4BBRG

Structure of rna polymerase ii-tfiib complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 28
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4bbrG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4bbrG01
4X6AH 2JA7H 3PO3G 4DUZQ 2R7ZH 3PGZA 4WJ4A 2ZM6L 2Y0SG 2QEXA 3I55A 3CF5A 2GN5A 1C7YA 3RLFA 4GLAC 2IX1A 1LTLA 1UE5A 4JI2Q 3M3YH 4DR5L 2UXDQ 2EIFA 3A0JA 3J81j 4LF9L 3GTPH 3M4OH 3CCMA 1UWVA 1M90C 4UY8C 5IYDH 1EIFA 4GN3B 4GOPA 4A3MH 5ELNA 3S1NH 1BBUA 1Q46A 1N9WA 3CCJA 4L5SA 3K0XA 2IY5B 1QZGA 4GNXA 1YIJA 1X3GA 1Q8KA 1X3EA 4QL5A 3T1YL 4JBMA 4JI6L 3BJUA 3UDFA 5IE8A 3S14H 1HNWL 1PFSA 1K8AC 4DUYL 4HIMA 2ZTDA 3OW2A 1K9MC 4LFBQ 3M4QA 4A3JG 1MIUA 1HZ9A 2AWOA 3FHWA 1I94L 3ERSX 5IP7H 1T9HA 4PZ7A 4JI7Q 2ZM6Q 3ZJYC 4NXNQ 2QGQA 2CQOA 2B63H 3RNUA 4IFDJ 4AYBE 4JCVE 1VQNA 4KHPL 4BY7H 2JEAI 1K3RA 4A3CH 2EXDA 5BR8Q 4A3BG 4DR4L 5GROA 2AHOB 4YY3Q 1EYGA 4C3JH 1KRTA 1IBKQ 3GTJH 1EOVA 3AFPA 1IBLL 3I4NG 2HQLA 4GKKL 4O0AA 4A3MG 4GOPC 3T1HQ 1VQAA 1FGUA 1ASZA 4A4IA 2UUBQ 2FXQA 2JK8A 1X55A 5LMUL 5C4XG 4DV5Q 1KXLA 1N36L 1VQ5A 1BVSA 2MO0A 2YYZA 3J80c 4BY1H 2UXBQ 2IT1A 3E9HA 1PA6A 2YTYA 1CKNA 1GVPA 1IZ6A 1Z47A 3J80i 1I5FA 1YVCA 4JC0A 4P74A 3AEVA 4JBWA 4JV5L 1SN8A 4DAYB 3CQZH 1OXUA 4X65L 4GOPB 1GO3E 3BZKA 1Q82C 4NB3A 2ES2A 2AKWB 4YWMA 3CD6A 2OWOA 3PO2G 3I4MG 3LGJA 5M3FG 4B3SL 1U0LA 3AFQA 1L1OA 4A3CG 3I7FA 5H1SE 4A3FH 3W5OA 2JA7G 2JQOA 3M4PA 3HOUG 3M7NA 1UE7A 2NZHA 3J81i 1M1KC 4DR1Q 5AJ3Q 4OWXB 1Y1VH 1G51A 3MEFA 3S2DH 4P75A 4DV6Q 3I4NH 2VNUD 3A5ZB 1W3SA 1L1OC 4JI0Q 1OXSC 4C2MH 4A3IG 4P72A 2BH8A 4JI6Q 2OCEA 4TQUS 3CXCA 3TQYA 1IYJB 4HJ7A 1I3QH 2UUCL 2JA8H 4GKKQ 5LMNL 4LF7Q 1P16A 4P73A 1CKMA 2HIXA 3HFZB 2CWAA 1PH8A 2UXCL 2F52A 4BY1G 4X64L 3KDFB 4Y52H 1C9OA 1SRUA 2AMCB 3L0OA 3G71A 3GO5A 2RHQB 2E8GA 3PF5A 1NE3A 1AE2A 1U5KA 1QUQB 1WCMG 3RLOA 3GD7A 5M5XH 4LFAL 2VUMG 3TEHB 4X66L 3BZCA 1B70B 5J3BA 1KIXA 4A93G 1PH7A 1A8VA 2E5LQ 5BR8L 4A3FG 1AH9A 4A3DH 3KF8B 2PNHA 3NBHB 2XTIA 4DV4Q 4AQYQ 1PHJA 1JT8A 2OQKA 4LUVA 4NXNL 2D0OA 4LUOA 3STBD 4BXXG 4BY7G 1FVIA 3IRBA 5GQOA 1EQQA 3PIOA 3HOVG 2I0QA 5C0XI 5FLXc 4LF5L 1XPOA 2K4KA 3S15H 1L1OB 1Q12A 4HIKA 2Q2TA 3T1YQ 1HNXQ 1BBWA 4IO9A 1MJCA 3CPFA 1YHAA 2NZOA 1RIPA 4L5QA 3NELA 2R92G 2R7FA 3L7ZC 5IP9H 4LF8L 1WCMH 4DKAC 3J81c 4LF7L 3S24A 3CC4A 1J5EQ 5C0XG 4DR2Q 4A93H 2XGTA 4IJLA 1VQMA 4IJHA 3B6YA 4MZ9A 3KF6B 3CMAA 4JI2L 4QIWE 3KDFA 1E1TA 3HOZH 1Q1BA 3EN2A 4JBJA 4OXPA 4RG1A 3PV0A 4J15A 4YCVA 4HIDA 2N3SA 2F3IA 3UDXA 3G6EA 