4BBRG

Structure of rna polymerase ii-tfiib complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 28
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4bbrG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4bbrG01
2R7ZG 3F2DA 2NN6I 2OCEA 1X55A 4HIMA 3HOWG 4DV5L 4A3LG 2E5LL 4DV2L 1PH9A 2K14A 4XIGS 3J81c 3BZKA 2R93H 1E1OA 2LXJA 1JMCA 1HNXQ 3STBC 4JI7L 3CW2C 4LNQA 4BXXH 2Y0SE 2OTJA 1E24A 1HNXL 3HOUG 1BBWA 4DR1L 4WJ4A 2ALYB 3JAMi 4X66L 1X54A 1BVSA 3ER0A 4AQYL 2OQKA 2R6GA 1TWAH 2ZTCA 2Y0SG 2CWAA 2WAQG 1XMOQ 5IWAQ 4KLKA 1K3RA 4DV3Q 3T1YQ 3TEHB 1YHQA 3PSIA 3HOYH 4BY1H 4GOPB 1SN8A 1XNRQ 4B3SQ 2ZM6Q 4L5RC 3S16H 4KHPQ 3TRZA 1VQ7A 2XTIA 4NXNL 3DM3A 3CPWA 5FJ8G 2KCTA 4YY3Q 4A3JH 4EX5A 4QGUA 4A3DH 3HOYG 1CKMA 1KAWA 2DUDA 3HKSA 2HIVA 2C35B 1Q82C 4HIKA 4JBWA 5LMUQ 1HH2P 3JC66 2D0PA 2E8GA 2EQSA 4LF4L 3T1HQ 1Y1VG 1Q8KA 4DR7L 4JI0L 4O0AA 2UUAQ 2YTYA 1Y14B 1J5EL 2OTLA 3W1BA 1E7ZA 4A3EG 4C3IH 4X65L 4B3MQ 1QVFA 1W2BA 3EBEA 1CUKA 1XNQL 4A3BG 4B3RQ 2ZJRA 3M9BA 4L5QA 2NN6G 1Y1VH 1XNQQ 5FLMH 2VZAA 2VQFL 4KHPL 4A3KH 1YITA 4BY7G 4DV4Q 5GAGC 4DR2Q 5IY0A 1TXYA 3U4VA 4YHHL 2B3GA 4C2MH 4JI4L 4JBKA 3KJOA 2ZJQA 5IP7G 2WB1G 2V1CC 4X62Q 4A3DG 2PI2E 2NVQH 4OWTB 4LF6Q 5LMNL 3CCUA 3PO2G 1AE3A 1CSPA 3E9IA 1HJPA 2F4VL 4L5TA 1IBLL 1HR0Q 5IYBG 4DR3L 1N33L 3J81j 5JJKA 1CSQA 2VS1A 4H02A 2N78A 4YWMA 1T9HA 2K50A 2PNHA 2B29A 2VUMG 2Z6KC 1OXUA 4JI6L 3SGIA 4GOPC 1V9PA 2N49A 4MTNA 2A19A 4R4QA 1N32L 1L1OC 1D8LA 1MKHA 3L2PA 5C3EG 5M3MH 1N8RC 4LFBL 1KC8C 1J5EQ 3FKIH 5M3FH 4MNOA 1EUJA 3PIPA 4NPSA 2ZM6L 2VL6A 1YNXA 1O7IA 3GO5A 3UE1A 1SFOH 3CF5A 3PO3H 2UXCL 1MIUA 2AWOA 2JJQA 5H1SE 4BXXG 2AKWB 1H95A 2UXCQ 3CAMA 1I5FA 3STBD 5C0XI 3I7FA 2MO0A 1A8VA 2AHOB 3HFZB 1R9TH 3PV0A 3HOXH 1YJNA 1HR0W 4A3GH 3CXCA 5IP7H 2GN5A 4JOIA 5IE8A 1ASYA 4OO1I 1JJCB 4LF5L 1LUZA 2WB1E 3RNUA 1KQSA 4X62L 1RIPA 1E22A 5M5WH 1EFWA 1YHAA 4J15A 4DV5Q 3U58A 3MXNB 1FL0A 1SR3A 3UE0A 2E2IH 4DAMA 1QVCA 3PGZA 2NZHA 1M90C 1ASZA 2JA9A 1CKNA 3L7ZC 2ZJPA 5M5YH 3JAMc 5DLQE 3UDXA 2Q2IA 4OXPA 4DR1Q 1YIJA 4TVAB 1IBKQ 3HOXG 4OX9L 1HNWQ 2BA0A 4DV6Q 3K8AA 1VQ9A 3ULLA 2VW9A 1A62A 1WI5A 3KDFB 5JEAG 2JA6G 1VQNA 1RL2A 1EOVA 3S1QH 1JE5A 1OXVA 2VQFQ 4DV3L 4YWKA 1IXRA 3T1YL 4IPHA 3CCLA 4GLVB 4A3JG 1PH5A 1X3GA 3J80c 1Q81C 4KHZA 4DV2Q 4IPCA 3J80i 3AFQA 3H3VI 3K80C 3RLFA 2IHEA 3KJPA 1PH6A 1GVPA 1IBLQ 1FJGQ 3HOZG 4GNXC 2ZTEA 2R92G 5C4JH 1Q1EA 1UE6A 2N3SA 2JA8G 3HOZH 1PH2A 3G71A 3H3VH 3MEFA 3U4ZA 2R7DA 3CCEA 2N8NA 1I94L 4EQ5A 2JQOA 2Z6KA 5BR8Q 5IYBH 2B63G 4BA2I 4JBMA 4A3CH 1S72A 5JJIA 5C4XH 1I94Q 3GTLH 4JI6Q 4NB3A 1TWHH 4OWXB 3T1HL 2K5VA 1WCMG 1XMOL 4HJ7A 3UDGA 2UUCQ 1NTGA 2YTXA 4YCUA 1WOCA 3OW2A 4PZ7A 1PFSA 3K7UC 5E7NA 5LMNW 3I56A 4B3RL 1VQDA 1VQIA 4R1JA 5M5XH 2JA8H 3OYYA 3I4MH 4JYAL 4LF9L 1N9WA 3S15H 1D7QA 3LGJA 4DV1L 4DK3C 3RZOH 3CMEA 1CKNB 3H0GH 1JT8A 1N34L 2VY3A 2F52A 2HIXA 2NVTH 1VQOA 1UE7A 3U50C 5LMUL 4IOAA 4A3FG 1DGSA 3AQQA 5C0XJ 2E5LQ 4AYBE 4X64Q 2WP8J 4L5SA 1GD7A 1A0IA 1HZCA 3A5ZB 3KDFA 4OWWB 4R4CA 3TQYA 4DR3Q 4JI7Q 4HJ5A 1C9OA 3W5OA 1XTDA 4BA1I 4X65Q 3RN2A 4LUZA 5ELNA 1XPOA 1BBUA 1YBYA 1K73C 1PH7A 5FJ8H 1SMXA 4DK6C 4BBSH 3BZCA 4RMFA 1WJJA 4AYBG 4JI2L 1VCIA 3GTJH 3D0FA 3K7AH 1IBKL 1P8LA 2MFIA 3I55A 1GM5A 3ICEA 4GN3B 1IL2A 4ALPA 1X9NA 1K0RA 1LYLA 3NEMA 4PZ6A 3RN5A 2WFWA 1X65A 4GLAC 1KL9A 5GROA 1M1KC 1AE2A 4DUYQ 1C7YA 5K36G 4BY7H 1X6OA 1X3FA 2Q2UA 4LF9Q 1WFQA 4A3BH 4JC0A 4K0KL 1JJGA 2PQAA 1VQMA 4GNXB 3HKZE 1VQ6A 2I0QA 3GTKH 4IPDA 2LSSA 2UUBQ 4DNIA 1Z47A 3A74A 4QJFA 3GTGH 1EQQA 2CWPA 2ATWA 4O2DA 1PVOA 4AQYQ 1UE5A 1C0AA 2LXKA 4TQUS 4JBJA 2ES2A 5C4XG 5IP9H 4A93H 1X56A 1TWCH 2H5XA 2B63H 3CCQA 4LFAQ 4P71A 3H15A 1MJCA 2KBNA 1JB7A 4PG3A 1BKBA 3I4OA 3D31A 1E3PA 1XMQL 3G48A 4Y7NH 1JJ2A 4DV7Q 1XNRL 4IO9A 2CKZB 2K52A 4DAYB 2GVBA 2VQEL 2IHFA 1PA6A 1PH4A 4YWLA 4UP8A 5GAHC 2HT1A 2MQHA 2KHIA 3KOJA 2NZOA 2NVXH 1U0LA 4A3EH 1UEBA 4DV4L 1OXXK 2BH2A 1B7YB 4A3IH 2XGTA 4DPGA 4IPGA 3GTMH 4DR6L 3H0GG 2GVAA 1PYBA 3M4OH 4LFBQ 2EIFA 4GNXA 5HY6A 3CPFA 3WWVA 1N34Q 2R7FA 5IP9G 4A93G 2KCMA 1VQKA 4IJLA 4JI0Q 3CCVA 4HJAA 4UP7A 1E1TA 2UUAL 1SLJA 4JI5L 1N36L 1QZHA 3CP0A 3VDYA 2I5MX 1YZ6A 1EYGA 4ME3A 1I50H 4GN4B 1N32Q 1NY4A 4X66Q 1Q12A 3CCJA 1Q1BA 1Q46A 4JI2Q 4OO1G 4R4IA 5C44G 2R7ZH 4JI1Q 4LF8Q 4LFCQ 1KHIA 4P73A 1PV4A 3AYHB 5IYCH 3AEVA 3RR5A 2Q2TA 4RG1A 4DV7L 4B3TQ 4DR4L 5ELOA 4APVA 4A3KG 1PH1A 1VQFA 5LMNQ 4DR4Q 4R4OA 4GLXA 3TREA 2E2JH 2JA7G 4FDBA 3PCOB 3K81C 2Q2HA 4A76A 1VQ4A 1CKOA 3NENA 3IRBA 4DR6Q 5M3FG 5FLXc 1IZ6A 2WAQE 1L0WA 3S17H 1QVGA 1KRTA 3B6YA 1OTCA 1G291 1K8GA 1YJWA 4GKJL 2UXDQ 1NMGA 2IX0A 2JEAI 5EAYA 2NVYH 1QUQB 4MZ9A 2YV5A 4DV0L 1HZAA 1OXTA 4OONA 4A3GG 1VS0A 3ERSX 5IWAL 3HOVH 3KF8B 2RF4A 4DV0Q 3KLWA 3EN2A 1HNZQ 1HNWL 3PUYA 4BBRH 4DV6L 1S3OA 3F8TA 4XTCS 1HZ9A 3M7NA 3FHWA 1Z9FA 4JV5L 2QGQA 4C3JH 4JV5Q 1IBML 2AMCB 1XPRA 1B8AA 4R4TA 2QEXA 1MJEA 4DKAC 2HHHL 3BU2A 5JJLA 4A75A 1VQHA 2A8VA 1K9MC 4AIMA 4LF6L 1G51A 1NE3A 2MO1A 1EQRA 4QY7A 2IX1A 4IFDG 4DR7Q 3AFPA 3M4QA 2FXQA 4GOPA 3I4NH 2RHQB 1GO3E 1K83H 2IT1A 3HOUH 2VNUD 3S2HH 2CFMA 3GTPH 4HJ8A 3HOVG 3G4SA 1VQLA 4P74A 2E2HH 3J7A5 5C0XG 3NELA 1QUQA 3Q8DA 3ZJYC 2R92H 4HIOA 1LTLA 3OTOQ 4BBRG 4LUOA 3CC2A 5HGQA 4IFDI 2HQLA 1VQCA 2I5LX 1IYJB 1P16A 4P75A 4B3TL 1B70B 3E0EA 1EIYB 1L1OA 4DUYL 4JI8Q 3ULJA 4POGA 3KYHC 3CCSA 3W1GA 4JI3Q 5C3EH 4QQBX 1YI2A 1KRSA 2A1AA 1K8AC 4JI3L 4PMWA 4A3MG 2ZTDA 2D62A 3A5UA 2JA7H 3GDEA 1WYDA 3S2DH 4BBSG 4A4IA 3CMAA 1HR0L 1KXLA 3NBHB 3J81i 4BY1G 4UP9A 2UUBL 2UXBQ 2IY5B 3CCMA 5IYCG 3S1NH 1J6QA 1NBWA 1I6HH 1I3QH 1UE1A 4NXML 1KIXA 1PYSB 1VQEA 1WCMH 2JEBI 3M3YH 3PF4A 4GN5A 3K0XA 4LFAL 3PUWA 3RZDH 1KD1C 2UU9Q 4LF7Q 1VQAA 4DUZQ 3KF6B 4HIDA 1S40A 4POFA 3CQZH 1Q86C 1HNZL 1VQBA 1L1OB 5C44H 3BJUA 3GTOH 3S1MH 3F2CA 4OX9Q 2YTVA 3I4MG 3PIOA 1TWGH 3UDIA 4QIWE 4HJ9A 3RLOA 3G6EA 3ULPA 4JYAQ 2EXDA 3CCRA 3PUZA 4NXNQ 3HOWH 4A3LH 3GD7A 4JG2A 1YVCA 3UDFA 4A3FH 4LWCA 2K5HA 1Y1WH 1SROA 4LF5Q 3DLLA 3TS2A 5JEAJ 1IBMQ 4JI4Q 4C3HH 4DR5L 4GKKL 1GKHA 3PUXA 1PH8A 2JA6H 4X64L 1YEZA 2CQOA 1OXSC 4IJHA 2K4KA 3S1RH 1FJGL 1FVIA 1V43A 1N36Q 3CC7A 4JI5Q 1HZBA 2Z0SA 3A0JA 3GTQH 2K75A 4P72A 2ID0A 3M4PA 2YU9H 1N33Q 2VUMH 2JE6I 4B3ML 4IFDJ 4AH6A 4NXMQ 3I4NG 1PHJA 2OWOA 1V1QA 5BR8L 1SRUA 2I5HA 2OQ0A 4JCVE 3HKZG 3PO3G 3F1ZA 1VQPA 3TS0A 3E9HA 4LFCL 3CC4A 3FKIG 1QZGA 2UUCL 4PZ8A 1VQ5A 1YJ9A 4A3CG 3PF5A 1L2FA 4UPAA 2BA1A 5M3MG 1XJVA 4YCVA 5GADC 5GQOA 1VQ8A 4LUVA 2PQAB 1AH9A 2L15A 3J7ZC 4JI8L 1PH3A 5AJ3Q 1Q7YC 2R93G 1NJIC 1XPUA 5GAEC 1SE8A 1X3EA 4A3MH 2F4VQ 4K0KQ 1U5KA 2JK8A 5AJ3L 2KENA 3EIVA 1TWFH 3CD6A 1VQGA 4DV1Q 4Y52H 4YCWA 2HHHQ 4JOIC 2YYZA 2MNAA 4LF4Q 2PMZE 2UXBL 4KI0A 3M85A 4GKJQ 2UXDL 1G6PA 2KHJA 2UU9L 2JA5H 5IYDH 1EWIA 5IT9c 5J3BA 2RHSB 4DUZL 4IOCA 4UY8C 2BH8A 2RCNA 4X6AH 3KF6A 4LW1A 1LM0A 1XMQQ 4A3IG 4LF7L 3I2ZA 5FLMG 2K5NA 2VQEQ 1A63A 1W3SA 2QA4A 3FP9A 4B3SL 1NMFA 3L0OA 3PUVA 2AWNA 4GS3A 2D0OA 4QL5A 2PI2A 3KFUA 1YHBA 5IYDG 3OTOL 3F2BA 2JA5G 2F3IA 4YHHQ 3PO2H 2CCZA 3RLNA 2DGYA 3S14H 4JI1L 4YY3L 4LF8L 4WJ3M 2ASBA 1VQJA 4DR2L 4DR5Q 1Y1WG 1UWVA 4GKKQ 1FGUA 3S24A 1EIFA
chains in the Genus database with same CATH superfamily
4A93B 2NN6I 2UXCH 2FJZA 4GC7A 2R92A 2PPBC 3J81c 3V96A 3BZKA 4B3TH 3SHLA 1JMCA 1GHJA 3PO2B 1JKJB 2YYAA 3IFDA 5IGFA 1BBWA 1QE6A 3IN5A 4WJ4A 2O5JC 1U4PA 2ALYB 3JAMi 3VPBA 1X54A 4JV5H 4G7HC 5I6YA 4MV7A 1V8QA 1D6EC 5EOYA 2Y0SG 2CWAA 3DWQA 4YR2A 1GXDC 5FLXW 1F9SA 4IUTA 4DV3Q 1LTID 4BY1H 4GOPB 5CBEE 2ZM6Q 3G7LA 3TRZA 4HNVA 1VQ7A 4JI4H 4IALA 3RD4A 1FD7D 3VR5A 3VYTA 2K04A 5K5PA 4A3JH 4A3DH 3HOYG 1KAWA 2DUDA 2ATLA 2HIVA 3EVQA 2SDFA 3FRPB 1HH2P 5KGUA 5EWEA 1BR9A 3ND9A 4DV0H 1CQFA 2YTYA 4DR4H 1Y14B 2W71A 4A3EG 4X65L 1AZPA 3GTQA 3ONAB 3EBEA 4LH7A 2W6OA 1XNQL 5BR8H 2HUGA 4DR2H 1TWGB 2NN6G 4DLKA 2JEFA 2VQFL 1YITA 2F0HA 2EJMA 5GAGC 2FMCA 5IY0A 2FLLA 4GC6A 1CQVA 2F4IA 4FVMA 1IBKH 1GSHA 5CYUA 4J9NA 4F7XA 2R8JA 1LV9A 4KD3A 2FMAA 4LF6Q 1I4RA 5KFEA 1CSPA 3E9IA 2I8CA 5IYBG 4HCEA 1N33L 1FGBD 2VS1A 1PX2A 4YWMA 2R8KA 2K50A 2EE1A 4UCSA 2HJWA 2P5ZX 4O3OA 4RCOA 4NKLA 4XYLB 4MTNA 1N32L 5DGAA 3R93A 2XC9A 1L1OC 4H13C 2Q8IB 5C3EG 1PYWD 1N8RC 1EEID 3PIP3 1ML0D 1O75A 4NPSA 4PQXA 1TU2B 3PO3H 2UXCL 2AWOA 1PRTC 5H1SE 1RJTA 2PN1A 5JAVA 1I5FA 2A5HA 3STBD 5C0XI 1A8VA 4G7ZC 1II3A 1R9TH 3HOXH 1YJNA 4ED0A 4O4HF 1LTGD 5I2YA 4JOIA 5IP7H 3VPCA 5M5YB 4LF5L 1LUZA 3RNUA 2F0OA 1EFWA 3SE7A 4J15A 3MXNB 1FL0A 1S4ZA 3Q22A 4C5BA 3N44B 1RDPD 3PW0A 4JV2A 3MR2A 1N56A 1SE3A 1M90C 5JUMA 4J9PA 5FLXL 1CKNA 3L7ZC 1B3AA 2QKIC 3LP8A 2MCTA 2HCCA 4OIJA 4OXPA 3PIO3 1YIJA 4OX9L 2RGVA 2JEGA 3HOXG 4J9KA 5KFSA 1VQ9A 4ZQ3A 5I6WA 5KFOA 1WI5A 3KDFB 1A9XA 4F4XA 3C2PA 2TMPA 3GTMA 3OWFA 1RL2A 5CMDA 3RV4A 4KHVA 4IPHA 4GLVB 1PH5A 3TZDA 4PMBA 2F0WA 1S5DD 3WNZA 3GILA 3J80i 4IR9A 1A3VA 2VXWA 1JWUD 4JI3H 4Y8VB 1S03G 1GVPA 4DL5A 2AQ3B 2ZTEA 1O7YA 2A69C 2EYLA 5LMUH 5CV5A 3AMUA 1Z6HA 2FLPA 5CA0F 3NK9A 2R7DA 1I94L 3MWEA 5IYBH 4BA2I 4O4LF 4NB3A 1TWHH 4RFBA 2B2YC 3SR1A 1SYEA 3HKZA 1HNWH 1WCMG 2SNMA 2UUCQ 4M9UA 2YTXA 1WOCA 3L9AX 1XMOH 2WV6D 2V4DA 1U4RA 1FR3A 3Q0AA 4R1JA 4H44C 5M5XH 1CZWA 1JWMD 3NQIA 1KJQA 3I4MH 3UQ8A 2HCIA 4TV8F 3S15H 4YAKB 1CE8A 2Z4HA 5T1IA 4YY3H 1N34L 1GHKA 2VQDA 3NXWA 2SEBD 2F52A 3VMMA 4IOAA 3CHBD 4O3QA 3AQQA 2YU9B 2KUMA 4AYBE 4B3SH 3MR5A 2WP8J 4L5SA 2QILA 3GTJB 1A6XA 4RAYA 4E4TA 1JICA 3TQYA 5C0XH 5C44B 4JI7Q 4HJ5A 5DNFA 4A3IB 1XTDA 2JA6B 4LUZA 5ELNA 1K73C 3GQCA 1PH7A 5KFNA 2XVSA 5JVG3 4MV4A 2Z1CA 2IL8A 4BBSH 3BZCA 1HQMC 1JIHA 4X3KA 2SOBA 4JI2L 3RAXA 3I55A 4NXNH 2V4QA 1X9NA 1W93A 5KT4A 3D8GA 1SNMA 3NEMA 4JK1C 4DXGA 3N6RA 1W96A 4F50A 2FK3A 2F0EA 2R7NA 4O3PA 4L6TB 1AE2A 1C7YA 1X6OA 3Q6SA 2CVRA 1V4YA 3KK7A 3E5SA 1X3FA 2Q2UA 2C22A 3Q8QB 3K3PA 2K33A 1M4VA 5ELBA 5J39A 1HQRD 2QW7A 3VYRA 4EBCA 1VQ6A 5IGDA 2UUBQ 4YHHH 4LMQD 5KFMA 4A3JB 1ZHQA 1STGA 1EQQA 3GIIA 2QCPX 1EY7A 1UE5A 4BY7B 4MV6A 4BWGB 2ES2A 1DV1A 3J81W 1GUWA 2H5XA 3CCQA 2WAQB 4P71A 5D3IB 3BS1A 2ZM6H 3R3OA 2W6ZA 4PG3A 1N36H 3I4OA 4PV1C 4DV7Q 4IO9A 2ZDHA 1PH4A 2HT1A 5GAHC 4UP8A 2Z4IA 4ECZA 1ZKOA 3ETHA 2NZOA 3OTOH 1A2UA 1U0LA 2V59A 4A3EH 2C28A 4X3TA 1OXXK 4DV4L 1KJIA 1L0YB 1SAPA 4CGYB 4DPGA 1WTXA 4IPGA 2QK4A 4TSSA 3H0GG 4DR6L 2GVAA 1PYBA 3NPPA 1S97A 5IP9G 4BY1B 3Q23A 3BG5A 1XXGA 3A7LA 5LL6b 1LTRD 3RB6A 5LL6X 4JI5L 1VAJA 2VOBA 1JLLB 4RZRA 4K2LA 2F1MA 3VDYA 4ZK9B 4U6PA 4GN4B 4UCUA 4X66Q 2Y0SB 5G3LF 3KBXA 4J9QA 3V6HA 2BCOA 4R7RA 2E2IB 1HTPA 5IGEA 1Q46A 3HG9A 4JI2Q 4MN3A 1TKWB 4R4IA 1KHIA 5KFRA 3AYHB 3KF8A 4PNYA 3KUPA 1PZKD 1R9TA 5ELOA 2WB1A 1TWFA 2UUCH 2E2JB 3TREA 2E2JH 3O13A 3M9MB 3PCOB 3K81C 2Q2HA 3IL8A 4RB1A 1TS2A 1PLFA 2DY7A 3D6WA 3IRBA 4L1KA 5M3FG 3FPPA 1L0WA 3FKIB 1QVGA 3VA7A 1N32H 3N43B 2B39A 2UXDQ 2AQ1B 2JEAI 4ECTA 5DAUA 2NVYH 4NMZA 4A3GG 2IY5B 1HZAA 2VR1A 1VS0A 3ERSX 1ZETA 5IWAL 3HOVH 4IUNA 2FP4B 2RA4A 4DV0Q 5KFLA 3RBDA 1HNZQ 1HNWL 3PUYA 1S9FA 3TBIB 1HZ9A 3FHWA 1A15A 1KNEA 1VF7A 3R5XA 3K7AB 2ASJA 4CDDC 4OELB 4Q0FA 3S1MB 2AMCB 1W6KA 2NVYB 1UC8A 1B8AA 1MJEA 2O5IC 2KCCA 1ENCA 4ED8A 4RAZA 1KLGD 2NN6H 1EQRA 2IX1A 4IFDG 4DR7Q 3M4QA 2FXQA 4RUAA 4DV3H 3I4NH 1GO3E 2A74C 1TWHB 1YNJC 4EGQA 3P20A 