4BBHA

Plasmodium vivax n-myristoyltransferase with a bound benzothiophene inhibitor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
384
structure length
384
Chain Sequence
DYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of Novel and Ligand-Efficient Inhibitors of Plasmodium Falciparum and Plasmodium Vivax N-Myristoyltransferase.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 116
structure length 384
sequence length 384
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4bbhA00
4A31A 4UFWA 4CGNA 5AG6A 4CYOA 4CYPA 4C7IA 2WSAA 4CYNA 5G22A 4A32A 4B13A 2YNDA 4BBHA 5AG5A 5AG7A 4CAEA 3IU1A 4CAFA 5G1ZA 5AGEA 4UCNA 5AG4A 4UFVA 4CGLA 4UCMA 4B12A 4C2XA 4C2ZA 4CGPA 5A28A 4A33A 4B10A 4C7HA 3IU2A 4C2YA 4A95A 3JTKA 4B11A 5G21A 4B14A 4C68A 4CGOA 2YNEA 4A2ZA 4A30A 3H5ZA 5A27A 4CYQA 2WUUA 2YNCC 4CGMA 4UCPA 2YNCA 4UFXA 3IWEA 5G20A
chains in the Genus database with same CATH superfamily
1BPMA 4G1PA 3WABA 5K8OA 4MY3A 2PJ6A 1H8LA 1VHEA 2Q43A 3PEIA 4W9YA 1S7NA 4KZTA 4R3KA 2PJCA 4YRHA 4BBHA 3H8FA 2ZW6A 2B5GA 3SJFA 1LANA 2P0WA 2CTBA 3S6FA 2PJAA 4UF4A 4MFJA 5KTCA 4OAEA 3PB9X 4UCNA 4XPKA 4UCMA 1YW6A 4Q7AA 1Y9KA 1MJAA 4H6ZA 3IU2A 4KVXA 4OIWA 2OH1A 2C6GA 3RZAA 1DE4C 3TCVA 1YK3A 4RS2A 5A27A 2CXAA 4AG9A 3GIUA 1ZLIA 1XF8A 2IMOA 3LACA 1CJWA 2R98A 2I79A 4NF1A 4NGPA 2ARHA 3WT4A 3B3CA 4FBEA 1K4JA 3BI0A 4CYQA 2VI7A 3PB6X 3D68A 3IJ3A 4A31A 3S9LA 4CGNA 3FB3A 3P2FA 2PRBA 1KUXA 3VATA 1L0CA 5KTDA 3FJUA 1PUAA 1RTQA 4UWIA 4OC3A 3PRTA 1QSRA 4MY0A 4BD9A 5HVFA 1KZFA 5D29A 4KOWA 2I00A 5G1ZA 2PJ1A 4JXRA 5LYIA 3GUXA 5A28A 3KASA 3PGPA 3TC8A 1CP7A 1KWMA 1ZG8A 3S6KA 4UEEA 3H8GA 1WWZA 4F9VA 4K30A 2ZEGA 3KHXA 2PDOA 4PXBA 4OIDA 4R9MA 1S60A 2REFA 2CIJA 4M6HA 1Z2LA 1OZPA 4NGMA 1Z5RA 2FIAA 1LCPA 1NE9A 3FXTA 4FWUA 3K9TA 1YX0A 2Z3LA 4KLVA 4A38A 4ZI6A 5C82A 3BHXA 4B5PA 2Y0MA 2ZOFA 3PP9A 4MHDA 4MHNA 1PU9A 4RI1A 4B5PB 1BPNA 4X5KA 3B7IA 2AFXA 2J8RA 3SXOA 3IO1A 1VHSA 4QB9A 1LOKA 3D3SA 2ZW4A 3EY5A 4QVTA 4CRZB 4PXEA 4E2AA 4A95A 3EFAA 5G21A 4J3GA 1FT7A 1IOIA 1B87A 3H8EA 4R6TA 5HXDA 2V8VA 3NH8A 3R96A 1Z8LA 3KZWA 3D2MA 5F09A 4EFDA 2FIWA 1DTDA 3S6HA 5JQ4A 2B4DA 2B4DB 2QIRA 4JXQA 2D4OA 4EWTA 2HB6A 1TXRA 4IF5A 4XNHB 1I1DA 4HPSA 4L89A 5G22A 1XFOA 2CNSA 3KHZA 4OC4A 4XPLA 1RO5A 3NE8A 3G8WA 3T8WA 1IB1E 5ISVA 1F57A 1WK4A 4MBUA 4IK2A 3VWEA 2CNTA 3B3TA 2ZW5A 1ON0A 3MN8A 4FD4A 3PZJA 2OOTA 2RB7A 2IL4A 1PYTB 1Z4RA 2JEWA 4CAVA 3SXNA 2G9DA 2HQYA 2EWBA 2RFHA 1ZG9A 4YWYA 3TE4A 1Z8TA 4X2TA 4NCZA 3GKRA 2FL4A 3I1UA 3S6GA 1YLOA 2JBJA 3IIBA 2EBJA 3EC4A 2GFQA 2CNMA 2CY2A 2FSRA 2Z11A 4FD7A 3WC6A 4PK2A 4F0YA 1LAMA 4JYWA 3R95A 3ISZA 4GM5A 1Q7LA 2PJ4A 2EO8A 2ZXVA 2YGWA 2VXKA 4DJLA 2ZELA 2FT0A 1ZLHA 1BO4A 1IOFA 2XEFA 2ZEEA 2AFZA 3PBEA 1HDUA 2ATRA 3FRMA 1HDQA 2QJ8A 5H86A 1IICA 1P4NA 1UFHA 2B58A 4PV6A 4P4IA 1HEEA 3H5ZA 4ZGYB 2NMTA 5E96A 2PIYA 5K8MA 1YR0A 5CBMA 2PJ3A 2R8VA 1M4LA 3CPXA 3LODA 3EO4A 3PB7X 4IHMA 4NSQA 2JDCA 1F2PA 1JWQA 4MHYA 3TFYA 1VGYA 4MFZA 1QSTA 7CPAA 2Q4ZA 1QSMA 2OZHA 3KR5A 5F48A 4R76A 1OBRA 2BCOA 1ZG7A 4TNUA 4AG7A 3SHPA 2BSWA 2YNDA 3QAYA 3NA6A 1ELLP 2B5GB 2ZEPA 3MGDA 2V77A 2NYQA 4AB7A 1TKJA 1YVKA 4CGPA 3SJEA 4A33A 4NEXA 2ZEHA 2PC1A 2P6EA 2Q0YA 5DS0A 3R9GA 2CF4A 1CPSA 4FD6A 1LFWA 3SI0A 1M4IA 2BUEA 2YNEA 3IGRA 4A37A 