4BBHA

Plasmodium vivax n-myristoyltransferase with a bound benzothiophene inhibitor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
384
structure length
384
Chain Sequence
DYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of Novel and Ligand-Efficient Inhibitors of Plasmodium Falciparum and Plasmodium Vivax N-Myristoyltransferase.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 116
structure length 384
sequence length 384
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4bbhA00
3IU1A 4UCNA 4A33A 4CGLA 4C68A 5G20A 5AG7A 5G22A 4B10A 4B12A 5A28A 5AG4A 4CYPA 4UFXA 4CGOA 4A32A 5A27A 4A95A 2YNEA 4B14A 4CYOA 4C7IA 4CGPA 5AG5A 4A2ZA 3H5ZA 4C2YA 4A31A 3IWEA 4UFVA 4A30A 4CYQA 2WUUA 4B11A 4C2ZA 5AGEA 3JTKA 4B13A 4CAFA 4CYNA 2YNDA 5G21A 2YNCC 4C2XA 4UCMA 2YNCA 4CGNA 2WSAA 4CGMA 4UFWA 4BBHA 5AG6A 4C7HA 4CAEA 3IU2A 4UCPA 5G1ZA
chains in the Genus database with same CATH superfamily
3IU1A 2B4DB 1QSOA 1MJAA 1RTQA 4OADA 5E96A 4A33A 2VXKA 2GLJA 4JZ0A 4HPSA 4X5KA 1HDUA 1BOBA 1KUYA 2F8HA 1PUAA 4U5YA 4P6YA 3B3TA 1S3ZA 2Z3KA 2QVPA 3H8GA 1OBRA 2CNMA 2Q4YA 2PVVA 3LD2A 4J3GA 4FD6A 4QVTA 3S6HA 4MI4A 2WPXA 4A2ZA 4P45A 4YFJA 2HQYA 4JD6A 1KUVA 1XJOA 3TCVA 4H6UA 4CAWA 3FB3A 1XF8A 2HB6A 3EFAA 3S9MA 3TFYA 3PP9A 3TC8A 2PDOA 3EXNA 2PCUA 1XIXA 1IB1E 2QJ8A 4H2KA 1YR0A 2ZPAA 3BHXA 2O28A 2VQYA 3MN8A 2QMLA 2ODFA 3S6GA 2B58A 4FWUA 3SJXA 4JJXA 6CPAA 4YRHA 4PQAA 3NA6A 5AG4A 4MY3A 4PSXA 2C1CA 2EWBA 2GREA 3FXTA 4UEZA 3T8WA 4F9UA 4R57A 3SJEA 1CP6A 3KKWA 2WYRA 1Z5RA 4C2YA 2X7BA 3IWGA 2DPTA 1V0CA 3JTKA 4P44A 1S7FA 2I79A 3IWWA 3PB9X 4P4BA 2PR8A 1I1DA 3QB8A 2V8HA 1PCAA 1X12A 3V8IA 1YVKA 2KCWA 2CTCA 2PJ9A 2B3UA 2GANA 3WABA 1Z2LA 2J8NA 3FMCA 1MK4A 4Q36A 1HDQA 3PB7X 2Q51A 5LYFA 1AYEA 2OZHA 2ZW4A 4EVYA 4ZY0A 4W9YA 2Z3OA 2BEIA 4MY0A 4KVXA 4H89A 3R9GA 4R87A 3NE8A 4F9VA 3FECA 2G9DA 4ORFA 4A95A 4OC2A 2CF4A 1CX8A 2ANPA 2DEAA 3K2KA 2ZW6A 1M44A 1WWZA 4HKFA 4CGPA 3DR8A 2FS5A 2P6EA 3VH9A 1TKHA 4OIWA 1Z4EA 4I49A 5G21A 4P4FA 1KZFA 2AFMA 4XPLA 1ZG7A 2ZELA 5LRGA 4A39A 5LRJA 4A37A 5HXDA 4MHNA 3F0AA 4MHPA 4YGOA 3SI2A 3DDDA 5F49A 5CPAA 5F46A 5K8NA 2FVGA 1XMTA 2Q44A 2PJAA 3KQZA 4GS4A 4F0XA 4M6HA 3SJFA 1VHOA 4C68A 2B4BA 1BO4A 3UY5A 3KR4A 1ZLIA 2I3CA 3SI0A 2ATRA 1HEEA 2C6PA 3TO6A 1Z8TA 2IMOA 3BJ7A 4LX9A 4MHYA 5HVFA 1CJWA 4MFKA 1VHEA 4JXQA 4Q38A 3BLNA 3FX6A 4NGRA 4K30A 4OLLA 3QAHA 5EC4A 2IL4A 4K3NA 4BBHA 1BPMA 3FBUA 2PJ8A 2CTBA 2PRQA 4UWJA 4PV6A 2AFXA 5LYDA 3EY5A 1LRZA 4KLVA 2NYQA 3PGPA 1XFOA 1Y0RA 1CBXA 5G20A 3L2NA 4JLYA 5AG7A 4IHMA 3DR6A 2VBQA 4XPKA 1YLEA 4QC6A 1R3NA 5H86A 5H84A 4UIBA 1TIQA 3PB4X 1CM0A 4TWEA 1ZO0A 4DJLA 1JQGA 2JBJA 2YNDA 3MRUA 1ARLA 2JDDA 2AFSA 4AXVA 1F57A 4C2XA 5J8FA 5J1QA 3FRMA 2WSAA 4A38A 3IIBA 3WC5A 2EK9A 2EBJA 3I1UA 3PFOA 2O53A 1IIDA 2WZNA 1LAMA 3CPXA 8CPAA 2PJ0A 5JH9A 4B6ZA 2FIAA 1MJ9A 2Z11A 2VZZA 4KSIA 4MFZA 2Z3LA 3WT4A 3ISZA 4OMEA 2EVNA 4MFPA 5LRKA 5I0CA 4OC3A 5DWNA 3PEIA 4UFXA 3KZWA 4EFDA 1Q7LA 4BD9A 2CY2A 2K5TA 4GM5A 4AVCA 5KTDA 3SI1A 3B3CA 3NH8A 1CPSA 4KZTA 2ZENA 2FE7A 5D8NA 4OC0A 3FH4A 3D68A 3GY9A 1GHEA 3D2MA 1P0HA 3G8WA 3CDXA 2Q7BA 4KSFA 4CS0B 3FF3A 3D4UA 3IJ3A 4E2AA 5D29A 3BJ8A 2IQ6A 4KUAA 4FBEA 3S6FA 3N5FA 3HLPA 2VL1A 2YGWA 4CRYB 2OZUA 3ISXA 4NGPA 3S9LA 1QSNA 4GXHA 1FNOA 