4BB6A

Free-wilson and structural approaches to co-optimising human and rodent isoform potency for 11b-hydroxysteroid dehydrogenase type 1 11b-hsd1 inhibitors
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
266
structure length
266
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPLVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPSRKILEELYSTSYNWDRFIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Free-Wilson and Structural Approaches to Co- Optimising Human and Rodent Isoform Potency for 11Beta-Hydroxysteroid Dehydrogenase Type 1 (11Beta-Hsd1) Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
total genus 100
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4bb6A00
4DYDA 1O6ZA 3JD2A 2VYND 5U4QA 3UN1A 4BKOA 4TROA 1WP4A 1NQTA 2DTEA 1PL7A 2Q3EA 3AU8A 1D1SA 1PS9A 3ANLA 1DIBA 3MOIA 5HM8A 3AW9A 3HN7A 4I5DA 2P68A 3OHSX 5I7EA 1ZEMA 4DIFA 3UHAA 4FSHA 5KOIA 5KKCA 3ASVA 2GZ2A 1E6WA 3HB4X 4L4RA 3UICA 2EGGA 2E4AA 5H83A 1U8XX 1Q0HA 1C0PA 3WBBA 3PJGA 4BGIA 1PGNA 2VUUA 4XA8A 3W6UA 2D2IA 3LT0A 3O8QA 4YQZA 1GV1A 2EKLA 4BNFA 5KIAA 3VZPA 2JKVA 1DDOA 2PNFA 4WEQA 4G81A 2I6TA 2HJSA 5EQDA 4IDGA 1QG6A 4ONEA 2WYVA 4RJTA 3BXXA 2EW8A 3RJ9A 5GMOA 4PN3A 1X13A 1BSVA 4OOFA 4BV8A 3K31A 4CLOA 3IJRA 4JCOA 1LDMA 2JCVA 5TJ9A 4I5GA 3Q0EA 2A4KA 3U4IA 4GGOA 5C7LO 4BMNA 2HLPA 1AGNA 3QVSA 5B12A 1RM4A 1EBFA 2O4UX 4A5OA 1JWAB 1ZMOA 3C24A 2X1HA 3PP8A 1X1TA 1ZCJA 2AQHA 2PR2A 3S1LA 5CAEA 3GG2A 1DEHA 4PG4A 4TRRA 1PJLA 4NI5A 5T5QA 3KYBA 4S1VA 1NTOA 4XQ9A 2HCTA 2OMEA 4I9UA 1WMAA 2QX7A 3AOEC 3E5RA 5I9MA 5HRUA 4W99A 1DC5A 1L7EA 3V8BA 4UAGA 1PJQA 1Y8QB 1YRLA 4AJNA 3PXXA 4AICA 4UEJA 4ALIA 4XGNA 1GZ4A 4CMIB 1P31A 1EVJA 1KVSA 1CF2O 3C7AA 4JBHA 1O5IA 1ZO8A 3JQAA 4E5PA 1ZXBA 4E3ZA 5IZCA 1ZMTA 4M49A 5HBRA 1GL3A 4HNHA 3DBHA 1T26A 4Z6KA 5C7IO 3LZ6A 5TS3A 5CEJA 5BR7A 3D4OA 1JVBA 4LISA 3HHPA 5IXYA 3DO5A 2F00A 1WZIA 4NG5A 4A10A 3QY9A 3IIEA 1BMDA 1EDZA 4D0SA 3FNEA 2WYUA 3LLVA 4J1NA 4PRLA 2D5AA 3RBZA 4CQLB 4WPGA 3WBFA 4NBUA 1A9YA 1LDNA 5IN4A 1F8FA 4NQZA 1F8GA 2GZ1A 2I5PO 1C0KA 1U3VA 4FCCA 4IDFA 1DIAA 4WE3A 1V3TA 4XZ3A 1AN9A 2OGUA 3JYOA 5FEUA 4QEDA 2DQ4A 2NM0A 2BFMA 1GAEO 5I7VA 1E3LA 1EE9A 4ND5A 3EUWA 1U3UA 5ER6A 3ZI0A 3I9LA 3FRJA 5K9ZA 3UVEA 3JYQA 3D3WA 3ZU3A 4CR8A 4BNWA 5JSFA 3KETA 2W2LD 1GV0A 2AG5A 4HADA 5HA5A 3T7CA 4TVBA 5LDGA 5MDHA 4FOOA 4EZBA 1YDEA 4RVFA 2J8ZA 2WEKA 2BFAA 1D3AA 2J3JA 1ZIDA 2VRBA 1O89A 3HDQA 1ZZEA 2ZJ1A 2GZ3A 4J43A 5C7OO 5KCZA 1XG5A 3QQPA 1HDXA 3ETDA 4RQUA 3LC1O 4A73A 3GDGA 3INTA 3HDJA 3KEOA 3L9WA 2YW9A 4PZCA 4G65A 5CEFA 5JDCA 3NT4A 3EYWA 1HXHA 3CPSA 3PK0A 5AQ1A 3SLGA 2A94A 1QYVA 1J4AA 2BFPA 1XELA 4J3FA 1M67A 4KDEA 1DXYA 3WJAA 2DBVO 3ZW9A 5KJ1A 3E03A 3HG7A 4H7PA 2Y93A 3ZHYA 5G0VA 1MX3A 3DBLB 4BB5A 4DA9A 4XQCA 4BNXA 4R5HA 3WXBA 1Z7EA 5FWNA 2B4QA 2H63A 2XXJA 2G82A 3ENKA 1NYTA 1QRRA 3HDHA 3OJFA 3SC4A 4E33A 1GUYA 4LW8A 2OZPA 1FDTA 2OL4A 2Y1EA 5L3ZA 4B7XA 4RL6A 1IULA 1CDOA 1JTVA 3UW3A 2OBYA 2CDAA 3AK4A 1KVRA 5HTOA 1A71A 1NWHA 4WCDA 3IJPA 4D43A 1U5AA 1LLCA 2YHUA 3ZWXA 2P4HX 4IJVA 3I9KA 4J2OA 1B3BA 4CMGA 4PG6A 3I6QA 2X5OA 1LDGA 1KBZA 2XOXA 5C37A 2AEJA 4K6FA 4XWYA 3VPSA 1EVIA 1ZH8A 3JQBA 4M89A 3QVXA 1PR9A 5A9SA 3DB2A 3EVTA 2Z5LA 3VKVA 2C07A 3GRPA 2BELA 1LQTA 4IGEA 3I4FA 3DL2A 2EF1A 4U6SA 2UYYA 1AHHA 2PH3A 4OSPA 4IXWA 1FDSA 2ET6A 3IP1A 1O9BA 4L4SA 3K96A 4Z9YA 5BNTA 2OUIA 2WDZA 4OAQA 4BNYA 1HE2A 5IAAA 3T4XA 2RIRA 2QYTA 2R00A 3B1JA 3E48A 4KOAA 4IS3A 4F6LA 1MXHA 1ZK1A 1SOVA 3PLRA 4RF3A 4FR5A 5EJ2A 4C4OA 4CM9A 4IJKA 4ZGWA 4XB2A 3ZV6A 3TZKA 3BMNB 3PFFA 2P9EA 3GK3A 4PLFA 2JD2A 3RC9A 3ZWWA 3PWSA 2BRUA 1EZ4A 2UV8A 5CHEA 3IUSA 3TL2A 1KETA 4BV9A 5HS6A 2PLAA 3W8EA 1ORRA 4IBOA 4FOSA 3GLQA 6LDHA 3MWDB 1KY4A 4EEZA 1HF3A 3HE3A 1E7YA 3ROMA 3JQAB 3ZU5A 2AE1A 3PWZA 1TT5B 3VC7A 2ZCUA 1TXGA 2FSSA 4EUFA 2Q2WA 3IMFA 5TT0A 3A1NA 4Z0TA 3RUFA 5JAQA 4RO0A 3OECA 1JAYA 2G1UA 3TZHA 2GUGA 4RGBA 2YQ4A 4P38A 4P8RA 2IZ1A 1YGYA 3WGTA 3BZUA 5G0SA 5G2OA 3F9IA 5JDIC 4GX1A 1U5CA 4IS2A 2UUPA 2VWHA 2C0CA 4QT0A 4U5QA 3VPFA 3RUEA 4R1TA 2X0JA 4MVJA 5DZSA 1BDMA 3GVIA 3ORFA 1H0KA 3OQ1A 4W9NA 3FTPA 5DCUA 3X2FA 1LXCA 3E1KA 1Y9AA 5L4NA 3AJRA 3HNPA 3GT0A 4N7RA 1LEHA 4Q3EA 3CEAA 3KLMX 4URFA 2XPCA 4GWGA 3HZZA 1PZHA 2PD4A 4RF4A 1UZNA 4CJXA 1Y5RA 2BMAA 4GX2A 3ZHBA 3GNQA 4ZQGA 2Y66A 4CM4B 3VPHA 1HZJA 4IDAA 1ZSNA 4OMUA 4O5OA 1LUAA 4PLTA 3KXDA 3NT5A 1EVZA 4OL9A 1LDBA 1KY5A 2FPIA 1QXSA 3ZHXA 4TMFA 3WQRA 1YL5A 1M2WA 3GA0A 2Y05A 3TZCA 4DMLA 4BGEA 3GRKA 5ILOA 5TF4A 3I9NA 3OJLA 1HE4A 4NHEA 5A5FA 3BTUA 4N5LA 2ZYGA 3RVDA 1N5DA 2X5KO 2FR8A 4RV9A 5IZ4A 1RM5A 4L8VA 2X0IA 3AUSA 3K8ZA 4MKRA 2VNSA 3BTVA 3AFMA 1VJTA 2R2GA 4U6QA 3PJDA 3LU1A 3OMLA 4QSMA 2Y67A 2JFGA 3WYBA 5L7TA 3PQFA 4L74A 3NJ8A 1XYGA 1C14A 4IDBA 4MIYA 3NJ4A 1MC5A 4W6ZA 1NASA 2PGLA 1XU9A 5ICMA 1MV8A 3V2UA 3DC2A 4L73A 2C29D 1E7MA 1CERA 2VTEA 2H5LA 2OP1A 4BO4A 8ADHA 1F17A 2X58A 4CV2A 4DPKA 1WVGA 1YKFA 4NU5A 2YDXA 1YBVA 3RFXA 3GPIA 3C85A 2OHXA 4YTEA 4XQGA 3RWBA 2ZB8A 1ULSA 2ZYAA 4CMAA 2DFVA 2HO5A 2IZ0A 1A72A 3NX4A 1R6DA 3V1UA 5B1YA 3KLPX 2PGJA 5FI5A 3A4VA 2EWMA 2HK8A 1YDWA 4K26A 