4BBOA

Crystal structure of core-bradavidin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
113
structure length
113
Chain Sequence
b'QSVNWTWTNQYGSTLAITSFNSNTGAITGTYTNNAANSCDEGKPQGVTGWLAYGNTGTAISFSVNFLGCGSTTVWTGQLNNATGFQGLWYLSLAEAVAWNGISAGADTFTFSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BLR5658 PROTEIN
publication title Crystal Structure of Core-Bradavidin
rcsb
source organism Bradyrhizobium japonicum
molecule tags Biotin-binding protein
total genus 23
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 4bboA00
4IRWA 4GGRA 1RAVA 2IZHB 5IRAA 2IZBA 1RXHA 2IZCB 1NBXA 1VWKB 2A5BA 2IZIA 4GGZA 2FHNX 4CPHB 4Z2VA 1N43A 2GH7A 4OKAA 1STSB 2FHLA 1VYOA 1MK5A 1VWGB 4Y5DA 2RTAA 3FDCA 1N4JA 3RE5A 3RDOA 1SWGA 4BBOA 1LCWA 1SREA 4Z2PA 1N9MA 4DNEA 1SLEB 2RTIB 1VWJB 2IZEB 1WBIA 2Y3FA 1NDJA 2Y32A 4Z27A 1NQMA 2A5CA 1VWDB 2IZFB 1AVEA 2RTFB 3X00A 1SWAA 4CPFA 3SZHA 1VWMB 3T2WA 1VWEB 1HXZA 1SWRA 2RTGB 2MF6A 2OFBA 3VGWA 5IRUA 4BJ8A 1KL4A 3VHIA 1HXLA 1VWNB 1SRHA 3RDSA 3MM0A 4GDAA 3T6LA 4BX5B 1MOYA 2UZ2A 2WPUA 1MEPA 2IZAA 3T6FA 1MM9A 5B5FA 1SLDB 4GJVA 1RXJA 4EKVA 3WZQA 3MG5A 1SWEA 2RTNB 3RY2A 4U46A 1LCVA 1RSTB 3SZJA 3WYQA 3WZOA 4BX6A 1NQNA 2RTMA 1N9YA 1Y55X 5CHKA 5K67A 2C1SA 1VWPB 1VWQB 1SWSA 2Y3EA 5B5GA 1SWOA 1SWQA 4Z28A 2IZJA 1DF8A 4GGTA 1SWJA 3RE6A 2OF9A 2RTDB 4BX5A 4CPHA 1SRJA 1SWKA 4JO6A 2RTHB 2UYWA 1LELA 1SRFA 4Z2OA 1SRGA 1LCZA 1SWPA 1AVDA 2RTQB 4GJSA 3SZIA 1VWLB 1SWTA 2C4IA 1SWLA 2IZKA 3RDQA 1VWHB 1Y53X 2IZDB 1LUQA 2RTLA 4GD9A 4CPEA 2A8GA 2F01A 4YVBA 4Y59A 5IRWA 3EW1A 1SWHA 1SLGB 1SWDA 3RDXA 1RXKA 2RTCB 2RTJA 2JGSA 4BX7B 1SWBA 1VWIB 3RDMA 3VHHA 2QCBA 5CSEA 4JNJA 4CPIA 1SWNA 1LDQA 2C1QA 3T2XA 1I9HA 2IZLB 3RDUA 1VWRB 2RTEB 1HY2A 1HQQA 1N7YA 1SWCA 1SRIA 2RTOB 1PTSA 3WZPA 2BC3A 5L3YA 2RTBB 2RTKA 2RTRB 5JD2A 1SLFB 1VWFB 1IJ8A 1VWBB 1LDOA 2CAMA 1VWCB 3PK2A 3WYPA 5K68A 2OF8A 2AVIA 1STRB 1STPA 1VWOB 1KL3A 4JHQA 3RY1A 3WZNA 4Z6JA 1SWUA 2RTPB 3VHMA 4BCSA 4BX7A 1KFFA 1VWAB 2IZGB 4BX6B 4I60A 1Y52X 1RSUB 2G5LA 2ZSCA 1NC9A 1SWFA 3EW2A 5F2BA 1KL5A 2OFAA
chains in the Genus database with same CATH superfamily
1GX9A 4IRWA 3ZW0A 2CZUA 2IZHB 1OPAA 1D3SA 2YMSA 5DG4A 3HOLA 3FR4A 4I3BA 1OBUA 4CPHB 1VWKB 3P6HA 1OEJA 3CKGA 4GETA 4EXZA 1BEBA 2AT8X 4Z2VA 1N43A 1SY0A 1YWDA 1DC9A 1JYJA 2W2AA 1X8QA 4YFQA 5HTEA 3FR5A 1N4JA 2X8TA 1LPJA 3RE5A 1ADLA 1FJ1E 1QY1A 1S2PA 3RDOA 4Z2PA 3FLLA 4O9SA 5BVQA 2RTIB 2NNEA 1B4MA 1VPRA 1VWJB 4ORRA 5F7GA 4XMCA 2Y3FA 4O4XA 1G5WA 2Y32A 1FE3A 2RD7C 4YCHA 2A5CA 5HZ9A 1X8NA 4GH7A 2L68A 3VG5A 3ZW1A 1VWMB 1LFOA 1QY0A 4ORUA 3T2WA 3VG6A 2RA6A 1VWEB 1E06A 2X4MA 1OPBA 3BU1A 3SLJA 4ID2A 4Y0SA 1ZNKA 2RTGB 3IA8A 1ICNA 3G7XA 1ZNLA 4IB6A 3UEWA 3VGWA 2G78A 4FBRA 3VHIA 1HXLA 4Y0RA 4AYHA 4WHIA 1JBHA 4O3XB 5FFHA 4I9RA 4NNSA 3BSZE 5FENA 3RWXA 4QYPA 2IZAA 3C77X 1MM9A 1I06A 1YWCA 2LBAA 3FIDA 5HZ6A 4YFPA 3U03A 5D48A 3FENA 4TJZA 4MVEA 1ZRYA 3WBGA 1XCAA 4IMOA 1W5RA 3MVFA 5B10O 2Z4IA 5AJBA 4BQUA 3APXA 4NV8A 4D6BA 3EMMA 1OBQA 1CBRA 4BX6A 4XMHA 1X71A 4YH0A 1VYFA 1PBOA 1Y55X 2QOSC 2ZAGA 2C1SA 1VWPB 4FBVA 4QAEA 3BS2A 1TOWA 2MHDA 1SWOA 2Y3EA 1SWQA 3EC5A 4O3YA 4O3ZA 5EEDA 3GAQA 3PECA 1PEEA 1SWJA 1A3YA 1EPAA 1KT4A 1MX7A 2ACPX 2AT3X 2W2FA 3WJFA 5KHPA 2AF5A 2ANSA 5KICA 1SRGA 1OSPO 2Q39A 4CDFA 3CBSA 3BRNA 2BLGA 3PEDA 4IB8A 1HBQA 1AVGI 4QGXA 1JJXA 1SWLA 1SY1A 2BT9A 2XKLA 3EBWA 