1JB7A 2V1CC 1HR0Q 3TRZA 5C44H 4OX9Q 2ZTEA 5C3EG 1XMQQ 1YI2A 2KHJA 4A3LG 1XNRQ 3GTQH 1SR3A 5EAYA 3CCEA 1TWGH 1E1OA 4OWWB 1K73C 2NVXH 1N36Q 2UXBL 2JA8G 5FLMH 2IHFA 3K81C 5HY6A 1Q81C 1Q86C 2CKZB 3GTKH 3K7UC 1VQHA 1WJJA 5IYCG 4GKJL 4X64Q 3CCUA 3HOYH 4BBRG 2IHEA 4A3KH 4P71A 4YCUA 4DV0L 2WB1E 1EUJA 4JI8L 2N8NA 4DR6L 5M3MH 2JE6I 4PG3A 1QZHA 4IFDI 1K0RA 4PMWA 5JEAJ 3NEMA 1YJ9A 1GD7A 2KCMA 3EIVA 4DV6L 1CKNB 1L0WA 3UE0A 4DR7Q 3PCOB 2EQSA 2DUDA 4L5TA 3M9BA 4DR1L 2D0PA 2A19A 1IL2A 4X62Q 4POFA 3W1BA 2PI2A 1YBYA 1P8LA 2VY3A 2Z6KC 3WWVA 2HHHQ 1G291 3PIPA 4HJAA 4KLKA 4DV5L 1X56A 4XIGS 4OX9L 3PUYA 3I56A 2ZJRA 2E2JH 4LUZA 1FJGQ 1VQDA 3S1QH 1EIYB 4JV5Q 4R4QA 3RZOH 3S16H 1J5EL 1OXXK 1VQCA 1WOCA 4GN5A 4DNIA 4PZ8A 1VQKA 4GLVB 3HOYG 3HOXH 3JAMi 1NTGA 2VQEQ 2IX0A 4ALPA 2R92H 3EBEA 1XJVA 4OO1G 3S1RH 4UPAA 1XMOQ 3F2DA 1G6PA 3AYHB 2VS1A 2ZJQA 1VQ7A 2R7ZG 3STBC 3K8AA 2B3GA 1QVCA 1NMFA 1YNXA 5IY0A 2JA5H 1VQPA 1GKHA 1JJGA 4DR4Q 3PUXA 4GN4B 1PH2A 3S2HH 4DR5Q 3FP9A 1Q1EA 3G48A 2PQAA 3CCRA 3VDYA 3RZDH 1X9NA 1Q7YC 2HIVA 2YV5A 5C44G 1X65A 3J7ZC 4JI3L 5M5WH 5IYDG 4IPGA 4IOCA 4K0KL 5C3EH 2MO1A 2Q2UA 2WAQE 5IWAL 4LFBL 4DV1Q 1R9TH 4DV2Q 2K5VA 4B3TQ 1HZCA 1HNWQ 1OXVA 5GAHC 3CCVA 1RL2A 2RF4A 3PO2H 5M3FH 1S40A 4MTNA 4QY7A 4AH6A 1NBWA 1LYLA 4LWCA 2E2IH 2BA1A 2NN6I 1UEBA 3U4ZA 2NVTH 1AE3A 2JEBI 2UXDL 3I2ZA 2JA5G 4DUZL 4HJ9A 1VQIA 1YHBA 2VL6A 1HZBA 1Z9FA 1KD1C 2UUAQ 4LF5Q 4AIMA 2NN6G 1A0IA 3NENA 2UUCQ 2BA0A 2ZTCA 1N34L 4L5RC 4BBSH 3KF6A 4OONA 4X62L 4RMFA 1VS0A 5LMNW 3AQQA 4ME3A 4APVA 2ALYB 2MFIA 4LFCQ 3HOWH 1DGSA 3F2CA 2VQFL 4JYAL 5K36G 4JOIA 4JI5L 5FJ8G 4HJ5A 2NVYH 3H3VH 1MKHA 2WP8J 2WFWA 2Y0SE 4DPGA 3HKZG 5IP7G 3U4VA 3ULLA 4LF6L 5JJKA 1VQBA 2JA9A 4X66Q 1IBML 1JJ2A 2D62A 4NPSA 2B63G 4GS3A 4XTCS 3S17H 1OTCA 3PUVA 4MNOA 3U58A 1YJNA 4X65Q 3SGIA 3CCSA 4A3BH 2QA4A 2K14A 4GKJQ 4DAMA 5IYBH 4LW1A 2VQEL 4R4OA 3FKIG 3PSIA 3TS0A 1QVFA 4JOIC 4BXXH 3E9IA 5AJ3L 3ER0A 4C3IH 1YHQA 1ASYA 4POGA 1TWCH 3HOVH 3KJOA 1JE5A 2CCZA 1IBKL 3S1MH 3E0EA 4IPDA 4YY3L 1WFQA 3F8TA 1X54A 1N8RC 3T1HL 2RCNA 4YCWA 1K8GA 4JYAQ 3K7AH 3JAMc 1PH9A 4OO1I 3BU2A 5JEAG 4LFCL 1I6HH 4C3HH 1S3OA 5M5YH 1TXYA 1KQSA 1HR0W 1VQFA 4O2DA 5IP9G 1WI5A 4DV3Q 3PF4A 4AYBG 4H02A 5LMUQ 3RLNA 5IT9c 4PZ6A 4KHPQ 2H5XA 3DLLA 4DUYQ 1EQRA 2KCTA 1KC8C 5E7NA 4A3JH 4R4CA 1BKBA 2AWNA 2JA6G 4DR2L 2K5HA 1B7YB 1KL9A 1TWFH 1SFOH 4UP8A 2E2HH 4DV0Q 3HOUH 4IOAA 3HKSA 5IYBG 4JG2A 2VUMH 1Y1VG 2K5NA 3FKIH 3H3VI 4A3GH 1IBLQ 4IPHA 1VQ4A 1X6OA 3ICEA 3RN5A 