFK 1GOTA 2B0JA 2Y92A 3FFAA 3Q7SA 4PY2A 1XZKA 1Y34E 3MNFA 4OF4A 4R9SA 1QK3A 2CXNA 2JLZA 1CQIA 3N7TA 5BWCA 4FBMA 3FPFA 1GQYA 2FPIA 3R9XB 3H5NA 5CFQA 4FBGA 3HG7A 4UVEA 2QTZA 1FQJA 1KIAA 2ZBUA 2JIZA 2X9GA 2AI2A 4FYWA 4OXNA 5FWYB 3U26A 5IWCA 3T9BA 1BX3A 1K2WA 4WJLA 3DWGA 3FZQA 4HGNA 2WYOA 2NO6A 3JATA 4L1KA 4IS2A 4IDGA 4GZ5A 2WM3A 4YGYA 4XWYA 2TSYB 1HDEA 3GJ4A 1UZUA 4WCVA 3BTOA 421PA 2OXTA 4HD8A 5H8WA 3RQSA 3SBDA 1O03A 1Q0HA 3QYPA 3WYCA 5BMVA 1UKAA 3D59A 1MU0A 2FSVA 2YV2A 5DT9A 1E0SA 1LX7A 2NSYA 2PQ2A 3O95A 2BM1A 3TN7A 4BU1A 1QO9A 1USGA 4UW9A 1TT7A 1HXHA 1LQTA 3TD9A 2VJLA 3EGOA 3IXLA 4KBFA 3UMFA 1M66A 4XUDA 1A5TA 1M76A 4AJLA 4C29A 1UH5A 4DLUA 4KR3A 1G2IA 5AQ1A 3GCGA 3D4OA 1IONA 1Y6GA 4JXZA 3GJTA 1O8CA 3IVCA 4NV1A 2AJTA 5F51A 1GYRA 1LDGA 1LI5A 1QCDA 3EVBA 2BP7A 2QQEA 4FFOA 5T3YA 1JF8A 1XP8A 2I6SA 3RVKA 3M4JA 2VH5R 1HEYA 1JR3D 2A30A 2QV0A 2K5UA 3H16A 3RTAA 1KJIA 2J6BA 1A8PA 4KE8A 1T8TA 2QPAA 3WO0A 3B6KA 5KQSA 3WK4A 2HIHA 3W3AA 1QRUA 3Q88A 3CY6A 2WJ4A 3HJUA 4UD2A 4ZT7A 2K4MA 2D5AA 5JLAA 5TQ0A 3VUFA 5JFTA 3OECA 4NAVA 4JMLA 3IDZA 1F5SA 1VLQA 2UZ0A 1G9SA 2A1TR 2P0YA 2PGOA 3Q0TA 2QZZA 3DQQA 1BKYA 3EUEA 4RXMA 1Z06A 2IUTA 4E5UA 4CQMA 3ZWBA 1O3YA 4CZ2A 4IH4A 3FNFA 3T5CA 2HI0A 4FN5A 3Q5DA 5DI9A 3FFBA 2M6SA 1E1NA 4HNSA 2OSBA 3LJKA 2P79A 3NCHA 1AU9A 4BNYA 3Q7RA 2FWIA 3AKDA 4OP3A 2IH5A 2IVZA 4IQ8A 3ZZTA 4FOSA 1J97A 1NLFA 1DKQA 3BDAA 2LNDA 4FCTA 4GYJA 4MW0A 1DRVA 2Q4EA 1IQUA 2R65A 5BP7A 2QRLA 3H2ZA 2COKA 1KHTA 4L51A 2EFHB 2I54A 1PZXA 4RX1A 1LKZA 1YRAA 4MPPA 3EGXA 1SZJG 2EWVA 4A16A 2JA2A 5COQA 4L0CA 4DBLC 1D2EA 4F8JA 5KB3A 3G5MA 5F1OA 3T3NA 4LBYA 4YR9A 3I92A 