4BBRG

Structure of rna polymerase ii-tfiib complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 28
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4bbrG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4bbrG01
1J6QA 3E9HA 3JAMc 1LYLA 4L5TA 4JC0A 1QUQA 3CXCA 1HZ9A 2UUAL 1WCMG 2UUBL 3GTLH 4TQUS 3PF4A 4YY3L 2E8GA 1YHQA 1IBML 4LF7L 3RLFA 1Q12A 4OO1G 4HJ7A 2JA5G 4OWXB 4BBSG 4K0KL 4QY7A 1VQPA 5IP7H 4JBMA 2JEAI 1PFSA 5C3EG 5J3BA 5IYCH 2RF4A 4B3TL 2VUMH 5IP7G 4DV6L 1PH4A 1IL2A 1OXSC 2BA0A 1VQ8A 5C44G 4UY8C 3PO2H 4DR1Q 2EQSA 1K3RA 3I4MH 4IOAA 2IX1A 4QQBX 4K0KQ 4Y52H 2PNHA 1XPUA 3E9IA 4HIDA 2JQOA 1FVIA 3K80C 2BH8A 1N33Q 4ME3A 2UU9L 3S15H 3PGZA 4GLXA 1B8AA 1UE7A 3HOUG 5C3EH 3PIOA 1SLJA 4KHZA 3A5ZB 3PIPA 3T1YL 4R4CA 1JT8A 1OXTA 3S2HH 5E7NA 2MNAA 4JV5Q 4DR6L 1RIPA 1CKOA 1EIFA 4L5RC 3LGJA 3CCVA 1HR0L 1X56A 1CKMA 4AQYL 2ZJQA 1IZ6A 2F4VL 1X3GA 1FGUA 3Q8DA 3J7ZC 1CKNB 2B3GA 2NN6G 2V1CC 3KDFB 4J15A 1X65A 4P71A 1B70B 4LF8L 4O0AA 5FLMG 4DUYL 4UPAA 1W3SA 5ELNA 1EIYB 3S1QH 4LF9Q 3TREA 1PYBA 4B3ML 3A74A 3STBC 4AYBE 5HY6A 4P75A 2WAQG 2WFWA 3TQYA 4X66Q 1BBWA 1VQOA 3CMAA 4X65L 4JI6Q 2Y0SG 5GQOA 4A3DH 1ASYA 5JJLA 5DLQE 3PUWA 4B3MQ 1Q46A 4LWCA 1E1OA 1SN8A 1AE3A 1HZAA 3I55A 3RN5A 3HOWH 2K50A 1K83H 1TWFH 4WJ4A 2Z6KA 3G6EA 2UXBQ 4GKJL 5EAYA 4AH6A 4A3DG 4L5QA 4DK3C 2AMCB 1X6OA 5GADC 1N32Q 2R92H 1Q81C 2EXDA 4DV6Q 5C4XH 1IBLL 3PUYA 5IYBH 4JI1L 1HZBA 4LFCL 4A3GG 1EQQA 4JBWA 4R4TA 1BKBA 2E2JH 1X3FA 4LW1A 4A3LG 5FLMH 1HNXQ 1CUKA 4A3CG 4JI7Q 4A3EG 3CC2A 3UDXA 2R93H 4C2MH 1MJCA 1WI5A 2Q2IA 1VQLA 2YV5A 2E5LL 2LXJA 3PCOB 1VQMA 4LFCQ 4BY1H 1JJGA 4X66L 4B3RL 1I94Q 4LF6L 1PA6A 1C0AA 3CC7A 4UP8A 4NXMQ 3L0OA 1Q1EA 1E3PA 1NY4A 1V1QA 3DLLA 2UUCQ 3JC66 4UP7A 4YCWA 3AEVA 2JA8G 1A63A 3RZDH 1R9TH 4A3BG 4BY7G 4GNXB 4A75A 3H3VI 4DR5L 3K0XA 1YJNA 4YWKA 3I2ZA 3KF6A 3U4VA 1PH8A 3S1NH 4GN3B 3UE1A 1UWVA 2MFIA 3M85A 3H0GG 5IYBG 5JEAG 5IT9c 4JYAQ 3PO3H 2FXQA 3KF8B 1N34L 2AKWB 2PI2A 4GOPC 4LF5Q 4BXXH 1JB7A 2R92G 3PV0A 5JEAJ 2UXCQ 1SROA 3G48A 1X9NA 3S24A 1EFWA 4IPDA 4JI7L 4C3JH 1GKHA 2JA6G 1L1OA 2R7FA 1NTGA 4A76A 1JMCA 5FLXc 2JEBI 1VQ9A 2Q2HA 1Y1VH 4C3HH 1EOVA 1EQRA 1FL0A 5LMUL 4JI2L 5LMNQ 2IHFA 1QVGA 2Z0SA 2K75A 1P16A 4IPGA 4GKKL 2KCTA 5M3MG 2OQ0A 1VQNA 4JOIA 4R4OA 1TWCH 4JOIC 5GAEC 3CCEA 1PHJA 1RL2A 4DV0L 3HOXG 1KL9A 4IJLA 3CQZH 3TEHB 1XMQQ 1EYGA 2YTYA 5H1SE 2CWAA 2JA5H 4MNOA 1XNRQ 3F8TA 1HJPA 4QJFA 1VQFA 1SFOH 1J5EQ 1BBUA 3CCSA 3U58A 1I94L 2CCZA 4LF5L 2ASBA 2YTXA 2ZTEA 3MEFA 4YHHL 5M3FH 3L2PA 4DV1Q 4OXPA 1OTCA 1YJWA 4B3TQ 4LF9L 4DR7L 1PH7A 4LFBQ 4JI4Q 3BZCA 1KQSA 1I6HH 4GLVB 2GN5A 4PZ7A 4AYBG 3VDYA 1XNRL 4MTNA 4H02A 4A3GH 1X3EA 3HOUH 2GVAA 2N78A 3M3YH 4NXNQ 5K36G 2Q2UA 2NN6I 4JV5L 4ALPA 2K4KA 2K5HA 3UDIA 5IE8A 2JJQA 2BA1A 2L15A 4HJ8A 2UXDQ 1M1KC 4OWTB 3GTPH 4IFDG 2E5LQ 2HQLA 4MZ9A 3K7UC 4A93H 1YHAA 4PG3A 1P8LA 5M3MH 2C35B 4B3SQ 1YBYA 1PYSB 4BA2I 3RR5A 4DUYQ 1CSQA 2UXDL 1T9HA 5IP9G 1XPRA 4NXML 2LSSA 3J80i 2RHSB 4LF4L 1V9PA 3H3VH 1XTDA 4YHHQ 3ULPA 3W5OA 1NE3A 5IYDH 1HNZQ 4PZ8A 2AWOA 4KLKA 1LM0A 3J81i 3CCLA 4RMFA 3ICEA 1X55A 2KENA 1VQCA 3G4SA 5C0XI 1X54A 3U4ZA 3OW2A 1Y1WH 4XTCS 3H15A 4JI0L 2IX0A 4YWLA 4LNQA 3CP0A 2OTLA 4KI0A 4O2DA 3CD6A 2PMZE 1HNWQ 2D0OA 3B6YA 4DR7Q 4JYAL 4A4IA 1WYDA 2JA9A 2XGTA 3E0EA 3H0GH 1NJIC 1N34Q 1M90C 3NBHB 2ZJPA 3CC4A 3M4QA 1S72A 4RG1A 1CKNA 4DKAC 3CPFA 4IFDI 1N32L 2R7DA 2I5MX 4WJ3M 1D7QA 3A0JA 1VQEA 4GN5A 4YCUA 1YHBA 2WB1E 1Y1VG 4R1JA 1PH5A 4A3BH 3GTJH 2AHOB 1IXRA 2N49A 4DR3L 1G291 3AFQA 1YZ6A 1N36L 4JI2Q 3T1HQ 2A19A 2KHIA 4DNIA 2A1AA 4DUZQ 3BZKA 1N8RC 1HNZL 1FJGL 2B63H 1LTLA 2ID0A 1K8GA 4BXXG 4EQ5A 1XNQL 3ULLA 2YU9H 3F1ZA 4A3JH 3G71A 2OTJA 5HGQA 2QA4A 4P72A 4X64Q 1IBMQ 4LF7Q 3TRZA 2VZAA 4POFA 3CCRA 4TVAB 3GTQH 4BY7H 3HKSA 4DK6C 5BR8Q 4DV1L 1Q82C 2JA8H 3PUXA 1VCIA 4A3FH 1UE6A 4DV7L 2XTIA 1WOCA 5C4JH 1Z47A 3RLOA 1YI2A 1XMQL 2I5LX 1GM5A 4GKJQ 3KOJA 5BR8L 3FP9A 5FJ8G 2A8VA 3HOYH 3GTOH 5IWAL 4GS3A 3D31A 4R4IA 3KLWA 1OXXK 3FKIH 2NZHA 5GAHC 4A3IG 1Q7YC 1IBLQ 3J80c 4A3FG 4JI4L 4A3CH 2R93G 3KYHC 2E2IH 4DV3Q 4OX9L 2OWOA 1GD7A 2VY3A 5LMNW 3KJPA 4B3RQ 1E7ZA 3CAMA 1XNQQ 5M3FG 4DR4Q 3M9BA 1W2BA 3RN2A 1QVFA 3I4NG 1VQGA 3HKZG 5LMNL 2JE6I 1D8LA 3J81c 1SE8A 1MKHA 2N8NA 3FKIG 3HOXH 2RCNA 2QEXA 4A3IH 3PUZA 4A3MG 2CQOA 3W1GA 4NB3A 3A5UA 2JA7H 1E22A 4YY3Q 1IYJB 1JJCB 5IYDG 3DM3A 2ZTDA 4YCVA 2VQEQ 4DV4L 1KC8C 2UUCL 5M5WH 3GTKH 1HR0W 3I4MG 2R7ZG 4C3IH 3NELA 2IHEA 5C44H 4X65Q 4HIOA 4P74A 1PVOA 4DV4Q 4DV2Q 1S40A 2D62A 1HNWL 3RLNA 1H95A 2IT1A 4APVA 1Y14B 2VL6A 2PQAA 3D0FA 3ERSX 3GTGH 4BBSH 2WP8J 3I4OA 1Z9FA 1U0LA 1NMGA 2I5HA 1PV4A 1IBKL 2KBNA 3M4OH 1VQ6A 3FHWA 2ATWA 1UEBA 1XPOA 1VQIA 3RNUA 3HOVG 3UE0A 1HR0Q 3W1BA 1OXVA 2NVYH 2ZM6Q 1YJ9A 1Y1WG 1U5KA 2JA6H 1G6PA 2KHJA 4A3KG 4GOPB 4IJHA 3T1HL 5IWAQ 1K73C 1WCMH 4HIKA 1O7IA 3S1MH 2HIVA 3GDEA 3KF6B 3STBD 3TS2A 4DR2Q 4GKKQ 1OXUA 3ULJA 4JBJA 1I3QH 2JK8A 3CMEA 4GNXC 4LF6Q 1QZHA 3NEMA 3EN2A 1QVCA 4IO9A 1KIXA 2MQHA 1C7YA 2VUMG 2Q2TA 1EUJA 4IFDJ 1JE5A 4DUZL 1FJGQ 5M5YH 2RHQB 2QGQA 1K9MC 1CSPA 3SGIA 4JCVE 1UE1A 4Y7NH 1TWAH 1B7YB 1KRTA 4DR1L 1VQBA 3MXNB 1YITA 4LFBL 3I56A 4JI8Q 4X64L 2B29A 4PMWA 3TS0A 2ZM6L 2R7ZH 3ER0A 1BVSA 2HHHL 5AJ3Q 1KXLA 4DV5Q 3K7AH 5GAGC 1VQ7A 1I50H 4LUOA 4DPGA 4A3MH 2LXKA 4AQYQ 1N36Q 2F4VQ 3S17H 4KHPL 1Q86C 2HHHQ 3HOZH 5AJ3L 1NBWA 4L5SA 3GTMH 1QUQB 1MIUA 4DAMA 1YNXA 1KD1C 4LUZA 4JI5Q 3I4NH 4OO1I 2YTVA 3EIVA 3CCUA 4LFAL 1VQHA 4BBRH 1KAWA 4DV3L 2ZTCA 2DUDA 1SMXA 3PSIA 4XIGS 4X62L 1LUZA 3GO5A 4DAYB 3KJOA 4LF4Q 1KRSA 3AYHB 1A8VA 4LUVA 3OTOQ 4DV0Q 4JI6L 1VS0A 2HIXA 4IOCA 1PH6A 4DR5Q 4GOPA 1N9WA 1XMOQ 4OWWB 2NVTH 4DV2L 3CF5A 2PQAB 1TWGH 2AWNA 2VQFQ 2IY5B 1L2FA 2WAQE 1VQ5A 2D0PA 3K81C 1HZCA 1AE2A 4YWMA 1EWIA 2E2HH 2VS1A 3HFZB 3HOVH 2UXBL 1HH2P 3EBEA 1XMOL 2GVBA 4QGUA 1KHIA 3AQQA 4JBKA 4GN4B 2ES2A 3AFPA 3KDFA 1PH1A 3L7ZC 4GNXA 3GD7A 4A3JG 4POGA 4JI3L 1XJVA 1PH3A 2I0QA 4DR4L 1V43A 3WWVA 2B63G 1E24A 2CWPA 3UDGA 4OX9Q 5JJIA 4OONA 2K5VA 3PUVA 2NVQH 2BH2A 4EX5A 4BA1I 3KFUA 3CCQA 4B3SL 3K8AA 4QIWE 3ZJYC 1A62A 1VQDA 1YEZA 1GO3E 4IPHA 4BY1G 1PH9A 1SR3A 1JJ2A 2UUAQ 3CPWA 2UUBQ 2WB1G 4JI5L 1J5EL 1TWHH 4A3KH 1VQKA 5JJKA 1DGSA 4DR2L 1ASZA 1E1TA 3J81j 1TXYA 1S3OA 5M5XH 4JI8L 3PO3G 4QL5A 3OTOL 1WJJA 2DGYA 1Q1BA 3CCMA 4GLAC 1AH9A 2NZOA 1VQAA 2K52A 3UDFA 2ZJRA 4JI3Q 2UXCL 4HJ9A 1A0IA 3U50C 3M4PA 2VQFL 4NXNL 4BBRG 2EIFA 2CFMA 2PI2E 3HOYG 1Q8KA 4A93G 3T1YQ 2NVXH 1L1OB 1SRUA 2R6GA 2MO1A 3M7NA 4R4QA 4DR6Q 2Z6KC 4KHPQ 3RZOH 5ELOA 3JAMi 4A3EH 3HOZG 2F52A 1NMFA 1L0WA 1YVCA 2ALYB 5IYCG 3NENA 1YIJA 2OQKA 4DV5L 5C0XG 4HJ5A 5C4XG 1VQ4A 1MJEA 3BJUA 2VNUD 2N3SA 3F2BA 1K0RA 4A3LH 4X6AH 3CCJA 4PZ6A 3BU2A 2VQEL 4FDBA 4AIMA 5IY0A 2JA7G 1GVPA 2CKZB 2YYZA 4NPSA 1N33L 3OYYA 4JI0Q 4LFAQ 2HT1A 1C9OA 5IP9H 3CW2C 4HIMA 4HJAA 3S2DH 4X62Q 4IPCA 2KCMA 5C0XJ 3HKZE 3I7FA 4DV7Q 2K14A 1I5FA 3S16H 2VW9A 1K8AC 2F3IA 3HOWG 3S1RH 1PH2A 4JG2A 2OCEA 3J7A5 1IBKQ 3F2DA 5GROA 3S14H 1L1OC 3PO2G 3F2CA 4UP9A 1QZGA 3IRBA 4LF8Q 4DR3Q 1UE5A 4JI1Q 5FJ8H 2K5NA 2UU9Q 2H5XA 1VQJA 2Y0SE 1G51A 1HNXL 4P73A 3PF5A 1WFQA 5LMUQ 2MO0A
chains in the Genus database with same CATH superfamily
3MEHA 3JAMc 2R8HA 3CXCA 1QUQA 3GIPA 2VQFH 2W7OA 3PF4A 1JDBB 2V9WA 2PO4A 4YY3L 2F0NA 1VBHA 1PXUA 5FK9C 4LF7L 3GILA 1EEFD 1Q12A 2E76C 1WD0A 4OO1G 5C5JA 1U9RA 2LKVA 3C2PA 5J3BA 1D5MC 5IYCH 2VUMH 4B3TL 2W6OA 4J9QA 4DV6L 2GA4B 2BA0A 1VQ8A 3PMFA 1JX4A 4G57A 2IX1A 4QQBX 4O3RA 1ESFA 1G2SA 4A3JB 4HIDA 3D6WA 1N33Q 2BH8A 5ELDA 4ME3A 4ZQ3A 3N41B 4GLXA 1RYRA 3L9AX 5C3EH 3PIOA 5LL6X 1IYVA 2F0VA 2PNRC 1PTOD 3MXUA 2MNAA 4ED2A 1S5CD 3KLSX 1EIFA 4L5RC 4TKOB 1HR0L 1X56A 2XNAC 5ELCA 4N8X1 4KJNA 2OH2A 3FKIB 5CR3A 1CKNB 1BO0A 1GUSA 4J15A 3OIQA 2FMAA 3FMAA 1H9MA 3C0FB 4DR5H 2W70A 4DUYL 2W9CA 1W3SA 3F8NA 2XCAA 4HCSA 3PZPA 5IT9W 3TREA 4B3ML 5C4JB 4DV6H 3ITPA 2W6ZA 4P75A 1DJRD 4A3MB 4GC6A 2NU7B 1LV9A 2E5LH 4U673 2Y0SG 5GQOA 5JJLA 1ASYA 1EYZA 3PUWA 2XWJB 1K8OA 4HAEA 2MHVA 1BF4A 2P0AA 4ED0A 2FLNA 4CDDC 1M8AA 5J22A 3GV8B 2Z6KA 1TWAA 4IRCA 1PRTD 3RBEA 1UNNC 1BXRA 2R93B 2YU9A 2J6TA 4UDUC 5EKLA 2PCFB 2R92H 4DV6Q 2HGSA 3OOCA 4GZYC 3QFFA 2X0SA 2W71A 4RKLA 3RAQA 4B3TH 2QDLA 3ZYYX 4A3LG 4DL5A 1HNXQ 1U4PA 2NTSA 4A3CG 2NB0A 3G6JB 4DR4H 2YV5A 4EFBA 2HDMA 3PCOB 1ZYRC 3PW7A 1DOKA 4LFCQ 4N9TA 5T1IA 1JJGA 1R4QB 1TS4A 3U9OA 1I94Q 1PA6A 3GTOA 4UP8A 3WNZA 2A74C 4XT1B 5E3FA 2XRQD 3V05A 4QW9A 4A75A 3H3VI 1YJNA 4HSPA 4YWKA 4F4WA 5D14A 2F1MA 1PH8A 1V1OA 2MFIA 3TSSA 3H0GG 5D1OB 4PV1C 2AGPA 3K0YA 2FXQA 4LF5Q 4GOPC 5KFSA 3PV0A 4HSVA 1PLFA 5C4ZA 2UXCQ 2M2LA 1I4RA 3G48A 3BVGA 4C3JH 1L1OA 3MTSA 1Z2OX 1SBBB 4X3TA 3M4YA 4G7HC 1HHVA 2JEBI 4J9KA 5CA1F 4KHVA 4RZRA 1O7ZA 1HFGA 2Z0SA 4F8MA 2K75A 2KCTA 1XNQH 3SK5A 1T5XD 3WOFA 4JOIA 4R4OA 1WTRA 3VR4A 4JOIC 4C5CA 5KFWA 1PHJA 2R7LA 4DV0L 3HOXG 1MSGA 3CQZH 4C3IG 1E0BA 4Q0YA 3DMUA 1CI3M 5KGUA 1Z7TA 2EYOA 4MNOA 4V190 4UCUA 1XNRQ 4LFAH 2NVXB 1HJPA 1SFOH 4B3RQ 2NVYA 4C2MB 1I94L 2ASBA 4JV0A 2ZTEA 4DV1Q 3L2PA 3BS1A 4OXPA 5DGAA 1KDAA 4LFBQ 4JVZA 5FO7B 1XNRL 2YYAA 4MTNA 1WCMA 1WTPA 3DHQA 5HV6A 4RNNA 2N78A 1BGWA 2B2VA 2VB2X 3RZDB 3R2IA 2Q2UA 2NN6I 2F0PA 1TWFB 1M4VA 2K4KA 2NVTB 1AFPA 5IE8A 4J9SA 2L15A 5LP6F 1M1KC 2W9CB 4OWTB 3GTPH 4KN7C 2R84A 2E5LQ 1BCPF 4MZ9A 4A93H 3GIIA 1YHAA 4PG3A 1KBLA 2C35B 1JCKB 4ZCKA 5KFIA 1EIGA 1B6RA 3QO2A 3RR5A 5IP9G 1XPRA 3GTPB 2L0CA 4TV9F 2ZM6H 3JSLA 2P5ZX 3J81i 3CCLA 1CT1D 1X55A 2KENA 1X54A 3U4ZA 5JVH3 4XTCS 4GKKH 5EKKA 2IA6A 2CW0C 1STBA 4YAKB 3CP0A 2OTLA 4KI0A 4K0KH 1DIKA 1B6SA 1S5BD 3GIMA 1L0YB 4XDXA 1KXLA 2W9BB 3H0GH 2C28A 1M90C 4ZYSA 1D2BA 2ZJPA 4A2AA 1I4XA 1CKNA 2PMZB 4DL6A 2I5MX 3A0JA 4GN5A 5M5XB 3GTQB 4JI7H 2WB1E 5KFDA 3GTJH 1I94H 4JW0A 2WE6A 3PO2B 1GHJA 3LX0A 2MUYA 3M9NB 1YZ6A 1KDBA 1UUPA 4KY5A 4ZOLF 3T56B 1PK8A 4MHEA 3H20A 4OX9H 2KHIA 2VB3X 3BZKA 4E6IA 3K5NA 1HNZL 1FJGL 4GKJH 2EDGA 1BDOA 4GC7A 4QMGA 4JI4H 1XNQL 1O7YA 4HNTA 1E2VA 4FVMA 4UCSA 2QA4A 3R23A 5HURA 1KJ8A 3TRZA 5KNCA 2O03A 3KAJA 5C8YF 1CZGA 4Y8VB 3HKSA 1IKLA 1N32H 2C5CA 3PUXA 5C4HA 2A6HD 4IAJA 3M9OB 1B33N 4DV7L 1AP0A 1SNDA 1DV2A 1DONA 4A3EB 1WOCA 3GV3A 5C4JH 3TN2A 1GM5A 4GKJQ 2IP4A 3V6KA 2KCNA 1SE2A 3GTPA 2FKLA 1I3QB 1EQTA 3D31A 1K3BC 2NZHA 1FJGH 1A2UA 4A3CH 4UHVA 1SYGA 1GLVA 1MZBA 2R8KA 5LMNW 2IBKA 2OT2A 4H0LC 3I72A 3G6YA 2A73B 2CZGA 3SE7A 1QVFA 2Z4IA 5LMNL 1IKMA 3E3XA 2JE6I 1D8LA 4RWSC 3V2TA 4FO2A 4A3MG 1CQVA 4DV1H 2BR0A 3LWBA 1E22A 4C5BA 1IYJB 1JJCB 1UEAB 3DM3A 4ZI7F 4YCVA 2JP1A 3OUUA 3R3OA 4N9PA 2UUCL 2FFKB 2R7ZG 2HVRA 3NELA 2UUBH 5DM73 3K3VA 3DF7A 3H09A 4MTKA 5CV7A 3R93A 3GTLB 3M4IA 4UCRA 1GGOA 5JUMA 5I47A 2VL6A 3D0FA 2PQAA 3GTGH 4QF4A 1XXGA 1PV4A 2QW7A 3T16A 4XX0B 2F0WA 2ATWA 1VQ6A 3SHLA 1GSHA 3DM1A 4HR7A 2PZUA 1BR9A 1H9JA 4ABNA 1BUVT 1OXVA 2ZM6Q 1YJ9A 2YL2A 1G8ZD 4IJHA 5D1OA 4Q45A 3RMHA 2BQUA 1F2ZA 5KNDA 4IUPA 2HIVA 1SJED 2QK4A 4ED7A 3TS2A 3N43B 4GKKQ 1OXUA 1TT2A 3EROA 2L4NA 1HRJA 2FLPA 4GNXC 4LF6Q 5DNFA 5C3XA 4YB8B 5I6YA 5I9OA 2VUMG 2MQHA 3D4WA 4B08A 4IFDJ 1WTWA 2Q8IB 2EE1A 1SNQA 4DXGA 1N48A 4IR9A 3MFYA 3H91A 4Y7NH 1B7YB 3PW2A 2R8GA 1SYXB 3I56A 4JI8Q 3A7LA 5L1IA 2B29A 4K8JA 2UXDH 4PMBA 2RDFA 