4BBFA

Aminoalkylpyrimidine inhibitor complexes with jak2
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
288
structure length
288
Chain Sequence
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRNLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYROSINE-PROTEIN KINASE JAK2
publication title Sar and in Vivo Evaluation of 4-Aryl-2-Aminoalkylpyrimidines as Potent and Selective Janus Kinase 2 (Jak2) Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 288
sequence length 288
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bbfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bbfA01
4M0ZA 4FIIA 4FV6A 2B52A 5H8GA 3PSCA 5JGDA 2X2LA 3QCQA 4YMJA 3I0QA 4MKCA 4YZ9A 4APCA 4DFXE 2BIKB 3ROYA 5A3XA 4J52A 2VTNA 4CCBA 1Q8YA 3VUDA 2GTMA 3ANRA 3HRBA 5AUVA 2QOFA 5CZIA 4X2NA 3GC7A 3KRXA 3OS3A 1TQPA 4M67A 4R5YA 4KIKB 3RP9A 3UYTA 2XKCA 4W4VA 5CAUA 2YHVA 2XNMA 4I6FA 4IVCA 4BL1A 4QMNA 2QG7A 4CKRA 2X6EA 4QYFA 2JLDA 2UW7A 4S2ZA 4CZYB 1M2PA 4K9YA 5L6OA 4YJRA 2OFVA 3MIYA 5HLPA 3UE4A 3SW4A 1PXLA 3EFKA 5KZIA 2HZ4A 3BYSA 3RCDA 2ZM3A 3VBWA 1ZMWA 2A2AA 5CYIA 4DFBA 1ZOEA 3PXFA 4I6QA 1PJKA 3DAJA 3DBCA 1WVXA 4HVGA 4FEXA 2WTDA 3PTGA 1WBTA 2C68A 4G6NA 4B0GA 5AX9A 5J1WA 3PFQA 3ZXZA 2PL0A 3AT3A 4I4EA 3ORMA 4AZSA 2YWVA 1W8CA 3AC3A 5HO8A 5HE3A 4E73A 3VBVA 2VTIA 5LMKC 4J98A 3KA0A 1OKVA 3JY9A 4ZAUA 2CN5A 3FKNA 4YJPA 5C03A 1KOAA 2WMSA 3HV6A 4GUBA 5CALA 4F09A 3WARA 4FZDB 1GZ8A 1YXVA 2HYYA 2R3IA 3DFAA 5KZ0A 3ZFXA 4BCIA 4YBJA 2WMWA 3KB7A 3OBJA 1URCA 4RBLA 4RJ7A 4BFMA 2WTCA 1YDRE 3MB6A 5AUWA 5BVFA 5AIRA 3NS9A 4YHJA 4MF1A 5AP6A 1SVGA 3D5WA 4CG8A 4PMPA 2OW3A 3OG7A 5KUPA 2HZNA 3EN6A 2PZPA 4AQCA 2XA4A 3HDMA 5LWNA 4ZZMA 3VUTA 2O64A 3KMUA 2ITYA 4OT5A 2PSQA 2C3LA 4EOJA 4ANOA 4FGBA 3VUHA 4JQEA 4LGHA 3GQLA 2LAVA 5JSMA 4GK4A 3R8UA 2XK3A 2P33A 4L46A 2UZOA 2Z7RA 2J50A 3BLHA 4ZTQA 3U9NA 3SG9A 4YZNA 2XP2A 3HKOA 2YN8A 3AMBA 4YR8A 2GHGA 2YIYA 2QOCA 2X9EA 4IFCA 5M44A 3EQBA 4PTEA 5CSVA 3DA6A 2C3KA 4O84A 4IFGA 4USEA 4I24A 2PHKA 4IBMA 1Y57A 1OECA 2R64A 4ITIA 4NZWB 2ZM1A 3MS9A 5IQDA 3QRJA 3LW0A 1WBSA 5AV3A 4NYEA 1B39A 2CJMA 3HNGA 4GL9A 2YCSA 4O7LA 3ZCLA 5L8JA 2G01A 3KULA 4YPDA 4QMSA 4E4XA 3WZJA 4X21A 3RKBA 3RI1A 5AFVA 3OW3A 3W2QA 3QBNA 2QONA 4YP8A 4CD0A 4FSWA 2O2UA 2PZ5A 5TE0A 3TEIA 1OUKA 4X6QC 1UNGA 2JDSA 1KE9A 3Q2MA 5HE1A 1A9UA 3RAHA 4EI4A 4L68A 5GIOE 2Y9QA 4YZCA 4AW1A 1H01A 1GY3A 2C4GA 2XYNA 2CGVA 3FE3A 4JDHA 3M1SA 3VUIA 3ODZX 5CASA 2E9VA 1O6KA 5CSPA 4V0GA 2OZAB 3EFJA 2J90A 4MWIA 3QTWA 2C6KA 4OBOA 3HRCA 5KMMA 3DJ7A 3FZPA 4UYNA 4XEYA 3A62A 3RM7A 4OAVB 2XYUA 3EYGA 5BUIA 1S9IA 3FQSA 2PVYA 2Y6OA 4AOIA 4EYMA 4F9YA 3EB0A 4YSMA 4FT9A 2PZIA 4X3JA 5AM7A 4TXCA 3GU8A 3I0OA 3W1FA 4B7TA 3FJQE 4FSUA 4D5HA 4TYJA 1XH9A 2QOKA 3EN4A 5E8XA 3UYSA 2OBJA 4RG0A 4MNFA 3W2SA 3NMUF 3FI4A 4IAAA 4FKTA 4PF4A 4C62A 4EUTA 3A7HA 3AXWA 4RX8A 4FKGA 4YC6A 4YHFA 1H1RA 3KXXA 4BKZA 2ZMCA 1IAHA 4ACDA 1TQIA 4DH8A 3LCSA 4M12A 3DPKA 2B1PA 3T8OA 4ANBA 4OTGA 4O7ZA 3Q2JA 5D12A 5AP1A 3FL4A 5GJGA 3RPSA 1KE6A 4KBAA 2WTJA 3TWJA 4E6CA 5FWKK 1Q24A 1OITA 3RCJA 4MNEB 3R21A 4U8ZA 1MUOA 3E88A 4FOCA 1WVYA 4TYGA 1FMOE 4QPMA 5CU4A 4CMTA 3RBWA 1OIQA 3DK7A 5H2UA 3GT8A 3G9LX 4MWHA 4UALA 3ZUVA 4DHFA 3O8TA 4TNBA 3TV7A 2J2IB 1FVTA 4QMXA 4A4LA 3FMKA 4I93A 4O7SA 5FUTA 2RG6A 5M08A 3JVSA 5BVOA 3RPVA 4CG9A 1BYGA 2GFCA 2UVZA 3F3UA 4HGEA 5DEYA 4DG3E 5IA1A 2WNTA 2ZMDA 4FZAB 4AZEA 4IB0A 5J9ZA 4C37A 3ZONA 4UZHA 4EOPA 4E6QA 5CEIA 5J7HA 4ALWA 4CMUA 4C35A 3NUPA 5E4HA 4JR3A 4EK6A 3AGLA 2HK5A 5CVGA 2IO6A 4L00A 4CLJA 4I3ZA 5EQEA 3LZBA 2X7FA 3C4WA 4UXQA 4XG3A 3LOKA 2X2KA 3ZC5A 3TUCA 3LMIA 1YXUA 3WYXA 4F65A 3P4KA 3C4FA 2YM6A 3P0MA 3SRVA 2PYWA 3AC8A 3OT3A 3POZA 4E6AA 5CSWA 3R8ZA 3UMXA 4J8NA 4GKHA 5FBOA 5IF1A 5A9UA 5M4UA 4ZIMA 3UQCA 5AUUA 3F7WA 5CSHA 4NKAA 3FKLA 4FK3A 2REIA 3TIZA 3N4VA 2XKFA 2YIQA 1YI4A 5FM2A 2R3NA 3E3BX 4GW8A 4C4JA 5HLNA 3UVRA 4ENXA 3BQCA 4DEEA 4FZ7A 4DINA 2W06A 1CDKA 3BEAA 4G9CA 3OWJA 1Q8WA 4NUSA 3KMWA 3BGQA 1J7LA 1U46A 4PTCA 4C4EA 3TG1A 4EUUA 2Z2WA 3HV3A 3VWAA 1J7UA 3LM5A 2BMCA 4J96A 4XV2A 4IXPA 3R30A 2VZ6A 4XJ0A 5C1QB 5L2IA 2WEIA 2YFXA 1IG1A 4WHZA 1U54B 2RFSA 4BC6A 4I5MA 1Z57A 2PK9A 3KXZA 1UA2A 4B99A 4O6LA 5BVDA 4KKHA 4YJNA 3DKOA 2FA2A 5EG3A 3R1SA 4EH3A 3FZRA 4KABA 2XMYA 3ZUUA 4TWOA 4RZVA 4O91A 5T6KA 3LFNA 5K4JA 4YPSA 3HECA 3UP2A 1PXKA 4L3LA 3RJCA 3V5PA 3QZFA 3E87A 4HYUA 3NUYA 3QTRA 3DGKA 2RFDA 1CMKE 3U6IA 3HMPA 3PWYA 4KINA 3EFWA 2ZDTA 3H10A 4WOVA 4JRNA 5AAEA 1ZOGA 3ULZA 4L52A 1ZYDA 3DFCB 3RGFA 4AG8A 4BZDA 4BZOA 1L8TA 2F9GA 4I5HA 4KKGA 4IVDA 4C02A 5EFQA 4OT6A 4CFMA 3RAIA 3ROCA 4GMYA 1SYKA 1W82A 3PA3A 2H8HA 3D14A 2Y0AA 4YC8A 3BE2A 4I6HA 1YDTE 1CKPA 4PUZA 3DT1A 3M11A 3O50A 1JLUE 5C9CA 3ZXTA 4EOIA 1GZKA 1XO2B 2ERKA 3BU3A 4FTTA 4TTHB 4XV9A 2UZWE 2WHBA 5HEZA 5CENA 3UTOA 4BN1A 4UN0C 4IADA 4YO4A 1DI9A 4RQKA 2JDRA 4Z3VA 4C4IA 3QQGA 3MB7A 3DBFA 5M06A 1UNLA 3BWJA 4IWQA 4EZ3A 2OJIA 2PTKA 2RF9A 3R2BA 3DAEA 5AA9A 1OL5A 2X4FA 3NAXA 2VTOA 3W8QA 1Q3WA 5AR2A 1R1WA 3NYXA 4Z55A 2R3KA 5CEOA 1FQ1B 1VEBA 3PXRA 5HESA 3V51A 4C57A 4P4CA 3VHKA 1G8SA 2WTIA 4P90A 4OTPA 4L8MA 