2N55A 4IWXA 2K32A 3Q8DA 4QMGA 1PDQA 4HIOA 5K36H 1LTLA 4XQJA 4ECSA 3CC2A 4LMYA 5EDWA 2N88A 2WKCA 1K0SA 4C2MA 3T56B 4Q8EA 2XN9C 3E0EA 1EIYB 4QWAA 1J8IA 4MV3A 1LT4D 4LF6H 4EBEA 2CW8A 1IOWA 2R92B 1QNKA 4JI3L 1STHA 2D62A 3GDEA 1WYDA 4A4IA 1YNND 4BY1G 2EJFC 4WRDA 5IYCG 3S1NH 4Q43A 1I3QH 2F3WA 3JZIA 2KOLA 1PTOF 4FXKC 1VQEA 1WCMH 2JEBI 3VR4A 3M3YH 5CV4A 2JA7B 2E2DC 3DWAA 2ICEC 4EVOA 3RZDH 3V4ZA 2NTTA 4DUZQ 2EYMA 2IX3A 4HIDA 4ZI7F 4POFA 3CQZH 5HBRB 3J80W 2UU9H 5C44H 3S1MH 1LLRD 2JA5B 2L11A 3CCRA 1MI2A 4O4IF 3UDFA 3VR6A 5KFIA 4DV6H 4HCSA 3DLLA 3N40P 5KT7A 5IGCA 3M7GA 1E2VA 4JI4Q 3JAMW 2W6NA 3UI2A 5KFXA 3PUXA 1B6RA 1PH8A 5JEAH 1IW7C 1CZGA 5D1OB 5C4ZA 3QJYA 1BGWA 4IAJA 4FF3A 5KT5A 1PFBA 4JI5Q 3BA8A 1TS3A 3GTQH 3JSNA 2K75A 4DV5H 2ID0A 1E4GT 3K5OA 1NUCA 2EYHA 1Z2NX 2L1BA 4IFDJ 1SYBA 3I4NG 1PHJA 2E2HB 5BR8L 1BNCA 1PFMA 1K1SA 4IFDH 2I5HA 3LWEA 3F1ZA 4FNFA 3QO2A 4EYIB 2CH4A 4LFCL 2HQEA 4A3CG 1VQ5A 4J9SA 1K8OA 4RGOS 3T5LA 1L2FA 1ESFA 1KC7A 4KY7A 4LFAH 3J7ZC 1PH3A 3R2TA 2XRQD 1XPUA 1SE8A 2F4VQ 4FF1A 4QUCA 1U5KA 1TWFH 1WTOA 3CD6A 4DV1Q 4LJZC 4C3IG 2HHHQ 3MFIA 4EEQA 4ZKBB 2MNAA 4MHEA 2UXDL 3EROA 2VQEH 2UU9L 2BQUA 1EQTA 5J3BA 4IOCA 3KALA 4MTDA 2RDHA 1IBLH 5DLFA 4X6AH 1E4EA 4WORA 2WACA 4OGQC 2K5NA 3FP9A 1NMFA 4LF8H 3PUVA 2J4XA 2LFNA 2NTSA 2PI2A 4QL5A 4ABNA 3S1QB 1M7JA 1Y1VB 4ULLA 2KCNA 2DN8A 4X3UA 2CCZA 1STEA 1NR2A 4KY5A 4DV1H 4DR5Q 2C2RA 1Y1WG 4TV9F 3S24A 3HOWG 3GTPB 1AZQA 4DV5L 2E5LL 4X65H 3NP8A 2K14A 4XIGS 2NVXA 2YS6A 2LXJA 4QWBA 3OMGA 5JQWA 2OLSA 2Y0SE 5CGKA 1KDAA 1I50A 2IBKA 1HNXL 3DEPA 1KJ8A 2XCAA 4JI6H 4X66L 4NXMH 4C3HB 3H91A 3MFHA 2ASLA 1BVSA 4AQYL 1PRTF 5IGGA 1B44D 5KG5A 1NNXA 3NE5B 2OF1A 2WAQG 2GLTA 2FHTA 4FM9A 4KLKA 4V0BA 1K3RA 3FKIA 1EY6A 3S16H 2FK1A 2RSNA 2MP1A 3OW7A 2IWHA 2XTIA 4DL4A 1L2ZA 1KNAA 3FDTA 5C4HA 2KCTA 2VQFH 4CJ2C 4ZLTF 4EX5A 3SVMA 4QGUA 5FK9C 3IKJA 4JYAH 1GJXA 3HKSA 1N33H 2OT2A 2C35B 2JSOA 1CFMA 3HBLA 4JBWA 4C5CA 2RGRA 1FKAH 2D0PA 2GA4B 1SSOA 5A35A 2E2IA 1Y1VG 1FJGH 3D4WA 2XIGA 3KAKA 4JI0L 3HOXB 1JORA 1F2ZA 2ALZA 1J5EL 4LF7H 1TQOA 2Z9HA 1E7ZA 1S0OA 5KFGA 2LKVA 1F9QA 3I4NB 4RWSC 5EWFA 2ZJRA 1Y1VH 5ELCA 4ED6A 4A3KH 4DL7A 3NBIA 5KNCA 3IFTA 4HQ6A 3U4VA 4TRDA 4ZRZA 4JI4L 1PTOH 4JBKA 1BJTA 4ECYA 5ELDA 2OXPA 1TR5A 1SNQA 1MGSA 3L4KA 3NHHA 2B2UA 3MXGA 4CDEC 4BS9A 5IWAH 5JJKA 2EDGA 4H02A 2F0FA 2M9VA 2N78A 2EY2A 5KKNB 2PNHA 3JRWA 2B29A 2VUMG 2Z6KC 2HHHH 1GUGA 1V9PA 1XWEA 1AFPA 3CQZB 1MKHA 1WH2A 4CKCA 3X3MA 1JQYD 1J5EQ 5BMVF 3T5HA 3FKIH 3MTSA 4MNOA 1WCMB 3EFXD 4K5XA 2VL6A 1YNXA 3A7AB 4QWEA 3S16B 1MIUA 2R82A 3GIMA 4O3SA 2MO0A 1DYQA 2D5DA 4FXDA 3M4OB 3ITPA 1HR0W 1S10A 3CXCA 3HXLA 2GN5A 2ZDGA 5IE8A 3V05A 3TINA 1KQSA 3BG3A 3ZYYX 5L1IA 1SNOA 2VB2X 1E22A 5M5WH 4A2AA 3KHRA 1YHAA 4DV5Q 1SR3A 2E2IH 1RYSA 4DAMA 1QVCA 2ZJTA 2UVVA 3EPGA 2NZHA 5M3MB 1RTOA 3TDQA 1D1IA 1R4PB 2IPKD 4F4YA 1J5EH 5M5YH 3JAMc 3UDXA 4TVAB 1TA8A 5KX5F 4C3JG 4DV6Q 5H80A 5DQHA 3K8AA 2NBFA 2H4OA 3D6CA 3ULLA 1A62A 3P1HA 2DPJA 4YBZB 1TWAB 3A8JE 3SEBA 1WTWA 5M3FB 4DV3L 3CCLA 3MWMA 3J80c 1Q81C 3KAJA 2W9CA 5KFFA 5LMNH 4DUZH 1BQQT 1B33N 3RLFA 4EGVA 5C4JH 2N3SA 2B2UC 2JA8G 3S17B 1PH2A 1W6JA 3E3XA 3ETJA 3H3VH 2NU9B 4IRDA 2F0GA 1EEFD 2K01A 3V2TA 3KHHA 2B63A 3U4ZA 2N8NA 4A3CH 4JBMA 3RUZA 1E0BA 5C4XH 3GTLH 3Q8SB 1BDOA 3HB9A 3S2HB 5KG3A 1NR4A 1MZBA 1V1PA 2VUGA 1GUNA 1X3QA 4YCUA 4K5WA 3OW2A 4PZ7A 1PFSA 5KG4A 1XNRH 2F0QA 4O2AF 2R7LA 5M5WB 1A3TA 2VA2A 5DG9A 2RVLA 3LNNA 4M1UB 4DV1L 4F4WA 3J81L 3RZOH 4C56C 1WTRA 1CKNB 2F3VA 1JT8A 4RNNA 2F0DA 3NUCA 3U50C 5KG1A 5EKIA 4A3FG 3S14B 5C0XJ 4PWQA 5DG7A 3TZUA 1STNA 1HZCA 4UCRA 4OWWB 3IAYA 3GTGA 3P7JA 1DV2A 4DR7H 2R6FA 2CW0D 4X3SA 2RDIA 1XPOA 1BBUA 1YBYA 3TP8A 2HVQA 2RCFA 3LWUA 3TP5A 1G2SA 5L1JA 5DGBA 1VCIA 5C4XB 3GTJH 1WD0A 1RK5A 3R5HA 4YR0A 2W9BB 4DAYA 1SJED 3ICEA 2L9HA 1STYA 3BQ2A 1LYLA 1E4FT 1HNZH 2WFWA 2CHBD 1KL9A 4DU9A 3PMFA 1M1KC 4FBUA 2E76C 4DUYQ 5K36G 2FPPB 4UDUC 1A3UA 4TUYF 2E75C 3T5JA 4A3BH 4JC0A 4K0KL 1SNDA 2EYFA 4GNXB 1EQVA 1HPCA 3HKZE 4A3KB 3GTKH 3KLSA 3GIKA 4DNIA 2KJXA 2WDTA 3RB3A 4NW2A 3A74A 2DWCA 2CWPA 3PW7A 3G6JB 2AQ2B 1ET9A 1E2ZA 1C0AA 2LXKA 1BOSA 1UEAB 5IP9H 1TWCH 3PQIA 2A69D 2WIIB 2F0NA 5I9OA 1HRJA 1BKBA 3D31A 1E3PA 4N9PA 5FPOA 1AW7A 2K52A 3GV8B 2IHFA 2X6LA 2V4RA 2MQHA 1M0WA 2BDOA 3GV6A 2J9GA 2NVXH 1B7YB 1FNUA 4GZYC 1WTQA 1SE4A 1I4QA 2DNEA 2R7FA 5COYA 3LWBA 4YR3A 4OX9H 1QG7A 1S5BD 3CCVA 1G6ZA 4HJAA 1E1TA 3Q8RB 1BXTA 1SXTA 3MFGA 1YZ6A 1EYGA 4ME3A 2OH2A 3V4SA 1RF2D 4C2MB 2GPWA 2J6TA 1DXMA 3QG1A 4KKSA 3CCJA 1Q1BA 3NTHA 5KYLA 1E2WA 4JI1Q 4LFCQ 4P73A 2NU8B 2DNCA 3AEVA 3RR5A 4RG1A 1LTBD 1VQFA 1Z7TA 4DR4Q 2W8KA 4GLXA 1BCPB 5CORA 1RJRA 4A76A 1GUSA 4M8AA 2F0LA 4LAAA 4ED3A 1S5FD 5CV8A 2FKLA 3BYTB 3QZ7A 4KD4A 2J7ZA 5JJZA 2IX0A 1AUVA 5KFCA 4CDFC 4MZ9A 4DV0L 4OONA 1EY9A 5JPMC 3KF8B 2RF4A 1PK8A 3EN2A 1KJ9A 4BBRH 5C8YF 4BBRB 1S5CD 4I4TF 3F8TA 4XTCS 2NVTB 3BQ1A 3M7NA 2FE3A 2B2TA 4MA5A 4MA0A 4C3JH 4JV5Q 1IBML 1XPRA 2PZWA 2EYOA 2JYOA 4DKAC 3H0GA 2RQXA 2XCPA 1VQHA 2A8VA 4LH6A 3H4DA 1LO5D 2K5DA 2AGPA 2JN4A 2JXMB 1NE3A 4QY7A 3AFPA 2B2WC 3RIZA 5KFAA 2RHQB 1K83H 3D4DA 3S2HH 1NAPA 3MR6A 3MR3A 4HJ8A 3HOVG 5KFWA 3G4SA 4I7AA 4LF5H 4P74A 5DQGA 3S2DB 3NELA 2PBZA 3RB4A 4RHRA 3T53B 4RKBA 5EWGA 4BBRG 3PO3B 1SEBD 3K5NA 5HGQA 3BDCA 3GQBA 4B3TL 2L12A 1QWYA 2MPMA 1L1OA 4DN4M 4JI8Q 4DUYL 1AP0A 4QWCA 3KYHC 4JI3Q 3W1GA 1EOTA 2EOTA 4QQBX 5I2XA 3S2DH 3A5UA 3CMAA 4GKKH 2Q8TA 4RUCA 4RKLA 1WR2A 3CCMA 4IURA 3S1NB 4OL7A 1J6QA 5EJWA 1I4HA 1KIXA 5C1PA 2Q8RE 3MFYA 4GN5A 2A68C 3M9NB 3K0XA 3I3CA 4LFAL 2F0VA 3PVXA 1S40A 1DOMA 1VQBA 2FMMA 4IUPA 4LFCH 4HR7A 1O78A 4UCTA 1JX4A 1TWGH 3UDIA 1TWGA 3BA9A 1I3QB 1VDZA 4JVZA 2A73B 3G6EA 3ULPA 5D1PA 2EXDA 4KK7A 3NGDA 3J7AV 1H9RA 4A3LH 1J9OA 3GD7A 2QDLA 4JG2A 1YVCA 4KKTA 2ZXPA 1SROA 4K6LA 5JEAJ 1EYDA 5HGTA 1IBMQ 2W57A 4C3HH 4DR5L 1GKHA 3SDZA 4LF9H 2JA6H 3WDNA 1YEZA 3DUZA 2VB3X 1OXSC 2YZNA 1RODA 5D3DA 1FVIA 1FJGL 1CI3M 2F0SA 4I65A 3CC7A 1HZBA 2Z0SA 5C3WA 3RB0A 2JE6I 1SJHD 2J0TD 3JAME 3K5HA 4B9WA 5BPFA 2OWOA 1V1QA 1EY8A 1HFGA 4C5AA 4M7EA 1EUDB 3HKZG 3X3NA 3K57A 4C3HG 1VQPA 3W2DA 3CC4A 1IKMA 5IYZF 5M5XB 1KBLA 3VPDA 1SDFA 3ORRA 3GTQB 2BA1A 4QIWA 5GQOA 1VQ8A 4LUVA 2O4XA 4IR1A 5EQ0A 4ZAIA 3VYSA 3Q8PB 1V1OA 4IZ8A 4JI8L 2R93G 1G2TA 3A56A 4RU9A 1UUPA 2JK8A 5DEHA 5AJ3L 2F03A 2KENA 3EIVA 4R8UB 4A3FB 2JP1A 4PMCA 1STBA 2PMZE 3I70A 3M85A 1HUNA 4ED1A 4XX0B 1B1ZA 2JA5H 5T1GA 3MXPA 5IT9c 3J80L 2RHSB 1KDBA 4CBVA 1DOKA 4HN7A 1TWFB 4DUYH 4RGNA 1LT6D 4LW1A 4J6HA 5FLMG 1A63A 2QA4A 1TS4A 3U9TA 2D0OA 3Q2OA 4EEYA 2JA5G 5E3FA 5C3XA 4YHHQ 2W6MA 2UUBH 1VMCA 2YZGA 1KAAA 4LF8L 4YY3L 2J6UA 1HFNA 4K0KH 1VQJA 4YP3A 1UWVA 2BQ3A 1XMQH 3F2DA 2OCEA 1EWCA 1LABA 1X55A 2CZGA 3H40A 3VR2A 4O2BF 1SMYC 4DV2L 1QNUA 2V58A 1JXLA 2R93H 3BDLA 3STBC 1O7ZA 1VF5C 1CQJB 4LF4H 4YQWA 3HOUG 4ODGA 2WB1B 4HTHA 4DR1L 4A3DB 1OWTA 1XYIA 4CC5A 1DJRD 1ONLA 3GIJA 1TWAH 4ZUJA 4NDXA 3SI8A 2ZTCA 4QW9A 2F0TA 2K05A 5IWAQ 3T1YQ 3TEHB 1EL0A 2X6GA 5KG7A 3N41B 4KHPQ 4B3SQ 4IUUA 4L5RC 2F0IA 2R93A 4XYQA 3R8BA 3U9SA 3GTPA 3MZ5A 4QUFA 4U68A 5FJ8G 4YY3Q 4ME6A 1B2TA 5JVH3 4J9RA 3P75A 3BDOA 4KTAA 1DONA 2AUJD 5DM73 1O7LA 4ECVA 2KVMA 3T1HQ 4O3RA 4DR7L 1A2TA 2LS01 3HEJA 2UUAQ 2TSSA 1EZ1A 1SNCA 5JVLA 1UNSA 2D2CC 3W1BA 2KSWA 1QVFA 3BVMA 1W2BA 5KFKA 1CUKA 5A2QE 2B2VC 3TN2A 4A3BG 4B3RQ 1XNQQ 3NTKA 4BY7G 1CT1D 2B8FA 3C3LA 1RTNA 1TXYA 4YHHL 2B3GA 4EQNA 1Y1WA 3KJOA 2ZJQA 5IP7G 1N48A 1QCBD 2WB1G 4X62Q 4A3DG 5A2QW 5J2UF 1IYUA 3J80E 1H9SB 4OWTB 5D1OA 2XSCA 3CCUA 1AE3A 3R2IA 1HJPA 2F4VL 1UAPA 4L5TA 1HR0Q 3OHXC 4DR3L 3J81j 3K6OA 4CJ0B 1T9HA 2DY8A 2MGSA 4QCLA 3V6JA 4FS2A 3SGIA 2UXBH 4R4QA 2N49A 2A19A 3J7AK 1SEIA 1DZ1A 4FXGC 1JWSD 3L2PA 3OHBA 3DM1A 1LT5D 4Q0YA 1KC8C 2PQEA 2ZXOA 1V51A 2K5WA 5M3FH 3RBEA 3PIPA 1DCZA 4DAPA 1ZYRC 3MHBA 3GO5A 1SFOH 3FVQA 3CF5A 2AKWB 3PR4A 5NUCA 3I7FA 2IA6A 4X62H 3W3AA 1SYCA 2AHOB 5J22A 3HRZC 1I6VC 3HFZB 4KN7C 5CA1F 1YNNC 1IHZA 1ZXTA 2ICIA 1JJCB 4X62L 3GTGB 1RIPA 3AU7A 3RTXA 5E1FA 3PGZA 1ZYRD 1ASZA 2ZJPA 2R93B 2WE6A 1T5EA 2UUAH 4FYDA 3A54A 3M9OB 4A3GB 3V6KA 2C00A 5LL6S 2FFKB 4HSPA 4JI2H 3BQ0A 5JEAG 3NQTA 1VQNA 1JE5A 1OXVA 2HD3A 1IXRA 2F4VH 3OOCA 4A3JG 5L1LA 4KHZA 3NWSA 3GV7B 4DV2Q 2RDJA 4IPCA 2NVXB 3AFQA 4EGJA 3K80C 3WOEA 3KJPA 1IBLQ 1FJGQ 1TVXA 1I6UA 4GNXC 4O3NA 2IW3A 3G71A 1PTOD 1GSAA 2VPSA 3NSWA 4H0LC 4Y7NB 3MEFA 1D2BA 3CU7A 2JQOA 2RBMA 2Z6KA 5BR8Q 4EQ5A 2B63G 5JJIA 2XCLA 1S72A 1V1PB 4J1MA 4HEDA 1IL8A 3T1HL 2K5VA 1XMOL 4O42A 1U4MA 3UDGA 3PW2A 1GUTA 1NTGA 4P2CB 2C2DA 3M4IA 1BO0A 1FNVA 2W7OA 4R8IA 4DV7H 4KHPH 4ETSA 3WO1A 3I56A 4B3RL 2E5LH 3T4AC 2MHVA 1N34H 2O03A 5KG2A 4FP5D 4JYAL 1I7LA 4LF9L 1N9WA 1D7QA 3LGJA 1L0XB 2K5QA 3CMEA 4DXFA 4FS1A 5JH7F 2HIXA 1G91A 1VBHA 1VQOA 3UFXB 1KTKA 2DJGC 1WTVA 5IOCA 2E5LQ 2XWBB 5KNDA 4X64Q 1EWHA 4JI0H 1GD7A 3A5ZB 1Y1VA 2HVSA 4DR3Q 3G6VA 4ECXA 1EFID 3RN2A 2PO4A 2ZDQA 4J9MA 2O2LD 3H94A 4WBNF 5FJ8H 1SMXA 3BZDB 4DK6C 2R85A 2K7VA 4RMFA 4C3JB 4KMUC 3D0FA 2MFIA 2W7PA 1I4PA 3OIQA 4GN3B 2DJFC 1M6VA 1IL2A 4ALPA 3L3OC 4PZ6A 4DNRB 1X65A 5GROA 4ED7A 3R23A 3TQ1A 1DM0B 1TT2A 4XT1B 4LF9Q 2JA8B 5IIFA 4AQYH 2A6EC 1VQMA 5LXTF 2I0QA 4IPDA 3G8CA 3N8DA 1Z47A 2NUCA 2BE5D 3GTGH 4L63B 5LA6F 1STAA 3OSNA 4AQYQ 1ICFB 3OIPA 5EKLA 5LYJF 1X56A 4I7ZC 4ZUIA 2YS7A 2B63H 1GSOA 1QOHA 2EY6A 4ILWA 4LFAQ 3H15A 5L9XA 1MJCA 2ASDA 1PXUA 3MEHA 1JB7A 4KHPL 1XMQL 3HS0C 3ORQA 2CKZB 4DAYB 2A6ED 1EYAA 3CVZA 2PNRC 2KHIA 1HA6A 2YL2A 5M9OA 2E74C 2YZMA 3E6ZX 1UEBA 2BH2A 4KJNA 2XGTA 2K1BA 3MWDA 3GTMH 4LFBQ 3I91A 4GNXA 5HY6A 3CPFA 3WWVA 4OO1H 4A93G 2R86A 5CV6A 2KCMA 2RDGA 4ECUA 3TMEA 4JI0Q 4G3IA 3TP6A 3SK5A 4UP7A 4MV8A 5TSSA 5EBCA 4FU0A 5GONF 4F4ZA 1PZJD 4DK1A 1TY0A 1QZHA 1MSGA 3CP0A 2I5MX 1IBMH 1I50H 2WKDA 3DEOA 1N32Q 3DHQA 1Q12A 1ILQA 4MAMA 3QZ8A 1UNNC 2W9BA 4OO1G 1HA5A 5C44G 2R7ZH 1PV4A 1SYGA 2FPGB 2Q2TA 1VMPA 1HR0H 4F87A 2EXZA 4APVA 4A3KG 1PH1A 3LMLA 2Z8LA 2JA7G 3TP7A 5KFQA 2EZVA 1CKOA 3NENA 3J81E 1K1QA 1WSCA 2NWGA 4XQQA 1K8MA 3GP7A 2R7ZB 3GTOA 5FKAC 1IZ6A 2WAQE 2QF7A 3S17H 2QDBA 1XNQH 2PZUA 3B6YA 4BBSB 1G291 4U7CA 1YJWA 4A3MB 3GV3A 3G6YA 2EYPA 3CRLC 3I12A 2JEIA 3T51B 3GTLB 1C8CA 3E0JA 3KLWA 1ZHSA 3MJFA 4WFN3 3T1HH 2KEEA 1S3OA 4DF7A 5JPNC 4JV5L 3S9WA 4HMIA 1EUCB 1WTPA 4YJ2F 1LTSD 2I46A 2NU7B 3RF2A 2KHSA 3S15B 4IWYA 2UVWA 2QEXA 1ENFA 1K9MC 4G57A 4AIMA 2R61A 3QB3A 4U673 1G51A 2MO1A 2RSOA 3S1RB 2F0PA 1EZ6A 4GOPA 2WYOA 5EZYF 3T1YH 1X3PA 2IT1A 2VNUD 1EYZA 5C5LA 3FDSA 1VQLA 1CM9A 5C0XG 4H7BA 4LK1C 1EY4A 3ZJYC 2R92H 5T14A 3OTOQ 1HTLD 4LUOA 3OWEB 1CHPD 2HQLA 2GPSA 3RFCA 2R7KA 3GTOB 4YIJA 5KT3A 4KJOA 4RH6A 3ULJA 3GIQA 1TAEA 3G6XA 5C3EH 4I55F 4QF4A 3PR5B 1YI2A 2FK2A 1KRSA 1K8AC 4PMWA 4A3MG 2ZTDA 1JR0D 1KXLA 2UXDH 1Y8NB 4DNTB 2G5DA 2C5CA 3J81i 3VA5A 4UP9A 2UXBQ 2L5TA 3SXHA 1I6HH 1UE1A 4ECWA 3OMCA 5CBAE 4RZQA 4ZQIA 3GTKB 2FJ2A 3C46A 1KJJA 4DR1H 2HVRA 2UU9Q 1PTOB 1VQAA 3BJYA 3A8IE 2MUYA 3DWPA 3KF6B 3K59A 1HHVA 1HNZL 2WAQA 1I3QA 4JI7H 1L1OB 2EYJA 4DL2A 3F2CA 5KT6A 4OX9Q 3FMAA 3BVGA 5CAEB 5KFYA 2ZT9C 2M2LA 4HJ9A 3RLOA 1PZID 4CC6A 3NWTA 3WOFA 1XTCD 1JDBB 4NXNQ 3CQZA 4IRCA 4YJ3F 1WTHA 4A3FH 1S68A 4LWCA 1C4QA 