4FB5A 1YQDA 5JCXA 2XF8A 1JDJA 3DFUA 3KM0A 4GX0A 1HDRA 4WECA 3NUGA 4GX5A 1W8DA 1H5QA 1T2EA 4IJUA 3GVPA 5IDWA 3RUDA 1H2BA 4CLRA 3PYLA 1H94A 5B4UA 3RC2A 3ADOA 1YONA 3KZVA 1NFQA 5COAA 2R00C 1MC4A 1HLPA 1T2FA 3C1OA 4YR9A 2FSVA 3MJCA 2I66A 4RVSA 3FF4A 4XJTA 3VVBA 4RVUA 5GZ6A 4GSLA 4R3NA 3QVOA 4GQAA 1U7TA 3ZV4A 1PWZA 5JBIA 1DC6A 2G17A 1E77A 1DJQA 2NU7A 2B0JA 4NH4A 3JQFA 4ALMA 5TQVA 3H9JA 4GPD1 4JIGA 3AOGA 4XYGA 4HBGA 2E49A 4QQRA 5KKAA 2PTGA 4NBTA 2SCUA 3H65A 4LVCA 3DEYX 4NJMA 3QRWA 1YQGA 3V1YA 3LK7A 5JDCC 4WNIA 2PH5A 1C1DB 3NT2A 1SOWA 2GD1O 3U4DA 2DM6A 3WGIA 2EERA 4J4HA 4DYVA 4EJMA 3WX0A 1I10A 1MGOA 3F4LA 1GR0A 4WLUA 2AQIA 1E0DA 4D45A 5KJCA 4WJZA 5KTKA 1YBMA 1V8BA 4WLNA 5JW6A 4B4WA 3LLSA 1I5RA 3CZRA 3SBOA 1U3TA 4EYEA 4KWIA 2CSUA 1KYQA 4IQGA 5TLSA 4FIZA 2WYWA 2AMFA 1A7KA 4CLXA 4ZQEA 4PG7A 2D0IA 2VZ9A 3RJ5A 4CR7A 4BO5A 4WLOA 1O8CA 4UUPA 2HMVA 3C8MA 1QYDA 3RFTA 3GF4A 4NFSA 4CLEA 4E5YA 5GZ1A 1P1IA 3OA0A 4RZIA 1K0UA 3M2PA 3ABIA 5TX7A 3V5NA 1Y81A 4F46A 3DZIA 2YV2A 2CVQA 5JMWA 4F45A 3M1AA 3B20A 4R9RA 2VYVA 4X54A 5MGBA 2Q49A 4YWJA 2HRZA 1KC3A 2V6GA 1E3WA 2WD7B 3R3JA 2AQKA 2HRBA 4TVOA 3CH6A 4OXYA 5KJ6A 2UDPA 4GKBA 3UXYA 1KEPA 2Z1NA 4D42A 4N54A 3GVXA 4ID9A 5G0TA 2BFOA 1V6AA 3AM4A 1E92A 3DHNA 5CDYA 4F3YA 1DRWA 4R41A 1CRWG 3OIDA 1DBVO 2VYVD 3NAQA 5FF9A 4BNIA 1Z45A 4YT8A 1U8FO 1ADBA 1XKQA 1DAOA 4I1IA 1WAMA 3GZNB 1TA4A 1HRDA 2J5RA 2EEZA 3JQAD 3IUPA 1NFRA 3K30A 5IXSA 3H9QA 1AUPA 4MKZA 4BKUA 3NTQA 3A9WA 4ND3A 5FYDA 3LVFO 4A2CA 3GGGA 3KYDB 1ZK4A 1VL0A 1HDCA 4AVYA 4W7HA 3KYCB 1I8TA 5I9NA 4BVAA 3K9QO 1NPTO 1U7HA 1PZEA 3AOEA 3BAZA 2FPGA 2QRJA 3MWEB 4PZDA 4ALKA 1Z6ZA 2IRWA 3OJ0A 3JQBC 4IDEA 1QLJA 3IDSA 3T4EA 3KUXA 4KUEA 2WE8A 2B69A 1EK5A 3LT2A 2DTDA 2BI7A 1U2GA 3K73O 3WDSA 3P2OA 4E2YA 4GGPA 3TOXA 4DPMA 4YBZA 4J1QA 4HFMA 3ZW8A 3GG9A 3G1TA 1U4OA 2VOEA 2VT2A 3ZWOA 4DQVA 4NFHA 4CV3A 3H9EO 3KSDO 2I65A 3GUCA 1LLUA 3JYLA 2C82A 4FFLA 1QYXA 1IHYA 1B8VA 4NJMB 4NDNE 4ZJUA 3KB6A 2YZ7A 2ZB7A 1WDMA 1DHTA 4E13A 3DBLA 3CKYA 5T67A 5KVQA 3HUDA 3AY7A 1XHLA 2V65A 4YAEA 2PGDA 5CFZA 1YH3A 1YVEI 5BNFA 3RC1A 3DXFA 5DCWA 1FDUA 4CQMD 3ANNA 3NTOA 3AWDA 1MB4A 2ZB3A 1NQOA 2Y1CA 2QHXA 5LDHA 3LT1A 3U4HA 1HLDA 3AUAA 3U49A 1IE3A 3L0DA 4AJ2A 3JQ8A 1BWSA 4Z3DA 4N5MA 3VKUA 2E82A 4J0EA 5DN9A 1BW9B 2P5UA 1DIGA 2I76A 2I99A 1IY8A 4UVIA 4QO7A 4E2XA 2O2YA 3WR5A 1PQUA 4Q3CA 2RH4A 1N1GA 4CQMA 3VTZA 3JD3A 3DBRB 3STHA 5U9CA 2C59A 1ZKMA 2X9GA 2O2SA 5F1OA 5AVOA 4EI2A 4D3FA 3H8VA 4BIIA 4WK6A 2VRCD 4R68A 5T64A 4DIBA 1NVGA 1GQ2A 4YDRA 4AJLA 3WICA 1OC4A 3RQSA 4FS3A 4YVFA 1I2CA 3MJTA 4BMVA 3KBOA 3C1TA 1UXJA 4OHUA 3UH1A 3BYZA 1Y8RA 3PZBA 1WNTA 1LDEA 3AUUA 1JW9B 3GY0A 3ZU4A 4FD3A 1SC6A 1DRVA 2VRCA 3ZV5A 5ENDA 3AI2A 3ZDFA 3SXPA 2O3UA 3PLNA 4XYBA 1GCOA 1XQ1A 5IDXA 4J1SA 2GN4A 1UDCA 3UGKA 4OO3A 1B7GO 1MA0A 4BNMA 1V0JA 1I36A 4R4JA 3GPDG 3DAPA 4MDHA 1CQIA 1YJQA 2EJVA 4MPDA 3VPXA 1E3JA 2ZKLA 4YT2A 4AJJA 1FMCA 5DT9A 4CM8B 5CG1A 1K2WA 4KP7A 4M1QA 2BKAA 4KTVE 2QQ5A 3NDIA 5DOVA 4UREA 3WOHA 2E37A 4ZA2A 3L6DA 3BIOA 4O0LA 5L4SA 1BTOA 4HV4A 1MXFA 3PHGA 2PD3A 3O8QB 4BNTA 5AXDA 4CMEA 1QKIA 3M6IA 3GR6A 4ALJA 1RYDA 1SCUA 3UKOA 2RHCA 2IZZA 1VE9A 1NHWA 1R4NA 4BO9A 3WSWA 3EAGA 1N9GA 4BNZA 3FNFA 1RYEA 4Y9DA 3FR8A 1LSUA 4RPLA 4Y8VA 1OI7A 1I33A 3JQGB 5L45A 3OF2A 1CYDA 1Y1PA 4ZRMA 4AJ1A 1S6YA 4OXKA 1O95A 3GAZA 2Y0EA 4B4UA 2P2SA 4QXMA 3JD0A 4H16A 1T2AA 1Y7TA 1LC3A 1A9ZA 2Y0CA 2J5QA 1ZUD1 2LDBA 3PQEA 4KTTE 1UR5A 4JK3A 3L4BC 4M8SA 4ZD6A 2Q4EA 1SO8A 2QG4A 4YJGB 2PZJA 2YHIB 3ST7A 1NVMB 2IXAA 3E6AA 1CWUA 4BO3A 5GZ3A 1YL7A 4J90A 4Z9XA 3VDRA 4B4OA 2YY7A 2C2XA 2JHFA 4JJFA 4WNCA 1VJ0A 1BRMA 1PGPA 1UXHA 5EQFA 1PZFA 2NADA 4CMIA 4GLOA 2FR0A 3CXRA 4NU6A 5DBFA 2AW5A 4EDFA 3P2YA 4KZPA 4PCVA 4JNKA 3EC7A 3TNLA 4B3JA 3K2BA 4E31A 5IJZA 3JQDA 4KDFA 4IJWA 4Z0HO 1LBEA 3L9XA 4LSWA 4ALNA 1T1SA 4K1LA 2P9CA 1GYRA 3PHHA 4MVJD 4FDAA 4XYLA 3FN4A 4W82A 5EIOA 6ADHA 2W4QA 2FR1A 2HMUA 1W73A 3BMOA 1N9GB 1ID1A 4N18A 1KOLA 3WLFA 5JS6A 2EGHA 3ZWMA 1FJHA 1KS9A 4WEOA 4WOKA 5C3MA 2V7PA 4E32A 2IEDA 1MUUA 3MCVA 3OICA 4JP2A 2YJZA 4IZIA 1N7HA 4TRNA 2NUAA 3L77A 4WUVA 5IN5A 3EZYA 3WFIA 1IPEA 4CMEC 1NAHA 2I67A 4J91A 4MVJM 4R3WA 1DFGA 4A26A 3B1FA 2A9FA 1HL3A 3FPLA 1VL8A 4YACA 1I3LA 3MZ0A 3VZSA 2AEMA 4GL4A 3F5SA 2YQ5A 1EE2A 1TEHA 2YHIA 4XIJA 2HK9A 3BMNA 3F47A 1OFGA 4CM8A 3QA9A 4JX8A 4QFDA 2Q1SA 1KIFA 1Q7GA 1G0OA 2Z95A 4G2NA 1BW9A 1BGVA 4UVHA 2D3TA 3F46A 3PDJA 3RUAA 4PLHA 3OJOA 1U1IA 4CV0A 4E6PA 2G5CA 4TKLA 3WGGA 2PA3A 2EW2A 1DB3A 1NPYA 3QHAA 3EVNA 1Z74A 1PGJA 1QORA 3KV3O 4HNGA 5JY1A 3HADA 4BNJA 4CL8A 3MJEA 4EW6A 2QIOA 4HKTA 3COSA 3IOYA 3PWKA 2DPHA 4RVDA 3ZU2A 4XRGA 4QTZA 1X14A 3BMOB 2GR9A 1B26A 3ZV3A 2NVBA 1EQ2A 3RD5A 1P1JA 4BGVA 1U4SA 2IDZA 3FBTA 4DRYA 1Z82A 5ILGA 4UVGA 2DU8A 1PZGA 3ENNA 3I5MA 4D7AA 1PJ2A 4XYMA 3OEYA 4ZQHA 1UXGA 2DC1A 2QRLA 4MOWA 3UCEA 4CUJA 1R12A 1R16A 1UDBA 3BA1A 5DP1A 5A02A 4EEXA 1QR6A 3JQ8B 2V6BA 3WGZA 3LDHA 3DQPA 4ZQFA 5DULA 1ONPA 1QYWA 1UAYA 3C7CB 2J5KA 1LU9A 4J1TA 4CLRB 4Y6PA 1D7OA 3MOGA 3F4BA 4FFPA 2YFHA 2JHGA 1LC0A 3CIFA 3E18A 2RAFA 3K92A 2BGMA 3I23A 3WWYA 3OA2A 3FTNA 2RH8A 