3Q96A 5A6NA 4CQGA 1R39A 1RW8A 3GENA 3MH1A 4BCMA 3PXQA 3TZMA 5T68A 1REJA 2CGUA 3MW1A 4FT5A 5ANDA 3WZEA 4ORKA 4GRBA 3GU6A 1H0VA 3OHTA 3LFSA 4YTIA 4GJ2A 4L53A 5ETFA 2FGIA 3DQWA 3UQGA 4JDKA 4E5AX 4EH5A 2ITWA 4DBNA 3LQ8A 2YLFA 3BHUA 5DN3A 1H08A 1P4FA 4FF8A 5IA5A 3M42A 4I21A 5CVFA 3VBQA 3VS4A 2WXVA 1U5RA 4FL3A 2QOQA 4L9IA 2A27A 4G3EA 3OT8A 1PW2A 5G1XA 4NH1A 4F7NA 1OGUA 4FG7A 4I0TA 2W5BA 5B2KA 3MJ2A 5GJDA 2BRBA 4RQVA 3EQHA 4FTAA 2RKUA 2BILB 3S95A 2GS2A 4OTHA 3VUMA 5EQPA 3V6RA 2YERA 3H0YA 4OUCA 4YGAA 4XG9A 2UW9A 2JIIA 4YLKA 1FOTA 4MVFA 3F5PA 3CTQA 3A4PA 5JRSA 3GEQA 1J91A 5HNBA 5DT3A 3DAKA 3QXOA 4KD1A 4EC9A 4L44A 5A54A 2JGZA 2C3JA 4J7BA 2JITA 3QA0A 1LR4A 3EQIA 3NR9A 4MBJA 5FXSA 4HVIA 4HVHA 5HZNA 5BVWA 5JK3A 3AGMA 1XR1A 2J51A 2W1ZA 3OTUA 1R0EA 2BUJA 2ITPA 3PWDA 2BVAA 4ZJIA 4F6WA 2H9VA 5CAPA 4I4FA 3ORLA 2XIZA 3TV4A 3UC4A 3W8LA 4FZ6A 4IB5A 4TWCA 4BKYA 2X2MA 4J71A 2JIVA 2YDKA 3WE4A 4NJ3A 4E5WA 3ORNA 4JBVA 4K8AA 2YLEA 3ITZA 1IASA 1WBNA 3DKCA 2HZ0A 3ALNA 3COHA 3HUBA 3V6SA 3PSBA 3ZS5A 4EC8A 2XK9A 4G31A 4O1PA 1DS5A 3FXXA 3HUCA 1CKJA 2R4BA 5HG7A 3TKIA 1ND4A 5IUGA 5JFWA 2BTSA 1UU9A 4C33A 3DBEA 5CU0A 3GCVA 3R22A 5C01A 1GIJA 1NT2A 3QYWA 3LFDA 3VHEA 3P78A 1Q8ZA 2RL5A 1F0QA 1T46A 3GU7A 3I4BA 3PZHA 5HNIX 2Y4IB 3OVVA 5TF9A 2VTTA 3C5IA 5A4CA 3MFUA 4RZWA 4WD5A 4FEUA 4ZTMA 4U97A 3LE6A 1U5QA 4M7IA 2HY81 3GCQA 4ID7A 3L9MA 4J97A 4E7WA 1OL6A 3P9JA 2V7OA 3COKA 1JQHA 3H9OA 3R83A 4C2VA 4O0XA 5AR4A 4DYMA 3LVPA 4O7NA 1PMNA 4RWLA 4ERWA 1JPAA 3VJNA 3Q60A 3MY1A 4ZMEA 3QTXA 1J1BA 4EHVA 3EQCA 4YBKA 5TR6A 3QRTA 3SOCA 2VWUA 4QMMA 2XS0A 2JKOA 3NUXA 4W8DA 5DE2A 3Q53A 3OCBA 4TRLA 1HCKA 2C69A 4IDVA 3EL7A 4W4YA 2NNWB 2VWXA 3C1XA 4C8BA 4F9AA 5IQEA 5AR3A 5CEMA 4NCTC 3NW5A 1YI3A 4N70A 2QCSA 1OBDA 5A4QA 2XIRA 4OTFA 4OTQA 3UDBA 3VF9A 2BAQA 3H4JA 3KXNA 4CEGA 3A7IA 5AWMA 3FL5A 3D94A 4IX6A 5KMNA 4CV8A 3QTQA 4PPCA 3OWLA 4K2RA 4A06A 4QP2A 4DA5A 3VIDA 5I9WA 4K11A 1BMKA 1CSNA 2CN8A 4ZY5A 2QURA 2QQ7A 3RPRA 5LVPA 3BYUA 3KVWA 4JQ7A 4UB7A 4CXAA 2XH5A 3C50A 2WIHA 1XKKA 5IMEA 2QHNA 1ZZ2A 3QCYA 4RPVA 5HQ0A 4O7YA 2PVLA 2XKDA 3LJ2A 4IH8A 4RIWA 3OBGA 2WFYA 2VTHA 3KXMA 4O2PA 3JPVA 2CPKE 2LGCA 4O27B 3Q4UA 3ZLWA 4D2WA 4L7SA 3EL8A 3U51A 4MXXA 2UVYA 1UKHA 4IAZA 3PXZA 3HV7A 5E1SA 3H9FA 5A4TA 3P86A 3LFCA 2R3QA 5FQDC 4EBWA 2OH0E 4R7HA 3ZYAA 3CPCA 3VS0A 3VRZA 3FEGA 3EJ1A 4J95A 1J3HA 3C0IA 5FDXA 4FIGA 3GXLA 3VW8A 5C4KA 3N51A 5M51A 2H6DA 3CQWA 3PPZA 5IEVA 3NRMA 2WMUA 5CF8A 4AX8A 3FAAA 3PJ3A 2PUUA 4JS8A 4QMZA 4H1MA 2C47A 4A07A 2F7XE 2V55A 3WE8A 4CVAA 2YAKA 1DAWA 4CQEA 2GS7A 4WBBB 4X3FC 4DEGA 5IDPA 4R1VA 1W84A 2VTSA 5M4CA 2CNUA 4YNOA 2WQMA 1XBCA 2HIWA 3R0TA 4EL9A 3RNIA 4FKIA 3AC1A 3R9OA 4AZVA 2CCIA 3BQRA 3HAVA 3OY3A 2XEYA 4HZSA 4QQCA 1OVEA 1PXOA 2GQGA 3PG3A 4PP9A 3UOHA 4FSMA 4X3FA 4H36A 4HYSA 3G6GA 4AXAA 4XS2A 1WBOA 3QQHA 1O6LA 3V5WA 2WB8A 2X7OA 5LQFA 5AAFA 4RJ3A 1XH5A 2YABA 2O63A 4RMZA 2B55A 4ANMA 4BCPA 2ITQA 2PZRA 3OEZA 4O7RA 2VX0A 4U81A 1GZNA 3ZU7A 3KK8A 5L8LA 2GQSA 2OXYA 4EH8A 3R8PA 3CD8A 4DEIA 4D1ZA 5GHVA 2R7BA 2YIWA 3D15A 5D9HA 3H3CA 4IHPA 4JIAA 1SMHA 3ZSHA 4KBCA 1SZMA 4KSQA 5L3AA 4KUJA 1KV1A 3FMLA 3MA6A 4UMRA 1OIYA 2HOGA 3S0OA 1YRPA 5ACBC 4O0SA 2QKRA 4U9AA 1OKWA 5F9EA 5AV1A 3FI8A 1KOBA 3HX4A 3QCXA 4FE2A 3TJCA 4ZLZA 5E8UA 3VN9A 3QC4A 2JAMA 4APPA 4CRSA 2E9NA 4BYJA 5BNJA 3UO6A 5EHLA 5DLSA 3MJ1A 3TL8A 2PVRA 5EM5A 3DNEA 4DEDA 2GHLA 5EI2A 2YA9A 2W9FB 4FSRA 4QMUA 4X2KA 3IW5A 2OGVA 4FTNA 4BWPA 4WNOA 4Z16A 5DI1A 3C4EA 3NPCA 3N9XA 4QMTA 3NLBA 4O0YA 5FM3A 1MQBA 4U0IA 3W2RA 2YDJA 4FTUA 4I23A 3RMFA 4X6RA 2QOOA 3A8WA 2VTMA 3UO4A 3DB8A 2RFEA 1W83A 4DGMA 3FC1X 2EXCX 2PUNA 5IQFA 4IX4A 3BYVA 5DBXA 4O0VA 4USFA 3PE1A 5CX9A 3RZFA 5IEYA 5GIPE 5HG8A 4ZSJA 2OICA 4CGAA 2I0HA 4D2RA 3KQ7A 3CD3A 4FTJA 1R0PA 4NM7A 5GZ8A 4HCUA 2VD5A 2CNVA 5E8ZA 3ZH8A 4RC3A 3IPHA 2OXDA 2B0QA 2XB7A 3ZBFA 4FIJA 4FV0A 5FXRA 2UZNA 4FKJA 3NUSA 3LIJA 5G6VA 4D55A 4QQTA 4WRGA 2XM8A 2XJ0A 5EH0A 3EWHA 4ZTLA 3SXFA 1ZMUA 3OMVA 2DQ7X 2F7EE 1XH7A 3QRIA 2VRXA 3Q9XA 3BBWA 1BI8A 3QKMA 3V5QA 5M55A 5A46A 2VX1A 5J1VA 1H26A 5CQUA 1YWVA 2C1AA 3BELA 3PA4A 3QGWA 5KCVA 3BHYA 3H0ZA 4JG8A 3TT0A 3WF6A 5LCJA 4GEOA 3DTCA 3CTJA 2GFSA 5DMZA 3M2WA 3G6HA 4CZUA 3FMEA 4AGCA 4R3CA 2B9JA 1F3MC 2OLCA 3NNUA 2Q0NA 5DVRA 5AP7A 5EI8A 4FGRA 3QHRA 4TL0A 2RG5A 1M52A 2J0MB 3HEGA 3F2AA 3QXPA 3UOJA 2ZDUA 4GYGA 4P5ZA 4IAYA 5J5SA 2XRWA 3Q4TA 3VW6A 1NVQA 4BWXA 4W4WA 4BDCA 5M07A 4FTMA 4BDAA 2YACA 5DWRA 2EB3A 2BROA 4OLIA 3WBLA 4D0XA 2GSFA 4R1YA 1V0PA 4TPTA 2C5YA 4C7TA 5HLWA 3HYHA 3LXPA 5HHWA 2W1EA 4KRCA 2W9ZB 4BI0A 3IKAA 4F9WA 3WIGA 2B9IA 3E8EA 3QTSA 4TYEA 4IMYA 3U55A 2HELA 3K3JA 5HI2A 2C6IA 4BDDA 5CF5A 3EQDA 3EYHA 2NP8A 1CM8A 4PY1A 3BZ3A 3MSSA 2H96A 5D7AA 2XRUA 2B54A 2OJFE 2IVTA 3DOGA 4FKPA 1BKXA 2WMQA 4ANSA 5ANIA 3RINA 3QGYA 3Q04A 3EKKA 5HCYA 4K77A 3HV4A 2GDOA 5AP4A 3F69A 4ALVA 2G9XA 4MK0A 2PVJA 5LMKA 5EDQA 2FB8A 3TUDA 3O2MA 5HO7A 4O0TA 2QLQA 2WMAA 4FNYA 2VWBA 3D7TB 4BDIA 4K1BA 4I20A 5JN2A 3SV0A 3T3VA 2F2CB 3NYNA 2VV9A 3PY1A 4DF3A 4NTTA 3MFTA 4FODA 2YM3A 3BYMA 4LRKA 1E1VA 3L9LA 3I5NA 4EOOA 3S00A 1IA9A 4QMLA 5DRBA 