4KN4C 3MAQA 4LF5Q 3TS2A 2YRWA 2LMCB 4EFEA 1Y8OB 1U4LA 3MC0B 4RGTA 5CC4A 1Q3LA 2YW2A 2CQOA 2Z6BA 4IJHA 1FNWA 2K4KA 4S3SA 2CQYA 1DIKA 3A0JA 2VUMA 4P72A 2VUMH 3R5FA 2OEOA 2L55A 2R87A 4B3ML 2DPIA 3KXYT 1SRUA 2OQ0A 1KDCA 1PTOC 2L4NA 3PO3G 2R84A 1M8AA 3MVVA 3TS0A 3T5KA 5G3LD 3E9HA 1YJ9A 2XWJB 3FMCA 4RB0A 2J6SA 2D9UA 5GADC 3BYYB 3CRKC 1AH9A 2L15A 5AJ3Q 1Q7YC 1NJIC 4K0KQ 2R7MA 1X3EA 3FPUB 1OO9B 1WD1A 3QIAA 3QOLA 4FO2A 1SCUB 4DV4H 4Y52H 5F2DA 4YCWA 1Y1WB 4GKJH 4JOIC 1F2LA 1B04A 2YYZA 1NSNS 4LF4Q 5F9NA 2UXBL 1CK1A 3PZPA 1JOOA 5KEEA 1B3QA 3H4BA 2KHJA 2C2EA 2FLNA 5IYDH 3KLSX 4B3MH 4UY8C 2ZXRA 3I4LA 2RCNA 1EHIA 3VR3A 5IGBA 1X32A 2BOSA 3CKIB 4LF7L 1XMQQ 3I4MB 4A3IG 4A3EB 3HP3A 1W3SA 1GUOA 4B3SL 3L0OA 1DD2A 4JI1H 2AWNA 3GV5B 4IUQA 1YHBA 3EQLC 1JB3A 5IYDG 2K6AA 3OTOL 3F2BA 2F3IA 5KG6A 3GTJA 2PW7A 3JRXA 2YRXA 3RLNA 1LT3D 2DGYA 4K6DA 1IKLA 1B53A 2B2TC 4XZ3B 2ASBA 4GKKQ 4C3IB 4LFBL 2B63B 1EIFA 1RKNA 2R7ZG 4A3LG 4HIMA 4HMJA 1AUXA 3PN1A 3AB9A 1EZ8A 1PH9A 4XYMB 4R8UA 1E1OA 1TS5A 4J9LA 4K5VA 1HNXQ 4JI7L 3CW2C 4LNQA 4BXXH 5EPLA 1BBXC 2BDNA 1E24A 2OTJA 4UHVA 5I9PA 3QR8A 1PRTB 3TQTA 5E4XA 4HAEA 2V9WA 4QIWB 1BNZA 3SE0A 4HNTA 4J9OA 3ER0A 3HKZB 2OQKA 2R6GA 1SYDA 4ZKCB 4ZHQF 1U9RA 1XMOQ 5FO9B 2BE5C 1B50A 3HOYH 1YHQA 3HOUB 3PSIA 3ERQA 1SN8A 3KLRA 1XNRQ 1EY5A 3RUPA 2IP4A 3LX0A 1TWCB 3RZOB 3KHGA 3D3RA 5FO7B 4NXNL 3DM3A 3CPWA 3EPIA 5LHY1 1JC7A 1F77A 4DK0A 3H20A 2R8HA 3VYUA 1CKMA 4EFBA 3K5MA 1I4XA 1Q82C 1GYFA 4HIKA 5LMUQ 1JCKB 3I72A 3JC66 1HNXH 2E8GA 1D1KA 2EQSA 4LF4L 1Q8KA 2KEDA 4RB2C 2R8GA 4O0AA 2NU6B 1O80A 1CA6A 3RGZA 4IUVA 3SK6A 5BN5A 2OTLA 4C3IH 4B3MQ 2NVQB 5KRUA 2SCUB 5LOVF 5I47A 4ECRA 2AUKA 5KFZA 3K5LA 3M9BA 4L5QA 1BCPD 2JA5A 2VPQA 5FLMH 2VZAA 2I07B 4DV4Q 4DR2Q 3K0YA 5C5JA 4C2MH 2V1CC 3QOJA 1JOQA 2PI2E 2NVQH 2YCHA 5LMNL 1EU4A 4Q45A 3PO2G 4JI8H 1T94A 1I6HB 1IBLL 1QJOA 5ELFA 4R8NA 1CSQA 1HCZA 2XGQA 1BCPC 5AFWA 4E6IA 4EQPA 1OXUA 3KBGA 4JI6L 1ILPA 4GOPC 3L4JA 5CV7A 5C6AA 1D8LA 4HR7B 1WCMA 1TWCA 1H9JA 1MBYA 5K2MA 5M3MH 3N52A 1EIHA 1EUJA 2ZM6L 3UE1A 1O7IA 1D5ZC 2JJQA 4L8JA 3N42B 4BXXG 4Q44A 1CA5A 3Q24A 1H95A 2UXCQ 1DOLA 1C48A 3CAMA 5EBDA 5L1KA 1F9PA 4B9XA 3PV0A 1EY0A 2PW5A 4OIKA 1ASYA 4OO1I 2WB1E 2W8LA 2IJ0A 1JE4A 1K28A 1ZQ7A 3U58A 3UE0A 4JW0A 3RV3A 1C30A 3TIGA 4A3BB 3K5IA 5D14A 4K14A 2A6HD 2JA9A 4MV9A 5DLQE 1SNPA 1YNJD 2RKSA 2Q2IA 4DR1Q 4EBDA 1IBKQ 1HNWQ 5IT9W 1T3NA 2BA0A 4NP5A 1B6SA 5KYIA 2VW9A 3T13A 3BVZA 5HURA 4XQNA 2JEJA 4IQZA 2JA6G 3E5NA 1EOVA 3S1QH 2VQFQ 3T1YL 4J8QA 4YWKA 5J1ZA 3SK4A 4RNOA 1X3GA 4UFZA 4ZCKA 1H9KA 4BWSC 4IHJF 3H3VI 4HYKA 2F0JA 2IHEA 4A2BA 1PH6A 2R92G 1G8ZD 1Q1EA 1UE6A 2NUAB 3HOZH 4CKBA 1GLVA 2L0CA 1SMYD 1JOKA 3CCEA 4PDBA 5IT9E 4YB8B 1HXYD 1RD9D 1I94Q 3PW5A 1Y69U 1RJQA 4JI6Q 5CB4F 4NLGA 2AQ4A 4OWXB 4JV1A 5C1OA 1SYXB 4HJ7A 2XD4A 1R4QB 5E4WC 1T36A 4QW8A 2RDFA 1D5MC 4APMA 1LTAD 2B2YA 3K7UC 5E7NA 5LMNW 3T16A 5EPJA 1VQDA 1VQIA 2JA8H 1ZEQX 3OYYA 1Z2PX 4LFBH 5FO8B 3DMUA 4DK3C 3QFFA 3H0GB 4JV0A 3H0GH 4C1NK 2G9DA 4V190 2VY3A 2F0KA 1AN7A 2R7ZA 2NVTH 4ZYSA 1UE7A 5LMUL 4N9TA 5KFVA 1DGSA 3OSPA 4UAIA 3I8ZA 3OPOA 3KDFA 1A0IA 3DF7A 4R4CA 1C9OA 3W5OA 4X65Q 4BA1I 1BXRA 3KTMA 1CTMA 2PCFB 1WJJA 4AYBG 4F88A 1JDEA 2BQRA 1IBKL 3K7AH 3FEWX 3JSLA 1P8LA 1GM5A 3KHLA 2Y0SA 4TQSA 4N8X1 5KT2A 1S5ED 1K0RA 3GIDA 1ENAA 4HSVA 5EGTA 1M0TA 3J7YW 3RN5A 4GLAC 2KQ3A 1D5XC 4KV6A 4RAUC 4G7OC 2LY7A 4BY7H 4DFAA 4Q5VA 5JOBA 3BABA 4HNUA 1AEXA 2XRSD 1S0NA 2EJGC 1B9NA 3NTIA 1WFQA 2EPBA 1JJGA 1Y8PB 2PQAA 5ELEA 4IN3A 3M3YB 2LSSA 2XGPA 1SFOA 4EYHB 4QJFA 3JAML 2ATWA 4O2DA 1PVOA 2B2WA 4TQUS 3C1EA 3A8KE 4JBJA 4QB4A 5C4XG 4A93H 4AYBB 3OSOA 5KNBA 3DXJC 2KBNA 4I50F 1PRTD 4MV1A 4JI5H 3TSSA 4RCNA 4XT3B 3I73A 3G48A 4Y7NH 5C3EB 1JJ2A 1XNRL 3HOZG 4ED2A 1FYCA 2VQEL 2GVBA 1PA6A 4X64H 4YWLA 2QYZA 4UCVA 2H1EA 5J2TF 1ET6A 3KOJA 4ID6A 4CDCC 4WJWA 5KG0A 2ENBA 2X69A 2F0MA 2AGQA 1H9SA 1IW7D 2PZTA 4A3IH 3OUUA 3EJIA 5IT9L 2IMWP 3M4OH 2EIFA 5KIXA 2B8GA 3J7AF 1N34Q 5KFPA 3HOWB 2K28A 2DLNA 3HZXA 1VQKA 2NYZD 1TIID 4IJLA 1RHPA 3A55A 2PVPA 2UUAL 2NB0A 3I90A 1SLJA 3HOZB 1N36L 2F0UA 1ULZA 5KFHA 4ECQA 2C9OA 3MA2B 1MSHA 1B4OA 3F8NA 1SYFA 4YAJB 4AYBA 1K3BC 1NY4A 1T5XD 2XNAC 1Q8IA 3H6MA 2DZDA 4OHJA 4IZOA 5DLGA 2QEJC 2PYKA 4UCOA 4MTKA 5DG8A 4RHSA 4LF8Q 4B3RH 1RCVD 5IYCH 1BCPF 1WVLA 3N6XA 4DR4L 5KFBA 3GTKA 4DV7L 4C1NI 1CHQD 4B3TQ 1RYRA 4R9WA 1CS0A 3NBHA 5LMNQ 4R4OA 5A2QL 5FD6A 3K3VA 4FDBA 1SE2A 4DV2H 5EPKA 3F2UA 2CW0C 1VQ4A 2AU0A 1K83B 4EG0A 4LSAA 3WO0A 4XDXA 4DR6Q 3M4YA 5FLXc 1XDNA 1QB5D 3RJ0A 2W9CB 1KRTA 1OTCA 1K8GA 5LP6F 4GKJL 5DQIA 1NMGA 5D8DA 1TWAA 5EAYA 1QUQB 2YV5A 1OXTA 2HDLA 2R8IA 4DR3H 2CW7A 2V5AA 4DGZA 1BF4A 2XIWA 5ISRA 5KFUA 4DV6L 2G9HD 1LTTD 4DAVA 1Z9FA 2QGQA 2E2HA 5CV9A 5BN4A 4R4TA 1ESRA 2HHHL 3BU2A 4RA8A 2KECA 5JJLA 1K83A 5KFJA 4A75A 2W9AA 5I4DA 3HGBA 1Z2OX 4LF6L 5C5MA 4KY6A 5CR3A 1CQIB 4RB3C 3D4RA 4OEMB 5FLXE 3OUZA 3HOUH 3HOYB 4IRKA 2CFMA 3GTPH 5FOBB 1R9TB 2E2HH 3GTMB 3J7A5 1ICWA 1QUQA 1VKZA 3EA6A 3URYA 4WD3A 2UVRA 3GTLA 2DIKA 4XYOA 4IFDI 1VQCA 1Q90A 2I5LX 1P16A 1IYJB 4P75A 5C4JB 3PW4A 1B70B 1F9RA 5DM63 3GIPA 4KKUA 2WINB 4K8IA 2HGSA 4POGA 3CCSA 2WTFA 4MIUA 1MD2D 2PMZA 2CQAA 2A1AA 2KA7A 3BAAA 1EYCA 2JA7H 4BBSG 4EQOA 2JA7A 4ZOLF 1HR0L 3MXNA 4DR5H 3NBHB 5L37A 5JVDF 2UUBL 3H09A 2VA3A 4JUZA 4F8MA 1GOZA 4DR6H 1NBWA 3MWYW 4FF2A 3SK8A 4NXML 1VBGA 4X66H 1PYSB 3EYYA 1SBBB 3PF4A 5F9LA 4Q8FA 3IG0A 4LSXA 4RNMA 4ME5A 3PUWA 1KD1C 4LF7Q 3RGXA 4I7HA 2UVUA 5BPHA 3RAQA 2M00A 1E4EB 1HUMA 1Q86C 1F2YA 1I4GA 3GTOH 2I87A 2NZ1D 3BJUA 4J0MA 4TQRA 2I80A 2AGOA 1B9MA 2YTVA 3PIOA 4RGMA 3I4MG 4QIWE 4O1NA 4G4KA 1LACA 2A6HC 4CHTB 4JYAQ 4B08A 2FPIB 3PUZA 3HOWH 2K5HA 1Y1WH 4DL6A 4K8JA 1PMRA 1AN8A 1QILA 1TY2A 2EY1A 1BUVT 5FPRA 4GKKL 2SNSA 4FF4A 1C3OA 5FD5A 2FINB 2MJ8A 4X64L 4MTEA 5KFTA 4DL3A 3S1RH 1GGOA 1F2MA 1V43A 5KFDA 1H9MA 1MHWC 1N36Q 5BN3A 2W6PA 2A68D 3M4PA 2YU9H 1N33Q 5IODA 4FBTA 4AH6A 4NXMQ 1I94H 2PMZB 3H3VC 2P0AA 4JCVE 1XX8A 2B2VA 3FKIG 1QZGA 2UUCL 2X0SA 4PZ8A 1SFOB 2VUMB 4XXEA 3PF5A 5M3MG 2K03A 4UPAA 4Z9CB 1EU3A 1XJVA 4YCVA 3HOVB 2FB9A 2BR0A 3C0FB 2PQAB 1TWHA 4JPBW 5HV6A 5GAEC 4A3MH 3RZDB 2R3ZA 4QWDA 1KEEA 2YU9A 2W70A 1EIGA 1VQGA 3TIIA 4DA2A 4KI0A 4GKJQ 2EY5A 1PFNA 1G6PA 2NVYA 2M05A 1UC9A 1EWIA 4DUZL 2BH8A 4N8FA 1S0MA 3MXUA 4CJ1B 1RK6A 2CH4W 3KF6A 1NCVA 1LM0A 5EKKA 1RJPA 3I2ZA 1KLUD 2VQEQ 3Q1KA 1IYVA 4K2KA 3GLKA 3U9OA 3KFUA 4GS3A 2W6QA 3C1FA 1IOVA 3OHAA 2JA6A 3QWNA 3RMHA 3K58A 3PO2H 3ND8A 1I7NA 3S14H 1I50B 4JI1L 4WJ3M 1KABA 4CKEA 4DR2L 2HDMA 5D65A 4A3GH 1FGUA 4TKOB 2EVBA
chains in the Genus database with same CATH topology
2R7ZG 3F2DA 2NN6I 2OCEA 1X55A 4HIMA 3HOWG 4DV5L 4A3LG 2E5LL 4DV2L 1PH9A 2K14A 4XIGS 3J81c 3BZKA 2R93H 1E1OA 2LXJA 1JMCA 1HNXQ 3STBC 4JI7L 3CW2C 4LNQA 4BXXH 2Y0SE 2OTJA 1E24A 1HNXL 3HOUG 1BBWA 4DR1L 4WJ4A 2ALYB 3JAMi 4X66L 1X54A 1BVSA 3ER0A 4AQYL 2OQKA 2R6GA 1TWAH 2ZTCA 2Y0SG 2CWAA 2WAQG 1XMOQ 5IWAQ 4KLKA 1K3RA 4DV3Q 3T1YQ 3TEHB 1YHQA 3PSIA 3HOYH 4BY1H 4GOPB 1SN8A 1XNRQ 4B3SQ 2ZM6Q 4L5RC 3S16H 4KHPQ 3TRZA 1VQ7A 2XTIA 4NXNL 3DM3A 3CPWA 5FJ8G 2KCTA 4YY3Q 4A3JH 4EX5A 4QGUA 4A3DH 3HOYG 1CKMA 1KAWA 2DUDA 3HKSA 2HIVA 2C35B 1Q82C 4HIKA 4JBWA 5LMUQ 1HH2P 3JC66 2D0PA 2E8GA 2EQSA 4LF4L 3T1HQ 1Y1VG 1Q8KA 4DR7L 4JI0L 4O0AA 2UUAQ 2YTYA 1Y14B 1J5EL 2OTLA 3W1BA 1E7ZA 4A3EG 4C3IH 4X65L 4B3MQ 1QVFA 1W2BA 3EBEA 1CUKA 1XNQL 4A3BG 4B3RQ 2ZJRA 3M9BA 4L5QA 2NN6G 1Y1VH 1XNQQ 5FLMH 2VZAA 2VQFL 4KHPL 4A3KH 1YITA 4BY7G 4DV4Q 5GAGC 4DR2Q 5IY0A 1TXYA 3U4VA 4YHHL 2B3GA 4C2MH 4JI4L 4JBKA 3KJOA 2ZJQA 5IP7G 2WB1G 2V1CC 4X62Q 4A3DG 2PI2E 2NVQH 4OWTB 4LF6Q 5LMNL 3CCUA 3PO2G 1AE3A 1CSPA 3E9IA 1HJPA 2F4VL 4L5TA 1IBLL 1HR0Q 5IYBG 4DR3L 1N33L 3J81j 5JJKA 1CSQA 2VS1A 4H02A 2N78A 4YWMA 1T9HA 2K50A 2PNHA 2B29A 2VUMG 2Z6KC 1OXUA 4JI6L 3SGIA 4GOPC 1V9PA 2N49A 4MTNA 2A19A 4R4QA 1N32L 1L1OC 1D8LA 1MKHA 3L2PA 5C3EG 5M3MH 1N8RC 4LFBL 1KC8C 1J5EQ 3FKIH 5M3FH 4MNOA 1EUJA 3PIPA 4NPSA 2ZM6L 2VL6A 1YNXA 1O7IA 3GO5A 3UE1A 1SFOH 3CF5A 3PO3H 2UXCL 1MIUA 2AWOA 2JJQA 5H1SE 4BXXG 2AKWB 1H95A 2UXCQ 3CAMA 1I5FA 3STBD 5C0XI 3I7FA 2MO0A 1A8VA 2AHOB 3HFZB 1R9TH 3PV0A 3HOXH 1YJNA 1HR0W 4A3GH 3CXCA 5IP7H 2GN5A 4JOIA 5IE8A 1ASYA 4OO1I 1JJCB 4LF5L 1LUZA 2WB1E 3RNUA 1KQSA 4X62L 1RIPA 1E22A 5M5WH 1EFWA 1YHAA 4J15A 4DV5Q 3U58A 3MXNB 1FL0A 1SR3A 3UE0A 2E2IH 4DAMA 1QVCA 3PGZA 2NZHA 1M90C 1ASZA 2JA9A 1CKNA 3L7ZC 2ZJPA 5M5YH 3JAMc 5DLQE 3UDXA 2Q2IA 4OXPA 4DR1Q 1YIJA 4TVAB 1IBKQ 3HOXG 4OX9L 1HNWQ 2BA0A 4DV6Q 3K8AA 1VQ9A 3ULLA 2VW9A 1A62A 1WI5A 3KDFB 5JEAG 2JA6G 1VQNA 1RL2A 1EOVA 3S1QH 1JE5A 1OXVA 2VQFQ 4DV3L 4YWKA 1IXRA 3T1YL 4IPHA 3CCLA 4GLVB 4A3JG 1PH5A 1X3GA 3J80c 1Q81C 4KHZA 4DV2Q 4IPCA 3J80i 3AFQA 3H3VI 3K80C 3RLFA 2IHEA 3KJPA 1PH6A 1GVPA 1IBLQ 1FJGQ 3HOZG 4GNXC 2ZTEA 2R92G 5C4JH 1Q1EA 1UE6A 2N3SA 2JA8G 3HOZH 1PH2A 3G71A 3H3VH 3MEFA 3U4ZA 2R7DA 3CCEA 2N8NA 1I94L 4EQ5A 2JQOA 2Z6KA 5BR8Q 5IYBH 2B63G 4BA2I 4JBMA 4A3CH 1S72A 5JJIA 5C4XH 1I94Q 3GTLH 4JI6Q 4NB3A 1TWHH 4OWXB 3T1HL 2K5VA 1WCMG 1XMOL 4HJ7A 3UDGA 2UUCQ 1NTGA 2YTXA 4YCUA 1WOCA 3OW2A 4PZ7A 1PFSA 3K7UC 5E7NA 5LMNW 3I56A 4B3RL 1VQDA 1VQIA 4R1JA 5M5XH 2JA8H 3OYYA 3I4MH 4JYAL 4LF9L 1N9WA 3S15H 1D7QA 3LGJA 4DV1L 4DK3C 3RZOH 3CMEA 1CKNB 3H0GH 1JT8A 1N34L 2VY3A 2F52A 2HIXA 2NVTH 1VQOA 1UE7A 3U50C 5LMUL 4IOAA 4A3FG 1DGSA 3AQQA 5C0XJ 2E5LQ 4AYBE 4X64Q 2WP8J 4L5SA 1GD7A 1A0IA 1HZCA 3A5ZB 3KDFA 4OWWB 4R4CA 3TQYA 4DR3Q 4JI7Q 4HJ5A 1C9OA 3W5OA 1XTDA 4BA1I 4X65Q 3RN2A 4LUZA 5ELNA 1XPOA 1BBUA 1YBYA 1K73C 1PH7A 5FJ8H 1SMXA 4DK6C 4BBSH 3BZCA 4RMFA 1WJJA 4AYBG 4JI2L 1VCIA 3GTJH 3D0FA 3K7AH 1IBKL 1P8LA 2MFIA 3I55A 1GM5A 3ICEA 4GN3B 1IL2A 4ALPA 1X9NA 1K0RA 1LYLA 3NEMA 4PZ6A 3RN5A 2WFWA 1X65A 4GLAC 1KL9A 5GROA 1M1KC 1AE2A 4DUYQ 1C7YA 5K36G 4BY7H 1X6OA 1X3FA 2Q2UA 4LF9Q 1WFQA 4A3BH 4JC0A 4K0KL 1JJGA 2PQAA 1VQMA 4GNXB 3HKZE 1VQ6A 2I0QA 3GTKH 4IPDA 2LSSA 2UUBQ 4DNIA 1Z47A 3A74A 4QJFA 3GTGH 1EQQA 2CWPA 2ATWA 4O2DA 1PVOA 4AQYQ 1UE5A 1C0AA 2LXKA 4TQUS 4JBJA 2ES2A 5C4XG 5IP9H 4A93H 1X56A 1TWCH 2H5XA 2B63H 3CCQA 4LFAQ 4P71A 3H15A 1MJCA 2KBNA 1JB7A 4PG3A 1BKBA 3I4OA 3D31A 1E3PA 1XMQL 3G48A 4Y7NH 1JJ2A 4DV7Q 1XNRL 4IO9A 2CKZB 2K52A 4DAYB 2GVBA 2VQEL 2IHFA 1PA6A 1PH4A 4YWLA 4UP8A 5GAHC 2HT1A 2MQHA 2KHIA 3KOJA 2NZOA 2NVXH 1U0LA 4A3EH 1UEBA 4DV4L 1OXXK 2BH2A 1B7YB 4A3IH 2XGTA 4DPGA 4IPGA 3GTMH 4DR6L 3H0GG 2GVAA 1PYBA 3M4OH 4LFBQ 2EIFA 4GNXA 5HY6A 3CPFA 3WWVA 1N34Q 2R7FA 5IP9G 4A93G 2KCMA 1VQKA 4IJLA 4JI0Q 3CCVA 4HJAA 4UP7A 1E1TA 2UUAL 1SLJA 4JI5L 1N36L 1QZHA 3CP0A 3VDYA 2I5MX 1YZ6A 1EYGA 4ME3A 1I50H 4GN4B 1N32Q 1NY4A 4X66Q 1Q12A 3CCJA 1Q1BA 1Q46A 4JI2Q 4OO1G 4R4IA 5C44G 2R7ZH 4JI1Q 4LF8Q 4LFCQ 1KHIA 4P73A 1PV4A 3AYHB 5IYCH 3AEVA 3RR5A 2Q2TA 4RG1A 4DV7L 4B3TQ 4DR4L 5ELOA 4APVA 4A3KG 1PH1A 1VQFA 5LMNQ 4DR4Q 4R4OA 4GLXA 3TREA 2E2JH 2JA7G 4FDBA 3PCOB 3K81C 2Q2HA 4A76A 1VQ4A 1CKOA 3NENA 3IRBA 4DR6Q 5M3FG 5FLXc 1IZ6A 2WAQE 1L0WA 3S17H 1QVGA 1KRTA 3B6YA 1OTCA 1G291 1K8GA 1YJWA 4GKJL 2UXDQ 1NMGA 2IX0A 2JEAI 5EAYA 2NVYH 1QUQB 4MZ9A 2YV5A 4DV0L 1HZAA 1OXTA 4OONA 4A3GG 1VS0A 3ERSX 5IWAL 3HOVH 3KF8B 2RF4A 4DV0Q 3KLWA 3EN2A 1HNZQ 1HNWL 