4R8FA 1AMPA 3QAHA 2PRQA 5K8PA 3SI1A 2AE6A 3H4QA 4QUSA 4YGOA 1KUVA 2Q04A 5J8FA 1X10A 2PSWA 3C26A 1YVOA 4E8OA 2QVPA 2B3UA 2AFOA 2FE7A 2QECA 2EK9A 1QMUA 5IB9A 4KLWA 4EMEA 4F0XA 3DNSA 5DWNA 4PQAA 3D4UA 3PFEA 1XBUA 2C1CA 3D7DA 2C6CA 4JWPA 5AG5A 3EXNA 4F6AA 4WWVA 4AXVA 4P4FA 4PXDA 2DXQA 4CGLA 3SJXA 4CRYB 2JEVA 4B10A 4A94A 2REEA 1M4DA 1S3ZA 1B6BA 2B4BA 4OC0A 5HVGA 2VZZA 3BJ7A 3G3SA 3OWCA 8CPAA 4YFJA 1J4JA 2HUZA 2WUUA 3TT2A 3DR8A 4UIAA 4R7MA 2GLJA 4MFPA 3S9NA 3VARA 3DLJA 5JPHA 4DUKA 1ARLA 2O28A 2JDDA 1QSNA 3B3VA 4H2KA 2I3CA 3D2PA 1SQHA 1Z9UA 5KTAA 4A32A 4KUBA 4CAXA 4NGQA 5F49A 4U9ZA 3FEEA 5ELYA 4CS0B 5HMNA 1IYLA 1ELMP 1CP6A 2A4NA 5AG4A 4MI4A 2Z3OA 1CM0A 3D7FA 4JLYA 4JZ0A 4AVBA 3VH9A 5HVHA 4NFRA 3R9FA 3JTKA 4HKFA 1YREA 2ZW7A 5EMIA 4KUAA 2JLMA 2K5TA 4KSFA 1MJBA 4L8AA 4HNWB 3FX6A 4ZX9A 3CXPA 1X12A 3PFOA 4UFXA 5I0CA 3RAMA 2PR8A 3N5FA 4EVYA 2FXFA 4KS9A 1Z8XA 4C7IA 4X8IA 2WSAA 3FVLA 4PSXA 2VBQA 4MXUA 3V38A 5I4MA 1CG2A 1CBXA 1IGBA 2Z3PA 4MCPA 3KQZA 4AVAA 2WPXA 3IWGA 2X7BA 1Y9WA 3KQXA 5BWAB 2XEIA 4B12A 5CPAA 4X3RA 4C2ZA 4KOYA 5EC4A 4FUUA 6CPAA 1Y0RA 2GREA 2PE3A 3SI2A 3WC7A 3R1KA 2BEIA 2P6FA 4IAVA 2PVVA 3KL9A 4K3NA 3CT9A 3FIXA 4ZY0A 2DF5A 4H89A 3BJ8A 3CZXA 3IEHA 4QC6A 4UCPA 4ZYQA 4NGSA 3V8IA 3IFEA 1F2OA 2OZUA 4ZY1A 4M6IA 1EE3P 3BI1A 4KVOE 5JM6A 4P45A 1XOVA 2GE3A 3RYOA 4II9A 2AFUA 3QB8A 2Z3NA 1R43A 2EK8A 3PBBA 1TF9A 2BL1A 2PJ9A 2PJ5A 1S7KA 2XEGA 3IC1A 4OP4A 4U9YA 1Q2YA 4GS4A 1AYEA 4KSAA 3T9YA 3F0AA 4C2XA 4KOXA 4P4BA 2FCKA 3GB0A 4JD6A 1NSLA 2Z10A 4B11A 3I3GA 4DYOA 2Z3KA 3TO6A 4M6GA 4A2ZA 2IJZA 4CPAA 2AJ6A 4AVCA 4MMOA 2OU2A 3I9SA 3RNZA 3PB8X 2DPSA 2O53A 3WC5A 3A9LA 4ONWA 1BAVA 3CDXA 1IY7A 1CPXA 4PPZA 5LRGA 5G20A 3DGVA 2VZYA 4UWJA 3FBUA 4NGNA 3GY9A 3NE7A 2GU2A 5J8CA 4B13A 1VIXA 4MFQA 3F8KA 3W6XA 4E0AA 1ZO0A 4DNCA 3NH4A 1YGHA 4KORA 2PQ8A 2OB0A 2H5MA 2J8NA 1V0CA 2ODFA 1RXTA 2ZPAA 5THWA 5F46A 2Q7BA 1Z8WA 3TOAA 1MK4A 4ORFA 4UEFA 2V8DA 1FNOA 4ZX8A 3SJGA 3VWDA 1M1DA 2O4HA 3ZJ0A 4CGMA 1Y7EA 4F8ZA 5D8NA 3ISXA 5C88A 2G0BA 3KR4A 3BLNA 1I12A 2AFMA 3IWEA 4KSIA 3TO7A 3TX8A 3V7ZA 5IB0A 1Y7RA 3N7ZA 4OC1A 4UIBA 1LRZA 1YSJA 4NJQA 2BO9A 3W91A 2ANPA 1S7FA 2WPWA 2Z0ZA 1KUYA 2CTCA 3IWWA 4PSWA 2RC4A 3FECA 1MJ9A 3LWUA 3B35A 5H84A 3MRUA 4ZY2A 5JH9A 4UFVA 3PB4X 1TKFA 3QNVA 1TKHA 4UEZA 3CXQA 3FNCA 4C7HA 3K2KA 1S5KA 1Q2CA 4CGOA 1I21A 5JGFA 1YMEA 1BLLE 4LX9A 2ZEDA 4KVME 4OMEA 4BINA 3KKWA 1Y0YA 2FS5A 2ZENA 4RN7A 3GYAA 4OLLA 4FD5A 1P0HA 5CNPA 4ZBGA 2EUIA 4JJXA 3F5BA 4R3LA 4CYOA 3NH5A 3D7GA 4MJ8A 3WR7A 1QQ9A 2F5IA 5LYDA 2ABZA 1XMBA 4M3SA 5AG7A 1NSAA 5GCNA 4P6YA 2NSMA 4ONUA 2ZEOA 4U5YA 5IV0A 3W6SA 4MCSA 3B3WA 2PJ2A 4OC5A 3P2HA 2ZEFA 2EVNA 4MHZA 3HUVA 4A30A 2POKA 4UBRA 3FEDA 4H6UA 4NJRA 3CXSA 1GHEA 2P6GA 1FY7A 3E0KA 4YU9A 1YQEA 3D7HA 1XRYA 2G3AA 2OZGA 1N71A 5AG6A 3B3SA 1A2ZA 4MCQA 1IIDA 5LYFA 1XMTA 5IX3A 2PJ8A 3JRUA 4P44A 4CAEA 1BOBA 1R3NA 2WZNA 2GIVA 2PVWA 4LUAA 3JVNA 1XE4A 1IU8A 2J8MA 3K9UA 2J9AA 3B2YA 3BXMA 2PR1A 1YW4A 4R87A 4B5OA 2PJ7A 4C2YA 4CAWA 4Q38A 4HNYB 4C68A 1M4GA 4OC2A 3ZZIA 2R7HA 3S9MA 2VL1A 2DPTA 4KOSA 5F47A 2QMLA 2V8GA 4MCRA 4F9UA 3FMCA 2ZEMA 2F8HA 2HC9A 4KOUA 4XNHC 5EBVA 2R1IA 2V8HA 3D67A 1QSOA 3FF3A 2AFWA 4NGTA 2OR4A 1R57A 4UFWA 1ARMA 4CYPA 2Q51A 1XJOA 1IYKA 2XEJA 4CYNA 1CX8A 2C6PA 2PJ0A 3RO0A 