3EYCA 3MX7A 2IZDB 1LUQA 5HA1A 3RDQA 4AZNA 3OJYC 3ELZA 4GD9A 2X55A 2A8GA 3O19A 2HMBA 4BVMA 4YVBA 3KFGA 4ZHGA 3KFFA 1E5PA 4NYRA 5CE4A 2OZQA 1U0XA 1CBIA 1FDQA 1OBPA 1QFTA 1SWHA 3BY0A 4I6SA 2ACOA 2RTJA 4A60A 4BX7B 4ZH9A 2CM9A 4OMXA 4JNJA 2KD2A 4ARHA 5HA0A 1DFVA 1IFCA 3T2XA 3EBKA 2AT5X 1VWRB 2RTEB 1EIIA 2VDFA 1IFBA 1JYDA 4I9SA 4MISA 3P6EA 1GXAA 2HLVA 3NADA 3WJCA 3HPEA 1WUBA 2OVAA 1BSYA 2AT0X 1U18A 3D97A 2O62A 2QM9A 2FS6A 4ORXA 5K68A 4KC8A 1QY2A 3FEPA 1STPA 3D9WA 1XKIA 5KIDA 3KVNA 3RZYA 1SWUA 4L1NA 3QKGA 3VE2A 4ZGUA 3NX1A 2F73A 4BX7A 4DCBA 1KFFA 2BS6A 3C78X 1VWAB 2OL6O 3C76X 2Q2PA 4YGZA 2X34A 4GZVA 1I05A 2G5LA 2ZSCA 1SWFA 5F2BA 3WZPA 1KL5A 4NYQA 4GGRA 2KW1A 1KT3A 4GE1A 2IZBA 4EEJA 4WFVA 2A5BA 1HMTA 2IZIA 2FKGA 4GGZA 2FHNX 4HPCA 4LKPA 1K24A 4IBAA 4XMEA 3RBYA 3D95A 3L4RA 4I3DA 4OKAA 1VYOA 1MK5A 1LIEA 1YP7A 2EU7X 3HWDA 3P24A 3PH6A 4Y5DA 1GKAB 2FKJA 2CBSA 1KQXA 1SWGA 2FWVA 1QQSA 2ASNX 3PH5A 2HZRA 5L8NA 4DNEA 3WOVA 3S5VA 3CQNA 1ZNHA 2GJ5A 4A8ZA 4AZMA 1WBIA 4A1HA 1YIVA 2RCQA 3NQ3A 5HCEC 4TQ2A 4YGGA 2RTFB 3RSWA 2I5ZO 5B3MO 4CPFA 3ELXA 1O1UA 4NNTA 4QZTA 3ZZVA 4HPDA 1YUPA 3VPJE 1ZNDA 2FRSA 3FYFA 1LICA 5L8IA 3CBCA 1SRHA 1SXXA 4GDAA 2NNQA 4KIIA 2WSJA 2RN4A 3RDSA 4CDCA 1GKAA 5K06A 3FA9A 3QQ2A 4FQBB 3WJEA 2GC9A 4QYNA 3ZI8A 3APUA 1JJUA 3P6FA 4L3RA 5FAZA 3MG5A 1JV4A 1SWEA 2RTNB 3FR2A 3K3LA 1QABE 1KQWA 4JGLA 4QRLA 4U46A 1TVQA 1QG5A 5JR8A 3FELA 5B2AO 1KGLA 4WBKA 4HPAA 4NV7A 2RTMA 5DPQA 1N9YA 5H8TA 3VG3A 3TGAA 1IIUA 2A3FX 3B2LA 4RUNA 4PSQA 1DZJA 5EEEA 4GUZA 3SLTA 2IZJA 1N0SA 1SXYA 1TW4A 4MEEA 1JJJA 4CPHA 4MVLA 2HZQA 2Q2MA 1UZ2X 4EQAC 2BHVA 4GNWA 4EFGA 2GTLN 1SWPA 2RTQB 4QZUA 3SZIA 1BRPA 2NNDA 1SY3A 5AEOA 1IKJA 1VWLB 1BWYA 2PI3O 4N7CA 1MX8A 3FMZA 1GX8A 1A18A 4ORWA 4U8UN 2A13A 2F01A 4LZVA 3KZAA 3N91A 3APWA 4IAWA 4GK9A 4CSBA 4AZRA 3AKNA 1RBPA 1SLGB 3RDXA 5H9AA 4M6SA 4TKHA 1QFVA 1HQPA 2QCBA 3AKMA 4AW8A 3ZW2A 4I95A 4CPIA 3D96A 2OFRX 1SWNA 3ZWEA 1CJ5A 2C1QA 2OYBO 1I9HA 3RDUA 3LHNA 3LV4A 2Q9SA 1HY2A 2KT4B 1SWCA 4YBUA 1DZPA 3UEUA 4LQZA 1GT1A 1PMPA 2A2UA 2Z4HA 2AL0X 2RTBB 2RTRB 1MDCA 3OBLA 5JD2A 1SLFB 1YWAA 3U0DA 1IJ8A 3F9DA 3JS1A 1LDOA 2CAMA 3P02A 3PK2A 2JMBA 3WJDA 3T1DA 1FTPA 1U17A 2A0AA 4ZHDA 3U9PC 3B2KA 4KH8A 2X56A 1ACDA 1NP4A 5LJCA 2GTLM 2WEXA 4QNIA 1ICMA 4O3WA 1KT5A 2FT9A 1GGLA 1Y52X 3EW2A 1KT7A 1NC9A 1E00A 2OFAA 2FR2A 3STKA 4O4UA 4U8UM 1MUPA 3CR6A 2OVSA 3CQRA 5B11O 1LNMA 2JU7A 5F1EA 5IRAA 3STNA 4QGVA 1A57A 2IZCB 1NBXA 2JN3A 3PP6A 4PJ2A 3UAQA 2L5PA 3BLGA 5FQ8E 4ALBA 4YGHA 4ZJ0A 1BSOA 1DZKA 1X89A 1VWGB 3DTQA 4AZOA 3VG4A 4QQ1A 5FQ7E 4YBPA 2XSTA 1UYOX 4TKBA 1AELA 2LB6A 4ZGFA 1LCWA 3BDRA 1JZUA 1SLEB 3D4RA 2RQ0A 1CBQA 2IZEB 1K3BA 4GKCA 3HOEA 4R0BA 1HN2A 1NDJA 3EM0A 2OVDA 4Z27A 1NQMA 4LKTA 1VWDB 3TZSA 4HPBA 1AVEA 4RUUA 2JU8A 3X00A 1BM5A 1Y0GA 3SZHA 2OL7A 1DF3A 3FA8A 4AZQA 1SWRA 1G85A 4ORYA 1EI5A 1O1VA 1DZMA 2OFBA 2YG2A 2DJFA 3HK1A 4FGIB 5IRUA 1VYGA 4TNNA 3B2IA 4I3CA 1FELA 3APVA 4YKOA 3WVMA 4O4SA 2Q4NA 3T6LA 3LTWA 1GT4A 3B2JA 1EALA 1FENA 1GM6A 2UZ2A 2WPUA 4UU3A 1LKEA 2HNXA 1SA8A 2MO5A 5B5FA 1SLDB 5IO7A 2AH7X 4ALOA 3TGBA 2POAA 3I0AA 2PY1A 2FR3A 5EDBA 4EKVA 3I17A 2G7BA 3UEVA 1T8VA 1TXLA 1EUOA 3RY2A 1Z24A 4Y0PA 4NLIA 3NR3A 4D6AA 3WYQA 3CMPA 2N93A 3PPTA 3WZOA 2OY1O 5B27A 1HMRA 1NQNA 1GT3A 1MVGA 2R74A 4MVIA 2WQAE 3UEXA 3TGCA 1P6PA 5HAEA 1VWQB 1SWSA 3ZW0B 1ALBA 1EPBA 5BVSA 