3MJSA 3EDMA 4YRBA 4YJFB 4I9HA 2NNLD 1MG0A 2QZZA 2F1KA 3ETGA 4Q3NA 4WASA 3DOJA 3O9ZA 4BO7A 4FGSA 1DIRA 4II2A 1XQ6A 4XYEA 4I8XA 3AY3A 4NMHA 2NU9A 5THQA 5EPOA 4JXKA 1PGOA 4UULA 4CLHA 1Y8RB 4P4NA 3KEQA 1LRLA 3I9MA 3QLJA 1RPNA 1C1DA 3H2ZA 4GWKA 3RC7A 2JCYA 3LYLA 3SC6A 5CP8A 1BVRA 4WGGA 4YT5A 1EDOA 1G1AA 4QX6A 4CUKA 1QLHA 3PZRA 2QRKA 5GY7A 2POQX 3L6OO 3WNQA 3RIHA 1YQXA 3T7EA 1K5HA 3WIEA 3ONDA 4TSKA 1H6AA 3CUKA 1E5LA 2B4TO 3D7LA 1NHGA 3H3JA 3PPIA 1E1LA 1GD1O 5KVVA 1EEHA 1JN0A 4PLVA 3RAJA 5IZCC 1F06A 4UUMA 4RPJA 3DZBA 3W8FA 3WFJA 1B3RA 4FFRA 3KTDA 4CMJA 3GQVA 1KERA 5A5EA 1EUDA 5HS4A 4OQYA 2TMDA 3BTSA 2C54A 4W7IA 4J2HA 1LSSA 2WTBA 5JAZA 1E7RA 1PJSA 4TZTA 3QWFA 2H6EA 3MTGA 3DMTA 4ILKA 2QYSA 5KJEA 1ZFNA 2FY8A 2W2KB 3L07A 3WYEA 1KEVA 4GBJA 4ZN6A 1ULUA 1PX0A 4BS9A 1I3NA 4PRKA 1VSVA 2HJRA 9LDTA 4FC6A 2WWRA 1LI4A 4LRSB 3JQGA 4HXYA 2H1SA 3RSHA 3VHRA 3DTYA 1ZVMA 4DTIA 3F6YA 3AY6A 1UUFA 3QWHA 3PJFA 4LMRA 1ZEJA 3GEGA 1GQQA 4NBWA 1GADO 2WM3A 3FSRA 2X6TA 4BO0A 2Q46A 2O7SA 3GZ4A 2VWPA 5JLAA 3TN7A 2OP0A 1I3KA 4R1UA 4H3VA 2CZCA 2UUOA 4BKRA 3GFBA 4D46A 2NU6A 4GLLA 3IKTA 2ZTMA 1AE1A 3TPCA 3A28A 1GTMA 1FDWA 1KVTA 1PQWA 5L51A 1P1HA 3ZHZA 4UUOA 5COQA 3RKRA 3DBVO 2VHZA 5JC1A 1IUKA 4XJSA 4Y67A 2HUNA 2JFHA 5TNXA 1XU7A 3V2HA 2X7HA 2FZWA 1NQ5A 3JTMA 4L76A 1P33A 1R15A 4MO2A 2FZEA 4Q3BA 1GEGA 3MEQA 3WQQA 4GVLA 2NV6A 4KQWA 4YYZA 4YCAA 1EFLA 4XGIA 4MINA 5JC8A 2O3JA 1R0LA 5ITWA 1XEAA 1ZSVA 1GY8A 3ROKA 2ZJ0A 2JD1A 3LC2O 3UCFA 1YXMA 1K3TA 4J7UA 2GERA 3I83A 3I9JA 1EQUA 2CDCA 1H6CA 3SX2A 3WSVA 1DIHA 2BGKA 2YV3A 5A9RA 4HX5A 1X7DA 3GHYA 4RQTA 2NACA 4B8WA 2W98A 2YDYA 7ADHA 1DC3A 4R1SA 4CQLA 2GRAA 3DAGA 1H6BA 2E6UX 2ZQZA 2IODA 3KO8A 1HETA 3TZ6A 3ONFA 4MIEA 1ZJYA 2HKIA 2Y68A 3U4CA 1JWBB 3VPGA 5KJFA 2VUSA 4RORA 4YJDA 1NBOA 1P44A 3L4BA 4YJGA 1DOHA 1H9AA 3UCXA 3K6JA 2ZIZA 4F6CA 1CEQA 3JD4A 2GASA 4KWHA 3MJ4A 3OJEA 2ZYDA 4HFJA 3WQSB 2UAGA 2Y1GA 2HSDA 3JYPA 3H9GA 5JAIA 3NDRA 1Q1NA 1F0YA 5ICSA 3LF1A 1HSOA 2O7QA 1B0AA 4CM5A 4YB8A 3WMWA 5TIIA 1RM3A 4PLZA 4E21A 4WKGA 4K9DA 4E5KA 3ZNOA 2E48A 4XEHA 3RUIA 2DVMA 3OEWA 3ZZNA 3GEMA 3OETA 3VZQA 1ADCA 5IDQA 4CMKA 3P19A 4ZVVA 5L7YA 2O3TA 4IQ0A 3GMSA 1NNUA 3OQ6A 4CM4A 3Q11A 5JXWA 2FP4A 1KEWA 5A3JA 1I30A 3HSKA 4BNVA 5ADHA 2NQTA 3IS3A 4WLFA 1L7DA 4AJHA 2AEFA 2HK7A 3KSZO 1PEDA 4AJ4A 2D5CA 1LSOA 1SB9A 1SNYA 3WTBA 3V2GA 1LLQA 3GVCA 5I7SA 5JPIA 3E9MA 3DHEA 4E5MA 3WLEA 1NFFA 2NVUB 4XDZA 2DAPA 2FRDA 3TOZA 2PK3A 3H6KA 1ISFA 4YJHA 1MFPA 1I01A 5IG2A 1RM0A 3JD1A 1GPJA 1O0SA 1SBYA 4A7PA 1B15A 4W9NC 1TB4A 5AYVA 3WS7A 1WW8A 1HZZA 1UDAA 4RF2A 3BMCB 4HFRA 1IHXA 5T6BA 2ZQYA 3Q9UA 2FOIA 3IKVA 3HFSA 3TDKA 3W6ZA 4D41A 5KVCA 2X86A 1NM5A 2NU8A 2HAEA 1TLTA 1P1KA 2P5YA 3JQCA 1V3UA 2PD6A 4ALLA 1V35A 3H7AA 3QJ5A 1E6UA 4GI2A 2P91A 1NP3A 1WDLA 2OORA 3A06A 3DWFA 1RJWA 3E9NA 4Q39A 1WWKA 4HY3A 3WG9A 4MVJH 3LT4A 5K6AC 3LF2A 4GAEA 1Y9EA 3GN2A 2Z1MA 3AI3A 2EP7A 4NFYA 3ZN2A 4U0JA 4NK5A 2EXXA 4Y6RA 3V1TC 4DMMA 3QVTA 4UEOA 3W1VA 3EK2A 2PKRA 3GVHA 4J16A 2FN7A 2DPGA 2JAHA 4M54A 5G4LA 1R4MB 3F1KA 1HTBA 1T2CA 2O50A 4PLCA 3PEFA 4J7CA 3O38A 1R4MA 2UVDA 2DT5A 2RBEA 2ZATA 3DDNA 2EP5A 3M2TA 4B7CA 5K6AA 1TT7A 3PYMA 2QW8A 1DJNA 2NVUA 4OOEA 4Q3AA 3DHYA 1NVTA 2D8AA 1BXKA 1Q7CA 2OFPA 3CMMA 3NGXA 4BNHA 2DBZA 4FN4A 1PJCA 1G6KA 4U8GA 1N1EA 3NV9A 3E8XA 4DUPA 4RVGA 4WCFA 2DKNA 4B7UA 1WLYA 1YB4A 1P3DA 4D44A 5B4TA 4JJIA 5CDGA 2PFGA 1BXGB 4GVXA 5K0ZA 2J3IA 1UP7A 5C5IA 1AXGA 1BXGA 1PS8A 3I1JA 4RF5A 5ER9A 2X5JO 5IDYA 1NR1A 2VWQA 1A7AA 2CD9A 3I6IA 4GMFA 1OC2A 4FBGA 3S2GA 3D5TA 2O3QA 3KVOA 4EITA 5I8WA 4JGBA 1J0XO 4A0SA 1DHRA 5J23A 3ZWCA 3ICCA 2CF6A 1GU7A 2CVZA 3GNTA 4PGFA 4AJKA 3R3SA 3U5TA 1WDKA 3ZWBA 3U0BA 4ND2A 1XGKA 2D59A 4TRMA 4XDYA 5EN4A 1B8UA 3PYXA 4BNNA 3FI9A 2VOJA 1HDZA 1T4DA 3WGQA 2DFDA 1HYHA 4AJEA 3GNSA 1V3VA 4EGFA 2HMTA 1ZK3A 4IINA 1Y6JA 4YRDA 2X9NA 2DLDA 4DC1A 2DUWA 3H4VA 4RPHA 3ETEA 1P0CA 4EUHA 1DFHA 1JKJA 4OYRA 1M66A 4RCVA 4YQYA 3WYCA 1D1TA 4CM3A 3S2EA 4Q3DA 3AU9A 4IUYA 4KQXA 3B1KA 4NBVA 1M6HA 3IP3A 2VWGA 1GCUA 3QP9A 4RDHA 2BI8A 1HEUA 4J6FA 4XRRA 1EBUA 2OO5A 1U2DA 1PQPA 5U1PA 4IIVA 5BNIA 4Z3KA 3W8DA 5A3VA 3FPCA 1I2BA 5ES3A 3WTCA 5CDUA 4MKXA 5TJHA 1ONNA 2ZCVA 3GGOA 3SVTA 1E1KA 4J4BA 5AXCA 1H6DA 4KMSA 5TRTA 2EG9A 5JO9A 5JE8A 1YOVB 5G4KA 2LDXA 1FF9A 4GKVA 2AHRA 1ISGA 1BVUA 1E5QA 4I5EA 4YAJA 4CLOB 3UFXA 3JV7A 3DONA 4ITUA 4I9NA 1JU9A 4TWRA 1LRJA 5BT9A 1QP8A 1ZW1A 2VHWA 4LGVA 1PL8A 4L0QA 4DXHA 2B5WA 1NR7A 1OBFO 2JCXA 3GFGA 3KRTA 4JLWA 3R6DA 4NIMA 3EMKA 4Z9FA 2QZ9A 2W90A 4J7XA 5L53A 1MP0A 2TMGA 4JP3A 4AJOA 5A06A 4K6CA 1ISJA 1M75A 1NWCA 3QE3A 5DDIP 4YA6A 3ZNPA 3G49A 2JL1A 3C7DB 3OBBA 4FGWA 3WWZA 5I8ZA 3WNVA 5DF1A 1G0NA 4LN1A 4UVDA 3RFVA 5JYEA 1TVEA 3EW7A 4PZEA 1VKOA 4JROA 4D3DA 1UP4A 2CVOA 4BNLA 4PG8A 1EMDA 2ZTUA 2EJWA 4AFNA 3JCZA 4MVJF 2FWMX 1ENYA 4E5NA 2AG8A 2CF5A 3ASUA 1Q0QA 1WMBA 5L7WA 1YJ8A 3TL3A 2IYOA 1XA0A 1ENZA 4MVJI 1R0SA 2Y0DA 1E1MA 3PIDA 4YXFA 2IE0A 2JD0A 1LRKA 1X7GA 4MVJG 3CTMA 1JKFA 1IL0A 5BSEA 8LDHA 4E2ZA 1JVSA 2Y1DA 4XD2A 5KVSA 3GOHA 2HMWA 5T8KC 1DO8A 5DOZA 5G0UA 1K6IA 1AXEA 3U09A 4I5FA 3U3XA 3H5NA 1VL6A 