4MHPA 4P4EA 1PCAA 5DWMA 2GLFA 3IU1A 4M85A 2DEAA 4XPDC 4PXCA 3RBUA 4CAFA 2Z3MA 5LRKA 4NGRA 3D8PA 4KOTA 3TOBA 3UY5A 1U6MA 1VHOA 1GYTA 2AFSA 3LD2A 1NMTA 1JQGA 3JUWA 4XPDB 3T90A 4Z65A 2G3TA 2C27A 2FVGA 3R9EA 2WYRA 2B3VA 1XEBA 4MFLA 3D66A 4TWEA 4B6ZA 4QBJA 1LAPA 2Q4YA 4RUHA 2ZOGA 4MRIA 3DSBA 3GLJA 2VEZA 4P4JA 2BOAA 3DR6A 1XIXA 4LQ6A 4O23A 3TO9A 4I49A 4P10A 1VKCA 2KCWA 2QYVA 2PCUA 3DDDA 2HV2A 3FH4A 3FYNA 1S7LA 3HLPA 3L2NA 4R57A 4BMHA 3KGQA 4HNXB 4Q36A 4MFKA 5FVJA 4GXHA 2IQ6A 4KOVA 4Y49C 3TTHA 5AGEA 1TIQA 3B8GA 4IUSA 2D4PA 5J1QA 1M44A 5LRJA 1Q2DA 4LQGA 4Y49B 5K8NA 4P4DA 4B14A 4OADA 1AUGA 2PIZA 3LMSA 1YLEA 2JBKA 4PK3A 3NFZA 1UWYA 2VQYA 2YNCC 4FAIA 3KI9A 4UA3A 4WJBA 2Q7SA 2F7VA 2GANA 2Q4VA 1TF8A 4A39A 5LYLA 2YNCA 2Q44A 3CPAA 4OKOA 2PJBA 5HH1A 1Z4EA 4NXYA
chains in the Genus database with same CATH topology
4MY3A 1S7NA 4KZTA 4R3KA 4YRHA 4BBHA 2ZW6A 2B5GA 2P0WA 3S6FA 4MFJA 5KTCA 4OAEA 4XPKA 4UCNA 4UCMA 1Y9KA 1MJAA 4H6ZA 3IU2A 4KVXA 2OH1A 3TCVA 1YK3A 4RS2A 5A27A 2CXAA 4AG9A 1XF8A 1CJWA 2R98A 2I79A 4NF1A 2ARHA 1K4JA 4CYQA 2VI7A 4A31A 4CGNA 3FB3A 3P2FA 2PRBA 1KUXA 1L0CA 5KTDA 1PUAA 4UWIA 1QSRA 4MY0A 1KZFA 4KOWA 2I00A 5G1ZA 4JXRA 5A28A 3PGPA 3S6KA 1WWZA 4K30A 2PDOA 4R9MA 1S60A 2REFA 1OZPA 2FIAA 3FXTA 1NE9A 5C82A 4KLVA 1YX0A 2Z3LA 4B5PA 2Y0MA 4MHDA 3PP9A 4RI1A 4B5PB 1PU9A 4X5KA 3SXOA 2J8RA 1VHSA 4QB9A 3D3SA 2ZW4A 3EY5A 4QVTA 4CRZB 4E2AA 4A95A 3EFAA 5G21A 4J3GA 1B87A 3R96A 3D2MA 2FIWA 3S6HA 5JQ4A 2B4DA 2B4DB 2QIRA 4JXQA 2D4OA 4IF5A 4XNHB 1I1DA 4L89A 5G22A 2CNSA 4XPLA 1RO5A 3G8WA 1IB1E 5ISVA 1WK4A 4MBUA 3VWEA 2CNTA 2ZW5A 1ON0A 4FD4A 3PZJA 2IL4A 1Z4RA 4CAVA 3SXNA 2HQYA 3TE4A 4NCZA 3GKRA 2FL4A 3S6GA 3EC4A 2CY2A 2CNMA 2FSRA 2Z11A 4FD7A 4PK2A 4F0YA 3R95A 2ZXVA 2YGWA 2VXKA 2FT0A 1BO4A 2ATRA 3FRMA 5H86A 1IICA 1P4NA 1UFHA 2B58A 4PV6A 4ZGYB 3H5ZA 2NMTA 5E96A 1YR0A 2R8VA 3LODA 3EO4A 4NSQA 2JDCA 3TFYA 4MFZA 1QSTA 5F48A 1QSMA 2OZHA 4AG7A 3SHPA 2BSWA 2YNDA 2B5GB 3MGDA 4AB7A 1YVKA 4CGPA 4A33A 4NEXA 2PC1A 2P6EA 2Q0YA 3R9GA 4FD6A 1M4IA 2BUEA 2YNEA 3IGRA 3QAHA 2AE6A 3H4QA 4QUSA 4YGOA 1KUVA 2Q04A 5J8FA 2PSWA 3C26A 1YVOA 4E8OA 2B3UA 2FE7A 2QECA 4KLWA 4F0XA 3DNSA 5DWNA 4JWPA 5AG5A 3EXNA 4F6AA 2DXQA 4CGLA 4CRYB 2JEVA 4B10A 2REEA 1M4DA 1S3ZA 1B6BA 2B4BA 2VZZA 3BJ7A 3G3SA 3OWCA 4YFJA 1J4JA 2HUZA 2WUUA 3TT2A 3DR8A 4MFPA 5JPHA 2O28A 2JDDA 1QSNA 3D2PA 1SQHA 1Z9UA 5KTAA 4A32A 4KUBA 4CAXA 5F49A 4U9ZA 4CS0B 5HMNA 1IYLA 2A4NA 5AG4A 4MI4A 2Z3OA 1CM0A 4JLYA 4AVBA 3R9FA 3JTKA 4HKFA 1YREA 2ZW7A 4KUAA 2JLMA 2K5TA 4KSFA 1MJBA 4L8AA 4HNWB 3CXPA 4UFXA 5I0CA 2PR8A 4EVYA 2FXFA 4KS9A 4C7IA 2WSAA 4PSXA 2VBQA 2Z3PA 4AVAA 2WPXA 3IWGA 2X7BA 1Y9WA 5BWAB 4B12A 4C2ZA 4KOYA 5EC4A 3R1KA 2BEIA 2P6FA 3FIXA 4H89A 3BJ8A 4UCPA 4QC6A 3V8IA 2OZUA 4KVOE 2GE3A 3RYOA 4II9A 3QB8A 2Z3NA 2BL1A 4U9YA 1S7KA 1Q2YA 4GS4A 4KSAA 3T9YA 3F0AA 4C2XA 4KOXA 2FCKA 4JD6A 1NSLA 2Z10A 4B11A 3I3GA 2Z3KA 3TO6A 4A2ZA 2AJ6A 4AVCA 2OU2A 3I9SA 2DPSA 3A9LA 5G20A 2VZYA 4UWJA 3FBUA 3GY9A 3NE7A 5J8CA 4B13A 4MFQA 3F8KA 3W6XA 4E0AA 1ZO0A 4DNCA 1YGHA 4KORA 2PQ8A 2OB0A 2H5MA 2J8NA 1V0CA 1RXTA 2ZPAA 5F46A 2Q7BA 3TOAA 1MK4A 4ORFA 3VWDA 1M1DA 3ZJ0A 4CGMA 5C88A 2G0BA 3BLNA 1I12A 3IWEA 3TO7A 5IB0A 1Y7RA 3N7ZA 1LRZA 3W91A 1S7FA 2WPWA 2Z0ZA 1KUYA 4PSWA 2RC4A 1MJ9A 