5D10A 4HGLA 3L9PA 4CNHA 5JMSA 2G2HA 4KAOA 3WOWA 1OKZA 3CBLA 3FKOA 3BX5A 1XBAA 3CQUA 3HA6A 5GJFA 2W1IA 5L8KA 1KE5A 2YM4A 3MFRA 3R28A 2ZVAA 5CU2A 3FHRA 3MH0A 4FEWA 3CQEA 1QPEA 4MCVA 3UJGA 2CLXA 3GC0A 3ZO3A 1I09A 4EHGA 4AE6A 3KRLA 2JBOA 5KO1A 3ZSGA 3ODYX 3BV3A 3F9NA 3ZM9A 4A7CA 4B6LA 3UIBA 4DCAA 4O7VA 4AZTA 3ZMMA 4U80A 1HCLA 3GOKA 4ZS0A 3Q6WA 4ASDA 3RHKA 3IECA 2HXLA 3V5JA 3Q3BA 2HZIA 5EYMA 4C61A 4CFNA 2YEXA 5E92A 4LG4A 5JQ5A 2PULA 3L8PA 3R7EA 2C6DA 3A7FA 5L2WA 4M13A 3JUHA 1MRUA 2X1NA 5A6OA 2OIBA 2WU6A 3GCUA 3IG7A 4UV0A 2C0TA 2F2UA 2IW9A 3ZRKA 2KULA 3R9RA 3U4WA 4Y73A 4GVJA 4EK8A 4PMMA 3KK9A 4A4XA 4DH7A 3O8PA 4ZMFA 4FTCA 2UZTA 4RFMA 1MQ4A 3D0EA 3F3ZA 4JXFA 4OGRA 4U3ZA 5JEBA 4IZYA 4DH1A 2OSCA 3O8UA 3MTLA 4JVGA 3MH2A 4UWBA 3OEFX 4W9WA 4B4LA 4FKVA 1UKIA 3MBLA 2F4JA 3DXPA 2FUMA 4DAWA 2BRGA 5AP5A 3FY0A 1JVPP 1KV2A 1YQJA 4NT4A 4NFMA 1HOWA 3VS6A 4BDBA 4E5BA 4JQ8A 1UU8A 4QTBA 3UOLA 3PYYA 4PDSA 3LFBA 2C1BA 2OI4X 4YSJA 5HG9A 3OROA 3AQVA 3CR0A 3F5XA 5HTIA 2GQRA 4GJ3A 2EWAA 4MNEA 3BHVA 4IANA 1XJDA 4IM0A 4OBPA 4QMPA 3F5UA 2QO7A 4O0WA 4ZTRA 3V5LA 1MRVA 4PNKA 4CZTA 2YCQA 2I0VA 1KSWA 3ZLYA 3KFAA 4FKRA 4ZY6A 2W1DA 5ANKA 4DFLA 5EHYA 4IDTA 3MGYA 2VWVA 4EH9A 3QLFA 3KULB 2P0CA 2GHMA 3OOMA 4FV4A 4AE9A 4G2FA 2YWPA 1AGWA 3EOCA 3HMIA 4KS7A 5FBNC 4BDEA 1QPDA 1OMWA 3KC3A 3LFAA 4I92A 4XLIA 1Q8TA 2BR1A 3E3PA 4HGTA 3FLSA 4MTAA 5EM6A 3R9DA 3UC3A 1PF8A 4RGJA 5HG5A 4FYNA 5L6PA 4EK5A 3V5TA 4LMNA 2J6MA 4DLJA 5HBJA 1BL7A 3RK7A 3V8SA 4L67A 4MH7A 3LAUA 4G5JA 3VS5A 5LXMA 1XWSA 3B8RA 2Z7SA 2NRYA 3LM0A 4FV7A 5DR6A 3E63A 4YNEA 4E6DA 1Y8YA 3IK3A 4RIOA 4YUQA 4QMYA 4V0GB 3AD5A 4USDA 3F88A 1IEPA 4F0FA 3PPJA 4M97A 3B2WA 2ETMA 3FLZA 3HMOA 3NZ0A 4FBXA 4MXOA 4CFWA 4DEAA 2W96B 3BLRA 4DLIA 2PU8A 3FMJA 3I60A 2V22A 5I9YA 3FWQA 5DR9A 3RM6A 4DFNA 1K2PA 3BCEA 3CGOA 2WZJA 4EKLA 2PMNX 5BMSA 3R9NA 3W2CA 5BMMA 4KA3A 4LFIA 4M69B 3PLSA 3PZEA 3BBTB 2OJJA 2AUHA 3WILA 3ZDIA 4E4LA 4KKEA 4PPBA 4U41A 5ANJA 3TTJA 3MVJA 5D41A 3SD0A 2UV2A 2C5XA 3P1AA 4XRLA 2BHEA 2JAVA 5KBQA 2FYSA 5IQHA 4J53A 1OPJA 5AR7A 1U54A 3HZTA 1WAKA 3NEWA 3R7IA 4ITJA 1JKSA 3TN8A 2VO3A 4YZDA 2PVMA 4NM3A 4EQCA 4XBUA 3HRFA 4X2FA 1PMUA 5IDNA 3QQJA 3NCGA 2BFXA 3OUKA 3BWFA 3BLQA 3FY2A 2W5AA 3C4CA 5DT4A 4G16A 4S31A 4TYHB 1S9JA 4MD8E 1LPUA 3PIYA 5EOBA 1WVWA 5CU6A 4G6LA 2IZUA 5FXQA 4BGHA 2QC6A 3CY2A 5CSXA 5F94A 4LUEA 4BB4A 4HPUE 2BZHB 5IISA 2X8IA 2GTNA 4DEBA 2OWBA 5B2LA 4WUAA 4I5PA 2W1GA 5EOLA 4XOZA 2UW8A 3FMHA 4JG6A 1Q3DA 4IB3A 1LEZA 5M53A 2WQEA 4BY9E 4EOSA 4WG5A 4BR3A 2R3JA 5M4FA 5IKWA 4PDOA 2RIOA 3E7OA 4XG8A 1RE8A 4GFGA 4XOYA 2WTVA 4UXLA 2YZAA 3NYVA 2BAKA 5AMNA 4ZXTA 3ORXA 4O81A 1URWA 3EMGA 2YAAA 3DY7A 4QOXA 4D1XA 4RFZA 2EU9A 1YKRA 2PVNA 3LCTA 5EDRA 2WELA 5CNNA 4RSSA 2X81A 1PYEA 3OUNB 4BTMA 2Z60A 4BKJA 1ZAOA 2PVKA 1Y6BA 2FSOX 3WZDA 2VAGA 4ZEGA 4XG6A 4JJRA 4IAIA 4M14A 2XBAA 5KBRA 4FSYA 1JKLA 2XCHA 5I0BA 3C5UA 3TZ8A 5DHJA 4ZP5A 2CKOA 4IC8A 2X8DA 3QAME 2PY3A 4PQNA 3ZFYA 4AT4A 3KCKA 3QD4A 2GS6A 4ANQA 3IOPA 5LWMA 5M57A 3GB2A 2OK1A 5KMLA 2WU7A 3BIZA 3CS9A 3KVXA 3ZEPA 5LMBA 2BDWA 1E1XA 2EUFB 4FTLA 4CFXA 2C6OA 2J0IA 2PWLA 3FC2A 4JLCA 3MFSA 3HGKA 3LLTA 4FL1A 4LL5A 4XH6A 2WPAA 4M84A 5BVEA 4QP9A 1ZRZA 5H8BA 3EN9A 4A9TA 1ZY5A 2UZUE 3JVRA 3ZM4A 4O7TA 2OXXA 4K6ZA 3NWWA 3BHHA 3ELJA 4H1JA 2UZDA 5HCXA 3ZC6A 4EQMA 1W0XC 5CU3A 5HICA 3JYAA 5M09A 2C5OA 2VNWA 3EQPA 1OI9A 4IZ7A 5AP0A 2CDZA 3VJOA 4YO6A 3IW6A 4XV1A 1MP8A 4D2TA 3ZEWA 1ZYLA 2PPQA 2Z8CA 4IWOA 4RVMA 5JZNA 4NL0A 4KWPA 2OF4A 5HIEA 3IDPA 1LEWA 3UG1A 4CKJA 2O8YA 3UOKA 3GP0A 5GNKA 4IEBA 3MVLA 4C4GA 5A14A 3AOXA 2WD1A 3VUGA 4EH4A 5CANA 5IQAA 1VYWA 3CCNA 3KY2A 4RJ6A 5HORA 4C4HA 2O0UA 3HMNA 3KRRA 5IG1A 3NX8A 4MXAA 3MH3A 1YOJA 4M3QA 4J1RA 4BCOA 4CFVA 3FLNC 4GKIA 3UIXA 4AW2A 2UW3A 5E1EA 2ZM4A 4IB1A 5DH3A 3W10A 4AP7A 5FEDA 4ZY4A 4IM3A 1UV5A 2IVVA 4XHKB 1OPKA 4C3RA 3ULIA 4MBIA 5HIDA 3FPQA 3Q5IA 3Q5ZA 2JFMA 2JKMA 4FKWA 3S3IA 3RK9A 4GK2A 4CT2A 2AYPA 2OIDA 2OU7A 2WTKC 4HNFA 4MXZA 4WG4A 3UZTA 4ITHA 1QPCA 4F08A 2Y4IC 5L2QA 5HCZA 3RALA 5IH6A 1AQ1A 3NVKI 4X2JA 3HVCA 5E7RA 1YXXA 4UEUA 2VWWA 3UZPA 4KIPA 1NW1A 3QL8A 4ZZOA 3MWUA 3S2PA 4BHZA 5EYCA 4FL2A 3MTFA 2W7XA 3MVMA 4JRVA 4O7WA 5FTQA 1OKYA 3D83A 1GJOA 3GQIA 4FICA 2NO3A 5CXHA 5FD2A 2QVSE 2WO6A 4O0UA 2VTRA 1O9UA 3OY1A 5JRQA 4QTCA 4LQMA 5J5TA 1BX6A 4FSTA 4XUFA 2NRUA 4O83A 3BEGA 2ETKA 4AW5A 2HCKA 4ALUA 3PPKA 5J8IA 4NM0A 2O5KA 5CF6A 2ACXA 2J7TA 4ONAA 2QR7A 1PXMA 5AIKA 3R7UA 4ANNA 3MVHA 3NNVA 4BBEA 3IOKA 4IX5A 3S1HA 3QALE 3DTWA 4BCGA 3VUKA 3EH9A 4CLIA 4XG7A 2ZOQA 5DGZA 3GU5A 1SNUA 3E62A 3FQHA 4L6QA 2WMTA 2WTKB 1YDSE 3ET7A 5KMKA 3ORKA 4Q9ZA 4EWHA 2A0CX 5H3QA 4TN6A 3R7YA 4QNAA 3G15A 1ZOHA 5EYDA 4ZK5A 5IA2A 3FYKX 3DU8A 5IU2A 4ZSLA 4HJOA 2F7ZE 3P7BA 1JWHA 4QMOA 3FZSA 3P7CA 4HCVA 4QYHA 4EBVA 2WMRA 4UYAA 5DT0A 5DIAA 1ZLTA 3BU6A 5L4QA 4FVPA 4FVQA 4Y83A 5ETAA 3IGOA 4MQ1A 3G2FA 3KRJA 4I41A 4LM5A 5DYJA 4XNEA 2Q0BA 2YM5A 3BI6A 3GOPA 4Z7HA 5CTPA 4N57A 3MIAA 3NUNA 4E93A 4IE9A 4DEHA 5CEKA 5HU3A 4QT1A 4JDIA 4JAIA 4OBQA 4G9RA 2BDFA 3KXHA 3LKMA 1ZXEA 3MI9A 3MPAA 3G0EA 5CS6A 1M7QA 1YXTA 3UIUA 3VQUA 5TO8A 