1UKEA 2WPDD 3ZWAA 4Y67A 3CPJB 4HLCA 4PCUA 5LQKA 2IW3A 1YJBA 2OBXA 3GOQA 3K30A 4NMHA 1CQPA 1Y1PA 3UO8B 5HCIA 5B55A 3RR2A 5AW2A 4JHXA 1P60A 2VPPA 2XCQA 4HDOB 3PUIA 1Z0JA 1Z74A 2ZRKA 2P9FA 2BGLA 5B1HA 1QP4A 3HWRA 4TLBA 2DERA 5B3LA 1VPTA 1GRVA 3E22B 2ILVA 3IEUA 4Y6RA 4XJTA 2M6LA 1XKTA 1WKVA 5I4KA 1X9GA 3KAPA 5IFKA 1SA0B 1SVSA 2WJ3A 2AUMA 3B7GA 5ER6A 5KMGA 1KKUA 2JCGA 1E3EA 4C3VA 4PZUA 3UENA 5F12A 4TWAA 4OKNA 3V4LA 1FNSA 3WFIA 1YZYA 1R37A 1RHMA 1W75A 2PGNA 4HK4A 1A50B 2ZIAA 3O2QB 3MWDA 4DCMA 1W88B 2P6MA 1LTQA 4OQXA 2H4JA 3NHKA 1ATIA 2FPRA 1E2LA 1H8HD 2WP0A 1IBMB 3KS9A 3LZCA 3TTTA 3M6AA 3EVTA 3NS7A 4I9NA 3A10A 2GJSA 2GM5A 4CHTA 4UHKA 4OG2A 2EW8A 1MNQA 4HQLA 4IQGA 4KAFA 4LOAA 4IKEA 4QVGA 3GG2A 3ZZMA 2ZSAA 5JMOA 1PQ4A 2V4MA 3K2EA 1J06A 3RU7A 2A4KA 2GLTA 2PZAA 4B2PA 5DHAA 2E18A 3LSTA 2XWSA 3GFSA 3QNMA 3E5RA 3FMFA 3STVA 3PHHA 4NF2A 3ONNA 4KXNA 1B8UA 1IVNA 1MAWA 3IEIA 2O8FB 3LPCA 2BSQA 3GJ3A 1QQ7A 1RYZA 2J0UA 1H42A 1V39A 2PZEA 3IJEB 3NBKA 5CA1F 2ZK7A 5C1DA 1NT2A 4GKKB 3ZV4A 2C54A 4HEA1 3SKXA 2A14A 1E2JA 1UMCA 3EXG1 2QUZA 1I14A 3O94A 2X7JA 3QPWA 4AFNA 1FDWA 4KZPA 3S4YA 4UMDA 1J42A 1V1RA 1ZLYA 5K0ZA 1JN0A 2ISSD 1BTOA 1VYTA 5K3AA 4BNHA 1N0UA 1PT8A 2PRJA 1T36A 4FFDA 5TY0A 5IRCD 1DSSG 4HWPA 2PZ8A 1WXQA 1RWPA 3RUHA 1WF3A 4KAAA 2OGTA 2ODBA 2BKEA 5B58C 5FJJA 2GT1A 2GLXA 3GEIA 4RA6A 5ADUS 1DX4A 4YP0A 2QOEA 5TPZD 2NZ8A 1EFHA 4BB0A 4JBXA 3KQKA 1GQOA 3IT0A 1UBFA 3AB7A 1QB7A 2D7CA 2WU4A 4GXRA 4OMFG 1KYYA 5GV7A 1PR2A 3SXUA 5IG2A 3ZHXA 1U4NA 4JLKA 2F1OA 4RKFA 1NMYA 1DE0A 4H9GA 3B9QA 3JD0A 1OXVA 2BFEA 1J49A 1TW2A 3RYHB 2ZJ2A 4UEJA 3GAAA 1UBUS 4JJ7A 3GDWA 3FOFC 3E84A 