3PUYA 4BBRH 4DV6L 1S3OA 3F8TA 4XTCS 1HZ9A 3M7NA 3FHWA 1Z9FA 4JV5L 2QGQA 4C3JH 4JV5Q 1IBML 2AMCB 1XPRA 1B8AA 4R4TA 2QEXA 1MJEA 4DKAC 2HHHL 3BU2A 5JJLA 4A75A 1VQHA 2A8VA 1K9MC 4AIMA 4LF6L 1G51A 1NE3A 2MO1A 1EQRA 4QY7A 2IX1A 4IFDG 4DR7Q 3AFPA 3M4QA 2FXQA 4GOPA 3I4NH 2RHQB 1GO3E 1K83H 2IT1A 3HOUH 2VNUD 3S2HH 2CFMA 3GTPH 4HJ8A 3HOVG 3G4SA 1VQLA 4P74A 2E2HH 3J7A5 5C0XG 3NELA 1QUQA 3Q8DA 3ZJYC 2R92H 4HIOA 1LTLA 3OTOQ 4BBRG 4LUOA 3CC2A 5HGQA 4IFDI 2HQLA 1VQCA 2I5LX 1IYJB 1P16A 4P75A 4B3TL 1B70B 3E0EA 1EIYB 1L1OA 4DUYL 4JI8Q 3ULJA 4POGA 3KYHC 3CCSA 3W1GA 4JI3Q 5C3EH 4QQBX 1YI2A 1KRSA 2A1AA 1K8AC 4JI3L 4PMWA 4A3MG 2ZTDA 2D62A 3A5UA 2JA7H 3GDEA 1WYDA 3S2DH 4BBSG 4A4IA 3CMAA 1HR0L 1KXLA 3NBHB 3J81i 4BY1G 4UP9A 2UUBL 2UXBQ 2IY5B 3CCMA 5IYCG 3S1NH 1J6QA 1NBWA 1I6HH 1I3QH 1UE1A 4NXML 1KIXA 1PYSB 1VQEA 1WCMH 2JEBI 3M3YH 3PF4A 4GN5A 3K0XA 4LFAL 3PUWA 3RZDH 1KD1C 2UU9Q 4LF7Q 1VQAA 4DUZQ 3KF6B 4HIDA 1S40A 4POFA 3CQZH 1Q86C 1HNZL 1VQBA 1L1OB 5C44H 3BJUA 3GTOH 3S1MH 3F2CA 4OX9Q 2YTVA 3I4MG 3PIOA 1TWGH 3UDIA 4QIWE 4HJ9A 3RLOA 3G6EA 3ULPA 4JYAQ 2EXDA 3CCRA 3PUZA 4NXNQ 3HOWH 4A3LH 3GD7A 4JG2A 1YVCA 3UDFA 4A3FH 4LWCA 2K5HA 1Y1WH 1SROA 4LF5Q 3DLLA 3TS2A 5JEAJ 1IBMQ 4JI4Q 4C3HH 4DR5L 4GKKL 1GKHA 3PUXA 1PH8A 2JA6H 4X64L 1YEZA 2CQOA 1OXSC 4IJHA 2K4KA 3S1RH 1FJGL 1FVIA 1V43A 1N36Q 3CC7A 4JI5Q 1HZBA 2Z0SA 3A0JA 3GTQH 2K75A 4P72A 2ID0A 3M4PA 2YU9H 1N33Q 2VUMH 2JE6I 4B3ML 4IFDJ 4AH6A 4NXMQ 3I4NG 1PHJA 2OWOA 1V1QA 5BR8L 1SRUA 2I5HA 2OQ0A 4JCVE 3HKZG 3PO3G 3F1ZA 1VQPA 3TS0A 3E9HA 4LFCL 3CC4A 3FKIG 1QZGA 2UUCL 4PZ8A 1VQ5A 1YJ9A 4A3CG 3PF5A 1L2FA 4UPAA 2BA1A 5M3MG 1XJVA 4YCVA 5GADC 5GQOA 1VQ8A 4LUVA 2PQAB 1AH9A 2L15A 3J7ZC 4JI8L 1PH3A 5AJ3Q 1Q7YC 2R93G 1NJIC 1XPUA 5GAEC 1SE8A 1X3EA 4A3MH 2F4VQ 4K0KQ 1U5KA 2JK8A 5AJ3L 2KENA 3EIVA 1TWFH 3CD6A 1VQGA 4DV1Q 4Y52H 4YCWA 2HHHQ 4JOIC 2YYZA 2MNAA 4LF4Q 2PMZE 2UXBL 4KI0A 3M85A 4GKJQ 2UXDL 1G6PA 2KHJA 2UU9L 2JA5H 5IYDH 1EWIA 5IT9c 5J3BA 2RHSB 4DUZL 4IOCA 4UY8C 2BH8A 2RCNA 4X6AH 3KF6A 4LW1A 1LM0A 1XMQQ 4A3IG 4LF7L 3I2ZA 5FLMG 2K5NA 2VQEQ 1A63A 1W3SA 2QA4A 3FP9A 4B3SL 1NMFA 3L0OA 3PUVA 2AWNA 4GS3A 2D0OA 4QL5A 2PI2A 3KFUA 1YHBA 5IYDG 3OTOL 3F2BA 2JA5G 2F3IA 4YHHQ 3PO2H 2CCZA 3RLNA 2DGYA 3S14H 4JI1L 4YY3L 4LF8L 4WJ3M 2ASBA 1VQJA 4DR2L 4DR5Q 1Y1WG 1UWVA 4GKKQ 1FGUA 3S24A 1EIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7Z G;  3F2D A;  2NN6 I;  2OCE A;  1X55 A;  4HIM A;  3HOW G;  4DV5 L;  4A3L G;  2E5L L;  4DV2 L;  1PH9 A;  2K14 A;  4XIG S;  3J81 c;  3BZK A;  2R93 H;  1E1O A;  2LXJ A;  1JMC A;  1HNX Q;  3STB C;  4JI7 L;  3CW2 C;  4LNQ A;  4BXX H;  2Y0S E;  2OTJ A;  1E24 A;  1HNX L;  3HOU G;  1BBW A;  4DR1 L;  4WJ4 A;  2ALY B;  3JAM i;  4X66 L;  1X54 A;  1BVS A;  3ER0 A;  4AQY L;  2OQK A;  2R6G A;  1TWA H;  2ZTC A;  2Y0S G;  2CWA A;  2WAQ G;  1XMO Q;  5IWA Q;  4KLK A;  1K3R A;  4DV3 Q;  3T1Y Q;  3TEH B;  1YHQ A;  3PSI A;  3HOY H;  4BY1 H;  4GOP B;  1SN8 A;  1XNR Q;  4B3S Q;  2ZM6 Q;  4L5R C;  3S16 H;  4KHP Q;  3TRZ A;  1VQ7 A;  2XTI A;  4NXN L;  3DM3 A;  3CPW A;  5FJ8 G;  2KCT A;  4YY3 Q;  4A3J H;  4EX5 A;  4QGU A;  4A3D H;  3HOY G;  1CKM A;  1KAW A;  2DUD A;  3HKS A;  2HIV A;  2C35 B;  1Q82 C;  4HIK A;  4JBW A;  5LMU Q;  1HH2 P;  3JC6 6;  2D0P A;  2E8G A;  2EQS A;  4LF4 L;  3T1H Q;  1Y1V G;  1Q8K A;  4DR7 L;  4JI0 L;  4O0A A;  2UUA Q;  2YTY A;  1Y14 B;  1J5E L;  2OTL A;  3W1B A;  1E7Z A;  4A3E G;  4C3I H;  4X65 L;  4B3M Q;  1QVF A;  1W2B A;  3EBE A;  1CUK A;  1XNQ L;  4A3B G;  4B3R Q;  2ZJR A;  3M9B A;  4L5Q A;  2NN6 G;  1Y1V H;  1XNQ Q;  5FLM H;  2VZA A;  2VQF L;  4KHP L;  4A3K H;  1YIT A;  4BY7 G;  4DV4 Q;  5GAG C;  4DR2 Q;  5IY0 A;  1TXY A;  3U4V A;  4YHH L;  2B3G A;  4C2M H;  4JI4 L;  4JBK A;  3KJO A;  2ZJQ A;  5IP7 G;  2WB1 G;  2V1C C;  4X62 Q;  4A3D G;  2PI2 E;  2NVQ H;  4OWT B;  4LF6 Q;  5LMN L;  3CCU A;  3PO2 G;  1AE3 A;  1CSP A;  3E9I A;  1HJP A;  2F4V L;  4L5T A;  1IBL L;  1HR0 Q;  5IYB G;  4DR3 L;  1N33 L;  3J81 j;  5JJK A;  1CSQ A;  2VS1 A;  4H02 A;  2N78 A;  4YWM A;  1T9H A;  2K50 A;  2PNH A;  2B29 A;  2VUM G;  2Z6K C;  1OXU A;  4JI6 L;  3SGI A;  4GOP C;  1V9P A;  2N49 A;  4MTN A;  2A19 A;  4R4Q A;  1N32 L;  1L1O C;  1D8L A;  1MKH A;  3L2P A;  5C3E G;  5M3M H;  1N8R C;  4LFB L;  1KC8 C;  1J5E Q;  3FKI H;  5M3F H;  4MNO A;  1EUJ A;  3PIP A;  4NPS A;  2ZM6 L;  2VL6 A;  1YNX A;  1O7I A;  3GO5 A;  3UE1 A;  1SFO H;  3CF5 A;  3PO3 H;  2UXC L;  1MIU A;  2AWO A;  2JJQ A;  5H1S E;  4BXX G;  2AKW B;  1H95 A;  2UXC Q;  3CAM A;  1I5F A;  3STB D;  5C0X I;  3I7F A;  2MO0 A;  1A8V A;  2AHO B;  3HFZ B;  1R9T H;  3PV0 A;  3HOX H;  1YJN A;  1HR0 W;  4A3G H;  3CXC A;  5IP7 H;  2GN5 A;  4JOI A;  5IE8 A;  1ASY A;  4OO1 I;  1JJC B;  4LF5 L;  1LUZ A;  2WB1 E;  3RNU A;  1KQS A;  4X62 L;  1RIP A;  1E22 A;  5M5W H;  1EFW A;  1YHA A;  4J15 A;  4DV5 Q;  3U58 A;  3MXN B;  1FL0 A;  1SR3 A;  3UE0 A;  2E2I H;  4DAM A;  1QVC A;  3PGZ A;  2NZH A;  1M90 C;  1ASZ A;  2JA9 A;  1CKN A;  3L7Z C;  2ZJP A;  5M5Y H;  3JAM c;  5DLQ E;  3UDX A;  2Q2I A;  4OXP A;  4DR1 Q;  1YIJ A;  4TVA B;  1IBK Q;  3HOX G;  4OX9 L;  1HNW Q;  2BA0 A;  4DV6 Q;  3K8A A;  1VQ9 A;  3ULL A;  2VW9 A;  1A62 A;  1WI5 A;  3KDF B;  5JEA G;  2JA6 G;  1VQN A;  1RL2 A;  1EOV A;  3S1Q H;  1JE5 A;  1OXV A;  2VQF Q;  4DV3 L;  4YWK A;  1IXR A;  3T1Y L;  4IPH A;  3CCL A;  4GLV B;  4A3J G;  1PH5 A;  1X3G A;  3J80 c;  1Q81 C;  4KHZ A;  4DV2 Q;  4IPC A;  3J80 i;  3AFQ A;  3H3V I;  3K80 C;  3RLF A;  2IHE A;  3KJP A;  1PH6 A;  1GVP A;  1IBL Q;  1FJG Q;  3HOZ G;  4GNX C;  2ZTE A;  2R92 G;  5C4J H;  1Q1E A;  1UE6 A;  2N3S A;  2JA8 G;  3HOZ H;  1PH2 A;  3G71 A;  3H3V H;  3MEF A;  3U4Z A;  2R7D A;  3CCE A;  2N8N A;  1I94 L;  4EQ5 A;  2JQO A;  2Z6K A;  5BR8 Q;  5IYB H;  2B63 G;  4BA2 I;  4JBM A;  4A3C H;  1S72 A;  5JJI A;  5C4X H;  1I94 Q;  3GTL H;  4JI6 Q;  4NB3 A;  1TWH H;  4OWX B;  3T1H L;  2K5V A;  1WCM G;  1XMO L;  4HJ7 A;  3UDG A;  2UUC Q;  1NTG A;  2YTX A;  4YCU A;  1WOC A;  3OW2 A;  4PZ7 A;  1PFS A;  3K7U C;  5E7N A;  5LMN W;  3I56 A;  4B3R L;  1VQD A;  1VQI A;  4R1J A;  5M5X H;  2JA8 H;  3OYY A;  3I4M H;  4JYA L;  4LF9 L;  1N9W A;  3S15 H;  1D7Q A;  3LGJ A;  4DV1 L;  4DK3 C;  3RZO H;  3CME A;  1CKN B;  3H0G H;  1JT8 A;  1N34 L;  2VY3 A;  2F52 A;  2HIX A;  2NVT H;  1VQO A;  1UE7 A;  3U50 C;  5LMU L;  4IOA A;  4A3F G;  1DGS A;  3AQQ A;  5C0X J;  2E5L Q;  4AYB E;  4X64 Q;  2WP8 J;  4L5S A;  1GD7 A;  1A0I A;  1HZC A;  3A5Z B;  3KDF A;  4OWW B;  4R4C A;  3TQY A;  4DR3 Q;  4JI7 Q;  4HJ5 A;  1C9O A;  3W5O A;  1XTD A;  4BA1 I;  4X65 Q;  3RN2 A;  4LUZ A;  5ELN A;  1XPO A;  1BBU A;  1YBY A;  1K73 C;  1PH7 A;  5FJ8 H;  1SMX A;  4DK6 C;  4BBS H;  3BZC A;  4RMF A;  1WJJ A;  4AYB G;  4JI2 L;  1VCI A;  3GTJ H;  3D0F A;  3K7A H;  1IBK L;  1P8L A;  2MFI A;  3I55 A;  1GM5 A;  3ICE A;  4GN3 B;  1IL2 A;  4ALP A;  1X9N A;  1K0R A;  1LYL A;  3NEM A;  4PZ6 A;  3RN5 A;  2WFW A;  1X65 A;  4GLA C;  1KL9 A;  5GRO A;  1M1K C;  1AE2 A;  4DUY Q;  1C7Y A;  5K36 G;  4BY7 H;  1X6O A;  1X3F A;  2Q2U A;  4LF9 Q;  1WFQ A;  4A3B H;  4JC0 A;  4K0K L;  1JJG A;  2PQA A;  1VQM A;  4GNX B;  3HKZ E;  1VQ6 A;  2I0Q A;  3GTK H;  4IPD A;  2LSS A;  2UUB Q;  4DNI A;  1Z47 A;  3A74 A;  4QJF A;  3GTG H;  1EQQ A;  2CWP A;  2ATW A;  4O2D A;  1PVO A;  4AQY Q;  1UE5 A;  1C0A A;  2LXK A;  4TQU S;  4JBJ A;  2ES2 A;  5C4X G;  5IP9 H;  4A93 H;  1X56 A;  1TWC H;  2H5X A;  2B63 H;  3CCQ A;  4LFA Q;  4P71 A;  3H15 A;  1MJC A;  2KBN A;  1JB7 A;  4PG3 A;  1BKB A;  3I4O A;  3D31 A;  1E3P A;  1XMQ L;  3G48 A;  4Y7N H;  1JJ2 A;  4DV7 Q;  1XNR L;  4IO9 A;  2CKZ B;  2K52 A;  4DAY B;  2GVB A;  2VQE L;  2IHF A;  1PA6 A;  1PH4 A;  4YWL A;  4UP8 A;  5GAH C;  2HT1 A;  2MQH A;  2KHI A;  3KOJ A;  2NZO A;  2NVX H;  1U0L A;  4A3E H;  1UEB A;  4DV4 L;  1OXX K;  2BH2 A;  1B7Y B;  4A3I H;  2XGT A;  4DPG A;  4IPG A;  3GTM H;  4DR6 L;  3H0G G;  2GVA A;  1PYB A;  3M4O H;  4LFB Q;  2EIF A;  4GNX A;  5HY6 A;  3CPF A;  3WWV A;  1N34 Q;  2R7F A;  5IP9 G;  4A93 G;  2KCM A;  1VQK A;  4IJL A;  4JI0 Q;  3CCV A;  4HJA A;  4UP7 A;  1E1T A;  2UUA L;  1SLJ A;  4JI5 L;  1N36 L;  1QZH A;  3CP0 A;  3VDY A;  2I5M X;  1YZ6 A;  1EYG A;  4ME3 A;  1I50 H;  4GN4 B;  1N32 Q;  1NY4 A;  4X66 Q;  1Q12 A;  3CCJ A;  1Q1B A;  1Q46 A;  4JI2 Q;  4OO1 G;  4R4I A;  5C44 G;  2R7Z H;  4JI1 Q;  4LF8 Q;  4LFC Q;  1KHI A;  4P73 A;  1PV4 A;  3AYH B;  5IYC H;  3AEV A;  3RR5 A;  2Q2T A;  4RG1 A;  4DV7 L;  4B3T Q;  4DR4 L;  5ELO A;  4APV A;  4A3K G;  1PH1 A;  1VQF A;  5LMN Q;  4DR4 Q;  4R4O A;  4GLX A;  3TRE A;  2E2J H;  2JA7 G;  4FDB A;  3PCO B;  3K81 C;  2Q2H A;  4A76 A;  1VQ4 A;  1CKO A;  3NEN A;  3IRB A;  4DR6 Q;  5M3F G;  5FLX c;  1IZ6 A;  2WAQ E;  1L0W A;  3S17 H;  1QVG A;  1KRT A;  3B6Y A;  1OTC A;  1G29 1;  1K8G A;  1YJW A;  4GKJ L;  2UXD Q;  1NMG A;  2IX0 A;  2JEA I;  5EAY A;  2NVY H;  1QUQ B;  4MZ9 A;  2YV5 A;  4DV0 L;  1HZA A;  1OXT A;  4OON A;  4A3G G;  1VS0 A;  3ERS X;  5IWA L;  3HOV H;  3KF8 B;  2RF4 A;  4DV0 Q;  3KLW A;  3EN2 A;  1HNZ Q;  1HNW L;  3PUY A;  4BBR H;  4DV6 L;  1S3O A;  3F8T A;  4XTC S;  1HZ9 A;  3M7N A;  3FHW A;  1Z9F A;  4JV5 L;  2QGQ A;  4C3J H;  4JV5 Q;  1IBM L;  2AMC B;  1XPR A;  1B8A A;  4R4T A;  2QEX A;  1MJE A;  4DKA C;  2HHH L;  3BU2 A;  5JJL A;  4A75 A;  1VQH A;  2A8V A;  1K9M C;  4AIM A;  4LF6 L;  1G51 A;  1NE3 A;  2MO1 A;  1EQR A;  4QY7 A;  2IX1 A;  4IFD G;  4DR7 Q;  3AFP A;  3M4Q A;  2FXQ A;  4GOP A;  3I4N H;  2RHQ B;  1GO3 E;  1K83 H;  2IT1 A;  3HOU H;  2VNU D;  3S2H H;  2CFM A;  3GTP H;  4HJ8 A;  3HOV G;  3G4S A;  1VQL A;  4P74 A;  2E2H H;  3J7A 5;  5C0X G;  3NEL A;  1QUQ A;  3Q8D A;  3ZJY C;  2R92 H;  4HIO A;  1LTL A;  3OTO Q;  4BBR G;  4LUO A;  3CC2 A;  5HGQ A;  4IFD I;  2HQL A;  1VQC A;  2I5L X;  1IYJ B;  1P16 A;  4P75 A;  4B3T L;  1B70 B;  3E0E A;  1EIY B;  1L1O A;  4DUY L;  4JI8 Q;  3ULJ A;  4POG A;  3KYH C;  3CCS A;  3W1G A;  4JI3 Q;  5C3E H;  4QQB X;  1YI2 A;  1KRS A;  2A1A A;  1K8A C;  4JI3 L;  4PMW A;  4A3M G;  2ZTD A;  2D62 A;  3A5U A;  2JA7 H;  3GDE A;  1WYD A;  3S2D H;  4BBS G;  4A4I A;  3CMA A;  1HR0 L;  1KXL A;  3NBH B;  3J81 i;  4BY1 G;  4UP9 A;  2UUB L;  2UXB Q;  2IY5 B;  3CCM A;  5IYC G;  3S1N H;  1J6Q A;  1NBW A;  1I6H H;  1I3Q H;  1UE1 A;  4NXM L;  1KIX A;  1PYS B;  1VQE A;  1WCM H;  2JEB I;  3M3Y H;  3PF4 A;  4GN5 A;  3K0X A;  4LFA L;  3PUW A;  3RZD H;  1KD1 C;  2UU9 Q;  4LF7 Q;  1VQA A;  4DUZ Q;  3KF6 B;  4HID A;  1S40 A;  4POF A;  3CQZ H;  1Q86 C;  1HNZ L;  1VQB A;  1L1O B;  5C44 H;  3BJU A;  3GTO H;  3S1M H;  3F2C A;  4OX9 Q;  2YTV A;  3I4M G;  3PIO A;  1TWG H;  3UDI A;  4QIW E;  4HJ9 A;  3RLO A;  3G6E A;  3ULP A;  4JYA Q;  2EXD A;  3CCR A;  3PUZ A;  4NXN Q;  3HOW H;  4A3L H;  3GD7 A;  4JG2 A;  1YVC A;  3UDF A;  4A3F H;  4LWC A;  2K5H A;  1Y1W H;  1SRO A;  4LF5 Q;  3DLL A;  3TS2 A;  5JEA J;  1IBM Q;  4JI4 Q;  4C3H H;  4DR5 L;  4GKK L;  1GKH A;  3PUX A;  1PH8 A;  2JA6 H;  4X64 L;  1YEZ A;  2CQO A;  1OXS C;  4IJH A;  2K4K A;  3S1R H;  1FJG L;  1FVI A;  1V43 A;  1N36 Q;  3CC7 A;  4JI5 Q;  1HZB A;  2Z0S A;  3A0J A;  3GTQ H;  2K75 A;  4P72 A;  2ID0 A;  3M4P A;  2YU9 H;  1N33 Q;  2VUM H;  2JE6 I;  4B3M L;  4IFD J;  4AH6 A;  4NXM Q;  3I4N G;  1PHJ A;  2OWO A;  1V1Q A;  5BR8 L;  1SRU A;  2I5H A;  2OQ0 A;  4JCV E;  3HKZ G;  3PO3 G;  3F1Z A;  1VQP A;  3TS0 A;  3E9H A;  4LFC L;  3CC4 A;  3FKI G;  1QZG A;  2UUC L;  4PZ8 A;  1VQ5 A;  1YJ9 A;  4A3C G;  3PF5 A;  1L2F A;  4UPA A;  2BA1 A;  5M3M G;  1XJV A;  4YCV A;  5GAD C;  5GQO A;  1VQ8 A;  4LUV A;  2PQA B;  1AH9 A;  2L15 A;  3J7Z C;  4JI8 L;  1PH3 A;  5AJ3 Q;  1Q7Y C;  2R93 G;  1NJI C;  1XPU A;  5GAE C;  1SE8 A;  1X3E A;  4A3M H;  2F4V Q;  4K0K Q;  1U5K A;  2JK8 A;  5AJ3 L;  2KEN A;  3EIV A;  1TWF H;  3CD6 A;  1VQG A;  4DV1 Q;  4Y52 H;  4YCW A;  2HHH Q;  4JOI C;  2YYZ A;  2MNA A;  4LF4 Q;  2PMZ E;  2UXB L;  4KI0 A;  3M85 A;  4GKJ Q;  2UXD L;  1G6P A;  2KHJ A;  2UU9 L;  2JA5 H;  5IYD H;  1EWI A;  5IT9 c;  5J3B A;  2RHS B;  4DUZ L;  4IOC A;  4UY8 C;  2BH8 A;  2RCN A;  4X6A H;  3KF6 A;  4LW1 A;  1LM0 A;  1XMQ Q;  4A3I G;  4LF7 L;  3I2Z A;  5FLM G;  2K5N A;  2VQE Q;  1A63 A;  1W3S A;  2QA4 A;  3FP9 A;  4B3S L;  1NMF A;  3L0O A;  3PUV A;  2AWN A;  4GS3 A;  2D0O A;  4QL5 A;  2PI2 A;  3KFU A;  1YHB A;  5IYD G;  3OTO L;  3F2B A;  2JA5 G;  2F3I A;  4YHH Q;  3PO2 H;  2CCZ A;  3RLN A;  2DGY A;  3S14 H;  4JI1 L;  4YY3 L;  4LF8 L;  4WJ3 M;  2ASB A;  1VQJ A;  4DR2 L;  4DR5 Q;  1Y1W G;  1UWV A;  4GKK Q;  1FGU A;  3S24 A;  1EIF A; 