3MPMA 2XK4A 2X7GA 2IVSA 2W99B 3R9HA 2P2HA 3PY0A 3LXKA 1YHWA 2ZV9A 3UBDA 1Q41A 2QHMA 2QLUA 3GVUA 3R2YA 4FT0A 4EH2A 4A9UA 4B8MA 3PVGA 2DS1A 1WBWA 3CJGA 4MHAA 4QNYA 1PYXA 4MQ2A 3VBYA 2UW5A 3E64A 3IDCA 4I0RA 2F57A 3WZKA 4C59A 4NCTA 3UVQA 3NNXA 3SHEA 3UVPA 2X39A 4D2PA 1OIRA 3NW7A 3COMA 3P5KA 5M4IA 4NJDA 1GZOA 3CP9A 4AFEA 3FXWA 2E2BA 1YWNA 3E7VA 5KMIA 4RC2A 5ANGA 4BBFA 2GNHA 4LGDA 4M66A 3PVBA 3TNQB 4ASXA 2ITOA 2BPMA 4BIEA 3FHIA 3QD2B 4ZTHA 5E8YA 3TUBA 5HVYA 2J4ZA 3W32A 4KNBA 3THBA 4YJQA 5HD4A 1QCFA 2RGPA 5K4IA 4M0YA 4RT7A 3FBVA 3D5VA 3OW4A 4FMQA 4I5CA 1M7NA 2WQOA 3LFEA 4BCQA 1IAJA 2CKQA 1STCE 2VGPA 4RJ4A 4BZNA 4ZSAA 1P14A 3ETAA 3Q9YA 2V62A 2WTWA 3W16A 5CAVA 5DRDA 4RX7A 3O7LB 4GCJA 3ZHPC 5BUEA 2JDTA 3DZQA 2FSLX 2I6LA 2OIQA 3SA0A 4EK4A 5H8EA 5EDPA 2XIXA 2XKEA 4JBPA 3UNZA 2WOUA 5HD7A 4Y95A 4ASEA 4U45A 3KU2A 2WAJA 3EFLA 3MPTA 5IQBA 1OB3A 4CYIA 3BRBA 2R5TA 4D58A 3R1QA 3R73A 3F3WA 4KIOA 2FSTX 4LL0A 5BYLA 2PVFA 2XM9A 3PUPA 4Y46A 4BIBA 4DFZE 4ERKA 3LXLA 4GT4A 5EW8A 3E92A 3PDTA 1Q62A 3N4UA 3HV5A 2XJ1A 4QD6A 2CKEA 4LYNA 2E9OA 4QTAA 3BHTA 1P2AA 4BRXA 2VWYA 5BYYA 4G17A 2ZV8A 4YU2A 4GFMA 5AA8A 5EQYA 5C4LA 4BCHA 3OCSA 3TNHA 4AWIA 3F2RA 3TKHA 4FR4A 4KSPA 4PRJA 4QMWA 2YM8A 3AT4A 4Q9SA 4YZMA 5KKRC 4ZJVA 2XNPA 4EOQA 2GNGA 4EOLA 1P4OA 4BCFA 4QQJA 4B8LA 3ZZWA 3U87A 1VJYA 5IH4A 1SVEA 2R3HA 4FA2A 2IVUA 3ACKA 3LFFA 3RHXA 4R78A 2W4JA 5HOAA 4OR5A 4D4VA 3IDBA 1JOWB 3G51A 1J7IA 2I7QA 3R6XA 3L9NA 2VU3A 2A4LA 5I3OA 2J5EA 3OTVA 4H3QA 4RIXB 1OL2A 4QPAA 3O51A 3FLYA 3Q9ZA 4FTOA 1Q97A 3VO3A 3O0GA 2JBPA 3QQUA 4FKUA 5FTOA 2XIKA 3U6HA 3FPMA 4IZ5A 5LOHA 3GC9A 4D28A 2ONLC 3WF9A 2ZJWA 3TDVA 5KHXA 3FYJX 4Q2AA 4L3PA 4GS6A 4G3GA 4PL5A 3P08A 2C3IB 3ATSA 3MESA 5AUTA 4IJ9A 5FP5A 4FSNA 4RVKA 4J8MA 3FMDA 2Y6MA 5A4EA 1TKIA 2EXEA 5JGAA 3DK6A 4PPAA 4HVSA 4FEQA 5KNJA 4RJ8A 4HNIA 1WBVA 3HL7A 4GIHA 2WOTA 3TJDA 3TNPC 5KKRB 1K9AA 4GV1A 3C4XA 4QP7A 4XP0A 3F5GA 4FTIA 1WZYA 4F1OA 5AR5A 2W4KA 1YHSA 1GOLA 3O17A 3PJ2A 4NIFA 4C34A 2F49A 4KS8A 4RLLA 3DDPA 4IVAA 2Z02A 5C27A 3CE3A 4TKSA 1XBBA 5C8NA 1SNXA 3UQFA 2R3RA 4HPTE 2EXMA 3ZTXA 1APME 4IIRA 3LCKA 1ATPE 1YOMA 2J9MA 4AGUA 5HX8A 3VS2A 3UZRA 4NW5A 5J87A 2XNOA 5KHWA 1H1PA 2I0EA 3NUAA 4F6UA 5JGBA 2FSMX 2Y7JA 3RZBA 4BDHA 2P4IA 4FIFA 4DT9A 2IG7A 3T9IA 2BRMA 4D9TA 4G3DA 2RFNA 4ZLYA 3QU0A 4OW8A 4KIKA 3ZO4A 2O3PA 3RAWA 2PUIA 2XNGA 1AD5A 2Z7LA 4LV8A 4A4OA 3VC4A 3AMYA 4IAFA 1H1WA 4R3PA 4TZRA 5LVLA 1F5QA 5EM7A 3KN6A 5HBHA 1VYZA 3SVVA 1FBNA 1TVOA 3U6JA 4WSQA 3UODA 2OZOA 3NIZA 4ARKA 3ZSIA 4F7LA 3TM0A 3A7JA 2DWBA 3KKVA 3UP7A 2JKQA 3G90X 2ITUA 2PMIA 4NTSA 3AD4A 4ZLOA 3U9CA 5IQIA 4JR7A 3VS3A 4MYGA 2WMVA 4BCKA 2VN9A 4K0YA 3OCTA 4G34A 4HOKA 5BQ0A 2YJRA 1GIIA 3C13A 3UMWA 3ZBXA 4RX9A 2BTRA 4ANLA 4UWYA 4BI2A 1E9HA 1NA7A 4GIIA 1Q8UA 5ANOA 4TY1A 2BHHA 3R8VA 4HW7A 3V01A 3ZO2A 4CKIA 3HDNA 3Q4CA 3DV3A 4U44A 4BF2A 3AC4A 3AT2A 4LMUA 4RIYB 4U43A 2BZIB 3OZ6A 4AN9A 3D7TA 1H1QA 3QKKA 1A06A 1UNHA 4IX3A 4QP1A 1R78A 3E93A 2PVHA 3RWPA 1JKTA 3IW8A 3UO5A 4F63A 5L2SA 3ZZEA 1TQMA 5F1ZA 4IWDA 1V1KA 4GH2A 4FV3A 4X2GA 5M56A 4ASZA 4BDKA 1J1CA 2X8EA 4E3CA 3C51A 3OWKA 2XF0A 3G0FA 5AP2A 4DFYA 3VQHA 3SXSA 2IZSA 5JH6A 3EHAA 4EWQA 4D2VA 3I7CA 4O38A 4GU9A 4II5A 3QX2A 4W9XA 5HGIA 1NXKA 4EONA 3F7ZA 2HW6A 3BU5A 1NY3A 3GCPA 4FOBA 4FUXA 3TZ9A 4F7SA 3QKLA 5C8MA 1H1SA 4BTJA 3ALOA 4P7EA 3II5A 1VR2A 3L8XA 4A9YA 3F61A 3IGGA 4C4FA 3VS1A 4F4PA 1H8FA 4PDPA 2OF2A 5HE2A 4I0SA 3HA8A 2SRCA 4L01A 1PY5A 4FNZA 4W8EA 4LRJA 4FK6A 3WF5A 4XRJA 3F6XA 5IZFA 5LJJA 4DG2E 4I94A 3K5VA 5CI7A 3TKUA 4IWPA 2BKKA 2XNBA 5CQWA 2YITA 1BL6A 2AC5A 4PL4A 2XUUA 2HW7A 3G5DA 3DXQA 2JKKA 4BDJA 4E8AA 5FEQA 4QMVA 4K33A 4ZTNA 5D7VA 1Z9XA 4HCTA 5CI6A 1O6YA 2UZEA 3FSFA 3S4QA 3GGFA 4OAUC 4W4XA 5E8TA 5F4NA 3V8WA 4H3PA 5F95A 4YTFA 3JY0A 5LVOA 5CT0A 4PX6A 4QP3A 3SW7A 2QOBA 2ZAZA 3R02A 3RWQA 4NK9A 3V3VA 1FGKA 2CSNA 3D2KA 3VAPA 5K9IA 4QMQA 2VWZA 4JL9A 1RDQE 1UWHA 1QPJA 3PP1A 4QP8A 5IA0A 5EKNA 5E8WA 3UNJA 4MAOA 5A4LA 2W1HA 1QL6A 4R7IA 3A7GA 3LQ3A 2OZAA 3EQGA 1H07A 5B0XA 3CGFA 5ITAA 5E9EA 1PKGA 4AA4A 1OBGA 3PY3A 2IPXA 1YOLA 5I5ZA 3MYGA 4PTGA 3I81A 1B38A 3AMAA 1H4LA 3O7LD 3TNIA 4AN2A 4CSVA 3OP5A 3FI2A 3ORTA 2W17A 4S30A 2CNQA 3T3UA 3A61A 2JC6A 4FV9A 4RVTA 3P79A 1PXNA 3EZRA 3AD6A 3DZOA 4PP7A 2CGXA 4GSBA 2QKWB 3V8TA 1ZMVA 2B53A 1CTPE 2VTJA 4V05A 4MBLA 5I3RA 2YZLA 4R7BA 2C6LA 3RK5A 1ZY4A 4ZZNA 1T45A 2QOIA 5I9ZA 2UZLA 4TWNA 4XYFA 3ZLSA 2BFYA 3R8LA 3QD3A 3NYOA 3R1NA 5EKOA 1Y8GA 4UMTA 4DCEA 4DTKA 3GFEA 4ZJJA 5I9VA 4BHNA 2IJMA 5TKDA 1YI6A 3TZ7A 4NEUA 4BTKA 4CT1A 4EQUA 4DN5A 4EZ7A 3BGZA 2GNIA 3SKCA 4H05A 5IQCA 2BAJA 1ZZLA 2BKZA 3PXYA 4GUEA 4C3PA 1VZOA 3UGCA 4OTRA 3Q9WA 5KE0A 3SAYA 4IVBA 4FI1A 5IUHA 3MY0A 4BCNA 3E8CA 2E9PA 2R3PA 3E5AA 1ZARA 2XCKA 2QU6A 2YM7A 3QTIA 2PMOX 4WKQA 3IO7A 4KIQA 3QRUA 4ACMA 4QYGA 4JBOA 5GZ9A 2VTAA 3L8SA 3SQQA 3W18A 1LUFA 2UW6A 4EKKA 4DGOA 5IUIA 4CV9A 2R3GA 4ZOGA 3OXIA 4NKSA 4O1OA 4Y85A 4MX9A 5DFPA 1FGIA 3KMMA 3F2NA 3QTZA 3QWJA 2VWIA 5AJQA 3W2OA 4R5SA 3FV8A 4EORA 4PMSA 3QLGA 4F1TA 2X0GA 5HX6A 5L6WL 1OPLA 5CAOA 5KMJA 3ANQA 4C0TA 5LMAA 1H27A 2VX3A 2XVDA 