1CF9A 4DM4A 4E88A 4CI9A 1F4PA 4NQZA 4HDKA 3AM5A 4LXXA 4Y2PA 4ZOLA 4DCTA 4XAQA 1DC6A 1DIBA 2HREA 2GM9A 1PEYA 4TKLA 3A0UA 1QB8A 2RHWA 3IA7A 1VJTA 4BO1A 4QU0A 4XTCS 5BSGA 1TCBA 2J7PD 2I2CA 3IAM6 1VIDA 2OAP1 3LXXA 1QDEA 4PRLA 4N0PA 3IELA 3VKWA 4YO8A 5JAMA 3EDMA 5AESA 1E3IA 3PPVA 3T1VA 3IALA 4JDUA 3ODPA 2XRMA 3EW7A 2FOIA 5E2IA 1CZOA 3TNFA 1OX6A 1IVYA 2DQ4A 4M55A 3B6ZA 1U1IA 3TOZA 4JEIA 4J0HA 3ZQJA 4B75A 1DBWA 4JEUA 4ZGBA 1TA9A 1KXJA 1CRZA 2WWIA 4IX1A 2YV5A 5LQCA 1X70A 1NVDA 1WXHA 2HQ1A 3Q11A 2WFZA 3MK31 4YY3B 3SS8A 2OTCA 2GZHA 4K1XA 4OXIA 3R77A 1RRCA 3OA2A 4J76A 5GJBA 3D7MA 3WS7A 1QLWA 3WLRA 4MR9A 4EJ0A 1DCKA 4EW6A 2D0PB 4Z5XA 1PQUA 1I4OA 3PUHA 4MP6A 4QJ4A 3U7IA 5CDHA 2RGGA 2BH2A 1NBMA 2ACVA 3I52A 4ZODA 4AK9A 4QARA 1AXRA 2BHLA 1AN0A 1EJ6A 4M22A 4R8SA 5I47A 5CD1A 1USVA 3KZMA 3JARB 4OH1A 1Q77A 3HBMA 5A6VA 1B42A 1A7UA 1GXSA 4RV9A 4HN9A 3FZNA 1G42A 1TKBA 1RWQA 2QZPA 4INZA 4BN5A 2FZVA 4MUYA 3NEJA 1OJ7A 3OU7A 1XDUA 2AVNA 3LT0A 3O3OB 1X1CA 3NALA 3NC4A 4DRZA 3TMKA 4UEWA 2JGDA 1YHZA 4PIMA 3HXOA 2ZM6B 3DAOA 1EIZA 3K16A 2FQXA 3JQQA 5FX2A 2IH4A 4UUOA 4QHSA 2WAXA 3E7PA 4GU5A 1YS9A 4H60A 4MEBA 3RH0A 3ZI7A 5EE3A 4AF8A 2IX3A 2YWXA 2QTWB 3K9NA 4HNTA 2Y71A 4KR0A 3IEPA 1FQOA 4FNGA 4MCAA 4ZAVA 3AI7A 2OA0A 2YHUA 2GF0A 3FG9A 4YT2A 1XCLA 4UXHA 2XCOA 3I6MA 4H7HA 1PSWA 3EFOA 4HN2A 3E2MA 2UV8A 1T6ZA 2Y1EA 1C3EA 1ZXBA 5EWJA 2ZU6A 3TMAA 1CY7A 5JPCA 2W48A 3BOSA 3D3EA 4LY9A 4UPEA 4EO7A 4F8EA 4ZPXA 4OHVA 5IJAA 4S05A 4LX0A 4LY3A 1HKHA 2FWJA 4KFTA 2OFFA 4CLOB 4ZT2A 1CBUA 5B53A 1XJ5A 1MGOA 3CB4A 4FGUA 2V55B 10MHA 5IFLA 2VHQA 2P1DA 4RIFA 3T7EA 4AG3A 2PUFA 5AUPB 4DE5A 2AYZA 1P5RA 