2LSSA 4JI4L 3UDGA 4LF4Q 1XPUA 4DK3C 4A3IH 2C35B 1Y1WH 1HNZQ 1VQ8A 3CC7A 5GAEC 4TVAB 1S72A 1HR0L 1PH4A 4KHZA 1EWIA 1SLJA 2R6GA 2WAQG 4YHHQ 5C0XJ 3ULPA 1VQ6A 1PH3A 2I5LX 1N34Q 1UE6A 2PMZE 4JI1L 3TREA 3GTMH 1OXTA 2N78A 3KFUA 4BBSG 2Z0SA 3CCLA 4LNQA 4DV7L 1XNQQ 2VQFQ 4BA2I 1NY4A 4DR3L 4DR3Q 5C4XH 3D0FA 5IYCH 1XNQL 3HOWG 2BH2A 1E7ZA 3RR5A 3CC2A 4YWLA 1E3PA 5FJ8H 3TS2A 2PQAB 1I94Q 1PYSB 2JJQA 2YTXA 3CAMA 4LF8Q 2L15A 1H95A 1YZ6A 1EFWA 1NMGA 1A63A 3I4OA 4DV4L 4AQYL 4UP9A 1CSQA 1MJEA 4A3GG 3KYHC 1CSPA 1VQOA 3I4MH 5JJIA 4LF9Q 4HIOA 4UP7A 4WJ3M 2CFMA 2E5LL 1IXRA 4GNXC 4QGUA 2R93H 1VCIA 1GM5A 3H15A 4GNXB 1E22A 3MXNB 4A3EH 3CP0A 3GTGH 2K50A 2YTVA 3OYYA 1PVOA 1XTDA 5LMNQ 1D7QA 1SMXA 1HNZL 4JI3Q 4JBKA 3GTOH 3K80C 4NXML 4JI4Q 1JMCA 3CPWA 4LF4L 4IPCA 3CMEA 1FJGL 1WYDA 4DV2L 5GADC 5DLQE 2UXCQ 4IFDG 3A5UA 3KLWA 3HKZE 2LXJA 1I50H 3M85A 3GDEA 4JI1Q 4K0KQ 2HHHL 2RHSB 4YHHL 2LXKA 2ID0A 1N33Q 4EX5A 2OTJA 1PH1A 2I5MX 1O7IA 4LFAQ 2UU9Q 5FLMG 4DV7Q 4A76A 1TWHH 2VZAA 3F2BA 3HOZG 2I5HA 3G4SA 3PUWA 2JA6H 1LM0A 1NJIC 1LUZA 4A3KG 3PUZA 3RN2A 2NVQH 1B8AA 4A3DG 1C0AA 4B3MQ 3W1GA 4A3EG 4DR7L 5M3MG 2MQHA 3UE1A 3OTOL 1PV4A 2Q2IA 2VW9A 1XMOL 2YU9H 2F4VL 1N32Q 1SROA 2N49A 3CW2C 4QQBX 4A3LH 1K83H 4JI0L 3H0GH 3F1ZA 2OTLA 2Z6KA 3U50C 3KOJA 3OTOQ 4BA1I 1HJPA 1TWAH 4KI0A 5ELOA 1PYBA 1D8LA 1V43A 1V9PA 2GVAA 5C4JH 2CWPA 1A62A 5HGQA 3L2PA 2PI2E 3GTLH 1W2BA 1KHIA 2ZJPA 1XNRL 4R4IA 4B3RQ 2GVBA 1VQJA 3A74A 4OWTB 2MNAA 4A75A 4DV3L 3JC66 4BBRH 2KENA 4B3RL 4R4TA 1L2FA 2UU9L 5GAGC 1YJWA 1XPRA 1IBMQ 2KBNA 1N33L 1VQGA 3DM3A 1CUKA 2OQ0A 1PH6A 2ASBA 2ATWA 2HT1A 4B3SQ 1Y14B 3UDIA 1CKOA 3PO3H 3HOXG 4GLXA 4HJ8A 1UE1A 1HH2P 2KHIA 1VQ9A 5JJLA 1KAWA 4JI7L 2K52A 1KRSA 2F4VQ 3J7A5 3Q8DA 4JI8Q 4DR6Q 1N32L 4B3ML 1X3FA 3H0GG 1VQLA 4YWKA 1SE8A 3CCQA 1PH5A 2R93G 1QUQA 2K75A 2UUAL 1J6QA 1YITA 2UUBL 2Q2HA 1QVGA 1E24A 4NXMQ 3D31A 1XMQL 4QJFA 4JI5Q 1HNXL 2A1AA 1FL0A 2A8VA 3ULJA 1HZAA 4DK6C 4LF6Q 4DV1L 1V1QA 2WB1G 5IWAQ 1YEZA 4R1JA 4EQ5A 4Y7NH 4FDBA 1JJCB 3KJPA 2DGYA 1Y1WG 2R7DA 1VQEA 4B3TL 2B29A
chains in the Genus database with same CATH superfamily
4X6AH 5I2YA 5J39A 4UDUC 2R7ZH 4WJ4A 2ZM6L 3QFFA 1EZ1A 1IBLH 2ZXPA 1K83A 1VBGA 5KT6A 3RAXA 5KFVA 1UE5A 1U9RA 4FF3A 4DR5L 2KEEA 4F8MA 2UXDQ 2EIFA 3J81j 1LTBD 3GTPH 3IFDA 5IYDH 1UWVA 1M90C 5IT9W 3M4OB 4GN3B 4DAYA 3PIP3 1PYWD 3S1NH 1JDEA 1KNAA 1Q46A 1G91A 2R6FA 4RB1A 1YIJA 1I50A 4QWDA 1X3GA 3MXNA 5NUCA 4JI6L 4DLKA 4Q0YA 5IE8A 1HNWL 3S14H 4HIMA 1LTAD 2E2HB 4DV6H 