5H84A 4UFVA 4C7HA 3CXQA 3FNCA 1S5KA 1Q2CA 4CGOA 1I21A 4LX9A 4KVME 3KKWA 2FS5A 3GYAA 4OLLA 4FD5A 1P0HA 5CNPA 4ZBGA 2EUIA 4JJXA 3F5BA 4R3LA 4CYOA 4MJ8A 3WR7A 2F5IA 4M3SA 5AG7A 5GCNA 4ONUA 4U5YA 5IV0A 3W6SA 3P2HA 2EVNA 4A30A 4UBRA 4H6UA 3CXSA 1GHEA 2P6GA 1FY7A 3E0KA 2G3AA 2OZGA 1N71A 5AG6A 1IIDA 1XMTA 5IX3A 4CAEA 1BOBA 2GIVA 4LUAA 3JVNA 1XE4A 2J8MA 3K9UA 4CAWA 2PR1A 4R87A 4B5OA 4C2YA 4Q38A 4HNYB 4C68A 1M4GA 3ZZIA 2R7HA 2DPTA 4KOSA 5F47A 2QMLA 5EBVA 4KOUA 4XNHC 2R1IA 1QSOA 1R57A 4UFWA 4CYPA 1IYKA 4CYNA 5DWMA 3IU1A 4M85A 4XPDC 4CAFA 2Z3MA 3D8PA 4KOTA 3TOBA 3UY5A 1U6MA 3T90A 3LD2A 1NMTA 3JUWA 4XPDB 2G3TA 2C27A 3R9EA 2B3VA 1XEBA 4MFLA 4QBJA 2Q4YA 3DSBA 2VEZA 3DR6A 1XIXA 3TO9A 4I49A 1VKCA 2KCWA 3DDDA 3FYNA 2HV2A 4R57A 1S7LA 4BMHA 4HNXB 4Q36A 4MFKA 5FVJA 4KOVA 4Y49C 3TTHA 5AGEA 1TIQA 3B8GA 4IUSA 2D4PA 1M44A 1Q2DA 4Y49B 4B14A 4OADA 1YLEA 4PK3A 2VQYA 2YNCC 4UA3A 2GANA 2Q4VA 2YNCA 2Q44A 5HH1A 1Z4EA 4NXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A31 A;  4UFW A;  4CGN A;  5AG6 A;  4CYO A;  4CYP A;  4C7I A;  2WSA A;  4CYN A;  5G22 A;  4A32 A;  4B13 A;  2YND A;  4BBH A;  5AG5 A;  5AG7 A;  4CAE A;  3IU1 A;  4CAF A;  5G1Z A;  5AGE A;  4UCN A;  5AG4 A;  4UFV A;  4CGL A;  4UCM A;  4B12 A;  4C2X A;  4C2Z A;  4CGP A;  5A28 A;  4A33 A;  4B10 A;  4C7H A;  3IU2 A;  4C2Y A;  4A95 A;  3JTK A;  4B11 A;  5G21 A;  4B14 A;  4C68 A;  4CGO A;  2YNE A;  4A2Z A;  4A30 A;  3H5Z A;  5A27 A;  4CYQ A;  2WUU A;  2YNC C;  4CGM A;  4UCP A;  2YNC A;  4UFX A;  3IWE A;  5G20 A; 
#chains in the Genus database with same CATH topology
 1BPM A;  4G1P A;  3WAB A;  5K8O A;  4MY3 A;  2PJ6 A;  1H8L A;  1VHE A;  2Q43 A;  3PEI A;  4W9Y A;  1S7N A;  4KZT A;  4R3K A;  2PJC A;  4YRH A;  4BBH A;  3H8F A;  2ZW6 A;  2B5G A;  3SJF A;  1LAN A;  2P0W A;  2CTB A;  3S6F A;  2PJA A;  4UF4 A;  4MFJ A;  5KTC A;  4OAE A;  3PB9 X;  4UCN A;  4XPK A;  4UCM A;  1YW6 A;  4Q7A A;  1Y9K A;  1MJA A;  4H6Z A;  3IU2 A;  4KVX A;  4OIW A;  2OH1 A;  2C6G A;  3RZA A;  1DE4 C;  3TCV A;  1YK3 A;  4RS2 A;  5A27 A;  2CXA A;  4AG9 A;  3GIU A;  1ZLI A;  1XF8 A;  2IMO A;  3LAC A;  1CJW A;  2R98 A;  2I79 A;  4NF1 A;  4NGP A;  2ARH A;  3WT4 A;  3B3C A;  4FBE A;  1K4J A;  3BI0 A;  4CYQ A;  2VI7 A;  3PB6 X;  3D68 A;  3IJ3 A;  4A31 A;  3S9L A;  4CGN A;  3FB3 A;  3P2F A;  2PRB A;  1KUX A;  3VAT A;  1L0C A;  5KTD A;  3FJU A;  1PUA A;  1RTQ A;  4UWI A;  4OC3 A;  3PRT A;  1QSR A;  4MY0 A;  4BD9 A;  5HVF A;  1KZF A;  5D29 A;  4KOW A;  2I00 A;  5G1Z A;  2PJ1 A;  4JXR A;  5LYI A;  3GUX A;  5A28 A;  3KAS A;  3PGP A;  3TC8 A;  1CP7 A;  1KWM A;  1ZG8 A;  3S6K A;  4UEE A;  3H8G A;  1WWZ A;  4F9V A;  4K30 A;  2ZEG A;  3KHX A;  2PDO A;  4PXB A;  4OID A;  4R9M A;  1S60 A;  2REF A;  2CIJ A;  4M6H A;  1Z2L A;  1OZP A;  4NGM A;  1Z5R A;  2FIA A;  1LCP A;  1NE9 A;  3FXT A;  4FWU A;  3K9T A;  1YX0 A;  2Z3L A;  4KLV A;  4A38 A;  4ZI6 A;  5C82 A;  3BHX A;  4B5P A;  2Y0M A;  2ZOF A;  3PP9 A;  4MHD A;  4MHN A;  1PU9 A;  4RI1 A;  4B5P B;  1BPN A;  4X5K A;  3B7I A;  2AFX A;  2J8R A;  3SXO A;  3IO1 A;  1VHS A;  4QB9 A;  1LOK A;  3D3S A;  2ZW4 A;  3EY5 A;  4QVT A;  4CRZ B;  4PXE A;  4E2A A;  4A95 A;  3EFA A;  5G21 A;  4J3G A;  1FT7 A;  1IOI A;  1B87 A;  3H8E A;  4R6T