4QDZA 5CJPA 1L8QA 2WTAA 4QVKA 5DBGA 5HMLA 2FRDC 1OV4A 3QU2A 5HF5A 4Z7JA 3Q12A 3TW6A 4C87A 2OMKA 1NXPA 1VJCA 1QPBA 3AYXB 1P6XA 5BRAA 4B8YA 1Z73A 3WLAA 3FPJA 4KNYA 2AG1A 1XELA 2NPIA 4CNQA 1VSUA 3TMYA 3RGWS 2D1QA 1DQNA 4BLUA 3EQ8A 4KUGA 3A1CA 3H9JA 3I2KA 1XWIA 2HA0A 3O0DA 4IF6A 2GASA 3H3XA 3IMKA 4Q3KA 3ENNA 1IN1A 3AINA 2XT9A 1RZRA 2I2WA 1R6UA 3IQZA 2PS3A 4ZYZA 3CKLA 1DADA 4OL0A 4YP5A 5CBPB 4JI7B 4P7KA 3WQSB 3KEMA 4DS3A 2F62A 2ZWVA 5ESXA 1MV5A 3IODA 2MYNA 3WGNA 2GZDA 3CEHA 2WWTA 2VWGA 4G1BA 3OLVA 3UYKA 4QSHA 2Y77A 4EB6A 1KFJB 3ST7A 5BMVF 5MGNA 3IKMB 4ZVTA 2PX6A 2QUAA 2DQSA 3HCRA 2IEIA 4Z4IA 1CFJA 1Q15A 3K0EA 1GR1A 3GFPA 4KXFB 4V03A 2Q2OA 2ZPTX 5EI5A 1NLMA 3FPCA 4YRIA 1T4GA 2C97A 1TM4E 1Z5NA 2XQVA 1L5OA 3SN6A 4ZT3A 2HA7A 3CNBA 4Y6QA 5YASA 2CMDA 4KQMA 4NCKA 2X0DA 4W63A 1T9BA 2FCAA 4RF3A 3DH0A 1X15A 4OV6B 2I7DA 3DZGA 3VO9A 3EC2A 3RU9A 3IP8A 2BI4A 2Q0SA 3BEDA 4G0PA 2BM8A 2FUEA 3NYIA 4KSBA 2IYYA 2PSHA 4NVRA 1FUEA 3SQXA 5KKCA 2CL7X 4FYHA 1LS6A 3LD9A 4JGBA 1RM5A 4OIFA 1BMFA 2VP4A 1LH0A 5BR4A 4JJKA 3TB6A 1CUZA 2ZPAA 5CLQA 3P9SA 4MIOA 5A0FA 1EDBA 1SPBS 3DWEX 4OOEA 4YP9A 4IIVA 1WCIB 4Z3DA 2IZOA 3NHJA 3AR3A 4LRWA 3USES 3U4MA 2CVQA 3PDHA 4JQCA 4KH1A 1K0UA 2AL7A 3QBJA 3NXSA 4ZDKA 4MUMA 3TLGA 1GAWA 3GPCA 2J8ZA 3KD3A 2PCJA 4Q7KA 3NKLA 2V7QA 3BG5A 2PZJA 2X14A 3UK0A 1J0DA 1EINA 2D0IA 1I13A 4GAEA 2V65A 4QG7A 4ZIRA 1K89A 2JGRA 3RS4A 5KX5A 3O8OA 3JQFA 4F3KA 1QGOA 3L7KA 5TMDA 1WDKA 2O8NA 3L0SA 3NR2A 2XB8A 3UAWA 1GL9B 1OLSB 1R7RA 4K9MA 4PSKA 3PS9A 3S2SA 3Q15C 2AI3A 4RU1A 4PG6A 2XOEA 1JFVA 1K3UB 1ZW6A 2OZLA 1FZQA 3NHWA 1L4UA 1YA8A 3M6MD 4IJQA 4B4KA 3MA0A 4EI8A 