5EKLA 1EHIA 4EBDA 4HCSA 1GUNA 2WIIB 1ENAA 3GTKA 1T9HA 4PZ7A 4JI7Q 2ZM6Q 2F0NA 3ZJYC 2E2DC 4S3SA 2QGQA 3HG9A 4Y7NB 4HSVA 1B50A 1AW7A 4BY7H 2VA3A 2JEAI 3BJYA 3URYA 2R8IA 1E2VA 3R8BA 2XVSA 3I90A 4GKJH 4YY3Q 1EYGA 1C30A 3T5JA 1KRTA 2B2YC 3PIO3 2Z1CA 4ED3A 5C5JA 3GTJH 1EOVA 2JXMB 1IBLL 2CZGA 3I4NG 4F4ZA 2L0CA 4O0AA 1XX8A 1SEIA 3T1HQ 1VQAA 3P1HA 3SDZA 1ASZA 1GUTA 3GIMA 3UQ8A 1HFNA 2NUCA 1E2ZA 1VF5C 4MV1A 2UXBQ 1VF7A 3V05A 3E9HA 1PA6A 2YTYA 1GVPA 4JC0A 3JAMW 4NKLA 1GUWA 2L1BA 5D3IB 4YWMA 3PO2G 4PMCA 1K1QA 5EWGA 1Y8PB 3K0YA 4RGTA 5H1SE 4A3FH 1AUVA 3MR2A 3M4PA 3HOUG 2JA8B 2B8GA 1M1KC 4FVMA 4RUAA 2XSCA 4OWXB 4K14A 3S2DH 2PW7A 2K33A 4P75A 4RCOA 1W3SA 4JI0Q 1L0YB 4MTEA 2LY7A 4OIJA 3NBIA 2B2TA 2BH8A 2JSOA 4X3KA 2OCEA 4HJ7A 3TQYA 1IYJB 4GKKQ 2JA8H 2HVQA 4NDXA 2HIXA 1PH8A 2CWAA 2UXCL 2F52A 1JB3A 4BY1G 1WTQA 4TRDA 1SRUA 3L0OA 3NWSA 1ULZA 2RHQB 1AE2A 1U5KA 1QUQB 3KAKA 5DQIA 2NUAB 4J0MA 1QOHA 1VAJA 3GQCA 3ONAB 4ZUJA 2RDGA 4RGNA 1A8VA 4OHJA 4CDFC 4XQNA 2RDIA 5LHY1 1HCZA 2XTIA 2EY1A 3JAML 4DV4Q 1CE8A 4JK1C 1PHJA 4K2LA 2FKLA 2OQKA 4LUVA 3STBD 4BXXG 4DL5A 1B4OA 1EQVA 3A8IE 3I70A 4EVOA 5D65A 5LL6S 2KUMA 3VPCA 4HIKA 2XGQA 1JOQA 2ASJA 3D4WA 1EYAA 4IO9A 2ALZA 1IOWA 4HEDA 5AFWA 2FINB 4TUYF 4L5QA 2R92G 1MD2D 5IP9H 4LF8L 5J2TF 1X3PA 4LF7L 1SNDA 2F1MA 2RBMA 2FPGB 1BR9A 3EJIA 4RHRA 1J9OA 5C0XG 4IJLA 2WKDA 3MWYW 4IJHA 3C1EA 2XN9C 5EGTA 2YW2A 5KG7A 3HOZH 4H13C 3EN2A 1UC9A 4OXPA 3T5KA 4IHJF 2ICIA 3RB4A 4C1NI 3BDCA 1K8OA 5KT5A 1JB7A 3T13A 2V1CC 2NB0A 5FKAC 4A3LG 2KHJA 3HP3A 3WOFA 1PZID 4O3PA 1Y1WA 5EAYA 2NVQB 2RCFA 3BQ1A 3TQTA 2UXBL 2JA8G 4XT3B 5IGFA 5HY6A 4BWGB 5KNCA 1Q81C 5L1LA 2BOSA 1VQHA 4HR7B 5IYCG 4MAMA 3KXYT 1QNUA 4ECRA 3FEWX 5CV5A 3I12A 4XYOA 3IKJA 4A3KH 4P71A 1N36H 3R3OA 5L9XA 4DV0L 4JI8L 3R2IA 4XYQA 4PG3A 5M3MH 2PMZB 5KFYA 3J80W 3PW2A 3D3RA 2RDFA 4CJ1B 3Q8PB 1DONA 3JZIA 3M3YB 1H9KA 3EIVA 5KG5A 4DR7Q 5M5WB 3M9BA 3MXUA 3E3XA 2D0PA 4G4KA 1SEBD 4JI7H 5K36H 4X3TA 2I80A 1TWAA 3NE5B 2R7LA 3QOLA 2R87A 4OX9L 3PUYA 3DUZA 4BY7B 4LUZA 4R4QA 3LWBA 2QYZA 4Q0FA 4DL6A 4R7RA 1VQCA 5CGKA 1W6KA 4O3QA 4XYLB 1KTKA 1NTGA 2IW3A 4Z9CB 2D9UA 4ALPA 2R85A 2JA7A 3EBEA 1XJVA 2KA7A 1Y1WB 1TVXA 2HD3A 3OIQA 3T56B 3VYRA 2J4XA 2B3GA 2JA5H 4PV1C 1GKHA 4DR4Q 4GN4B 2XGPA 2ZJTA 3S2HH 1L0XB 4C5CA 2NN6H 2O2LD 3RZDH 4MV7A 2B2UC 2RGRA 5C44G 1X65A 5COYA 5KG1A 4ECZA 5FPOA 5EWFA 2MO1A 2Q2UA 1MGSA 1R9TH 5DQGA 1S97A 3TSSA 4B3TQ 2EYLA 5BR8H 3HOYB 1NUCA 1S68A 1JOKA 1TWAB 3QIAA 3T4AC 1DV1A 4M7EA 1F77A 