4NU1A 3LLAA 4M69A 2CLQA 5AM6A 3PVWA 2Z7QA 3FDNA 4MF0A 2C0IA 4UWCA 5DR2A 3RVGA 2ITZA 2PE1A 2VO7A 4HGSA 4O22A 3LCDA 3P7AA 4V01A 4YLJA 4BVUA 4O82A 4UY9A 4EJ7A 3G9NA 5IA3A 1GAGA 1RQQA 2J0KA 3HAMA 2GNFA 2VTLA 4LV5A 4O6EA 3NAYA 3QX4A 4QTEA 2OG8A 3QQKA 4O96A 3ZLXA 1JSVA 4JI9A 1REKA 2GPHA 3IQ7A 1Y6AA 4FX3A 4ZSGA 3VBTA 2IW6A 5CLPA 3SG8A 4GVAA 4JNWA 2B4SB 5HO6A 5IQGA 3A2CA 5CEQA 3IS5A 1NVRA 3QYZA 4HYHA 4TYHA 3QUPA 3SX9A 1BLXA 3KRWA 2H34A 2HAKA 3GNIB 4QYYA 2J0JA 3DQXA 5JQ8A 3CIKA 4AZFA 4O2ZA 3FQEA 3NSZA 3QZGA 3DBQA 3REPA 4P2KA 1U59A 4U42A 1H24A 4JBQA 4RRVA 4M15A 1X8BA 3QHWA 4WUNA 5F20A 2C6TA 5DPVA 2HXQA 4FT3A 4FV1A 5EHOA 4NWMA 3LMHA 4BWKA 5IH5A 4BICA 2B7AA 2WGJA 5DA3A 4IJPA 5CY3A 4EHZA 3TACA 3VVHA 5AUYA 3G33A 4UBAA 2BALA 1YVJA 2BCJA 3QTUA 4FG9A 2CKPA 2VO0A 2ZB1A 3ORIA 4YTHA 2P2IA 3ERKA 4R77A 1PXPA 4DGNA 4L3JA 1UU7A 2R3LA 5CWZA 4UX9A 4WG3A 3OXTA 1A48A 3NCZA 3ZRMA 2UVXA 3U4UA 3PLAE 3LXNA 2I1MA 4FSZA 4F1MA 2ZB0A 1XH8A 3I5ZA 4KRDA 3SOAA 5EK7A 2QODA 4EH7A 4JDJA 2VTQA 2IN6A 4G3FA 4XMOA 5HKMA 4WIHA 4U5JA 5AUZA 2OKRA 2BZJA 3CKXA 4X7QA 3R7OA 2I40A 4EH6A 4CYJA 3PIZA 4QYEA 3QCSA 1Q61A 2PZYA 1OL1A 1OUYA 3ATTA 3PJ8A 3QUDA 4RVLA 5AX3A 1Y91A 3GU4A 5FTGA 3PRIA 1GIHA 3CY3A 3ZRLA 4U79A 1MRYA 2FVDA 2QU5A 4FTKA 4BDGA 4F0IA 5J79A 1ZYSA 2CGWA 4LOOA 4P5QA 4DH3A 4ZSEA 1Q4LA 1YW2A 4XCUA 2JFLA 4FKLA 4TW9A 3A8XA 5E91A 5K3YA 4C3FA 1W7HA 3H30A 4QO9A 4FEVA 3SRVB 1QMZA 5ICPA 3PG1A 2BZKB 2ZYBA 4FV2A 5TT7A 5BUJA 3OWPA 4FVRA 2XIYA 2UW0A 4AZWA 4TWPA 4QQ5A 3QWKA 4WNMA 1PHKA 5I4NA 2JDOA 2GNLA 1K3AA 3UPXA 5AEPA 2V0DA 2JEDA 4F99A 2PE0A 4L45A 5AV2A 4O0RA 4RLKA 2PE2A 5T3QA 2YISA 4N0SA 2IZTA 1XH4A 3I79A 3RAKA 2YJSA 2WMXA 2E9UA 2WQNA 4H39A 4HZRA 1UWJA 4E4NA 4DFUA 5J9LA 1M14A 4JOAA 4JT3A 4FV5A 3VF8A 3PRFA 5ANEA 4D9UA 1FVRA 3EZVA 1PMVA 5J95A 3Q32A 4BGQA 1WCCA 2C0OA 2PMLX 2W5HA 3GFWA 5K5XA 1KE8A 4JAJA 4ACGA 4Q5HA 4EOMA 3ZFMA 3FLQA 4FV8A 3BV2A 3CSVA 3C0GA 3R01A 3DXNA 5JZJA 4Y5HA 1KWPA 2QOLA 1W98A 3DDQA 3KGAA 1SM2A 3H9RA 4YJVA 4WRSA 3RPYA 5D1JA 4YTCA 3NVMB 1JSUA 3KN5A 4RX5A 1OZ1A 2XNNA 4F70A 4M68A 1P5EA 3C7QA 3OCGA 1PKDA 5J7BA 3TTIA 1V0OA 4D5KA 2XJ2A 5AADA 3AC5A 3PXKA 3HP5A 4FG8A 4JX7A 4YURA 5HVJA 3TV6A 1PXJA 3WZUA 2WIPA 1XQZA 2VTPA 2VUWA 4PL3A 4XP2A 5E8SA 5EW9A 5AV0A 1KUTA 5B7VA 3LHJA 5K0XA 4GG5A 5TOZA 4PDYA 4NW6A 2NPQA 2UZBA 2ERZE 4AA0A 5DOSA 2JIUA 2YIRA 2ZV7A 3Q4ZA 4GYIA 1PMEA 4CRLA 3OD6X 4D2SA 2JDVA 2BIYA 3E8NA 4MD7E 4GFOA 1IR3A 4FTRA 4RWJA 1I44A 5CXZA 4GG7A 4S33A 2G1TA 1FINA 3K3IA 4HYIA 4C2WA 5HU9A 2W1CA 3TI1A 5KX8A 2Q83A 2GU8A 3BKBA 2DUVA 3D4QA 2ITVA 3IW4A 3QZIA 3LMGA 4XG2A 3WYYA 2ESMA 3DLZA 3CC6A 4F9CA 1FPUA 3TXOA 3U8WA 4EK3A 2P55A 5AUXA 3QF9A 3ORPA 4FC0A 3MV5A 3GBZA 3EN7A 4IACA 2IWIA 4Q5EA 2JD5A 3PJ1A 3NDMA 3QUEA 2C30A 5E90A 4QP4A 5ETCA 2KTYA 4FSQA 3UIMA 2QR8A 4D4YA 4GK3A 4DBXA 5AR8A 4D0WA 3UG2A 1L3RE 3E8DA 3QA8A 3NNWA 3F82A 3QRKA 5JKGA 3O23A 4QRCA 2ITNA 4LOQA 3A60A 4DT8A 3IONA 3CTHA 2YDIA 3OOGA 5I9UA 4JIKA 5GINE 4L43A 3T9TA 4D4SA 3R00A 3JR1A 3CJFA 3FLWA 3LJ1A 3LCOA 5EYKA 1ERKA 3DLSA 5CT7A 3KCFA 4PV0A 2VGOA 3I7BA 3VRYA 1B6CB 3GUBA 3PIXA 1JBPE 4LRMA 4G3CA 1KE7A 2R3OA 3KEXA 4RFYA 3OC1A 4YLLA 2V7AA 2R7IA 4FTQA 1H00A 3FZTA 4DGGA 3F66A 5LCKA 3U54A 5C8KA 3MN3A 2Y4PA 5I9XA 3RPOA 3D5UA 4BIDA 4I22A 3IW7A 1JNKA 5K0KA 5IMXA 3I1AA 3L8VA 4AU8A 5HE0A 1H25A 4CTBA 4WA9A 4JG7A 3GC8A 2R9SA 3QQLA 5JFXA 4IZAA 1Q99A 3A4OX 3O71A 2WEVA 4JX3A 4AS0A 1OIUA 4FKOA 1WBPA 3KF7A 3PA5A 4WT6A 4YC3A 4BTFA 1M2RA 3D7ZA 3L1SA 3ZO1A 4A9SA 4E26A 2WMBA 4YZBA 3NW6A 2W4OA 3D5XA 5FG8A 3FSKA 3CLYA 5J9YA 3ZDUA 4DC2A 1YWRA 5DEWA 3WF7A 5IA4A 1V0BA 2G2FA 4AF3A 1ZWSA 2R3FA 4IC7A 2WKMA 4F7JA 3D2IA 4M8TA 3R7VA 3FZ1A 2ZV2A 2X6DA 4U40A 3W2PA 3B8QA 2I0YA 1M17A 3ZUTA 5IEXA 4KBKA 3MA3A 4GT5A 4DG0E 4BBMA 2DYLA 3DJ6A 3FUPA 3HLLA 4ZTSA 4G1WA 3FMNA 4R3RA 4WBOA 4Y5QA 3DCVA 5IPJA 1Z5MA 2UUEA 4O86A 3UNKA 2P3GX 2W0JA 3K54A 4LOPA 3CXWA 3DKFA 2G2IA 3EQRA 4F64A 3I6WA 4OTDA 3F3VA 5HVKA 3JXWA 1R3CA 4BI1A 3C4ZA 2CMWA 2XEZA 4EYJA 2BDJA 3BE9A 2BRHA 4KB8A 4BGGA 4AACA 1FMKA 5HIBA 4NFNA 4ACHA 2GMXA 3QFVA 5HTCA 4DTBA 3RNYA 4C58A 4E1ZA 3WF8A 4S34A 3ENMA 1YXSA 1DM2A 4NM5A 1H28A 4LUDA 4BYIA 4XG4A 3DB6A 3R63A 3R1YA 2OH4A 1BUHA 3O96A 5FDPA 4OTIA 4Z7GA 5AV4A 4YJTA 4AW0A 5CZHA 3SXRA 2OJ9A 3DS6A 3LQ5A 4Y72A 5CEPA 3WIKA 3LFQA 4XLVA 4CCUA 1JAMA 4E20A 3K2LA 5H9BA 1ZYCA 3DKGA 2OFUA 2HENA 2QD9A 2YIXA 4XV3A 5CNOA 3KF4A 4B9DA 5D11A 4F6SA 2QO2A 4PWNA 4LI5A 2QG5A 3ACJA 3FMMA 4QPSA 4BDFA 5DNRA 4UMPA 3PJCA 3AG9A 2R2PA 2QNJA 3MDYA 2XZSA 3ORZA 5BYZA 4DGLC 4ENYA 2HWPA 2EB2A 4RWKA 5B2MA 5K5NA 5FRIA 2XNEA 3SLSA 3V04A 4WNPA 5C26A 4AN3A 3R8MA 3TIYA 3BPRA 4OTWA 2FO0A 5JFVA 3BGPA 4QTDA 2IW8A 3ZOSA 3HP2A 1H0WA 4UMUA 4EOKA 3NIEA 4TYIA 3OFMA 4D1SA 4RC4A 2CHLA 2VO6A 4RIXA 5LARA 4FKQA 4FYOA 4H58A 3VS7A 4EEVA 4UMQA 3KL8A 5GZAA 1PXIA 5EI6A 1EH4A 3DJ5A 3TNWA 4ZS4A 2GNJA 3EKNA 4PMTA 5LVNA 2FH9A 4V04A 4U7ZA 3TCPA 2C5NA 2C6EA 2BRNA 3P23A 2R3MA 4RIWB 4TNDA 4MXCA 2QI8A 4FNXA 4G6OA 4I1ZA 1DAYA 2B9FA 2B9HA 4GU6A 2GCDA 2UW4A 4S32A 3PE2A 4CTCA 3ID6C 3AC2A 2C5VA 4D4RA 4HVDA 1UU3A 3POOA 4C36A 1SVHA 2OJGA 1M2QA 1G8AA 