3INRA 3EHEA 3PRJA 4M86A 1M76A 4TKMA 3OIFA 3SJUA 4Z0PA 4PFJA 4D0RA 4D79A 1HT0A 3RBXA 5KWEA 4UEKA 3P7MA 3H5AA 3WJ7A 4OGWA 1U3WA 4YJHB 3PTZA 1FXSA 3G79A 4ROSA 5LC1A 3ROQA 1DLJA 3B70A 1CIVA 2X23A 4DLAA 3OP4A 4LK3A 3K5PA 2Y1OA 4RPKA 3WMXA 5DBIA 1UAGA 1BXZA 2Q99A 1PJ4A 3PJEA 4YEDA 3FCOA 1JQBA 2ILTA 4GSKA 1JLLA 1CQJA 1X15A 2NTNA 4JJGA 2JAPA 3NRCA 4J49A 3G3EA 4BNKA 3HB5X 1Y8QA 4GH5A 3VH3A 2YYYA 2C5AA 2B4RO 1A5ZA 3VDQA 4BO6A 1U28A 2Q1WA 3PHLA 5LCXA 1SPXA 3R1IA 2W2KA 4IPTA 1MLDA 2GPTA 3F3SA 2X0RA 5CPFA 1O94A 4DGSA 2PKQO 5IFLA 1QV6A 3M1LA 3OM9A 1ENPA 1VKNA 2ZTVA 4CV1A 2X0NA 3NEPX 1QV7A 5L40A 2WSBA 5DP2A 2WE7A 5JCJD 2ZTLA 4IM7A 5A04A 1E6EA 2VUTA 1QYCA 3ZGYA 3S2IA 4RLHA 3CZMA 5CEEA 3JQ6A 2BHLA 3U9LA 1C0IA 4RVHA 3F5QA 3GGPA 3RU7A 2X8LA 3DAFA 3H5RA 1HWYA 2GYYA 3E82A 3IC5A 3HDYA 1X7HA 1T2DA 2VZ0A 3NDJA 1DRUA 4B4VA 1PTJA 4BKQA 1OMOA 1ZNQO 4FJ2A 5HWSA 4UVEA 3JQEA 3JQ9C 4FC7A 3RROA 4CODB 4OKNA 3RUHA 1ZJZA 1XCBA 3FWNA 3RI3A 3VZRA 1Z7BA 4CM7A 4R5MA 1WZEA 4NNJA 4PVCA 1HDOA 3B6ZA 1I24A 1VM6A 2RHRA 3DOOA 3PIIA 2B35A 2Q45A 1YB1A 3GAFA 2A92A 3GDFA 3UF0A 4CLDA 5AXAA 4INAA 1NPDA 2O4CA 2EHDA 3PHJA 3QVWA 1KVQA 3LC7O 1R37A 4O63O 3BHJA 5BSFA 5ENVA 1H9BA 4TZKA 5BSHA 4MP8A 1UXKA 4YJFA 2OXIA 1PWXA 1LLDA 1LX6A 4KUGA 4JBIA 1UZMA 2ZK7A 3SEFA 1JA9A 4OIMA 2IYPA 2VYNA 1E7QA 4YPOA 3G17A 2GGSA 3KHUA 1T1RA 1OZAA 4H15A 3RKUA 3N58A 3SJ7A 5EINA 3L6EA 1P74A 3PHIA 1E3WB 5DNAA 2OOSA 4G5HA 3W4IA 4GMGA 2GN6A 5F1KA 5A03A 4P4GA 5A9SB 1EK6A 1HDGO 3PVZA 4HFNA 1CJCA 5A9TA 2C2YA 1GYPA 3QW2A 3SLKA 3OQBA 3RASA 3DTTA 3TQHA 4OSOA 1A4IA 4MVJP 4BQPA 5CG2A 1EVYA 2P4QA 3W4KA 1MFZA 2B37A 3LSYA 5DCYA 2Q2VA 4IXTA 1W4ZA 2YV1A 4OXNA 4MJLA 5A4DA 1GUFA 4U0KA 3NYWA 2C20A 3ZNQA 3KYDA 3D3WB 1ZXLA 3TRIA 1K6JA 4BHTA 5JFOA 1PJ3A 1ENOA 4XQEA 5A05A 2I3GA 3TFQA 3FNGA 2Y99A 4BL5A 3G0OA 1J6UA 1I0ZA 2DBQA 5T8KA 3O03A 3C1AA 4XB1A 1V9LA 5B4VA 4NR0A 4XKJA 4O1MA 4CMHA 1FDVA 3PGJA 3WGYA 4HUJA 2VNAA 3G1UA 2I9PA 1R4NB 2O3RA 2GDZA 4PIVA 5F21A 2B83A 1GPDG 3DOCA 4R69A 3AUTA 2VHXA 4IDDA 4II3A 4E4YA 3QSGA 4ND4A 2VN8A 1PIWA 2C5EA 3QV1A 4K28A 3RCBA 2NTJA 1C1XB 1XWFA 4CUZA 3D5QA 4MP3A 1B16A 1IZ0A 1F14A 4IIUA 3BTOA 3N74A 1C1XA 4R54A 4BO8A 3OH8A 1BHSA 3ZH2A 1H93A 3ITKA 4P4LA 3QWIA 3I52A 4Y98A 3D0OA 1PGQA 4YRAA 1VLLA 4N5NA 4BUCA 5I9LA 1PR3A 3RBVA 5TSDA 1U9JA 4RDIA 1ZBQA 2CFCA 1LSJA 4NBRA 4XIYA 3D64A 3L4SO 1PU2A 5T57A 1A27A 1Q0LA 4XR4A 5JAMA 2H9IA 1IZ9A 1NAIA 3TJRA 4IDCA 3ZWPA 2DBRA 3BHIA 2D4AA 3FD8A 2NLOA 3ANMA 3UAGA 4XX0A 3UUWA 3TFOA 4LVUA 3HJAA 4OJNA 4DQUA 3BHMA 5JNLA 3PQDA 3DBRA 1YB5A 3QIVA 3JQ9A 1OOEA 3VVCA 2WD7A 1R0KA 4BB6A 1T24A 2B36A 4PLGA 4R16A 3P5SA 1LJ8A 5JDIA 1FK8A 1WPQA 4E30A 3D3EA 5TC4A 1KEUA 3S55A 3GN1A 1R66A 5EL0A 2C7VA 1IYZA 3AI1A 2PY6A 2GSDA 5IF3A 4HWKA 2G0TA 4KUHA 3OIGA 3FHLA 2VCYA 2W2LA 1XLTA 2HU2A 4FJ1A 1DC4A 5L95A 5KNLA 1EFKA 4IQ8A 3U62A 3VH2A 3WGOA 3KSUA 1ML3A 4E0BA 4ZHSA 1LA2A 1GDHA 2VHYA 2PWZA 4UUNA 1XDWA 2Q4BA 3VH1A 4BNGA 4E12A 3TSCA 2EIHA 1B8PA 1J5PA 4R51A 2NTVA 3IAHA 2W8ZA 4J9VA 1E3IA 4L75A 4YAGA 1DLIA 3GHHA 2CNBA 1LQUA 2GLXA 2IXBA 3PI7A 3D4PA 4FPXA 3WB9A 2AQ8A 1SZJG 4FFNA 3OSUA 4S3MA 7MDHA 1VI2A 4QO8A 2Q50A 1H2HA 1GFSA 4BGUA 1X0XA 2BD0A 3FR7A 2GN9A 4RPGA 1T25A 3IL2A 3ZNNA 3Q1LA 3NTRA 1PL6A 3Q9NA 1N92A 4DL9A 4EUEA 3VH4A 2G76A 3Q2IA 5DBGA 2Q1UA 2NSDA 4LCEA 1YL6A 4M55A 4QUKA 1LNQA 1K6XA 2O3SA 1TT5A 3MTJA 4EBFA 1W6UA 1D4FA 2VTDA 3A14A 5I7FA 4ND1A 4DC0A 2GF2A 4PLWA 4BQRA 4OKIA 4P22A 2PKQP 3BMQB 5TT1A 3H3FA 3BMQA 4NK4A 3DMTC 4XGKA 1N2SA 1VPDA 5BQFA 2O23A 3DZGA 3JQFC 1UJMA 1IOLA 4JN6B 1Q2XA 1GQYA 4WOJA 4FFOA 1KVUA 2Q1TA 4IGFA 1RKXA 1BDBA 1SAYA 4BMSA 1M6WA 1YE3A 2CUKA 1P77A 2P9GA 4FJ0A 5EESA 4ZU3A 5TGDA 3DZHA 1ISIA 1WXDA 3DZJA 1EUZA 2EKQA 4O6VA 5F5NA 1E3SA 2R6JA 1DSSG 4IMRA 4ZQBA 3LQFA 1ISMA 1SB8A 3X2EA 4AJPA 4BNUA 2GO1A 1K89A 2A35A 3S8MA 5L4LA 1QMGA 3GC6A 1ADGA 1RWBA 3E9QA 3R0IA 1E7WA 2WJPA 4CQMB 4PLYA 3RUCA 1CETA 1I3MA 1P0FA 3ZWNA 1ZK2A 5B37A 4AL4A 5F5LA 1ZSYA 2EKPA 4DBZA 1HE3A 2GN8A 2I3AA 4R01A 4XCVA 5JYDA 4LMPA 3ULKA 1AHIA 4TRJA 2FPPA 2VHVA 5THKA 4ESOA 3D1LA 4FQ8A 3FBGA 3MJVA 4CPDA 3VOSA 3I3OA 1P9LA 3ZWVA 3VTFA 4WLEA 4CM9D 2WD8A 1VJ1A 1SEVA 4RLSA 3OFSA 5FFFA 4CMBA 2NVWA 3DR3A 4NJOA 5CDTA 2D1YA 1F12A 1YWGO 4I08A 3ROPA 4CM6A 1SMKA 3KYCA 3VAZA 5F1PA 2V6FA 2C7GA 1C0LA 1IB6A 3CE6A 3ON5A 4BKPA 3WIDA 1OAAA 1UXIA 2GCGA 1UH5A 1I32A 1GZ6A 3H9UA 3HFGA 4L9RA 4AG3A 4BOYA 4OH1A 4Y6SA 1YO6A 3EZLA 1T4BA 4B79A 5EERA 5JY6A 4QFCA 1I2ZA 4HP8A 4RZHA 2B5VA 4JBGA 4ZRNA 2VT3A 5FI3A 3TWOA 3ADPA 4CMCA 3O4RA 1X0VA 1GEEA 2CDBA 1DAPA 2HDHA 3ITDA 2HQ1A 2OBNA 4IZHA 2BF7A 4YAIA 1Z75A 3K2EA 4DLLA 2AE2A 2X22A 3C3XA 1HDYA 3JYNA 4TQGA 4C7JA 3PDUA 3RU9A 1YBAA 4FW8A 3UOGA 2XAAA 4MP6A 1TI7A 1Q7BA 3DFZA 2CY0A 5H82A 1KC1A 1PS0A 3EGOA 4CL3A 1L1FA 1HYGA 3QWBA 3TZQA 1E7SA 3I9OA 1B14A 1P1FA 3ZWAA 3HWRA 1EUCA 4OM8A 2X4GA 2O48X 4PG5A 2XXBA 1N8KA 3WGHA 2DTXA 2FMUA 3ICPA 4FFMA 1ADFA 4C7KA 5H81A 1LTHR 3HQ4O 3TF5A 3INGA 3F1LA 3KOUA 1NX6A 2JFFA 4IY1A 3GEDA 5EMHA 1PJBA 3FWZA 1GUZA 3I4CA 2PZMA 4WCFC 4DBVO 1Z73A 2CMDA 4AJIA 4OQZA 1GZ3A 4DLBA 9LDBA 4DIOA 5BSGA 3DZFA 3AFNA 1S7CA 