1EW3A 2WUTA 4KCAA 3RE6A 3O2YA 2OF9A 1YWBA 2RTDB 1EXSA 2K62A 2DJGA 4JO6A 4YFRA 3F6ZB 2UYWA 1LELA 3PDFA 5HCCC 2QOMA 3VG2A 1OEEA 1YP6A 1ERXA 4GJSA 2KTSA 2AT6X 2MM3A 2OY8A 2C4IA 3NQKA 3WXQA 2IZKA 1G7NA 1VWHB 1Y53X 4GU8A 2RTLA 3FA7A 1TOUA 3BU9A 4Y59A 4HFOA 1X8UA 5IRWA 5AQ6A 3EW1A 4IB9A 2M4LA 2P8GA 1SWDA 1KOIA 1RXKA 2CM4A 2WR6A 4ZCBA 3MBTA 3RKGA 3ZW1B 1VWIB 5FQ6E 3RDMA 3S26A 3VHHA 3H3IA 4ZHHA 1CBSA 4AZPA 4ZH6A 2K23A 4OEMA 5HZ8A 1LDQA 2X32A 3AEHA 2IZLB 5D8JA 5D4AA 4GRJA 4INNA 2OY7A 2RCTA 2OFMX 1EIOA 1PTSA 4CV7A 2CBRA 2BC3A 2BS5A 1D2UA 1Y9LA 4CDEA 5L3YA 3B2HA 1QWDA 4GDZA 5IO5A 1VWBB 2MJIA 3Q6LA 3FW4A 3WYPA 1KZWA 4IMNA 2I5VO 1HMSA 3IFBA 2OF8A 2X8SA 3NX2A 1KZXA 1STRB 1VWOB 2AMMX 1CRBA 5AJCA 4ZR2A 5D45A 5HCDC 2WQ9A 4Y0QA 3WZNA 3VHMA 3SOTA 5D47A 3SLOA 3S5XA 3OE3A 2BSZA 4U9CA 2MWHA 2QO4A 5LJGA 4BX6B 4I60A 5BYPA 1S44A 1I04A 3TF6A 2G79A 3NPOA 4QGWA 3P6CA 2GTFX 1O8VA 4N7DA 5F6BA 3S60A 3ZUIA 2CZTA 1RAVA 2QMIA 1S7DA 3P6DA 5H9KA 1IKEA 4IAXA 2E4JA 5B29A 2FTBA 2JOZA 4TLJA 5F58A 1RXHA 4A1YA 4DQ3A 5C0NA 2FLJA 5H9NA 3NQ9A 5LKFA 4FBOA 3O22A 3HWEA 4ON1A 2VFCA 1SXWA 2L9CA 2GH7A 1STSB 2FHLA 2RTAA 1OEKA 2LBVA 3VU1A 4MIRA 3FDCA 3FW5A 4KT5A 1UREA 3DSZA 4BBOA 3HTYA 1SREA 1N9MA 2W2BA 1GX3A 3F8AA 1LIDA 4XMFA 3HWGA 1I78A 1GT5A 4DQ4A 3FA6A 1JMXA 1Y9TA 2JU3A 4OS0A 1JQPA 1SY2A 2IZFB 4ZHFA 1SWAA 1X8OA 3PQUA 4TKJA 2ZAIA 3WJBA 1HXZA 4LZUA 4ML7B 2IFBA 4NP1A 2FGSA 4COTA 5HZ5A 3ZUOA 4HWMA 1H91A 2MF6A 2LFOA 1SXUA 4BJ8A 5LJBA 1KL4A 2FS7A 3JQOA 1VWNB 2LKKA 4ZHCA 4M7MA 3GE2A 3ZQ3A 3MM0A 4BX5B 2HKDA 2OL8O 1MOYA 2WEWA 2G8CO 5F6ZA 1MEPA 2DM5A 2LA7A 4C5PA 1JMZA 3T6FA 1HBPA 4GJVA 4YDBA 4ODDA 5L8OA 1RLBE 1RXJA 2JW1A 2L67A 5CYBA 3WZQA 1W6FA 1X8PA 5HTDA 1BBPA 2NP1A 4CDDA 4OS3A 3Q34A 1LCVA 2HYSA 1LIBA 1RSTB 3P6GA 4GNYA 3SZJA 4EDEA 2R73A 1A2DA 2X8FA 3FEKA 3WJGA 4ZFXA 5HBSA 5CHKA 2QO6A 5K67A 1PBYA 1B0OA 4BGFA 2GTLO 5B5GA 4CK4A 4Z28A 5HWZA 5LJEA 1DF8A 4YDAA 1I4UA 4GGTA 1LF7A 4BX5A 1ZNGA 1SRJA 1B56A 4O49A 4YCEA 1SWKA 1NGLA 1BJ7A 2RTHB 1LIFA 1SRFA 5HZQA 4Z2OA 1LCZA 4XMDA 4U8UO 1NP1A 1ERBA 1AVDA 3KFHA 4XMGA 3V8UA 5BVTA 1DV9A 4YKMA 1SWTA 5LKEA 3PQSA 3BX8A 5LJHA 5IXGA 4IB7A 2A2GA 4CPEA 5LJDA 1AQBA 2OY5O 4NW4A 1ZNEA 5EDCA 3VE1A 3OD9A 2WWPA 2R56A 5LJKA 1R0UA 1PM1X 2RTCB 3AUMO 2JGSA 1BLRA 1SWBA 3KFIA 1EQDA 5CSEA 4K19A 5EPQA 4O4OA 2AKQA 2ALLX 1SMPI 1E2TA 1W4TA 4MVKA 3STMX 1G74A 1HQQA 1N7YA 5EZ2A 1KT6A 1FEMA 5IO6A 1SRIA 1IW2A 3KQ0A 2RTOB 1ML7A 3CWKA 2VFBA 1L6MA 3BX7A 3E3CA 4UU2A 2F09A 1KXOA 2OVEA 1BRQA 1JIWI 2RTKA 3VG7A 1VWFB 3SAOA 4WFUA 1VWCB 4OS8A 3NP1A 4ES7A 4U3QA 1UYNX 2KTDA 1AB0A 3HWFA 2X45A 2AVIA 4IABA 2X46A 2QO5A 1BSQA 4YMYA 1KL3A 4JHQA 3RY1A 4Z6JA 1T68X 2RTPB 4KC7A 4BOEA 4ORSA 4OELA 4OMWA 4BCSA 3CKFA 2IZGB 4NLJA 1RSUB 3NBXX 3FIQA 1T0VA 1B8EA 5H9LA 4B55A 1E02A 3JSQA
chains in the Genus database with same CATH topology
4IRWA 4GGRA 1RAVA 2IZHB 5IRAA 2IZBA 1RXHA 2IZCB 1NBXA 1VWKB 2A5BA 2IZIA 4GGZA 2FHNX 4CPHB 4Z2VA 1N43A 2GH7A 4OKAA 1STSB 2FHLA 1VYOA 1MK5A 1VWGB 4Y5DA 2RTAA 3FDCA 1N4JA 3RE5A 3RDOA 1SWGA 4BBOA 1LCWA 1SREA 4Z2PA 1N9MA 4DNEA 1SLEB 2RTIB 1VWJB 2IZEB 1WBIA 2Y3FA 1NDJA 2Y32A 4Z27A 1NQMA 2A5CA 1VWDB 2IZFB 1AVEA 2RTFB 3X00A 1SWAA 4CPFA 3SZHA 1VWMB 3T2WA 1VWEB 1HXZA 1SWRA 2RTGB 2MF6A 2OFBA 3VGWA 5IRUA 4BJ8A 1KL4A 3VHIA 1HXLA 1VWNB 1SRHA 3RDSA 3MM0A 4GDAA 3T6LA 4BX5B 1MOYA 2UZ2A 2WPUA 1MEPA 2IZAA 