4PK2A 4P4DA 3ZZIA 4ZY1A 4UIAA 3CXSA 1IOFA 5ISVA 3IO1A 4KLWA 2I00A 4B12A 3K9UA 4AVAA 2HC9A 3K9TA 5A28A 2CIJA 4A32A 3LODA 2XEGA 4JXRA 4B5OA 2ZEPA 5DWMA 3D7HA 2ZEDA 4C7IA 2GLFA 2ZW5A 4A31A 1TF9A 4C2ZA 3I3GA 4B13A 4HNWB 4CAFA 1YVOA 2ZEHA 5CNPA 4XPDB 1YQEA 4ZI6A 3T9YA 2B3VA 2FSRA 4L89A 4MHDA 2AFOA 2ZXVA 3D66A 4EMEA 2PJ7A 2FXFA 2VEZA 4R3KA 4CAEA 1ARMA 5HVHA 2F7VA 2F5IA 4UA3A 2Q4ZA 4L8AA 5F48A 1ELLP 1FT7A 3A9LA 3KHZA 4KOTA 1XEBA 1VKCA 2GE3A 4MCPA 2Z0ZA 4KOUA 4CYPA 1M4IA 5LYLA 1Y0YA 3CPAA 1Y7RA 2ARHA 1ZLHA 3TE4A 2R98A 5AG5A 4LUAA 5LYIA 2AJ6A 4F8ZA 4NFRA 2QYVA 4MBUA 4DUKA 2C27A 4P4IA 1Z8WA 4U9YA 4NCZA 3SXOA 4CYNA 5KTCA 2J8MA 4IAVA 2PJ2A 1IOIA 4CPAA 5IB0A 3GYAA 1AUGA 3W91A 2Q4VA 1CP7A 3QAYA 2NSMA 4CGMA 1AMPA 2CNTA 2OZGA 2VZYA 3GKRA 3CXQA 2G3TA 1M4GA 1ON0A 2OB0A 1KWMA 3GIUA 5HMNA 4AG7A 4UCPA 4F6AA 3SJGA 2ZW7A 1DE4C 1BLLE 2FIWA 1J4JA 1VGYA 2ZEOA 3CZXA 4R3LA 4ZX8A 3FEDA 2PVWA 4B5PB 3IEHA 3D2PA 3H4QA 4BMHA 4HNXB 1XE4A 4OAEA 4MFQA 4UEFA 5ELYA 3TOAA 1TF8A 3E0KA 1I12A 1BAVA 4PPZA 1B87A 4IUSA 4IK2A 4NEXA 5FVJA 5THWA 2OU2A 4EWTA 1YLOA 5F09A 3VATA 2BUEA 1JWQA 4KOXA 3WR7A 4KVME 4XNHB 4KOWA 1YREA 4JYWA 4FAIA 4ONWA 1TXRA 3DSBA 3KR5A 4TNUA 3N7ZA 3W6XA 4IF5A 3WC6A 1XMBA 1VIXA 2Q7SA 3D7FA 3VWEA 4UWIA 4PK3A 3B8GA 4UCNA 4YWYA 4G1PA 1LANA 2Y0MA 4LQ6A 3NH4A 2ZEMA 1YW6A 3GUXA 3NE7A 4RI1A 2V77A 1S60A 3FVLA 3SHPA 4CYOA 3B2YA 1NE9A 5JQ4A 3JRUA 3KQXA 2D4OA 4UFVA 4ZBGA 3B3SA 1M4DA 4CYQA 2WUUA 5AGEA 2PSWA 2JLMA 4OC4A 2P6FA 4PXCA 1XRYA 4X3RA 3FIXA 4KOVA 4UFWA 1L0CA 5IX3A 4PXDA 1Z8LA 4O23A 4XPDC 4MRIA 1OZPA 4R7MA 2Z3PA 5G1ZA 3TO7A 1ZG8A 3ZJ0A 3IFEA 1YK3A 1IY7A 3R9EA 3I9SA 1R57A 2JEVA 2OH1A 4AVBA 4B14A 2EK8A 4E8OA 2Z3NA 3LWUA 4AB7A 3S6KA 4KSAA 1GYTA 5J8CA 3C26A 1TKJA 3IWEA 3D3SA 1EE3P 2J8RA 4NGSA 5C82A 4OC5A 2GFQA 2V8VA 1UFHA 2BOAA 2PC1A 3VWDA 4Q7AA 3TOBA 3PZJA 2ZOFA 4MFLA 4UCMA 4F0YA 5K8OA 2BSWA 4MXUA 3RYOA 3BI0A 3DNSA 4A94A 2PJBA 2JEWA 5EBVA 2DXQA 4KOYA 4M85A 4UEEA 4R6TA 2OOTA 1WK4A 4BINA 5C88A 3B3VA 4MCQA 2Q43A 4LQGA 4CGLA 3W6SA 3TT2A 4NGMA 5K8PA 2PJ4A 3CXPA 5HH1A 4MHZA 3SXNA 2PRBA 4FUUA 2ZEGA 4YU9A 3OWCA 1N71A 2REFA 3LACA 4B5PA 4U9ZA 3DLJA 4A30A 3NH5A 1S5KA 2PE3A 3RNZA 1RXTA 3IC1A 3NFZA 1YW4A 4RN7A 2FL4A 4CAXA 2EO8A 3KHXA 3H8FA 2Q0YA 4Y49C 1SQHA 1CPXA 1X10A 1NMTA 2CNSA 3D67A 1NSAA 3DGVA 4ONUA 4XNHC 1I21A 3D8PA 4NF1A 3R96A 1Z9UA 4MJ8A 2J9AA 2R7HA 4MFJA 1LFWA 1YX0A 3P2FA 5EMIA 1MJBA 4RS2A 1A2ZA 2PR1A 4R9MA 3PBBA 2PJ6A 2ABZA 2D4PA 2PJ1A 4NXYA 2V8GA 4NSQA 1IYLA 4E0AA 4JWPA 2AFZA 1RO5A 4ZYQA 4WWVA 4P10A 3VARA 5DS0A 3B3WA 5KTAA 3EO4A 4FD5A 5K8MA 3JUWA 1CG2A 2BCOA 4RUHA 2AFUA 2ZEEA 2Z3MA 3MGDA 2R1IA 4OIDA 1Y9KA 2EUIA 1QSMA 1YGHA 2RC4A 4MCSA 3PRTA 3V38A 4PSWA 5F47A 2WPWA 4HNYB 1QMUA 3QNVA 2R8VA 1IICA 1PYTB 4KVOE 4PXBA 3KL9A 2P0WA 2HV2A 3LMSA 1KUXA 5IB9A 1Y9WA 1LCPA 1QQ9A 4FD7A 4NGQA 4B10A 2XEJA 4Z65A 1S7LA 3FYNA 4MCRA 5CBMA 2DPSA 5A27A 1IYKA 4NGTA 4II9A 1K4JA 3D7GA 3TX8A 1IGBA 3FEEA 3H5ZA 1LAPA 4KOSA 4X8IA 4OP4A 2JDCA 4Y49B 4FD4A 2ZOGA 4QUSA 2YNCC 4OKOA 3GLJA 3R95A 2CXAA 2YNCA 3BI1A 1Z8XA 2ZEFA 2AE6A 4CAVA 4OC1A 4X2TA 2C6GA 3KI9A 1M1DA 1TKFA 2B5GA 2QECA 5AG6A 3CT9A 3KASA 1QSTA 3JVNA 4WJBA 3KGQA 3TTHA 4PXEA 2GIVA 1Q2CA 3R1KA 2FCKA 2A4NA 4KS9A 4R8FA 1XOVA 5G22A 3TO9A 4AG9A 2B4DA 1Y7EA 2BL1A 2G3AA 2RFHA 