4PVDA 4YT4A 1NXQA 4WCFB 2NWQA 2Y1FA 1DPGA 3IQDB 4BO1A 1YS4A 1PJTA 1ZK0A 1N7GA 4LSMA 1VSUA 4J4TA 3ZWYA 2X9VA 2J6IA 3DBHB 2HMSA 1UP6A 3NKLA 4A27A 1HKUA 2JJYA 3E5MA 4B8ZA 3W4JA 3JQ7B 4U7WA 1HE5A 1MG5A 5ITVA 2PV7A 3JQ7A 3Q2KA 4CR6A 1JAXA 4J0FA 1GYQA 3DZKA 1E3EA 4NZ9A 4R9SA 3PFWO 5CDSA 5JMPA 1BG6A 1YOVA 3O26A 5G4KB 4LCJA 5L9AA 4W4TA 2WMDA 2FHSA 5G0WA 2BGLA 3EY4A 4B3IA 1SEPA 3GH3A 1ISHA 4LRTB 3QWAA 4L4XA 2YUTA 3N7UA 2AXQA 5COBA 4M87A 1LDYA 2NQ8A 4IMPA 4WLVA 4PLPA 3ZCXA 4DQXA 1P45A 5JCJA 4JQCA 1PSDA 1J49A 1VRWA 5CPBA 4YAKA 2EV9A 3Q6IA 4E2WA 1XIVA 4DREA 3AM3A 1XR3A 2VZ8A 1P1RA 1QSGA 2IEBA 3PGXA 4DPLA 3GUYA 4J9UE 4Q9NA 1W0CA 3JSAA 2YFQA 3DMYA 4MVJE 1D8AA 1A4UA 3H2SA 4B3HA 3ONEA 1HSZA 3AM5A 2PZLA 2RCYA 1E1NA 1ARZA 2GNAA 1IPFA 1ONOA 3GMDA 1NQAO 3CSDA 5A1TA 3BMCA 4BO2A 1X1EA 2DUUA 1HYEA 3D4NA 1UZLA 4ZICA 3S2FA 2BLLA 4EJ0A 4EJ6A 2J3KA 4XR9A 2VQ3A 2J3HA 3GDOA 4QECA 4R1NA 3NGLA 1JKIA 3HN2A 5AXBA 5F3RA 4MIOA 5AOVA 4DVJA 1XSEA 1Y5MA 2BH9A 2ZB4A 4CM1A 4A03A 4NPCA 2PZKA 4O59O 2V6MA 1C3VA 2Q2QA 4DWVA 4D3SA 1VC2A 3FNHA 5JO0A 1B2LA 1DFIA 3CINA 3CMCO 3GZNA 3Q3CA 2AA3A
chains in the Genus database with same CATH superfamily
2PJZA 4E4TA 2IH2A 1NQTA 1V8FA 1PL7A 3QXJA 2NZ2A 2V7UA 1PS9A 3EVDA 2WJHA 4JBLA 1KTIA 4U7TB 1H4SA 1TAQA 2AYZA 1DJOA 1UMDB 3KD2A 4KQHA 5J47A 2PKCA 5JZVA 1PT8A 1DG9A 3OHSX 3U7EB 4MR9B 1IU9A 2E4WA 1M8JA 1H2AS 1TTTA 4INJA 4U39A 3IEKA 2CYBA 3F5MA 4NBSA 2I4NA 2XI4A 1Q7TA 4MVXA 4UTPA 3I45A 1BOOA 4YUVA 3FHOA 2ZVJA 2QRVB 4CN8A 5JAUA 1V2GA 2I7DA 4ZO4A 1U5BA 1NJ6A 3GXBA 3TM4A 3WNCA 5HCNA 2B7BA 1ADJA 5DM0A 5I9SA 3K1JA 3AUKA 2Q6VA 2R6CA 2YJNA 1Q20A 5F4ZA 3PJGA 3VC1A 1JQLB 3N86A 4MS1A 1PGNA 1YFZA 3K9GA 4KG7A 1ETUA 4BVLA 3NDBB 1RWNA 1FQJA 4G5SA 1GV1A 2EKLA 1BWPA 4BNFA 3FGPA 2JKVA 2PNFA 3RRFA 3ZHCA 5HR5A 4G81A 2I6TA 2QUAA 3DZ8A 2HJSA 5ESXA 1L6IA 4H3SA 4KBFA 4PPGA 3QE4A 3I58A 3AHGA 3E3OA 5DB4A 3RSCA 1X77A 3U80A 3V3KA 3EPHA 4TLCA 1TQ2A 3BXXA 3LT5A 4TKUA 3RJ9A 4X0EA 5EIWA 3F96A 4PN3A 2BUCA 4JJKA 3A37A 3QH4A 4F4HA 1IN8A 2V7VA 4CLOA 4OQFA 4NLLA 3AF0A 2W2NA 3LKVA 1YIAA 5AWFC 5TJ9A 1PT6A 1E4OA 2GILA 3EAFA 2HT1A 4TV8F 4B3DA 1NXSA 3RTGA 4BMNA 1AGNA 2PAFA 4EA8A 2HHAA 2VJMB 2I2CA 2B8JA 2O4UX 2RHOA 2R5FA 3EXIA 3K6SA 3C24A 1V7CA 5C34B 2X1HA 1X1TA 3S1LA 3C8ZA 3GG2A 2P5SA 4F4UA 1FFCA 1TIBA 4PG4A 4TRRA 3IUJA 2RFLA 4JCCA 3UWSA 2B34A 3B13B 4GIBA 1AKYA 4JX9A 4I9UA 4LQDA 2GOYA 1JI0A 1H4QA 1T2VA 3E5RA 2I7VA 3BJZA 1BE6A 2L18A 2LCQA 3V8BA 4ZIRB 1ZA2A 5K4GA 1PJQA 1Y8QB 2R47A 1W76A 1YR8A 3AL3A 3PQ3A 4YQFA 2FJPA 5BW8A 4RK6A 3N8IA 3ZYZA 2OKCA 1U8EA 4QULA 4J0IA 1T3LA 4OV6B 5FPYA 5EQTA 2C5GA 3BWDD 1KQGA 4ZV9A 5FLXA 3CRMA 2QM8A 2X15A 5EWLB 2V1UA 5IZCA 4M49A 4QBKA 5KWSA 2PJRA 4E15A 4HNHA 1QRDA 4JI3B 2H2FA 3IA7A 3PQ7A 3UYLA 3ZI4A 2KWIA 4Z6KA 5ADWA 5IXYA 3GPLA 3L1JA 2GBFA 3KTAB 4GLJA 3DO5A 5A62A 5AUNB 4MDYA 2I8LA 1MMFB 2ZT5A 4A10A 1BMDA 3OOWA 5KTRA 1RZUA 3PPYA 2GARA 1M7HA 5ALMA 3LLVA 4J1NA 5EWJB 1NF8A 4EHKA 3UPTA 1XMIA 2V03A 2WJJA 2FP4B 4WPGA 4F3CA 4QUBA 3WBFA 4NBUA 5IN4A 4NQZA 1F8GA 2I5PO 2AFIA 3A2MA 1DIAA 1UANA 1V3TA 3JYOA 1U0EA 4QEDA 2NM0A 2BFMA 2PUTA 3FKSA 4LYHA 1RZRA 2CLHB 4ER6A 3WP1B 3OOJA 2J48A 4C6RA 1G5TA 3U40A 2V4MA 1ULHA 3BZBA 2C8KA 3QM1A 2F48A 4QL3A 5FTMA 1U80A 1NXTA 3EGXB 4IV5A 4PPFA 4WK2B 4L02A 1T6YA 4NV1A 3BH6A 3UVEA 4BP9A 4HDKB 3CVOA 1GP2A 4L2IA 2BWJA 1GV0A 3T7CA 2MT9A 1I3OA 2VFAA 3HH8A 2FUG1 4EELA 4UHCA 2B25A 5MDHA 5LDGA 4G9GA 2WIKA 1L8QA 1QC5A 1QIFA 2EZTA 1NVEA 2ZRLA 3IVGA 4FHFA 3A3OA 3TZLA 4C03A 1XNGA 3NNSA 3EEBA 2XB4A 3R09A 4MGYR 3D7SA 1OU0A 5KCZA 5C7OO 1D7AA 2FEXA 1E1QA 1XG5A 2Z8XA 1LI5A 2ZUWA 3QQPA 1Z22A 4Q6WA 3ECAA 3ETDA 4RQUA 1HNNA 1K5GA 3TIGA 4C4ZA 3GDGA 4W63A 1P7VA 3INTA 3Q72A 1SXJE 3N28A 2YW9A 4PZCA 3P0JA 5LLTA 4FXOA 4L3VA 4Q3LA 3CPSA 1R27A 3DD5A 3HJTA 3N2IA 4F5WA 2ATEA 5BW5A 3SX4A 5AQ1A 4JR0A 4MDEA 3TTVA 3PX3A 1QYVA 1PFGA 1L3IA 3PQ6A 3VDMA 2WZDA 2NO9A 3AG6A 1A77A 4J3FA 4X92A 1BYIA 2HK6A 5KQGA 4NATA 1PFKA 1MAVA 3AI7A 4KH0A 5G3ZA 3C8DA 5KJ1A 3O8NA 3ZHYA 2P2YA 5IBPA 1YVUA 2OK7A 4H4CA 2MSEB 1JLMA 3OTGA 3EH2A 5JNVA 3C8UA 3FZYA 1KS2A 5CW1A 3B9RA 4MS4A 2VRNA 4NCXA 3HL0A 4UM9D 5KSWB 2ZSJA 1JIKA 2IYUA 3JATB 3STXA 3UFBA 3UK6A 1H2YA 4B6JA 4EHJA 2GPJA 2MU1A 2G82A 3SQMA 3ENKA 1QRRA 2J9GA 3HDHA 3OJFA 4KIFA 5KTOA 3G2QA 1G59A 1J9EA 3ER6A 1ORDA 2QTVA 4Q9LA 2PUGA 1WDTA 2EJTA 2LZ0A 1RHRA 3G2HA 4IH4A 4RL6A 4AX8A 4QM6A 3OCUA 4JJZA 4H0NA 4ND7A 1IEXA 3EH1A 3FHTA 1RNLA 3O21A 3SBDA 1JI3A 2Q5OA 3AEKA 3BXHA 3D7NA 3TDNA 3UMYA 2QX4A 3I9KA 2QTBA 1B3BA 2Z8YM 2HU7A 3GJ8A 3I05A 4WKPA 1IWOA 1PW5A 4JLVA 4MARA 4X8OA 5KMGB 3VBEA 2XDAA 5KQLA 1EFTA 1KBZA 1QGUB 3EIXA 5K0EA 3B78A 3E8MA 4KDCA 4U5XA 1G21A 4XVCA 2OAP1 2Q5IA 4NYJQ 5JHHB 2G08A 1OXUA 1GNRA 5EMMA 3VPSA 1ST2A 1UBNA 1E2HA 1TQ6A 4X00A 4I4TB 3WGJA 2ZIEA 1I7PA 1Y9DA 3EVTA 3KQWA 4KQ2A 2YQZA 1WUJS 2ZS8A 1LQTA 4CG1A 4W5TA 4O29A 4HDAA 5EYPB 5FBWB 1BVHA 2OC9A 3I4FA 2QVBA 1CUGA 3ODPA 1QRUA 4U6SA 1W87A 2F1RA 1EWYA 3RYHB 1KJYA 2J08A 2E9SA 1YMVA 1OI3A 4O2BF 1T13A 2BE7A 2OXFA 4OSPA 4WY2A 3TJZA 3RYTC 3VYRB 5B30A 3ZJ4A 5AVWA 1O9BA 4X7MA 4OBBA 4TLEA 4V0RA 3K96A 1SULA 