#chains in the Genus database with same CATH topology
 4A93 B;  2NN6 I;  2UXC H;  2FJZ A;  4GC7 A;  2R92 A;  2PPB C;  3J81 c;  3V96 A;  3BZK A;  4B3T H;  3SHL A;  1JMC A;  1GHJ A;  3PO2 B;  1JKJ B;  2YYA A;  3IFD A;  5IGF A;  1BBW A;  1QE6 A;  3IN5 A;  4WJ4 A;  2O5J C;  1U4P A;  2ALY B;  3JAM i;  3VPB A;  1X54 A;  4JV5 H;  4G7H C;  5I6Y A;  4MV7 A;  1V8Q A;  1D6E C;  5EOY A;  2Y0S G;  2CWA A;  3DWQ A;  4YR2 A;  1GXD C;  5FLX W;  1F9S A;  4IUT A;  4DV3 Q;  1LTI D;  4BY1 H;  4GOP B;  5CBE E;  2ZM6 Q;  3G7L A;  3TRZ A;  4HNV A;  1VQ7 A;  4JI4 H;  4IAL A;  3RD4 A;  1FD7 D;  3VR5 A;  3VYT A;  2K04 A;  5K5P A;  4A3J H;  4A3D H;  3HOY G;  1KAW A;  2DUD A;  2ATL A;  2HIV A;  3EVQ A;  2SDF A;  3FRP B;  1HH2 P;  5KGU A;  5EWE A;  1BR9 A;  3ND9 A;  4DV0 H;  1CQF A;  2YTY A;  4DR4 H;  1Y14 B;  2W71 A;  4A3E G;  4X65 L;  1AZP A;  3GTQ A;  3ONA B;  3EBE A;  4LH7 A;  2W6O A;  1XNQ L;  5BR8 H;  2HUG A;  4DR2 H;  1TWG B;  2NN6 G;  4DLK A;  2JEF A;  2VQF L;  1YIT A;  2F0H A;  2EJM A;  5GAG C;  2FMC A;  5IY0 A;  2FLL A;  4GC6 A;  1CQV A;  2F4I A;  4FVM A;  1IBK H;  1GSH A;  5CYU A;  4J9N A;  4F7X A;  2R8J A;  1LV9 A;  4KD3 A;  2FMA A;  4LF6 Q;  1I4R A;  5KFE A;  1CSP A;  3E9I A;  2I8C A;  5IYB G;  4HCE A;  1N33 L;  1FGB D;  2VS1 A;  1PX2 A;  4YWM A;  2R8K A;  2K50 A;  2EE1 A;  4UCS A;  2HJW A;  2P5Z X;  4O3O A;  4RCO A;  4NKL A;  4XYL B;  4MTN A;  1N32 L;  5DGA A;  3R93 A;  2XC9 A;  1L1O C;  4H13 C;  2Q8I B;  5C3E G;  1PYW D;  1N8R C;  1EEI D;  3PIP 3;  1ML0 D;  1O75 A;  4NPS A;  4PQX A;  1TU2 B;  3PO3 H;  2UXC L;  2AWO A;  1PRT C;  5H1S E;  1RJT A;  2PN1 A;  5JAV A;  1I5F A;  2A5H A;  3STB D;  5C0X I;  1A8V A;  4G7Z C;  1II3 A;  1R9T H;  3HOX H;  1YJN A;  4ED0 A;  4O4H F;  1LTG D;  5I2Y A;  4JOI A;  5IP7 H;  3VPC A;  5M5Y B;  4LF5 L;  1LUZ A;  3RNU A;  2F0O A;  1EFW A;  3SE7 A;  4J15 A;  3MXN B;  1FL0 A;  1S4Z A;  3Q22 A;  4C5B A;  3N44 B;  1RDP D;  3PW0 A;  4JV2 A;  3MR2 A;  1N56 A;  1SE3 A;  1M90 C;  5JUM A;  4J9P A;  5FLX L;  1CKN A;  3L7Z C;  1B3A A;  2QKI C;  3LP8 A;  2MCT A;  2HCC A;  4OIJ A;  4OXP A;  3PIO 3;  1YIJ A;  4OX9 L;  2RGV A;  2JEG A;  3HOX G;  4J9K A;  5KFS A;  1VQ9 A;  4ZQ3 A;  5I6W A;  5KFO A;  1WI5 A;  3KDF B;  1A9X A;  4F4X A;  3C2P A;  2TMP A;  3GTM A;  3OWF A;  1RL2 A;  5CMD A;  3RV4 A;  4KHV A;  4IPH A;  4GLV B;  1PH5 A;  3TZD A;  4PMB A;  2F0W A;  1S5D D;  3WNZ A;  3GIL A;  3J80 i;  4IR9 A;  1A3V A;  2VXW A;  1JWU D;  4JI3 H;  4Y8V B;  1S03 G;  1GVP A;  4DL5 A;  2AQ3 B;  2ZTE A;  1O7Y A;  2A69 C;  2EYL A;  5LMU H;  5CV5 A;  3AMU A;  1Z6H A;  2FLP A;  5CA0 F;  3NK9 A;  2R7D A;  1I94 L;  3MWE A;  5IYB H;  4BA2 I;  4O4L F;  4NB3 A;  1TWH H;  4RFB A;  2B2Y C;  3SR1 A;  1SYE A;  3HKZ A;  1HNW H;  1WCM G;  2SNM A;  2UUC Q;  4M9U A;  2YTX A;  1WOC A;  3L9A X;  1XMO H;  2WV6 D;  2V4D A;  1U4R A;  1FR3 A;  3Q0A A;  4R1J A;  4H44 C;  5M5X H;  1CZW A;  1JWM D;  3NQI A;  1KJQ A;  3I4M H;  3UQ8 A;  2HCI A;  4TV8 F;  3S15 H;  4YAK B;  1CE8 A;  2Z4H A;  5T1I A;  4YY3 H;  1N34 L;  1GHK A;  2VQD A;  3NXW A;  2SEB D;  2F52 A;  3VMM A;  4IOA A;  3CHB D;  4O3Q A;  3AQQ A;  2YU9 B;  2KUM A;  4AYB E;  4B3S H;  3MR5 A;  2WP8 J;  4L5S A;  2QIL A;  3GTJ B;  1A6X A;  4RAY A;  4E4T A;  1JIC A;  3TQY A;  5C0X H;  5C44 B;  4JI7 Q;  4HJ5 A;  5DNF A;  4A3I B;  1XTD A;  2JA6 B;  4LUZ A;  5ELN A;  1K73 C;  3GQC A;  1PH7 A;  5KFN A;  2XVS A;  5JVG 3;  4MV4 A;  2Z1C A;  2IL8 A;  4BBS H;  3BZC A;  1HQM C;  1JIH A;  4X3K A;  2SOB A;  4JI2 L;  3RAX A;  3I55 A;  4NXN H;  2V4Q A;  1X9N A;  1W93 A;  5KT4 A;  3D8G A;  1SNM A;  3NEM A;  4JK1 C;  4DXG A;  3N6R A;  1W96 A;  4F50 A;  2FK3 A;  2F0E A;  2R7N A;  4O3P A;  4L6T B;  1AE2 A;  1C7Y A;  1X6O A;  3Q6S A;  2CVR A;  1V4Y A;  3KK7 A;  3E5S A;  1X3F A;  2Q2U A;  2C22 A;  3Q8Q B;  3K3P A;  2K33 A;  1M4V A;  5ELB A;  5J39 A;  1HQR D;  2QW7 A;  3VYR A;  4EBC A;  1VQ6 A;  5IGD A;  2UUB Q;  4YHH H;  4LMQ D;  5KFM A;  4A3J B;  1ZHQ A;  1STG A;  1EQQ A;  3GII A;  2QCP X;  1EY7 A;  1UE5 A;  4BY7 B;  4MV6 A;  4BWG B;  2ES2 A;  1DV1 A;  3J81 W;  1GUW A;  2H5X A;  3CCQ A;  2WAQ B;  4P71 A;  5D3I B;  3BS1 A;  2ZM6 H;  3R3O A;  2W6Z A;  4PG3 A;  1N36 H;  3I4O A;  4PV1 C;  4DV7 Q;  4IO9 A;  2ZDH A;  1PH4 A;  2HT1 A;  5GAH C;  4UP8 A;  2Z4I A;  4ECZ A;  1ZKO A;  3ETH A;  2NZO A;  3OTO H;  1A2U A;  1U0L A;  2V59 A;  4A3E H;  2C28 A;  4X3T A;  1OXX K;  4DV4 L;  1KJI A;  1L0Y B;  1SAP A;  4CGY B;  4DPG A;  1WTX A;  4IPG A;  2QK4 A;  4TSS A;  3H0G G;  4DR6 L;  2GVA A;  1PYB A;  3NPP A;  1S97 A;  5IP9 G;  4BY1 B;  3Q23 A;  3BG5 A;  1XXG A;  3A7L A;  5LL6 b;  1LTR D;  3RB6 A;  5LL6 X;  4JI5 L;  1VAJ A;  2VOB A;  1JLL B;  4RZR A;  4K2L A;  2F1M A;  3VDY A;  4ZK9 B;  4U6P A;  4GN4 B;  4UCU A;  4X66 Q;  2Y0S B;  5G3L F;  3KBX A;  4J9Q A;  3V6H A;  2BCO A;  4R7R A;  2E2I B;  1HTP A;  5IGE A;  1Q46 A;  3HG9 A;  4JI2 Q;  4MN3 A;  1TKW B;  4R4I A;  1KHI A;  5KFR A;  3AYH B;  3KF8 A;  4PNY A;  3KUP A;  1PZK D;  1R9T A;  5ELO A;  2WB1 A;  1TWF A;  2UUC H;  2E2J B;  3TRE A;  2E2J H;  3O13 A;  3M9M B;  3PCO B;  3K81 C;  2Q2H A;  3IL8 A;  4RB1 A;  1TS2 A;  1PLF A;  2DY7 A;  3D6W A;  3IRB A;  4L1K A;  5M3F G;  3FPP A;  1L0W A;  3FKI B;  1QVG A;  3VA7 A;  1N32 H;  3N43 B;  2B39 A;  2UXD Q;  2AQ1 B;  2JEA I;  4ECT A;  5DAU A;  2NVY H;  4NMZ A;  4A3G G;  2IY5 B;  1HZA A;  2VR1 A;  1VS0 A;  3ERS X;  1ZET A;  5IWA L;  3HOV H;  4IUN A;  2FP4 B;  2RA4 A;  4DV0 Q;  5KFL A;  3RBD A;  1HNZ Q;  1HNW L;  3PUY A;  1S9F A;  3TBI B;  1HZ9 A;  3FHW A;  1A15 A;  1KNE A;  1VF7 A;  3R5X A;  3K7A B;  2ASJ A;  4CDD C;  4OEL B;  4Q0F A;  3S1M B;  2AMC B;  1W6K A;  2NVY B;  1UC8 A;  1B8A A;  1MJE A;  2O5I C;  2KCC A;  1ENC A;  4ED8 A;  4RAZ A;  1KLG D;  2NN6 H;  1EQR A;  2IX1 A;  4IFD G;  4DR7 Q;  3M4Q A;  2FXQ A;  4RUA A;  4DV3 H;  3I4N H;  1GO3 E;  2A74 C;  1TWH B;  1YNJ C;  4EGQ A;  3P20 A;  2N55 A;  4IWX A;  2K32 A;  3Q8D A;  4QMG A;  1PDQ A;  4HIO A;  5K36 H;  1LTL A;  4XQJ A;  4ECS A;  3CC2 A;  4LMY A;  5EDW A;  2N88 A;  2WKC A;  1K0S A;  4C2M A;  3T56 B;  4Q8E A;  2XN9 C;  3E0E A;  1EIY B;  4QWA A;  1J8I A;  4MV3 A;  1LT4 D;  4LF6 H;  4EBE A;  2CW8 A;  1IOW A;  2R92 B;  1QNK A;  4JI3 L;  1STH A;  2D62 A;  3GDE A;  1WYD A;  4A4I A;  1YNN D;  4BY1 G;  2EJF C;  4WRD A;  5IYC G;  3S1N H;  4Q43 A;  1I3Q H;  2F3W A;  3JZI A;  2KOL A;  1PTO F;  4FXK C;  1VQE A;  1WCM H;  2JEB I;  3VR4 A;  3M3Y H;  5CV4 A;  2JA7 B;  2E2D C;  3DWA A;  2ICE C;  4EVO A;  3RZD H;  3V4Z A;  2NTT A;  4DUZ Q;  2EYM A;  2IX3 A;  4HID A;  4ZI7 F;  4POF A;  3CQZ H;  5HBR B;  3J80 W;  2UU9 H;  5C44 H;  3S1M H;  1LLR D;  2JA5 B;  2L11 A;  3CCR A;  1MI2 A;  4O4I F;  3UDF A;  3VR6 A;  5KFI A;  4DV6 H;  4HCS A;  3DLL A;  3N40 P;  5KT7 A;  5IGC A;  3M7G A;  1E2V A;  4JI4 Q;  3JAM W;  2W6N A;  3UI2 A;  5KFX A;  3PUX A;  1B6R A;  1PH8 A;  5JEA H;  1IW7 C;  1CZG A;  5D1O B;  5C4Z A;  3QJY A;  1BGW A;  4IAJ A;  4FF3 A;  5KT5 A;  1PFB A;  4JI5 Q;  3BA8 A;  1TS3 A;  3GTQ H;  3JSN A;  2K75 A;  4DV5 H;  2ID0 A;  1E4G T;  3K5O A;  1NUC A;  2EYH A;  1Z2N X;  2L1B A;  4IFD J;  1SYB A;  3I4N G;  1PHJ A;  2E2H B;  5BR8 L;  1BNC A;  1PFM A;  1K1S A;  4IFD H;  2I5H A;  3LWE A;  3F1Z A;  4FNF A;  3QO2 A;  4EYI B;  2CH4 A;  4LFC L;  2HQE A;  4A3C G;  1VQ5 A;  4J9S A;  1K8O A;  4RGO S;  3T5L A;  1L2F A;  1ESF A;  1KC7 A;  4KY7 A;  4LFA H;  3J7Z C;  1PH3 A;  3R2T A;  2XRQ D;  1XPU A;  1SE8 A;  2F4V Q;  4FF1 A;  4QUC A;  1U5K A;  1TWF H;  1WTO A;  3CD6 A;  4DV1 Q;  4LJZ C;  4C3I G;  2HHH Q;  3MFI A;  4EEQ A;  4ZKB B;  2MNA A;  4MHE A;  2UXD L;  3ERO A;  2VQE H;  2UU9 L;  2BQU A;  1EQT A;  5J3B A;  4IOC A;  3KAL A;  4MTD A;  2RDH A;  1IBL H;  5DLF A;  4X6A H;  1E4E A;  4WOR A;  2WAC A;  4OGQ C;  2K5N A;  3FP9 A;  1NMF A;  4LF8 H;  3PUV A;  2J4X A;  2LFN A;  2NTS A;  2PI2 A;  4QL5 A;  4ABN A;  3S1Q B;  1M7J A;  1Y1V B;  4ULL A;  2KCN A;  2DN8 A;  4X3U A;  2CCZ A;  1STE A;  1NR2 A;  4KY5 A;  4DV1 H;  4DR5 Q;  2C2R A;  1Y1W G;  4TV9 F;  3S24 A;  3HOW G;  3GTP B;  1AZQ A;  4DV5 L;  2E5L L;  4X65 H;  3NP8 A;  2K14 A;  4XIG S;  2NVX A;  2YS6 A;  2LXJ A;  4QWB A;  3OMG A;  5JQW A;  2OLS A;  2Y0S E;  5CGK A;  1KDA A;  1I50 A;  2IBK A;  1HNX L;  3DEP A;  1KJ8 A;  2XCA A;  4JI6 H;  4X66 L;  4NXM H;  4C3H B;  3H91 A;  3MFH A;  2ASL A;  1BVS A;  4AQY L;  1PRT F;  5IGG A;  1B44 D;  5KG5 A;  1NNX A;  3NE5 B;  2OF1 A;  2WAQ G;  2GLT A;  2FHT A;  4FM9 A;  4KLK A;  4V0B A;  1K3R A;  3FKI A;  1EY6 A;  3S16 H;  2FK1 A;  2RSN A;  2MP1 A;  3OW7 A;  2IWH A;  2XTI A;  4DL4 A;  1L2Z A;  1KNA A;  3FDT A;  5C4H A;  2KCT A;  2VQF H;  4CJ2 C;  4ZLT F;  4EX5 A;  3SVM A;  4QGU A;  5FK9 C;  3IKJ A;  4JYA H;  1GJX A;  3HKS A;  1N33 H;  2OT2 A;  2C35 B;  2JSO A;  1CFM A;  3HBL A;  4JBW A;  4C5C A;  2RGR A;  1FKA H;  2D0P A;  2GA4 B;  1SSO A;  5A35 A;  2E2I A;  1Y1V G;  1FJG H;  3D4W A;  2XIG A;  3KAK A;  4JI0 L;  3HOX B;  1JOR A;  1F2Z A;  2ALZ A;  1J5E L;  4LF7 H;  1TQO A;  2Z9H A;  1E7Z A;  1S0O A;  5KFG A;  2LKV A;  1F9Q A;  3I4N B;  4RWS C;  5EWF A;  2ZJR A;  1Y1V H;  5ELC A;  4ED6 A;  4A3K H;  4DL7 A;  3NBI A;  5KNC A;  3IFT A;  4HQ6 A;  3U4V A;  4TRD A;  4ZRZ A;  4JI4 L;  1PTO H;  4JBK A;  1BJT A;  4ECY A;  5ELD A;  2OXP A;  1TR5 A;  1SNQ A;  1MGS A;  3L4K A;  3NHH A;  2B2U A;  3MXG A;  4CDE C;  4BS9 A;  5IWA H;  5JJK A;  2EDG A;  4H02 A;  2F0F A;  2M9V A;  