1BCPB 3ND8A 4K5VA 4G7OC 2HHHL 5DG8A 1STAA 3K7AH 3RB6A 4FP5D 1VQ7A 2PPBC 1I50H 2SDFA 2I8CA 2ASLA 4DPGA 4AQYQ 2F4VQ 2HHHQ 1W6JA 3HOZH 2XWBB 4LF8H 1CQFA 2RSNA 1QUQB 1MIUA 2DLNA 2F0LA 4JI8H 4IUQA 5ELBA 4BBRH 3HXLA 1B9NA 1KAWA 1DCZA 2EYLA 3PSIA 1LUZA 4DAYB 3V6JA 5KFUA 1VDZA 4RCOA 4LF9H 1A8VA 4JI6L 1VS0A 1SDFA 4ILWA 1PH6A 4DR5Q 4BBRB 1XMOQ 3VA5A 5CV4A 3FMCA 4XYOA 2R7MA 2R7ZA 1TWGH 1RF2D 3RZOB 4J9NA 1L2FA 1PTOC 4MV4A 4EFEA 2BE5D 3MXNA 1VQ5A 2D0PA 2N55A 1HZCA 4YWMA 1H9RA 2B2TA 1HH2P 3RFCA 1XMOL 4E4TA 3KXYT 4ED6A 2K03A 1QB5D 5G3LD 4IUTA 5C6AA 4DAVA 4JBKA 3BJYA 4GN4B 4F4YA 3JSNA 3L7ZC 3HOVB 3GD7A 2WB1B 4JI3L 5BN4A 2I0QA 3UDGA 2FMCA 3PUVA 2VXWA 5CYUA 1F2YA 4U7CA 4I4TF 4FF3A 4BA1I 4XT3B 3A8IE 1EY6A 4F87A 2FK2A 4LSAA 2Z4HA 2UUAQ 3QB3A 1DD2A 5EGTA 2DJGC 4Q8EA 5EWFA 2TMPA 4DV5H 4JUZA 1DGSA 3JZIA 2PZTA 1EY9A 4EQPA 2GLTA 1TXYA 2R85A 1JOOA 4JI8L 1NUCA 1I4GA 4QL5A 5F9NA 3P20A 2JA5B 2AUJD 1Q1BA 4A2BA 2E75C 5JVDF 1AH9A 2E2DC 3JAMW 3UDFA 2UXCL 2ZJRA 1A0IA 2FHTA 3M4PA 2UUAH 3TQ1A 2EIFA 2CFMA 1GUTA 2WKCA 3T1YQ 2DJFC 2B63B 1SRUA 1TWCB 2MO1A 1V51A 1KNAA 2Z6KC 3SK4A 1TWGB 3RZOH 2PVPA 5FOBB 2PMZA 1S0OA 3H6MA 2VA3A 1YVCA 4G7ZC 4JV1A 4KKUA 1VQ4A 4ETSA 3A56A 2N3SA 3NGDA 2EYJA 2MJ8A 1QNUA 3VYUA 3SR1A 1ULZA 1V4YA 2WYOA 4J9LA 4Q8FA 2EXZA 2CW0D 1B9MA 1C9OA 1AW7A 3K7AB 4HIMA 4L6TB 1NAPA 3S2DH 5C0XJ 5EQ0A 3D4RA 4AQYH 2F4VH 1I5FA 4ME5A 4YIJA 2VW9A 1K8AC 3S16H 2F3IA 4QWAA 1RD9D 2RDJA 1KTKA 2OCEA 3F2DA 1IBLH 1QE6A 4MTEA 3KHRA 3K5MA 3F2CA 1QZGA 5JAVA 3EVQA 1TS2A 2M00A 4XYMB 1Z6HA 4JI1Q 5COYA 1SYEA 3MWEA 3RV3A 4RNOA 4DR1H 4J0MA 5LMUQ 3PN1A 2SCUB 4PDBA 5KFLA 3TMEA 4L5TA 1HZ9A 3BDOA 1LLRD 3NE5B 1WCMG 4HEDA 4TQUS 1ENAA 1QG7A 2AQ1B 2R82A 2E8GA 1IBML 3CRLC 3MFHA 4C3HB 2JA5G 2EJMA 2KECA 4BBSG 5HGTA 4K0KL 4QY7A 1IOWA 2AUKA 3RB3A 2DPIA 4JBMA 4JI1H 2J0TD 4IUUA 3TZDA 4LFCH 3JRXA 4NKLA 2EQSA 4DR1Q 5IOCA 5K2MA 2PQEA 4OO1H 2K04A 3CQZB 2PNHA 1XPUA 5DLGA 4ED8A 2NVYB 3E9IA 1WTVA 4K5WA 1B8AA 1R9TA 1SNOA 3VR3A 1ML0D 1EQVA 4KHZA 4DFAA 1OXTA 2SNMA 3S2HH 2ZXRA 5E7NA 3K5LA 4EBEA 1RIPA 3NWSA 3LGJA 1IZ6A 1LTBD 3J7ZC 2GPWA 3A55A 2V4DA 4RB1A 4L1KA 2B3GA 2V1CC 3KDFB 3OMCA 4EGQA 5KFJA 5C3WA 1X65A 4IR1A 1B70B 4O0AA 4L63B 3I70A 3S1QH 1PRTB 2RGVA 3A74A 4ZKBB 4AYBE 5L9XA 4Z9CB 1ZHQA 1Q3LA 3TQYA 2NTTA 2WINB 4DNTB 4X66Q 1BBWA 4R9WA 1VQOA 3DWQA 4X65L 2BQ3A 4IUVA 5DLQE 3FDTA 3F2UA 1SN8A 3RN5A 1HZAA 5JVLA 3T1YH 3KLSA 5CAEB 1TWFH 2YS6A 1U4LA 2MCTA 4WJ4A 1XNRH 4AH6A 4A3DG 4L5QA 1RJPA 3QJYA 2LFNA 3RBDA 5GADC 1N32Q 3RUZA 3R2TA 2W9AA 5C4XH 1IBLL 2QKIC 4V0BA 1HZBA 1VF5C 2E2JH 4JBWA 1X3FA 1I50A 2VUMB 5FLMH 1X3QA 2R93H 2HQEA 1BCPC 1XTCD 2YZGA 4DV3H 1A3VA 2L55A 4ED1A 4J9MA 3GTQA 1U4RA 1STEA 2NU6B 1VQMA 3E0JA 4M7EA 3K5HA 4BY1H 5IGGA 1LT6D 3MWMA 4B3RL 3BQ0A 1D1IA 3SE0A 3T1HH 2A6HC 1C0AA 2KJXA 3HP3A 2F0DA 1NY4A 1QNKA 4MAMA 3S16B 4UP7A 4YCWA 4TV8F 1EZ1A 4BY7G 2KSWA 5A2QE 3VYTA 4O4LF 2F3WA 2B63A 1EFID 2B2YA 3UE1A 5DAUA 1VMPA 1STYA 4CJ1B 4Q44A 5JEAG 3PO3H 4L8JA 1N34L 2AKWB 2R92G 5JEAJ 4CGYB 1ENFA 1ICFB 2UU9H 1EFWA 3S24A 2FJ2A 4JI7L 2E2HA 1GKHA 3RGZA 3SEBA 2R7FA 1NTGA 2O5IC 1MGSA 1JMCA 3I4MB 1Y1VH 4C3HH 4HNVA 4TQRA 2OF1A 1CK1A 1FL0A 1EQRA 3PQIA 5LMUL 3MR3A 5LMNQ 1QVGA 4MV3A 4HNUA 3BA8A 4IPGA 4GKKL 3RGXA 2NVXA 4DR2H 4ZKCB 4UAIA 1PX2A 1RL2A 5FKAC 1TWFA 2K28A 3TEHB 4FM9A 1RCVD 3WO0A 4LH7A 4A3BB 3S17B 3F8TA 4QJFA 5KFEA 1VQFA 1J5EQ 1PFNA 3CCSA 3U58A 1TAEA 4ECWA 1PTOH 4HCEA 5M3FH 1BBXC 1VBGA 3I4NB 4DV7H 4WRDA 5GONF 2KOLA 4LF6H 4FXGC 4J9RA 4JI4Q 1S9FA 1B3QA 5EPLA 1I6HH 5KG3A 1SYCA 1GSAA 3VDYA 1S5DD 2VOBA 5JPMC 3GTMB 5A35A 4H02A 2CH4W 3X3MA 1D5ZC 3NTHA 1PZJD 3H3VC 4NXNQ 3AU7A 1A3TA 2CQAA 4JV5L 1KEEA 1W6KA 3Q0AA 2JJQA 2BA1A 2UXDQ 4ZHQF 2RSOA 2DN8A 1TR5A 3J80E 3K7UC 1W93A 4CKCA 3QZ8A 1N34H 5M3MH 4B3SQ 1SFOA 4JI6H 2LSSA 3H3VH 3A8KE 1CTMA 4YHHQ 3W5OA 5IWAH 2RDHA 3S14B 2MPMA 4KLKA 3ICEA 2EZVA 1VQCA 5C0XI 4K2LA 3OW2A 3RF2A 4J9PA 3CRKC 1CM9A 4JI0L 2JA7A 2CVRA 2PBZA 4O2DA 1JOKA 3CKIB 4A4IA 1Y8OB 1N34Q 3MWDA 1C8CA 4EVOA 1R9TB 5FO9B 1S4ZA 1N32L 1KAAA 4WJ3M 1KDCA 1G91A 1D7QA 1VF7A 4BY7B 1YHBA 2R61A 4A3BH 4Y7NB 1G2TA 5T14A 4YHHH 1IXRA 1E2WA 4DR3L 5FO8B 3GIDA 1N36L 2E2IA 1IHZA 3QG1A 2A19A 2JXMB 1N8RC 3J80L 2R92A 3J81E 4IURA 2ZT9C 3ULLA 4I7AA 4A3JH 1EZ8A 5CV5A 3TP6A 5C3EB 1PMRA 1II3A 2VZAA 4POFA 1TKWB 5EDWA 3KBGA 5KYIA 3J81L 2B8FA 4DV1L 5BR8Q 2YZNA 4RUAA 4QWEA 1UE6A 2XTIA 4RGMA 3Q6SA 1XMQL 2I5LX 4R8UA 4KMUC 5BR8L 1LTGD 4ODGA 5IWAL 4CKBA 4GS3A 4IWYA 4KTAA 1NSNS 1F77A 2E2IH 1VMCA 1UC9A 3FPUB 3RN2A 1VQGA 3E6ZX 4ECRA 2R6FA 1CFMA 5KT4A 2RCNA 2WAQB 3WOEA 3PUZA 3UFXB 3GTLA 3W1GA 4NB3A 2JA7H 3RV4A 4RHSA 5IYDG 2ZTDA 3HOYB 3H40A 4KKSA 1D1KA 5M5WH 3TIGA 3GTKH 1Z2PX 1C48A 4C3IH 3MWYW 4BWSC 4HIOA 2UVRA 2E2JB 4I7ZC 1S97A 3J7YW 2UVWA 4BY1B 1PTOF 5CMDA 5M9OA 3RLNA 4I65A 2IT1A 4ED3A 4BBSH 3NBIA 1RTOA 2WP8J 3T5LA 1NMGA 2I5HA 2XC9A 1EL0A 1EWCA 2K1BA 2JA5A 4BBSB 3HOVG 2JN4A 4JI3H 2VUGA 1L2ZA 1U5KA 4QW8A 2KHJA 2RDGA 4GOPB 1IW7C 4C1NK 5IWAQ 1K73C 4F50A 1XMQH 5C44B 3S1MH 4DL7A 1TWHB 3KF6B 4A3KB 5KFXA 1IBMH 4YJ2F 5D1PA 4JBJA 4EQNA 4XQNA 5JJZA 1I3QH 1QZHA 3NEMA 3EN2A 1QVCA 5CA0F 3BVMA 1C7YA 2E2IB 4RZQA 5ELFA 2NU9B 2WKDA 1QILA 2RHQB 2CW7A 3MJFA 5DGBA 4ECYA 1UE1A 1TWAH 3A7AB 2FE3A 1YITA 2X69A 4X64L 5C1PA 3VPCA 1RK6A 2FMMA 3TS0A 4LF4H 5KFMA 5C5MA 2W6MA 2FP4B 2L5TA 4DV5Q 4JI2H 1PTOB 3MC0B 1TA8A 1LTSD 4FYDA 3OHAA 2SEBD 3TDQA 3MR2A 2NU8B 3I8ZA 1N36Q 1MHWC 5KFFA 1NBWA 3GTMH 4O3SA 1ILQA 4DAMA 3TP8A 3I4NH 2AQ2B 4DUYH 1HTPA 2YTVA 1B2TA 2H4OA 1L0XB 4ZAIA 5J39A 5J2TF 4B3MQ 2DUDA 4XIGS 3GO5A 3GTJA 3KJOA 4LF4Q 2BDOA 3PW4A 3SI8A 5KG5A 3AYHB 1BJTA 2HIXA 1KLGD 3GTOB 1JWSD 3BABA 1PRTC 3D8GA 4GOPA 2KA7A 2NVTH 3CF5A 1EUCB 1GUWA 3K6OA 1AE2A 2E2HH 1EWIA 2VS1A 2FB9A 3GIQA 3FPPA 3R5HA 4FBTA 4JYAH 1KHIA 1CE8A 1EY5A 2ALZA 4UCTA 3VYRA 1HA5A 3MVVA 1Z2NX 2JA7B 2XGPA 4DR4L 1FNWA 3LMLA 4R8IA 2B63G 4WORA 3HGBA 5M5WB 1AN7A 4OONA 1HUNA 2K5VA 1UAPA 1CHQD 5FLXL 2BH2A 4EX5A 1TQOA 3KFUA 3IFDA 5IIFA 3CCQA 4QIWE 3ZJYC 3S1NB 2V58A 3EFXD 1PH9A 3NP8A 4IPHA 2WAQA 3CPWA 2BDNA 2WB1G 1N56A 2C00A 3SVMA 5EJWA 3T4AC 5JJKA 3EQLC 4DR2L 1LO5D 4B9WA 5LOVF 1E1TA 5BPHA 2EY5A 5M5XH 3PO3G 3CVZA 2B2WC 1WJJA 3CCMA 4GLAC 2NZOA 1ZYRD 3U9SA 3SDZA 1FKAH 1U4MA 4EGJA 4BBRG 3HOYG 5KT3A 1GUGA 2F4IA 4A93G 5KIXA 4KD3A 2RDIA 4MV7A 3I3CA 5J2UF 2R6GA 4ZRZA 5J1ZA 4YY3H 3I90A 2F0UA 4R4QA 3UI2A 4DR6Q 3L4JA 2UXBH 3JAMi 4A3EH 1Y8NB 1SYBA 3HOZG 4EBDA 1EY0A 2F52A 1NMFA 2ALYB 1YIJA 3NENA 3NPPA 1S5ED 2OQKA 1DV1A 4DV0H 5C0XG 4A3GB 2J4XA 2G9HD 4JPBW 5LA6F 5KFVA 1IBKH 2C9OA 3E5SA 2VNUD 1E4EA 4KK7A 1UNSA 2F0GA 4PZ6A 4Q0FA 3CCJA 4FDBA 5IY0A 2R7NA 4X65H 4O2AF 3Q8SB 3SK8A 1GVPA 3NBHA 4NPSA 3NTIA 2BQRA 3KUPA 4DV4H 4QUCA 4LFAQ 3J7AF 2HT1A 2W6PA 3BDLA 3KBXA 1ICWA 3CW2C 1SMYC 1I7LA 4IPCA 2C2RA 1NCVA 3I7FA 3Q8PB 3ETJA 4OGQC 4IZ8A 1QOHA 1PH2A 3J7A5 1IBKQ 5GROA 4TQSA 1HUMA 3N44B 3PO2G 3DEPA 5KT7A 2Z8LA 3IRBA 5K5PA 1UE5A 2H5XA 4RB0A 1VQJA 1FR3A 2DWCA 3T5HA 3PF5A 2B2YC 1PZID 1KNEA 1KJJA 3VR6A 1STNA 2NUCA 2UUAL 3GTLH 1DYQA 1AUXA 1CS0A 3I12A 2B8GA 3RLFA 2J9GA 4ECZA 4XQQA 3GV5B 1SCUB 2A69D 4OWXB 4APMA 3KLRA 1VQPA 5FPRA 5IP7H 3J7AV 2HVSA 2RF4A 1HA6A 2GPSA 1K3RA 5KFHA 4Y52H 5ISRA 4K0KQ 4YP3A 2F0OA 2JQOA 1FVIA 1TU2B 1Y1VB 2EY2A 3K80C 2UU9L 2JEFA 1A15A 3PGZA 4LFBH 1UE7A 2IPKD 3W2DA 3T1YL 3A5ZB 4R4CA 4DN4M 1JKJB 4FS2A 5KFPA 3EYYA 4JV5Q 4DXFA 1CKOA 3CCVA 1JXLA 2K05A 3EJIA 1KC7A 1CKMA 1AZPA 4RUCA 3Q8DA 3EA6A 1ET6A 4IHJF 5KT5A 2NN6G 1JICA 4AYBB 4HYKA 2ICEC 4LF8L 3VR2A 4UPAA 2EYHA 2JYOA 2PW5A 1H9KA 4XQJA 1PYBA 3LWEA 4ME6A 3STBC 2FK1A 5KFOA 2WFWA 1LTAD 3KK7A 4IZOA 2Y0SA 4ECSA 2AGQA 2KCCA 3HOXB 4TRDA 5KEEA 2DIKA 1E1OA 1RHPA 4MN3A 2DNCA 3HS0C 5KG7A 2K50A 1C30A 1K83H 4IFDH 4HTHA 3D4DA 4DR6H 3G6EA 5D3IB 1DM0B 4GKJL 2UXBQ 5EAYA 1SNMA 5EPJA 5FPOA 1HNZH 2RBMA 4DNRB 4MV9A 3T51B 3MXPA 2AMCB 1X6OA 3HBLA 4C56C 1RTNA 4H44C 2EXDA 2K5QA 4A3IB 3PUYA 4J8QA 5IYBH 4JI1L 4A3GG 2J6SA 1B44D 4R4TA 1BKBA 3QOJA 4LW1A 4O3QA 2SNSA 4JI7Q 4EYIB 3CC2A 3UDXA 5CGKA 1WI5A 2NBFA 1Q8IA 5CV9A 1VQLA 3HRZC 2F0IA 2LXJA 2W7PA 3HB9A 2CH4A 1WD1A 5BMVF 2L12A 1ZQ7A 4C3JB 4LF6L 5E4XA 3L0OA 1HXYD 1E3PA 1Q1EA 3DLLA 2UUCQ 2Q8RE 2RGRA 3JC66 1JLLB 2BCOA 3IN5A 2JA8G 1E4EB 4XXEA 2F0EA 1ZEQX 5F2DA 4GNXB 4DR5L 3K0XA 4O1NA 3IFTA 1WVLA 3OUZA 3I2ZA 3SK6A 5KFTA 4ZUJA 2ZDGA 4R8NA 4GN3B 4QWCA 4IN3A 2J6UA 1ZETA 1RK5A 4RH6A 1E4GT 3KTMA 4BXXH 4FF1A 5IGFA 1SROA 5NUCA 1ILPA 5KX5F 1XDNA 1J9OA 2KHSA 2NYZD 2Z9HA 3IL8A 3OHBA 2UUCH 4A76A 1WTQA 2A69C 2XCPA 5FLXc 2H1EA 2K01A 2O2LD 2Q2HA 3H0GA 4CC6A 1H9SB 1K83B 3ND9A 1EOVA 2O5JC 2IHFA 1P16A 3FEWX 3FRPB 1X32A 1TWCH 3CCEA 1ZHSA 2M05A 2K32A 2AGOA 4IJLA 1XMQQ 1JR0D 2YTYA 4LH6A 2VPQA 2B2TC 1HTLD 4U6PA 2VPSA 4DR7L 4LF9L 1Y1WA 1PH7A 3GQCA 3N6RA 3HEJA 4PZ7A 2J7ZA 3AMUA 2VR1A 5BR8H 1V8QA 5I2XA 1BCPD 4FF4A 5A2QW 3OMGA 1X3EA 3HOUH 3M3YH 4UFZA 4MV1A 3J7AK 4ALPA 2K5HA 4K14A 3UDIA 4HJ8A 4K5XA 2R8JA 3BZDB 3KAKA 3KHLA 3BVZA 3OWEB 2HQLA 4IRDA 1P8LA 3I73A 1YBYA 2D5DA 2Y0SB 3PIO3 1ZXTA 4LMYA 2UXDL 1T9HA 4DR7H 3J80i 4LF4L 5DM63 1N36H 1XTDA 2HD3A 1NE3A 5IYDH 1HNZQ 2AWOA 2EOTA 1RODA 3LNNA 3R5FA 3G4SA 2XIGA 1SE3A 1Y1WH 3H15A 4CC5A 4LNQA 2IX0A 2O4XA 3CD6A 1HNWQ 1FGBD 2D0OA 3B6YA 1M7JA 2MP1A 1WYDA 2XGTA 1NJIC 3NBHB 3CC4A 5LXTF 3CPFA 1SAPA 1T3NA 4YCUA 1DOMA 3NUCA 1PFBA 2QF7A 3QZ7A 1G291 3AFQA 4R7RA 4PWQA 4DNIA 2B63H 1HNWH 3BG3A 3BQ1A 1LTLA 2ID0A 1MI2A 1I4QA 2A68C 2EYPA 1K8GA 4BXXG 2FJZA 3TINA 2YU9H 1C3OA 3S2HB 1SYFA 2FINB 4P72A 4C3JG 1VKZA 3KHHA 1IBMQ 4YR0A 4LF7Q 4TUYF 3CCRA 4LAAA 4TVAB 3GTQH 2JA8H 5HBRB 1YNND 3GTJB 2XN9C 4A3FH 2IJ0A 2UXCH 2M9VA 1LT4D 1WCMB 5KFBA 1F9SA 1YI2A 4PNYA 4NDXA 2JEIA 3RAXA 3KOJA 2A8VA 5FJ8G 4IUNA 3GTOH 4R4IA 5JOBA 5KFAA 3KLWA 3FKIH 4A3IG 4A3FG 1TVXA 3P75A 3KYHC 5K36H 1CQJB 1WSCA 5KFNA 2VY3A 1E7ZA 3CAMA 1XNQQ 5M3FG 4DR4Q 3M9BA 1VAJA 4Q43A 4RHRA 1W2BA 3I4NG 3T5JA 3HKZG 3NK9A 1JB3A 5CORA 4DAPA 2F0JA 3MA2B 3J81c 1SE8A 5IGCA 2YCHA 2N8NA 3FKIG 4A3IH 1DOLA 4I55F 2CQOA 3A5UA 4ZK9B 4YY3Q 1SEBD 3DXJC 4B3RH 5EWEA 3DUZA 4K6DA 4RCNA 2RVLA 1KC8C 3IKJA 4X66H 1T94A 4CKEA 2IHEA 3V4ZA 4C3HG 3BYTB 1PVOA 2PYKA 4DV2Q 1S40A 2D62A 3ETHA 2KQ3A 4NW2A 3ERSX 4PMCA 1Z9FA 1SJHD 2I80A 3S9WA 2L1BA 1IBKL 4MV6A 1RYSA 3FHWA 1UEBA 5JEAH 3C1EA 4YBZB 3K3PA 1VQIA 1Q90A 1HR0Q 2R8IA 4X64H 1HQMC 3W1BA 2NVYH 1Y1WG 2JA6H 1G6PA 3H0GB 3H4BA 3G8CA 3VPDA 2BE5C 3T5KA 2XSCA 3T13A 4HIKA 5L1LA 4J1MA 1B1ZA 5LMUH 1JC7A 2YS7A 2C22A 5BN3A 1EU4A 4KHPH 1AN8A 2QCPX 3S1MB 1EY8A 1KIXA 5DG7A 5CV8A 2R7KA 1B3AA 4DUZL 2JSOA 5M5YH 1K9MC 4O3OA 4RA8A 1GJXA 1CSPA 4JCVE 2I87A 4RAZA 4FXDA 4DR1L 4FS1A 4LFBL 3WO1A 4FF2A 3PW5A 2OXPA 5DQHA 1I4HA 4O4IF 4RB3C 2V4QA 5KFKA 4PMWA 1CA5A 1NNXA 2I07B 4A3DB 1UC8A 2YU9B 2R93A 4X3UA 2PN1A 3S17H 4KHPL 1Q86C 2SOBA 1ZKOA 4L5SA 4M9UA 1KD1C 5C0XH 4H13C 4OO1I 3EIVA 3CCUA 3L3OC 1XWEA 4LFAL 1JWMD 1VQHA 1SFOB 5JH7F 5I2YA 4O3NA 1BQQT 4DV3L 1Y8PB 2ZTCA 2AQ3B 4YR3A 1GXDC 4KD4A 2X6LA 4C5AA 4LUVA 2EVBA 3DWPA 3ONAB 3OTOQ 4DV0Q 1WTXA 4IOCA 5KFGA 3V4SA 4MIUA 5L1JA 5DQIA 4YQWA 4U68A 2XRSD 1N9WA 4N8FA 4ZUIA 5IT9E 4OWWB 4DV2L 3BG5A 4RNMA 2PQAB 2AWNA 3QR8A 4MV8A 5D65A 3Q8QB 1IYUA 4EEYA 2I46A 3HOZB 1GUNA 3HFZB 