A;  5HXD A;  2V8V A;  3NH8 A;  3R96 A;  1Z8L A;  3KZW A;  3D2M A;  5F09 A;  4EFD A;  2FIW A;  1DTD A;  3S6H A;  5JQ4 A;  2B4D A;  2B4D B;  2QIR A;  4JXQ A;  2D4O A;  4EWT A;  2HB6 A;  1TXR A;  4IF5 A;  4XNH B;  1I1D A;  4HPS A;  4L89 A;  5G22 A;  1XFO A;  2CNS A;  3KHZ A;  4OC4 A;  4XPL A;  1RO5 A;  3NE8 A;  3G8W A;  3T8W A;  1IB1 E;  5ISV A;  1F57 A;  1WK4 A;  4MBU A;  4IK2 A;  3VWE A;  2CNT A;  3B3T A;  2ZW5 A;  1ON0 A;  3MN8 A;  4FD4 A;  3PZJ A;  2OOT A;  2RB7 A;  2IL4 A;  1PYT B;  1Z4R A;  2JEW A;  4CAV A;  3SXN A;  2G9D A;  2HQY A;  2EWB A;  2RFH A;  1ZG9 A;  4YWY A;  3TE4 A;  1Z8T A;  4X2T A;  4NCZ A;  3GKR A;  2FL4 A;  3I1U A;  3S6G A;  1YLO A;  2JBJ A;  3IIB A;  2EBJ A;  3EC4 A;  2GFQ A;  2CNM A;  2CY2 A;  2FSR A;  2Z11 A;  4FD7 A;  3WC6 A;  4PK2 A;  4F0Y A;  1LAM A;  4JYW A;  3R95 A;  3ISZ A;  4GM5 A;  1Q7L A;  2PJ4 A;  2EO8 A;  2ZXV A;  2YGW A;  2VXK A;  4DJL A;  2ZEL A;  2FT0 A;  1ZLH A;  1BO4 A;  1IOF A;  2XEF A;  2ZEE A;  2AFZ A;  3PBE A;  1HDU A;  2ATR A;  3FRM A;  1HDQ A;  2QJ8 A;  5H86 A;  1IIC A;  1P4N A;  1UFH A;  2B58 A;  4PV6 A;  4P4I A;  1HEE A;  3H5Z A;  4ZGY B;  2NMT A;  5E96 A;  2PIY A;  5K8M A;  1YR0 A;  5CBM A;  2PJ3 A;  2R8V A;  1M4L A;  3CPX A;  3LOD A;  3EO4 A;  3PB7 X;  4IHM A;  4NSQ A;  2JDC A;  1F2P A;  1JWQ A;  4MHY A;  3TFY A;  1VGY A;  4MFZ A;  1QST A;  7CPA A;  2Q4Z A;  1QSM A;  2OZH A;  3KR5 A;  5F48 A;  4R76 A;  1OBR A;  2BCO A;  1ZG7 A;  4TNU A;  4AG7 A;  3SHP A;  2BSW A;  2YND A;  3QAY A;  3NA6 A;  1ELL P;  2B5G B;  2ZEP A;  3MGD A;  2V77 A;  2NYQ A;  4AB7 A;  1TKJ A;  1YVK A;  4CGP A;  3SJE A;  4A33 A;  4NEX A;  2ZEH A;  2PC1 A;  2P6E A;  2Q0Y A;  5DS0 A;  3R9G A;  2CF4 A;  1CPS A;  4FD6 A;  1LFW A;  3SI0 A;  1M4I A;  2BUE A;  2YNE A;  3IGR A;  4A37 A;  4R8F A;  1AMP A;  3QAH A;  2PRQ A;  5K8P A;  3SI1 A;  2AE6 A;  3H4Q A;  4QUS A;  4YGO A;  1KUV A;  2Q04 A;  5J8F A;  1X10 A;  2PSW A;  3C26 A;  1YVO A;  4E8O A;  2QVP A;  2B3U A;  2AFO A;  2FE7 A;  2QEC A;  2EK9 A;  1QMU A;  5IB9 A;  4KLW A;  4EME A;  4F0X A;  3DNS A;  5DWN A;  4PQA A;  3D4U A;  3PFE A;  1XBU A;  2C1C A;  3D7D A;  2C6C A;  4JWP A;  5AG5 A;  3EXN A;  4F6A A;  4WWV A;  4AXV A;  4P4F A;  4PXD A;  2DXQ A;  4CGL A;  3SJX A;  4CRY B;  2JEV A;  4B10 A;  4A94 A;  2REE A;  1M4D A;  1S3Z A;  1B6B A;  2B4B A;  4OC0 A;  5HVG A;  2VZZ A;  3BJ7 A;  3G3S A;  3OWC A;  8CPA A;  4YFJ A;  1J4J A;  2HUZ A;  2WUU A;  3TT2 A;  3DR8 A;  4UIA A;  4R7M A;  2GLJ A;  4MFP A;  3S9N A;  3VAR A;  3DLJ A;  5JPH A;  4DUK A;  1ARL A;  2O28 A;  2JDD A;  1QSN A;  3B3V A;  4H2K A;  2I3C A;  3D2P A;  1SQH A;  1Z9U A;  5KTA A;  4A32 A;  4KUB A;  4CAX A;  4NGQ A;  5F49 A;  4U9Z A;  3FEE A;  5ELY A;  4CS0 B;  5HMN A;  1IYL A;  1ELM P;  1CP6 A;  2A4N A;  5AG4 A;  4MI4 A;  2Z3O A;  1CM0 A;  3D7F A;  4JLY A;  4JZ0 A;  4AVB A;  3VH9 A;  5HVH A;  4NFR A;  3R9F A;  3JTK A;  4HKF A;  1YRE A;  2ZW7 A;  5EMI A;  4KUA A;  2JLM A;  2K5T A;  4KSF A;  1MJB A;  4L8A A;  4HNW B;  3FX6 A;  4ZX9 A;  3CXP A;  1X12 A;  3PFO A;  4UFX A;  5I0C A;  3RAM A;  2PR8 A;  3N5F A;  4EVY A;  2FXF A;  4KS9 A;  1Z8X A;  4C7I A;  4X8I A;  2WSA A;  3FVL A;  4PSX A;  2VBQ A;  4MXU A;  3V38 A;  5I4M A;  1CG2 A;  1CBX A;  