1F2OA 3V7ZA 4NGNA 2PIYA 4CRZB 7CPAA 3RBUA 4QBJA 3F5BA 3PB8X 4UBRA 4P4EA 4QB9A 3S9NA 2NMTA 3RAMA 2FT0A 1S7NA 1ELMP 4B11A 3D7DA 5JPHA 1H8LA 5HVGA 5I4MA 1YMEA 3FJUA 2C6CA 1Q2YA 2H5MA 2PJ5A 2GU2A 5JM6A 1BPNA 1XBUA 4ZGYB 2OR4A 4KORA 4CGNA 3PB6X 1B6BA 4KUBA 1VHSA 4R76A 3FNCA 2VI7A 1FY7A 2AFWA 1S7KA 2V8DA 4ZX9A 1NSLA 1U6MA 2HUZA 2P6GA 2PIZA 4NJRA 3GB0A 2IJZA 3EC4A 3IU2A 1Q2DA 2YNEA 1YSJA 3B35A 3HUVA 4MMOA 1M4LA 4P4JA 2PJCA 2O4HA 5GCNA 2BO9A 2QIRA 3BXMA 2DF5A 5BWAB 3B7IA 3H8EA 5JGFA 1PU9A 4CGOA 2G0BA 2Z10A 1ZG9A 2XEFA 4ZY2A 2REEA 3RO0A 1DTDA 3G3SA 5IV0A 2Q04A 1R43A 3F8KA 1F2PA 1UWYA 3T90A 2B5GB 3RZAA 4UF4A 1LOKA 4H6ZA 2RB7A 1Z4RA 1QSRA 3IGRA 1IU8A 3P2HA 4NJQA 2PJ3A 3PBEA 4M6GA 3WC7A 4M6IA 4DNCA 4C7HA 3R9FA 2PQ8A 1P4NA 4M3SA 2POKA 2XEIA 4DYOA 3PFEA 2JBKA
chains in the Genus database with same CATH topology
3IU1A 2B4DB 1QSOA 1MJAA 4OADA 5E96A 4A33A 2VXKA 4X5KA 1BOBA 1KUYA 1PUAA 4U5YA 1S3ZA 2Z3KA 2CNMA 2Q4YA 4J3GA 3LD2A 4QVTA 4FD6A 3S6HA 4A2ZA 4MI4A 4YFJA 2HQYA 4JD6A 1KUVA 3TCVA 4H6UA 4CAWA 3FB3A 1XF8A 3TFYA 3EFAA 3PP9A 2PDOA 3EXNA 1XIXA 1IB1E 1YR0A 2ZPAA 2O28A 2VQYA 2QMLA 3S6GA 2B58A 4JJXA 4YRHA 5AG4A 4MY3A 4PSXA 3FXTA 4R57A 3KKWA 4C2YA 2X7BA 3IWGA 2DPTA 1V0CA 3JTKA 1S7FA 2I79A 2PR8A 1I1DA 3QB8A 3V8IA 1YVKA 2KCWA 2B3UA 2GANA 2J8NA 1MK4A 4Q36A 2OZHA 2ZW4A 4EVYA 2Z3OA 2BEIA 4MY0A 4KVXA 4H89A 3R9GA 4R87A 4ORFA 4A95A 4HKFA 2ZW6A 1M44A 1WWZA 4CGPA 3DR8A 2FS5A 2P6EA 1Z4EA 4I49A 5G21A 1KZFA 4XPLA 3F0AA 4YGOA 3DDDA 5F49A 5F46A 1XMTA 2Q44A 4GS4A 4F0XA 4C68A 2B4BA 1BO4A 3UY5A 2ATRA 3TO6A 3BJ7A 4LX9A 1CJWA 4MFKA 4JXQA 4Q38A 3BLNA 4K30A 4OLLA 3QAHA 5EC4A 2IL4A 4BBHA 3FBUA 4UWJA 4PV6A 3EY5A 1LRZA 4KLVA 3PGPA 5G20A 4JLYA 5AG7A 3DR6A 2VBQA 4XPKA 1YLEA 4QC6A 5H86A 5H84A 1TIQA 1CM0A 1ZO0A 2YNDA 2JDDA 4C2XA 5J8FA 3FRMA 2WSAA 1IIDA 2FIAA 1MJ9A 2Z11A 2VZZA 4MFZA 2Z3LA 2EVNA 4MFPA 5I0CA 5DWNA 4UFXA 5KTDA 2CY2A 2K5TA 4AVCA 4KZTA 2FE7A 3GY9A 1GHEA 3D2MA 1P0HA 3G8WA 2Q7BA 4KSFA 4CS0B 4E2AA 3BJ8A 4KUAA 3S6FA 2YGWA 4CRYB 2OZUA 1QSNA 4PK2A 3ZZIA 3CXSA 5ISVA 4KLWA 2I00A 4B12A 3K9UA 4AVAA 5A28A 4A32A 3LODA 4JXRA 4B5OA 5DWMA 4C7IA 2ZW5A 4A31A 4C2ZA 3I3GA 4B13A 4HNWB 4CAFA 1YVOA 5CNPA 4XPDB 3T9YA 2B3VA 2FSRA 4L89A 4MHDA 2ZXVA 2FXFA 2VEZA 4R3KA 4CAEA 2F5IA 4UA3A 4L8AA 5F48A 3A9LA 4KOTA 1XEBA 1VKCA 2GE3A 2Z0ZA 4KOUA 4CYPA 1M4IA 1Y7RA 2ARHA 3TE4A 2R98A 5AG5A 4LUAA 2AJ6A 4MBUA 2C27A 4U9YA 4NCZA 3SXOA 4CYNA 5KTCA 2J8MA 5IB0A 3GYAA 3W91A 2Q4VA 4CGMA 2CNTA 2VZYA 2OZGA 3GKRA 3CXQA 2G3TA 1M4GA 1ON0A 2OB0A 5HMNA 4AG7A 4UCPA 4F6AA 2ZW7A 2FIWA 1J4JA 4R3LA 4B5PB 3D2PA 3H4QA 4BMHA 4HNXB 1XE4A 4OAEA 4MFQA 3TOAA 3E0KA 1I12A 1B87A 4IUSA 4NEXA 5FVJA 2OU2A 2BUEA 3WR7A 4KOXA 4KVME 4XNHB 4KOWA 1YREA 3DSBA 3N7ZA 3W6XA 4IF5A 3VWEA 4UWIA 4PK3A 3B8GA 4UCNA 2Y0MA 4RI1A 3NE7A 1S60A 3SHPA 4CYOA 1NE9A 5JQ4A 4ZBGA 2D4OA 4UFVA 4CYQA 1M4DA 2WUUA 5AGEA 2PSWA 2JLMA 2P6FA 3FIXA 4KOVA 4UFWA 1L0CA 5IX3A 4XPDC 1OZPA 2Z3PA 5G1ZA 3TO7A 3ZJ0A 1YK3A 3R9EA 3I9SA 1R57A 2JEVA 2OH1A 4AVBA 4B14A 4E8OA 2Z3NA 4AB7A 5J8CA 3S6KA 4KSAA 3C26A 3IWEA 3D3SA 2J8RA 5C82A 1UFHA 2PC1A 3VWDA 3TOBA 3PZJA 4UCMA 4MFLA 4F0YA 2BSWA 3RYOA 3DNSA 5EBVA 2DXQA 4KOYA 4M85A 1WK4A 5C88A 4CGLA 3W6SA 3TT2A 3CXPA 5HH1A 3SXNA 2PRBA 3OWCA 1N71A 2REFA 4B5PA 4U9ZA 4A30A 