4RSGA 3UTDA 1OAOA 4JWTA 2P40A 2PQ0A 3R6GA 1HE2A 3L0SA 3T3DA 5CBPB 5IAAA 2IS4A 4HDCA 3JRNA 2BEWB 1Q1EA 2QYTA 2R00A 4P98A 1J39A 2O5CA 2AR9A 1U9IA 2POCA 4RTOA 4RXTA 4IS3A 1MXHA 2CLIB 1USUA 2Y27A 1DDGA 2XQVA 1U0HC 4M1ZA 1US8A 4JI5B 1MGPA 3QTTA 2IEIA 2ZTHA 1A8IA 3ZS8A 2AJTA 1E6KA 2QD4A 3VNRA 4ZGWA 2ENUA 4XB2A 3EDOA 3TIIA 2BHSA 1CB0A 3PFFA 2P9EA 1O1YA 4PLFA 3RC9A 3O8RA 4OXXA 2BRUA 4YRFA 3KJGA 1XAJA 1NSFA 1M1UA 4KN6A 2MSLA 1L9XA 2Y9MB 3HB7A 3AKDA 3GLHA 3IUSA 3W6OA 4CFZA 1CFJA 3W8EA 3OQIB 1CRLA 3HJBA 1Q17A 3GLQA 4MQUA 3A9CA 4LGMA 1Q3TA 2WU4A 1PE0A 3PNYA 4JKYA 3I4LA 2PRKA 3MGAA 4PEVA 1E7YA 4HAYA 3IPCA 1T0PA 3JQAB 4LWQA 2BFFA 3PWZA 4EGJA 1TT5B 4R2IA 1B23P 2JAXA 1MR3F 1A9QA 1FA9A 1SA0A 4RZXA 4G4IA 4NNOA 2Q2WA 3FZGA 3ANXA 3DV2A 2R7MA 2H18A 3NBFA 5DGDA 3ZU6A 4OMCA 1EX6A 2R48A 2WF9A 2X4IA 4G5YA 3TUZC 1EFPB 2BEVA 2G1UA 4P53A 4CNBA 3EXIB 4BYGA 2J9RA 3R40A 4P38A 3KJXA 4UBMA 1L5RA 2XCSB 2ZXUA 1YGYA 5IF9A 4C7OA 3IX7A 4NJEB 1SZDA 4RZ3A 1CEEA 5FYQA 5K3SA 1CY6A 1GLVA 2ECQA 2ZYUX 5H7XA 3RC3A 4GDFA 4I4CA 2VWHA 2C0CA 2JAWA 2XA9A 1GR1A 3C15C 4L5JA 4U5QA 1NJSA 3VPFA 4R1TA 1FVXA 1YCHA 3CNLA 3SSNA 1BDMA 1XQYA 3A10A 3GVIA 1RZ3A 3ORFA 5FTNA 2HO4A 1OUMA 1KYIA 3IQEA 3Q8KA 2FUNB 3FTPA 3Q1KA 5CLLA 5DCUA 5AVYA 2LW7A 2O2JA 3X2FA 5EHZA 1GPWB 3HABA 4MRMB 3AJRA 1CLUA 4HX9A 1P0IA 1A7UA 4N7RA 4LZOA 4OAOA 3K35A 2QYOA 3L02A 3GYGA 1FZQA 3T7RA 2G9QA 4EPYA 4MO9A 2WINI 3U3MA 1WEHA 5LXTA 2V8BA 3H1PA 4DEYA 1QPZA 3GNQA 3FB4A 4ZQGA 2Y66A 4I2VA 4CM4B 2PE5A 2VPQA 3V7WA 2OLKA 3E7FA 3HUEA 1ZSNA 4IDAA 5IC5A 1WCV1 4J3NA 3T94A 3UM9A 3KXDA 1CW2B 3K2IA 4OL9A 4UZEA 3U3JA 4IDQA 1KY5A 1QXSA 5ECGC 4DMRA 4TMFA 3P71T 2Y05A 1ICIA 3AZPA 2E4XA 3TZCA 2TSYB 1NJ1A 1PUXA 4BGEA 5TF4A 5AW3A 3T5PA 2ZZNA 1XZFA 5K20A 1N32B 2ZP1A 3TAUA 1G63A 2YIMA 3BTUA 4L5YA 4N5LA 3RHSA 1QWSA 4UFNA 4KXUA 2OUKA 2X5KO 4A1OA 5C1BA 2FR8A 3U44B 4ID3A 1VRCA 3ZBQA 5IZ4A 1RM5A 2BZ0A 3M7IA 3AKZA 3K8ZA 3AUSA 1IEQA 3DCNA 4MKRA 4XM0A 2BM9A 3B36A 3CXUA 5AM5A 4ECAA 3K70C 1VJTA 1PV4A 1I4OA 4UBNA 2IH5A 3SX0A 3QLUC 3ROFA 1KXJA 3H4MA 2B9EA 3LU1A 4MWBA 3RF7A 1SCKA 4QYTA 1YRBA 2C9OA 3UENA 2JFGA 5DSZA 5IC6A 1ECLA 2H17A 2IW3A 3PR3A 3ZVRA 1XA3A 4AUNA 4RK1A 1XMQB 5CLGA 1G17A 2ZI5A 3N2KB 1R18A 4G97A 1P7CA 2O2IA 1BU8A 4N8EA 5FWYB 3WYBA 5L7TA 3S8EA 4TT3A 1CP2A 3C8HA 1IN4A 1AB5A 4G0ZA 4MIYA 4W6ZA 3ZD9A 1Z4KA 4Q01A 3STTA 3WIUA 1HX7A 3QHQA 1XU9A 4IF6A 5B57C 3FSJX 3BT7A 3BXGA 2ZXEA 1E4YA 1N2OA 4UEQA 1XVIA 4M6WB 4WCFB 3WB1A 1I7DA 1I7SB 1IY9A 2C7RA 3AONB 3VSAA 2H5LA 1DUVG 1W2GA 5CCEA 5BWLA 1RZVA 3PNQA 2J9FA 1QRAA 4ZQIA 1VQ1A 2JGDA 4YR7A 4CV2A 2VAVA 5IP5A 1L7RA 3VR4H 2APJA 4V03A 2ST1A 2DJ5A 3MGBA 4NU5A 2WSYB 4TMKA 3MUEA 2HA2A 2VDOB 1CZHA 3MVEA 3AQ4A 3MB5A 4LTDA 4Z8XA 3RWBA 3UOWA 1DXHA 4D80A 2GZAA 3NYQA 2G9NA 4JBNA 3E1SA 3KWLA 2HO5A 2YRFA 3L46A 2J6CA 4OU4A 5D7BA 4J0JA 1BIFA 1QKKA 1RQXA 2J3LA 2YHSA 4KRGA 3P9XA 3TQSA 3ESZA 2PGJA 3GRUA 3JATA 2ON6A 3QJGA 2EWMA 4FQ5A 5FUWA 1R50A 4NYIR 3W8NA 5IC4A 1YDWA 1SURA 4KQ1A 4FD2A 5AJZA 5DWQA 4HNTA 5JCXA 4FS8A 2HNBA 1AQYA 3CGWA 5J4LA 5MN5A 2PUDA 3N8GA 1Z36A 3KM0A 1NUPA 2GHTA 2CB0A 3L8MA 4ZV4A 3Q15C 4DCGA 5TGZA 5DRTA 1W96A 2J7PA 1RYYA 2HSZA 4L95C 4IJUA 2PUEA 1F8YA 2ID4A 3ZE1B 5IDWA 5CH8A 4IQFA 1SELA 2WUFA 1H2BA 3KKOA 1KAEA 3PYLA 3ABZA 3VO2A 3RGGA 4EG0A 5B4UA 3C87A 2QE6A 2AV6A 4RYDA 3HCBA 1U9IC 1NFQA 4QICA 1RXEA 2R00C 4WNAB 4N1AA 3G8BA 4MV1A 4A82A 4YR9A 4IHJA 1L7BA 1HKHA 2HXYA 2I66A 3BCSA 3MJCA 4RVSA 3SJBA 3FF4A 3T5DA 4DAOA 4PFKA 1ZIOA 1RI2A 1G21B 3IBSA 4HI0E 1O9HA 4NENB 3VVBA 1XRRA 3KVYA 4GSLA 4AYWA 3QW4B 3QVOA 4M0DA 3ZV4A 1XAIA 1PWZA 1YR1A 1EHYA 2NT4A 1J00A 2WYIA 2NO5A 4MMYB 1DJQA 5DGHA 2K7FA 3JQFA 4AQYB 4K86A 3AHHA 5TQVA 1DQRA 3H9JA 1PG2A 3HJUA 4GPD1 4JIGA 4RTJA 3OQOA 2AC2A 5FBKA 5LZ2A 1UJCA 2NZXA 2OXEA 4NPAA 4EY7A 2QD1A 5JD6A 4LVCA 4LXGA 2QMYA 2EIXA 3IIIA 5K3EA 3N39C 3CT4A 4U3JA 3DVRX 3GJSA 4OGKA 2V54A 2I6XA 3TR5A 2GD1O 1W2HA 3ICOA 3LRPA 4QRDA 3UMBA 2BEWA 4DYVA 1M33A 1QTIA 3EWAA 1OTXA 1GR0A 3HA3A 4MUXA 1YDFA 2HA3A 3L05A 4WJZA 5KTKA 1PK9A 4KFSA 3SF8A 5D84A 5IJAA 2IPLA 1ZPDA 4K46A 3DW1X 4M53A 4Z49A 3SBOA 3PGMA 4EYEA 1WE2A 4KWIA 3T9CA 2H0RA 5JNRA 2CSUA 2QTGA 5KHLB 2QI9C 1JBQA 2F3TA 4OXIA 2UYOA 1GM5A 4OHFA 3WNBA 2C1XA 1JKJB 2PBRA 4DJAA 3V8PA 3TXXA 3E35A 4G0UA 2P11A 3G0HA 1O8CA 1QYDA 2VJOA 2YOGA 1F6DA 1KMQA 2ZOSA 4B87A 2QZ4A 3OA0A 1C50A 1NYRA 4RZIA 3AIIA 3OQIA 5TX7A 3VOAA 5AVQA 2EG5A 4P0PB 1YZ3A 3V5NA 1DP4A 3MBIA 4PIMA 1KMCA 2DBYA 5E4FA 4AYTA 3KU4A 4F46A 2XXAA 1EP2B 1M2OB 4A2WA 4PXSA 1YK0A 2XGJA 1O9GA 3V8QA 1XD2B 4YWJA 3ZHQA 5FAKA 1JYSA 1MAUA 1WTAA 4C3UA 2QX9A 1Z8FA 1UDXA 4UJ5A 5K0TA 2YV4A 1QOZA 2OG1A 4TV9B 1Z6XA 3KJZA 2JIMA 3CH6A 4OXYA 3DKRA 3TIFA 5KJ6A 1KOGA 4GKBA 1MOPA 4JB2A 3RTCA 5A3QA 3VNUA 4NFLA 5C0OE 1BQ4A 4D2IA 1E92A 3PVCA 2OQIA 1O6FA 2H2DA 1AGYA 3EQ8A 4BJ5A 1J70A 1L5NA 3SFVA 5LQNA 1NG9A 1DBVO 2VYVD 4B6FA 3UK1A 5KYXB 3TVTA 3VR5D 1RJGA 1XCOA 1DAOA 1R6TA 3GZNB 3D1VA 3JWEA 2EEZA 2OT3B 4CG0A 3BXEA 5EIAA 2UKDA 4CKBB 4KV7A 3ZZUA 4MKZA 5FYDA 3A9WA 4JVNA 4P82A 4ZAVA 4ZVKA 3WVNA 2F17A 3GGGA 3KYDB 1XLUA 3H0CA 4FMDF 3OQHA 1YFKA 3DAOA 3GYBA 3WRWA 3K9QO 5I9NA 1NPTO 2RGYA 3NBAA 3QBVA 4G0QA 3F67A 1DC7A 1NC3A 4MHTA 2XAUA 1MB3A 3CEMA 5IKMA 4PZDA 1Z6ZA 1JXMA 3JQBC 1QLJA 4HNSA 2NV0A 1C9DB 1CY2A 3R20A 4KUEA 3C3PA 1EK5A 1T3HA 3LT2A 2BC9A 4EO4A 2BI7A 1U2GA 3WDSA 1H4TA 3WADA 2I80A 1YBFA 2YCBA 5GGXA 1AS3A 3ZW8A 1VCHA 4DCNA 1K08A 4N01A 2H4ZA 1G9SA 4DQLA 4BV3A 4RENA 3UT6A 2A59A 3OLXA 4N9WA 2H2IA 1FCJA 1J0DA 2A3RA 1V4BA 1U8CB 2ZAYA 4CV3A 3SR3A 1X39A 4RBNA 2GCIA 3BM5A 2PX4A 1XZPA 4FFLA 4JBWA 1IHYA 1B8VA 2AS0A 2IHKA 4RGYA 3SIXA 1DJMA 1NIPA 2A2ZA 5DYGA 1QOPB 3V34A 2ZB7A 1WDMA 1VMDA 4HD8A 3LIPA 4W5QA 4E13A 3HYNA 3PDIB 5T67A 1KI6B 5JH7B 3AY7A 2V65A 4QDJA 1QF6A 1M1NA 1UBHS 1Y3FE 5EUQB 3VI3B 5CFZA 5HGJA 4DKJA 4I81A 1UM9B 3DWIA 3HP4A 1UF9A 1JBEA 3F6CA 2DCMA 3AEQA 2FX3A 1FDUA 1QAOA 3ANNA 4CQMD 3O6VA 2QN9A 2ZB3A 3AHFA 1M8GA 3BSYA 4QGBA 1N4AA 3LWZA 4PX3A 2QHXA 2J31A 2XMSA 1HLDA 1XJ5A 2P78A 2O2ZA 2H52A 2JFZA 4AJ2A 3ZQUA 4N5MA 1V5IA 1ODLA 5DT2A 2GCPA 3KAKA 1HO3A 1DIGA 4LY6A 2KW5A 1ZU4A 4CKYA 3QBTA 2I76A 2QLMA 2I99A 3BL8A 2AFHA 2GN2A 4IOMA 4QO7A 4UVIA 4E2XA 4CF7A 2M6RA 2VJAA 2FW0A 1KF0A 3UAWA 2B94A 1P5RA 3EY9A 1WB6A 3R3WA 3ER8A 2CUZA 1L4BA 2WQZA 3AFIA 3DBRB 3E4CA 4UJ3A 2R79A 5AP9A 2RI6A 5FWAA 3STHA 5SICE 2JGIA 2YXNA 4DDUA 2O2SA 5I7RA 3I2FA 2P27A 5AHXA 5F1OA 5AVOA 4YP7A 4DG5A 4ZGGA 3OPYA 3SJAA 4D3FA 1T6XA 3KQKA 3RRNA 5T64A 5DRYA 4CCSA 5JALA 1NVGA 2FB9A 4I3FA 2IYTA 2WWIA 5FB3A 2I71A 5L3SA 3FFWA 3RQSA 1MABB 5KNDA 4HGQA 5IJ9A 1NV9A 2CHVA 4FLMA 4YJ3A 1IMOA 1I2CA 2P30A 2OQ2A 1Z4QA 3KBOA 5CCDA 3R7SA 3QX3A 1N6KA 5FULA 3EMBA 4TKZA 2H4XA 2VAWA 1GSAA 3GCGA 4NS1A 5EXSA 3V8NA 1TK3A 1WNTA 2C42A 2CXSA 4I5IA 3O7WA 2IHTA 3K0FA 4JDUA 1LD3A 3DPUA 1SC6A 2W6OA 2BCJQ 3RARA 2VRCA 3OIWA 3KE9A 2XTZA 4RMGA 2O59A 1Q0TA 1G18A 1DTWA 2J5BA 2JLBA 2W83A 3CHYA 3NIDB 3P2MA 4LDRA 5FUXA 3SXPA 1J9GA 2EC5A 4I99A 1XQ1A 2HWUA 4YMLA 2WMYA 5IDXA 5EXPA 4J1SA 1WHTB 2JH8A 3EXFA 3EGVA 4M8IA 4LXXA 4OO3A 3ER9A 5CB8A 4XGRA 2BEJA 2C1ZA 4R4JA 4XTRA 5JBNA 4IW3B 1RABA 2EJVA 1K3UB 1ATZA 2R4QA 2QLLA 4XGQA 3BE6A 3SYRA 5K2OA 2ZKLA 3PWTA 4YT2A 4JI8B 1Z4JA 1QRSA 4IHJB 4Y18A 4CM8B 1U6JA 2JPDA 4KP7A 4BLSA 3N2KA 2BKAA 4M1QA 3NDIA 5DOVA 1RKBA 1FFBA 2OV8A 3VMFA 5E8JA 1U0OC 2R7NA 1QP0A 4X1IB 2X3FA 2ZYTX 2F1JA 1Z4MA 3OE5A 3K05A 4ZA2A 1ZYUA 5L4SA 1DZIA 5KSPA 4IH1A 2F8LA 4BBPA 4EGSA 4HV4A 1TKCA 5DGTA 4BNTA 2AH5A 2CJWA 3H11A 1Y42X 4F97A 1FYFA 4WXPA 1N2EA 2V6JA 4JMLA 4XX0B 1FNSA 3CLSD 3FLEA 3LDAA 5DYTA 3WSWA 2JRCA 1GRNA 3EAGA 4QUIA 5ILQA 1N6PA 4BNZA 1RYEA 3VHQA 1Y1SA 3GMIA 4IDPA 2VP6A 4P81A 4AY4A 2YXBA 4RPLA 1JFFB 5AW7A 4Y8VA 4YY3B 2DHEA 3OCCA 4RAOA 1I33A 5AKGA 2H9YA 4C87A 3GROA 4YAFA 1FB5A 3A32A 3AVTA 3MIIA 4WL0A 3OZGA 2GM4A 1AF4A 3L2OB 3VYSB 1HA3A 4B4UA 3GW8A 4MCAA 4QXMA 3OUUA 3JD0A 4H16A 4HQOA 1T2AA 2J4CA 2V5UA 2D1RA 4G1VA 4HGOA 3VC3A 2ZSHA 3RIYA 4JLNA 1JTEA 2OXRA 3PQEA 4OG2A 3R7FA 4GUDA 4F5YA 1KFCB 2IOFA 5JMTA 5AFSA 1IQRA 4YFYA 1FVOA 4EABA 3VJRA 1R0BA 4DA7A 2Q4EA 1YA8A 2WBLC 4DHEA 4YBRA 2J85A 1NVMB 1RI1A 1BX1A 1CWUA 1Y80A 1D4AA 1M6YA 1MJFA 2VCEA 5AVKA 4COOA 4CGYA 5CVCA 4DLKA 5GZ3A 4ZCIA 1J1IA 2LP4Y 4UUBA 2VP5A 3UIEA 1SU6A 1PWYE 1FSGA 2C2XA 1T2NA 4JJFA 5H9WA 1UXHA 5EQFA 1PZFA 2HJ9A 4IJQA 2NADA 4CMIA 2M1XA 2FR0A 1Z0UA 3CXRA 3CUVA 3I01A 4A15A 1FLVA 4OYYA 4M9UA 1N9ZA 2QDXA 4D4GA 1SH7A 3GLGA 4C2TA 1CUBA 1E63A 5FBZA 3X0DA 2HF7A 4HEA6 5CM8B 1UODA 4V0SA 1LBEA 1XCMA 2HWWA 4CU5A 4W6QA 1Z4LA 5K01A 1DBQA 3DF9A 1NNI1 1KH2A 4MI9A 4OB8A 1XEXA 1GTL1 1GYRA 2JZCA 2WT9A 3MHPA 3PHHA 3WNZA 1FYVA 4XYLA 2XZDA 1JF8A 1ND5A 4O33A 5LSAA 2FR1A 2WB4A 1MQ8B 3BMOA 3EN0A 1ID1A 4KO2S 3WYAA 1DQNA 4PPYA 2ZUBA 4H27A 5E2BA 1QP7A 2GESA 2PVCA 3AFOA 4KN9S 4Q9JA 5HF8A 4O1HA 1D5CA 2ZROA 5KU1A 3VR6A 1FJHA 2FQ1A 4K9QA 4EY6A 4JUDX 4HAXA 4YCCA 2P9HA 2C2GA 5AKLA 3GFFA 4ZI5A 1M6EX 2ZAGA 1FYEA 1KI7A 1NJFA 2FFJA 3H5LA 2YJZA 3FIJA 2FZ4A 2QM0A 2ODEA 4IZIA 2I2FA 4XI9A 3U37A 3WDLA 1NN5A 2XECA 2WOJA 4HPJB 1VFPA 2XLCA 4LFCB 2HIHA 4CMEC 4MVJM 1OF1A 1REQA 1CHDA 2DKOA 4MJ3A 4MYCA 1HL3A 2WB2A 1VL8A 1E2LA 3HVKA 3TG8A 2ZAOA 4LF4B 1XBTA 3F5SA 3OD1A 3G82C 1QDUA 1EE2A 5BSKA 2Z2JA 3V8RA 1C1HA 3T6KA 1CR6A 1XROA 3BGWA 3IO5A 1GGJA 3FWPA 3GJQA 3QPCA 4NTZA 3ZDAA 2WUEA 2Q0HA 1NBME 1LWOA 1WZNA 3CKLA 1BW9A 1FSPA 1P5HA 5FQNA 1BGVA 2D3TA 2CNDA 3F46A 3T15A 1VG1A 3RUAA 3A6KA 4KSYA 1U1IA 5C35A 4ZQCB 4E6PA 2K2QB 3Q7IA 4LQ4A 2PA3A 3WGGA 3ZY2A 1GL6A 2EW2A 1GLNA 2GD6A 3F78A 3QHAA 5HQJA 3D0KA 4IX9A 1PGJA 2HN9A 5JECA 5JY1A 3BDAA 3O31A 4KO3S 1U2TA 2PJUA 4LG1A 4CL8A 5GADl 5E4YA 5JVDB 1Y82A 1OYYA 2QIOA 2XBLA 1XE3A 4HKTA 4WADA 2DPHA 4AP5A 5KYUB 1GTRA 2NUPA 1IN6A 3VXKA 2GR9A 4GM0A 1W4RA 2O0LA 1B8OA 3QFFA 3RD5A 1P1JA 4BGVA 2IDZA 1FC0A 4JC8A 2QY6A 1Z82A 3BXFA 4S05A 5AW1A 1NLMA 2QU7A 3IAS1 1PT9A 3ENNA 3KZ1E 2H06A 3I5MA 4LYYA 3G0DA 4EMTA 1OPRA 1Q77A 5EZYA 4I4TF 4WBNB 5JPDA 1QHNA 1QCDA 2DSNA 4XYMA 3NHYA 1MVOA 2Q7XA 5E7IA 4DZRA 4JI2B 2BFDB 1K5PA 5T3YA 3EPPA 1L4UA 4ESEA 3BA1A 3JVIA 5IYZB 4GU5A 1A82A 3CLHA 3LHKA 5INTA 4RDCA 3WGZA 2NAPA 4RK5A 2X0DA 1ONPA 4CKZA 3GLFB 5EXTA 3GX1A 1KP3A 1ZC4A 4EJSC 4EPXA 1OH8A 2G3YA 5EFOA 1D7OA 2GT1A 4RA9B 4UCQA 5TF0A 3R7AA 4BZPA 1RWKA 1RRVA 2Y4NA 