1X7ZB 2XYRA 1V9CA 4FKZA 2V1XA 4RDHA 4OP2A 1FP6A 5ECYA 2I4MA 3G13A 3LH5A 3O6VA 4FTWA 1CNEA 1VJ5A 5GONB 3UJHA 1KH1A 2V97A 4JXJA 1A4UA 5G1PA 2BMFA 1TE2A 3DE2X 4G67A 4V2IA 4YRQA 5ITVA 5BWLA 3R3ZA 2YJ6A 2VDRB 5HDQA 3KELA 4O4LB 4MVJE 1AQ6A 1B8NA 1YRBA 5L7YA 2WUGA 1DAMA 4HZUB 2JFUA 4ZVUA 2OCAA 4JI2B 3AQ4A 1U8AA 3KFXA 1JHQA 2CFRA 3HB0A 1YR2A 3FB1A 1KC3A 3KFLA 2Q0HA 3QY9A 4O4JB 1ZNZA 5AKXA 1KSHA 5KJ6A 3B52X 3KQVA 2C1XA 4RZSA 1V1MB 2QNRA 2JAPA 2YL2A 4YMSA 5EJ8A 1PTJA 1TYCA 2CE7A 1SZPA 4J0DA 2JDID 2WFLB 1E2IA 2XMRA 1MC5A 2ZAMA 4OSOA 4TL8A 2HWKA 5G41A 1E69A 3SHVA 5KVCA 2BLLA 4XD2A 4H31A 3T1QA 1FLAA 5C18A 4HF7A 3BXXA 3OPNA 3IPYA 3PUJA 2FLWA 2Z1NA 1TIPA 4KQ1A 1ESEA 4BFZA 2QRUA 3GJYA 3G2JA 3V7WA 4LYYA 3L9WA 3EIEA 5A5EA 4CTOA 4MV0A 3OCJA 1JBKA 4OKIA 1LWNA 3E53A 1NVUQ 3F5SA 2F9MA 2W6CX 2A0FA 3PSHA 4XEHA 3TECE 2PV0A 1XQYA 3OIUA 2EWMA 2RBEA 4XLLA 3MAJA 4UTZA 2BFDA 5A6SB 2QVBA 1KPIA 1KAMA 2XMPA 4UDYX 4D45A 4EP1A 1DS6A 3ESXA 4S04A 3U13A 1W8IA 1KEUA 3BVPA 2PPVA 1KK3A 3V4RA 2PN1A 2DTDA 2QX8A 2ZBPA 4L85A 4REQB 3VOTA 1WUHS 4BEVA 4MPRA 4F6RB 1RPNA 1VG9B 2EKLA 4LDAA 1I4EB 2ODNA 4MCJA 2NSJA 4PLFA 4QOIA 1AF4A 5TB5A 3WB1A 5A62A 4RULA 4N8DA 3E9EA 4BJ1A 4D8XA 5JJCA 1C0EA 1SC3A 1W94A 2CLLB 3C14C 3JZIA 4A4DA 3VHXA 4PHFA 5ICEA 4MUIA 2DWPA 1Q19A 4NFYA 1I2CA 2CCGA 1GDDA 2OUKA 3N9IA 4FHFA 3TBKA 2HDHA 4B2LA 2P62A 4WK4B 3DEFA 4AJOA 2HNKA 2QTVB 1K2VN 4IFIA 4P2GA 4PPQA 2Z2XA 4NHOA 4ER0A 3RJ5A 1BNCA 4M7RA 1ZHHA 3ADOA 1JI0A 3QEOA 2FLVA 1HE2A 1JMKC 2PMKA 3CTMA 3NVAA 5CVUA 3WHPA 3CNNA 3ZWDA 4EPTA 2BEWA 4G8BA 1HT3A 4LSGA 3TLCA 5ALFA 2PK3A 1NKSA 1GNLA 3OM8A 4II2A 4NOJA 3W8NA 2Y3IA 3TQFA 