1S5KA 1RXTA 4CAXA 2FL4A 4Y49C 2Q0YA 1SQHA 1NMTA 2CNSA 4XNHC 4ONUA 1I21A 3D8PA 4NF1A 3R96A 1Z9UA 4MJ8A 2R7HA 4MFJA 1YX0A 3P2FA 1MJBA 4RS2A 2PR1A 4R9MA 2D4PA 4NXYA 4NSQA 1IYLA 4E0AA 4JWPA 1RO5A 5KTAA 3EO4A 4FD5A 3JUWA 3MGDA 2Z3MA 2R1IA 1Y9KA 2EUIA 1QSMA 1YGHA 2RC4A 4PSWA 5F47A 2WPWA 4HNYB 2R8VA 1IICA 4KVOE 2P0WA 2HV2A 1KUXA 1Y9WA 4FD7A 4B10A 1S7LA 3FYNA 2DPSA 5A27A 1IYKA 4II9A 1K4JA 3H5ZA 4KOSA 2JDCA 4Y49B 4FD4A 4QUSA 2YNCC 3R95A 2CXAA 2YNCA 4CAVA 2AE6A 1M1DA 2B5GA 2QECA 5AG6A 1QSTA 3JVNA 3TTHA 2GIVA 1Q2CA 3R1KA 2FCKA 2A4NA 4KS9A 5G22A 3TO9A 4AG9A 2B4DA 2BL1A 2G3AA 4CRZB 4QBJA 3F5BA 4UBRA 4QB9A 2NMTA 2FT0A 1S7NA 4B11A 5JPHA 1Q2YA 2H5MA 4ZGYB 4CGNA 4KORA 1B6BA 4KUBA 1VHSA 3FNCA 2VI7A 1FY7A 1NSLA 1S7KA 1U6MA 2HUZA 2P6GA 3EC4A 3IU2A 1Q2DA 2YNEA 5GCNA 2QIRA 5BWAB 1PU9A 4CGOA 2G0BA 2Z10A 2REEA 3G3SA 5IV0A 2Q04A 3F8KA 3T90A 2B5GB 4H6ZA 1Z4RA 1QSRA 3IGRA 3P2HA 4DNCA 4C7HA 3R9FA 2PQ8A 1P4NA 4M3SA 2WPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IU1 A;  4UCN A;  4A33 A;  4CGL A;  4C68 A;  5G20 A;  5AG7 A;  5G22 A;  4B10 A;  4B12 A;  5A28 A;  5AG4 A;  4CYP A;  4UFX A;  4CGO A;  4A32 A;  5A27 A;  4A95 A;  2YNE A;  4B14 A;  4CYO A;  4C7I A;  4CGP A;  5AG5 A;  4A2Z A;  3H5Z A;  4C2Y A;  4A31 A;  3IWE A;  4UFV A;  4A30 A;  4CYQ A;  2WUU A;  4B11 A;  4C2Z A;  5AGE A;  3JTK A;  4B13 A;  4CAF A;  4CYN A;  2YND A;  5G21 A;  2YNC C;  4C2X A;  4UCM A;  2YNC A;  4CGN A;  2WSA A;  4CGM A;  4UFW A;  4BBH A;  5AG6 A;  4C7H A;  4CAE A;  3IU2 A;  4UCP A;  5G1Z A; 
#chains in the Genus database with same CATH topology
 3IU1 A;  2B4D B;  1QSO A;  1MJA A;  1RTQ A;  4OAD A;  5E96 A;  4A33 A;  2VXK A;  2GLJ A;  4JZ0 A;  4HPS A;  4X5K A;  1HDU A;  1BOB A;  1KUY A;  2F8H A;  1PUA A;  4U5Y A;  4P6Y A;  3B3T A;  1S3Z A;  2Z3K A;  2QVP A;  3H8G A;  1OBR A;  2CNM A;  2Q4Y A;  2PVV A;  3LD2 A;  4J3G A;  4FD6 A;  4QVT A;  3S6H A;  4MI4 A;  2WPX A;  4A2Z A;  4P45 A;  4YFJ A;  2HQY A;  4JD6 A;  1KUV A;  1XJO A;  3TCV A;  4H6U A;  4CAW A;  3FB3 A;  1XF8 A;  2HB6 A;  3EFA A;  3S9M A;  3TFY A;  3PP9 A;  3TC8 A;  2PDO A;  3EXN A;  2PCU A;  1XIX A;  1IB1 E;  2QJ8 A;  4H2K A;  1YR0 A;  2ZPA A;  3BHX A;  2O28 A;  2VQY A;  3MN8 A;  2QML A;  2ODF A;  3S6G A;  2B58 A;  4FWU A;  3SJX A;  4JJX A;  6CPA A;  4YRH A;  4PQA A;  3NA6 A;  5AG4 A;  4MY3 A;  4PSX A;  2C1C A;  2EWB A;  2GRE A;  3FXT A;  4UEZ A;  3T8W A;  4F9U A;  4R57 A;  3SJE A;  1CP6 A;  3KKW A;  2WYR A;  1Z5R A;  4C2Y A;  2X7B A;  3IWG A;  2DPT A;  1V0C A;  3JTK A;  4P44 A;  1S7F A;  2I79 A;  3IWW A;  3PB9 X;  4P4B A;  2PR8 A;  1I1D A;  3QB8 A;  2V8H A;  1PCA A;  1X12 A;  3V8I A;  1YVK A;  2KCW A;  2CTC A;  2PJ9 A;  2B3U A;  2GAN A;  3WAB A;  1Z2L A;  2J8N A;  3FMC A;  1MK4 A;  4Q36 A;  1HDQ A;  3PB7 X;  2Q51 A;  5LYF A;  1AYE A;  2OZH A;  2ZW4 A;  4EVY A;  4ZY0 A;  4W9Y A;  2Z3O A;  2BEI A;  4MY0 A;  4KVX A;  4H89 A;  3R9G A;  4R87 A;  3NE8 A;  4F9V A;  3FEC A;  2G9D A;  4ORF A;  4A95 A;  4OC2 A;  2CF4 A;  1CX8 A;  2ANP A;  2DEA A;  3K2K A;  2ZW6 A;  1M44 A;  1WWZ A;  4HKF A;  4CGP A;  3DR8 A;  2FS5 A;  2P6E A;  3VH9 A;  1TKH A;  4OIW A;  1Z4E A;  4I49 A;  5G21 A;  4P4F A;  1KZF A;  2AFM A;  4XPL A;  1ZG7 A;  2ZEL A;  5LRG A;  4A39 A;  5LRJ A;  4A37 A;  5HXD A;  4MHN A;  3F0A A;  4MHP A;  4YGO A;  3SI2 A;  3DDD A;  5F49 A;  5CPA A;  5F46 A;  5K8N A;  2FVG A;  1XMT A;  2Q44 A;  2PJA A;  3KQZ A;  4GS4 A;  4F0X A;  4M6H A;  3SJF A;  1VHO A;  4C68 A;  2B4B A;  1BO4 A;  3UY5 A;  3KR4 A;  1ZLI A;  2I3C A;  3SI0 A;  2ATR A;  1HEE A;  2C6P A;  3TO6 A;  1Z8T A;  2IMO A;  3BJ7 A;  4LX9 A;  4MHY A;  5HVF A;  1CJW A;  4MFK A;  1VHE A;  4JXQ A;  4Q38 A;  3BLN A;  3FX6 A;  4NGR A;  4K30 A;  4OLL A;  3QAH A;  5EC4 A;  2IL4 A;  4K3N A;  4BBH A;  1BPM A;  3FBU A;  2PJ8 A;  2CTB A;  2PRQ A;  4UWJ A;  4PV6 A;  2AFX A;  5LYD A;  3EY5 A;  1LRZ A;  4KLV A;  2NYQ A;  3PGP A;  1XFO A;  1Y0R A;  1CBX A;  5G20 A;  3L2N A;  4JLY A;  5AG7 A;  4IHM A;  3DR6 A;  2VBQ A;  4XPK A;  1YLE A;  4QC6 A;  1R3N A;  5H86 A;  5H84 A;  4UIB A;  1TIQ A;  3PB4 X;  1CM0 A;  4TWE A;  1ZO0 A;  4DJL A;  1JQG A;  2JBJ A;  2YND A;  3MRU A;  1ARL A;  2JDD A;  2AFS A;  4AXV A;  1F57 A;  4C2X A;  5J8F A;  5J1Q A;  3FRM A;  2WSA A;  4A38 A;  3IIB A;  3WC5 A;  2EK9 A;  2EBJ A;  3I1U A;  3PFO A;  2O53 A;  1IID A;  2WZN A;  1LAM A;  3CPX A;  8CPA A;  2PJ0 A;  5JH9 A;  4B6Z A;  2FIA A;  1MJ9 A;  2Z11 A;  2VZZ A;  4KSI A;  4MFZ A;  2Z3L A;  3WT4 A;  3ISZ A;  4OME A;  2EVN A;  4MFP A;  5LRK A;  5I0C A;  4OC3 A;  5DWN A;  3PEI A;  4UFX A;  3KZW A;  4EFD A;  1Q7L A;  4BD9 A;  2CY2 A;  2K5T A;  4GM5 A;  4AVC A;  5KTD A;  3SI1 A;  3B3C A;  3NH8 A;  1CPS A;  4KZT A;  2ZEN A;  2FE7 A;  5D8N A;  4OC0 A;  3FH4 A;  3D68 A;  3GY9 A;  1GHE A;  3D2M A;  1P0H A;  3G8W A;  3CDX A;  2Q7B A;  4KSF A;  4CS0 B;  3FF3 A;  3D4U A;  3IJ3 A;  4E2A A;  5D29 A;  3BJ8 A;  2IQ6 A;  4KUA A;  4FBE A;  3S6F A;  3N5F A;  3HLP A;  2VL1 A;  2YGW A;  4CRY B;  2OZU A;  3ISX A;  4NGP A;  3S9L A;  1QSN A;  4GXH A;  1FNO A;  4PK2 A;  4P4D A;  3ZZI A;  4ZY1 A;  4UIA A;  3CXS A;  1IOF A;  5ISV A;  3IO1 A;  4KLW A;  2I00 A;  4B12 A;  3K9U A;  4AVA A;  2HC9 A;  3K9T A;  5A28 A;  2CIJ A;  4A32 A;  3LOD A;  2XEG A;  4JXR A;  4B5O A;  2ZEP A;  5DWM A;  3D7H A;  2ZED A;  4C7I A;  2GLF A;  2ZW5 A;  4A31 A;  1TF9 A;  4C2Z A;  3I3G A;  4B13 A;  4HNW B;  4CAF A;  1YVO A;  2ZEH A;  5CNP A;  4XPD B;  1YQE A;  4ZI6 A;  3T9Y A;  2B3V A;  2FSR A;  4L89 A;  4MHD A;  2AFO A;  2ZXV A;  3D66 A;  4EME A;  2PJ7 A;  2FXF A;  2VEZ A;  4R3K A;  4CAE A;  1ARM A;  5HVH A;  2F7V A;  2F5I A;  4UA3 A;  2Q4Z A;  4L8A A;  5F48 A;  1ELL P;  1FT7 A;  3A9L A;  3KHZ A;  4KOT A;  1XEB A;  1VKC A;  2GE3 A;  4MCP A;  2Z0Z A;  4KOU A;  4CYP A;  1M4I A;  5LYL A;  1Y0Y A;  3CPA A;  1Y7R A;  2ARH A;  1ZLH A;  3TE4 A;  2R98 A;  5AG5 A;  4LUA A;  5LYI A;  2AJ6 A;  4F8Z A;  4NFR A;  2QYV A;  4MBU A;  4DUK A;  2C27 A;  4P4I A;  1Z8W A;  4U9Y A;  4NCZ A;  3SXO A;  4CYN A;  5KTC A;  2J8M A;  4IAV A;  2PJ2 A;  1IOI A;  4CPA A;  5IB0 A;  3GYA A;  1AUG A;  3W91 A;  2Q4V A;  1CP7 A;  3QAY A;  2NSM A;  4CGM A;  1AMP A;  2CNT A;  2OZG A;  2VZY A;  3GKR A;  3CXQ A;  2G3T A;  1M4G A;  1ON0 A;  2OB0 A;  1KWM A;  3GIU A;  5HMN A;  4AG7 A;  4UCP A;  4F6A A;  3SJG A;  2ZW7 A;  1DE4 C;  1BLL E;  2FIW A;  1J4J A;  1VGY A;  2ZEO A;  3CZX A;  4R3L A;  4ZX8 A;  3FED A;  2PVW A;  4B5P B;  3IEH A;  3D2P A;  3H4Q A;  4BMH A;  4HNX B;  1XE4 A;  4OAE A;  