3T6FA 1MM9A 5B5FA 1SLDB 4GJVA 1RXJA 4EKVA 3WZQA 3MG5A 1SWEA 2RTNB 3RY2A 4U46A 1LCVA 1RSTB 3SZJA 3WYQA 3WZOA 4BX6A 1NQNA 2RTMA 1N9YA 1Y55X 5CHKA 5K67A 2C1SA 1VWPB 1VWQB 1SWSA 2Y3EA 5B5GA 1SWOA 1SWQA 4Z28A 2IZJA 1DF8A 4GGTA 1SWJA 3RE6A 2OF9A 2RTDB 4BX5A 4CPHA 1SRJA 1SWKA 4JO6A 2RTHB 2UYWA 1LELA 1SRFA 4Z2OA 1SRGA 1LCZA 1SWPA 1AVDA 2RTQB 4GJSA 3SZIA 1VWLB 1SWTA 2C4IA 1SWLA 2IZKA 3RDQA 1VWHB 1Y53X 2IZDB 1LUQA 2RTLA 4GD9A 4CPEA 2A8GA 2F01A 4YVBA 4Y59A 5IRWA 3EW1A 1SWHA 1SLGB 1SWDA 3RDXA 1RXKA 2RTCB 2RTJA 2JGSA 4BX7B 1SWBA 1VWIB 3RDMA 3VHHA 2QCBA 5CSEA 4JNJA 4CPIA 1SWNA 1LDQA 2C1QA 3T2XA 1I9HA 2IZLB 3RDUA 1VWRB 2RTEB 1HY2A 1HQQA 1N7YA 1SWCA 1SRIA 2RTOB 1PTSA 3WZPA 2BC3A 5L3YA 2RTBB 2RTKA 2RTRB 5JD2A 1SLFB 1VWFB 1IJ8A 1VWBB 1LDOA 2CAMA 1VWCB 3PK2A 3WYPA 5K68A 2OF8A 2AVIA 1STRB 1STPA 1VWOB 1KL3A 4JHQA 3RY1A 3WZNA 4Z6JA 1SWUA 2RTPB 3VHMA 4BCSA 4BX7A 1KFFA 1VWAB 2IZGB 4BX6B 4I60A 1Y52X 1RSUB 2G5LA 2ZSCA 1NC9A 1SWFA 3EW2A 5F2BA 1KL5A 2OFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IRW A;  4GGR A;  1RAV A;  2IZH B;  5IRA A;  2IZB A;  1RXH A;  2IZC B;  1NBX A;  1VWK B;  2A5B A;  2IZI A;  4GGZ A;  2FHN X;  4CPH B;  4Z2V A;  1N43 A;  2GH7 A;  4OKA A;  1STS B;  2FHL A;  1VYO A;  1MK5 A;  1VWG B;  4Y5D A;  2RTA A;  3FDC A;  1N4J A;  3RE5 A;  3RDO A;  1SWG A;  4BBO A;  1LCW A;  1SRE A;  4Z2P A;  1N9M A;  4DNE A;  1SLE B;  2RTI B;  1VWJ B;  2IZE B;  1WBI A;  2Y3F A;  1NDJ A;  2Y32 A;  4Z27 A;  1NQM A;  2A5C A;  1VWD B;  2IZF B;  1AVE A;  2RTF B;  3X00 A;  1SWA A;  4CPF A;  3SZH A;  1VWM B;  3T2W A;  1VWE B;  1HXZ A;  1SWR A;  2RTG B;  2MF6 A;  2OFB A;  3VGW A;  5IRU A;  4BJ8 A;  1KL4 A;  3VHI A;  1HXL A;  1VWN B;  1SRH A;  3RDS A;  3MM0 A;  4GDA A;  3T6L A;  4BX5 B;  1MOY A;  2UZ2 A;  2WPU A;  1MEP A;  2IZA A;  3T6F A;  1MM9 A;  5B5F A;  1SLD B;  4GJV A;  1RXJ A;  4EKV A;  3WZQ A;  3MG5 A;  1SWE A;  2RTN B;  3RY2 A;  4U46 A;  1LCV A;  1RST B;  3SZJ A;  3WYQ A;  3WZO A;  4BX6 A;  1NQN A;  2RTM A;  1N9Y A;  1Y55 X;  5CHK A;  5K67 A;  2C1S A;  1VWP B;  1VWQ B;  1SWS A;  2Y3E A;  5B5G A;  1SWO A;  1SWQ A;  4Z28 A;  2IZJ A;  1DF8 A;  4GGT A;  1SWJ A;  3RE6 A;  2OF9 A;  2RTD B;  4BX5 A;  4CPH A;  1SRJ A;  1SWK A;  4JO6 A;  2RTH B;  2UYW A;  1LEL A;  1SRF A;  4Z2O A;  1SRG A;  1LCZ A;  1SWP A;  1AVD A;  2RTQ B;  4GJS A;  3SZI A;  1VWL B;  1SWT A;  2C4I A;  1SWL A;  2IZK A;  3RDQ A;  1VWH B;  1Y53 X;  2IZD B;  1LUQ A;  2RTL A;  4GD9 A;  4CPE A;  2A8G A;  2F01 A;  4YVB A;  4Y59 A;  5IRW A;  3EW1 A;  1SWH A;  1SLG B;  1SWD A;  3RDX A;  1RXK A;  2RTC B;  2RTJ A;  2JGS A;  4BX7 B;  1SWB A;  1VWI B;  3RDM A;  3VHH A;  2QCB A;  5CSE A;  4JNJ A;  4CPI A;  1SWN A;  1LDQ A;  2C1Q A;  3T2X A;  1I9H A;  2IZL B;  3RDU A;  1VWR B;  2RTE B;  1HY2 A;  1HQQ A;  1N7Y A;  1SWC A;  1SRI A;  2RTO B;  1PTS A;  3WZP A;  2BC3 A;  5L3Y A;  2RTB B;  2RTK A;  2RTR B;  5JD2 A;  1SLF B;  1VWF B;  1IJ8 A;  1VWB B;  1LDO A;  2CAM A;  1VWC B;  3PK2 A;  3WYP A;  5K68 A;  2OF8 A;  2AVI A;  1STR B;  1STP A;  1VWO B;  1KL3 A;  4JHQ A;  3RY1 A;  3WZN A;  4Z6J A;  1SWU A;  2RTP B;  3VHM A;  4BCS A;  4BX7 A;  1KFF A;  1VWA B;  2IZG B;  4BX6 B;  4I60 A;  1Y52 X;  1RSU B;  2G5L A;  2ZSC A;  1NC9 A;  1SWF A;  3EW2 A;  5F2B A;  1KL5 A;  2OFA A; 
#chains in the Genus database with same CATH topology