5I7OA 4LJAA 2VSFA 4NZ9A 4XQEA 5FI0B 4BQEA 1V7ZA 2QP9X 2VAXA 2EQBA 2IU0A 1KC1A 4P6VF 2JFGA 4U2DA 3K6RA 2PAFA 3CM0A 1H05A 3P9YA 3B1KA 3W04A 2WI8A 2BELA 4YCJA 3P9XA 3VHQA 4GBED 3ZTYA 1HEUA 2ZRGA 2GJ9A 3WWZA 3P9QA 2W4IA 3SXJA 4C0JA 5BN1A 5C7OO 1ONSA 2DBRA 3K1AA 3KUKA 1IJFA 3JD4A 3BICA 3ANYB 4DQ0A 1BDMA 1HK7A 2NYRA 5HR5A 1Z6AA 2DYKA 1XC7A 4JWKA 3HFSA 4PC2A 3I2JA 4ZOLF 2NQ8A 5DTIA 4JYAB 2J5KA 1Y9JA 3WLSA 2R7NA 5EJ5A 2Z4SA 4R1UA 5DHRA 1QGZA 4MS3B 3RVBA 3OKPA 4UU1A 5KHLB 4EA8A 3M8KA 4KE6A 5DM4A 5JD5A 2JFBA 2K2QB 3N7UA 4KN8A 2J5QA 3GK3A 4IJVA 3SOPA 4KREA 5BYJA 2NU6B 5A0TA 3AF2A 2A9PA 2G5GX 1ILEA 3ROKA 5TC4A 1N9KA 2XQGA 2PJZA 1AUPA 3QUAA 2BKAA 1ULAA 2P8SA 1N7IA 2G1JA 3ZU6A 4HNAA 3A1FA 3SPXA 4M98A 4OK3A 1CZRA 1KYVA 4JQYA 2Q6TA 3NORA 4LJ8A 4J0JA 2XCTB 1JGTA 5H3LA 3AHCA 2QLMA 5LQSA 4NXMB 4Z99A 4S1OA 4F92B 2I6TA 4WNAB 1FSGA 1NM5A 2IHVA 4LTMA 3BAFA 1IY2A 3BRWD 4YPOA 1VE3A 1SXQA 1KO5A 2O23A 2DRIA 2O7RA 2WOOA 2UVPA 2XX3A 3GUUA 1VGQA 2RG1A 4G9EA 1V16A 4UAVA 5CGZA 2C4HA 4XWWA 5DKFA 2XGJA 3TVDA 2ENWA 3WLNA 2BKVA 3CNQS 1U8YA 2Q1UA 3KRTA 2FPXA 2PVSA 1G38A 2H4ZA 3S2YA 3KR0A 4JYBA 2LPMA 2R8EA 3FMPB 4C3ZA 3T9AA 3ILHA 3WL8A 1GU0A 1DBRA 4MWBA 1NVWQ 1TVCA 3I1YA 4ALMA 3RC1A 1FS4A 2JI4A 1RLMA 1RZVA 3MBIA 4Z0NA 4N03A 3U16A 1GAJA 3PNMA 4YXWD 1JEEA 4ZP1A 1E6UA 1UP6A 1G8FA 4G4IA 2AFIE 2AZMA 1JXAA 4G1FA 4N6OA 2ZB7A 5ALHA 4TYNA 3GMSA 2WUFA 3CG0A 4RPKA 5JE8A 4M9XA 3C4VA 2VXYA 1NLYA 3JR7A 1GILA 2F43A 1K7YA 2XWQA 3PTLA 1FNDA 2BR4A 2OCKA 1DQYA 1R0WA 4GI2A 4BX9A 1ULUA 2EJTA 4DXAA 2FR8A 4WFJA 3T38A 2ZRBA 4XM1A 3OEED 1PCXA 2FXVA 4I46A 2B1GA 1NL3A 1N0WA 4LRTB 4MWZA 3RDPA 4CG0A 4BFUA 