4MFQ A;  4UEF A;  5ELY A;  3TOA A;  1TF8 A;  3E0K A;  1I12 A;  1BAV A;  4PPZ A;  1B87 A;  4IUS A;  4IK2 A;  4NEX A;  5FVJ A;  5THW A;  2OU2 A;  4EWT A;  1YLO A;  5F09 A;  3VAT A;  2BUE A;  1JWQ A;  4KOX A;  3WR7 A;  4KVM E;  4XNH B;  4KOW A;  1YRE A;  4JYW A;  4FAI A;  4ONW A;  1TXR A;  3DSB A;  3KR5 A;  4TNU A;  3N7Z A;  3W6X A;  4IF5 A;  3WC6 A;  1XMB A;  1VIX A;  2Q7S A;  3D7F A;  3VWE A;  4UWI A;  4PK3 A;  3B8G A;  4UCN A;  4YWY A;  4G1P A;  1LAN A;  2Y0M A;  4LQ6 A;  3NH4 A;  2ZEM A;  1YW6 A;  3GUX A;  3NE7 A;  4RI1 A;  2V77 A;  1S60 A;  3FVL A;  3SHP A;  4CYO A;  3B2Y A;  1NE9 A;  5JQ4 A;  3JRU A;  3KQX A;  2D4O A;  4UFV A;  4ZBG A;  3B3S A;  1M4D A;  4CYQ A;  2WUU A;  5AGE A;  2PSW A;  2JLM A;  4OC4 A;  2P6F A;  4PXC A;  1XRY A;  4X3R A;  3FIX A;  4KOV A;  4UFW A;  1L0C A;  5IX3 A;  4PXD A;  1Z8L A;  4O23 A;  4XPD C;  4MRI A;  1OZP A;  4R7M A;  2Z3P A;  5G1Z A;  3TO7 A;  1ZG8 A;  3ZJ0 A;  3IFE A;  1YK3 A;  1IY7 A;  3R9E A;  3I9S A;  1R57 A;  2JEV A;  2OH1 A;  4AVB A;  4B14 A;  2EK8 A;  4E8O A;  2Z3N A;  3LWU A;  4AB7 A;  3S6K A;  4KSA A;  1GYT A;  5J8C A;  3C26 A;  1TKJ A;  3IWE A;  3D3S A;  1EE3 P;  2J8R A;  4NGS A;  5C82 A;  4OC5 A;  2GFQ A;  2V8V A;  1UFH A;  2BOA A;  2PC1 A;  3VWD A;  4Q7A A;  3TOB A;  3PZJ A;  2ZOF A;  4MFL A;  4UCM A;  4F0Y A;  5K8O A;  2BSW A;  4MXU A;  3RYO A;  3BI0 A;  3DNS A;  4A94 A;  2PJB A;  2JEW A;  5EBV A;  2DXQ A;  4KOY A;  4M85 A;  4UEE A;  4R6T A;  2OOT A;  1WK4 A;  4BIN A;  5C88 A;  3B3V A;  4MCQ A;  2Q43 A;  4LQG A;  4CGL A;  3W6S A;  3TT2 A;  4NGM A;  5K8P A;  2PJ4 A;  3CXP A;  5HH1 A;  4MHZ A;  3SXN A;  2PRB A;  4FUU A;  2ZEG A;  4YU9 A;  3OWC A;  1N71 A;  2REF A;  3LAC A;  4B5P A;  4U9Z A;  3DLJ A;  4A30 A;  3NH5 A;  1S5K A;  2PE3 A;  3RNZ A;  1RXT A;  3IC1 A;  3NFZ A;  1YW4 A;  4RN7 A;  2FL4 A;  4CAX A;  2EO8 A;  3KHX A;  3H8F A;  2Q0Y A;  4Y49 C;  1SQH A;  1CPX A;  1X10 A;  1NMT A;  2CNS A;  3D67 A;  1NSA A;  3DGV A;  4ONU A;  4XNH C;  1I21 A;  3D8P A;  4NF1 A;  3R96 A;  1Z9U A;  4MJ8 A;  2J9A A;  2R7H A;  4MFJ A;  1LFW A;  1YX0 A;  3P2F A;  5EMI A;  1MJB A;  4RS2 A;  1A2Z A;  2PR1 A;  4R9M A;  3PBB A;  2PJ6 A;  2ABZ A;  2D4P A;  2PJ1 A;  4NXY A;  2V8G A;  4NSQ A;  1IYL A;  4E0A A;  4JWP A;  2AFZ A;  1RO5 A;  4ZYQ A;  4WWV A;  4P10 A;  3VAR A;  5DS0 A;  3B3W A;  5KTA A;  3EO4 A;  4FD5 A;  5K8M A;  3JUW A;  1CG2 A;  2BCO A;  4RUH A;  2AFU A;  2ZEE A;  2Z3M A;  3MGD A;  2R1I A;  4OID A;  1Y9K A;  2EUI A;  1QSM A;  1YGH A;  2RC4 A;  4MCS A;  3PRT A;  3V38 A;  4PSW A;  5F47 A;  2WPW A;  4HNY B;  1QMU A;  3QNV A;  2R8V A;  1IIC A;  1PYT B;  4KVO E;  4PXB A;  3KL9 A;  2P0W A;  2HV2 A;  3LMS A;  1KUX A;  5IB9 A;  1Y9W A;  1LCP A;  1QQ9 A;  4FD7 A;  4NGQ A;  4B10 A;  2XEJ A;  4Z65 A;  1S7L A;  3FYN A;  4MCR A;  5CBM A;  2DPS A;  5A27 A;  1IYK A;  4NGT A;  4II9 A;  1K4J A;  3D7G A;  3TX8 A;  1IGB A;  3FEE A;  3H5Z A;  1LAP A;  4KOS A;  4X8I A;  4OP4 A;  2JDC A;  4Y49 B;  4FD4 A;  2ZOG A;  4QUS A;  2YNC C;  4OKO A;  3GLJ A;  3R95 A;  2CXA A;  2YNC A;  3BI1 A;  1Z8X A;  2ZEF A;  2AE6 A;  4CAV A;  4OC1 A;  4X2T A;  2C6G A;  3KI9 A;  1M1D A;  1TKF A;  2B5G A;  2QEC A;  5AG6 A;  3CT9 A;  3KAS A;  1QST A;  3JVN A;  4WJB