1DXMA 3J81W 4I50F 2UVUA 2GVBA 4QGUA 4DL3A 2G5DA 5TSSA 3MXGA 5DG9A 2YW2A 4YJ3F 4S3SA 1Y1WB 4DUZH 3AFPA 1TY0A 3N8DA 3OTOH 4A3JG 2AU0A 2JEGA 2QILA 1Y1VA 3NTKA 3TQTA 1PH3A 3LP8A 1V43A 4ECTA 2ICIA 1E24A 4KV6A 4OX9Q 5JJIA 1I3QA 3G6VA 2F0QA 4HN7A 3GTGA 3QIAA 3CHBD 3LWUA 4RAUC 2FPGB 4B3SL 2HVQA 4J6HA 3A8JE 4DV2H 1A62A 3O13A 2E2HB 2KEDA 1JJ2A 2UUBQ 1SR3A 1SYDA 4LMQD 4RGOS 4MTDA 4OIJA 3FDSA 1GOZA 4JI5L 3PIP3 1FNUA 2A68D 3Q22A 1VQKA 3SXHA 2R3ZA 4QB4A 4KJOA 4NP5A 2W6NA 1R4PB 4RGNA 3J81j 1B04A 3KALA 2L9HA 1EHIA 3OTOL 2F3VA 3RB4A 1SSOA 1VQAA 2XVSA 4HJ9A 5KFZA 2VQFL 4NXNL 3K57A 1SNCA 2NVXH 2DPJA 3HOWB 2K33A 4A3FB 1YNJD 5C5LA 3M7NA 3VPBA 4KHPQ 2L11A 5EPKA 3KF8A 4DK1A 2B2WA 3CU7A 2K5DA 3AB9A 2K6AA 1T36A 2D2CC 2ZDQA 2A6EC 5LMNH 1O75A 3JAME 1JOQA 2WTFA 3BJUA 1LTID 3F2BA 3N40P 1K0RA 2W57A 3D3RA 4A3LH 4ID6A 5DQGA 3Q1KA 2DNEA 1NR2A 3BU2A 2VQEL 2IX3A 3MR5A 2R7ZB 2YYZA 2W6QA 3OYYA 1EWHA 5KG6A 1I6VC 4X62Q 2W8KA 2KCMA 3HKZE 4CDEC 4DV7Q 1LT3D 2V59A 1F9RA 4F4ZA 2EY6A 5L1KA 1CQIB 3GLKA 4JG2A 1RJRA 1WTHA 5F9LA 1BNZA 3PR5B 2W9BA 1L1OC 4LF8Q 5FLXW 5FJ8H 2K5NA 2UU9Q 4Q5VA 1K1SA 2K7VA 1ET9A 5EZYF 1G51A 1HNXL 4P73A 1EY4A 1WFQA 3E5NA 5KT6A 3GTKB 2B2VC 3TIIA 1J6QA 3E9HA 1LYLA 4JC0A 4G4KA 1IOVA 4B3SH 2UUBL 1A6XA 4K2KA 1AEXA 4F7XA 1YHQA 4NLGA 2R92B 5BPFA 4HJ7A 4O42A 3ORRA 2UVVA 5FD6A 1WTOA 2JEAI 3N6XA 1PFSA 3NHHA 5C3EG 3BAAA 4DR7Q 1I6UA 2F0FA 5IP7G 1PH4A 4H7BA 1OXSC 4LJZC 5I6WA 5C44G 4UY8C 1IL2A 3PO2H 4XYLB 2WIIB 3I4MH 4IOAA 2V5AA 3GIKA 3VA7A 2ENBA 4LSXA 1S10A 3S15H 5JQWA 3HOUG 3U9TA 1JWUD 4O2BF 1SLJA 1JT8A 2PW7A 3PIPA 1QWYA 3HG9A 3RIZA 3IAYA 3OIPA 1EOTA 4DR6L 2W8LA 2HUGA 1O7LA 1V1PA 1EZ6A 4AQYL 1SNPA 2ZJQA 1PDQA 1X3GA 1FGUA 4RFBA 5CV6A 2F4VL 1KJQA 4CBVA 4P71A 4J9OA 3I91A 2QYZA 4TSSA 5FLMG 2CW8A 5ELNA 1EIYB 4LF9Q 1CHPD 1S0NA 4I7HA 3GTKA 1EU3A 5HY6A 2WAQG 3K5OA 3BA9A 3CMAA 4JI6Q 4A3DH 3N42B 5L37A 1Q46A 4LWCA 2EJFC 2F0KA 1AE3A 3I55A 3HOWH 2OLSA 1JDEA 1HQRD 3FKIA 1ESRA 4XZ3B 1W96A 5EBCA 4DK3C 3MAQA 4RB2C 1Q81C 1ONLA 1QJOA 2XIWA 4OHJA 3S2DB 2C2EA 1HFNA 1JIHA 4LFCL 4ZLTF 1EQQA 4CHTB 1ENCA 3X3NA 4WD3A 3DEOA 1CUKA 1RDPD 4A3EG 2ZXPA 4C2MH 1J8IA 1F9QA 1LTRD 1MJCA 2Q2IA 4MA0A 2E5LL 2Z1CA 4X66L 4RKBA 1TIID 4IQZA 1Y69U 2QDBA 3CC7A 4NXMQ 3GIJA 3V96A 1V1QA 1PYWD 3AEVA 1A63A 1K0SA 3RZDH 1R9TH 1B53A 4A3BG 3JRWA 1QCBD 3A54A 1OO9B 2KVMA 3KF6A 2Q8TA 3U4VA 1FYCA 3S1NH 3M85A 1KJ9A 1UWVA 1TWHA 1GHKA 5CB4F 2RCFA 3MFIA 4NMZA 4P2CB 5IYBG 4JYAQ 5IT9c 2YRXA 3ERQA 3KF8B 3GV6A 2PI2A 2RKSA 4CJ2C 1JB7A 1TS3A 1IL8A 2JA6A 3IG0A 1X9NA 1EIHA 4IPDA 1TWAB 2JA6G 3Q2OA 3K58A 3H4DA 2EY1A 4X3KA 1M6VA 1VQ9A 5AFWA 4XYQA 4JI2L 3R8BA 2WACA 4IRKA 1MD2D 2MGSA 2NWGA 5M3MG 2OQ0A 4JI0H 2XGQA 1VQNA 5GAEC 1EYAA 4IALA 1XYIA 1KL9A 3M7GA 1EYGA 5H1SE 4HQ6A 2CWAA 2RQXA 2JA5H 3D6CA 5DEHA 3KHGA 1HCZA 4IWXA 1BBUA 2CCZA 4FNFA 3RB0A 4LF5L 3TP7A 2YTXA 4YHHL 3MEFA 5BN5A 1OTCA 4B3TQ 1GSOA 3S1QB 4O4HF 1YJWA 2ASJA 1JORA 5IYZF 5H80A 3N52A 3JAML 4QWBA 4DR3H 3BZCA 5LL6S 1KQSA 4GLVB 2GN5A 4AYBG 4G3IA 3PW0A 4A3GH 4LF7H 1FD7D 2GVAA 1A2TA 3NSWA 2FLLA 4BWGB 4PQXA 5IODA 5K36G 3J80W 5FLXE 2VUMA 1KLUD 2DZDA 1AZQA 5I4DA 3HOUB 4IFDG 4ZQIA 1YNJC 1PYSB 5KG2A 4DUYQ 1CSQA 4NXML 2RHSB 1V9PA 3ULPA 4PZ8A 4OEMB 1LM0A 3PR4A 2F0TA 1MBYA 4RMFA 2ZJTA 2F0SA 4QIWA 4ECXA 5E4WC 1BXTA 4YWLA 2NN6H 2Z6BA 1NR4A 1K28A 4BS9A 4DL4A 3EPGA 2PMZE 4JYAL 1LT5D 1YNNC 3K59A 2JA9A 3E0EA 1OWTA 1EYCA 4RAYA 3M4QA 1S72A 4RG1A 4DKAC 4IFDI 2NVQB 2R7DA 5M5YB 5EWGA 1VQEA 4RU9A 5G3LF 1JE4A 5I9PA 4YR2A 1Y1VG 3QWNA 4R1JA 1PH5A 5A2QL 2AQ4A 2AHOB 2B39A 3VR5A 1A3UA 3G7LA 3ORQA 2N49A 2DY7A 4MA5A 2V4RA 2JEJA 4NXMH 3PVXA 4HMIA 4JI2Q 5KYLA 1DZ1A 3T1HQ 5IGBA 1HR0H 4DLKA 2A1AA 1E2ZA 4DUZQ 1TWGA 4OL7A 4EQ5A 1STHA 1KJIA 5DLFA 2F03A 2IW3A 3F1ZA 1EUDB 3G71A 3Q8RB 3I4LA 4LK1C 2OTJA 5HGQA 5CBEE 4X64Q 2B2UC 3WDNA 4UCOA 4HMJA 4OIKA 4B3MH 4BY7H 2C2DA 4DK6C 4ECVA 1Q82C 1FNVA 1VCIA 3TP5A 5LYJF 4DA2A 4FU0A 5C1OA 3GTMA 2EYMA 2N88A 3OSPA 1Z47A 3RLOA 1B4OA 1SE4A 3HOYH 3FP9A 3FVQA 3HZXA 2TSSA 4CDFC 1OXXK 5GAHC 1Q7YC 1IBLQ 4HR7B 3TBIB 3J80c 2VQDA 2BOSA 4JI4L 2R93G 1C4QA 4DV3Q 2OWOA 1GD7A 2R87A 3KJPA 2KUMA 2LS01 5KFCA 5EKIA 3GTGB 1S68A 5KKNB 5JPNC 1I7NA 1PRTF 5IT9L 3S1RB 1MKHA 3HOXH 2QEXA 5CBAE 3MFGA 2X6GA 4DV4L 3Q24A 2VQEQ 1S03G 2YRWA 1HR0W 1EYDA 1PFMA 2HDLA 5M3MB 3I4MG 5C44H 4X65Q 1RJQA 4P74A 2LY7A 2ASDA 2F0HA 3OWFA 4DV4Q 1HNWL 1JQYD 1H95A 1S5FD 3G6XA 4APVA 1Y14B 4KKTA 2FK3A 2RA4A 1TWCA 3I4OA 1AUVA 1M0TA 2B2UA 3QOLA 1U0LA 4DK0A 4R8UB 5KG0A 3UQ8A 3P1HA 1O78A 2KBNA 3M4OH 1XPOA 3M9MB 5FD5A 4X62H 3RNUA 4ECUA 3UE0A 2JA8B 1X3PA 5D8DA 1LACA 4A3KG 4DGZA 3T1HL 1EEID 1WCMH 1O7IA 1CZWA 1K8MA 3GDEA 2HCIA 3STBD 4B9XA 4DR2Q 3ULJA 2JA6B 2JK8A 3CMEA 5KT2A 3GQBA 4IO9A 4K8IA 1WH2A 3GV7B 4EBCA 1J5EH 2Q2TA 1EUJA 2D9UA 1JE5A 1FJGQ 3OSOA 4JK1C 1B50A 3RTXA 2QGQA 2YZMA 1EY7A 3SGIA 4BA2I 1KRTA 1VQBA 3MXNB 3W3AA 1I50B 4ECQA 2ZM6L 2R7ZH 4FBUA 1PZKD 3ER0A 1BVSA 4NXNH 4ULLA 5AJ3Q 4DF7A 5GAGC 4C2MA 3H94A 3VMMA 2WB1A 2ZXOA 3V6HA 1LABA 4LUOA 4A3MH 2LXKA 4JV5H 1IW7D 3RUPA 4O3PA 4CJ0B 2CHBD 5AJ3L 4QUFA 4M8AA 4QCLA 3R5XA 1YNXA 4JI5Q 4LUZA 2FPIB 1MSHA 4EYHB 1XX8A 3OHXC 1K1QA 3M4OB 2LMCB 1SMXA 4X62L 1BOSA 4FXKC 5EOYA 1H9SA 1K83A 1KRSA 1RJTA 1WR2A 3M3YB 5LL6b 3MZ5A 5C4XB 3T53B 3C1FA 3HKZA 2VQFQ 5T1GA 3TZUA 4WFN3 4KY6A 4DAYA 2IY5B 4UCVA 2WAQE 3BDCA 5KFYA 3RJ0A 3K81C 1E4FT 2UXBL 2EPBA 3HOVH 3EBEA 4JV2A 4C3IB 3AQQA 4RGTA 3VYSA 1F2MA 1S0MA 2ES2A 2ZDHA 2XD4A 4YAJB 2ATLA 4EEQA 3KDFA 1LTTD 1PH1A 4GNXA 3L4KA 5CC4A 4POGA 1XJVA 1GYFA 4C1NI 3PO3B 1KABA 2R86A 3WWVA 2VQEH 4WJWA 2CWPA 5LHY1 1N33H 2IMWP 1GUOA 2NVQH 5IGDA 3K8AA 1M0WA 5ELEA 1HPCA 5KG1A 3BQ2A 2A6ED 1VQDA 1YEZA 4BY1G 1GO3E 1RKNA 4F88A 4OX9L 2F0MA 3CQZA 2IL8A 1STGA 2OEOA 1J5EL 1TWHH 4A3KH 3S15B 1ASZA 1O80A 3BYYB 2NUAB 1S3OA 1SMYD 2HCCA 2QEJC 3NQIA 2E74C 2DGYA 3HKZB 3NXWA 5KNBA 3URYA 2K52A 4JI3Q 2EYFA 5IGEA 5M3FB 3U50C 2G9DA 2HHHH 1F2LA 5KFRA 3OSNA 2PI2E 3OPOA 1Q8KA 1L1OB 2IWHA 3OW7A 2EJGC 4EGVA 4DU9A 1D5XC 1D6EC 1SXTA 5ELOA 3RD4A 4KY7A 1XMOH 3C46A 1V1PB 1L0WA 3GP7A 2HJWA 4K6LA 5IYCG 4DV5L 4DL2A 1TY2A 4HJ5A 5C4XG 4AYBA 1MJEA 1G6ZA 2VA2A 3P7JA 1I6HB 5KG4A 4EG0A 2NZ1D 4F4XA 1HNXH 4X3SA 4X6AH 2DY8A 3EPIA 4AIMA 2WDTA 2JA7G 1A9XA 2CKZB 2A5HA 4EQOA 1N33L 4QWDA 2KEEA 4JI0Q 4A93B 1SEIA 3C3LA 5IP9H 4HJAA 1I4PA 3NWTA 2XCLA 1F9PA 1BNCA 4WBNF 2K14A 2CQYA 1TS5A 2WV6D 3HOWG 3S1RH 1CA6A 5KRUA 4OELB 2PZWA 4KN4C 3S14H 4JI5H 3DWAA 5KFQA 4M1UB 3NQTA 4UP9A 5EBDA 3Q23A 4DR3Q 3MR6A 2FPPB 5JVG3 5E1FA 4CDCC 2Y0SE 3MHBA 5D3DA 4LF5H 4QIWB 2K5WA 1T5EA 3K5IA 2MO0A
chains in the Genus database with same CATH topology
1J6QA 3E9HA 3JAMc 1LYLA 4L5TA 4JC0A 1QUQA 3CXCA 1HZ9A 2UUAL 1WCMG 2UUBL 3GTLH 4TQUS 3PF4A 4YY3L 2E8GA 1YHQA 1IBML 4LF7L 3RLFA 1Q12A 4OO1G 4HJ7A 2JA5G 4OWXB 4BBSG 4K0KL 4QY7A 1VQPA 5IP7H 4JBMA 2JEAI 1PFSA 5C3EG 5J3BA 5IYCH 2RF4A 4B3TL 2VUMH 5IP7G 4DV6L 1PH4A 1IL2A 1OXSC 2BA0A 1VQ8A 5C44G 4UY8C 3PO2H 4DR1Q 2EQSA 1K3RA 3I4MH 4IOAA 2IX1A 4QQBX 4K0KQ 4Y52H 2PNHA 1XPUA 3E9IA 4HIDA 2JQOA 1FVIA 3K80C 2BH8A 1N33Q 4ME3A 2UU9L 3S15H 3PGZA 4GLXA 1B8AA 1UE7A 3HOUG 5C3EH 3PIOA 1SLJA 4KHZA 3A5ZB 3PIPA 3T1YL 4R4CA 1JT8A 1OXTA 3S2HH 5E7NA 2MNAA 4JV5Q 4DR6L 1RIPA 1CKOA 1EIFA 4L5RC 3LGJA 3CCVA 1HR0L 1X56A 1CKMA 4AQYL 2ZJQA 1IZ6A 2F4VL 1X3GA 1FGUA 3Q8DA 3J7ZC 1CKNB 2B3GA 2NN6G 2V1CC 3KDFB 4J15A 1X65A 4P71A 1B70B 4LF8L 4O0AA 5FLMG 4DUYL 4UPAA 1W3SA 5ELNA 1EIYB 3S1QH 4LF9Q 3TREA 1PYBA 4B3ML 3A74A 3STBC 4AYBE 5HY6A 4P75A 2WAQG 2WFWA 3TQYA 4X66Q 1BBWA 1VQOA 3CMAA 4X65L 4JI6Q 2Y0SG 5GQOA 4A3DH 1ASYA 5JJLA 5DLQE 3PUWA 4B3MQ 1Q46A 4LWCA 1E1OA 1SN8A 1AE3A 1HZAA 3I55A 3RN5A 3HOWH 2K50A 1K83H 1TWFH 4WJ4A 2Z6KA 3G6EA 2UXBQ 4GKJL 5EAYA 4AH6A 4A3DG 4L5QA 4DK3C 2AMCB 1X6OA 5GADC 1N32Q 2R92H 1Q81C 2EXDA 4DV6Q 5C4XH 1IBLL 3PUYA 5IYBH 4JI1L 1HZBA 4LFCL 4A3GG 1EQQA 4JBWA 4R4TA 1BKBA 2E2JH 1X3FA 4LW1A 4A3LG 5FLMH 1HNXQ 1CUKA 4A3CG 4JI7Q 4A3EG 3CC2A 3UDXA 2R93H 4C2MH 1MJCA 1WI5A 2Q2IA 1VQLA 2YV5A 2E5LL 2LXJA 3PCOB 1VQMA 4LFCQ 4BY1H 1JJGA 4X66L 4B3RL 1I94Q 4LF6L 1PA6A 1C0AA 3CC7A 4UP8A 4NXMQ 3L0OA 1Q1EA 1E3PA 1NY4A 1V1QA 3DLLA 2UUCQ 3JC66 4UP7A 4YCWA 3AEVA 2JA8G 1A63A 3RZDH 1R9TH 4A3BG 4BY7G 4GNXB 4A75A 3H3VI 4DR5L 3K0XA 1YJNA 4YWKA 3I2ZA 3KF6A 3U4VA 1PH8A 3S1NH 4GN3B 3UE1A 1UWVA 2MFIA 3M85A 3H0GG 5IYBG 5JEAG 5IT9c 4JYAQ 3PO3H 2FXQA 3KF8B 1N34L 2AKWB 2PI2A 4GOPC 4LF5Q 4BXXH 1JB7A 2R92G 3PV0A 5JEAJ 2UXCQ 1SROA 3G48A 1X9NA 3S24A 1EFWA 4IPDA 4JI7L 4C3JH 1GKHA 2JA6G 1L1OA 2R7FA 1NTGA 4A76A 1JMCA 5FLXc 2JEBI 1VQ9A 2Q2HA 1Y1VH 4C3HH 1EOVA 1EQRA 1FL0A 5LMUL 4JI2L 5LMNQ 2IHFA 1QVGA 2Z0SA 2K75A 1P16A 4IPGA 4GKKL 2KCTA 5M3MG 2OQ0A 1VQNA 4JOIA 4R4OA 1TWCH 4JOIC 5GAEC 3CCEA 1PHJA 1RL2A 4DV0L 3HOXG 1KL9A 4IJLA 3CQZH 3TEHB 1XMQQ 1EYGA 2YTYA 5H1SE 2CWAA 2JA5H 4MNOA 1XNRQ 3F8TA 1HJPA 4QJFA 1VQFA 1SFOH 1J5EQ 1BBUA 3CCSA 3U58A 1I94L 2CCZA 4LF5L 2ASBA 2YTXA 2ZTEA 3MEFA 4YHHL 5M3FH 3L2PA 4DV1Q 4OXPA 1OTCA 1YJWA 4B3TQ 4LF9L 4DR7L 1PH7A 4LFBQ 4JI4Q 3BZCA 1KQSA 1I6HH 4GLVB 2GN5A 4PZ7A 4AYBG 3VDYA 1XNRL 4MTNA 4H02A 4A3GH 1X3EA 3HOUH 2GVAA 2N78A 3M3YH 4NXNQ 5K36G 2Q2UA 2NN6I 4JV5L 4ALPA 2K4KA 2K5HA 3UDIA 5IE8A 2JJQA 2BA1A 2L15A 4HJ8A 2UXDQ 1M1KC 4OWTB 3GTPH 4IFDG 2E5LQ 2HQLA 4MZ9A 3K7UC 4A93H 1YHAA 4PG3A 1P8LA 5M3MH 2C35B 4B3SQ 1YBYA 1PYSB 4BA2I 3RR5A 4DUYQ 1CSQA 2UXDL 1T9HA 5IP9G 1XPRA 4NXML 2LSSA 3J80i 2RHSB 4LF4L 1V9PA 3H3VH 1XTDA 4YHHQ 3ULPA 3W5OA 1NE3A 5IYDH 1HNZQ 4PZ8A 2AWOA 4KLKA 1LM0A 3J81i 3CCLA 4RMFA 3ICEA 1X55A 2KENA 1VQCA 3G4SA 5C0XI 1X54A 3U4ZA 3OW2A 1Y1WH 4XTCS 3H15A 4JI0L 2IX0A 4YWLA 4LNQA 3CP0A 2OTLA 4KI0A 4O2DA 3CD6A 2PMZE 1HNWQ 2D0OA 3B6YA 4DR7Q 4JYAL 4A4IA 1WYDA 2JA9A 2XGTA 3E0EA 3H0GH 1NJIC 1N34Q 1M90C 3NBHB 2ZJPA 3CC4A 3M4QA 1S72A 4RG1A 1CKNA 4DKAC 3CPFA 4IFDI 1N32L 2R7DA 2I5MX 4WJ3M 1D7QA 3A0JA 1VQEA 4GN5A 4YCUA 1YHBA 2WB1E 1Y1VG 4R1JA 1PH5A 4A3BH 3GTJH 2AHOB 1IXRA 2N49A 4DR3L 1G291 3AFQA 1YZ6A 1N36L 4JI2Q 3T1HQ 2A19A 2KHIA 4DNIA 2A1AA 4DUZQ 3BZKA 1N8RC 1HNZL 1FJGL 2B63H 1LTLA 2ID0A 1K8GA 4BXXG 4EQ5A 1XNQL 3ULLA 2YU9H 3F1ZA 4A3JH 3G71A 2OTJA 5HGQA 2QA4A 4P72A 4X64Q 1IBMQ 4LF7Q 3TRZA 2VZAA 4POFA 3CCRA 4TVAB 3GTQH 4BY7H 3HKSA 4DK6C 5BR8Q 4DV1L 1Q82C 2JA8H 3PUXA 1VCIA 4A3FH 1UE6A 4DV7L 2XTIA 1WOCA 5C4JH 1Z47A 3RLOA 1YI2A 1XMQL 2I5LX 1GM5A 4GKJQ 3KOJA 5BR8L 3FP9A 5FJ8G 2A8VA 3HOYH 3GTOH 5IWAL 4GS3A 3D31A 4R4IA 3KLWA 1OXXK 3FKIH 2NZHA 5GAHC 4A3IG 1Q7YC 1IBLQ 3J80c 4A3FG 4JI4L 4A3CH 2R93G 3KYHC 2E2IH 4DV3Q 4OX9L 2OWOA 1GD7A 2VY3A 5LMNW 3KJPA 4B3RQ 1E7ZA 3CAMA 1XNQQ 5M3FG 4DR4Q 3M9BA 1W2BA 3RN2A 1QVFA 3I4NG 1VQGA 3HKZG 5LMNL 2JE6I 1D8LA 3J81c 1SE8A 1MKHA 2N8NA 3FKIG 3HOXH 2RCNA 2QEXA 4A3IH 3PUZA 4A3MG 2CQOA 3W1GA 4NB3A 3A5UA 2JA7H 1E22A 4YY3Q 1IYJB 1JJCB 5IYDG 3DM3A 2ZTDA 4YCVA 2VQEQ 4DV4L 1KC8C 2UUCL 5M5WH 3GTKH 1HR0W 3I4MG 2R7ZG 4C3IH 3NELA 2IHEA 5C44H 4X65Q 4HIOA 4P74A 1PVOA 4DV4Q 4DV2Q 1S40A 2D62A 1HNWL 3RLNA 1H95A 2IT1A 4APVA 1Y14B 2VL6A 2PQAA 3D0FA 3ERSX 3GTGH 4BBSH 2WP8J 3I4OA 1Z9FA 1U0LA 1NMGA 2I5HA 1PV4A 1IBKL 2KBNA 3M4OH 1VQ6A 3FHWA 2ATWA 1UEBA 1XPOA 1VQIA 3RNUA 3HOVG 3UE0A 1HR0Q 3W1BA 1OXVA 2NVYH 2ZM6Q 1YJ9A 1Y1WG 