2J5FA 4FKSA 2ITXA 2OO8X 4U6RA 2X4ZA 2XBJA 3R04A 3OXZA 5EW3A 3C9WA 1G5SA 4MD9E 1CKIA 3Q6UA 4A9RA 3R71A 4UZDA 3OF0A 4WNKA 5JFSA 5LVMA 2ITTA 2QOHA 4IQ6A 4DH5A 5E8VA 3EQFA 5FLFA 5BVNA 2YCRA 1NVSA 3KXGA 5FP6A 4EHEA 1U4DA 5L2TA 3TDWA 1XH6A 2AC3A 3MY5A 4X0MA 3DBDA 3FZOA 3FI3A 4Z9LA 1OL7A 1Q5KA 2XK8A 2Y8OA 5JT2A 2PUPA 2G15A 5AP3A 3K5UA 3W55A 3GCSA 4FNWA 3LPBA 3PP0A 4J99A 4AAAA 3VBXA 4GT3A 3WI6A 4DTAA 5KMOA 4YHTA 2ONLA 5ETIA 4AGDA 1FVVA 3GI3A 4AUAA 4X3FB 4H3BA 4EJNA 3UPZA 3KREA 4C38A 3FXZA 3NGAA 3EIDA 2IZRA 3QC9A 2RSVA 4PNIA 3LJ0A 2W1FA 5AAGA 1OM1A 4WSYA 3RTPA 2C6MA 3COIA 4U3YA 4TT7A 4K18A 2WQBA 2R0IA 5EM8A 3DNDA 1GNGA 4QP6A 4DE4A 4F0GA 1BI7A 4MEDA 3CKWA 4FZFB 2QO9A 2XK6A 2X9FA 5ACKA 3EN5A 4AA5A 4RA4A 4F9BA 2EVAA 5FGKA 5CAQA 2UZVA 4AFJA 4LGGA 3QZHA 4AT3A 4FT7A 5FEEA 4G5PA 2O65A 1IRKA 3NUUA 5BPYA 1YHVA 3PSDA 3ENHA 4CFUA 4RJ5A 4FIHA 4FUYA 1RJBA 2XK7A 4MXYA 2A19B 4O21A 4R6VA 4XP3A 5HNGA 4YJOA 1UVRA 5CVHA 4ACCA 3Q52A 3R7GA 4RWIA 4AOJA 2CCHA 2HWOA 4R8QA 3W33A 2V5QA 1XHAA 2W05A 4XX9A 3B2TA 1DI8A 3BYOA 3SDJA 3CEKA 4L42A 3A99A 2R0UA 4IM2A 3QD0A 1JKKA 4Y8DA 4E4MA 1LP4A 2YCFA 4FIEA 3D9VA 4RA5A 5HBEA 4AOTA 4EZ5A 4NSTA 4WO5A 5HTBA 4RIYA 3I6UA 4BCJA 5BVKA 4AGWA 2HY0A 2ETRA 3VULA 4I6BA 4N4SA 4AT5A 1ZYJA 2VNYA 4N6ZA 5DG5A 3VNTA 4CFFA 3DK3A 4L7FA 4DITA 4N6YA 5BX0A 4YJSA 2A1AB 3C0HA 4NIFB 4IW0A 4IAKA 2J0LA 3N4TA 3HMMA 3SC1A 4CMOA 3QQFA 3F3TA 5CF4A 1IA8A 3SGCA 1PRYA 4XBRA 1WMKA 3CPBA 1JSTA 3JS2A 4YJUA 1WFCA 1G3NA 3PVUA
chains in the Genus database with same CATH superfamily
4M0ZA 4FIIA 4FV6A 2B52A 5H8GA 3PSCA 5JGDA 2X2LA 3QCQA 4YMJA 3I0QA 4MKCA 4YZ9A 4APCA 4O4BB 4DFXE 2BIKB 3ROYA 5A3XA 4J52A 2VTNA 4CCBA 1Q8YA 3VUDA 2GTMA 3ANRA 3HRBA 5AUVA 2QOFA 5CZIA 4X2NA 3GC7A 3KRXA 3OS3A 1TQPA 4M67A 4R5YA 4KIKB 3RP9A 3UYTA 2XKCA 4W4VA 4O4CA 5CAUA 2YHVA 2XNMA 4I6FA 4IVCA 1W2FA 4BL1A 4QMNA 2QG7A 4CKRA 2X6EA 4QYFA 2JLDA 2UW7A 4S2ZA 4CZYB 1M2PA 4K9YA 5L6OA 4YJRA 2OFVA 3MIYA 5HLPA 3UE4A 3SW4A 1PXLA 3EFKA 5KZIA 2HZ4A 3BYSA 3RCDA 2ZM3A 3VBWA 1ZMWA 2A2AA 5CYIA 4DFBA 1ZOEA 3PXFA 4I6QA 1PJKA 3DAJA 3DBCA 1WVXA 4HVGA 4FEXA 2WTDA 3PTGA 1WBTA 2C68A 4G6NA 4B0GA 5AX9A 5J1WA 3PFQA 3ZXZA 3W0OA 2PL0A 3AT3A 4I4EA 3ORMA 4AZSA 2YWVA 1W8CA 3AC3A 5HO8A 5HE3A 4E73A 3VBVA 2VTIA 5LMKC 4J98A 3KA0A 1OKVA 3JY9A 4ZAUA 2CN5A 3FKNA 4YJPA 5C03A 1KOAA 2WMSA 3HV6A 4GUBA 5CALA 4F09A 3WARA 4FZDB 1GZ8A 1YXVA 2HYYA 2R3IA 3DFAA 5KZ0A 3ZFXA 4BCIA 4YBJA 2WMWA 3KB7A 3OBJA 1URCA 4RBLA 4RJ7A 4BFMA 2WTCA 1YDRE 3MB6A 5AUWA 4FRFA 5BVFA 5AIRA 3NS9A 4YHJA 4MF1A 5AP6A 1SVGA 3D5WA 4CG8A 4PMPA 2OW3A 3OG7A 5KUPA 2HZNA 3EN6A 2PZPA 4AQCA 2XA4A 3HDMA 5LWNA 4ZZMA 3VUTA 2O64A 3KMUA 2ITYA 4OT5A 2PSQA 2C3LA 4EOJA 4ANOA 4FGBA 3VUHA 4JQEA 4LGHA 3GQLA 2LAVA 5JSMA 4GK4A 3R8UA 2XK3A 2P33A 4L46A 2UZOA 2Z7RA 2J50A 3BLHA 4ZTQA 3U9NA 3SG9A 4YZNA 2XP2A 3HKOA 2YN8A 3AMBA 4YR8A 2GHGA 2YIYA 2QOCA 2X9EA 4IFCA 5M44A 3EQBA 4PTEA 5CSVA 3DA6A 2C3KA 4O84A 4IFGA 4USEA 4I24A 2PHKA 4IBMA 1Y57A 1OECA 2R64A 4ITIA 4NZWB 2ZM1A 3MS9A 5IQDA 3QRJA 3LW0A 1WBSA 5AV3A 4NYEA 1B39A 2CJMA 3HNGA 4GL9A 2YCSA 4O7LA 3ZCLA 5L8JA 2G01A 3KULA 4YPDA 4QMSA 4E4XA 3WZJA 4X21A 3RKBA 3RI1A 5AFVA 3OW3A 3W2QA 3QBNA 2QONA 4YP8A 4CD0A 4FSWA 2O2UA 2PZ5A 5TE0A 3TEIA 1OUKA 4X6QC 1UNGA 2JDSA 1KE9A 3Q2MA 5HE1A 1A9UA 3RAHA 4EI4A 4L68A 5GIOE 2Y9QA 4YZCA 4AW1A 1H01A 1GY3A 2C4GA 2XYNA 2CGVA 3FE3A 4JDHA 3M1SA 3VUIA 3ODZX 5CASA 2E9VA 1O6KA 5CSPA 4V0GA 2OZAB 3EFJA 2J90A 4MWIA 3QTWA 2C6KA 4OBOA 3HRCA 5KMMA 3DJ7A 3FZPA 4UYNA 4XEYA 3A62A 3RM7A 4OAVB 2XYUA 3EYGA 5BUIA 1S9IA 3FQSA 2PVYA 2Y6OA 4AOIA 4EYMA 4F9YA 1XMLA 3EB0A 4YSMA 4FT9A 2PZIA 4X3JA 5AM7A 4TXCA 3GU8A 3I0OA 3W1FA 4B7TA 2XANA 3FJQE 4FSUA 4D5HA 4TYJA 1XH9A 2QOKA 3EN4A 5E8XA 3UYSA 2OBJA 4RG0A 4MNFA 3W2SA 3NMUF 3FI4A 4IAAA 4FKTA 4PF4A 4C62A 4EUTA 3A7HA 3AXWA 4RX8A 4FKGA 4YC6A 4YHFA 1H1RA 3KXXA 4BKZA 2ZMCA 1IAHA 4ACDA 1TQIA 4DH8A 3LCSA 4M12A 3DPKA 2B1PA 3T8OA 4ANBA 4OTGA 4O7ZA 3Q2JA 5D12A 5AP1A 3FL4A 5GJGA 3RPSA 1KE6A 4KBAA 2WTJA 3TWJA 4E6CA 5FWKK 1Q24A 1OITA 3RCJA 4MNEB 3R21A 4U8ZA 1MUOA 3E88A 4FOCA 1WVYA 4TYGA 1FMOE 4QPMA 5CU4A 4CMTA 3RBWA 1OIQA 3DK7A 5H2UA 3GT8A 3G9LX 4MWHA 4UALA 3ZUVA 4DHFA 3O8TA 4TNBA 3TV7A 2J2IB 1FVTA 4QMXA 4A4LA 3FMKA 4I93A 4O7SA 5FUTA 2RG6A 5M08A 3JVSA 5BVOA 3RPVA 4CG9A 1BYGA 2GFCA 2UVZA 3F3UA 4HGEA 5DEYA 4DG3E 5IA1A 2WNTA 2ZMDA 4FZAB 4AZEA 4IB0A 5J9ZA 4C37A 3ZONA 4UZHA 4EOPA 4E6QA 5CEIA 5J7HA 4ALWA 4CMUA 4C35A 3NUPA 5E4HA 4JR3A 4EK6A 3AGLA 2HK5A 5CVGA 2IO6A 4L00A 4CLJA 4I3ZA 5EQEA 3LZBA 2X7FA 3C4WA 4UXQA 4XG3A 3LOKA 2X2KA 3ZC5A 3TUCA 3LMIA 1YXUA 3WYXA 4F65A 3P4KA 3C4FA 2YM6A 3P0MA 3SRVA 2PYWA 3AC8A 3OT3A 3POZA 4E6AA 5CSWA 3R8ZA 3UMXA 4J8NA 4GKHA 5FBOA 5IF1A 5A9UA 5M4UA 4ZIMA 3UQCA 5AUUA 3F7WA 3NFFB 5CSHA 4NKAA 3FKLA 4FK3A 2REIA 3TIZA 3N4VA 2XKFA 2YIQA 1YI4A 5FM2A 2R3NA 3E3BX 4GW8A 4C4JA 5HLNA 3UVRA 4ENXA 3BQCA 4DEEA 4FZ7A 4DINA 4AXCA 2W06A 1CDKA 3BEAA 4G9CA 3OWJA 1Q8WA 4NUSA 3KMWA 3BGQA 1J7LA 1U46A 4PTCA 4C4EA 3TG1A 4EUUA 2Z2WA 3HV3A 3VWAA 1J7UA 3LM5A 2BMCA 4J96A 4XV2A 4IXPA 3R30A 3PUFC 2VZ6A 4XJ0A 5C1QB 5L2IA 2WEIA 2YFXA 