A;  3KGQ A;  3TTH A;  4PXE A;  2GIV A;  1Q2C A;  3R1K A;  2FCK A;  2A4N A;  4KS9 A;  4R8F A;  1XOV A;  5G22 A;  3TO9 A;  4AG9 A;  2B4D A;  1Y7E A;  2BL1 A;  2G3A A;  2RFH A;  1F2O A;  3V7Z A;  4NGN A;  2PIY A;  4CRZ B;  7CPA A;  3RBU A;  4QBJ A;  3F5B A;  3PB8 X;  4UBR A;  4P4E A;  4QB9 A;  3S9N A;  2NMT A;  3RAM A;  2FT0 A;  1S7N A;  1ELM P;  4B11 A;  3D7D A;  5JPH A;  1H8L A;  5HVG A;  5I4M A;  1YME A;  3FJU A;  2C6C A;  1Q2Y A;  2H5M A;  2PJ5 A;  2GU2 A;  5JM6 A;  1BPN A;  1XBU A;  4ZGY B;  2OR4 A;  4KOR A;  4CGN A;  3PB6 X;  1B6B A;  4KUB A;  1VHS A;  4R76 A;  3FNC A;  2VI7 A;  1FY7 A;  2AFW A;  1S7K A;  2V8D A;  4ZX9 A;  1NSL A;  1U6M A;  2HUZ A;  2P6G A;  2PIZ A;  4NJR A;  3GB0 A;  2IJZ A;  3EC4 A;  3IU2 A;  1Q2D A;  2YNE A;  1YSJ A;  3B35 A;  3HUV A;  4MMO A;  1M4L A;  4P4J A;  2PJC A;  2O4H A;  5GCN A;  2BO9 A;  2QIR A;  3BXM A;  2DF5 A;  5BWA B;  3B7I A;  3H8E A;  5JGF A;  1PU9 A;  4CGO A;  2G0B A;  2Z10 A;  1ZG9 A;  2XEF A;  4ZY2 A;  2REE A;  3RO0 A;  1DTD A;  3G3S A;  5IV0 A;  2Q04 A;  1R43 A;  3F8K A;  1F2P A;  1UWY A;  3T90 A;  2B5G B;  3RZA A;  4UF4 A;  1LOK A;  4H6Z A;  2RB7 A;  1Z4R A;  1QSR A;  3IGR A;  1IU8 A;  3P2H A;  4NJQ A;  2PJ3 A;  3PBE A;  4M6G A;  3WC7 A;  4M6I A;  4DNC A;  4C7H A;  3R9F A;  2PQ8 A;  1P4N A;  4M3S A;  2POK A;  2XEI A;  4DYO A;  3PFE A;  2JBK A; 
#chains in the Genus database with same CATH homology
 3IU1 A;  2B4D B;  1QSO A;  1MJA A;  4OAD A;  5E96 A;  4A33 A;  2VXK A;  4X5K A;  1BOB A;  1KUY A;  1PUA A;  4U5Y A;  1S3Z A;  2Z3K A;  2CNM A;  2Q4Y A;  4J3G A;  3LD2 A;  4QVT A;  4FD6 A;  3S6H A;  4A2Z A;  4MI4 A;  4YFJ A;  2HQY A;  4JD6 A;  1KUV A;  3TCV A;  4H6U A;  4CAW A;  3FB3 A;  1XF8 A;  3TFY A;  3EFA A;  3PP9 A;  2PDO A;  3EXN A;  1XIX A;  1IB1 E;  1YR0 A;  2ZPA A;  2O28 A;  2VQY A;  2QML A;  3S6G A;  2B58 A;  4JJX A;  4YRH A;  5AG4 A;  4MY3 A;  4PSX A;  3FXT A;  4R57 A;  3KKW A;  4C2Y A;  2X7B A;  3IWG A;  2DPT A;  1V0C A;  3JTK A;  1S7F A;  2I79 A;  2PR8 A;  1I1D A;  3QB8 A;  3V8I A;  1YVK A;  2KCW A;  2B3U A;  2GAN A;  2J8N A;  1MK4 A;  4Q36 A;  2OZH A;  2ZW4 A;  4EVY A;  2Z3O A;  2BEI A;  4MY0 A;  4KVX A;  4H89 A;  3R9G A;  4R87 A;  4ORF A;  4A95 A;  4HKF A;  2ZW6 A;  1M44 A;  1WWZ A;  4CGP A;  3DR8 A;  2FS5 A;  2P6E A;  1Z4E A;  4I49 A;  5G21 A;  1KZF A;  4XPL A;  3F0A A;  4YGO A;  3DDD A;  5F49 A;  5F46 A;  1XMT A;  2Q44 A;  4GS4 A;  4F0X A;  4C68 A;  2B4B A;  1BO4 A;  3UY5 A;  2ATR A;  3TO6 A;  3BJ7 A;  4LX9 A;  1CJW A;  4MFK A;  4JXQ A;  4Q38 A;  3BLN A;  4K30 A;  4OLL A;  3QAH A;  5EC4 A;  2IL4 A;  4BBH A;  3FBU A;  4UWJ A;  4PV6 A;  3EY5 A;  1LRZ A;  4KLV A;  3PGP A;  5G20 A;  4JLY A;  5AG7 A;  3DR6 A;  2VBQ A;  4XPK A;  1YLE A;  4QC6 A;  5H86 A;  5H84 A;  1TIQ A;  1CM0 A;  1ZO0 A;  2YND A;  2JDD A;  4C2X A;  5J8F A;  3FRM A;  2WSA A;  1IID A;  2FIA A;  1MJ9 A;  2Z11 A;  2VZZ A;  4MFZ A;  2Z3L A;  2EVN A;  4MFP A;  5I0C A;  5DWN A;  4UFX A;  5KTD A;  2CY2 A;  2K5T A;  4AVC A;  4KZT A;  2FE7 A;  3GY9 A;  1GHE A;  3D2M A;  1P0H A;  3G8W A;  2Q7B A;  4KSF A;  4CS0 B;  4E2A A;  3BJ8 A;  4KUA A;  3S6F A;  2YGW A;  4CRY B;  2OZU A;  1QSN A;  4PK2 A;  3ZZI A;  3CXS A;  5ISV A;  4KLW A;  2I00 A;  4B12 A;  