1U5KA 2JA6H 1G6PA 2KHJA 4A3KG 4GOPB 4IJHA 3T1HL 5IWAQ 1K73C 1WCMH 4HIKA 1O7IA 3S1MH 2HIVA 3GDEA 3KF6B 3STBD 3TS2A 4DR2Q 4GKKQ 1OXUA 3ULJA 4JBJA 1I3QH 2JK8A 3CMEA 4GNXC 4LF6Q 1QZHA 3NEMA 3EN2A 1QVCA 4IO9A 1KIXA 2MQHA 1C7YA 2VUMG 2Q2TA 1EUJA 4IFDJ 1JE5A 4DUZL 1FJGQ 5M5YH 2RHQB 2QGQA 1K9MC 1CSPA 3SGIA 4JCVE 1UE1A 4Y7NH 1TWAH 1B7YB 1KRTA 4DR1L 1VQBA 3MXNB 1YITA 4LFBL 3I56A 4JI8Q 4X64L 2B29A 4PMWA 3TS0A 2ZM6L 2R7ZH 3ER0A 1BVSA 2HHHL 5AJ3Q 1KXLA 4DV5Q 3K7AH 5GAGC 1VQ7A 1I50H 4LUOA 4DPGA 4A3MH 2LXKA 4AQYQ 1N36Q 2F4VQ 3S17H 4KHPL 1Q86C 2HHHQ 3HOZH 5AJ3L 1NBWA 4L5SA 3GTMH 1QUQB 1MIUA 4DAMA 1YNXA 1KD1C 4LUZA 4JI5Q 3I4NH 4OO1I 2YTVA 3EIVA 3CCUA 4LFAL 1VQHA 4BBRH 1KAWA 4DV3L 2ZTCA 2DUDA 1SMXA 3PSIA 4XIGS 4X62L 1LUZA 3GO5A 4DAYB 3KJOA 4LF4Q 1KRSA 3AYHB 1A8VA 4LUVA 3OTOQ 4DV0Q 4JI6L 1VS0A 2HIXA 4IOCA 1PH6A 4DR5Q 4GOPA 1N9WA 1XMOQ 4OWWB 2NVTH 4DV2L 3CF5A 2PQAB 1TWGH 2AWNA 2VQFQ 2IY5B 1L2FA 2WAQE 1VQ5A 2D0PA 3K81C 1HZCA 1AE2A 4YWMA 1EWIA 2E2HH 2VS1A 3HFZB 3HOVH 2UXBL 1HH2P 3EBEA 1XMOL 2GVBA 4QGUA 1KHIA 3AQQA 4JBKA 4GN4B 2ES2A 3AFPA 3KDFA 1PH1A 3L7ZC 4GNXA 3GD7A 4A3JG 4POGA 4JI3L 1XJVA 1PH3A 2I0QA 4DR4L 1V43A 3WWVA 2B63G 1E24A 2CWPA 3UDGA 4OX9Q 5JJIA 4OONA 2K5VA 3PUVA 2NVQH 2BH2A 4EX5A 4BA1I 3KFUA 3CCQA 4B3SL 3K8AA 4QIWE 3ZJYC 1A62A 1VQDA 1YEZA 1GO3E 4IPHA 4BY1G 1PH9A 1SR3A 1JJ2A 2UUAQ 3CPWA 2UUBQ 2WB1G 4JI5L 1J5EL 1TWHH 4A3KH 1VQKA 5JJKA 1DGSA 4DR2L 1ASZA 1E1TA 3J81j 1TXYA 1S3OA 5M5XH 4JI8L 3PO3G 4QL5A 3OTOL 1WJJA 2DGYA 1Q1BA 3CCMA 4GLAC 1AH9A 2NZOA 1VQAA 2K52A 3UDFA 2ZJRA 4JI3Q 2UXCL 4HJ9A 1A0IA 3U50C 3M4PA 2VQFL 4NXNL 4BBRG 2EIFA 2CFMA 2PI2E 3HOYG 1Q8KA 4A93G 3T1YQ 2NVXH 1L1OB 1SRUA 2R6GA 2MO1A 3M7NA 4R4QA 4DR6Q 2Z6KC 4KHPQ 3RZOH 5ELOA 3JAMi 4A3EH 3HOZG 2F52A 1NMFA 1L0WA 1YVCA 2ALYB 5IYCG 3NENA 1YIJA 2OQKA 4DV5L 5C0XG 4HJ5A 5C4XG 1VQ4A 1MJEA 3BJUA 2VNUD 2N3SA 3F2BA 1K0RA 4A3LH 4X6AH 3CCJA 4PZ6A 3BU2A 2VQEL 4FDBA 4AIMA 5IY0A 2JA7G 1GVPA 2CKZB 2YYZA 4NPSA 1N33L 3OYYA 4JI0Q 4LFAQ 2HT1A 1C9OA 5IP9H 3CW2C 4HIMA 4HJAA 3S2DH 4X62Q 4IPCA 2KCMA 5C0XJ 3HKZE 3I7FA 4DV7Q 2K14A 1I5FA 3S16H 2VW9A 1K8AC 2F3IA 3HOWG 3S1RH 1PH2A 4JG2A 2OCEA 3J7A5 1IBKQ 3F2DA 5GROA 3S14H 1L1OC 3PO2G 3F2CA 4UP9A 1QZGA 3IRBA 4LF8Q 4DR3Q 1UE5A 4JI1Q 5FJ8H 2K5NA 2UU9Q 2H5XA 1VQJA 2Y0SE 1G51A 1HNXL 4P73A 3PF5A 1WFQA 5LMUQ 2MO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6Q A;  3E9H A;  3JAM c;  1LYL A;  4L5T A;  4JC0 A;  1QUQ A;  3CXC A;  1HZ9 A;  2UUA L;  1WCM G;  2UUB L;  3GTL H;  4TQU S;  3PF4 A;  4YY3 L;  2E8G A;  1YHQ A;  1IBM L;  4LF7 L;  3RLF A;  1Q12 A;  4OO1 G;  4HJ7 A;  2JA5 G;  4OWX B;  4BBS G;  4K0K L;  4QY7 A;  1VQP A;  5IP7 H;  4JBM A;  2JEA I;  1PFS A;  5C3E G;  5J3B A;  5IYC H;  2RF4 A;  4B3T L;  2VUM H;  5IP7 G;  4DV6 L;  1PH4 A;  1IL2 A;  1OXS C;  2BA0 A;  1VQ8 A;  5C44 G;  4UY8 C;  3PO2 H;  4DR1 Q;  2EQS A;  1K3R A;  3I4M H;  4IOA A;  2IX1 A;  4QQB X;  4K0K Q;  4Y52 H;  2PNH A;  1XPU A;  3E9I A;  4HID A;  2JQO A;  1FVI A;  3K80 C;  2BH8 A;  1N33 Q;  4ME3 A;  2UU9 L;  3S15 H;  3PGZ A;  4GLX A;  1B8A A;  1UE7 A;  3HOU G;  5C3E H;  3PIO A;  1SLJ A;  4KHZ A;  3A5Z B;  3PIP A;  3T1Y L;  4R4C A;  1JT8 A;  1OXT A;  3S2H H;  5E7N A;  2MNA A;  4JV5 Q;  4DR6 L;  1RIP A;  1CKO A;  1EIF A;  4L5R C;  3LGJ A;  3CCV A;  1HR0 L;  1X56 A;  1CKM A;  4AQY L;  2ZJQ A;  1IZ6 A;  2F4V L;  1X3G A;  1FGU A;  3Q8D A;  3J7Z C;  1CKN B;  2B3G A;  2NN6 G;  2V1C C;  3KDF B;  4J15 A;  1X65 A;  4P71 A;  1B70 B;  4LF8 L;  4O0A A;  5FLM G;  4DUY L;  4UPA A;  1W3S A;  5ELN A;  1EIY B;  3S1Q H;  4LF9 Q;  3TRE A;  1PYB A;  4B3M L;  3A74 A;  3STB C;  4AYB E;  5HY6 A;  4P75 A;  2WAQ G;  2WFW A;  3TQY A;  4X66 Q;  1BBW A;  1VQO A;  3CMA A;  4X65 L;  4JI6 Q;  2Y0S G;  5GQO A;  4A3D H;  1ASY A;  5JJL A;  5DLQ E;  3PUW A;  4B3M Q;  1Q46 A;  4LWC A;  1E1O A;  1SN8 A;  1AE3 A;  1HZA A;  3I55 A;  3RN5 A;  3HOW H;  2K50 A;  1K83 H;  1TWF H;  4WJ4 A;  2Z6K A;  3G6E A;  2UXB Q;  4GKJ L;  5EAY A;  4AH6 A;  4A3D G;  4L5Q A;  4DK3 C;  2AMC B;  1X6O A;  5GAD C;  1N32 Q;  2R92 H;  1Q81 C;  2EXD A;  4DV6 Q;  5C4X H;  1IBL L;  3PUY A;  5IYB H;  4JI1 L;  1HZB A;  4LFC L;  4A3G G;  1EQQ A;  4JBW A;  4R4T A;  1BKB A;  2E2J H;  1X3F A;  4LW1 A;  4A3L G;  5FLM H;  1HNX Q;  1CUK A;  4A3C G;  4JI7 Q;  4A3E G;  3CC2 A;  3UDX A;  2R93 H;  4C2M H;  1MJC A;  1WI5 A;  2Q2I A;  1VQL A;  2YV5 A;  2E5L L;  2LXJ A;  3PCO B;  1VQM A;  4LFC Q;  4BY1 H;  1JJG A;  4X66 L;  4B3R L;  1I94 Q;  4LF6 L;  1PA6 A;  1C0A A;  3CC7 A;  4UP8 A;  4NXM Q;  3L0O A;  1Q1E A;  1E3P A;  1NY4 A;  1V1Q A;  3DLL A;  2UUC Q;  3JC6 6;  4UP7 A;  4YCW A;  3AEV A;  2JA8 G;  1A63 A;  3RZD H;  1R9T H;  4A3B G;  4BY7 G;  4GNX B;  4A75 A;  3H3V I;  4DR5 L;  3K0X A;  1YJN A;  4YWK A;  3I2Z A;  3KF6 A;  3U4V A;  1PH8 A;  3S1N H;  4GN3 B;  3UE1 A;  1UWV A;  2MFI A;  3M85 A;  3H0G G;  5IYB G;  5JEA G;  5IT9 c;  4JYA Q;  3PO3 H;  2FXQ A;  3KF8 B;  1N34 L;  2AKW B;  2PI2 A;  4GOP C;  4LF5 Q;  4BXX H;  1JB7 A;  2R92 G;  3PV0 A;  5JEA J;  2UXC Q;  1SRO A;  3G48 A;  1X9N A;  3S24 A;  1EFW A;  4IPD A;  4JI7 L;  4C3J H;  1GKH A;  2JA6 G;  1L1O A;  2R7F A;  1NTG A;  4A76 A;  1JMC A;  5FLX c;  2JEB I;  1VQ9 A;  2Q2H A;  1Y1V H;  4C3H H;  1EOV A;  1EQR A;  1FL0 A;  5LMU L;  4JI2 L;  5LMN Q;  2IHF A;  1QVG A;  2Z0S A;  2K75 A;  1P16 A;  4IPG A;  4GKK L;  2KCT A;  5M3M G;  2OQ0 A;  1VQN A;  4JOI A;  4R4O A;  1TWC H;  4JOI C;  5GAE C;  3CCE A;  1PHJ A;  1RL2 A;  4DV0 L;  3HOX G;  1KL9 A;  4IJL A;  3CQZ H;  3TEH B;  1XMQ Q;  1EYG A;  2YTY A;  5H1S E;  2CWA A;  2JA5 H;  4MNO A;  1XNR Q;  3F8T A;  1HJP A;  4QJF A;  1VQF A;  1SFO H;  1J5E Q;  1BBU A;  3CCS A;  3U58 A;  1I94 L;  2CCZ A;  4LF5 L;  2ASB A;  2YTX A;  2ZTE A;  3MEF A;  4YHH L;  5M3F H;  3L2P A;  4DV1 Q;  4OXP A;  1OTC A;  1YJW A;  4B3T Q;  4LF9 L;  4DR7 L;  1PH7 A;  4LFB Q;  4JI4 Q;  3BZC A;  1KQS A;  1I6H H;  4GLV B;  2GN5 A;  4PZ7 A;  4AYB G;  3VDY A;  1XNR L;  4MTN A;  4H02 A;  4A3G H;  1X3E A;  3HOU H;  2GVA A;  2N78 A;  3M3Y H;  4NXN Q;  5K36 G;  2Q2U A;  2NN6 I;  4JV5 L;  4ALP A;  2K4K A;  2K5H A;  3UDI A;  5IE8 A;  2JJQ A;  2BA1 A;  2L15 A;  4HJ8 A;  2UXD Q;  1M1K C;  4OWT B;  3GTP H;  4IFD G;  2E5L Q;  2HQL A;  4MZ9 A;  3K7U C;  4A93 H;  1YHA A;  4PG3 A;  1P8L A;  5M3M H;  2C35 B;  4B3S Q;  1YBY A;  1PYS B;  4BA2 I;  3RR5 A;  4DUY Q;  1CSQ A;  2UXD L;  1T9H A;  5IP9 G;  1XPR A;  4NXM L;  2LSS A;  3J80 i;  2RHS B;  4LF4 L;  1V9P A;  3H3V H;  1XTD A;  4YHH Q;  3ULP A;  3W5O A;  1NE3 A;  5IYD H;  1HNZ Q;  4PZ8 A;  2AWO A;  4KLK A;  1LM0 A;  3J81 i;  3CCL A;  4RMF A;  3ICE A;  1X55 A;  2KEN A;  1VQC A;  3G4S A;  5C0X I;  1X54 A;  3U4Z A;  3OW2 A;  1Y1W H;  4XTC S;  3H15 A;  4JI0 L;  2IX0 A;  4YWL A;  4LNQ A;  3CP0 A;  2OTL A;  4KI0 A;  4O2D A;  3CD6 A;  2PMZ E;  1HNW Q;  2D0O A;  3B6Y A;  4DR7 Q;  4JYA L;  4A4I A;  1WYD A;  2JA9 A;  2XGT A;  3E0E A;  3H0G H;  1NJI C;  1N34 Q;  1M90 C;  3NBH B;  2ZJP A;  3CC4 A;  3M4Q A;  1S72 A;  4RG1 A;  1CKN A;  4DKA C;  3CPF A;  4IFD I;  1N32 L;  2R7D A;  2I5M X;  4WJ3 M;  1D7Q A;  3A0J A;  1VQE A;  4GN5 A;  4YCU A;  1YHB A;  2WB1 E;  1Y1V G;  4R1J A;  1PH5 A;  4A3B H;  3GTJ H;  2AHO B;  1IXR A;  2N49 A;  4DR3 L;  1G29 1;  3AFQ A;  1YZ6 A;  1N36 L;  4JI2 Q;  3T1H Q;  2A19 A;  2KHI A;  4DNI A;  2A1A A;  4DUZ Q;  3BZK A;  1N8R C;  1HNZ L;  1FJG L;  2B63 H;  1LTL A;  2ID0 A;  1K8G A;  4BXX G;  4EQ5 A;  1XNQ L;  3ULL A;  2YU9 H;  3F1Z A;  4A3J H;  3G71 A;  2OTJ A;  5HGQ A;  2QA4 A;  4P72 A;  4X64 Q;  1IBM Q;  4LF7 Q;  3TRZ A;  2VZA A;  4POF A;  3CCR A;  4TVA B;  3GTQ H;  4BY7 H;  3HKS A;  4DK6 C;  5BR8 Q;  4DV1 L;  1Q82 C;  2JA8 H;  3PUX A;  1VCI A;  4A3F H;  1UE6 A;  4DV7 L;  2XTI A;  1WOC A;  5C4J H;  1Z47 A;  3RLO A;  1YI2 A;  1XMQ L;  2I5L X;  1GM5 A;  4GKJ Q;  3KOJ A;  5BR8 L;  3FP9 A;  5FJ8 G;  2A8V A;  3HOY H;  3GTO H;  5IWA L;  4GS3 A;  3D31 A;  4R4I A;  3KLW A;  1OXX K;  3FKI H;  2NZH A;  5GAH C;  4A3I G;  1Q7Y C;  1IBL Q;  3J80 c;  4A3F G;  4JI4 L;  4A3C H;  2R93 G;  3KYH C;  2E2I H;  4DV3 Q;  4OX9 L;  2OWO A;  1GD7 A;  2VY3 A;  5LMN W;  3KJP A;  4B3R Q;  1E7Z A;  3CAM A;  1XNQ Q;  5M3F G;  4DR4 Q;  3M9B A;  1W2B A;  3RN2 A;  1QVF A;  3I4N G;  1VQG A;  3HKZ G;  5LMN L;  2JE6 I;  1D8L A;  3J81 c;  1SE8 A;  1MKH A;  2N8N A;  3FKI G;  3HOX H;  2RCN A;  2QEX A;  4A3I H;  3PUZ A;  4A3M G;  2CQO A;  3W1G A;  4NB3 A;  3A5U A;  2JA7 H;  1E22 A;  4YY3 Q;  1IYJ B;  1JJC B;  5IYD G;  3DM3 A;  2ZTD A;  4YCV A;  2VQE Q;  4DV4 L;  1KC8 C;  2UUC L;  5M5W H;  3GTK H;  1HR0 W;  3I4M G;  2R7Z G;  4C3I H;  3NEL A;  2IHE A;  5C44 H;  4X65 Q;  4HIO A;  4P74 A;  1PVO A;  4DV4 Q;  4DV2 Q;  1S40 A;  2D62 A;  1HNW L;  3RLN A;  1H95 A;  2IT1 A;  4APV A;  1Y14 B;  2VL6 A;  2PQA A;  3D0F A;  3ERS X;  3GTG H;  4BBS H;  2WP8 J;  3I4O A;  1Z9F A;  1U0L A;  1NMG A;  2I5H A;  1PV4 A;  1IBK L;  2KBN A;  3M4O H;  1VQ6 A;  3FHW A;  2ATW A;  1UEB A;  1XPO A;  1VQI A;  3RNU A;  3HOV G;  3UE0 A;  1HR0 Q;  3W1B A;  1OXV A;  2NVY H;  2ZM6 Q;  1YJ9 A;  1Y1W G;  1U5K A;  2JA6 H;  1G6P A;  2KHJ A;  4A3K G;  4GOP B;  4IJH A;  3T1H L;  5IWA Q;  1K73 C;  1WCM H;  4HIK A;  1O7I A;  3S1M H;  2HIV A;  3GDE A;  3KF6 B;  3STB D;  3TS2 A;  4DR2 Q;  4GKK Q;  1OXU A;  3ULJ A;  4JBJ A;  1I3Q H;  2JK8 A;  3CME A;  4GNX C;  4LF6 Q;  1QZH A;  3NEM A;  3EN2 A;  1QVC A;  4IO9 A;  1KIX A;  2MQH A;  1C7Y A;  2VUM G;  2Q2T A;  1EUJ A;  4IFD J;  1JE5 A;  4DUZ L;  1FJG Q;  5M5Y H;  2RHQ B;  2QGQ A;  1K9M C;  1CSP A;  3SGI A;  4JCV E;  1UE1 A;  4Y7N H;  1TWA H;  1B7Y B;  1KRT A;  4DR1 L;  1VQB A;  3MXN B;  1YIT A;  4LFB L;  3I56 A;  4JI8 Q;  4X64 L;  2B29 A;  4PMW A;  3TS0 A;  2ZM6 L;  2R7Z H;  3ER0 A;  1BVS A;  2HHH L;  5AJ3 Q;  1KXL A;  4DV5 Q;  3K7A H;  5GAG C;  1VQ7 A;  1I50 H;  4LUO A;  4DPG A;  4A3M H;  2LXK A;  4AQY Q;  1N36 Q;  2F4V Q;  3S17 H;  4KHP L;  1Q86 C;  2HHH Q;  3HOZ H;  5AJ3 L;  1NBW A;  4L5S A;  3GTM H;  1QUQ B;  1MIU A;  4DAM A;  1YNX A;  1KD1 C;  4LUZ A;  4JI5 Q;  3I4N H;  4OO1 I;  2YTV A;  3EIV A;  3CCU A;  4LFA L;  1VQH A;  4BBR H;  1KAW A;  4DV3 L;  2ZTC A;  2DUD A;  1SMX A;  3PSI A;  4XIG S;  4X62 L;  1LUZ A;  3GO5 A;  4DAY B;  3KJO A;  4LF4 Q;  1KRS A;  3AYH B;  1A8V A;  4LUV A;  3OTO Q;  4DV0 Q;  4JI6 L;  1VS0 A;  2HIX A;  4IOC A;  1PH6 A;  4DR5 Q;  4GOP A;  1N9W A;  1XMO Q;  4OWW B;  2NVT H;  4DV2 L;  3CF5 A;  2PQA B;  1TWG H;  2AWN A;  2VQF Q;  2IY5 B;  1L2F A;  2WAQ E;  1VQ5 A;  2D0P A;  3K81 C;  1HZC A;  1AE2 A;  4YWM A;  1EWI A;  2E2H H;  2VS1 A;  3HFZ B;  3HOV H;  2UXB L;  1HH2 P;  3EBE A;  1XMO L;  2GVB A;  4QGU A;  1KHI A;  3AQQ A;  4JBK A;  4GN4 B;  2ES2 A;  3AFP A;  3KDF A;  1PH1 A;  3L7Z C;  4GNX A;  3GD7 A;  4A3J G;  4POG A;  4JI3 L;  1XJV A;  1PH3 A;  2I0Q A;  4DR4 L;  1V43 A;  3WWV A;  2B63 G;  1E24 A;  2CWP A;  3UDG A;  4OX9 Q;  5JJI A;  4OON A;  2K5V A;  3PUV A;  2NVQ H;  2BH2 A;  4EX5 A;  4BA1 I;  3KFU A;  3CCQ A;  4B3S L;  3K8A A;  4QIW E;  3ZJY C;  1A62 A;  1VQD A;  1YEZ A;  1GO3 E;  4IPH A;  4BY1 G;  1PH9 A;  1SR3 A;  1JJ2 A;  2UUA Q;  3CPW A;  2UUB Q;  2WB1 G;  4JI5 L;  1J5E L;  1TWH H;  4A3K H;  1VQK A;  5JJK A;  1DGS A;  4DR2 L;  1ASZ A;  1E1T A;  3J81 j;  1TXY A;  1S3O A;  5M5X H;  4JI8 L;  3PO3 G;  4QL5 A;  3OTO L;  1WJJ A;  2DGY A;  1Q1B A;  3CCM A;  4GLA C;  1AH9 A;  2NZO A;  1VQA A;  2K52 A;  3UDF A;  2ZJR A;  4JI3 Q;  2UXC L;  4HJ9 A;  1A0I A;  3U50 C;  3M4P A;  2VQF L;  4NXN L;  4BBR G;  2EIF A;  2CFM A;  2PI2 E;  3HOY G;  1Q8K A;  4A93 G;  3T1Y Q;  2NVX H;  1L1O B;  1SRU A;  2R6G A;  2MO1 A;  3M7N A;  4R4Q A;  4DR6 Q;  2Z6K C;  4KHP Q;  3RZO H;  5ELO A;  3JAM i;  4A3E H;  3HOZ G;  2F52 A;  1NMF A;  1L0W A;  1YVC A;  2ALY B;  5IYC G;  3NEN A;  1YIJ A;  2OQK A;  4DV5 L;  5C0X G;  4HJ5 A;  5C4X G;  1VQ4 A;  1MJE A;  3BJU A;  2VNU D;  2N3S A;  3F2B A;  1K0R A;  4A3L H;  4X6A H;  3CCJ A;  4PZ6 A;  3BU2 A;  2VQE L;  4FDB A;  4AIM A;  5IY0 A;  2JA7 G;  1GVP A;  2CKZ B;  2YYZ A;  4NPS A;  1N33 L;  3OYY A;  4JI0 Q;  4LFA Q;  2HT1 A;  1C9O A;  5IP9 H;  3CW2 C;  4HIM A;  4HJA A;  3S2D H;  4X62 Q;  4IPC A;  2KCM A;  5C0X J;  3HKZ E;  3I7F A;  4DV7 Q;  2K14 A;  1I5F A;  3S16 H;  2VW9 A;  1K8A C;  2F3I A;  3HOW G;  3S1R H;  1PH2 A;  4JG2 A;  2OCE A;  3J7A 5;  1IBK Q;  3F2D A;  5GRO A;  3S14 H;  1L1O C;  3PO2 G;  3F2C A;  4UP9 A;  1QZG A;  3IRB A;  4LF8 Q;  4DR3 Q;  1UE5 A;  4JI1 Q;  5FJ8 H;  2K5N A;  2UU9 Q;  2H5X A;  1VQJ A;  2Y0S E;  1G51 A;  1HNX L;  4P73 A;  3PF5 A;  1WFQ A;  5LMU Q;  2MO0 A; 