5KEIA 5LM3A 4EPRA 2XMQA 1SR8A 4EA9A 4HVLA 1M8PA 2JBWA 3JQ9A 4WWHA 4EY5A 1NATA 1W2GA 3HKCB 3D0QA 3MINA 3VZBA 3J81A 4QYTA 4Y3UA 4NDAA 1CE8B 4XEUA 2WV7A 1GA4A 4PLYA 4LGYA 3JASA 1ZMBA 4YMIA 2ZJ7A 3PXEA 3PC7A 3ROZA 3PYMA 2R1VA 5M7EA 2QN1A 4AKSA 1RKBA 4WSOA 2GB4A 3EY9A 4DXDA 2WZBA 3L7OA 2O5EA 5JJKA 2GPBA 4D26A 3LK7A 2WZCA 4IGFA 3QKUA 4J1TC 5DSTA 2UZ1A 4IOKA 3EH2A 2HPHA 2W11A 3EEOA 4AD8A 3ZHTA 4LF8B 3GRVA 3IB6A 1ZPDA 3TXAA 3KT6A 2HM7A 1QLJA 1I9GA 4HH1A 1VHJA 3T0GA 2VJPA 2WJPA 3PFNA 3PGKA 2E1RA 2HQRA 4P5PA 2C5AA 3C4QA 1NE7A 5JVDB 4PONA 3PPXA 2IGTA 4CMCA 2QTNA 1G16A 3CCFA 2O3SA 4WXHA 3H6KA 2E9SA 4WEOA 2H9AA 4BNGA 3E3AA 3I61A 2GRAA 2XNSA 2VTVA 5EKDA 5G0WA 4FQ8A 5LDDC 2Q41A 4I0WB 3O8QA 1XCBA 3IOMA 3UMRA 1BVRA 1C1XB 1H2ZA 1MFPA 2HMAA 2B5WA 4P80A 2FX2A 5DIFA 3H3JA 4QASA 3AEUA 1XAJA 2HLDA 2R6R1 4CLRB 5JXGA 5JZMA 3LPMA 4L73A 2MCFA 3MWKA 1ZGCA 4RQUA 3I4LA 4TLMB 4EI2A 4N5NA 3NT4A 3A0RB 3SDZA 3QUCA 2GX6A 4HMQA 4XARA 2G5CA 3I39X 1QC5A 1J56A 1KPGA 4GI5A 1R4ZA 1UFRA 3P9RA 2HQSA 3UUGA 3AG5A 4F85A 3NX4A 4IUDS 4YJ2A 3VR2D 5FT9A 4CTJA 4HUQA 1O6CA 2IDZA 1E6EA 5FOQA 2V4ZA 1Q84A 1EM8B 2AXPA 5FL7A 3I1FA 2RE8A 4M99A 3GEBA 4GYWA 1M75A 5B7PA 3HPRA 1ZK3A 2YQZA 3WI7A 4DR1B 3ESAA 3CB2A 4TMYA 5FADA 3HB1A 3P96A 4FJ1A 4GLFA 2PUHA 3DOCA 3GQBB 5LKRA 4N0MA 4YMUA 3B3AA 2VQFB 2G67A 3IDFA 1Y9EA 3H11B 4L28A 2ZQYA 3MWGA 3MCZA 4FX2A 5DBIA 4K87A 2V03A 2YKGA 2YMPA 4HVCA 3WP0A 2J4FA 3GEPA 2NVWA 2YICA 3EF1A 1I36A 3IT2A 3I04M 4RLQA 4CQLB 1D4AA 3CO0S 4EBBA 2PUEA 3AMVA 2B8JA 1D1TA 1JQAA 2AQ8A 3PICA 5HIMA 1XMPA 2XCRB 3OP1A 1GTG1 2VK4A 1XTSA 3I34X 4MKIA 1DJNA 1MC1A 2C2MA 1JIQA 3I83A 4F11A 