 1GX9 A;  4IRW A;  3ZW0 A;  2CZU A;  2IZH B;  1OPA A;  1D3S A;  2YMS A;  5DG4 A;  3HOL A;  3FR4 A;  4I3B A;  1OBU A;  4CPH B;  1VWK B;  3P6H A;  1OEJ A;  3CKG A;  4GET A;  4EXZ A;  1BEB A;  2AT8 X;  4Z2V A;  1N43 A;  1SY0 A;  1YWD A;  1DC9 A;  1JYJ A;  2W2A A;  1X8Q A;  4YFQ A;  5HTE A;  3FR5 A;  1N4J A;  2X8T A;  1LPJ A;  3RE5 A;  1ADL A;  1FJ1 E;  1QY1 A;  1S2P A;  3RDO A;  4Z2P A;  3FLL A;  4O9S A;  5BVQ A;  2RTI B;  2NNE A;  1B4M A;  1VPR A;  1VWJ B;  4ORR A;  5F7G A;  4XMC A;  2Y3F A;  4O4X A;  1G5W A;  2Y32 A;  1FE3 A;  2RD7 C;  4YCH A;  2A5C A;  5HZ9 A;  1X8N A;  4GH7 A;  2L68 A;  3VG5 A;  3ZW1 A;  1VWM B;  1LFO A;  1QY0 A;  4ORU A;  3T2W A;  3VG6 A;  2RA6 A;  1VWE B;  1E06 A;  2X4M A;  1OPB A;  3BU1 A;  3SLJ A;  4ID2 A;  4Y0S A;  1ZNK A;  2RTG B;  3IA8 A;  1ICN A;  3G7X A;  1ZNL A;  4IB6 A;  3UEW A;  3VGW A;  2G78 A;  4FBR A;  3VHI A;  1HXL A;  4Y0R A;  4AYH A;  4WHI A;  1JBH A;  4O3X B;  5FFH A;  4I9R A;  4NNS A;  3BSZ E;  5FEN A;  3RWX A;  4QYP A;  2IZA A;  3C77 X;  1MM9 A;  1I06 A;  1YWC A;  2LBA A;  3FID A;  5HZ6 A;  4YFP A;  3U03 A;  5D48 A;  3FEN A;  4TJZ A;  4MVE A;  1ZRY A;  3WBG A;  1XCA A;  4IMO A;  1W5R A;  3MVF A;  5B10 O;  2Z4I A;  5AJB A;  4BQU A;  3APX A;  4NV8 A;  4D6B A;  3EMM A;  1OBQ A;  1CBR A;  4BX6 A;  4XMH A;  1X71 A;  4YH0 A;  1VYF A;  1PBO A;  1Y55 X;  2QOS C;  2ZAG A;  2C1S A;  1VWP B;  4FBV A;  4QAE A;  3BS2 A;  1TOW A;  2MHD A;  1SWO A;  2Y3E A;  1SWQ A;  3EC5 A;  4O3Y A;  4O3Z A;  5EED A;  3GAQ A;  3PEC A;  1PEE A;  1SWJ A;  1A3Y A;  1EPA A;  1KT4 A;  1MX7 A;  2ACP X;  2AT3 X;  2W2F A;  3WJF A;  5KHP A;  2AF5 A;  2ANS A;  5KIC A;  1SRG A;  1OSP O;  2Q39 A;  4CDF A;  3CBS A;  3BRN A;  2BLG A;  3PED A;  4IB8 A;  1HBQ A;  1AVG I;  4QGX A;  1JJX A;  1SWL A;  1SY1 A;  2BT9 A;  2XKL A;  3EBW A;  3EYC A;  3MX7 A;  2IZD B;  1LUQ A;  5HA1 A;  3RDQ A;  4AZN A;  3OJY C;  3ELZ A;  4GD9 A;  2X55 A;  2A8G A;  3O19 A;  2HMB A;  4BVM A;  4YVB A;  3KFG A;  4ZHG A;  3KFF A;  1E5P A;  4NYR A;  5CE4 A;  2OZQ A;  1U0X A;  1CBI A;  1FDQ A;  1OBP A;  1QFT A;  1SWH A;  3BY0 A;  4I6S A;  2ACO A;  2RTJ A;  4A60 A;  4BX7 B;  4ZH9 A;  2CM9 A;  4OMX A;  4JNJ A;  2KD2 A;  4ARH A;  5HA0 A;  1DFV A;  1IFC A;  3T2X A;  3EBK A;  2AT5 X;  1VWR B;  2RTE B;  1EII A;  2VDF A;  1IFB A;  1JYD A;  4I9S A;  4MIS A;  3P6E A;  1GXA A;  2HLV A;  3NAD A;  3WJC A;  3HPE A;  1WUB A;  2OVA A;  1BSY A;  2AT0 X;  1U18 A;  3D97 A;  2O62 A;  2QM9 A;  2FS6 A;  4ORX A;  5K68 A;  4KC8 A;  1QY2 A;  3FEP A;  1STP A;  3D9W A;  1XKI A;  5KID A;  3KVN A;  3RZY A;  1SWU A;  4L1N A;  3QKG A;  3VE2 A;  4ZGU A;  3NX1 A;  2F73 A;  4BX7 A;  4DCB A;  1KFF A;  2BS6 A;  3C78 X;  1VWA B;  2OL6 O;  3C76 X;  2Q2P A;  4YGZ A;  2X34 A;  4GZV A;  1I05 A;  2G5L A;  2ZSC A;  1SWF A;  5F2B A;  3WZP A;  1KL5 A;  4NYQ A;  4GGR A;  2KW1 A;  1KT3 A;  4GE1 A;  2IZB A;  4EEJ A;  4WFV A;  2A5B A;  1HMT A;  2IZI A;  2FKG A;  4GGZ A;  2FHN X;  4HPC A;  4LKP A;  1K24 A;  4IBA A;  4XME A;  3RBY A;  3D95 A;  3L4R A;  4I3D A;  4OKA A;  1VYO A;  1MK5 A;  1LIE A;  1YP7 A;  2EU7 X;  3HWD A;  3P24 A;  3PH6 A;  4Y5D A;  1GKA B;  2FKJ A;  2CBS A;  1KQX A;  1SWG A;  2FWV A;  1QQS A;  2ASN X;  3PH5 A;  2HZR A;  5L8N A;  4DNE A;  3WOV A;  3S5V A;  3CQN A;  1ZNH A;  2GJ5 A;  4A8Z A;  4AZM A;  1WBI