#chains in the Genus database with same CATH topology
 3MEH A;  3JAM c;  2R8H A;  3CXC A;  1QUQ A;  3GIP A;  2VQF H;  2W7O A;  3PF4 A;  1JDB B;  2V9W A;  2PO4 A;  4YY3 L;  2F0N A;  1VBH A;  1PXU A;  5FK9 C;  4LF7 L;  3GIL A;  1EEF D;  1Q12 A;  2E76 C;  1WD0 A;  4OO1 G;  5C5J A;  1U9R A;  2LKV A;  3C2P A;  5J3B A;  1D5M C;  5IYC H;  2VUM H;  4B3T L;  2W6O A;  4J9Q A;  4DV6 L;  2GA4 B;  2BA0 A;  1VQ8 A;  3PMF A;  1JX4 A;  4G57 A;  2IX1 A;  4QQB X;  4O3R A;  1ESF A;  1G2S A;  4A3J B;  4HID A;  3D6W A;  1N33 Q;  2BH8 A;  5ELD A;  4ME3 A;  4ZQ3 A;  3N41 B;  4GLX A;  1RYR A;  3L9A X;  5C3E H;  3PIO A;  5LL6 X;  1IYV A;  2F0V A;  2PNR C;  1PTO D;  3MXU A;  2MNA A;  4ED2 A;  1S5C D;  3KLS X;  1EIF A;  4L5R C;  4TKO B;  1HR0 L;  1X56 A;  2XNA C;  5ELC A;  4N8X 1;  4KJN A;  2OH2 A;  3FKI B;  5CR3 A;  1CKN B;  1BO0 A;  1GUS A;  4J15 A;  3OIQ A;  2FMA A;  3FMA A;  1H9M A;  3C0F B;  4DR5 H;  2W70 A;  4DUY L;  2W9C A;  1W3S A;  3F8N A;  2XCA A;  4HCS A;  3PZP A;  5IT9 W;  3TRE A;  4B3M L;  5C4J B;  4DV6 H;  3ITP A;  2W6Z A;  4P75 A;  1DJR D;  4A3M B;  4GC6 A;  2NU7 B;  1LV9 A;  2E5L H;  4U67 3;  2Y0S G;  5GQO A;  5JJL A;  1ASY A;  1EYZ A;  3PUW A;  2XWJ B;  1K8O A;  4HAE A;  2MHV A;  1BF4 A;  2P0A A;  4ED0 A;  2FLN A;  4CDD C;  1M8A A;  5J22 A;  3GV8 B;  2Z6K A;  1TWA A;  4IRC A;  1PRT D;  3RBE A;  1UNN C;  1BXR A;  2R93 B;  2YU9 A;  2J6T A;  4UDU C;  5EKL A;  2PCF B;  2R92 H;  4DV6 Q;  2HGS A;  3OOC A;  4GZY C;  3QFF A;  2X0S A;  2W71 A;  4RKL A;  3RAQ A;  4B3T H;  2QDL A;  3ZYY X;  4A3L G;  4DL5 A;  1HNX Q;  1U4P A;  2NTS A;  4A3C G;  2NB0 A;  3G6J B;  4DR4 H;  2YV5 A;  4EFB A;  2HDM A;  3PCO B;  1ZYR C;  3PW7 A;  1DOK A;  4LFC Q;  4N9T A;  5T1I A;  1JJG A;  1R4Q B;  1TS4 A;  3U9O A;  1I94 Q;  1PA6 A;  3GTO A;  4UP8 A;  3WNZ A;  2A74 C;  4XT1 B;  5E3F A;  2XRQ D;  3V05 A;  4QW9 A;  4A75 A;  3H3V I;  1YJN A;  4HSP A;  4YWK A;  4F4W A;  5D14 A;  2F1M A;  1PH8 A;  1V1O A;  2MFI A;  3TSS A;  3H0G G;  5D1O B;  4PV1 C;  2AGP A;  3K0Y A;  2FXQ A;  4LF5 Q;  4GOP C;  5KFS A;  3PV0 A;  4HSV A;  1PLF A;  5C4Z A;  2UXC Q;  2M2L A;  1I4R A;  3G48 A;  3BVG A;  4C3J H;  1L1O A;  3MTS A;  1Z2O X;  1SBB B;  4X3T A;  3M4Y A;  4G7H C;  1HHV A;  2JEB I;  4J9K A;  5CA1 F;  4KHV A;  4RZR A;  1O7Z A;  1HFG A;  2Z0S A;  4F8M A;  2K75 A;  2KCT A;  1XNQ H;  3SK5 A;  1T5X D;  3WOF A;  4JOI A;  4R4O A;  1WTR A;  3VR4 A;  4JOI C;  4C5C A;  5KFW A;  1PHJ A;  2R7L A;  4DV0 L;  3HOX G;  1MSG A;  3CQZ H;  4C3I G;  1E0B A;  4Q0Y A;  3DMU A;  1CI3 M;  5KGU A;  1Z7T A;  2EYO A;  4MNO A;  4V19 0;  4UCU A;  1XNR Q;  4LFA H;  2NVX B;  1HJP A;  1SFO H;  4B3R Q;  2NVY A;  4C2M B;  1I94 L;  2ASB A;  4JV0 A;  2ZTE A;  4DV1 Q;  3L2P A;  3BS1 A;  4OXP A;  5DGA A;  1KDA A;  4LFB Q;  4JVZ A;  5FO7 B;  1XNR L;  2YYA A;  4MTN A;  1WCM A;  1WTP A;  3DHQ A;  5HV6 A;  4RNN A;  2N78 A;  1BGW A;  2B2V A;  2VB2 X;  3RZD B;  3R2I A;  2Q2U A;  2NN6 I;  2F0P A;  1TWF B;  1M4V A;  2K4K A;  2NVT B;  1AFP A;  5IE8 A;  4J9S A;  2L15 A;  5LP6 F;  1M1K C;  2W9C B;  4OWT B;  3GTP H;  4KN7 C;  2R84 A;  2E5L Q;  1BCP F;  4MZ9 A;  4A93 H;  3GII A;  1YHA A;  4PG3 A;  1KBL A;  2C35 B;  1JCK B;  4ZCK A;  5KFI A;  1EIG A;  1B6R A;  3QO2 A;  3RR5 A;  5IP9 G;  1XPR A;  3GTP B;  2L0C A;  4TV9 F;  2ZM6 H;  3JSL A;  2P5Z X;  3J81 i;  3CCL A;  1CT1 D;  1X55 A;  2KEN A;  1X54 A;  3U4Z A;  5JVH 3;  4XTC S;  4GKK H;  5EKK A;  2IA6 A;  2CW0 C;  1STB A;  4YAK B;  3CP0 A;  2OTL A;  4KI0 A;  4K0K H;  1DIK A;  1B6S A;  1S5B D;  3GIM A;  1L0Y B;  4XDX A;  1KXL A;  2W9B B;  3H0G H;  2C28 A;  1M90 C;  4ZYS A;  1D2B A;  2ZJP A;  4A2A A;  1I4X A;  1CKN A;  2PMZ B;  4DL6 A;  2I5M X;  3A0J A;  4GN5 A;  5M5X B;  3GTQ B;  4JI7 H;  2WB1 E;  5KFD A;  3GTJ H;  1I94 H;  4JW0 A;  2WE6 A;  3PO2 B;  1GHJ A;  3LX0 A;  2MUY A;  3M9N B;  1YZ6 A;  1KDB A;  1UUP A;  4KY5 A;  4ZOL F;  3T56 B;  1PK8 A;  4MHE A;  3H20 A;  4OX9 H;  2KHI A;  2VB3 X;  3BZK A;  4E6I A;  3K5N A;  1HNZ L;  1FJG L;  4GKJ H;  2EDG A;  1BDO A;  4GC7 A;  4QMG A;  4JI4 H;  1XNQ L;  1O7Y A;  4HNT A;  1E2V A;  4FVM A;  4UCS A;  2QA4 A;  3R23 A;  5HUR A;  1KJ8 A;  3TRZ A;  5KNC A;  2O03 A;  3KAJ A;  5C8Y F;  1CZG A;  4Y8V B;  3HKS A;  1IKL A;  1N32 H;  2C5C A;  3PUX A;  5C4H A;  2A6H D;  4IAJ A;  3M9O B;  1B33 N;  4DV7 L;  1AP0 A;  1SND A;  1DV2 A;  1DON A;  4A3E B;  1WOC A;  3GV3 A;  5C4J H;  3TN2 A;  1GM5 A;  4GKJ Q;  2IP4 A;  3V6K A;  2KCN A;  1SE2 A;  3GTP A;  2FKL A;  1I3Q B;  1EQT A;  3D31 A;  1K3B C;  2NZH A;  1FJG H;  1A2U A;  4A3C H;  4UHV A;  1SYG A;  1GLV A;  1MZB A;  2R8K A;  5LMN W;  2IBK A;  2OT2 A;  4H0L C;  3I72 A;  3G6Y A;  2A73 B;  2CZG A;  3SE7 A;  1QVF A;  2Z4I A;  5LMN L;  1IKM A;  3E3X A;  2JE6 I;  1D8L A;  4RWS C;  3V2T A;  4FO2 A;  4A3M G;  1CQV A;  4DV1 H;  2BR0 A;  3LWB A;  1E22 A;  4C5B A;  1IYJ B;  1JJC B;  1UEA B;  3DM3 A;  4ZI7 F;  4YCV A;  2JP1 A;  3OUU A;  3R3O A;  4N9P A;  2UUC L;  2FFK B;  2R7Z G;  2HVR A;  3NEL A;  2UUB H;  5DM7 3;  3K3V A;  3DF7 A;  3H09 A;  4MTK A;  5CV7 A;  3R93 A;  3GTL B;  3M4I A;  4UCR A;  1GGO A;  5JUM A;  5I47 A;  2VL6 A;  3D0F A;  2PQA A;  3GTG H;  4QF4 A;  1XXG A;  1PV4 A;  2QW7 A;  3T16 A;  4XX0 B;  2F0W A;  2ATW A;  1VQ6 A;  3SHL A;  1GSH A;  3DM1 A;  4HR7 A;  2PZU A;  1BR9 A;  1H9J A;  4ABN A;  1BUV T;  1OXV A;  2ZM6 Q;  1YJ9 A;  2YL2 A;  1G8Z D;  4IJH A;  5D1O A;  4Q45 A;  3RMH A;  2BQU A;  1F2Z A;  5KND A;  4IUP A;  2HIV A;  1SJE D;  2QK4 A;  4ED7 A;  3TS2 A;  3N43 B;  4GKK Q;  1OXU A;  1TT2 A;  3ERO A;  2L4N A;  1HRJ A;  2FLP A;  4GNX C;  4LF6 Q;  5DNF A;  5C3X A;  4YB8 B;  5I6Y A;  5I9O A;  2VUM G;  2MQH A;  3D4W A;  4B08 A;  4IFD J;  1WTW A;  2Q8I B;  2EE1 A;  1SNQ A;  4DXG A;  1N48 A;  4IR9 A;  3MFY A;  3H91 A;  4Y7N H;  1B7Y B;  3PW2 A;  2R8G A;  1SYX B;  3I56 A;  4JI8 Q;  3A7L A;  5L1I A;  2B29 A;  4K8J A;  2UXD H;  4PMB A;  2RDF A;  1BCP B;  3ND8 A;  4K5V A;  4G7O C;  2HHH L;  5DG8 A;  1STA A;  3K7A H;  3RB6 A;  4FP5 D;  1VQ7 A;  2PPB C;  1I50 H;  2SDF A;  2I8C A;  2ASL A;  4DPG A;  4AQY Q;  2F4V Q;  2HHH Q;  1W6J A;  3HOZ H;  2XWB B;  4LF8 H;  1CQF A;  2RSN A;  1QUQ B;  1MIU A;  2DLN A;  2F0L A;  4JI8 H;  4IUQ A;  5ELB A;  4BBR H;  3HXL A;  1B9N A;  1KAW A;  1DCZ A;  2EYL A;  3PSI A;  1LUZ A;  4DAY B;  3V6J A;  5KFU A;  1VDZ A;  4RCO A;  4LF9 H;  1A8V A;  4JI6 L;  1VS0 A;  1SDF A;  4ILW A;  1PH6 A;  4DR5 Q;  4BBR B;  1XMO Q;  3VA5 A;  5CV4 A;  3FMC A;  4XYO A;  2R7M A;  2R7Z A;  1TWG H;  1RF2 D;  3RZO B;  4J9N A;  1L2F A;  1PTO C;  4MV4 A;  4EFE A;  2BE5 D;  3MXN A;  1VQ5 A;  2D0P A;  2N55 A;  1HZC A;  4YWM A;  1H9R A;  2B2T A;  1HH2 P;  3RFC A;  1XMO L;  4E4T A;  3KXY T;  4ED6 A;  2K03 A;  1QB5 D;  5G3L D;  4IUT A;  5C6A A;  4DAV A;  4JBK A;  3BJY A;  4GN4 B;  4F4Y A;  3JSN A;  3L7Z C;  3HOV B;  3GD7 A;  2WB1 B;  4JI3 L;  5BN4 A;  2I0Q A;  3UDG A;  2FMC A;  3PUV A;  2VXW A;  5CYU A;  1F2Y A;  4U7C A;  4I4T F;  4FF3 A;  4BA1 I;  4XT3 B;  3A8I E;  1EY6 A;  4F87 A;  2FK2 A;  4LSA A;  2Z4H A;  2UUA Q;  3QB3 A;  1DD2 A;  5EGT A;  2DJG C;  4Q8E A;  5EWF A;  2TMP A;  4DV5 H;  4JUZ A;  1DGS A;  3JZI A;  2PZT A;  1EY9 A;  4EQP A;  2GLT A;  1TXY A;  2R85 A;  1JOO A;  4JI8 L;  1NUC A;  1I4G A;  4QL5 A;  5F9N A;  3P20 A;  2JA5 B;  2AUJ D;  1Q1B A;  4A2B A;  2E75 C;  5JVD F;  1AH9 A;  2E2D C;  3JAM W;  3UDF A;  2UXC L;  2ZJR A;  1A0I A;  2FHT A;  3M4P A;  2UUA H;  3TQ1 A;  2EIF A;  2CFM A;  1GUT A;  2WKC A;  3T1Y Q;  2DJF C;  2B63 B;  1SRU A;  1TWC B;  2MO1 A;  1V51 A;  1KNA A;  2Z6K C;  3SK4 A;  1TWG B;  3RZO H;  2PVP A;  5FOB B;  2PMZ A;  1S0O A;  3H6M A;  2VA3 A;  1YVC A;  4G7Z C;  4JV1 A;  4KKU A;  1VQ4 A;  4ETS A;  3A56 A;  2N3S A;  3NGD A;  2EYJ A;  2MJ8 A;  1QNU A;  3VYU A;  3SR1 A;  1ULZ A;  1V4Y A;  2WYO A;  4J9L A;  4Q8F A;  2EXZ A;  2CW0 D;  1B9M A;  1C9O A;  1AW7 A;  3K7A B;  4HIM A;  4L6T B;  1NAP A;  3S2D H;  5C0X J;  5EQ0 A;  3D4R A;  4AQY H;  2F4V H;  1I5F A;  4ME5 A;  4YIJ A;  2VW9 A;  1K8A C;  3S16 H;  2F3I A;  4QWA A;  1RD9 D;  2RDJ A;  1KTK A;  2OCE A;  3F2D A;  1IBL H;  1QE6 A;  4MTE A;  3KHR A;  3K5M A;  3F2C A;  1QZG A;  5JAV A;  3EVQ A;  1TS2 A;  2M00 A;  4XYM B;  1Z6H A;  4JI1 Q;  5COY A;  1SYE A;  3MWE A;  3RV3 A;  4RNO A;  4DR1 H;  4J0M A;  5LMU Q;  3PN1 A;  2SCU B;  4PDB A;  5KFL A;  3TME A;  4L5T A;  1HZ9 A;  3BDO A;  1LLR D;  3NE5 B;  1WCM G;  4HED A;  4TQU S;  1ENA A;  1QG7 A;  2AQ1 B;  2R82 A;  2E8G A;  1IBM L;  3CRL C;  3MFH A;  4C3H B;  2JA5 G;  2EJM A;  2KEC A;  4BBS G;  5HGT A;  4K0K L;  4QY7 A;  1IOW A;  2AUK A;  3RB3 A;  2DPI A;  4JBM A;  4JI1 H;  2J0T D;  4IUU A;  3TZD A;  4LFC H;  3JRX A;  4NKL A;  2EQS A;  4DR1 Q;  5IOC A;  5K2M A;  2PQE A;  4OO1 H;  2K04 A;  3CQZ B;  2PNH A;  1XPU A;  5DLG A;  4ED8 A;  2NVY B;  3E9I A;  1WTV A;  4K5W A;  1B8A A;  1R9T A;  1SNO A;  3VR3 A;  1ML0 D;  1EQV A;  4KHZ A;  4DFA A;  1OXT A;  2SNM A;  3S2H H;  2ZXR A;  5E7N A;  3K5L A;  4EBE A;  1RIP A;  3NWS A;  3LGJ A;  1IZ6 A;  1LTB D;  3J7Z C;  2GPW A;  3A55 A;  2V4D A;  4RB1 A;  4L1K A;  2B3G A;  2V1C C;  3KDF B;  3OMC A;  4EGQ A;  5KFJ A;  5C3W A;  1X65 A;  4IR1 A;  1B70 B;  4O0A A;  4L63 B;  3I70 A;  3S1Q H;  1PRT B;  2RGV A;  3A74 A;  4ZKB B;  4AYB E;  5L9X A;  4Z9C B;  1ZHQ A;  1Q3L A;  3TQY A;  2NTT A;  2WIN B;  4DNT B;  4X66 Q;  1BBW A;  4R9W A;  1VQO A;  3DWQ A;  4X65 L;  2BQ3 A;  4IUV A;  5DLQ E;  