1S40A 3J80L 1WTRA 3I72A 4TSSA 2FJZA 1DM0B 1LYLA 2EYMA 2E2IH 1XXGA 2NN6I 1KJ9A 1Y1VB 2NVTH 3OIPA 4F87A 4HJ9A 2VL6A 3KHLA 1Z9FA 2YZMA 4OGQC 4UAIA 5IGGA 2V4RA 2UUCQ 1N34L 4BBSH 4FS1A 2E5LH 4OONA 4RMFA 1QWYA 4ME3A 4EQNA 4X66H 3F2CA 4KV6A 2IL8A 3OMGA 5KYLA 3A8KE 1PTOH 2K05A 5K36G 3ETJA 5KG4A 4HJ5A 3H3VH 3FDSA 2WP8J 3MWDA 2WFWA 3V2TA 4G3IA 4IWYA 1GHKA 4CJ0B 1DZ1A 5CMDA 4O3SA 2A68C 1GSHA 2D62A 4NXNH 2B63G 1WH2A 3SR1A 3OWEB 3PUVA 5CYUA 1JQYD 1YJNA 3NGDA 3S2HB 1HA6A 2XWJB 4LW1A 4C3JG 3TS0A 4FO2A 3VPBA 4ZK9B 2CW0C 4IUNA 5CC4A 2YZNA 5AJ3L 3ER0A 5M3MB 4C3HB 1ASYA 3GIKA 4IRKA 4POGA 1TQOA 4EGQA 2EJFC 2JA6A 1IBKL 3E0EA 2C22A 3T1HL 1CQVA 2RCNA 4YCWA 2W6ZA 4LJZC 1K8GA 1ILPA 2V4QA 4LFCL 4C3HH 4YY3H 1SYDA 1WCMB 4FF1A 2XC9A 3GILA 2BQUA 1JCKB 3VA5A 4DV3Q 2F0GA 2KSWA 4K6LA 4DV0H 3LWEA 5LMUQ 1FKAH 3DLLA 5E3FA 3GIIA 3V6JA 2JA6G 4CJ2C 1M0WA 2AWNA 2XRQD 2ZXOA 4DR2L 1B7YB 1TWFH 4DV0Q 4FF2A 4ABNA 4IOAA 2UXBH 4DR1H 5L1JA 4UCVA 4TV8F 4A3GH 1RJQA 3RMHA 5D1PA 2TSSA 2I07B 3RN5A 1I7NA 5D14A 3GTMA 1VQ8A 1ML0D 1TWFB 5G3LD 5KNBA 1KJ8A 1HR0L 4FXKC 4DV7H 1EY6A 4KHZA 1CI3M 2WAQG 4YHHQ 4HQ6A 1N34Q 1UE6A 3GTMH 1OXTA 1CK1A 3KFUA 4BBSG 3TQ1A 2M2LA 1XNQQ 1FYCA 1XWEA 1D2BA 2R8GA 5C4XH 4QWAA 1UAPA 5FLXW 2B2WA 4G57A 2A68D 2YTXA 4ME5A 3S1NB 2DZDA 3BABA 3ORQA 4JYAH 2W71A 1SYXB 2DY8A 3EPIA 1BXTA 3H09A 4YR0A 2B2WC 4DN4M 2R93B 5JUMA 1IXRA 1LABA 3ND8A 4GNXC 1GM5A 1STNA 5HURA 2I46A 3MXNB 1UUPA 3CP0A 5CB4F 3G7LA 5DLGA 2SNSA 1H9JA 3PMFA 5DG9A 3T1YH 3L4JA 4JI4Q 4LF4L 4EEYA 1VMPA 4IPCA 3CMEA 2E74C 5DLQE 5DGAA 2EJMA 4MHEA 5CR3A 3A5UA 1GJXA 2LXJA 3J7AV 2Y0SB 2HHHL 4YJ3F 1N33Q 4EX5A 2OTJA 4JI8H 4LFAQ 2R84A 4YJ2F 1AN7A 3Q22A 3F2BA 2I5HA 1ZXTA 4DK0A 3MR5A 2MP1A 4IRDA 5C5LA 1LUZA 3PUZA 2NVQH 1B8AA 4YAJB 5KFNA 1KAAA 1U4RA 1BCPC 4B3MQ 2YU9H 2MQHA 2Q2IA 2VW9A 1I4XA 1SAPA 1XMOL 3VYSA 1SROA 2N49A 1RODA 3H0GH 4XXEA 2K7VA 1ENFA 3OTOQ 4BA1I 2DY7A 1TWAH 2VA2A 2JA5B 2GVAA 4HCEA 1EY9A 3GV5B 2WAQA 1KHIA 4R4IA 2NVTB 5KFTA 4OWTB 3A74A 4DV3L 1D5MC 1FJGH 2E2IA 1L2FA 2NYZD 2UU9L 2UUCH 2UXDH 3KHRA 2OQ0A 3CQZA 1PH6A 1T36A 3E0JA 4YR3A 3UDIA 2GPWA 2A69D 1A2UA 3PO3H 4DL4A 5KFCA 2XIWA 3P7JA 2EY5A 3C1FA 4MN3A 1HH2P 1DJRD 4ZYSA 2F0TA 3DF7A 1LT3D 2K52A 1TS5A 1SE8A 1R4PB 1PH5A 2R93G 1QUQA 2K75A 3FVQA 2R7KA 1HNWH 5ELFA 5A35A 1QVGA 1O7LA 4NXMQ 5KYIA 4JV5H 3N42B 4QCLA 3GTJA 1PZJD 3M7GA 1TWGA 1CS0A 2A8VA 2W70A 5JAVA 4DK6C 1CHPD 4LF6Q 4NMZA 5IWAQ 3GTMB 4X62H 4YIJA 2Z9HA 1JJCB 4FDBA 2DGYA 3RTXA 2J9GA 1XMOH 3J7YW 5LXTF 2JA7H 