1IG1A 4WHZA 1U54B 2RFSA 4BC6A 4I5MA 1Z57A 2PK9A 3KXZA 1UA2A 4B99A 4O6LA 5BVDA 4KKHA 4YJNA 3DKOA 2FA2A 5EG3A 3R1SA 4EH3A 3FZRA 4KABA 2XMYA 3ZUUA 4TWOA 4RZVA 4O91A 5T6KA 3LFNA 5K4JA 4YPSA 3HECA 3UP2A 1PXKA 4L3LA 3RJCA 3V5PA 3QZFA 3E87A 4HYUA 3NUYA 3QTRA 3DGKA 2RFDA 1CMKE 3U6IA 3HMPA 3PWYA 4KINA 3EFWA 2ZDTA 3H10A 4WOVA 4JRNA 5AAEA 1ZOGA 3ULZA 4L52A 1ZYDA 3DFCB 3RGFA 4AG8A 4BZDA 4BZOA 1L8TA 2F9GA 4I5HA 4KKGA 4IVDA 4C02A 5EFQA 4OT6A 4CFMA 3RAIA 3ROCA 4GMYA 1SYKA 1W82A 3PA3A 2H8HA 3D14A 2Y0AA 4YC8A 3BE2A 4I6HA 1YDTE 1CKPA 4PUZA 3DT1A 3M11A 3O50A 1JLUE 5C9CA 3ZXTA 4EOIA 1GZKA 1XO2B 2ERKA 3BU3A 4FTTA 4TTHB 4XV9A 2UZWE 2WHBA 5HEZA 5CENA 3UTOA 4BN1A 4UN0C 4IADA 4YO4A 1DI9A 4RQKA 2JDRA 4Z3VA 4C4IA 3QQGA 3MB7A 3DBFA 5M06A 1UNLA 3BWJA 4IWQA 4EZ3A 2OJIA 2PTKA 2RF9A 3R2BA 3DAEA 5AA9A 1OL5A 2X4FA 3NAXA 2VTOA 3W8QA 1Q3WA 5AR2A 1R1WA 3NYXA 4O4DA 4Z55A 2R3KA 5CEOA 1FQ1B 1VEBA 3PXRA 5HESA 3V51A 4C57A 4DHJA 4P4CA 3VHKA 1G8SA 2WTIA 4P90A 4OTPA 4L8MA 3Q96A 5A6NA 4CQGA 1R39A 1RW8A 3GENA 3MH1A 4BCMA 3PXQA 3TZMA 5T68A 1REJA 2CGUA 3MW1A 4FT5A 5ANDA 3WZEA 4ORKA 4GRBA 3GU6A 1H0VA 3OHTA 3LFSA 4YTIA 4GJ2A 4L53A 5ETFA 2FGIA 3DQWA 3UQGA 4JDKA 4E5AX 4EH5A 2ITWA 4DBNA 3LQ8A 2YLFA 3BHUA 5DN3A 3W0RA 1H08A 1P4FA 4FF8A 5IA5A 3M42A 4I21A 5CVFA 3VBQA 3VS4A 2WXVA 1U5RA 4FL3A 2QOQA 4L9IA 2A27A 4G3EA 3OT8A 1PW2A 5G1XA 4NH1A 4F7NA 1OGUA 4FG7A 4I0TA 2W5BA 5B2KA 3MJ2A 5GJDA 2BRBA 4RQVA 3EQHA 4FTAA 2RKUA 2BILB 3S95A 2GS2A 4OTHA 3VUMA 5EQPA 3V6RA 2YERA 3H0YA 4OUCA 4YGAA 4XG9A 2UW9A 2JIIA 4YLKA 1FOTA 4MVFA 3F5PA 3CTQA 3A4PA 5JRSA 3GEQA 1J91A 5HNBA 5DT3A 3DAKA 3QXOA 4KD1A 4EC9A 4L44A 5A54A 2JGZA 2C3JA 4J7BA 2JITA 2XALA 3QA0A 1LR4A 3EQIA 3NR9A 4MBJA 5FXSA 4HVIA 4HVHA 5HZNA 5BVWA 5JK3A 3AGMA 1XR1A 2J51A 3W0PA 2W1ZA 1ST4A 3OTUA 1R0EA 2BUJA 2ITPA 3PWDA 2BVAA 4ZJIA 4F6WA 2H9VA 5CAPA 4I4FA 3ORLA 2XIZA 3TV4A 3UC4A 3W8LA 4FZ6A 4IB5A 4TWCA 4BKYA 2X2MA 4J71A 2JIVA 2YDKA 3WE4A 4NJ3A 4E5WA 3ORNA 4JBVA 4K8AA 2YLEA 3ITZA 1IASA 1WBNA 3DKCA 2HZ0A 3ALNA 3COHA 3HUBA 3V6SA 3PSBA 3ZS5A 4EC8A 2XK9A 4G31A 4O1PA 1DS5A 3FXXA 3HUCA 1CKJA 2R4BA 5HG7A 3TKIA 1ND4A 3UDZA 5IUGA 5JFWA 2BTSA 1UU9A 4C33A 3W0SA 3DBEA 5CU0A 3GCVA 3R22A 5C01A 1GIJA 1NT2A 3QYWA 3LFDA 3VHEA 4JMQA 3P78A 1Q8ZA 2RL5A 1F0QA 1T46A 3GU7A 3I4BA 3PZHA 5HNIX 2Y4IB 1TFFA 3OVVA 5TF9A 2VTTA 3C5IA 5A4CA 3MFUA 4RZWA 4WD5A 4FEUA 4ZTMA 4U97A 3LE6A 1U5QA 4M7IA 2HY81 3GCQA 4ID7A 3L9MA 4J97A 4E7WA 1OL6A 3P9JA 2V7OA 3COKA 1JQHA 3H9OA 3R83A 4C2VA 4O0XA 5AR4A 4DYMA 3LVPA 4O7NA 1PMNA 2ZFYA 4RWLA 4ERWA 1JPAA 3VJNA 3Q60A 3MY1A 4ZMEA 3QTXA 1J1BA 4EHVA 3EQCA 4YBKA 5TR6A 3QRTA 3SOCA 2VWUA 4QMMA 2XS0A 2JKOA 3NUXA 4W8DA 5DE2A 3Q53A 3OCBA 4TRLA 1HCKA 2C69A 4IDVA 3EL7A 4W4YA 2NNWB 2VWXA 3C1XA 4C8BA 4F9AA 5IQEA 5AR3A 5CEMA 4BJJB 4NCTC 3NW5A 1YI3A 4N70A 2QCSA 1OBDA 5A4QA 2IF8A 2XIRA 4OTFA 4OTQA 3UDBA 3VF9A 2BAQA 3H4JA 3KXNA 4CEGA 3A7IA 5AWMA 3FL5A 3D94A 4IX6A 5KMNA 4CV8A 3QTQA 2IEWA 4PPCA 3OWLA 4K2RA 4A06A 4QP2A 4DA5A 3VIDA 5I9WA 4K11A 1BMKA 1CSNA 2CN8A 4ZY5A 2QURA 2QQ7A 3RPRA 5LVPA 3BYUA 3KVWA 4JQ7A 4UB7A 4CXAA 2XH5A 3C50A 2WIHA 1XKKA 5IMEA 2QHNA 1ZZ2A 3QCYA 4RPVA 5HQ0A 4O7YA 4DDIA 2PVLA 2XKDA 3LJ2A 4IH8A 4RIWA 3OBGA 2WFYA 2VTHA 3KXMA 4O2PA 3JPVA 2CPKE 2LGCA 4O27B 3Q4UA 3ZLWA 4D2WA 4L7SA 3EL8A 3U51A 4MXXA 2UVYA 1UKHA 4IAZA 3PXZA 3HV7A 5E1SA 3H9FA 5A4TA 3P86A 3LFCA 2R3QA 5FQDC 4EBWA 2OH0E 4R7HA 3ZYAA 3CPCA 3VS0A 3VRZA 3FEGA 3EJ1A 4J95A 1J3HA 3C0IA 5FDXA 4FIGA 3GXLA 3VW8A 5C4KA 3N51A 5M51A 2H6DA 3CQWA 3PPZA 5IEVA 3NRMA 2WMUA 5CF8A 4AX8A 3FAAA 3PJ3A 2PUUA 4JS8A 4QMZA 4H1MA 2C47A 4A07A 2F7XE 2V55A 3WE8A 4CVAA 2YAKA 1DAWA 4CQEA 2GS7A 4WBBB 4X3FC 4DEGA 5IDPA 4R1VA 1W84A 2VTSA 5M4CA 2CNUA 4YNOA 2WQMA 1XBCA 2HIWA 3R0TA 4EL9A 3RNIA 4FKIA 3AC1A 3R9OA 4AZVA 2CCIA 3BQRA 3HAVA 3OY3A 2XEYA 4HZSA 4QQCA 1OVEA 1PXOA 2GQGA 3PG3A 4PP9A 3UOHA 4FSMA 4X3FA 3BL9A 4H36A 4HYSA 3G6GA 4AXAA 4XS2A 1WBOA 3QQHA 1O6LA 3V5WA 2WB8A 2X7OA 5LQFA 5AAFA 4RJ3A 1XH5A 2YABA 4O4EA 2O63A 4RMZA 2B55A 4ANMA 4BCPA 2ITQA 2PZRA 3OEZA 4O7RA 2VX0A 4U81A 1GZNA 3ZU7A 3KK8A 5L8LA 1ST0A 2GQSA 2OXYA 4EH8A 3R8PA 3CD8A 4DEIA 4D1ZA 5GHVA 2R7BA 2YIWA 3D15A 5D9HA 3H3CA 4IHPA 4JIAA 1SMHA 3ZSHA 4KBCA 1SZMA 4KSQA 5L3AA 4KUJA 1KV1A 3FMLA 3MA6A 4UMRA 1OIYA 2HOGA 3S0OA 1YRPA 5ACBC 4O0SA 2QKRA 4U9AA 1OKWA 5F9EA 5AV1A 3FI8A 1KOBA 3HX4A 3QCXA 4FE2A 3TJCA 4ZLZA 5E8UA 3VN9A 3QC4A 2JAMA 4APPA 4CRSA 2E9NA 4BYJA 5BNJA 3UO6A 5EHLA 5DLSA 3MJ1A 3W0MA 3TL8A 2PVRA 5EM5A 3DNEA 4DEDA 2GHLA 5EI2A 2YA9A 2W9FB 4FSRA 4QMUA 4X2KA 3IW5A 2OGVA 4FTNA 4BWPA 4WNOA 4Z16A 5DI1A 3C4EA 3NPCA 3N9XA 4QMTA 3NLBA 4O0YA 5FM3A 1MQBA 4U0IA 3W2RA 2YDJA 4FTUA 4I23A 3RMFA 4X6RA 2QOOA 3A8WA 2VTMA 3UO4A 3DB8A 2RFEA 1W83A 4DGMA 3FC1X 2EXCX 2PUNA 5IQFA 4IX4A 3BYVA 5DBXA 4O0VA 4USFA 3PE1A 3UDSA 5CX9A 3RZFA 5IEYA 5GIPE 5HG8A 4ZSJA 2OICA 4CGAA 1W2DA 2I0HA 4D2RA 3KQ7A 3CD3A 4FTJA 1R0PA 4NM7A 5GZ8A 4HCUA 2VD5A 2CNVA 5E8ZA 3ZH8A 4RC3A 3AKJA 3IPHA 2OXDA 2B0QA 2XB7A 3ZBFA 4FIJA 4FV0A 5FXRA 2UZNA 4FKJA 3NUSA 3LIJA 5G6VA 4D55A 4QQTA 4WRGA 2XM8A 2XJ0A 5EH0A 3EWHA 4ZTLA 3SXFA 1ZMUA 3OMVA 2DQ7X 2F7EE 