3FDT A;  3F2U A;  1SN8 A;  3RN5 A;  1HZA A;  5JVL A;  3T1Y H;  3KLS A;  5CAE B;  1TWF H;  2YS6 A;  1U4L A;  2MCT A;  4WJ4 A;  1XNR H;  4AH6 A;  4A3D G;  4L5Q A;  1RJP A;  3QJY A;  2LFN A;  3RBD A;  5GAD C;  1N32 Q;  3RUZ A;  3R2T A;  2W9A A;  5C4X H;  1IBL L;  2QKI C;  4V0B A;  1HZB A;  1VF5 C;  2E2J H;  4JBW A;  1X3F A;  1I50 A;  2VUM B;  5FLM H;  1X3Q A;  2R93 H;  2HQE A;  1BCP C;  1XTC D;  2YZG A;  4DV3 H;  1A3V A;  2L55 A;  4ED1 A;  4J9M A;  3GTQ A;  1U4R A;  1STE A;  2NU6 B;  1VQM A;  3E0J A;  4M7E A;  3K5H A;  4BY1 H;  5IGG A;  1LT6 D;  3MWM A;  4B3R L;  3BQ0 A;  1D1I A;  3SE0 A;  3T1H H;  2A6H C;  1C0A A;  2KJX A;  3HP3 A;  2F0D A;  1NY4 A;  1QNK A;  4MAM A;  3S16 B;  4UP7 A;  4YCW A;  4TV8 F;  1EZ1 A;  4BY7 G;  2KSW A;  5A2Q E;  3VYT A;  4O4L F;  2F3W A;  2B63 A;  1EFI D;  2B2Y A;  3UE1 A;  5DAU A;  1VMP A;  1STY A;  4CJ1 B;  4Q44 A;  5JEA G;  3PO3 H;  4L8J A;  1N34 L;  2AKW B;  2R92 G;  5JEA J;  4CGY B;  1ENF A;  1ICF B;  2UU9 H;  1EFW A;  3S24 A;  2FJ2 A;  4JI7 L;  2E2H A;  1GKH A;  3RGZ A;  3SEB A;  2R7F A;  1NTG A;  2O5I C;  1MGS A;  1JMC A;  3I4M B;  1Y1V H;  4C3H H;  4HNV A;  4TQR A;  2OF1 A;  1CK1 A;  1FL0 A;  1EQR A;  3PQI A;  5LMU L;  3MR3 A;  5LMN Q;  1QVG A;  4MV3 A;  4HNU A;  3BA8 A;  4IPG A;  4GKK L;  3RGX A;  2NVX A;  4DR2 H;  4ZKC B;  4UAI A;  1PX2 A;  1RL2 A;  5FKA C;  1TWF A;  2K28 A;  3TEH B;  4FM9 A;  1RCV D;  3WO0 A;  4LH7 A;  4A3B B;  3S17 B;  3F8T A;  4QJF A;  5KFE A;  1VQF A;  1J5E Q;  1PFN A;  3CCS A;  3U58 A;  1TAE A;  4ECW A;  1PTO H;  4HCE A;  5M3F H;  1BBX C;  1VBG A;  3I4N B;  4DV7 H;  4WRD A;  5GON F;  2KOL A;  4LF6 H;  4FXG C;  4J9R A;  4JI4 Q;  1S9F A;  1B3Q A;  5EPL A;  1I6H H;  5KG3 A;  1SYC A;  1GSA A;  3VDY A;  1S5D D;  2VOB A;  5JPM C;  3GTM B;  5A35 A;  4H02 A;  2CH4 W;  3X3M A;  1D5Z C;  3NTH A;  1PZJ D;  3H3V C;  4NXN Q;  3AU7 A;  1A3T A;  2CQA A;  4JV5 L;  1KEE A;  1W6K A;  3Q0A A;  2JJQ A;  2BA1 A;  2UXD Q;  4ZHQ F;  2RSO A;  2DN8 A;  1TR5 A;  3J80 E;  3K7U C;  1W93 A;  4CKC A;  3QZ8 A;  1N34 H;  5M3M H;  4B3S Q;  1SFO A;  4JI6 H;  2LSS A;  3H3V H;  3A8K E;  1CTM A;  4YHH Q;  3W5O A;  5IWA H;  2RDH A;  3S14 B;  2MPM A;  4KLK A;  3ICE A;  2EZV A;  1VQC A;  5C0X I;  4K2L A;  3OW2 A;  3RF2 A;  4J9P A;  3CRK C;  1CM9 A;  4JI0 L;  2JA7 A;  2CVR A;  2PBZ A;  4O2D A;  1JOK A;  3CKI B;  4A4I A;  1Y8O B;  1N34 Q;  3MWD A;  1C8C A;  4EVO A;  1R9T B;  5FO9 B;  1S4Z A;  1N32 L;  1KAA A;  4WJ3 M;  1KDC A;  1G91 A;  1D7Q A;  1VF7 A;  4BY7 B;  1YHB A;  2R61 A;  4A3B H;  4Y7N B;  1G2T A;  5T14 A;  4YHH H;  1IXR A;  1E2W A;  4DR3 L;  5FO8 B;  3GID A;  1N36 L;  2E2I A;  1IHZ A;  3QG1 A;  2A19 A;  2JXM B;  1N8R C;  3J80 L;  2R92 A;  3J81 E;  4IUR A;  2ZT9 C;  3ULL A;  4I7A A;  4A3J H;  1EZ8 A;  5CV5 A;  3TP6 A;  5C3E B;  1PMR A;  1II3 A;  2VZA A;  4POF A;  1TKW B;  5EDW A;  3KBG A;  5KYI A;  3J81 L;  2B8F A;  4DV1 L;  5BR8 Q;  2YZN A;  4RUA A;  4QWE A;  1UE6 A;  2XTI A;  4RGM A;  3Q6S A;  1XMQ L;  2I5L X;  4R8U A;  4KMU C;  5BR8 L;  1LTG D;  4ODG A;  5IWA L;  4CKB A;  4GS3 A;  4IWY A;  4KTA A;  1NSN S;  1F77 A;  2E2I H;  1VMC A;  1UC9 A;  3FPU B;  3RN2 A;  1VQG A;  3E6Z X;  4ECR A;  2R6F A;  1CFM A;  5KT4 A;  2RCN A;  2WAQ B;  3WOE A;  3PUZ A;  3UFX B;  3GTL A;  3W1G A;  4NB3 A;  2JA7 H;  3RV4 A;  4RHS A;  5IYD G;  2ZTD A;  3HOY B;  3H40 A;  4KKS A;  1D1K A;  5M5W H;  3TIG A;  3GTK H;  1Z2P X;  1C48 A;  4C3I H;  3MWY W;  4BWS C;  4HIO A;  2UVR A;  2E2J B;  4I7Z C;  1S97 A;  3J7Y W;  2UVW A;  4BY1 B;  1PTO F;  5CMD A;  5M9O A;  3RLN A;  4I65 A;  2IT1 A;  4ED3 A;  4BBS H;  3NBI A;  1RTO A;  2WP8 J;  3T5L A;  1NMG A;  2I5H A;  2XC9 A;  1EL0 A;  1EWC A;  2K1B A;  2JA5 A;  4BBS B;  3HOV G;  2JN4 A;  4JI3 H;  2VUG A;  1L2Z A;  1U5K A;  4QW8 A;  2KHJ A;  2RDG A;  4GOP B;  1IW7 C;  4C1N K;  5IWA Q;  1K73 C;  4F50 A;  1XMQ H;  5C44 B;  3S1M H;  4DL7 A;  1TWH B;  3KF6 B;  4A3K B;  5KFX A;  1IBM H;  4YJ2 F;  5D1P A;  4JBJ A;  4EQN A;  4XQN A;  5JJZ A;  1I3Q H;  1QZH A;  3NEM A;  3EN2 A;  1QVC A;  5CA0 F;  3BVM A;  1C7Y A;  2E2I B;  4RZQ A;  5ELF A;  2NU9 B;  2WKD A;  1QIL A;  2RHQ B;  2CW7 A;  3MJF A;  5DGB A;  4ECY A;  1UE1 A;  1TWA H;  3A7A B;  2FE3 A;  1YIT A;  2X69 A;  4X64 L;  5C1P A;  3VPC A;  1RK6 A;  2FMM A;  3TS0 A;  4LF4 H;  5KFM A;  5C5M A;  2W6M A;  2FP4 B;  2L5T A;  4DV5 Q;  4JI2 H;  1PTO B;  3MC0 B;  1TA8 A;  1LTS D;  4FYD A;  3OHA A;  2SEB D;  3TDQ A;  3MR2 A;  2NU8 B;  3I8Z A;  1N36 Q;  1MHW C;  5KFF A;  1NBW A;  3GTM H;  4O3S A;  1ILQ A;  4DAM A;  3TP8 A;  3I4N H;  2AQ2 B;  4DUY H;  1HTP A;  2YTV A;  1B2T A;  2H4O A;  1L0X B;  4ZAI A;  5J39 A;  5J2T F;  4B3M Q;  2DUD A;  4XIG S;  3GO5 A;  3GTJ A;  3KJO A;  4LF4 Q;  2BDO A;  3PW4 A;  3SI8 A;  5KG5 A;  3AYH B;  1BJT A;  2HIX A;  1KLG D;  3GTO B;  1JWS D;  3BAB A;  1PRT C;  3D8G A;  4GOP A;  2KA7 A;  2NVT H;  3CF5 A;  1EUC B;  1GUW A;  3K6O A;  1AE2 A;  2E2H H;  1EWI A;  2VS1 A;  2FB9 A;  3GIQ A;  3FPP A;  3R5H A;  4FBT A;  4JYA H;  1KHI A;  1CE8 A;  1EY5 A;  2ALZ A;  4UCT A;  3VYR A;  1HA5 A;  3MVV A;  1Z2N X;  2JA7 B;  2XGP A;  4DR4 L;  1FNW A;  3LML A;  4R8I A;  2B63 G;  4WOR A;  3HGB A;  5M5W B;  1AN7 A;  4OON A;  1HUN A;  2K5V A;  1UAP A;  1CHQ D;  5FLX L;  2BH2 A;  4EX5 A;  1TQO A;  3KFU A;  3IFD A;  5IIF A;  3CCQ A;  4QIW E;  3ZJY C;  3S1N B;  2V58 A;  3EFX D;  1PH9 A;  3NP8 A;  4IPH A;  2WAQ A;  3CPW A;  2BDN A;  2WB1 G;  1N56 A;  2C00 A;  3SVM A;  5EJW A;  3T4A C;  5JJK A;  3EQL C;  4DR2 L;  1LO5 D;  4B9W A;  5LOV F;  1E1T A;  5BPH A;  2EY5 A;  5M5X H;  3PO3 G;  3CVZ A;  2B2W C;  1WJJ A;  3CCM A;  4GLA C;  2NZO A;  1ZYR D;  3U9S A;  3SDZ A;  1FKA H;  1U4M A;  4EGJ A;  4BBR G;  3HOY G;  5KT3 A;  1GUG A;  2F4I A;  4A93 G;  5KIX A;  4KD3 A;  2RDI A;  4MV7 A;  3I3C A;  5J2U F;  2R6G A;  4ZRZ A;  5J1Z A;  4YY3 H;  3I90 A;  2F0U A;  4R4Q A;  3UI2 A;  4DR6 Q;  3L4J A;  2UXB H;  3JAM i;  4A3E H;  1Y8N B;  1SYB A;  3HOZ G;  4EBD A;  1EY0 A;  2F52 A;  1NMF A;  2ALY B;  1YIJ A;  3NEN A;  3NPP A;  1S5E D;  2OQK A;  1DV1 A;  4DV0 H;  5C0X G;  4A3G B;  2J4X A;  2G9H D;  4JPB W;  5LA6 F;  5KFV A;  1IBK H;  2C9O A;  3E5S A;  2VNU D;  1E4E A;  4KK7 A;  1UNS A;  2F0G A;  4PZ6 A;  4Q0F A;  3CCJ A;  4FDB A;  5IY0 A;  2R7N A;  4X65 H;  4O2A F;  3Q8S B;  3SK8 A;  1GVP A;  3NBH A;  4NPS A;  3NTI A;  2BQR A;  3KUP A;  4DV4 H;  4QUC A;  4LFA Q;  3J7A F;  2HT1 A;  2W6P A;  3BDL A;  3KBX A;  1ICW A;  3CW2 C;  1SMY C;  1I7L A;  4IPC A;  2C2R A;  1NCV A;  3I7F A;  3Q8P B;  3ETJ A;  4OGQ C;  4IZ8 A;  1QOH A;  1PH2 A;  3J7A 5;  1IBK Q;  5GRO A;  4TQS A;  1HUM A;  3N44 B;  3PO2 G;  3DEP A;  5KT7 A;  2Z8L A;  3IRB A;  5K5P A;  1UE5 A;  2H5X A;  4RB0 A;  1VQJ A;  1FR3 A;  2DWC A;  3T5H A;  3PF5 A;  2B2Y C;  1PZI D;  1KNE A;  1KJJ A;  3VR6 A;  1STN A;  2NUC A;  2UUA L;  3GTL H;  1DYQ A;  1AUX A;  1CS0 A;  3I12 A;  2B8G A;  3RLF A;  2J9G A;  4ECZ A;  4XQQ A;  3GV5 B;  1SCU B;  2A69 D;  4OWX B;  4APM A;  3KLR A;  1VQP A;  5FPR A;  5IP7 H;  3J7A V;  2HVS A;  2RF4 A;  1HA6 A;  2GPS A;  1K3R A;  5KFH A;  4Y52 H;  5ISR A;  4K0K Q;  4YP3 A;  2F0O A;  2JQO A;  1FVI A;  1TU2 B;  1Y1V B;  2EY2 A;  3K80 C;  2UU9 L;  2JEF A;  1A15 A;  3PGZ A;  4LFB H;  1UE7 A;  2IPK D;  3W2D A;  3T1Y L;  3A5Z B;  4R4C A;  4DN4 M;  1JKJ B;  4FS2 A;  5KFP A;  3EYY A;  4JV5 Q;  4DXF A;  1CKO A;  3CCV A;  1JXL A;  2K05 A;  3EJI A;  1KC7 A;  1CKM A;  1AZP A;  4RUC A;  3Q8D A;  3EA6 A;  1ET6 A;  4IHJ F;  5KT5 A;  2NN6 G;  1JIC A;  4AYB B;  4HYK A;  2ICE C;  4LF8 L;  3VR2 A;  4UPA A;  2EYH A;  2JYO A;  2PW5 A;  1H9K A;  4XQJ A;  1PYB A;  3LWE A;  4ME6 A;  3STB C;  2FK1 A;  5KFO A;  2WFW A;  1LTA D;  3KK7 A;  4IZO A;  2Y0S A;  4ECS A;  2AGQ A;  2KCC A;  3HOX B;  4TRD A;  5KEE A;  2DIK A;  1E1O A;  1RHP A;  4MN3 A;  2DNC A;  3HS0 C;  5KG7 A;  2K50 A;  1C30 A;  1K83 H;  4IFD H;  4HTH A;  3D4D A;  4DR6 H;  3G6E A;  5D3I B;  1DM0 B;  4GKJ L;  2UXB Q;  5EAY A;  1SNM A;  5EPJ A;  5FPO A;  1HNZ H;  2RBM A;  4DNR B;  4MV9 A;  3T51 B;  3MXP A;  2AMC B;  1X6O A;  3HBL A;  4C56 C;  1RTN A;  4H44 C;  2EXD A;  2K5Q A;  4A3I B;  3PUY A;  4J8Q A;  5IYB H;  4JI1 L;  4A3G G;  2J6S A;  1B44 D;  4R4T A;  1BKB A;  3QOJ A;  4LW1 A;  4O3Q A;  2SNS A;  4JI7 Q;  4EYI B;  3CC2 A;  3UDX A;  5CGK A;  1WI5 A;  2NBF A;  1Q8I A;  5CV9 A;  1VQL A;  3HRZ C;  2F0I A;  2LXJ A;  2W7P A;  3HB9 A;  2CH4 A;  1WD1 A;  5BMV F;  2L12 A;  1ZQ7 A;  4C3J B;  4LF6 L;  5E4X A;  3L0O A;  1HXY D;  1E3P A;  1Q1E A;  3DLL A;  2UUC Q;  2Q8R E;  2RGR A;  3JC6 6;  1JLL B;  2BCO A;  3IN5 A;  2JA8 G;  1E4E B;  4XXE A;  2F0E A;  1ZEQ X;  5F2D A;  4GNX B;  4DR5 L;  3K0X A;  4O1N A;  3IFT A;  1WVL A;  3OUZ A;  3I2Z A;  3SK6 A;  5KFT A;  4ZUJ A;  2ZDG A;  4R8N A;  4GN3 B;  4QWC A;  4IN3 A;  2J6U A;  1ZET A;  1RK5 A;  4RH6 A;  1E4G T;  3KTM A;  4BXX H;  4FF1 A;  5IGF A;  1SRO A;  5NUC A;  1ILP A;  5KX5 F;  1XDN A;  1J9O A;  2KHS A;  2NYZ D;  2Z9H A;  3IL8 A;  3OHB A;  2UUC H;  4A76 A;  1WTQ A;  2A69 C;  2XCP A;  5FLX c;  2H1E A;  2K01 A;  2O2L D;  2Q2H A;  3H0G A;  4CC6 A;  1H9S B;  1K83 B;  3ND9 A;  1EOV A;  2O5J C;  2IHF A;  1P16 A;  3FEW X;  3FRP B;  1X32 A;  1TWC H;  3CCE A;  1ZHS A;  2M05 A;  2K32 A;  2AGO A;  4IJL A;  1XMQ Q;  1JR0 D;  2YTY A;  4LH6 A;  2VPQ A;  2B2T C;  1HTL D;  4U6P A;  2VPS A;  4DR7 L;  4LF9 L;  1Y1W A;  1PH7 A;  3GQC A;  3N6R A;  3HEJ A;  4PZ7 A;  2J7Z A;  3AMU A;  2VR1 A;  5BR8 H;  1V8Q A;  5I2X A;  1BCP D;  4FF4 A;  5A2Q W;  3OMG A;  1X3E A;  3HOU H;  3M3Y H;  4UFZ A;  4MV1 A;  3J7A K;  4ALP A;  2K5H A;  4K14 A;  3UDI A;  4HJ8 A;  4K5X A;  2R8J A;  3BZD B;  3KAK A;  3KHL A;  3BVZ A;  3OWE B;  2HQL A;  4IRD A;  1P8L A;  3I73 A;  1YBY A;  2D5D A;  2Y0S B;  3PIO 3;  1ZXT A;  4LMY A;  2UXD L;  1T9H A;  4DR7 H;  3J80 i;  4LF4 L;  5DM6 3;  1N36 H;  1XTD A;  2HD3 A;  1NE3 A;  5IYD H;  1HNZ Q;  2AWO A;  2EOT A;  1ROD A;  3LNN A;  3R5F A;  3G4S A;  2XIG A;  1SE3 A;  1Y1W H;  3H15 A;  4CC5 A;  4LNQ A;  2IX0 A;  2O4X A;  3CD6 A;  1HNW Q;  1FGB D;  2D0O A;  3B6Y A;  1M7J A;  2MP1 A;  1WYD A;  2XGT A;  1NJI C;  3NBH B;  3CC4 A;  5LXT F;  3CPF A;  1SAP A;  1T3N A;  4YCU A;  1DOM A;  3NUC A;  1PFB A;  2QF7 A;  3QZ7 A;  1G29 1;  3AFQ A;  4R7R A;  4PWQ A;  4DNI A;  2B63 H;  1HNW H;  3BG3 A;  3BQ1 A;  1LTL A;  2ID0 A;  1MI2 A;  1I4Q A;  2A68 C;  2EYP A;  1K8G A;  4BXX G;  2FJZ A;  3TIN A;  2YU9 H;  1C3O A;  3S2H B;  1SYF A;  2FIN B;  4P72 A;  4C3J G;  1VKZ A;  3KHH A;  1IBM Q;  4YR0 A;  4LF7 Q;  4TUY F;  3CCR A;  4LAA A;  4TVA B;  3GTQ H;  2JA8 H;  5HBR B;  1YNN D;  3GTJ B;  2XN9 C;  4A3F H;  2IJ0 A;  2UXC H;  2M9V A;  1LT4 D;  1WCM B;  5KFB A;  1F9S A;  1YI2 A;  4PNY A;  4NDX A;  2JEI A;  3RAX A;  3KOJ A;  2A8V A;  5FJ8 G;  4IUN A;  3GTO H;  4R4I A;  5JOB A;  5KFA A;  3KLW A;  3FKI H;  4A3I G;  4A3F G;  1TVX A;  3P75 A;  3KYH C;  5K36 H;  1CQJ B;  1WSC A;  5KFN A;  2VY3 A;  1E7Z A;  3CAM A;  1XNQ Q;  5M3F G;  