3K9U A;  4AVA A;  5A28 A;  4A32 A;  3LOD A;  4JXR A;  4B5O A;  5DWM A;  4C7I A;  2ZW5 A;  4A31 A;  4C2Z A;  3I3G A;  4B13 A;  4HNW B;  4CAF A;  1YVO A;  5CNP A;  4XPD B;  3T9Y A;  2B3V A;  2FSR A;  4L89 A;  4MHD A;  2ZXV A;  2FXF A;  2VEZ A;  4R3K A;  4CAE A;  2F5I A;  4UA3 A;  4L8A A;  5F48 A;  3A9L A;  4KOT A;  1XEB A;  1VKC A;  2GE3 A;  2Z0Z A;  4KOU A;  4CYP A;  1M4I A;  1Y7R A;  2ARH A;  3TE4 A;  2R98 A;  5AG5 A;  4LUA A;  2AJ6 A;  4MBU A;  2C27 A;  4U9Y A;  4NCZ A;  3SXO A;  4CYN A;  5KTC A;  2J8M A;  5IB0 A;  3GYA A;  3W91 A;  2Q4V A;  4CGM A;  2CNT A;  2VZY A;  2OZG A;  3GKR A;  3CXQ A;  2G3T A;  1M4G A;  1ON0 A;  2OB0 A;  5HMN A;  4AG7 A;  4UCP A;  4F6A A;  2ZW7 A;  2FIW A;  1J4J A;  4R3L A;  4B5P B;  3D2P A;  3H4Q A;  4BMH A;  4HNX B;  1XE4 A;  4OAE A;  4MFQ A;  3TOA A;  3E0K A;  1I12 A;  1B87 A;  4IUS A;  4NEX A;  5FVJ A;  2OU2 A;  2BUE A;  3WR7 A;  4KOX A;  4KVM E;  4XNH B;  4KOW A;  1YRE A;  3DSB A;  3N7Z A;  3W6X A;  4IF5 A;  3VWE A;  4UWI A;  4PK3 A;  3B8G A;  4UCN A;  2Y0M A;  4RI1 A;  3NE7 A;  1S60 A;  3SHP A;  4CYO A;  1NE9 A;  5JQ4 A;  4ZBG A;  2D4O A;  4UFV A;  4CYQ A;  1M4D A;  2WUU A;  5AGE A;  2PSW A;  2JLM A;  2P6F A;  3FIX A;  4KOV A;  4UFW A;  1L0C A;  5IX3 A;  4XPD C;  1OZP A;  2Z3P A;  5G1Z A;  3TO7 A;  3ZJ0 A;  1YK3 A;  3R9E A;  3I9S A;  1R57 A;  2JEV A;  2OH1 A;  4AVB A;  4B14 A;  4E8O A;  2Z3N A;  4AB7 A;  5J8C A;  3S6K A;  4KSA A;  3C26 A;  3IWE A;  3D3S A;  2J8R A;  5C82 A;  1UFH A;  2PC1 A;  3VWD A;  3TOB A;  3PZJ A;  4UCM A;  4MFL A;  4F0Y A;  2BSW A;  3RYO A;  3DNS A;  5EBV A;  2DXQ A;  4KOY A;  4M85 A;  1WK4 A;  5C88 A;  4CGL A;  3W6S A;  3TT2 A;  3CXP A;  5HH1 A;  3SXN A;  2PRB A;  3OWC A;  1N71 A;  2REF A;  4B5P A;  4U9Z A;  4A30 A;  1S5K A;  1RXT A;  4CAX A;  2FL4 A;  4Y49 C;  2Q0Y A;  1SQH A;  1NMT A;  2CNS A;  4XNH C;  4ONU A;  1I21 A;  3D8P A;  4NF1 A;  3R96 A;  1Z9U A;  4MJ8 A;  2R7H A;  4MFJ A;  1YX0 A;  3P2F A;  1MJB A;  4RS2 A;  2PR1 A;  4R9M A;  2D4P A;  4NXY A;  4NSQ A;  1IYL A;  4E0A A;  4JWP A;  1RO5 A;  5KTA A;  3EO4 A;  4FD5 A;  3JUW A;  3MGD A;  2Z3M A;  2R1I A;  1Y9K A;  2EUI A;  1QSM A;  1YGH A;  2RC4 A;  4PSW A;  5F47 A;  2WPW A;  4HNY B;  2R8V A;  1IIC A;  4KVO E;  2P0W A;  2HV2 A;  1KUX A;  1Y9W A;  4FD7 A;  4B10 A;  1S7L A;  3FYN A;  2DPS A;  5A27 A;  1IYK A;  4II9 A;  1K4J A;  3H5Z A;  4KOS A;  2JDC A;  4Y49 B;  4FD4 A;  4QUS A;  2YNC C;  3R95 A;  2CXA A;  2YNC A;  4CAV A;  2AE6 A;  1M1D A;  2B5G A;  2QEC A;  5AG6 A;  1QST A;  3JVN A;  3TTH A;  2GIV A;  1Q2C A;  3R1K A;  2FCK A;  2A4N A;  4KS9 A;  5G22 A;  3TO9 A;  4AG9 A;  2B4D A;  2BL1 A;  2G3A A;  4CRZ B;  4QBJ A;  3F5B A;  4UBR A;  4QB9 A;  2NMT A;  2FT0 A;  1S7N A;  4B11 A;  5JPH A;  1Q2Y A;  2H5M A;  4ZGY B;  4CGN A;  4KOR A;  1B6B A;  4KUB A;  1VHS A;  3FNC A;  2VI7 A;  1FY7 A;  1NSL A;  1S7K A;  1U6M A;  2HUZ A;  2P6G A;  3EC4 A;  3IU2 A;  1Q2D A;  2YNE A;  5GCN A;  2QIR A;  5BWA B;  1PU9 A;  4CGO A;  2G0B A;  2Z10 A;  2REE A;  3G3S A;  5IV0 A;  2Q04 A;  3F8K A;  3T90 A;  2B5G B;  4H6Z A;  1Z4R A;  1QSR A;  3IGR A;  3P2H A;  4DNC A;  4C7H A;  3R9F A;  2PQ8 A;  1P4N A;  4M3S A;  2WPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...