2N78 A;  2EY2 A;  5KKN B;  2PNH A;  3JRW A;  2B29 A;  2VUM G;  2Z6K C;  2HHH H;  1GUG A;  1V9P A;  1XWE A;  1AFP A;  3CQZ B;  1MKH A;  1WH2 A;  4CKC A;  3X3M A;  1JQY D;  1J5E Q;  5BMV F;  3T5H A;  3FKI H;  3MTS A;  4MNO A;  1WCM B;  3EFX D;  4K5X A;  2VL6 A;  1YNX A;  3A7A B;  4QWE A;  3S16 B;  1MIU A;  2R82 A;  3GIM A;  4O3S A;  2MO0 A;  1DYQ A;  2D5D A;  4FXD A;  3M4O B;  3ITP A;  1HR0 W;  1S10 A;  3CXC A;  3HXL A;  2GN5 A;  2ZDG A;  5IE8 A;  3V05 A;  3TIN A;  1KQS A;  3BG3 A;  3ZYY X;  5L1I A;  1SNO A;  2VB2 X;  1E22 A;  5M5W H;  4A2A A;  3KHR A;  1YHA A;  4DV5 Q;  1SR3 A;  2E2I H;  1RYS A;  4DAM A;  1QVC A;  2ZJT A;  2UVV A;  3EPG A;  2NZH A;  5M3M B;  1RTO A;  3TDQ A;  1D1I A;  1R4P B;  2IPK D;  4F4Y A;  1J5E H;  5M5Y H;  3JAM c;  3UDX A;  4TVA B;  1TA8 A;  5KX5 F;  4C3J G;  4DV6 Q;  5H80 A;  5DQH A;  3K8A A;  2NBF A;  2H4O A;  3D6C A;  3ULL A;  1A62 A;  3P1H A;  2DPJ A;  4YBZ B;  1TWA B;  3A8J E;  3SEB A;  1WTW A;  5M3F B;  4DV3 L;  3CCL A;  3MWM A;  3J80 c;  1Q81 C;  3KAJ A;  2W9C A;  5KFF A;  5LMN H;  4DUZ H;  1BQQ T;  1B33 N;  3RLF A;  4EGV A;  5C4J H;  2N3S A;  2B2U C;  2JA8 G;  3S17 B;  1PH2 A;  1W6J A;  3E3X A;  3ETJ A;  3H3V H;  2NU9 B;  4IRD A;  2F0G A;  1EEF D;  2K01 A;  3V2T A;  3KHH A;  2B63 A;  3U4Z A;  2N8N A;  4A3C H;  4JBM A;  3RUZ A;  1E0B A;  5C4X H;  3GTL H;  3Q8S B;  1BDO A;  3HB9 A;  3S2H B;  5KG3 A;  1NR4 A;  1MZB A;  1V1P A;  2VUG A;  1GUN A;  1X3Q A;  4YCU A;  4K5W A;  3OW2 A;  4PZ7 A;  1PFS A;  5KG4 A;  1XNR H;  2F0Q A;  4O2A F;  2R7L A;  5M5W B;  1A3T A;  2VA2 A;  5DG9 A;  2RVL A;  3LNN A;  4M1U B;  4DV1 L;  4F4W A;  3J81 L;  3RZO H;  4C56 C;  1WTR A;  1CKN B;  2F3V A;  1JT8 A;  4RNN A;  2F0D A;  3NUC A;  3U50 C;  5KG1 A;  5EKI A;  4A3F G;  3S14 B;  5C0X J;  4PWQ A;  5DG7 A;  3TZU A;  1STN A;  1HZC A;  4UCR A;  4OWW B;  3IAY A;  3GTG A;  3P7J A;  1DV2 A;  4DR7 H;  2R6F A;  2CW0 D;  4X3S A;  2RDI A;  1XPO A;  1BBU A;  1YBY A;  3TP8 A;  2HVQ A;  2RCF A;  3LWU A;  3TP5 A;  1G2S A;  5L1J A;  5DGB A;  1VCI A;  5C4X B;  3GTJ H;  1WD0 A;  1RK5 A;  3R5H A;  4YR0 A;  2W9B B;  4DAY A;  1SJE D;  3ICE A;  2L9H A;  1STY A;  3BQ2 A;  1LYL A;  1E4F T;  1HNZ H;  2WFW A;  2CHB D;  1KL9 A;  4DU9 A;  3PMF A;  1M1K C;  4FBU A;  2E76 C;  4DUY Q;  5K36 G;  2FPP B;  4UDU C;  1A3U A;  4TUY F;  2E75 C;  3T5J A;  4A3B H;  4JC0 A;  4K0K L;  1SND A;  2EYF A;  4GNX B;  1EQV A;  1HPC A;  3HKZ E;  4A3K B;  3GTK H;  3KLS A;  3GIK A;  4DNI A;  2KJX A;  2WDT A;  3RB3 A;  4NW2 A;  3A74 A;  2DWC A;  2CWP A;  3PW7 A;  3G6J B;  2AQ2 B;  1ET9 A;  1E2Z A;  1C0A A;  2LXK A;  1BOS A;  1UEA B;  5IP9 H;  1TWC H;  3PQI A;  2A69 D;  2WII B;  2F0N A;  5I9O A;  1HRJ A;  1BKB A;  3D31 A;  1E3P A;  4N9P A;  5FPO A;  1AW7 A;  2K52 A;  3GV8 B;  2IHF A;  2X6L A;  2V4R A;  2MQH A;  1M0W A;  2BDO A;  3GV6 A;  2J9G A;  2NVX H;  1B7Y B;  1FNU A;  4GZY C;  1WTQ A;  1SE4 A;  1I4Q A;  2DNE A;  2R7F A;  5COY A;  3LWB A;  4YR3 A;  4OX9 H;  1QG7 A;  1S5B D;  3CCV A;  1G6Z A;  4HJA A;  1E1T A;  3Q8R B;  1BXT A;  1SXT A;  3MFG A;  1YZ6 A;  1EYG A;  4ME3 A;  2OH2 A;  3V4S A;  1RF2 D;  4C2M B;  2GPW A;  2J6T A;  1DXM A;  3QG1 A;  4KKS A;  3CCJ A;  1Q1B A;  3NTH A;  5KYL A;  1E2W A;  4JI1 Q;  4LFC Q;  4P73 A;  2NU8 B;  2DNC A;  3AEV A;  3RR5 A;  4RG1 A;  1LTB D;  1VQF A;  1Z7T A;  4DR4 Q;  2W8K A;  4GLX A;  1BCP B;  5COR A;  1RJR A;  4A76 A;  1GUS A;  4M8A A;  2F0L A;  4LAA A;  4ED3 A;  1S5F D;  5CV8 A;  2FKL A;  3BYT B;  3QZ7 A;  4KD4 A;  2J7Z A;  5JJZ A;  2IX0 A;  1AUV A;  5KFC A;  4CDF C;  4MZ9 A;  4DV0 L;  4OON A;  1EY9 A;  5JPM C;  3KF8 B;  2RF4 A;  1PK8 A;  3EN2 A;  1KJ9 A;  4BBR H;  5C8Y F;  4BBR B;  1S5C D;  4I4T F;  3F8T A;  4XTC S;  2NVT B;  3BQ1 A;  3M7N A;  2FE3 A;  2B2T A;  4MA5 A;  4MA0 A;  4C3J H;  4JV5 Q;  1IBM L;  1XPR A;  2PZW A;  2EYO A;  2JYO A;  4DKA C;  3H0G A;  2RQX A;  2XCP A;  1VQH A;  2A8V A;  4LH6 A;  3H4D A;  1LO5 D;  2K5D A;  2AGP A;  2JN4 A;  2JXM B;  1NE3 A;  4QY7 A;  3AFP A;  2B2W C;  3RIZ A;  5KFA A;  2RHQ B;  1K83 H;  3D4D A;  3S2H H;  1NAP A;  3MR6 A;  3MR3 A;  4HJ8 A;  3HOV G;  5KFW A;  3G4S A;  4I7A A;  4LF5 H;  4P74 A;  5DQG A;  3S2D B;  3NEL A;  2PBZ A;  3RB4 A;  4RHR A;  3T53 B;  4RKB A;  5EWG A;  4BBR G;  3PO3 B;  1SEB D;  3K5N A;  5HGQ A;  3BDC A;  3GQB A;  4B3T L;  2L12 A;  1QWY A;  2MPM A;  1L1O A;  4DN4 M;  4JI8 Q;  4DUY L;  1AP0 A;  4QWC A;  3KYH C;  4JI3 Q;  3W1G A;  1EOT A;  2EOT A;  4QQB X;  5I2X A;  3S2D H;  3A5U A;  3CMA A;  4GKK H;  2Q8T A;  4RUC A;  4RKL A;  1WR2 A;  3CCM A;  4IUR A;  3S1N B;  4OL7 A;  1J6Q A;  5EJW A;  1I4H A;  1KIX A;  5C1P A;  2Q8R E;  3MFY A;  4GN5 A;  2A68 C;  3M9N B;  3K0X A;  3I3C A;  4LFA L;  2F0V A;  3PVX A;  1S40 A;  1DOM A;  1VQB A;  2FMM A;  4IUP A;  4LFC H;  4HR7 A;  1O78 A;  4UCT A;  1JX4 A;  1TWG H;  3UDI A;  1TWG A;  3BA9 A;  1I3Q B;  1VDZ A;  4JVZ A;  2A73 B;  3G6E A;  3ULP A;  5D1P A;  2EXD A;  4KK7 A;  3NGD A;  3J7A V;  1H9R A;  4A3L H;  1J9O A;  3GD7 A;  2QDL A;  4JG2 A;  1YVC A;  4KKT A;  2ZXP A;  1SRO A;  4K6L A;  5JEA J;  1EYD A;  5HGT A;  1IBM Q;  2W57 A;  4C3H H;  4DR5 L;  1GKH A;  3SDZ A;  4LF9 H;  2JA6 H;  3WDN A;  1YEZ A;  3DUZ A;  2VB3 X;  1OXS C;  2YZN A;  1ROD A;  5D3D A;  1FVI A;  1FJG L;  1CI3 M;  2F0S A;  4I65 A;  3CC7 A;  1HZB A;  2Z0S A;  5C3W A;  3RB0 A;  2JE6 I;  1SJH D;  2J0T D;  3JAM E;  3K5H A;  4B9W A;  5BPF A;  2OWO A;  1V1Q A;  1EY8 A;  1HFG A;  4C5A A;  4M7E A;  1EUD B;  3HKZ G;  3X3N A;  3K57 A;  4C3H G;  1VQP A;  3W2D A;  3CC4 A;  1IKM A;  5IYZ F;  5M5X B;  1KBL A;  3VPD A;  1SDF A;  3ORR A;  3GTQ B;  2BA1 A;  4QIW A;  5GQO A;  1VQ8 A;  4LUV A;  2O4X A;  4IR1 A;  5EQ0 A;  4ZAI A;  3VYS A;  3Q8P B;  1V1O A;  4IZ8 A;  4JI8 L;  2R93 G;  1G2T A;  3A56 A;  4RU9 A;  1UUP A;  2JK8 A;  5DEH A;  5AJ3 L;  2F03 A;  2KEN A;  3EIV A;  4R8U B;  4A3F B;  2JP1 A;  4PMC A;  1STB A;  2PMZ E;  3I70 A;  3M85 A;  1HUN A;  4ED1 A;  4XX0 B;  1B1Z A;  2JA5 H;  5T1G A;  3MXP A;  5IT9 c;  3J80 L;  2RHS B;  1KDB A;  4CBV A;  1DOK A;  4HN7 A;  1TWF B;  4DUY H;  4RGN A;  1LT6 D;  4LW1 A;  4J6H A;  5FLM G;  1A63 A;  2QA4 A;  1TS4 A;  3U9T A;  2D0O A;  3Q2O A;  4EEY A;  2JA5 G;  5E3F A;  5C3X A;  4YHH Q;  2W6M A;  2UUB H;  1VMC A;  2YZG A;  1KAA A;  4LF8 L;  4YY3 L;  2J6U A;  1HFN A;  4K0K H;  1VQJ A;  4YP3 A;  1UWV A;  2BQ3 A;  1XMQ H;  3F2D A;  2OCE A;  1EWC A;  1LAB A;  1X55 A;  2CZG A;  3H40 A;  3VR2 A;  4O2B F;  1SMY C;  4DV2 L;  1QNU A;  2V58 A;  1JXL A;  2R93 H;  3BDL A;  3STB C;  1O7Z A;  1VF5 C;  1CQJ B;  4LF4 H;  4YQW A;  3HOU G;  4ODG A;  2WB1 B;  4HTH A;  4DR1 L;  4A3D B;  1OWT A;  1XYI A;  4CC5 A;  1DJR D;  1ONL A;  3GIJ A;  1TWA H;  4ZUJ A;  4NDX A;  3SI8 A;  2ZTC A;  4QW9 A;  2F0T A;  2K05 A;  5IWA Q;  3T1Y Q;  3TEH B;  1EL0 A;  2X6G A;  5KG7 A;  3N41 B;  4KHP Q;  4B3S Q;  4IUU A;  4L5R C;  2F0I A;  2R93 A;  4XYQ A;  3R8B A;  3U9S A;  3GTP A;  3MZ5 A;  4QUF A;  4U68 A;  5FJ8 G;  4YY3 Q;  4ME6 A;  1B2T A;  5JVH 3;  4J9R A;  3P75 A;  3BDO A;  4KTA A;  1DON A;  2AUJ D;  5DM7 3;  1O7L A;  4ECV A;  2KVM A;  3T1H Q;  4O3R A;  4DR7 L;  1A2T A;  2LS0 1;  3HEJ A;  2UUA Q;  2TSS A;  1EZ1 A;  1SNC A;  5JVL A;  1UNS A;  2D2C C;  3W1B A;  2KSW A;  1QVF A;  3BVM A;  1W2B A;  5KFK A;  1CUK A;  5A2Q E;  2B2V C;  3TN2 A;  4A3B G;  4B3R Q;  1XNQ Q;  3NTK A;  4BY7 G;  1CT1 D;  2B8F A;  3C3L A;  1RTN A;  1TXY A;  4YHH L;  2B3G A;  4EQN A;  1Y1W A;  3KJO A;  2ZJQ A;  5IP7 G;  1N48 A;  1QCB D;  2WB1 G;  4X62 Q;  4A3D G;  5A2Q W;  5J2U F;  1IYU A;  3J80 E;  1H9S B;  4OWT B;  5D1O A;  2XSC A;  3CCU A;  1AE3 A;  3R2I A;  1HJP A;  2F4V L;  1UAP A;  4L5T A;  1HR0 Q;  3OHX C;  4DR3 L;  3J81 j;  3K6O A;  4CJ0 B;  1T9H A;  2DY8 A;  2MGS A;  4QCL A;  3V6J A;  4FS2 A;  3SGI A;  2UXB H;  4R4Q A;  2N49 A;  2A19 A;  3J7A K;  1SEI A;  1DZ1 A;  4FXG C;  1JWS D;  3L2P A;  3OHB A;  3DM1 A;  1LT5 D;  4Q0Y A;  1KC8 C;  2PQE A;  2ZXO A;  1V51 A;  2K5W A;  5M3F H;  3RBE A;  3PIP A;  1DCZ A;  4DAP A;  1ZYR C;  3MHB A;  3GO5 A;  1SFO H;  3FVQ A;  3CF5 A;  2AKW B;  3PR4 A;  5NUC A;  3I7F A;  2IA6 A;  4X62 H;  3W3A A;  1SYC A;  2AHO B;  5J22 A;  3HRZ C;  1I6V C;  3HFZ B;  4KN7 C;  5CA1 F;  1YNN C;  1IHZ A;  1ZXT A;  2ICI A;  1JJC B;  4X62 L;  3GTG B;  1RIP A;  3AU7 A;  3RTX A;  5E1F A;  3PGZ A;  1ZYR D;  1ASZ A;  2ZJP A;  2R93 B;  2WE6 A;  1T5E A;  2UUA H;  4FYD A;  3A54 A;  3M9O B;  4A3G B;  3V6K A;  2C00 A;  5LL6 S;  2FFK B;  4HSP A;  4JI2 H;  3BQ0 A;  5JEA G;  3NQT A;  1VQN A;  1JE5 A;  1OXV A;  2HD3 A;  1IXR A;  2F4V H;  3OOC A;  4A3J G;  5L1L A;  4KHZ A;  3NWS A;  3GV7 B;  4DV2 Q;  2RDJ A;  4IPC A;  2NVX B;  3AFQ A;  4EGJ A;  3K80 C;  3WOE A;  3KJP A;  1IBL Q;  1FJG Q;  1TVX A;  1I6U A;  4GNX C;  4O3N A;  2IW3 A;  3G71 A;  1PTO D;  1GSA A;  2VPS A;  3NSW A;  4H0L C;  4Y7N B;  3MEF A;  1D2B A;  3CU7 A;  2JQO A;  2RBM A;  2Z6K A;  5BR8 Q;  4EQ5 A;  2B63 G;  5JJI A;  2XCL A;  1S72 A;  1V1P B;  4J1M A;  4HED A;  1IL8 A;  3T1H L;  2K5V A;  1XMO L;  4O42 A;  1U4M A;  3UDG A;  3PW2 A;  1GUT A;  1NTG A;  4P2C B;  2C2D A;  3M4I A;  1BO0 A;  1FNV A;  2W7O A;  4R8I A;  4DV7 H;  4KHP H;  4ETS A;  3WO1 A;  3I56 A;  4B3R L;  2E5L H;  3T4A C;  2MHV A;  1N34 H;  2O03 A;  5KG2 A;  4FP5 D;  4JYA L;  1I7L A;  4LF9 L;  1N9W A;  1D7Q A;  3LGJ A;  1L0X B;  2K5Q A;  3CME A;  4DXF A;  4FS1 A;  5JH7 F;  2HIX A;  1G91 A;  1VBH A;  1VQO A;  3UFX B;  1KTK A;  2DJG C;  1WTV A;  5IOC A;  2E5L Q;  2XWB B;  5KND A;  4X64 Q;  1EWH A;  4JI0 H;  1GD7 A;  3A5Z B;  1Y1V A;  2HVS A;  4DR3 Q;  3G6V A;  4ECX A;  1EFI D;  3RN2 A;  2PO4 A;  2ZDQ A;  4J9M A;  2O2L D;  3H94 A;  4WBN F;  5FJ8 H;  1SMX A;  3BZD B;  4DK6 C;  2R85 A;  2K7V A;  4RMF A;  4C3J B;  4KMU C;  3D0F A;  2MFI A;  2W7P A;  1I4P A;  3OIQ A;  4GN3 B;  2DJF C;  1M6V A;  1IL2 A;  4ALP A;  3L3O C;  4PZ6 A;  4DNR B;  1X65 A;  5GRO A;  4ED7 A;  3R23 A;  3TQ1 A;  1DM0 B;  1TT2 A;  4XT1 B;  4LF9 Q;  2JA8 B;  5IIF A;  4AQY H;  2A6E C;  1VQM A;  5LXT F;  2I0Q A;  4IPD A;  3G8C A;  3N8D A;  1Z47 A;  2NUC A;  2BE5 D;  3GTG H;  4L63 B;  5LA6 F;  1STA A;  3OSN A;  4AQY Q;  1ICF B;  3OIP A;  5EKL A;  5LYJ F;  1X56 A;  4I7Z C;  4ZUI A;  2YS7 A;  2B63 H;  1GSO A;  1QOH A;  2EY6 A;  4ILW A;  4LFA Q;  3H15 A;  5L9X A;  1MJC A;  2ASD A;  1PXU A;  3MEH A;  1JB7 A;  4KHP L;  1XMQ L;  3HS0 C;  3ORQ A;  2CKZ B;  4DAY B;  2A6E D;  1EYA A;  3CVZ A;  2PNR C;  2KHI A;  1HA6 A;  2YL2 A;  5M9O A;  2E74 C;  2YZM A;  3E6Z X;  1UEB A;  2BH2 A;  4KJN A;  2XGT A;  2K1B A;  3MWD A;  3GTM H;  4LFB Q;  3I91 A;  4GNX A;  5HY6 A;  3CPF A;  3WWV A;  4OO1 H;  4A93 G;  2R86 A;  5CV6 A;  2KCM A;  2RDG A;  4ECU A;  3TME A;  4JI0 Q;  4G3I A;  3TP6 A;  3SK5 A;  4UP7 A;  4MV8 A;  5TSS A;  5EBC A;  4FU0 A;  5GON F;  4F4Z A;  1PZJ D;  4DK1 A;  1TY0 A;  1QZH A;  1MSG A;  3CP0 A;  2I5M X;  1IBM H;  1I50 H;  2WKD A;  3DEO A;  1N32 Q;  3DHQ A;  1Q12 A;  1ILQ A;  4MAM A;  3QZ8 A;  1UNN C;  