A;  4A1H A;  1YIV A;  2RCQ A;  3NQ3 A;  5HCE C;  4TQ2 A;  4YGG A;  2RTF B;  3RSW A;  2I5Z O;  5B3M O;  4CPF A;  3ELX A;  1O1U A;  4NNT A;  4QZT A;  3ZZV A;  4HPD A;  1YUP A;  3VPJ E;  1ZND A;  2FRS A;  3FYF A;  1LIC A;  5L8I A;  3CBC A;  1SRH A;  1SXX A;  4GDA A;  2NNQ A;  4KII A;  2WSJ A;  2RN4 A;  3RDS A;  4CDC A;  1GKA A;  5K06 A;  3FA9 A;  3QQ2 A;  4FQB B;  3WJE A;  2GC9 A;  4QYN A;  3ZI8 A;  3APU A;  1JJU A;  3P6F A;  4L3R A;  5FAZ A;  3MG5 A;  1JV4 A;  1SWE A;  2RTN B;  3FR2 A;  3K3L A;  1QAB E;  1KQW A;  4JGL A;  4QRL A;  4U46 A;  1TVQ A;  1QG5 A;  5JR8 A;  3FEL A;  5B2A O;  1KGL A;  4WBK A;  4HPA A;  4NV7 A;  2RTM A;  5DPQ A;  1N9Y A;  5H8T A;  3VG3 A;  3TGA A;  1IIU A;  2A3F X;  3B2L A;  4RUN A;  4PSQ A;  1DZJ A;  5EEE A;  4GUZ A;  3SLT A;  2IZJ A;  1N0S A;  1SXY A;  1TW4 A;  4MEE A;  1JJJ A;  4CPH A;  4MVL A;  2HZQ A;  2Q2M A;  1UZ2 X;  4EQA C;  2BHV A;  4GNW A;  4EFG A;  2GTL N;  1SWP A;  2RTQ B;  4QZU A;  3SZI A;  1BRP A;  2NND A;  1SY3 A;  5AEO A;  1IKJ A;  1VWL B;  1BWY A;  2PI3 O;  4N7C A;  1MX8 A;  3FMZ A;  1GX8 A;  1A18 A;  4ORW A;  4U8U N;  2A13 A;  2F01 A;  4LZV A;  3KZA A;  3N91 A;  3APW A;  4IAW A;  4GK9 A;  4CSB A;  4AZR A;  3AKN A;  1RBP A;  1SLG B;  3RDX A;  5H9A A;  4M6S A;  4TKH A;  1QFV A;  1HQP A;  2QCB A;  3AKM A;  4AW8 A;  3ZW2 A;  4I95 A;  4CPI A;  3D96 A;  2OFR X;  1SWN A;  3ZWE A;  1CJ5 A;  2C1Q A;  2OYB O;  1I9H A;  3RDU A;  3LHN A;  3LV4 A;  2Q9S A;  1HY2 A;  2KT4 B;  1SWC A;  4YBU A;  1DZP A;  3UEU A;  4LQZ A;  1GT1 A;  1PMP A;  2A2U A;  2Z4H A;  2AL0 X;  2RTB B;  2RTR B;  1MDC A;  3OBL A;  5JD2 A;  1SLF B;  1YWA A;  3U0D A;  1IJ8 A;  3F9D A;  3JS1 A;  1LDO A;  2CAM A;  3P02 A;  3PK2 A;  2JMB A;  3WJD A;  3T1D A;  1FTP A;  1U17 A;  2A0A A;  4ZHD A;  3U9P C;  3B2K A;  4KH8 A;  2X56 A;  1ACD A;  1NP4 A;  5LJC A;  2GTL M;  2WEX A;  4QNI A;  1ICM A;  4O3W A;  1KT5 A;  2FT9 A;  1GGL A;  1Y52 X;  3EW2 A;  1KT7 A;  1NC9 A;  1E00 A;  2OFA A;  2FR2 A;  3STK A;  4O4U A;  4U8U M;  1MUP A;  3CR6 A;  2OVS A;  3CQR A;  5B11 O;  1LNM A;  2JU7 A;  5F1E A;  5IRA A;  3STN A;  4QGV A;  1A57 A;  2IZC B;  1NBX A;  2JN3 A;  3PP6 A;  4PJ2 A;  3UAQ A;  2L5P A;  3BLG A;  5FQ8 E;  4ALB A;  4YGH A;  4ZJ0 A;  1BSO A;  1DZK A;  1X89 A;  1VWG B;  3DTQ A;  4AZO A;  3VG4 A;  4QQ1 A;  5FQ7 E;  4YBP A;  2XST A;  1UYO X;  4TKB A;  1AEL A;  2LB6 A;  4ZGF A;  1LCW A;  3BDR A;  1JZU A;  1SLE B;  3D4R A;  2RQ0 A;  1CBQ A;  2IZE B;  1K3B A;  4GKC A;  3HOE A;  4R0B A;  1HN2 A;  1NDJ A;  3EM0 A;  2OVD A;  4Z27 A;  1NQM A;  4LKT A;  1VWD B;  3TZS A;  4HPB A;  1AVE A;  4RUU A;  2JU8 A;  3X00 A;  1BM5 A;  1Y0G A;  3SZH A;  2OL7 A;  1DF3 A;  3FA8 A;  4AZQ A;  1SWR A;  1G85 A;  4ORY A;  1EI5 A;  1O1V A;  1DZM A;  2OFB A;  2YG2 A;  2DJF A;  3HK1 A;  4FGI B;  5IRU A;  1VYG A;  4TNN A;  3B2I A;  4I3C A;  1FEL A;  3APV A;  4YKO A;  3WVM A;  4O4S A;  2Q4N A;  3T6L A;  3LTW A;  1GT4 A;  3B2J A;  1EAL A;  1FEN A;  1GM6 A;  2UZ2 A;  2WPU A;  4UU3 A;  1LKE A;  2HNX A;  1SA8 A;  2MO5 A;  5B5F A;  1SLD B;  5IO7 A;  2AH7 X;  4ALO A;  3TGB A;  2POA A;  3I0A A;  2PY1 A;  2FR3 A;  5EDB A;  4EKV A;  3I17 A;  2G7B A;  3UEV A;  1T8V A;  1TXL A;  1EUO A;  3RY2 A;  1Z24 A;  4Y0P A;  4NLI A;  3NR3 A;  4D6A A;  3WYQ A;  3CMP A;  2N93 A;  3PPT A;  3WZO A;  2OY1 O;  5B27 