4F04A 5K99A 5C80A 2ZBVA 2QAGB 3P9CA 3RIMA 3CIFA 1QGDA 4PC6A 5K8TA 1MOQA 3HC7A 2D1TA 4MUFA 5H9VA 4L0MA 4WXRA 2IC5A 4LX0A 1BEZA 4MVYA 3U19A 1MJNA 2JGAA 3NV7A 3VSDA 1KO1A 3BX1A 3O75A 4MICA 5ALEA 3GD7A 2GFIA 4M37A 4MRNA 1ZM9A 3GFSA 1QBGA 4HTAA 4MH0R 4WASA 3DOJA 3O9ZA 4YUWA 3HU2A 1DDIA 2BTEA 3THSA 2EYUA 2YRXA 1ZNXA 4CCWA 4I8XA 4EGAA 1LNSA 1NV8A 3DFMA 3F7OA 3KVVA 3LL4A 4ERXA 3E1GA 3MFYA 4GHWA 2HRDA 1DAKA 1A4RA 1S3FA 3QNWA 4WKCA 5ELXA 1PGOA 2FDRA 3BGVA 1JFSA 3ERCA 3VR0A 2XCRB 2YY5A 5FJJA 3LRTA 5AVUA 3QBDA 5DHAA 2VTBB 1VTKA 3I9MA 2OENG 3S8YA 4DABA 4DR7B 2AR0A 2AOTA 1Q83A 3H2ZA 1L5MA 3P0IA 4G26A 3TBHA 3BFPA 3JPWA 1ULTA 1UDRA 2VP2A 1EDOA 4YT5A 3I8XA 5CT8A 2JLRA 1QLHA 4NAHA 3PNPA 3PZRA 2QRKA 3OAAD 1KDVA 4FYYA 1RPAA 4EHAA 2NO7A 3RIHA 3HGQA 1H2FA 3A1DA 2Q0QA 3ONDA 4YH1A 1AJEA 3LNCA 3LKBA 3AMVA 1P29A 3HR8A 4LZJA 3VJKA 3D7LA 1NHGA 4QDKA 2WIBA 2FUCA 2QTAA 4PBTA 3VPCA 1W1IA 3F2IA 3QGMA 4EPVA 4D4LA 2GPAA 3WFJA 1XZIA 4IXDA 1EFDN 3KTDA 3TK1A 5GJBA 3WZLA 5EIHA 2H2WA 3PEEA 3CZQA 3FOCA 3MLAA 4GI3A 1ORIA 4AY5A 3HY6A 4LBYA 4CG2A 1AZSC 1DI0A 4G86A 3PC8A 4HNRA 2VSNA 4P4UA 1OLSB 1UPUA 2G77B 2REQB 3JXEA 3PRHA 4AMYA 2Q21A 1LS6A 2PGXA 2QPOA 3QWFA 5EXEA 3MTGA 1XOIA 3DMTA 1OX4A 4FILA 4ILKA 2OFWA 4WWHA 1HTTA 5E2IA 3T34A 2HXSA 4FU0A 3D6HA 3CT6A 5ADUS 2W2KB 2HTFA 2PRSA 3L07A 4JLOA 1KEVA 2P6MA 3B6IA 4GBJA 4WFIA 1YCGA 2PO5A 4ZV7A 3WYEA 5BWBA 3NRJA 3O1JC 1J22A 5E0OA 2HJRA 2XYRA 3NHBA 1QVAA 3U7IA 5CB4A 9LDTA 4DR1B 4K05A 5LUBA 3S81A 5JCOA 3UT0A 2E0IA 2HHJA 4C7MA 1BKYA 1GFWA 3SE7A 7YASA 2JF0A 2XT9A 1YZHA 2Q6TA 5ALZA 3KPUA 4QGFA 4Z51A 3PJFA 5ALXA 2GRUA 2E4YA 4ZREA 1JZQA 1GADO 4ZO7A 1XZJA 1KAOA 4AWBA 4LNHA 3VYUB 3FETA 4LJ7A 4ZZ2A 2FEAA 2X6RA 3RVBA 2OHJA 2NU6A 2BBOA 4MRRA 4QWMA 3DQQA 4KQCA 3E9EA 2WSSA 4AWAA 4DV4B 3A28A 1PQWA 3QUBA 3EG9A 3Q3GE 5EE5B 1ZH2A 4PN7A 2F90A 2Q6IA 1P1HA 2DECA 1I2AA 3UJDA 4A3SA 4MR7A 1FRFS 1XZGA 4AK9A 3RKRA 4QUHA 2VT6A 4EG5A 4JDPA 2YNMA 2D0PB 5JXHA 4IGKA 2JFHA 2R1UA 2W4MA 2V5AA 3NCHA 3I5XA 1XU7A 2WUWE 2PT5A 3E27A 5AKIA 3V2HA 1WQ1R 2MSWA 1NQ5A 2LE0A 3JTMA 2KLHA 3QMVA 5ALWA 4ZGBA 3PHBE 1O7JA 1GEGA 4Q3BA 4WX2B 4YAWA 3A6JA 3PFNA 2B1JA 1GITA 2J33A 2HB6A 4OHZA 3H8JA 1R5OA 5BWNA 1JDBB 1P4RA 2I1LA 4YCAA 4QBIA 3K1TA 1TD1A 3ZQJA 3O8OA 1NMSA 7AT1A 1XVAA 4PGAA 3LHSA 4BX3A 2ZT6A 4IILA 1Q1GA 2WIFA 4CTKA 4X1KA 1XEAA 3EZ9A 2JD1A 2OB2A 3UCFA 1K3TA 3IESA 5E9WA 2Q6OA 1DJLA 2XNJA 2FV8A 4V1CA 5AIBA 1BS9A 4WBNF 4C4RA 1JDVA 1SBNE 1SKYB 2P9QA 3SKYA 2QR2A 2C2BA 2YV3A 3RAGA 1Z4IA 4MCIA 4WMLA 3THYB 1O57A 2AMJA 3M4ZA 4HX5A 5KNDD 2R8BA 2NACA 2ZBDA 3CZPA 3M6VA 2NO1A 5LMZA 2IH4A 4RW0A 1IM5A 4LZPA 2ISCA 1RC0A 2WAOA 3WLIA 3CCCA 2GSWA 5H3LA 3QF7A 1M54A 3LBHA 3NUZA 1H5NA 3R5SA 4TS1A 2QSJA 1H6BA 3R2JA 2TECE 2KYRA 2OZLA 1R7RA 3KO8A 3LUCA 3ONFA 4J0KA 4TSFD 4ENQA 1R8XA 4L7VA 3RNLA 2C9ZA 5JSKA 3VPGA 1P3Y1 3BBLA 3BJEA 4DCUA 2WOOA 3K16A 3JVEA 3QHPA 2VJNA 2F3SA 2YWEA 4RORA 4D3XA 3QK7A 1H9AA 4QJ4A 3UCXA 4E5DA 3K6JA 4ETIA 2IU3A 3QKSA 2XKAA 3QFCA 3DEHA 1CEQA 3JD4A 4BFLA 3CRRA 1L4EA 2G6TA 4I1VA 5CVTA 4FWTA 2ZULA 2LIVA 3OJEA 2ZYDA 2NPFA 4HFJA 4X6UA 4ZAWA 4DLZA 1JHOA 2F3QA 2FZCA 3P4XA 5B3JA 3JYPA 4NRDA 5JAIA 3NDRA 1TDJA 3NPAA 2OHVA 3NKVA 4CM5A 5C52B 2HPZA 3WMWA 2DHCA 4OGGA 4E21A 4K9DA 3EIFA 4AURA 4E5KA 5EPEA 2E48A 4XEHA 4F5ZA 1SWWA 3CO5A 4HEQA 4ZCMA 2MMCA 3I2KA 2AI3A 5SYAA 5BYKA 9GPBA 2HIAA 2XVMA 3BE8A 3HCNA 3LP5A 1L3CA 4Q47A 3P19A 1ORVA 3K8QA 4QTTB 5IDQA 3UGQA 3RVSA 4KEAA 1XTIA 3WDKA 1Y1KE 2C92A 4JKIA 3AHJA 2IDMA 3L0YA 3GMSA 4PO3X 1NNUA 2RBGA 5IJWA 3ORQA 4EPRA 2ZIWB 3QPDA 5BORA 1I30A 3HSKA 4B3BA 5YASA 2AF4C 1OI2A 2R6GA 2QENA 3IS3A 3QUQA 1DWPA 4MZXA 3HMQA 3G23A 4LRQA 4RTRA 4FYVA 5LP1A 2D5CA 1Q84A 4M0PA 3QYFA 1U2ZA 1A5TA 3GVCA 3SIWA 3H6HA 3E9MA 3DHEA 2VSOA 1BE8A 3A8TA 1RXSA 1RXYA 3OO0A 3GQBB 2FRDA 3RRXA 2PMCA 2PK3A 3H19A 3UW1A 1ULAA 1IHPA 4IO1A 3H6KA 4KNVA 1CYEA 3REOA 3W5CA 1PJAA 3BVPA 3DOEA 4GMDA 1MFPA 2TS1A 4P7GA 4YJHA 5BR4A 2EOAA 1JTFA 1I01A 1US8B 5CA0F 1K1EA 4KN5A 3RVLA 4EFNA 1I14A 1YVDA 4MGKR 4C0XA 2VQSA 4REQB 1Q22A 2VJBA 5KOJA 3U3ZA 1TB4A 5AYVA 1WW8A 4LE1A 4P2BA 2C4HA 2YCLA 5LOVA 2GYVA 4HFRA 3PUKA 2ZQYA 4EFKA 3FCUB 4M9XA 3QEOA 4IIGA 1KYVA 1FFGA 4IR7A 2HC9A 4YJKA 4Z4CA 5KVCA 2HSJA 3BQ9A 2NU8A 2X0KA 1OBVA 3OEED 3V6MA 5G1NA 2A4MA 2O07A 3JQCA 3GL9A 3UHJA 2GF0A 2PD6A 5FBRB 2W71A 3H7AA 3HB1A 3H5VA 3L4EA 4Q39A 4RCYA 1RJWA 4LZAA 1QO0A 4HY3A 1C7JA 1ECCA 5JFGA 4J0QA 2PHZA 4GAEA 1V41E 2ZR0A 1BKDR 4XFDA 5JVDA 4Q7LA 2HM7A 3UJHA 1JJBA 1Q0RA 2ETXA 1L7XA 4U0JA 2EXXA 3IEIA 3T8YA 5BUSA 3SDSA 3QVTA 3VAAA 4XFJA 2V58A 5HCIA 4PNEA 1TM4E 1Y6ZA 3GVHA 2FN7A 5HW0A 1DV1A 2ZJ2A 4ZU1X 2VI5A 3S5JA 3R4VA 4Y1EA 4JI6B 4HVLA 4GM1A 1CUYA 2BJVA 2DH5A 2O50A 3PEFA 3ND9A 2DT5A 3L0IB 2EP5A 3QG1A 4PYNA 1G3QA 1H2ZA 2QW8A 3I2IA 2NVUA 4OOEA 2OCGA 1YAHA 1Q21A 2ORYA 1Q7CA 3DC7A 4PHCA 3CMMA 1I4EB 2R7AA 1JT9A 5B36A 3LBYA 3ZWDA 1FNCA 5DSTA 1PAUA 2DBZA 3ZE7A 1XL0A 4A16A 1HQCA 2VDUE 4DR4B 1C3JA 2XIJA 1QHYA 4U8GA 2VPXA 3NOQA 2VLBA 2PQMA 1HFWA 3AIKA 4UM5A 3BJRA 3E5NA 4KXYA 1UC8A 2QIPA 3HMKA 4RVGA 1OKKD 1U94A 4WCFA 2DKNA 4XDGA 3UHPA 2ZIFA 4D44A 4JJIA 2PFGA 1Y7HA