2W9B A;  4OO1 G;  1HA5 A;  5C44 G;  2R7Z H;  1PV4 A;  1SYG A;  2FPG B;  2Q2T A;  1VMP A;  1HR0 H;  4F87 A;  2EXZ A;  4APV A;  4A3K G;  1PH1 A;  3LML A;  2Z8L A;  2JA7 G;  3TP7 A;  5KFQ A;  2EZV A;  1CKO A;  3NEN A;  3J81 E;  1K1Q A;  1WSC A;  2NWG A;  4XQQ A;  1K8M A;  3GP7 A;  2R7Z B;  3GTO A;  5FKA C;  1IZ6 A;  2WAQ E;  2QF7 A;  3S17 H;  2QDB A;  1XNQ H;  2PZU A;  3B6Y A;  4BBS B;  1G29 1;  4U7C A;  1YJW A;  4A3M B;  3GV3 A;  3G6Y A;  2EYP A;  3CRL C;  3I12 A;  2JEI A;  3T51 B;  3GTL B;  1C8C A;  3E0J A;  3KLW A;  1ZHS A;  3MJF A;  4WFN 3;  3T1H H;  2KEE A;  1S3O A;  4DF7 A;  5JPN C;  4JV5 L;  3S9W A;  4HMI A;  1EUC B;  1WTP A;  4YJ2 F;  1LTS D;  2I46 A;  2NU7 B;  3RF2 A;  2KHS A;  3S15 B;  4IWY A;  2UVW A;  2QEX A;  1ENF A;  1K9M C;  4G57 A;  4AIM A;  2R61 A;  3QB3 A;  4U67 3;  1G51 A;  2MO1 A;  2RSO A;  3S1R B;  2F0P A;  1EZ6 A;  4GOP A;  2WYO A;  5EZY F;  3T1Y H;  1X3P A;  2IT1 A;  2VNU D;  1EYZ A;  5C5L A;  3FDS A;  1VQL A;  1CM9 A;  5C0X G;  4H7B A;  4LK1 C;  1EY4 A;  3ZJY C;  2R92 H;  5T14 A;  3OTO Q;  1HTL D;  4LUO A;  3OWE B;  1CHP D;  2HQL A;  2GPS A;  3RFC A;  2R7K A;  3GTO B;  4YIJ A;  5KT3 A;  4KJO A;  4RH6 A;  3ULJ A;  3GIQ A;  1TAE A;  3G6X A;  5C3E H;  4I55 F;  4QF4 A;  3PR5 B;  1YI2 A;  2FK2 A;  1KRS A;  1K8A C;  4PMW A;  4A3M G;  2ZTD A;  1JR0 D;  1KXL A;  2UXD H;  1Y8N B;  4DNT B;  2G5D A;  2C5C A;  3J81 i;  3VA5 A;  4UP9 A;  2UXB Q;  2L5T A;  3SXH A;  1I6H H;  1UE1 A;  4ECW A;  3OMC A;  5CBA E;  4RZQ A;  4ZQI A;  3GTK B;  2FJ2 A;  3C46 A;  1KJJ A;  4DR1 H;  2HVR A;  2UU9 Q;  1PTO B;  1VQA A;  3BJY A;  3A8I E;  2MUY A;  3DWP A;  3KF6 B;  3K59 A;  1HHV A;  1HNZ L;  2WAQ A;  1I3Q A;  4JI7 H;  1L1O B;  2EYJ A;  4DL2 A;  3F2C A;  5KT6 A;  4OX9 Q;  3FMA A;  3BVG A;  5CAE B;  5KFY A;  2ZT9 C;  2M2L A;  4HJ9 A;  3RLO A;  1PZI D;  4CC6 A;  3NWT A;  3WOF A;  1XTC D;  1JDB B;  4NXN Q;  3CQZ A;  4IRC A;  4YJ3 F;  1WTH A;  4A3F H;  1S68 A;  4LWC A;  1C4Q A;  4KN4 C;  3MAQ A;  4LF5 Q;  3TS2 A;  2YRW A;  2LMC B;  4EFE A;  1Y8O B;  1U4L A;  3MC0 B;  4RGT A;  5CC4 A;  1Q3L A;  2YW2 A;  2CQO A;  2Z6B A;  4IJH A;  1FNW A;  2K4K A;  4S3S A;  2CQY A;  1DIK A;  3A0J A;  2VUM A;  4P72 A;  2VUM H;  3R5F A;  2OEO A;  2L55 A;  2R87 A;  4B3M L;  2DPI A;  3KXY T;  1SRU A;  2OQ0 A;  1KDC A;  1PTO C;  2L4N A;  3PO3 G;  2R84 A;  1M8A A;  3MVV A;  3TS0 A;  3T5K A;  5G3L D;  3E9H A;  1YJ9 A;  2XWJ B;  3FMC A;  4RB0 A;  2J6S A;  2D9U A;  5GAD C;  3BYY B;  3CRK C;  1AH9 A;  2L15 A;  5AJ3 Q;  1Q7Y C;  1NJI C;  4K0K Q;  2R7M A;  1X3E A;  3FPU B;  1OO9 B;  1WD1 A;  3QIA A;  3QOL A;  4FO2 A;  1SCU B;  4DV4 H;  4Y52 H;  5F2D A;  4YCW A;  1Y1W B;  4GKJ H;  4JOI C;  1F2L A;  1B04 A;  2YYZ A;  1NSN S;  4LF4 Q;  5F9N A;  2UXB L;  1CK1 A;  3PZP A;  1JOO A;  5KEE A;  1B3Q A;  3H4B A;  2KHJ A;  2C2E A;  2FLN A;  5IYD H;  3KLS X;  4B3M H;  4UY8 C;  2ZXR A;  3I4L A;  2RCN A;  1EHI A;  3VR3 A;  5IGB A;  1X32 A;  2BOS A;  3CKI B;  4LF7 L;  1XMQ Q;  3I4M B;  4A3I G;  4A3E B;  3HP3 A;  1W3S A;  1GUO A;  4B3S L;  3L0O A;  1DD2 A;  4JI1 H;  2AWN A;  3GV5 B;  4IUQ A;  1YHB A;  3EQL C;  1JB3 A;  5IYD G;  2K6A A;  3OTO L;  3F2B A;  2F3I A;  5KG6 A;  3GTJ A;  2PW7 A;  3JRX A;  2YRX A;  3RLN A;  1LT3 D;  2DGY A;  4K6D A;  1IKL A;  1B53 A;  2B2T C;  4XZ3 B;  2ASB A;  4GKK Q;  4C3I B;  4LFB L;  2B63 B;  1EIF A;  1RKN A;  2R7Z G;  4A3L G;  4HIM A;  4HMJ A;  1AUX A;  3PN1 A;  3AB9 A;  1EZ8 A;  1PH9 A;  4XYM B;  4R8U A;  1E1O A;  1TS5 A;  4J9L A;  4K5V A;  1HNX Q;  4JI7 L;  3CW2 C;  4LNQ A;  4BXX H;  5EPL A;  1BBX C;  2BDN A;  1E24 A;  2OTJ A;  4UHV A;  5I9P A;  3QR8 A;  1PRT B;  3TQT A;  5E4X A;  4HAE A;  2V9W A;  4QIW B;  1BNZ A;  3SE0 A;  4HNT A;  4J9O A;  3ER0 A;  3HKZ B;  2OQK A;  2R6G A;  1SYD A;  4ZKC B;  4ZHQ F;  1U9R A;  1XMO Q;  5FO9 B;  2BE5 C;  1B50 A;  3HOY H;  1YHQ A;  3HOU B;  3PSI A;  3ERQ A;  1SN8 A;  3KLR A;  1XNR Q;  1EY5 A;  3RUP A;  2IP4 A;  3LX0 A;  1TWC B;  3RZO B;  3KHG A;  3D3R A;  5FO7 B;  4NXN L;  3DM3 A;  3CPW A;  3EPI A;  5LHY 1;  1JC7 A;  1F77 A;  4DK0 A;  3H20 A;  2R8H A;  3VYU A;  1CKM A;  4EFB A;  3K5M A;  1I4X A;  1Q82 C;  1GYF A;  4HIK A;  5LMU Q;  1JCK B;  3I72 A;  3JC6 6;  1HNX H;  2E8G A;  1D1K A;  2EQS A;  4LF4 L;  1Q8K A;  2KED A;  4RB2 C;  2R8G A;  4O0A A;  2NU6 B;  1O80 A;  1CA6 A;  3RGZ A;  4IUV A;  3SK6 A;  5BN5 A;  2OTL A;  4C3I H;  4B3M Q;  2NVQ B;  5KRU A;  2SCU B;  5LOV F;  5I47 A;  4ECR A;  2AUK A;  5KFZ A;  3K5L A;  3M9B A;  4L5Q A;  1BCP D;  2JA5 A;  2VPQ A;  5FLM H;  2VZA A;  2I07 B;  4DV4 Q;  4DR2 Q;  3K0Y A;  5C5J A;  4C2M H;  2V1C C;  3QOJ A;  1JOQ A;  2PI2 E;  2NVQ H;  2YCH A;  5LMN L;  1EU4 A;  4Q45 A;  3PO2 G;  4JI8 H;  1T94 A;  1I6H B;  1IBL L;  1QJO A;  5ELF A;  4R8N A;  1CSQ A;  1HCZ A;  2XGQ A;  1BCP C;  5AFW A;  4E6I A;  4EQP A;  1OXU A;  3KBG A;  4JI6 L;  1ILP A;  4GOP C;  3L4J A;  5CV7 A;  5C6A A;  1D8L A;  4HR7 B;  1WCM A;  1TWC A;  1H9J A;  1MBY A;  5K2M A;  5M3M H;  3N52 A;  1EIH A;  1EUJ A;  2ZM6 L;  3UE1 A;  1O7I A;  1D5Z C;  2JJQ A;  4L8J A;  3N42 B;  4BXX G;  4Q44 A;  1CA5 A;  3Q24 A;  1H95 A;  2UXC Q;  1DOL A;  1C48 A;  3CAM A;  5EBD A;  5L1K A;  1F9P A;  4B9X A;  3PV0 A;  1EY0 A;  2PW5 A;  4OIK A;  1ASY A;  4OO1 I;  2WB1 E;  2W8L A;  2IJ0 A;  1JE4 A;  1K28 A;  1ZQ7 A;  3U58 A;  3UE0 A;  4JW0 A;  3RV3 A;  1C30 A;  3TIG A;  4A3B B;  3K5I A;  5D14 A;  4K14 A;  2A6H D;  2JA9 A;  4MV9 A;  5DLQ E;  1SNP A;  1YNJ D;  2RKS A;  2Q2I A;  4DR1 Q;  4EBD A;  1IBK Q;  1HNW Q;  5IT9 W;  1T3N A;  2BA0 A;  4NP5 A;  1B6S A;  5KYI A;  2VW9 A;  3T13 A;  3BVZ A;  5HUR A;  4XQN A;  2JEJ A;  4IQZ A;  2JA6 G;  3E5N A;  1EOV A;  3S1Q H;  2VQF Q;  3T1Y L;  4J8Q A;  4YWK A;  5J1Z A;  3SK4 A;  4RNO A;  1X3G A;  4UFZ A;  4ZCK A;  1H9K A;  4BWS C;  4IHJ F;  3H3V I;  4HYK A;  2F0J A;  2IHE A;  4A2B A;  1PH6 A;  2R92 G;  1G8Z D;  1Q1E A;  1UE6 A;  2NUA B;  3HOZ H;  4CKB A;  1GLV A;  2L0C A;  1SMY D;  1JOK A;  3CCE A;  4PDB A;  5IT9 E;  4YB8 B;  1HXY D;  1RD9 D;  1I94 Q;  3PW5 A;  1Y69 U;  1RJQ A;  4JI6 Q;  5CB4 F;  4NLG A;  2AQ4 A;  4OWX B;  4JV1 A;  5C1O A;  1SYX B;  4HJ7 A;  2XD4 A;  1R4Q B;  5E4W C;  1T36 A;  4QW8 A;  2RDF A;  1D5M C;  4APM A;  1LTA D;  2B2Y A;  3K7U C;  5E7N A;  5LMN W;  3T16 A;  5EPJ A;  1VQD A;  1VQI A;  2JA8 H;  1ZEQ X;  3OYY A;  1Z2P X;  4LFB H;  5FO8 B;  3DMU A;  4DK3 C;  3QFF A;  3H0G B;  4JV0 A;  3H0G H;  4C1N K;  2G9D A;  4V19 0;  2VY3 A;  2F0K A;  1AN7 A;  2R7Z A;  2NVT H;  4ZYS A;  1UE7 A;  5LMU L;  4N9T A;  5KFV A;  1DGS A;  3OSP A;  4UAI A;  3I8Z A;  3OPO A;  3KDF A;  1A0I A;  3DF7 A;  4R4C A;  1C9O A;  3W5O A;  4X65 Q;  4BA1 I;  1BXR A;  3KTM A;  1CTM A;  2PCF B;  1WJJ A;  4AYB G;  4F88 A;  1JDE A;  2BQR A;  1IBK L;  3K7A H;  3FEW X;  3JSL A;  1P8L A;  1GM5 A;  3KHL A;  2Y0S A;  4TQS A;  4N8X 1;  5KT2 A;  1S5E D;  1K0R A;  3GID A;  1ENA A;  4HSV A;  5EGT A;  1M0T A;  3J7Y W;  3RN5 A;  4GLA C;  2KQ3 A;  1D5X C;  4KV6 A;  4RAU C;  4G7O C;  2LY7 A;  4BY7 H;  4DFA A;  4Q5V A;  5JOB A;  3BAB A;  4HNU A;  1AEX A;  2XRS D;  1S0N A;  2EJG C;  1B9N A;  3NTI A;  1WFQ A;  2EPB A;  1JJG A;  1Y8P B;  2PQA A;  5ELE A;  4IN3 A;  3M3Y B;  2LSS A;  2XGP A;  1SFO A;  4EYH B;  4QJF A;  3JAM L;  2ATW A;  4O2D A;  1PVO A;  2B2W A;  4TQU S;  3C1E A;  3A8K E;  4JBJ A;  4QB4 A;  5C4X G;  4A93 H;  4AYB B;  3OSO A;  5KNB A;  3DXJ C;  2KBN A;  4I50 F;  1PRT D;  4MV1 A;  4JI5 H;  3TSS A;  4RCN A;  4XT3 B;  3I73 A;  3G48 A;  4Y7N H;  5C3E B;  1JJ2 A;  1XNR L;  3HOZ G;  4ED2 A;  1FYC A;  2VQE L;  2GVB A;  1PA6 A;  4X64 H;  4YWL A;  2QYZ A;  4UCV A;  2H1E A;  5J2T F;  1ET6 A;  3KOJ A;  4ID6 A;  4CDC C;  4WJW A;  5KG0 A;  2ENB A;  2X69 A;  2F0M A;  2AGQ A;  1H9S A;  1IW7 D;  2PZT A;  4A3I H;  3OUU A;  3EJI A;  5IT9 L;  2IMW P;  3M4O H;  2EIF A;  5KIX A;  2B8G A;  3J7A F;  1N34 Q;  5KFP A;  3HOW B;  2K28 A;  2DLN A;  3HZX A;  1VQK A;  2NYZ D;  1TII D;  4IJL A;  1RHP A;  3A55 A;  2PVP A;  2UUA L;  2NB0 A;  3I90 A;  1SLJ A;  3HOZ B;  1N36 L;  2F0U A;  1ULZ A;  5KFH A;  4ECQ A;  2C9O A;  3MA2 B;  1MSH A;  1B4O A;  3F8N A;  1SYF A;  4YAJ B;  4AYB A;  1K3B C;  1NY4 A;  1T5X D;  2XNA C;  1Q8I A;  3H6M A;  2DZD A;  4OHJ A;  4IZO A;  5DLG A;  2QEJ C;  2PYK A;  4UCO A;  4MTK A;  5DG8 A;  4RHS A;  4LF8 Q;  4B3R H;  1RCV D;  5IYC H;  1BCP F;  1WVL A;  3N6X A;  4DR4 L;  5KFB A;  3GTK A;  4DV7 L;  4C1N I;  1CHQ D;  4B3T Q;  1RYR A;  4R9W A;  1CS0 A;  3NBH A;  5LMN Q;  4R4O A;  5A2Q L;  5FD6 A;  3K3V A;  4FDB A;  1SE2 A;  4DV2 H;  5EPK A;  3F2U A;  2CW0 C;  1VQ4 A;  2AU0 A;  1K83 B;  4EG0 A;  4LSA A;  3WO0 A;  4XDX A;  4DR6 Q;  3M4Y A;  5FLX c;  1XDN A;  1QB5 D;  3RJ0 A;  2W9C B;  1KRT A;  1OTC A;  1K8G A;  5LP6 F;  4GKJ L;  5DQI A;  1NMG A;  5D8D A;  1TWA A;  5EAY A;  1QUQ B;  2YV5 A;  1OXT A;  2HDL A;  2R8I A;  4DR3 H;  2CW7 A;  2V5A A;  4DGZ A;  1BF4 A;  2XIW A;  5ISR A;  5KFU A;  4DV6 L;  2G9H D;  1LTT D;  4DAV A;  1Z9F A;  2QGQ A;  2E2H A;  5CV9 A;  5BN4 A;  4R4T A;  1ESR A;  2HHH L;  3BU2 A;  4RA8 A;  2KEC A;  5JJL A;  1K83 A;  5KFJ A;  4A75 A;  2W9A A;  5I4D A;  3HGB A;  1Z2O X;  4LF6 L;  5C5M A;  4KY6 A;  5CR3 A;  1CQI B;  4RB3 C;  3D4R A;  4OEM B;  5FLX E;  3OUZ A;  3HOU H;  3HOY B;  4IRK A;  2CFM A;  3GTP H;  5FOB B;  1R9T B;  2E2H H;  3GTM B;  3J7A 5;  1ICW A;  1QUQ A;  1VKZ A;  3EA6 A;  3URY A;  4WD3 A;  2UVR A;  3GTL A;  2DIK A;  4XYO A;  4IFD I;  1VQC A;  1Q90 A;  2I5L X;  1P16 A;  1IYJ B;  4P75 A;  5C4J B;  3PW4 A;  1B70 B;  1F9R A;  5DM6 3;  3GIP A;  4KKU A;  2WIN B;  4K8I A;  2HGS A;  4POG A;  3CCS A;  2WTF A;  4MIU A;  1MD2 D;  2PMZ A;  2CQA A;  2A1A A;  2KA7 A;  3BAA A;  1EYC A;  2JA7 H;  4BBS G;  4EQO A;  2JA7 A;  4ZOL F;  1HR0 L;  3MXN A;  4DR5 H;  3NBH B;  5L37 A;  5JVD F;  2UUB L;  3H09 A;  2VA3 A;  4JUZ A;  4F8M A;  1GOZ A;  4DR6 H;  1NBW A;  3MWY W;  4FF2 A;  3SK8 A;  4NXM L;  1VBG A;  4X66 H;  1PYS B;  3EYY A;  1SBB B;  3PF4 A;  5F9L A;  4Q8F A;  3IG0 A;  4LSX A;  4RNM A;  4ME5 A;  3PUW A;  1KD1 C;  4LF7 Q;  3RGX A;  4I7H A;  2UVU A;  5BPH A;  3RAQ A;  2M00 A;  1E4E B;  1HUM A;  1Q86 C;  1F2Y A;  1I4G A;  3GTO H;  2I87 A;  2NZ1 D;  3BJU A;  4J0M A;  4TQR A;  2I80 A;  2AGO A;  1B9M A;  2YTV A;  3PIO A;  4RGM A;  3I4M G;  4QIW E;  4O1N A;  4G4K A;  1LAC A;  2A6H C;  4CHT B;  4JYA Q;  4B08 A;  2FPI B;  3PUZ A;  3HOW H;  2K5H A;  1Y1W H;  4DL6 A;  4K8J A;  1PMR A;  1AN8 A;  1QIL A;  1TY2 A;  2EY1 A;  1BUV T;  5FPR A;  4GKK L;  2SNS A;  4FF4 A;  1C3O A;  5FD5 A;  2FIN B;  2MJ8 A;  4X64 L;  4MTE A;  5KFT A;  4DL3 A;  3S1R H;  1GGO A;  1F2M A;  1V43 A;  5KFD A;  1H9M A;  1MHW C;  1N36 Q;  5BN3 A;  2W6P A;  2A68 D;  3M4P A;  2YU9 H;  1N33 Q;  5IOD A;  4FBT A;  4AH6 A;  4NXM Q;  1I94 H;  2PMZ B;  3H3V C;  2P0A A;  4JCV E;  1XX8 A;  2B2V A;  3FKI G;  1QZG A;  2UUC L;  2X0S A;  4PZ8 A;  1SFO B;  2VUM B;  4XXE A;  3PF5 A;  5M3M G;  2K03 A;  4UPA A;  4Z9C B;  1EU3 A;  1XJV A;  4YCV A;  3HOV B;  2FB9 A;  2BR0 A;  3C0F B;  2PQA B;  1TWH A;  4JPB W;  5HV6 A;  5GAE C;  4A3M H;  3RZD B;  2R3Z A;  4QWD A;  1KEE A;  2YU9 A;  2W70 A;  1EIG A;  1VQG A;  3TII A;  4DA2 A;  4KI0 A;  4GKJ Q;  2EY5 A;  1PFN A;  1G6P A;  2NVY A;  2M05 A;  1UC9 A;  1EWI A;  4DUZ L;  2BH8 A;  4N8F A;  1S0M A;  3MXU A;  4CJ1 B;  1RK6 A;  2CH4 W;  3KF6 A;  1NCV A;  1LM0 A;  5EKK A;  1RJP A;  3I2Z A;  1KLU D;  2VQE Q;  3Q1K A;  1IYV A;  4K2K A;  3GLK A;  3U9O A;  3KFU A;  4GS3 A;  2W6Q A;  3C1F A;  1IOV A;  3OHA A;  2JA6 A;  3QWN A;  3RMH A;  3K58 A;  3PO2 H;  3ND8 A;  1I7N A;  3S14 H;  1I50 B;  4JI1 L;  4WJ3 M;  1KAB A;  4CKE A;  4DR2 L;  2HDM A;  5D65 A;  4A3G H;  1FGU A;  4TKO B;  2EVB A; 