5IWAH 3GV8B 2WAQB 2Y0SG 4RNNA 2B2VA 2QEXA 3FMAA 1RTOA 1B9MA 5KFPA 4RKBA 2GN5A 3LX0A 4LH7A 2L4NA 2IX1A 1LTLA 2A6HC 5CV7A 5EPKA 4FU0A 3SVMA 1IL8A 3VYUA 1YNJD 2NTSA 5JPMC 4QF4A 3CCMA 2RA4A 5ELCA 4J9MA 4YR2A 4ECYA 4XX0B 1BBUA 2MGSA 1I6VC 4UCRA 1HTPA 3MFGA 4LF4H 1Q8KA 4QL5A 5M9OA 3T1YL 4CC6A 4TQRA 1O7ZA 3BJUA 4KHVA 3UDFA 2NZ1D 2ZM6H 4IAJA 1S5FD 4DUYL 1I3QA 2VQDA 4LFBQ 5F9NA 3CU7A 4A3JG 1KLUD 4X3SA 2R7MA 3DM1A 5D8DA 2A69C 2CQOA 2K5WA 3RNUA 4BWSC 4JCVE 2HUGA 3ZYYX 2EY6A 2FP4B 2EYOA 3EA6A 3MTSA 4O1NA 3E5NA 2EXDA 5GROA 2AHOB 1XMQH 3HRZC 3X3NA 4C3JH 2FK3A 5C3WA 1Z7TA 2L5TA 4J8QA 1DOMA 4A3MG 5EPLA 1FGUA 1Z2PX 4A4IA 3NTIA 5DM63 4XZ3B 5G3LF 2X6GA 3CKIB 2C2EA 1VQ5A 1BVSA 3J80c 4BY1H 2PQEA 2IT1A 3ND9A 5JVH3 4MTDA 3T16A 1IZ6A 1Z47A 2UVVA 1YVCA 4P74A 3NQTA 4JBWA 5CA1F 1SN8A 4RGOS 1OXUA 3CQZH 4X65L 1Q82C 4LFCH 2F4VH 4B08A 4NB3A 2OWOA 1BXRA 3NTKA 4B3SL 2XWBB 1U0LA 4B3MH 4A3CG 3K6OA 3W5OA 2JA7G 2JQOA 2NBFA 3X3MA 2YRXA 1G51A 4EEQA 3K5NA 2MUYA 4R8UA 5L1IA 1KJJA 2VNUD 4JVZA 4EBCA 2CQAA 5C44B 1EIHA 4WFN3 4A3IG 1PDQA 4DAPA 4JI6Q 3VR2A 3CXCA 4TQUS 4DR5H 2R86A 2RVLA 4KY6A 1P16A 4P73A 1CKMA 3SXHA 3HFZB 3TZDA 1KC7A 4A3GB 2HVSA 3KDFB 1JWSD 3GIPA 3S14B 4XDXA 3GO5A 4A3DB 4R8IA 1IBKH 2ASLA 4U68A 4J9RA 4M9UA 4RA8A 3RLOA 4KK7A 4LFAL 1KDCA 4X66L 1JDBB 2F0OA 1KIXA 4A93G 2X0SA 1PH7A 3OOCA 3TMEA 2E5LQ 3HOVB 3Q8SB 4A3DH 2V4DA 2PNHA 4KTAA 3GV3A 3R5FA 1JT8A 5A2QW 4NXNL 3W2DA 4QWEA 3RGZA 3IRBA 4CBVA 4K0KH 5GQOA 1AN8A 4X64H 5C4JB 2I0QA 4MIUA 4N9PA 4ZOLF 3L3OC 5KEEA 5JJZA 1DOKA 1B1ZA 5T1IA 2Q2TA 1HNXQ 2LMCB 2L11A 5JEAH 5T1GA 3PW5A 1MJCA 3CPFA 1C48A 3RF2A 1R9TA 3RZOB 3NELA 2MJ8A 4IR1A 3J81c 2W57A 4RFBA 3G6JB 1S4ZA 2VPQA 4DR2Q 2XGTA 3GIJA 3A55A 2A74C 2AGPA 1XNQH 4JI2L 4MZ9A 3KF6B 3K57A 1EZ8A 4DR3H 3TN2A 3QG1A 2F0SA 3KDFA 1E1TA 2XIGA 1Q1BA 4JBJA 3MXGA 3PV0A 4KY5A 5KRUA 2V9WA 1QG7A 4FBUA 2EDGA 1N56A 4IURA 1DIKA 3GTOA 4WORA 5EJWA 1XNRQ 4QW9A 1TWCA 4QIWB 3CCEA 1TWGH 1EU3A 3E5SA 1K73C 2NVXH 2B29A 1N36Q 3NPPA 3K81C 3J7AK 2CKZB 5F9LA 1VMCA 2XNAC 1SXTA 3MA2B 4DR4H 2A6ED 3RZDB 3CCUA 4FXDA 2IHEA 4V0BA 1SYFA 2FLLA 3VMMA 3BQ2A 4IUQA 4DR6L 2PVPA 1M0TA 1QZHA 3QB3A 2W8LA 1R9TB 4PMWA 3NEMA 1GD7A 2KCMA 1G2SA 3ETHA 1CKNB 4IUPA 1L0WA 1LTSD 2IP4A 2XCLA 4DV2H 4L5TA 4DAVA 1EYZA 3BG5A 1IL2A 3W1BA 2F0KA 1LTGD 2Z6KC 3WWVA 4HJAA 3OMCA 4KLKA 1X56A 3T5LA 4H0LC 3S2DB 4EFBA 2KJXA 1IKMA 1VQDA 3NK9A 4H44C 5ELBA 1J5EL 1Y1VA 1B3QA 1OXXK 1SJED 3RB0A 1WOCA 4DNIA 1HPCA 2L9HA 5JH7F 1YNND 2AUJD 4B3SH 1VQKA 2HVRA 