A;  1HMR A;  1NQN A;  1GT3 A;  1MVG A;  2R74 A;  4MVI A;  2WQA E;  3UEX A;  3TGC A;  1P6P A;  5HAE A;  1VWQ B;  1SWS A;  3ZW0 B;  1ALB A;  1EPB A;  5BVS A;  1EW3 A;  2WUT A;  4KCA A;  3RE6 A;  3O2Y A;  2OF9 A;  1YWB A;  2RTD B;  1EXS A;  2K62 A;  2DJG A;  4JO6 A;  4YFR A;  3F6Z B;  2UYW A;  1LEL A;  3PDF A;  5HCC C;  2QOM A;  3VG2 A;  1OEE A;  1YP6 A;  1ERX A;  4GJS A;  2KTS A;  2AT6 X;  2MM3 A;  2OY8 A;  2C4I A;  3NQK A;  3WXQ A;  2IZK A;  1G7N A;  1VWH B;  1Y53 X;  4GU8 A;  2RTL A;  3FA7 A;  1TOU A;  3BU9 A;  4Y59 A;  4HFO A;  1X8U A;  5IRW A;  5AQ6 A;  3EW1 A;  4IB9 A;  2M4L A;  2P8G A;  1SWD A;  1KOI A;  1RXK A;  2CM4 A;  2WR6 A;  4ZCB A;  3MBT A;  3RKG A;  3ZW1 B;  1VWI B;  5FQ6 E;  3RDM A;  3S26 A;  3VHH A;  3H3I A;  4ZHH A;  1CBS A;  4AZP A;  4ZH6 A;  2K23 A;  4OEM A;  5HZ8 A;  1LDQ A;  2X32 A;  3AEH A;  2IZL B;  5D8J A;  5D4A A;  4GRJ A;  4INN A;  2OY7 A;  2RCT A;  2OFM X;  1EIO A;  1PTS A;  4CV7 A;  2CBR A;  2BC3 A;  2BS5 A;  1D2U A;  1Y9L A;  4CDE A;  5L3Y A;  3B2H A;  1QWD A;  4GDZ A;  5IO5 A;  1VWB B;  2MJI A;  3Q6L A;  3FW4 A;  3WYP A;  1KZW A;  4IMN A;  2I5V O;  1HMS A;  3IFB A;  2OF8 A;  2X8S A;  3NX2 A;  1KZX A;  1STR B;  1VWO B;  2AMM X;  1CRB A;  5AJC A;  4ZR2 A;  5D45 A;  5HCD C;  2WQ9 A;  4Y0Q A;  3WZN A;  3VHM A;  3SOT A;  5D47 A;  3SLO A;  3S5X A;  3OE3 A;  2BSZ A;  4U9C A;  2MWH A;  2QO4 A;  5LJG A;  4BX6 B;  4I60 A;  5BYP A;  1S44 A;  1I04 A;  3TF6 A;  2G79 A;  3NPO A;  4QGW A;  3P6C A;  2GTF X;  1O8V A;  4N7D A;  5F6B A;  3S60 A;  3ZUI A;  2CZT A;  1RAV A;  2QMI A;  1S7D A;  3P6D A;  5H9K A;  1IKE A;  4IAX A;  2E4J A;  5B29 A;  2FTB A;  2JOZ A;  4TLJ A;  5F58 A;  1RXH A;  4A1Y A;  4DQ3 A;  5C0N A;  2FLJ A;  5H9N A;  3NQ9 A;  5LKF A;  4FBO A;  3O22 A;  3HWE A;  4ON1 A;  2VFC A;  1SXW A;  2L9C A;  2GH7 A;  1STS B;  2FHL A;  2RTA A;  1OEK A;  2LBV A;  3VU1 A;  4MIR A;  3FDC A;  3FW5 A;  4KT5 A;  1URE A;  3DSZ A;  4BBO A;  3HTY A;  1SRE A;  1N9M A;  2W2B A;  1GX3 A;  3F8A A;  1LID A;  4XMF A;  3HWG A;  1I78 A;  1GT5 A;  4DQ4 A;  3FA6 A;  1JMX A;  1Y9T A;  2JU3 A;  4OS0 A;  1JQP A;  1SY2 A;  2IZF B;  4ZHF A;  1SWA A;  1X8O A;  3PQU A;  4TKJ A;  2ZAI A;  3WJB A;  1HXZ A;  4LZU A;  4ML7 B;  2IFB A;  4NP1 A;  2FGS A;  4COT A;  5HZ5 A;  3ZUO A;  4HWM A;  1H91 A;  2MF6 A;  2LFO A;  1SXU A;  4BJ8 A;  5LJB A;  1KL4 A;  2FS7 A;  3JQO A;  1VWN B;  2LKK A;  4ZHC A;  4M7M A;  3GE2 A;  3ZQ3 A;  3MM0 A;  4BX5 B;  2HKD A;  2OL8 O;  1MOY A;  2WEW A;  2G8C O;  5F6Z A;  1MEP A;  2DM5 A;  2LA7 A;  4C5P A;  1JMZ A;  3T6F A;  1HBP A;  4GJV A;  4YDB A;  4ODD A;  5L8O A;  1RLB E;  1RXJ A;  2JW1 A;  2L67 A;  5CYB A;  3WZQ A;  1W6F A;  1X8P A;  5HTD A;  1BBP A;  2NP1 A;  4CDD A;  4OS3 A;  3Q34 A;  1LCV A;  2HYS A;  1LIB A;  1RST B;  3P6G A;  4GNY A;  3SZJ A;  4EDE A;  2R73 A;  1A2D A;  2X8F A;  3FEK A;  3WJG A;  4ZFX A;  5HBS A;  5CHK A;  2QO6 A;  5K67 A;  1PBY A;  1B0O A;  4BGF A;  2GTL O;  5B5G A;  4CK4 A;  4Z28 A;  5HWZ A;  5LJE A;  1DF8 A;  4YDA A;  1I4U A;  4GGT A;  1LF7 A;  4BX5 A;  1ZNG A;  1SRJ A;  1B56 A;  4O49 A;  4YCE A;  1SWK A;  1NGL A;  1BJ7 A;  2RTH B;  1LIF A;  1SRF A;  5HZQ A;  4Z2O A;  1LCZ A;  4XMD A;  4U8U O;  1NP1 A;  1ERB A;  1AVD A;  3KFH A;  4XMG A;  3V8U A;  5BVT A;  1DV9 A;  4YKM A;  1SWT A;  5LKE A;  3PQS A;  3BX8 