2JEOA 5DBOA 5U4XA 5KX5F 3NWOA 4HNHA 4OB8A 2YH2A 4FB4A 3I53A 2Q45A 3BMOB 4C0QC 2R48A 4E12A 2HUPA 1Y5LA 4S2EA 3O2SB 5ALRA 3UTCA 3O75A 1EVLA 3ANXA 2YTZA 3I8XA 4R40A 3SY8A 4XOUA 2XVAA 1VKOA 2V4UA 3SIPA 1KYTA 4DDKA 2JLWA 1FXSA 1V6SA 2C4MA 3QHAA 1QNFA 1JG4A 2NT4A 1JPJA 1KJNA 4AZ3B 4HYQA 4DC1A 4KXVA 1IRIA 1IL0A 1IEWA 1O6FA 4MWDA 4C4TA 3PEVA 2AMVA 4Q1DA 3AIKA 2O07A 4U39A 5JH7A 3CLSC 1JEYB 1W96A 4FWIB 1TNDA 1A4XA 2ZJFA 3M6FA 3WRYA 3E03A 4EHBA 5A4FS 2GEJA 3IP1A 4RWEA 4FLMA 3GHHA 2IW1A 4O2RA 4WQMA 3OUZA 1M1UA 5CX1B 2JGIA 4IGEA 4OFXA 4FFLA 1SOAA 3O7MA 2YVKA 4UE2A 3C3XA 4RTSA 4UEQA 1HZZA 1AN9A 3PT5A 4IFBA 4BJ5A 3OSZA 3LYLA 4UNNA 5I7RA 2HSEA 2WTUA 5AVRA 3FHTA 1DKNA 1ISRA 2FDRA 5F9HA 1H23A 1RYBA 3O74A 1Y42X 1RYNA 1A9YA 4PAOA 3QUBA 3UC5A 1RHQA 4KTVE 3DVQX 4A2QA 3B82A 4DREA 5IBRA 3VVCA 1SCBA 1UODA 2JCXA 1A7AA 5C7IO 4R2XA 3S6JA 4Q1VA 3RC3A 3KQUA 4QA9A 3MT8A 4POOA 2Q21A 2ON6A 5ELMA 3R9WA 1QM5A 4RS3A 1V6CA 3DBVO 4HB4A 5DWQA 2DLDA 1EFPA 2DPYA 1CY8A 2MSKA 2NZUG 3IIIA 1RMYA 1KPHA 2BE7A 4WKBA 1MFZA 3ZXXA 1OH7A 1H0SA 3A2MA 5CCEA 1YDGA 2Q5EA 3MUFA 4R7GA 4XR4A 1J2YA 1N7JA 2IP2A 3KZKA 3N8DA 4UZFA 2E4XA 5D6NA 4NK4A 3WIEA 3M5CA 3ZOKA 2RC5A 2FAXA 2HCFA 1ODJA 3MGBA 5KZMB 4TMWA 1UZMA 1HSZA 2YVUA 3DR3A 2BE9A 1U6JA 4BIIA 3R8FA 2B4QA 4DRXA 4G0YA 1QHIA 1WB4A 3F8SA 3T3DA 3U31A 3WLFA 4JUFA 2JGAA 4UM7A 5LWHA 4JD5A 4RTNA 4KGDA 3R24A 4WZ6A 4MS1B 3RKSA 2JKZA 4HDNB 4R8KA 3ZWCA 4CCYA 1VL5A 5B57C 3QV1A 1H2FA 1F7VA 3IIJA 3ICVA 2IPOA 2VCHA 1I3KA 1PT9A 3IMCA 4TM8A 3SDSA 3H1PA 3OOEA 3P0EA 4IO1A 4D9MA 2A9JA 3A7EA 5HZGA 5KSZA 2Z2JA 4YCLA 3FTQA 2ZG6A 3HDQA 1VE7A 5EINA 2AB0A 5H9WA 3VH2A 3AEKA</