2VQEQ 3GTOB 1H9RA 4OO1G 4QWBA 5LL6X 3F2DA 1G6PA 2C9OA 4ZRZA 2ZJQA 3F2UA 1VQ7A 2F0UA 1W96A 1QVCA 4JI1H 5IY0A 4MV8A 3A54A 3QJYA 2W9BB 2VUMA 5K2MA 1F2LA 4ECUA 4P2CB 2F0QA 4DR5Q 2PQAA 1SNPA 4EQOA 3VDYA 2I87A 2F0EA 5M5WH 4K0KL 1M7JA 3IL8A 1SNCA 3I4LA 2PBZA 2R7NA 4FYDA 4LFBL 3QR8A 1KJQA 2EYJA 1ZEQX 1HZCA 2W9AA 3CCVA 3PO2B 1GYFA 2L12A 2WB1A 4DV1H 2EVBA 1U4MA 3G8CA 4MTNA 4QY7A 4AH6A 5E4WC 1BCPF 1NBWA 1S0NA 2BA1A 1UEBA 3EVQA 3U4ZA 2W6PA 4RB0A 2JA5G 2UUBH 3S1QB 1XYIA 2JP1A 4KKSA 1KD1C 3HOUB 1TR5A 4AIMA 1NAPA 3NENA 2BA0A 3HOXB 1F9PA 4X62L 5LMNW 1Q8IA 2VB3X 4ECVA 1DGSA 2VQFL 1GUSA 3BVGA 3MXPA 4JOIA 4CDCC 1IHZA 4CKEA 3HKZG 5BN5A 5IP7G 3U4VA 4RGMA 3ULLA 3Q0AA 4LF6L 1IBML 1L2ZA 1JJ2A 5FD6A 3IG0A 2A73B 1BNCA 4XTCS 2PZWA 3U58A 4MNOA 1LT4D 3RIZA 3SGIA 1JWUD 1RD9D 1AZPA 4GKJQ 1V51A 4ETSA 4R4OA 1DOLA 2QK4A 1ESFA 1YHQA 1RHPA 4R9WA 3HOVH 4C1NK 1JE5A 1V1OA 2B2VC 3S1MH 1NCVA 2HCCA 3M9NB 1N8RC 1MBYA 1B6RA 4DV3H 4JYAQ 3K7AH 4F4WA 3BU2A 4J9PA 1O75A 2Q8TA 2W6MA 1S3OA 5M5YH 1TXYA 1KQSA 3EQLC 4JW0A 3KLSX 5IP9G 2ICEC 4F7XA 3NSWA 1S10A 3RLNA 4PZ6A 4RAUC 5CV4A 2H5XA 1J8IA 4LAAA 1EQRA 1STYA 2JEGA 5E7NA 1BKBA 5KFSA 3KHGA 1KL9A 1SFOH 4UP8A 2E2HH 3HOUH 3HKSA 5IYBG 4J9KA 2E75C 1SMYD 4DUYH 1TWGB 1CA5A 1CZWA 3IN5A 5KT4A 1XDNA 1X6OA 5J22A 3ICEA 2R7ZA 4JI4L 4LF4Q 2Y0SA 3NHHA 1Y1WH 1HNZQ 1JE4A 1S0OA 1GHJA 1SFOB 5JOBA 2JA7B 4JI5H 4TVAB 1S72A 1PH4A 1YNJC 1Z2OX 5DM73 1SLJA 3I8ZA 5C0XJ 1KBLA 3D4RA 1KABA 2HDMA 4DXFA 1PH3A 2VB2X 3TREA 2DN8A 5KKNB 4YB8B 3PR4A 4ED8A 1PTOB 3PVXA 1NNXA 5ISRA 3HOWG 2BH2A 3JRXA 2JA6B 4HMJA 4YWLA 2PQAB 4M1UB 1TY2A 1PYSB 1SE3A 4LF8Q 2L15A 1H95A 4L63B 3VA7A 1EFWA 1TS2A 1A63A 3I4OA 2RGVA 4UP9A 4A3GG 5JJIA 1PTOD 3I4MH 4LF9Q 1LTRD 4QUCA 4UP7A 4WJ3M 2CFMA 1S5ED 1VCIA 5EPJA 1QNKA 1WR2A 4IRCA 3HZXA 5IT9E 2G9DA 3OYYA 1XTDA 1GSAA 4QUFA 1B33N 3RV4A 5BMVF 1TY0A 4C2MA 4O42A 3GTOH 3SK4A 3A8JE 3CPWA 1FJGL 1SSOA 5GADC 1XTCD 1GUGA 2N88A 2A5HA 3HKZE 2VUGA 4JI1Q 3TP8A 3IFTA 3HB9A 5KFLA 3RB6A 2L55A 1LLRD 1BNZA 4FP5D 1SFOA 4YP3A 2K01A 4FXGC 5FLXE 5D1OB 1II3A 4U7CA 4O4HF 3HOZG 5KFUA 4HMIA 4RH6A 2NTTA 1D1IA 2UU9H 1B9NA 3LNNA 1CQJB 2NVYA 4A3EG 3GV7B 1SNMA 1A2TA 1VDZA 4OEMB 1S03G 1DCZA 3O13A 4QQBX 3VR4A 2PNRC 4DR2H 4JI0L 1A3TA 4K5XA 4KI0A 1Y1WG 1PYBA 3L2PA 1Q7YC 5LMUH 1E4EA 5HGQA 1EU4A 2PI2E 4UHVA 3GTLH 1IOVA 4K5WA 4OELB 3DEOA 5DEHA 1WTHA 2C00A 3G6YA 4MV9A 4BBRH 2KENA 3I3CA 5LMNH 3T1HH 4GC7A 3OUZA 3BYTB 3DM3A 1CUKA 2RDHA 2ASBA 2ATWA 2NU9B 1Y14B 1TAEA 4KY7A 1PXUA 2OEOA 4TQSA 