1IGB A;  2Z3P A;  4MCP A;  3KQZ A;  4AVA A;  2WPX A;  3IWG A;  2X7B A;  1Y9W A;  3KQX A;  5BWA B;  2XEI A;  4B12 A;  5CPA A;  4X3R A;  4C2Z A;  4KOY A;  5EC4 A;  4FUU A;  6CPA A;  1Y0R A;  2GRE A;  2PE3 A;  3SI2 A;  3WC7 A;  3R1K A;  2BEI A;  2P6F A;  4IAV A;  2PVV A;  3KL9 A;  4K3N A;  3CT9 A;  3FIX A;  4ZY0 A;  2DF5 A;  4H89 A;  3BJ8 A;  3CZX A;  3IEH A;  4QC6 A;  4UCP A;  4ZYQ A;  4NGS A;  3V8I A;  3IFE A;  1F2O A;  2OZU A;  4ZY1 A;  4M6I A;  1EE3 P;  3BI1 A;  4KVO E;  5JM6 A;  4P45 A;  1XOV A;  2GE3 A;  3RYO A;  4II9 A;  2AFU A;  3QB8 A;  2Z3N A;  1R43 A;  2EK8 A;  3PBB A;  1TF9 A;  2BL1 A;  2PJ9 A;  2PJ5 A;  1S7K A;  2XEG A;  3IC1 A;  4OP4 A;  4U9Y A;  1Q2Y A;  4GS4 A;  1AYE A;  4KSA A;  3T9Y A;  3F0A A;  4C2X A;  4KOX A;  4P4B A;  2FCK A;  3GB0 A;  4JD6 A;  1NSL A;  2Z10 A;  4B11 A;  3I3G A;  4DYO A;  2Z3K A;  3TO6 A;  4M6G A;  4A2Z A;  2IJZ A;  4CPA A;  2AJ6 A;  4AVC A;  4MMO A;  2OU2 A;  3I9S A;  3RNZ A;  3PB8 X;  2DPS A;  2O53 A;  3WC5 A;  3A9L A;  4ONW A;  1BAV A;  3CDX A;  1IY7 A;  1CPX A;  4PPZ A;  5LRG A;  5G20 A;  3DGV A;  2VZY A;  4UWJ A;  3FBU A;  4NGN A;  3GY9 A;  3NE7 A;  2GU2 A;  5J8C A;  4B13 A;  1VIX A;  4MFQ A;  3F8K A;  3W6X A;  4E0A A;  1ZO0 A;  4DNC A;  3NH4 A;  1YGH A;  4KOR A;  2PQ8 A;  2OB0 A;  2H5M A;  2J8N A;  1V0C A;  2ODF A;  1RXT A;  2ZPA A;  5THW A;  5F46 A;  2Q7B A;  1Z8W A;  3TOA A;  1MK4 A;  4ORF A;  4UEF A;  2V8D A;  1FNO A;  4ZX8 A;  3SJG A;  3VWD A;  1M1D A;  2O4H A;  3ZJ0 A;  4CGM A;  1Y7E A;  4F8Z A;  5D8N A;  3ISX A;  5C88 A;  2G0B A;  3KR4 A;  3BLN A;  1I12 A;  2AFM A;  3IWE A;  4KSI A;  3TO7 A;  3TX8 A;  3V7Z A;  5IB0 A;  1Y7R A;  3N7Z A;  4OC1 A;  4UIB A;  1LRZ A;  1YSJ A;  4NJQ A;  2BO9 A;  3W91 A;  2ANP A;  1S7F A;  2WPW A;  2Z0Z A;  1KUY A;  2CTC A;  3IWW A;  4PSW A;  2RC4 A;  3FEC A;  1MJ9 A;  3LWU A;  3B35 A;  5H84 A;  3MRU A;  4ZY2 A;  5JH9 A;  4UFV A;  3PB4 X;  1TKF A;  3QNV A;  1TKH A;  4UEZ A;  3CXQ A;  3FNC A;  4C7H A;  3K2K A;  1S5K A;  1Q2C A;  4CGO A;  1I21 A;  5JGF A;  1YME A;  1BLL E;  4LX9 A;  2ZED A;  4KVM E;  4OME A;  4BIN A;  3KKW A;  1Y0Y A;  2FS5 A;  2ZEN A;  4RN7 A;  3GYA A;  4OLL A;  4FD5 A;  1P0H A;  5CNP A;  4ZBG A;  2EUI A;  4JJX A;  3F5B A;  4R3L A;  4CYO A;  3NH5 A;  3D7G A;  4MJ8 A;  3WR7 A;  1QQ9 A;  2F5I A;  5LYD A;  2ABZ A;  1XMB A;  4M3S A;  5AG7 A;  1NSA A;  5GCN A;  4P6Y A;  2NSM A;  4ONU A;  2ZEO A;  4U5Y A;  5IV0 A;  3W6S A;  4MCS A;  3B3W A;  2PJ2 A;  4OC5 A;  3P2H A;  2ZEF A;  2EVN A;  4MHZ A;  3HUV A;  4A30 A;  2POK A;  4UBR A;  3FED A;  4H6U A;  4NJR A;  3CXS A;  1GHE A;  2P6G A;  1FY7 A;  3E0K A;  4YU9 A;  1YQE A;  3D7H A;  1XRY A;  2G3A A;  2OZG A;  1N71 A;  5AG6 A;  3B3S A;  1A2Z A;  4MCQ A;  1IID A;  5LYF A;  1XMT A;  5IX3 A;  2PJ8 A;  3JRU A;  4P44 A;  4CAE A;  1BOB A;  1R3N A;  2WZN A;  2GIV A;  2PVW A;  4LUA A;  3JVN A;  1XE4 A;  1IU8 A;  2J8M A;  3K9U A;  2J9A A;  3B2Y A;  3BXM A;  2PR1 A;  1YW4 A;  4R87 A;  4B5O A;  2PJ7 A;  4C2Y A;  4CAW A;  4Q38 A;  4HNY B;  4C68 A;  1M4G A;  4OC2 A;  3ZZI A;  2R7H A;  3S9M A;  2VL1 A;  2DPT A;  4KOS A;  5F47 A;  2QML A;  2V8G A;  4MCR A;  4F9U A;  3FMC A;  2ZEM A;  2F8H A;  2HC9 A;  4KOU A;  4XNH C;  5EBV A;  2R1I A;  2V8H