#chains in the Genus database with same CATH homology
 2R7Z G;  3F2D A;  2NN6 I;  2OCE A;  1X55 A;  4HIM A;  3HOW G;  4DV5 L;  4A3L G;  2E5L L;  4DV2 L;  1PH9 A;  2K14 A;  4XIG S;  3J81 c;  3BZK A;  2R93 H;  1E1O A;  2LXJ A;  1JMC A;  1HNX Q;  3STB C;  4JI7 L;  3CW2 C;  4LNQ A;  4BXX H;  2Y0S E;  2OTJ A;  1E24 A;  1HNX L;  3HOU G;  1BBW A;  4DR1 L;  4WJ4 A;  2ALY B;  3JAM i;  4X66 L;  1X54 A;  1BVS A;  3ER0 A;  4AQY L;  2OQK A;  2R6G A;  1TWA H;  2ZTC A;  2Y0S G;  2CWA A;  2WAQ G;  1XMO Q;  5IWA Q;  4KLK A;  1K3R A;  4DV3 Q;  3T1Y Q;  3TEH B;  1YHQ A;  3PSI A;  3HOY H;  4BY1 H;  4GOP B;  1SN8 A;  1XNR Q;  4B3S Q;  2ZM6 Q;  4L5R C;  3S16 H;  4KHP Q;  3TRZ A;  1VQ7 A;  2XTI A;  4NXN L;  3DM3 A;  3CPW A;  5FJ8 G;  2KCT A;  4YY3 Q;  4A3J H;  4EX5 A;  4QGU A;  4A3D H;  3HOY G;  1CKM A;  1KAW A;  2DUD A;  3HKS A;  2HIV A;  2C35 B;  1Q82 C;  4HIK A;  4JBW A;  5LMU Q;  1HH2 P;  3JC6 6;  2D0P A;  2E8G A;  2EQS A;  4LF4 L;  3T1H Q;  1Y1V G;  1Q8K A;  4DR7 L;  4JI0 L;  4O0A A;  2UUA Q;  2YTY A;  1Y14 B;  1J5E L;  2OTL A;  3W1B A;  1E7Z A;  4A3E G;  4C3I H;  4X65 L;  4B3M Q;  1QVF A;  1W2B A;  3EBE A;  1CUK A;  1XNQ L;  4A3B G;  4B3R Q;  2ZJR A;  3M9B A;  4L5Q A;  2NN6 G;  1Y1V H;  1XNQ Q;  5FLM H;  2VZA A;  2VQF L;  4KHP L;  4A3K H;  1YIT A;  4BY7 G;  4DV4 Q;  5GAG C;  4DR2 Q;  5IY0 A;  1TXY A;  3U4V A;  4YHH L;  2B3G A;  4C2M H;  4JI4 L;  4JBK A;  3KJO A;  2ZJQ A;  5IP7 G;  2WB1 G;  2V1C C;  4X62 Q;  4A3D G;  2PI2 E;  2NVQ H;  4OWT B;  4LF6 Q;  5LMN L;  3CCU A;  3PO2 G;  1AE3 A;  1CSP A;  3E9I A;  1HJP A;  2F4V L;  4L5T A;  1IBL L;  1HR0 Q;  5IYB G;  4DR3 L;  1N33 L;  3J81 j;  5JJK A;  1CSQ A;  2VS1 A;  4H02 A;  2N78 A;  4YWM A;  1T9H A;  2K50 A;  2PNH A;  2B29 A;  2VUM G;  2Z6K C;  1OXU A;  4JI6 L;  3SGI A;  4GOP C;  1V9P A;  2N49 A;  4MTN A;  2A19 A;  4R4Q A;  1N32 L;  1L1O C;  1D8L A;  1MKH A;  3L2P A;  5C3E G;  5M3M H;  1N8R C;  4LFB L;  1KC8 C;  1J5E Q;  3FKI H;  5M3F H;  4MNO A;  1EUJ A;  3PIP A;  4NPS A;  2ZM6 L;  2VL6 A;  1YNX A;  1O7I A;  3GO5 A;  3UE1 A;  1SFO H;  3CF5 A;  3PO3 H;  2UXC L;  1MIU A;  2AWO A;  2JJQ A;  5H1S E;  4BXX G;  2AKW B;  1H95 A;  2UXC Q;  3CAM A;  1I5F A;  3STB D;  5C0X I;  3I7F A;  2MO0 A;  1A8V A;  2AHO B;  3HFZ B;  1R9T H;  3PV0 A;  3HOX H;  1YJN A;  1HR0 W;  4A3G H;  3CXC A;  5IP7 H;  2GN5 A;  4JOI A;  5IE8 A;  1ASY A;  4OO1 I;  1JJC B;  4LF5 L;  1LUZ A;  2WB1 E;  3RNU A;  1KQS A;  4X62 L;  1RIP A;  1E22 A;  5M5W H;  1EFW A;  1YHA A;  4J15 A;  4DV5 Q;  3U58 A;  3MXN B;  1FL0 A;  1SR3 A;  3UE0 A;  2E2I H;  4DAM A;  1QVC A;  3PGZ A;  2NZH A;  1M90 C;  1ASZ A;  2JA9 A;  1CKN A;  3L7Z C;  2ZJP A;  5M5Y H;  3JAM c;  5DLQ E;  3UDX A;  2Q2I A;  4OXP A;  4DR1 Q;  1YIJ A;  4TVA B;  1IBK Q;  3HOX G;  4OX9 L;  1HNW Q;  2BA0 A;  4DV6 Q;  3K8A A;  1VQ9 A;  3ULL A;  2VW9 A;  1A62 A;  1WI5 A;  3KDF B;  5JEA G;  2JA6 G;  1VQN A;  1RL2 A;  1EOV A;  3S1Q H;  1JE5 A;  1OXV A;  2VQF Q;  4DV3 L;  4YWK A;  1IXR A;  3T1Y L;  4IPH A;  3CCL A;  4GLV B;  4A3J G;  1PH5 A;  1X3G A;  3J80 c;  1Q81 C;  4KHZ A;  4DV2 Q;  4IPC A;  3J80 i;  3AFQ A;  3H3V I;  3K80 C;  3RLF A;  2IHE A;  3KJP A;  1PH6 A;  1GVP A;  1IBL Q;  1FJG Q;  3HOZ G;  4GNX C;  2ZTE A;  2R92 G;  5C4J H;  1Q1E A;  1UE6 A;  2N3S A;  2JA8 G;  3HOZ H;  1PH2 A;  3G71 A;  3H3V H;  3MEF A;  3U4Z A;  2R7D A;  3CCE A;  2N8N A;  1I94 L;  4EQ5 A;  2JQO A;  2Z6K A;  5BR8 Q;  5IYB H;  2B63 G;  4BA2 I;  4JBM A;  4A3C H;  1S72 A;  5JJI A;  5C4X H;  1I94 Q;  3GTL H;  4JI6 Q;  4NB3 A;  1TWH H;  4OWX B;  3T1H L;  2K5V A;  1WCM G;  1XMO L;  4HJ7 A;  3UDG A;  2UUC Q;  1NTG A;  2YTX A;  4YCU A;  1WOC A;  3OW2 A;  4PZ7 A;  1PFS A;  3K7U C;  5E7N A;  5LMN W;  3I56 A;  4B3R L;  1VQD A;  1VQI A;  4R1J A;  5M5X H;  2JA8 H;  3OYY A;  3I4M H;  4JYA L;  4LF9 L;  1N9W A;  3S15 H;  1D7Q A;  3LGJ A;  4DV1 L;  4DK3 C;  3RZO H;  3CME A;  1CKN B;  3H0G H;  1JT8 A;  1N34 L;  2VY3 A;  2F52 A;  2HIX A;  2NVT H;  1VQO A;  1UE7 A;  3U50 C;  5LMU L;  4IOA A;  4A3F G;  1DGS A;  3AQQ A;  5C0X J;  2E5L Q;  4AYB E;  4X64 Q;  2WP8 J;  4L5S A;  1GD7 A;  1A0I A;  1HZC A;  3A5Z B;  3KDF A;  4OWW B;  4R4C A;  3TQY A;  4DR3 Q;  4JI7 Q;  4HJ5 A;  1C9O A;  3W5O A;  1XTD A;  4BA1 I;  4X65 Q;  3RN2 A;  4LUZ A;  5ELN A;  1XPO A;  1BBU A;  1YBY A;  1K73 C;  1PH7 A;  5FJ8 H;  1SMX A;  4DK6 C;  4BBS H;  3BZC A;  4RMF A;  1WJJ A;  4AYB G;  4JI2 L;  1VCI A;  3GTJ H;  3D0F A;  3K7A H;  1IBK L;  1P8L A;  2MFI A;  3I55 A;  1GM5 A;  3ICE A;  4GN3 B;  1IL2 A;  4ALP A;  1X9N A;  1K0R A;  1LYL A;  3NEM A;  4PZ6 A;  3RN5 A;  2WFW A;  1X65 A;  4GLA C;  1KL9 A;  5GRO A;  1M1K C;  1AE2 A;  4DUY Q;  1C7Y A;  5K36 G;  4BY7 H;  1X6O A;  1X3F A;  2Q2U A;  4LF9 Q;  1WFQ A;  4A3B H;  4JC0 A;  4K0K L;  1JJG A;  2PQA A;  1VQM A;  4GNX B;  3HKZ E;  1VQ6 A;  2I0Q A;  3GTK H;  4IPD A;  2LSS A;  2UUB Q;  4DNI A;  1Z47 A;  3A74 A;  4QJF A;  3GTG H;  1EQQ A;  2CWP A;  2ATW A;  4O2D A;  1PVO A;  4AQY Q;  1UE5 A;  1C0A A;  2LXK A;  4TQU S;  4JBJ A;  2ES2 A;  5C4X G;  5IP9 H;  4A93 H;  1X56 A;  1TWC H;  2H5X A;  2B63 H;  3CCQ A;  4LFA Q;  4P71 A;  3H15 A;  1MJC A;  2KBN A;  1JB7 A;  4PG3 A;  1BKB A;  3I4O A;  3D31 A;  1E3P A;  1XMQ L;  3G48 A;  4Y7N H;  1JJ2 A;  4DV7 Q;  1XNR L;  4IO9 A;  2CKZ B;  2K52 A;  4DAY B;  2GVB A;  2VQE L;  2IHF A;  1PA6 A;  1PH4 A;  4YWL A;  4UP8 A;  5GAH C;  2HT1 A;  2MQH A;  2KHI A;  3KOJ A;  2NZO A;  2NVX H;  1U0L A;  4A3E H;  1UEB A;  4DV4 L;  1OXX K;  2BH2 A;  1B7Y B;  4A3I H;  2XGT A;  4DPG A;  4IPG A;  3GTM H;  4DR6 L;  3H0G G;  2GVA A;  1PYB A;  3M4O H;  4LFB Q;  2EIF A;  4GNX A;  5HY6 A;  3CPF A;  3WWV A;  1N34 Q;  2R7F A;  5IP9 G;  4A93 G;  2KCM A;  1VQK A;  4IJL A;  4JI0 Q;  3CCV A;  4HJA A;  4UP7 A;  1E1T A;  2UUA L;  1SLJ A;  4JI5 L;  1N36 L;  1QZH A;  3CP0 A;  3VDY A;  2I5M X;  1YZ6 A;  1EYG A;  4ME3 A;  1I50 H;  4GN4 B;  1N32 Q;  1NY4 A;  4X66 Q;  1Q12 A;  3CCJ A;  1Q1B A;  1Q46 A;  4JI2 Q;  4OO1 G;  4R4I A;  5C44 G;  2R7Z H;  4JI1 Q;  4LF8 Q;  4LFC Q;  1KHI A;  4P73 A;  1PV4 A;  3AYH B;  5IYC H;  3AEV A;  3RR5 A;  2Q2T A;  4RG1 A;  4DV7 L;  4B3T Q;  4DR4 L;  5ELO A;  4APV A;  4A3K G;  1PH1 A;  1VQF A;  5LMN Q;  4DR4 Q;  4R4O A;  4GLX A;  3TRE A;  2E2J H;  2JA7 G;  4FDB A;  3PCO B;  3K81 C;  2Q2H A;  4A76 A;  1VQ4 A;  1CKO A;  3NEN A;  3IRB A;  4DR6 Q;  5M3F G;  5FLX c;  1IZ6 A;  2WAQ E;  1L0W A;  3S17 H;  1QVG A;  1KRT A;  3B6Y A;  1OTC A;  1G29 1;  1K8G A;  1YJW A;  4GKJ L;  2UXD Q;  1NMG A;  2IX0 A;  2JEA I;  5EAY A;  2NVY H;  1QUQ B;  4MZ9 A;  2YV5 A;  4DV0 L;  1HZA A;  1OXT A;  4OON A;  4A3G G;  1VS0 A;  3ERS X;  5IWA L;  3HOV H;  3KF8 B;  2RF4 A;  4DV0 Q;  3KLW A;  3EN2 A;  1HNZ Q;  1HNW L;  3PUY A;  4BBR H;  4DV6 L;  1S3O A;  3F8T A;  4XTC S;  1HZ9 A;  3M7N A;  3FHW A;  1Z9F A;  4JV5 L;  2QGQ A;  4C3J H;  4JV5 Q;  1IBM L;  2AMC B;  1XPR A;  1B8A A;  4R4T A;  2QEX A;  1MJE A;  4DKA C;  2HHH L;  3BU2 A;  5JJL A;  4A75 A;  1VQH A;  2A8V A;  1K9M C;  4AIM A;  4LF6 L;  1G51 A;  1NE3 A;  2MO1 A;  1EQR A;  4QY7 A;  2IX1 A;  4IFD G;  4DR7 Q;  3AFP A;  3M4Q A;  2FXQ A;  4GOP A;  3I4N H;  2RHQ B;  1GO3 E;  1K83 H;  2IT1 A;  3HOU H;  2VNU D;  3S2H H;  2CFM A;  3GTP H;  4HJ8 A;  3HOV G;  3G4S A;  1VQL A;  4P74 A;  2E2H H;  3J7A 5;  5C0X G;  3NEL A;  1QUQ A;  3Q8D A;  3ZJY C;  2R92 H;  4HIO A;  1LTL A;  3OTO Q;  4BBR G;  4LUO A;  3CC2 A;  5HGQ A;  4IFD I;  2HQL A;  1VQC A;  2I5L X;  1IYJ B;  1P16 A;  4P75 A;  4B3T L;  1B70 B;  3E0E A;  1EIY B;  1L1O A;  4DUY L;  4JI8 Q;  3ULJ A;  4POG A;  3KYH C;  3CCS A;  3W1G A;  4JI3 Q;  5C3E H;  4QQB X;  1YI2 A;  1KRS A;  2A1A A;  1K8A C;  4JI3 L;  4PMW A;  4A3M G;  2ZTD A;  2D62 A;  3A5U A;  2JA7 H;  3GDE A;  1WYD A;  3S2D H;  4BBS G;  4A4I A;  3CMA A;  1HR0 L;  1KXL A;  3NBH B;  3J81 i;  4BY1 G;  4UP9 A;  2UUB L;  2UXB Q;  2IY5 B;  3CCM A;  5IYC G;  3S1N H;  1J6Q A;  1NBW A;  1I6H H;  1I3Q H;  1UE1 A;  4NXM L;  1KIX A;  1PYS B;  1VQE A;  1WCM H;  2JEB I;  3M3Y H;  3PF4 A;  4GN5 A;  3K0X A;  4LFA L;  3PUW A;  3RZD H;  1KD1 C;  2UU9 Q;  4LF7 Q;  1VQA A;  4DUZ Q;  3KF6 B;  4HID A;  1S40 A;  4POF A;  3CQZ H;  1Q86 C;  1HNZ L;  1VQB A;  1L1O B;  5C44 H;  3BJU A;  3GTO H;  3S1M H;  3F2C A;  4OX9 Q;  2YTV A;  3I4M G;  3PIO A;  1TWG H;  3UDI A;  4QIW E;  4HJ9 A;  3RLO A;  3G6E A;  3ULP A;  4JYA Q;  2EXD A;  3CCR A;  3PUZ A;  4NXN Q;  3HOW H;  4A3L H;  3GD7 A;  4JG2 A;  1YVC A;  3UDF A;  4A3F H;  4LWC A;  2K5H A;  1Y1W H;  1SRO A;  4LF5 Q;  3DLL A;  3TS2 A;  5JEA J;  1IBM Q;  4JI4 Q;  4C3H H;  4DR5 L;  4GKK L;  1GKH A;  3PUX A;  1PH8 A;  2JA6 H;  4X64 L;  1YEZ A;  2CQO A;  1OXS C;  4IJH A;  2K4K A;  3S1R H;  1FJG L;  1FVI A;  1V43 A;  1N36 Q;  3CC7 A;  4JI5 Q;  1HZB A;  2Z0S A;  3A0J A;  3GTQ H;  2K75 A;  4P72 A;  2ID0 A;  3M4P A;  2YU9 H;  1N33 Q;  2VUM H;  2JE6 I;  4B3M L;  4IFD J;  4AH6 A;  4NXM Q;  3I4N G;  1PHJ A;  2OWO A;  1V1Q A;  5BR8 L;  1SRU A;  2I5H A;  2OQ0 A;  4JCV E;  3HKZ G;  3PO3 G;  3F1Z A;  1VQP A;  3TS0 A;  3E9H A;  4LFC L;  3CC4 A;  3FKI G;  1QZG A;  2UUC L;  4PZ8 A;  1VQ5 A;  1YJ9 A;  4A3C G;  3PF5 A;  1L2F A;  4UPA A;  2BA1 A;  5M3M G;  1XJV A;  4YCV A;  5GAD C;  5GQO A;  1VQ8 A;  4LUV A;  2PQA B;  1AH9 A;  2L15 A;  3J7Z C;  4JI8 L;  1PH3 A;  5AJ3 Q;  1Q7Y C;  2R93 G;  1NJI C;  1XPU A;  5GAE C;  1SE8 A;  1X3E A;  4A3M H;  2F4V Q;  4K0K Q;  1U5K A;  2JK8 A;  5AJ3 L;  2KEN A;  3EIV A;  1TWF H;  3CD6 A;  1VQG A;  4DV1 Q;  4Y52 H;  4YCW A;  2HHH Q;  4JOI C;  2YYZ A;  2MNA A;  4LF4 Q;  2PMZ E;  2UXB L;  4KI0 A;  3M85 A;  4GKJ Q;  2UXD L;  1G6P A;  2KHJ A;  2UU9 L;  2JA5 H;  5IYD H;  1EWI A;  5IT9 c;  5J3B A;  2RHS B;  4DUZ L;  4IOC A;  4UY8 C;  2BH8 A;  2RCN A;  4X6A H;  3KF6 A;  4LW1 A;  1LM0 A;  1XMQ Q;  4A3I G;  4LF7 L;  3I2Z A;  5FLM G;  2K5N A;  2VQE Q;  1A63 A;  1W3S A;  2QA4 A;  3FP9 A;  4B3S L;  1NMF A;  3L0O A;  3PUV A;  2AWN A;  4GS3 A;  2D0O A;  4QL5 A;  2PI2 A;  3KFU A;  1YHB A;  5IYD G;  3OTO L;  3F2B A;  2JA5 G;  2F3I A;  4YHH Q;  3PO2 H;  2CCZ A;  3RLN A;  2DGY A;  3S14 H;  4JI1 L;  4YY3 L;  4LF8 L;  4WJ3 M;  2ASB A;  1VQJ A;  4DR2 L;  4DR5 Q;  1Y1W G;  1UWV A;  4GKK Q;  1FGU A;  3S24 A;  1EIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...