A;  5LJH A;  5IXG A;  4IB7 A;  2A2G A;  4CPE A;  5LJD A;  1AQB A;  2OY5 O;  4NW4 A;  1ZNE A;  5EDC A;  3VE1 A;  3OD9 A;  2WWP A;  2R56 A;  5LJK A;  1R0U A;  1PM1 X;  2RTC B;  3AUM O;  2JGS A;  1BLR A;  1SWB A;  3KFI A;  1EQD A;  5CSE A;  4K19 A;  5EPQ A;  4O4O A;  2AKQ A;  2ALL X;  1SMP I;  1E2T A;  1W4T A;  4MVK A;  3STM X;  1G74 A;  1HQQ A;  1N7Y A;  5EZ2 A;  1KT6 A;  1FEM A;  5IO6 A;  1SRI A;  1IW2 A;  3KQ0 A;  2RTO B;  1ML7 A;  3CWK A;  2VFB A;  1L6M A;  3BX7 A;  3E3C A;  4UU2 A;  2F09 A;  1KXO A;  2OVE A;  1BRQ A;  1JIW I;  2RTK A;  3VG7 A;  1VWF B;  3SAO A;  4WFU A;  1VWC B;  4OS8 A;  3NP1 A;  4ES7 A;  4U3Q A;  1UYN X;  2KTD A;  1AB0 A;  3HWF A;  2X45 A;  2AVI A;  4IAB A;  2X46 A;  2QO5 A;  1BSQ A;  4YMY A;  1KL3 A;  4JHQ A;  3RY1 A;  4Z6J A;  1T68 X;  2RTP B;  4KC7 A;  4BOE A;  4ORS A;  4OEL A;  4OMW A;  4BCS A;  3CKF A;  2IZG B;  4NLJ A;  1RSU B;  3NBX X;  3FIQ A;  1T0V A;  1B8E A;  5H9L A;  4B55 A;  1E02 A;  3JSQ A; 
#chains in the Genus database with same CATH homology
 4IRW A;  4GGR A;  1RAV A;  2IZH B;  5IRA A;  2IZB A;  1RXH A;  2IZC B;  1NBX A;  1VWK B;  2A5B A;  2IZI A;  4GGZ A;  2FHN X;  4CPH B;  4Z2V A;  1N43 A;  2GH7 A;  4OKA A;  1STS B;  2FHL A;  1VYO A;  1MK5 A;  1VWG B;  4Y5D A;  2RTA A;  3FDC A;  1N4J A;  3RE5 A;  3RDO A;  1SWG A;  4BBO A;  1LCW A;  1SRE A;  4Z2P A;  1N9M A;  4DNE A;  1SLE B;  2RTI B;  1VWJ B;  2IZE B;  1WBI A;  2Y3F A;  1NDJ A;  2Y32 A;  4Z27 A;  1NQM A;  2A5C A;  1VWD B;  2IZF B;  1AVE A;  2RTF B;  3X00 A;  1SWA A;  4CPF A;  3SZH A;  1VWM B;  3T2W A;  1VWE B;  1HXZ A;  1SWR A;  2RTG B;  2MF6 A;  2OFB A;  3VGW A;  5IRU A;  4BJ8 A;  1KL4 A;  3VHI A;  1HXL A;  1VWN B;  1SRH A;  3RDS A;  3MM0 A;  4GDA A;  3T6L A;  4BX5 B;  1MOY A;  2UZ2 A;  2WPU A;  1MEP A;  2IZA A;  3T6F A;  1MM9 A;  5B5F A;  1SLD B;  4GJV A;  1RXJ A;  4EKV A;  3WZQ A;  3MG5 A;  1SWE A;  2RTN B;  3RY2 A;  4U46 A;  1LCV A;  1RST B;  3SZJ A;  3WYQ A;  3WZO A;  4BX6 A;  1NQN A;  2RTM A;  1N9Y A;  1Y55 X;  5CHK A;  5K67 A;  2C1S A;  1VWP B;  1VWQ B;  1SWS A;  2Y3E A;  5B5G A;  1SWO A;  1SWQ A;  4Z28 A;  2IZJ A;  1DF8 A;  4GGT A;  1SWJ A;  3RE6 A;  2OF9 A;  2RTD B;  4BX5 A;  4CPH A;  1SRJ A;  1SWK A;  4JO6 A;  2RTH B;  2UYW A;  1LEL A;  1SRF A;  4Z2O A;  1SRG A;  1LCZ A;  1SWP A;  1AVD A;  2RTQ B;  4GJS A;  3SZI A;  1VWL B;  1SWT A;  2C4I A;  1SWL A;  2IZK A;  3RDQ A;  1VWH B;  1Y53 X;  2IZD B;  1LUQ A;  2RTL A;  4GD9 A;  4CPE A;  2A8G A;  2F01 A;  4YVB A;  4Y59 A;  5IRW A;  3EW1 A;  1SWH A;  1SLG B;  1SWD A;  3RDX A;  1RXK A;  2RTC B;  2RTJ A;  2JGS A;  4BX7 B;  1SWB A;  1VWI B;  3RDM A;  3VHH A;  2QCB A;  5CSE A;  4JNJ A;  4CPI A;  1SWN A;  1LDQ A;  2C1Q A;  3T2X A;  1I9H A;  2IZL B;  3RDU A;  1VWR B;  2RTE B;  1HY2 A;  1HQQ A;  1N7Y A;  1SWC A;  1SRI A;  2RTO B;  1PTS A;  3WZP A;  2BC3 A;  5L3Y A;  2RTB B;  2RTK A;  2RTR B;  5JD2 A;  1SLF B;  1VWF B;  1IJ8 A;  1VWB B;  1LDO A;  2CAM A;  1VWC B;  3PK2 A;  3WYP A;  5K68 A;  2OF8 A;  2AVI A;  1STR B;  1STP A;  1VWO B;  1KL3 A;  4JHQ A;  3RY1 A;  3WZN A;  4Z6J A;  1SWU A;  2RTP B;  3VHM A;  4BCS A;  4BX7 A;  1KFF A;  1VWA B;  2IZG B;  4BX6 B;  4I60 A;  1Y52 X;  1RSU B;  2G5L A;  2ZSC A;  1NC9 A;  1SWF A;  3EW2 A;  5F2B A;  1KL5 A;  2OFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...