4DR4 Q;  3M9B A;  1VAJ A;  4Q43 A;  4RHR A;  1W2B A;  3I4N G;  3T5J A;  3HKZ G;  3NK9 A;  1JB3 A;  5COR A;  4DAP A;  2F0J A;  3MA2 B;  3J81 c;  1SE8 A;  5IGC A;  2YCH A;  2N8N A;  3FKI G;  4A3I H;  1DOL A;  4I55 F;  2CQO A;  3A5U A;  4ZK9 B;  4YY3 Q;  1SEB D;  3DXJ C;  4B3R H;  5EWE A;  3DUZ A;  4K6D A;  4RCN A;  2RVL A;  1KC8 C;  3IKJ A;  4X66 H;  1T94 A;  4CKE A;  2IHE A;  3V4Z A;  4C3H G;  3BYT B;  1PVO A;  2PYK A;  4DV2 Q;  1S40 A;  2D62 A;  3ETH A;  2KQ3 A;  4NW2 A;  3ERS X;  4PMC A;  1Z9F A;  1SJH D;  2I80 A;  3S9W A;  2L1B A;  1IBK L;  4MV6 A;  1RYS A;  3FHW A;  1UEB A;  5JEA H;  3C1E A;  4YBZ B;  3K3P A;  1VQI A;  1Q90 A;  1HR0 Q;  2R8I A;  4X64 H;  1HQM C;  3W1B A;  2NVY H;  1Y1W G;  2JA6 H;  1G6P A;  3H0G B;  3H4B A;  3G8C A;  3VPD A;  2BE5 C;  3T5K A;  2XSC A;  3T13 A;  4HIK A;  5L1L A;  4J1M A;  1B1Z A;  5LMU H;  1JC7 A;  2YS7 A;  2C22 A;  5BN3 A;  1EU4 A;  4KHP H;  1AN8 A;  2QCP X;  3S1M B;  1EY8 A;  1KIX A;  5DG7 A;  5CV8 A;  2R7K A;  1B3A A;  4DUZ L;  2JSO A;  5M5Y H;  1K9M C;  4O3O A;  4RA8 A;  1GJX A;  1CSP A;  4JCV E;  2I87 A;  4RAZ A;  4FXD A;  4DR1 L;  4FS1 A;  4LFB L;  3WO1 A;  4FF2 A;  3PW5 A;  2OXP A;  5DQH A;  1I4H A;  4O4I F;  4RB3 C;  2V4Q A;  5KFK A;  4PMW A;  1CA5 A;  1NNX A;  2I07 B;  4A3D B;  1UC8 A;  2YU9 B;  2R93 A;  4X3U A;  2PN1 A;  3S17 H;  4KHP L;  1Q86 C;  2SOB A;  1ZKO A;  4L5S A;  4M9U A;  1KD1 C;  5C0X H;  4H13 C;  4OO1 I;  3EIV A;  3CCU A;  3L3O C;  1XWE A;  4LFA L;  1JWM D;  1VQH A;  1SFO B;  5JH7 F;  5I2Y A;  4O3N A;  1BQQ T;  4DV3 L;  1Y8P B;  2ZTC A;  2AQ3 B;  4YR3 A;  1GXD C;  4KD4 A;  2X6L A;  4C5A A;  4LUV A;  2EVB A;  3DWP A;  3ONA B;  3OTO Q;  4DV0 Q;  1WTX A;  4IOC A;  5KFG A;  3V4S A;  4MIU A;  5L1J A;  5DQI A;  4YQW A;  4U68 A;  2XRS D;  1N9W A;  4N8F A;  4ZUI A;  5IT9 E;  4OWW B;  4DV2 L;  3BG5 A;  4RNM A;  2PQA B;  2AWN A;  3QR8 A;  4MV8 A;  5D65 A;  3Q8Q B;  1IYU A;  4EEY A;  2I46 A;  3HOZ B;  1GUN A;  3HFZ B;  1DXM A;  3J81 W;  4I50 F;  2UVU A;  2GVB A;  4QGU A;  4DL3 A;  2G5D A;  5TSS A;  3MXG A;  5DG9 A;  2YW2 A;  4YJ3 F;  4S3S A;  1Y1W B;  4DUZ H;  3AFP A;  1TY0 A;  3N8D A;  3OTO H;  4A3J G;  2AU0 A;  2JEG A;  2QIL A;  1Y1V A;  3NTK A;  3TQT A;  1PH3 A;  3LP8 A;  1V43 A;  4ECT A;  2ICI A;  1E24 A;  4KV6 A;  4OX9 Q;  5JJI A;  1I3Q A;  3G6V A;  2F0Q A;  4HN7 A;  3GTG A;  3QIA A;  3CHB D;  3LWU A;  4RAU C;  2FPG B;  4B3S L;  2HVQ A;  4J6H A;  3A8J E;  4DV2 H;  1A62 A;  3O13 A;  2E2H B;  2KED A;  1JJ2 A;  2UUB Q;  1SR3 A;  1SYD A;  4LMQ D;  4RGO S;  4MTD A;  4OIJ A;  3FDS A;  1GOZ A;  4JI5 L;  3PIP 3;  1FNU A;  2A68 D;  3Q22 A;  1VQK A;  3SXH A;  2R3Z A;  4QB4 A;  4KJO A;  4NP5 A;  2W6N A;  1R4P B;  4RGN A;  3J81 j;  1B04 A;  3KAL A;  2L9H A;  1EHI A;  3OTO L;  2F3V A;  3RB4 A;  1SSO A;  1VQA A;  2XVS A;  4HJ9 A;  5KFZ A;  2VQF L;  4NXN L;  3K57 A;  1SNC A;  2NVX H;  2DPJ A;  3HOW B;  2K33 A;  4A3F B;  1YNJ D;  5C5L A;  3M7N A;  3VPB A;  4KHP Q;  2L11 A;  5EPK A;  3KF8 A;  4DK1 A;  2B2W A;  3CU7 A;  2K5D A;  3AB9 A;  2K6A A;  1T36 A;  2D2C C;  2ZDQ A;  2A6E C;  5LMN H;  1O75 A;  3JAM E;  1JOQ A;  2WTF A;  3BJU A;  1LTI D;  3F2B A;  3N40 P;  1K0R A;  2W57 A;  3D3R A;  4A3L H;  4ID6 A;  5DQG A;  3Q1K A;  2DNE A;  1NR2 A;  3BU2 A;  2VQE L;  2IX3 A;  3MR5 A;  2R7Z B;  2YYZ A;  2W6Q A;  3OYY A;  1EWH A;  5KG6 A;  1I6V C;  4X62 Q;  2W8K A;  2KCM A;  3HKZ E;  4CDE C;  4DV7 Q;  1LT3 D;  2V59 A;  1F9R A;  4F4Z A;  2EY6 A;  5L1K A;  1CQI B;  3GLK A;  4JG2 A;  1RJR A;  1WTH A;  5F9L A;  1BNZ A;  3PR5 B;  2W9B A;  1L1O C;  4LF8 Q;  5FLX W;  5FJ8 H;  2K5N A;  2UU9 Q;  4Q5V A;  1K1S A;  2K7V A;  1ET9 A;  5EZY F;  1G51 A;  1HNX L;  4P73 A;  1EY4 A;  1WFQ A;  3E5N A;  5KT6 A;  3GTK B;  2B2V C;  3TII A;  1J6Q A;  3E9H A;  1LYL A;  4JC0 A;  4G4K A;  1IOV A;  4B3S H;  2UUB L;  1A6X A;  4K2K A;  1AEX A;  4F7X A;  1YHQ A;  4NLG A;  2R92 B;  5BPF A;  4HJ7 A;  4O42 A;  3ORR A;  2UVV A;  5FD6 A;  1WTO A;  2JEA I;  3N6X A;  1PFS A;  3NHH A;  5C3E G;  3BAA A;  4DR7 Q;  1I6U A;  2F0F A;  5IP7 G;  1PH4 A;  4H7B A;  1OXS C;  4LJZ C;  5I6W A;  5C44 G;  4UY8 C;  1IL2 A;  3PO2 H;  4XYL B;  2WII B;  3I4M H;  4IOA A;  2V5A A;  3GIK A;  3VA7 A;  2ENB A;  4LSX A;  1S10 A;  3S15 H;  5JQW A;  3HOU G;  3U9T A;  1JWU D;  4O2B F;  1SLJ A;  1JT8 A;  2PW7 A;  3PIP A;  1QWY A;  3HG9 A;  3RIZ A;  3IAY A;  3OIP A;  1EOT A;  4DR6 L;  2W8L A;  2HUG A;  1O7L A;  1V1P A;  1EZ6 A;  4AQY L;  1SNP A;  2ZJQ A;  1PDQ A;  1X3G A;  1FGU A;  4RFB A;  5CV6 A;  2F4V L;  1KJQ A;  4CBV A;  4P71 A;  4J9O A;  3I91 A;  2QYZ A;  4TSS A;  5FLM G;  2CW8 A;  5ELN A;  1EIY B;  4LF9 Q;  1CHP D;  1S0N A;  4I7H A;  3GTK A;  1EU3 A;  5HY6 A;  2WAQ G;  3K5O A;  3BA9 A;  3CMA A;  4JI6 Q;  4A3D H;  3N42 B;  5L37 A;  1Q46 A;  4LWC A;  2EJF C;  2F0K A;  1AE3 A;  3I55 A;  3HOW H;  2OLS A;  1JDE A;  1HQR D;  3FKI A;  1ESR A;  4XZ3 B;  1W96 A;  5EBC A;  4DK3 C;  3MAQ A;  4RB2 C;  1Q81 C;  1ONL A;  1QJO A;  2XIW A;  4OHJ A;  3S2D B;  2C2E A;  1HFN A;  1JIH A;  4LFC L;  4ZLT F;  1EQQ A;  4CHT B;  1ENC A;  3X3N A;  4WD3 A;  3DEO A;  1CUK A;  1RDP D;  4A3E G;  2ZXP A;  4C2M H;  1J8I A;  1F9Q A;  1LTR D;  1MJC A;  2Q2I A;  4MA0 A;  2E5L L;  2Z1C A;  4X66 L;  4RKB A;  1TII D;  4IQZ A;  1Y69 U;  2QDB A;  3CC7 A;  4NXM Q;  3GIJ A;  3V96 A;  1V1Q A;  1PYW D;  3AEV A;  1A63 A;  1K0S A;  3RZD H;  1R9T H;  1B53 A;  4A3B G;  3JRW A;  1QCB D;  3A54 A;  1OO9 B;  2KVM A;  3KF6 A;  2Q8T A;  3U4V A;  1FYC A;  3S1N H;  3M85 A;  1KJ9 A;  1UWV A;  1TWH A;  1GHK A;  5CB4 F;  2RCF A;  3MFI A;  4NMZ A;  4P2C B;  5IYB G;  4JYA Q;  5IT9 c;  2YRX A;  3ERQ A;  3KF8 B;  3GV6 A;  2PI2 A;  2RKS A;  4CJ2 C;  1JB7 A;  1TS3 A;  1IL8 A;  2JA6 A;  3IG0 A;  1X9N A;  1EIH A;  4IPD A;  1TWA B;  2JA6 G;  3Q2O A;  3K58 A;  3H4D A;  2EY1 A;  4X3K A;  1M6V A;  1VQ9 A;  5AFW A;  4XYQ A;  4JI2 L;  3R8B A;  2WAC A;  4IRK A;  1MD2 D;  2MGS A;  2NWG A;  5M3M G;  2OQ0 A;  4JI0 H;  2XGQ A;  1VQN A;  5GAE C;  1EYA A;  4IAL A;  1XYI A;  1KL9 A;  3M7G A;  1EYG A;  5H1S E;  4HQ6 A;  2CWA A;  2RQX A;  2JA5 H;  3D6C A;  5DEH A;  3KHG A;  1HCZ A;  4IWX A;  1BBU A;  2CCZ A;  4FNF A;  3RB0 A;  4LF5 L;  3TP7 A;  2YTX A;  4YHH L;  3MEF A;  5BN5 A;  1OTC A;  4B3T Q;  1GSO A;  3S1Q B;  4O4H F;  1YJW A;  2ASJ A;  1JOR A;  5IYZ F;  5H80 A;  3N52 A;  3JAM L;  4QWB A;  4DR3 H;  3BZC A;  5LL6 S;  1KQS A;  4GLV B;  2GN5 A;  4AYB G;  4G3I A;  3PW0 A;  4A3G H;  4LF7 H;  1FD7 D;  2GVA A;  1A2T A;  3NSW A;  2FLL A;  4BWG B;  4PQX A;  5IOD A;  5K36 G;  3J80 W;  5FLX E;  2VUM A;  1KLU D;  2DZD A;  1AZQ A;  5I4D A;  3HOU B;  4IFD G;  4ZQI A;  1YNJ C;  1PYS B;  5KG2 A;  4DUY Q;  1CSQ A;  4NXM L;  2RHS B;  1V9P A;  3ULP A;  4PZ8 A;  4OEM B;  1LM0 A;  3PR4 A;  2F0T A;  1MBY A;  4RMF A;  2ZJT A;  2F0S A;  4QIW A;  4ECX A;  5E4W C;  1BXT A;  4YWL A;  2NN6 H;  2Z6B A;  1NR4 A;  1K28 A;  4BS9 A;  4DL4 A;  3EPG A;  2PMZ E;  4JYA L;  1LT5 D;  1YNN C;  3K59 A;  2JA9 A;  3E0E A;  1OWT A;  1EYC A;  4RAY A;  3M4Q A;  1S72 A;  4RG1 A;  4DKA C;  4IFD I;  2NVQ B;  2R7D A;  5M5Y B;  5EWG A;  1VQE A;  4RU9 A;  5G3L F;  1JE4 A;  5I9P A;  4YR2 A;  1Y1V G;  3QWN A;  4R1J A;  1PH5 A;  5A2Q L;  2AQ4 A;  2AHO B;  2B39 A;  3VR5 A;  1A3U A;  3G7L A;  3ORQ A;  2N49 A;  2DY7 A;  4MA5 A;  2V4R A;  2JEJ A;  4NXM H;  3PVX A;  4HMI A;  4JI2 Q;  5KYL A;  1DZ1 A;  3T1H Q;  5IGB A;  1HR0 H;  4DLK A;  2A1A A;  1E2Z A;  4DUZ Q;  1TWG A;  4OL7 A;  4EQ5 A;  1STH A;  1KJI A;  5DLF A;  2F03 A;  2IW3 A;  3F1Z A;  1EUD B;  3G71 A;  3Q8R B;  3I4L A;  4LK1 C;  2OTJ A;  5HGQ A;  5CBE E;  4X64 Q;  2B2U C;  3WDN A;  4UCO A;  4HMJ A;  4OIK A;  4B3M H;  4BY7 H;  2C2D A;  4DK6 C;  4ECV A;  1Q82 C;  1FNV A;  1VCI A;  3TP5 A;  5LYJ F;  4DA2 A;  4FU0 A;  5C1O A;  3GTM A;  2EYM A;  2N88 A;  3OSP A;  1Z47 A;  3RLO A;  1B4O A;  1SE4 A;  3HOY H;  3FP9 A;  3FVQ A;  3HZX A;  2TSS A;  4CDF C;  1OXX K;  5GAH C;  1Q7Y C;  1IBL Q;  4HR7 B;  3TBI B;  3J80 c;  2VQD A;  2BOS A;  4JI4 L;  2R93 G;  1C4Q A;  4DV3 Q;  2OWO A;  1GD7 A;  2R87 A;  3KJP A;  2KUM A;  2LS0 1;  5KFC A;  5EKI A;  3GTG B;  1S68 A;  5KKN B;  5JPN C;  1I7N A;  1PRT F;  5IT9 L;  3S1R B;  1MKH A;  3HOX H;  2QEX A;  5CBA E;  3MFG A;  2X6G A;  4DV4 L;  3Q24 A;  2VQE Q;  1S03 G;  2YRW A;  1HR0 W;  1EYD A;  1PFM A;  2HDL A;  5M3M B;  3I4M G;  5C44 H;  4X65 Q;  1RJQ A;  4P74 A;  2LY7 A;  2ASD A;  2F0H A;  3OWF A;  4DV4 Q;  1HNW L;  1JQY D;  1H95 A;  1S5F D;  3G6X A;  4APV A;  1Y14 B;  4KKT A;  2FK3 A;  2RA4 A;  1TWC A;  3I4O A;  1AUV A;  1M0T A;  2B2U A;  3QOL A;  1U0L A;  4DK0 A;  4R8U B;  5KG0 A;  3UQ8 A;  3P1H A;  1O78 A;  2KBN A;  3M4O H;  1XPO A;  3M9M B;  5FD5 A;  4X62 H;  3RNU A;  4ECU A;  3UE0 A;  2JA8 B;  1X3P A;  5D8D A;  1LAC A;  4A3K G;  4DGZ A;  3T1H L;  1EEI D;  1WCM H;  1O7I A;  1CZW A;  1K8M A;  3GDE A;  2HCI A;  3STB D;  4B9X A;  4DR2 Q;  3ULJ A;  2JA6 B;  2JK8 A;  3CME A;  5KT2 A;  3GQB A;  4IO9 A;  4K8I A;  1WH2 A;  3GV7 B;  4EBC A;  1J5E H;  2Q2T A;  1EUJ A;  2D9U A;  1JE5 A;  1FJG Q;  3OSO A;  4JK1 C;  1B50 A;  3RTX A;  2QGQ A;  2YZM A;  1EY7 A;  3SGI A;  4BA2 I;  1KRT A;  1VQB A;  3MXN B;  3W3A A;  1I50 B;  4ECQ A;  2ZM6 L;  2R7Z H;  4FBU A;  1PZK D;  3ER0 A;  1BVS A;  4NXN H;  4ULL A;  5AJ3 Q;  4DF7 A;  5GAG C;  4C2M A;  3H94 A;  3VMM A;  2WB1 A;  2ZXO A;  3V6H A;  1LAB A;  4LUO A;  4A3M H;  2LXK A;  4JV5 H;  1IW7 D;  3RUP A;  4O3P A;  4CJ0 B;  2CHB D;  5AJ3 L;  4QUF A;  4M8A A;  4QCL A;  3R5X A;  1YNX A;  4JI5 Q;  4LUZ A;  2FPI B;  1MSH A;  4EYH B;  1XX8 A;  3OHX C;  1K1Q A;  3M4O B;  2LMC B;  1SMX A;  4X62 L;  1BOS A;  4FXK C;  5EOY A;  1H9S A;  1K83 A;  1KRS A;  1RJT A;  1WR2 A;  3M3Y B;  5LL6 b;  3MZ5 A;  5C4X B;  3T53 B;  3C1F A;  3HKZ A;  2VQF Q;  5T1G A;  3TZU A;  4WFN 3;  4KY6 A;  4DAY A;  2IY5 B;  4UCV A;  2WAQ E;  3BDC A;  5KFY A;  3RJ0 A;  3K81 C;  1E4F T;  2UXB L;  2EPB A;  3HOV H;  3EBE A;  4JV2 A;  4C3I B;  3AQQ A;  4RGT A;  3VYS A;  1F2M A;  1S0M A;  2ES2 A;  2ZDH A;  2XD4 A;  4YAJ B;  2ATL A;  4EEQ A;  3KDF A;  1LTT D;  1PH1 A;  4GNX A;  3L4K A;  5CC4 A;  4POG A;  1XJV A;  1GYF A;  4C1N I;  3PO3 B;  1KAB A;  2R86 A;  3WWV A;  2VQE H;  4WJW A;  2CWP A;  5LHY 1;  1N33 H;  2IMW P;  1GUO A;  2NVQ H;  5IGD A;  3K8A A;  1M0W A;  5ELE A;  1HPC A;  5KG1 A;  3BQ2 A;  2A6E D;  1VQD A;  1YEZ A;  4BY1 G;  1GO3 E;  1RKN A;  4F88 A;  4OX9 L;  2F0M A;  3CQZ A;  2IL8 A;  1STG A;  2OEO A;  1J5E L;  1TWH H;  4A3K H;  3S15 B;  1ASZ A;  1O80 A;  3BYY B;  2NUA B;  1S3O A;  1SMY D;  2HCC A;  2QEJ C;  3NQI A;  2E74 C;  2DGY A;  3HKZ B;  3NXW A;  5KNB A;  3URY A;  2K52 A;  4JI3 Q;  2EYF A;  5IGE A;  5M3F B;  3U50 C;  2G9D A;  2HHH H;  1F2L A;  5KFR A;  3OSN A;  2PI2 E;  3OPO A;  1Q8K A;  1L1O B;  2IWH A;  3OW7 A;  2EJG C;  4EGV A;  4DU9 A;  1D5X C;  1D6E C;  1SXT A;  5ELO A;  3RD4 A;  4KY7 A;  1XMO H;  3C46 A;  1V1P B;  1L0W A;  3GP7 A;  2HJW A;  4K6L A;  5IYC G;  4DV5 L;  4DL2 A;  1TY2 A;  4HJ5 A;  5C4X G;  4AYB A;  1MJE A;  1G6Z A;  2VA2 A;  3P7J A;  1I6H B;  5KG4 A;  4EG0 A;  2NZ1 D;  4F4X A;  1HNX H;  4X3S A;  4X6A H;  2DY8 A;  3EPI A;  4AIM A;  2WDT A;  2JA7 G;  1A9X A;  2CKZ B;  2A5H A;  4EQO A;  1N33 L;  4QWD A;  2KEE A;  4JI0 Q;  4A93 B;  1SEI A;  3C3L A;  5IP9 H;  4HJA A;  1I4P A;  3NWT A;  2XCL A;  1F9P A;  1BNC A;  4WBN F;  2K14 A;  2CQY A;  1TS5 A;  2WV6 D;  3HOW G;  3S1R H;  1CA6 A;  5KRU A;  4OEL B;  2PZW A;  4KN4 C;  3S14 H;  4JI5 H;  3DWA A;  5KFQ A;  4M1U B;  3NQT A;  4UP9 A;  5EBD A;  3Q23 A;  4DR3 Q;  3MR6 A;  2FPP B;  5JVG 3;  5E1F A;  4CDC C;  2Y0S E;  3MHB A;  5D3D A;  4LF5 H;  4QIW B;  2K5W A;  1T5E A;  3K5I A;  2MO0 A; 