A;  3D67 A;  1QSO A;  3FF3 A;  2AFW A;  4NGT A;  2OR4 A;  1R57 A;  4UFW A;  1ARM A;  4CYP A;  2Q51 A;  1XJO A;  1IYK A;  2XEJ A;  4CYN A;  1CX8 A;  2C6P A;  2PJ0 A;  3RO0 A;  4MHP A;  4P4E A;  1PCA A;  5DWM A;  2GLF A;  3IU1 A;  4M85 A;  2DEA A;  4XPD C;  4PXC A;  3RBU A;  4CAF A;  2Z3M A;  5LRK A;  4NGR A;  3D8P A;  4KOT A;  3TOB A;  3UY5 A;  1U6M A;  1VHO A;  1GYT A;  2AFS A;  3LD2 A;  1NMT A;  1JQG A;  3JUW A;  4XPD B;  3T90 A;  4Z65 A;  2G3T A;  2C27 A;  2FVG A;  3R9E A;  2WYR A;  2B3V A;  1XEB A;  4MFL A;  3D66 A;  4TWE A;  4B6Z A;  4QBJ A;  1LAP A;  2Q4Y A;  4RUH A;  2ZOG A;  4MRI A;  3DSB A;  3GLJ A;  2VEZ A;  4P4J A;  2BOA A;  3DR6 A;  1XIX A;  4LQ6 A;  4O23 A;  3TO9 A;  4I49 A;  4P10 A;  1VKC A;  2KCW A;  2QYV A;  2PCU A;  3DDD A;  2HV2 A;  3FH4 A;  3FYN A;  1S7L A;  3HLP A;  3L2N A;  4R57 A;  4BMH A;  3KGQ A;  4HNX B;  4Q36 A;  4MFK A;  5FVJ A;  4GXH A;  2IQ6 A;  4KOV A;  4Y49 C;  3TTH A;  5AGE A;  1TIQ A;  3B8G A;  4IUS A;  2D4P A;  5J1Q A;  1M44 A;  5LRJ A;  1Q2D A;  4LQG A;  4Y49 B;  5K8N A;  4P4D A;  4B14 A;  4OAD A;  1AUG A;  2PIZ A;  3LMS A;  1YLE A;  2JBK A;  4PK3 A;  3NFZ A;  1UWY A;  2VQY A;  2YNC C;  4FAI A;  3KI9 A;  4UA3 A;  4WJB A;  2Q7S A;  2F7V A;  2GAN A;  2Q4V A;  1TF8 A;  4A39 A;  5LYL A;  2YNC A;  2Q44 A;  3CPA A;  4OKO A;  2PJB A;  5HH1 A;  1Z4E A;  4NXY A; 
#chains in the Genus database with same CATH homology
 4MY3 A;  1S7N A;  4KZT A;  4R3K A;  4YRH A;  4BBH A;  2ZW6 A;  2B5G A;  2P0W A;  3S6F A;  4MFJ A;  5KTC A;  4OAE A;  4XPK A;  4UCN A;  4UCM A;  1Y9K A;  1MJA A;  4H6Z A;  3IU2 A;  4KVX A;  2OH1 A;  3TCV A;  1YK3 A;  4RS2 A;  5A27 A;  2CXA A;  4AG9 A;  1XF8 A;  1CJW A;  2R98 A;  2I79 A;  4NF1 A;  2ARH A;  1K4J A;  4CYQ A;  2VI7 A;  4A31 A;  4CGN A;  3FB3 A;  3P2F A;  2PRB A;  1KUX A;  1L0C A;  5KTD A;  1PUA A;  4UWI A;  1QSR A;  4MY0 A;  1KZF A;  4KOW A;  2I00 A;  5G1Z A;  4JXR A;  5A28 A;  3PGP A;  3S6K A;  1WWZ A;  4K30 A;  2PDO A;  4R9M A;  1S60 A;  2REF A;  1OZP A;  2FIA A;  3FXT A;  1NE9 A;  5C82 A;  4KLV A;  1YX0 A;  2Z3L A;  4B5P A;  2Y0M A;  4MHD A;  3PP9 A;  4RI1 A;  4B5P B;  1PU9 A;  4X5K A;  3SXO A;  2J8R A;  1VHS A;  4QB9 A;  3D3S A;  2ZW4 A;  3EY5 A;  4QVT A;  4CRZ B;  4E2A A;  4A95 A;  3EFA A;  5G21 A;  4J3G A;  1B87 A;  3R96 A;  3D2M A;  2FIW A;  3S6H A;  5JQ4 A;  2B4D A;  2B4D B;  2QIR A;  4JXQ A;  2D4O A;  4IF5 A;  4XNH B;  1I1D A;  4L89 A;  5G22 A;  2CNS A;  4XPL A;  1RO5 A;  3G8W A;  1IB1 E;  5ISV A;  1WK4 A;  4MBU A;  3VWE A;  2CNT A;  2ZW5 A;  1ON0 A;  4FD4 A;  3PZJ A;  2IL4 A;  1Z4R A;  4CAV A;  3SXN A;  2HQY A;  3TE4 A;  4NCZ A;  3GKR A;  2FL4 A;  3S6G A;  3EC4 A;  2CY2 A;  2CNM A;  2FSR A;  2Z11 A;  4FD7 A;  4PK2 A;  4F0Y A;  3R95 A;  2ZXV A;  2YGW A;  2VXK A;  2FT0 A;  1BO4 A;  2ATR A;  3FRM A;  5H86 A;  1IIC A;  1P4N A;  1UFH A;  2B58 A;  4PV6 A;  4ZGY B;  3H5Z A;  2NMT A;  5E96 A;  1YR0 A;  2R8V A;  3LOD A;  3EO4 A;  4NSQ A;  2JDC A;  3TFY A;  4MFZ A;  1QST A;  5F48 A;  1QSM A;  2OZH A;  4AG7 A;  3SHP A;  2BSW A;  2YND A;  2B5G B;  3MGD A;  4AB7 A;  1YVK A;  4CGP A;  4A33 A;  4NEX A;  2PC1 A;  2P6E A;  2Q0Y A;  3R9G A;  4FD6 A;  1M4I A;  2BUE A;  2YNE A;  3IGR A;  3QAH A;  2AE6 A;  3H4Q A;  