1XH7A 3QRIA 2VRXA 3Q9XA 3BBWA 1BI8A 3QKMA 3V5QA 5M55A 5A46A 2VX1A 5J1VA 1H26A 5CQUA 1YWVA 2C1AA 3BELA 3PA4A 3QGWA 5KCVA 3BHYA 3H0ZA 4JG8A 3TT0A 3WF6A 5LCJA 4GEOA 3DTCA 3CTJA 2GFSA 5DMZA 3M2WA 3G6HA 4CZUA 3FMEA 4AGCA 4R3CA 2B9JA 1F3MC 2OLCA 3NNUA 2Q0NA 5DVRA 5AP7A 5EI8A 4FGRA 3QHRA 4TL0A 2RG5A 1M52A 2J0MB 3HEGA 3F2AA 3QXPA 3UOJA 2ZDUA 4GYGA 4P5ZA 4IAYA 5J5SA 2XRWA 3Q4TA 3VW6A 1NVQA 4BWXA 4W4WA 4BDCA 5M07A 4FTMA 4BDAA 2YACA 5DWRA 2EB3A 2BROA 4OLIA 3WBLA 4D0XA 2GSFA 4R1YA 1V0PA 4TPTA 2C5YA 4C7TA 5HLWA 3HYHA 3LXPA 1VLRA 5HHWA 2W1EA 4KRCA 2W9ZB 4BI0A 3IKAA 4F9WA 3WIGA 2B9IA 3E8EA 3QTSA 4TYEA 4IMYA 3U55A 2HELA 3K3JA 5HI2A 2C6IA 4BDDA 5CF5A 3EQDA 3EYHA 2NP8A 1CM8A 4PY1A 3BZ3A 3MSSA 2H96A 5D7AA 2XRUA 2B54A 2OJFE 2IVTA 3DOGA 4FKPA 4F78A 1BKXA 2WMQA 4ANSA 5ANIA 3RINA 3QGYA 3Q04A 3EKKA 5HCYA 4K77A 3HV4A 2GDOA 5AP4A 3F69A 4ALVA 2G9XA 4MK0A 2PVJA 5LMKA 5EDQA 2FB8A 3TUDA 3O2MA 5HO7A 4O0TA 2QLQA 2WMAA 4FNYA 2VWBA 3D7TB 4BDIA 4K1BA 4I20A 5JN2A 3SV0A 3T3VA 2XAMA 2F2CB 3NYNA 2VV9A 3PY1A 4DF3A 4NTTA 3MFTA 4FODA 2YM3A 3BYMA 4LRKA 1E1VA 3L9LA 3I5NA 4EOOA 3S00A 1IA9A 4QMLA 5DRBA 5D10A 4HGLA 3L9PA 4CNHA 5JMSA 2G2HA 4KAOA 3WOWA 1OKZA 3CBLA 3FKOA 3BX5A 1XBAA 3CQUA 3HA6A 5GJFA 2W1IA 5L8KA 1KE5A 2YM4A 3MFRA 3R28A 2ZVAA 5CU2A 3FHRA 3MH0A 4FEWA 3CQEA 1QPEA 4MCVA 3UJGA 2CLXA 3GC0A 3ZO3A 1I09A 4EHGA 4AE6A 3KRLA 2JBOA 5KO1A 3ZSGA 3ODYX 3BV3A 3F9NA 3ZM9A 4A7CA 4B6LA 3UIBA 4DCAA 4O7VA 4AZTA 3ZMMA 4U80A 1HCLA 3GOKA 4ZS0A 3Q6WA 4ASDA 3RHKA 3IECA 2HXLA 3V5JA 3Q3BA 2HZIA 5EYMA 4C61A 4CFNA 2YEXA 5E92A 4LG4A 5JQ5A 2PULA 3L8PA 3R7EA 2C6DA 3A7FA 5L2WA 4M13A 3JUHA 1MRUA 2X1NA 5A6OA 2OIBA 2WU6A 3GCUA 3IG7A 4UV0A 2C0TA 2F2UA 2IW9A 3ZRKA 2KULA 3R9RA 3U4WA 4Y73A 4GVJA 4EK8A 4PMMA 3KK9A 4A4XA 4DH7A 3O8PA 4ZMFA 4FTCA 2UZTA 4RFMA 1MQ4A 3D0EA 3F3ZA 4QDVA 4JXFA 4OGRA 4U3ZA 5JEBA 4IZYA 4DH1A 2OSCA 3O8UA 3MTLA 4JVGA 3MH2A 4UWBA 3OEFX 4W9WA 4B4LA 4FKVA 1UKIA 3MBLA 2F4JA 3DXPA 2FUMA 4DAWA 2BRGA 5AP5A 3FY0A 1JVPP 1KV2A 1YQJA 4NT4A 4NFMA 1HOWA 3VS6A 4BDBA 4E5BA 4JQ8A 1UU8A 4QTBA 3UOLA 3PYYA 4PDSA 3LFBA 2C1BA 2OI4X 4YSJA 5HG9A 3OROA 3AQVA 3UDTA 3CR0A 3F5XA 5HTIA 2GQRA 4GJ3A 2EWAA 4MNEA 3BHVA 4IANA 1XJDA 4IM0A 4OBPA 4QMPA 3F5UA 2QO7A 4O0WA 4ZTRA 3V5LA 1MRVA 4PNKA 4CZTA 2YCQA 2I0VA 1KSWA 3ZLYA 3KFAA 4FKRA 4ZY6A 2W1DA 5ANKA 4DFLA 5EHYA 4IDTA 3MGYA 2VWVA 4EH9A 3QLFA 3KULB 2P0CA 2GHMA 3OOMA 4FV4A 4AE9A 4G2FA 2YWPA 1AGWA 3EOCA 3HMIA 4KS7A 5FBNC 4BDEA 1QPDA 1OMWA 3KC3A 3LFAA 4I92A 4XLIA 1Q8TA 2BR1A 3E3PA 4HGTA 3FLSA 4MTAA 5EM6A 3R9DA 3UC3A 1PF8A 4RGJA 5HG5A 4FYNA 5L6PA 4EK5A 3V5TA 4LMNA 2J6MA 4DLJA 5HBJA 1BL7A 3RK7A 3V8SA 4L67A 4MH7A 3LAUA 4G5JA 3VS5A 5LXMA 1XWSA 3B8RA 2Z7SA 2NRYA 3LM0A 4FV7A 5DR6A 3O5AA 3E63A 4YNEA 4E6DA 1Y8YA 3IK3A 4RIOA 4YUQA 4QMYA 4V0GB 3AD5A 4USDA 3F88A 1IEPA 4F0FA 3PPJA 4M97A 3B2WA 2ETMA 3FLZA 3HMOA 3NZ0A 4FBXA 4MXOA 4CFWA 4DEAA 2W96B 3BLRA 4DLIA 2PU8A 3FMJA 3I60A 2V22A 5I9YA 3FWQA 5DR9A 3RM6A 4DFNA 1K2PA 3BCEA 3CGOA 2WZJA 4EKLA 2PMNX 5BMSA 3R9NA 3W2CA 5BMMA 4KA3A 4LFIA 4M69B 3PLSA 3PZEA 3BBTB 2OJJA 2AUHA 3WILA 3ZDIA 4E4LA 4KKEA 4PPBA 4U41A 5ANJA 3TTJA 3MVJA 5D41A 3SD0A 2UV2A 2C5XA 3P1AA 4XRLA 2BHEA 2JAVA 5KBQA 2FYSA 5IQHA 4J53A 1OPJA 5AR7A 1U54A 3HZTA 1WAKA 3NEWA 3R7IA 4ITJA 1JKSA 3TN8A 2VO3A 4YZDA 2PVMA 4NM3A 4EQCA 4XBUA 3HRFA 4X2FA 1PMUA 5IDNA 3QQJA 3NCGA 2BFXA 3OUKA 3BWFA 3BLQA 3FY2A 2W5AA 3C4CA 5DT4A 4G16A 4S31A 4TYHB 1S9JA 4MD8E 1LPUA 3PIYA 5EOBA 1WVWA 5CU6A 4G6LA 2IZUA 5FXQA 4BGHA 2QC6A 3CY2A 5CSXA 5F94A 4LUEA 4BB4A 4HPUE 2BZHB 5IISA 2X8IA 2GTNA 4DEBA 2OWBA 5B2LA 4WUAA 4I5PA 2W1GA 5EOLA 4XOZA 2UW8A 3FMHA 4JG6A 1Q3DA 4IB3A 1LEZA 5M53A 2WQEA 4BY9E 4EOSA 4WG5A 4BR3A 2R3JA 2A98A 5M4FA 5IKWA 4PDOA 2RIOA 3E7OA 4XG8A 1RE8A 4GFGA 4XOYA 2WTVA 4UXLA 2YZAA 3NYVA 2BAKA 5AMNA 4ZXTA 3ORXA 4O81A 4AXEA 1URWA 3EMGA 2YAAA 3DY7A 4QOXA 4D1XA 4RFZA 2EU9A 1YKRA 2PVNA 3LCTA 3KIOC 5EDRA 2WELA 5CNNA 4RSSA 2X81A 1PYEA 3OUNB 4BTMA 2Z60A 4I6LA 4BKJA 1ZAOA 2PVKA 1Y6BA 2FSOX 3WZDA 4AXDA 2VAGA 4ZEGA 4XG6A 3ML1A 4JJRA 4IAIA 4M14A 2XBAA 4DHZA 5KBRA 4FSYA 1JKLA 2XCHA 5I0BA 3C5UA 3TZ8A 5DHJA 4ZP5A 2CKOA 4IC8A 2X8DA 3QAME 2PY3A 4PQNA 3ZFYA 4AT4A 3KCKA 3QD4A 2GS6A 4ANQA 3IOPA 5LWMA 5M57A 3GB2A 2OK1A 5KMLA 2WU7A 3BIZA 3CS9A 3KVXA 3ZEPA 5LMBA 2BDWA 1E1XA 2EUFB 4FTLA 4CFXA 2C6OA 2J0IA 2PWLA 3FC2A 4JLCA 3MFSA 3HGKA 3LLTA 4FL1A 4LL5A 4XH6A 2WPAA 4M84A 5BVEA 4QP9A 1ZRZA 5H8BA 3EN9A 4A9TA 1ZY5A 2UZUE 3JVRA 3ZM4A 4O7TA 2OXXA 4K6ZA 3NWWA 3BHHA 3ELJA 4H1JA 2UZDA 5HCXA 3ZC6A 4EQMA 1W0XC 5CU3A 5HICA 3JYAA 5M09A 2C5OA 2VNWA 3EQPA 1OI9A 4IZ7A 5AP0A 2CDZA 3VJOA 4YO6A 3IW6A 4XV1A 1MP8A 4D2TA 3ZEWA 1ZYLA 2PPQA 2Z8CA 4IWOA 4RVMA 5JZNA 4NL0A 4KWPA 2OF4A 5HIEA 3IDPA 1LEWA 3UG1A 4CKJA 4QDEA 2O8YA 3UOKA 3GP0A 5GNKA 4IEBA 3MVLA 4C4GA 5A14A 3AOXA 2WD1A 3VUGA 4EH4A 5CANA 5IQAA 1VYWA 3CCNA 3KY2A 4RJ6A 5HORA 4C4HA 2O0UA 3HMNA 3KRRA 5IG1A 3NX8A 4MXAA 3MH3A 1YOJA 4M3QA 4J1RA 4BCOA 4CFVA 3W0QA 3FLNC 4GKIA 3UIXA 4AW2A 2UW3A 5E1EA 2ZM4A 4IB1A 5DH3A 3W10A 4AP7A 5FEDA 4ZY4A 4IM3A 1UV5A 2IVVA 4XHKB 1OPKA 4C3RA 3ULIA 4MBIA 5HIDA 4AXFA 3FPQA 3Q5IA