#chains in the Genus database with same CATH homology
 1J6Q A;  3E9H A;  3JAM c;  1LYL A;  4L5T A;  4JC0 A;  1QUQ A;  3CXC A;  1HZ9 A;  2UUA L;  1WCM G;  2UUB L;  3GTL H;  4TQU S;  3PF4 A;  4YY3 L;  2E8G A;  1YHQ A;  1IBM L;  4LF7 L;  3RLF A;  1Q12 A;  4OO1 G;  4HJ7 A;  2JA5 G;  4OWX B;  4BBS G;  4K0K L;  4QY7 A;  1VQP A;  5IP7 H;  4JBM A;  2JEA I;  1PFS A;  5C3E G;  5J3B A;  5IYC H;  2RF4 A;  4B3T L;  2VUM H;  5IP7 G;  4DV6 L;  1PH4 A;  1IL2 A;  1OXS C;  2BA0 A;  1VQ8 A;  5C44 G;  4UY8 C;  3PO2 H;  4DR1 Q;  2EQS A;  1K3R A;  3I4M H;  4IOA A;  2IX1 A;  4QQB X;  4K0K Q;  4Y52 H;  2PNH A;  1XPU A;  3E9I A;  4HID A;  2JQO A;  1FVI A;  3K80 C;  2BH8 A;  1N33 Q;  4ME3 A;  2UU9 L;  3S15 H;  3PGZ A;  4GLX A;  1B8A A;  1UE7 A;  3HOU G;  5C3E H;  3PIO A;  1SLJ A;  4KHZ A;  3A5Z B;  3PIP A;  3T1Y L;  4R4C A;  1JT8 A;  1OXT A;  3S2H H;  5E7N A;  2MNA A;  4JV5 Q;  4DR6 L;  1RIP A;  1CKO A;  1EIF A;  4L5R C;  3LGJ A;  3CCV A;  1HR0 L;  1X56 A;  1CKM A;  4AQY L;  2ZJQ A;  1IZ6 A;  2F4V L;  1X3G A;  1FGU A;  3Q8D A;  3J7Z C;  1CKN B;  2B3G A;  2NN6 G;  2V1C C;  3KDF B;  4J15 A;  1X65 A;  4P71 A;  1B70 B;  4LF8 L;  4O0A A;  5FLM G;  4DUY L;  4UPA A;  1W3S A;  5ELN A;  1EIY B;  3S1Q H;  4LF9 Q;  3TRE A;  1PYB A;  4B3M L;  3A74 A;  3STB C;  4AYB E;  5HY6 A;  4P75 A;  2WAQ G;  2WFW A;  3TQY A;  4X66 Q;  1BBW A;  1VQO A;  3CMA A;  4X65 L;  4JI6 Q;  2Y0S G;  5GQO A;  4A3D H;  1ASY A;  5JJL A;  5DLQ E;  3PUW A;  4B3M Q;  1Q46 A;  4LWC A;  1E1O A;  1SN8 A;  1AE3 A;  1HZA A;  3I55 A;  3RN5 A;  3HOW H;  2K50 A;  1K83 H;  1TWF H;  4WJ4 A;  2Z6K A;  3G6E A;  2UXB Q;  4GKJ L;  5EAY A;  4AH6 A;  4A3D G;  4L5Q A;  4DK3 C;  2AMC B;  1X6O A;  5GAD C;  1N32 Q;  2R92 H;  1Q81 C;  2EXD A;  4DV6 Q;  5C4X H;  1IBL L;  3PUY A;  5IYB H;  4JI1 L;  1HZB A;  4LFC L;  4A3G G;  1EQQ A;  4JBW A;  4R4T A;  1BKB A;  2E2J H;  1X3F A;  4LW1 A;  4A3L G;  5FLM H;  1HNX Q;  1CUK A;  4A3C G;  4JI7 Q;  4A3E G;  3CC2 A;  3UDX A;  2R93 H;  4C2M H;  1MJC A;  1WI5 A;  2Q2I A;  1VQL A;  2YV5 A;  2E5L L;  2LXJ A;  3PCO B;  1VQM A;  4LFC Q;  4BY1 H;  1JJG A;  4X66 L;  4B3R L;  1I94 Q;  4LF6 L;  1PA6 A;  1C0A A;  3CC7 A;  4UP8 A;  4NXM Q;  3L0O A;  1Q1E A;  1E3P A;  1NY4 A;  1V1Q A;  3DLL A;  2UUC Q;  3JC6 6;  4UP7 A;  4YCW A;  3AEV A;  2JA8 G;  1A63 A;  3RZD H;  1R9T H;  4A3B G;  4BY7 G;  4GNX B;  4A75 A;  3H3V I;  4DR5 L;  3K0X A;  1YJN A;  4YWK A;  3I2Z A;  3KF6 A;  3U4V A;  1PH8 A;  3S1N H;  4GN3 B;  3UE1 A;  1UWV A;  2MFI A;  3M85 A;  3H0G G;  5IYB G;  5JEA G;  5IT9 c;  4JYA Q;  3PO3 H;  2FXQ A;  3KF8 B;  1N34 L;  2AKW B;  2PI2 A;  4GOP C;  4LF5 Q;  4BXX H;  1JB7 A;  2R92 G;  3PV0 A;  5JEA J;  2UXC Q;  1SRO A;  3G48 A;  1X9N A;  3S24 A;  1EFW A;  4IPD A;  4JI7 L;  4C3J H;  1GKH A;  2JA6 G;  1L1O A;  2R7F A;  1NTG A;  4A76 A;  1JMC A;  5FLX c;  2JEB I;  1VQ9 A;  2Q2H A;  1Y1V H;  4C3H H;  1EOV A;  1EQR A;  1FL0 A;  5LMU L;  4JI2 L;  5LMN Q;  2IHF A;  1QVG A;  2Z0S A;  2K75 A;  1P16 A;  4IPG A;  4GKK L;  2KCT A;  5M3M G;  2OQ0 A;  1VQN A;  4JOI A;  4R4O A;  1TWC H;  4JOI C;  5GAE C;  3CCE A;  1PHJ A;  1RL2 A;  4DV0 L;  3HOX G;  1KL9 A;  4IJL A;  3CQZ H;  3TEH B;  1XMQ Q;  1EYG A;  2YTY A;  5H1S E;  2CWA A;  2JA5 H;  4MNO A;  1XNR Q;  3F8T A;  1HJP A;  4QJF A;  1VQF A;  1SFO H;  1J5E Q;  1BBU A;  3CCS A;  3U58 A;  1I94 L;  2CCZ A;  4LF5 L;  2ASB A;  2YTX A;  2ZTE A;  3MEF A;  4YHH L;  5M3F H;  3L2P A;  4DV1 Q;  4OXP A;  1OTC A;  1YJW A;  4B3T Q;  4LF9 L;  4DR7 L;  1PH7 A;  4LFB Q;  4JI4 Q;  3BZC A;  1KQS A;  1I6H H;  4GLV B;  2GN5 A;  4PZ7 A;  4AYB G;  3VDY A;  1XNR L;  4MTN A;  4H02 A;  4A3G H;  1X3E A;  3HOU H;  2GVA A;  2N78 A;  3M3Y H;  4NXN Q;  5K36 G;  2Q2U A;  2NN6 I;  4JV5 L;  4ALP A;  2K4K A;  2K5H A;  3UDI A;  5IE8 A;  2JJQ A;  2BA1 A;  2L15 A;  4HJ8 A;  2UXD Q;  1M1K C;  4OWT B;  3GTP H;  4IFD G;  2E5L Q;  2HQL A;  4MZ9 A;  3K7U C;  4A93 H;  1YHA A;  4PG3 A;  1P8L A;  5M3M H;  2C35 B;  4B3S Q;  1YBY A;  1PYS B;  4BA2 I;  3RR5 A;  4DUY Q;  1CSQ A;  2UXD L;  1T9H A;  5IP9 G;  1XPR A;  4NXM L;  2LSS A;  3J80 i;  2RHS B;  4LF4 L;  1V9P A;  3H3V H;  1XTD A;  4YHH Q;  3ULP A;  3W5O A;  1NE3 A;  5IYD H;  1HNZ Q;  4PZ8 A;  2AWO A;  4KLK A;  1LM0 A;  3J81 i;  3CCL A;  4RMF A;  3ICE A;  1X55 A;  2KEN A;  1VQC A;  3G4S A;  5C0X I;  1X54 A;  3U4Z A;  3OW2 A;  1Y1W H;  4XTC S;  3H15 A;  4JI0 L;  2IX0 A;  4YWL A;  4LNQ A;  3CP0 A;  2OTL A;  4KI0 A;  4O2D A;  3CD6 A;  2PMZ E;  1HNW Q;  2D0O A;  3B6Y A;  4DR7 Q;  4JYA L;  4A4I A;  1WYD A;  2JA9 A;  2XGT A;  3E0E A;  3H0G H;  1NJI C;  1N34 Q;  1M90 C;  3NBH B;  2ZJP A;  3CC4 A;  3M4Q A;  1S72 A;  4RG1 A;  1CKN A;  4DKA C;  3CPF A;  4IFD I;  1N32 L;  2R7D A;  2I5M X;  4WJ3 M;  1D7Q A;  3A0J A;  1VQE A;  4GN5 A;  4YCU A;  1YHB A;  2WB1 E;  1Y1V G;  4R1J A;  1PH5 A;  4A3B H;  3GTJ H;  2AHO B;  1IXR A;  2N49 A;  4DR3 L;  1G29 1;  3AFQ A;  1YZ6 A;  1N36 L;  4JI2 Q;  3T1H Q;  2A19 A;  2KHI A;  4DNI A;  2A1A A;  4DUZ Q;  3BZK A;  1N8R C;  1HNZ L;  1FJG L;  2B63 H;  1LTL A;  2ID0 A;  1K8G A;  4BXX G;  4EQ5 A;  1XNQ L;  3ULL A;  2YU9 H;  3F1Z A;  4A3J H;  3G71 A;  2OTJ A;  5HGQ A;  2QA4 A;  4P72 A;  4X64 Q;  1IBM Q;  4LF7 Q;  3TRZ A;  2VZA A;  4POF A;  3CCR A;  4TVA B;  3GTQ H;  4BY7 H;  3HKS A;  4DK6 C;  5BR8 Q;  4DV1 L;  1Q82 C;  2JA8 H;  3PUX A;  1VCI A;  4A3F H;  1UE6 A;  4DV7 L;  2XTI A;  1WOC A;  5C4J H;  1Z47 A;  3RLO A;  1YI2 A;  1XMQ L;  2I5L X;  1GM5 A;  4GKJ Q;  3KOJ A;  5BR8 L;  3FP9 A;  5FJ8 G;  2A8V A;  3HOY H;  3GTO H;  5IWA L;  4GS3 A;  3D31 A;  4R4I A;  3KLW A;  1OXX K;  3FKI H;  2NZH A;  5GAH C;  4A3I G;  1Q7Y C;  1IBL Q;  3J80 c;  4A3F G;  4JI4 L;  4A3C H;  2R93 G;  3KYH C;  2E2I H;  4DV3 Q;  4OX9 L;  2OWO A;  1GD7 A;  2VY3 A;  5LMN W;  3KJP A;  4B3R Q;  1E7Z A;  3CAM A;  1XNQ Q;  5M3F G;  4DR4 Q;  3M9B A;  1W2B A;  3RN2 A;  1QVF A;  3I4N G;  1VQG A;  3HKZ G;  5LMN L;  2JE6 I;  1D8L A;  3J81 c;  1SE8 A;  1MKH A;  2N8N A;  3FKI G;  3HOX H;  2RCN A;  2QEX A;  4A3I H;  3PUZ A;  4A3M G;  2CQO A;  3W1G A;  4NB3 A;  3A5U A;  2JA7 H;  1E22 A;  4YY3 Q;  1IYJ B;  1JJC B;  5IYD G;  3DM3 A;  2ZTD A;  4YCV A;  2VQE Q;  4DV4 L;  1KC8 C;  2UUC L;  5M5W H;  3GTK H;  1HR0 W;  3I4M G;  2R7Z G;  4C3I H;  3NEL A;  2IHE A;  5C44 H;  4X65 Q;  4HIO A;  4P74 A;  1PVO A;  4DV4 Q;  4DV2 Q;  1S40 A;  2D62 A;  1HNW L;  3RLN A;  1H95 A;  2IT1 A;  4APV A;  1Y14 B;  2VL6 A;  2PQA A;  3D0F A;  3ERS X;  3GTG H;  4BBS H;  2WP8 J;  3I4O A;  1Z9F A;  1U0L A;  1NMG A;  2I5H A;  1PV4 A;  1IBK L;  2KBN A;  3M4O H;  1VQ6 A;  3FHW A;  2ATW A;  1UEB A;  1XPO A;  1VQI A;  3RNU A;  3HOV G;  3UE0 A;  1HR0 Q;  3W1B A;  1OXV A;  2NVY H;  2ZM6 Q;  1YJ9 A;  1Y1W G;  1U5K A;  2JA6 H;  1G6P A;  2KHJ A;  4A3K G;  4GOP B;  4IJH A;  3T1H L;  5IWA Q;  1K73 C;  1WCM H;  4HIK A;  1O7I A;  3S1M H;  2HIV A;  3GDE A;  3KF6 B;  3STB D;  3TS2 A;  4DR2 Q;  4GKK Q;  1OXU A;  3ULJ A;  4JBJ A;  1I3Q H;  2JK8 A;  3CME A;  4GNX C;  4LF6 Q;  1QZH A;  3NEM A;  3EN2 A;  1QVC A;  4IO9 A;  1KIX A;  2MQH A;  1C7Y A;  2VUM G;  2Q2T A;  1EUJ A;  4IFD J;  1JE5 A;  4DUZ L;  1FJG Q;  5M5Y H;  2RHQ B;  2QGQ A;  1K9M C;  1CSP A;  3SGI A;  4JCV E;  1UE1 A;  4Y7N H;  1TWA H;  1B7Y B;  1KRT A;  4DR1 L;  1VQB A;  3MXN B;  1YIT A;  4LFB L;  3I56 A;  4JI8 Q;  4X64 L;  2B29 A;  4PMW A;  3TS0 A;  2ZM6 L;  2R7Z H;  3ER0 A;  1BVS A;  2HHH L;  5AJ3 Q;  1KXL A;  4DV5 Q;  3K7A H;  5GAG C;  1VQ7 A;  1I50 H;  4LUO A;  4DPG A;  4A3M H;  2LXK A;  4AQY Q;  1N36 Q;  2F4V Q;  3S17 H;  4KHP L;  1Q86 C;  2HHH Q;  3HOZ H;  5AJ3 L;  1NBW A;  4L5S A;  3GTM H;  1QUQ B;  1MIU A;  4DAM A;  1YNX A;  1KD1 C;  4LUZ A;  4JI5 Q;  3I4N H;  4OO1 I;  2YTV A;  3EIV A;  3CCU A;  4LFA L;  1VQH A;  4BBR H;  1KAW A;  4DV3 L;  2ZTC A;  2DUD A;  1SMX A;  3PSI A;  4XIG S;  4X62 L;  1LUZ A;  3GO5 A;  4DAY B;  3KJO A;  4LF4 Q;  1KRS A;  3AYH B;  1A8V A;  4LUV A;  3OTO Q;  4DV0 Q;  4JI6 L;  1VS0 A;  2HIX A;  4IOC A;  1PH6 A;  4DR5 Q;  4GOP A;  1N9W A;  1XMO Q;  4OWW B;  2NVT H;  4DV2 L;  3CF5 A;  2PQA B;  1TWG H;  2AWN A;  2VQF Q;  2IY5 B;  1L2F A;  2WAQ E;  1VQ5 A;  2D0P A;  3K81 C;  1HZC A;  1AE2 A;  4YWM A;  1EWI A;  2E2H H;  2VS1 A;  3HFZ B;  3HOV H;  2UXB L;  1HH2 P;  3EBE A;  1XMO L;  2GVB A;  4QGU A;  1KHI A;  3AQQ A;  4JBK A;  4GN4 B;  2ES2 A;  3AFP A;  3KDF A;  1PH1 A;  3L7Z C;  4GNX A;  3GD7 A;  4A3J G;  4POG A;  4JI3 L;  1XJV A;  1PH3 A;  2I0Q A;  4DR4 L;  1V43 A;  3WWV A;  2B63 G;  1E24 A;  2CWP A;  3UDG A;  4OX9 Q;  5JJI A;  4OON A;  2K5V A;  3PUV A;  2NVQ H;  2BH2 A;  4EX5 A;  4BA1 I;  3KFU A;  3CCQ A;  4B3S L;  3K8A A;  4QIW E;  3ZJY C;  1A62 A;  1VQD A;  1YEZ A;  1GO3 E;  4IPH A;  4BY1 G;  1PH9 A;  1SR3 A;  1JJ2 A;  2UUA Q;  3CPW A;  2UUB Q;  2WB1 G;  4JI5 L;  1J5E L;  1TWH H;  4A3K H;  1VQK A;  5JJK A;  1DGS A;  4DR2 L;  1ASZ A;  1E1T A;  3J81 j;  1TXY A;  1S3O A;  5M5X H;  4JI8 L;  3PO3 G;  4QL5 A;  3OTO L;  1WJJ A;  2DGY A;  1Q1B A;  3CCM A;  4GLA C;  1AH9 A;  2NZO A;  1VQA A;  2K52 A;  3UDF A;  2ZJR A;  4JI3 Q;  2UXC L;  4HJ9 A;  1A0I A;  3U50 C;  3M4P A;  2VQF L;  4NXN L;  4BBR G;  2EIF A;  2CFM A;  2PI2 E;  3HOY G;  1Q8K A;  4A93 G;  3T1Y Q;  2NVX H;  1L1O B;  1SRU A;  2R6G A;  2MO1 A;  3M7N A;  4R4Q A;  4DR6 Q;  2Z6K C;  4KHP Q;  3RZO H;  5ELO A;  3JAM i;  4A3E H;  3HOZ G;  2F52 A;  1NMF A;  1L0W A;  1YVC A;  2ALY B;  5IYC G;  3NEN A;  1YIJ A;  2OQK A;  4DV5 L;  5C0X G;  4HJ5 A;  5C4X G;  1VQ4 A;  1MJE A;  3BJU A;  2VNU D;  2N3S A;  3F2B A;  1K0R A;  4A3L H;  4X6A H;  3CCJ A;  4PZ6 A;  3BU2 A;  2VQE L;  4FDB A;  4AIM A;  5IY0 A;  2JA7 G;  1GVP A;  2CKZ B;  2YYZ A;  4NPS A;  1N33 L;  3OYY A;  4JI0 Q;  4LFA Q;  2HT1 A;  1C9O A;  5IP9 H;  3CW2 C;  4HIM A;  4HJA A;  3S2D H;  4X62 Q;  4IPC A;  2KCM A;  5C0X J;  3HKZ E;  3I7F A;  4DV7 Q;  2K14 A;  1I5F A;  3S16 H;  2VW9 A;  1K8A C;  2F3I A;  3HOW G;  3S1R H;  1PH2 A;  4JG2 A;  2OCE A;  3J7A 5;  1IBK Q;  3F2D A;  5GRO A;  3S14 H;  1L1O C;  3PO2 G;  3F2C A;  4UP9 A;  1QZG A;  3IRB A;  4LF8 Q;  4DR3 Q;  1UE5 A;  4JI1 Q;  5FJ8 H;  2K5N A;  2UU9 Q;  2H5X A;  1VQJ A;  2Y0S E;  1G51 A;  1HNX L;  4P73 A;  3PF5 A;  1WFQ A;  5LMU Q;  2MO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...