4QUS A;  4YGO A;  1KUV A;  2Q04 A;  5J8F A;  2PSW A;  3C26 A;  1YVO A;  4E8O A;  2B3U A;  2FE7 A;  2QEC A;  4KLW A;  4F0X A;  3DNS A;  5DWN A;  4JWP A;  5AG5 A;  3EXN A;  4F6A A;  2DXQ A;  4CGL A;  4CRY B;  2JEV A;  4B10 A;  2REE A;  1M4D A;  1S3Z A;  1B6B A;  2B4B A;  2VZZ A;  3BJ7 A;  3G3S A;  3OWC A;  4YFJ A;  1J4J A;  2HUZ A;  2WUU A;  3TT2 A;  3DR8 A;  4MFP A;  5JPH A;  2O28 A;  2JDD A;  1QSN A;  3D2P A;  1SQH A;  1Z9U A;  5KTA A;  4A32 A;  4KUB A;  4CAX A;  5F49 A;  4U9Z A;  4CS0 B;  5HMN A;  1IYL A;  2A4N A;  5AG4 A;  4MI4 A;  2Z3O A;  1CM0 A;  4JLY A;  4AVB A;  3R9F A;  3JTK A;  4HKF A;  1YRE A;  2ZW7 A;  4KUA A;  2JLM A;  2K5T A;  4KSF A;  1MJB A;  4L8A A;  4HNW B;  3CXP A;  4UFX A;  5I0C A;  2PR8 A;  4EVY A;  2FXF A;  4KS9 A;  4C7I A;  2WSA A;  4PSX A;  2VBQ A;  2Z3P A;  4AVA A;  2WPX A;  3IWG A;  2X7B A;  1Y9W A;  5BWA B;  4B12 A;  4C2Z A;  4KOY A;  5EC4 A;  3R1K A;  2BEI A;  2P6F A;  3FIX A;  4H89 A;  3BJ8 A;  4UCP A;  4QC6 A;  3V8I A;  2OZU A;  4KVO E;  2GE3 A;  3RYO A;  4II9 A;  3QB8 A;  2Z3N A;  2BL1 A;  4U9Y A;  1S7K A;  1Q2Y A;  4GS4 A;  4KSA A;  3T9Y A;  3F0A A;  4C2X A;  4KOX A;  2FCK A;  4JD6 A;  1NSL A;  2Z10 A;  4B11 A;  3I3G A;  2Z3K A;  3TO6 A;  4A2Z A;  2AJ6 A;  4AVC A;  2OU2 A;  3I9S A;  2DPS A;  3A9L A;  5G20 A;  2VZY A;  4UWJ A;  3FBU A;  3GY9 A;  3NE7 A;  5J8C A;  4B13 A;  4MFQ A;  3F8K A;  3W6X A;  4E0A A;  1ZO0 A;  4DNC A;  1YGH A;  4KOR A;  2PQ8 A;  2OB0 A;  2H5M A;  2J8N A;  1V0C A;  1RXT A;  2ZPA A;  5F46 A;  2Q7B A;  3TOA A;  1MK4 A;  4ORF A;  3VWD A;  1M1D A;  3ZJ0 A;  4CGM A;  5C88 A;  2G0B A;  3BLN A;  1I12 A;  3IWE A;  3TO7 A;  5IB0 A;  1Y7R A;  3N7Z A;  1LRZ A;  3W91 A;  1S7F A;  2WPW A;  2Z0Z A;  1KUY A;  4PSW A;  2RC4 A;  1MJ9 A;  5H84 A;  4UFV A;  4C7H A;  3CXQ A;  3FNC A;  1S5K A;  1Q2C A;  4CGO A;  1I21 A;  4LX9 A;  4KVM E;  3KKW A;  2FS5 A;  3GYA A;  4OLL A;  4FD5 A;  1P0H A;  5CNP A;  4ZBG A;  2EUI A;  4JJX A;  3F5B A;  4R3L A;  4CYO A;  4MJ8 A;  3WR7 A;  2F5I A;  4M3S A;  5AG7 A;  5GCN A;  4ONU A;  4U5Y A;  5IV0 A;  3W6S A;  3P2H A;  2EVN A;  4A30 A;  4UBR A;  4H6U A;  3CXS A;  1GHE A;  2P6G A;  1FY7 A;  3E0K A;  2G3A A;  2OZG A;  1N71 A;  5AG6 A;  1IID A;  1XMT A;  5IX3 A;  4CAE A;  1BOB A;  2GIV A;  4LUA A;  3JVN A;  1XE4 A;  2J8M A;  3K9U A;  4CAW A;  2PR1 A;  4R87 A;  4B5O A;  4C2Y A;  4Q38 A;  4HNY B;  4C68 A;  1M4G A;  3ZZI A;  2R7H A;  2DPT A;  4KOS A;  5F47 A;  2QML A;  5EBV A;  4KOU A;  4XNH C;  2R1I A;  1QSO A;  1R57 A;  4UFW A;  4CYP A;  1IYK A;  4CYN A;  5DWM A;  3IU1 A;  4M85 A;  4XPD C;  4CAF A;  2Z3M A;  3D8P A;  4KOT A;  3TOB A;  3UY5 A;  1U6M A;  3T90 A;  3LD2 A;  1NMT A;  3JUW A;  4XPD B;  2G3T A;  2C27 A;  3R9E A;  2B3V A;  1XEB A;  4MFL A;  4QBJ A;  2Q4Y A;  3DSB A;  2VEZ A;  3DR6 A;  1XIX A;  3TO9 A;  4I49 A;  1VKC A;  2KCW A;  3DDD A;  3FYN A;  2HV2 A;  4R57 A;  1S7L A;  4BMH A;  4HNX B;  4Q36 A;  4MFK A;  5FVJ A;  4KOV A;  4Y49 C;  3TTH A;  5AGE A;  1TIQ A;  3B8G A;  4IUS A;  2D4P A;  1M44 A;  1Q2D A;  4Y49 B;  4B14 A;  4OAD A;  1YLE A;  4PK3 A;  2VQY A;  2YNC C;  4UA3 A;  2GAN A;  2Q4V A;  2YNC A;  2Q44 A;  5HH1 A;  1Z4E A;  4NXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...