1PTOC 5I47A 4F88A 4V190 1UE1A 1OO9B 5DQHA 5C5MA 1NR4A 1GLVA 4EBEA 1KAWA 1KRSA 1QE6A 3Q8DA 3GV6A 4DR6Q 2OLSA 1X3FA 3HOZB 3H0GG 2WDTA 2F0VA 1I3QB 2R61A 3BS1A 2UUAL 4QWCA 3VR6A 1J6QA 1ESRA 2UUBL 1RJPA 2Q2HA 4YBZB 3D31A 1RK5A 3GTKB 1FL0A 5DG8A 1JOOA 4GZYC 3FPPA 2NVYB 5BN4A 1S9FA 4DV1L 2V59A 1V1QA 2WB1G 2YZGA 3A7AB 2B63B 4J9NA 3KJPA 3V4ZA 5KFHA 2DPJA 2R7DA 1VQEA 5J1ZA 3JRWA 5CV8A 4B3TL 2EYFA 1Q90A 4KKTA 3PO3G 1KEEA 4DUZQ 3N6RA 3PGZA 1EWHA 3PR5B 3I91A 3CF5A 4C3IG 1Y69U 1C7YA 2YU9B 1JORA 4GLAC 3WO1A 2E2IB 3M3YH 1MSGA 4KHPH 3N52A 4RNMA 4LF9L 1Y8NB 3A0JA 3CQZB 3S9WA 3M4OH 4YHHH 4GC6A 1JIHA 1LT5D 3D6CA 1EIFA 3EROA 3GTPB 1ZHSA 4IUUA 2HJWA 2YS6A 2E76C 4A3MH 3CCJA 1N9WA 1O7YA 1TS3A 4JUZA 3K0XA 1Q3LA 1QZGA 2KHSA 1LV9A 1BCPB 2FMMA 3TZUA 4JBMA 1JC7A 5JVG3 1HNZH 1PFSA 2BE5D 1K8AC 2O4XA 1BGWA 3CHBD 2Q8RE 2F0JA 5KG6A 3FHWA 2RSOA 1I94L 3LP8A 3K5HA 5IP7H 2EZVA 2IBKA 1D1KA 2X6LA 4OO1H 5EBDA 4LF9H 4NXNQ 4AYBE 1VQNA 4KHPL 3Q8RB 4QIWA 1K3RA 4A3CH 3H20A 5FO7B 5KGUA 5BR8Q 4BS9A 4DR4L 1CM9A 3GTLA 3J81W 4JPBW 4WD3A 4ED1A 4EFEA 3AFPA 1E0BA 1KDAA 2HQLA 2H1EA 4ZAIA 1KNEA 3MAQA 2WTFA 4GKKL 1PFNA 3OSOA 2EY2A 2UUBQ 2FXQA 3PZPA 2JK8A 1DD2A 1S5BD 1EIGA 5KFFA 5C4XG 1KXLA 4DV5Q 5JVDF 2Z4HA 2MO0A 4LFAH 2IWHA 3DEPA 1CKNA 2OH2A 3NP8A 4I4TF 1EOTA 2QF7A 4MTKA 3AEVA 3RJ0A 1DV2A 3BA9A 3GTPA 1F9QA 1SE2A 4DAYB 4L5RC 4U673 3BZKA 2DJGC 4BBRB 3C46A 4TV9F 4O2AF 2PZTA 3LGJA 5M3FG 5KX5F 3AFQA 1L1OA 3EYYA 3I7FA 4IZ8A 4A3FB 3J81i 4DR1Q 1Y1VH 2AUKA 3JSLA 5HBRB 2E2HA 3OHAA 3A5ZB 4JV0A 1L1OC 1OXSC 4KJOA 4FM9A 4C2MH 4UCOA 1I94H 2PZUA 4G7OC 1I3QH 1CT1D 5LMNL 1UNSA 1G6ZA 1TS4A 4KKUA 4X64L 5KFRA 1M4VA 3ITPA 3SHLA 3PF5A 2F0DA 2BE5C 4MV3A 4DFAA 5FO8B 4K5VA 1ET6A 5M5XH 3A56A 3BZCA 2EOTA 1WTPA 3PW4A 1B70B 5J3BA 1QB5D 3MWMA 5BR8L 1TWCB 2NVXB 2GLTA 3WOEA 1RJRA 1Z2NX 1PFMA 4MV6A 1MI2A 3H3VC 2D0OA 3PN1A 4Q45A 4BY7G 4RB3C 5A2QE 4O3NA 1EQQA 3PIOA 3HOVG 5KNDA 4H7BA 5C0XI 1I4GA 1XPOA 5CBAE 5KFJA 2K4KA 3S15H 2PN1A 4I55F 4J9LA 2WACA 3AMUA 1BBWA 2JYOA 2PMZA 3I4MB 3NUCA 1SBBB 2OT2A 1RIPA 1WD0A 4IUTA 2R7FA 3L7ZC 1WCMH 3TBIB 3VPDA 3BG3A 3S15B 2EXZA 1J5EQ 5C6AA 4A93H 1STBA 1TU2B 3MZ5A 3B6YA 4A3IB 1EUCB 4LF7H 4RU9A 4QIWE 4QMGA 4EQPA 5KT3A 5LYJF 2RQXA 3K5OA 1GXDC 4J15A 4YCVA 2N3SA 3UDXA 5EKIA 1HR0Q 5BPHA 5C44H 2OF1A 2RKSA 1K8MA 3AB9A 1YI2A 2GA4B 1XMQQ 5EBCA 3GTQH 3RD4A 1SR3A 3H94A 3OTOH 4C3JB 1I4QA 4OWWB 4LH6A 4ZKBB 5FLMH 3SK5A 3GTKH 4C5BA 3IAYA 4EGVA 3RBEA 1F9RA 1EFID 2QEJC 2FMCA 4BBRG 3RV3A 2TMPA 4YCUA 4Q44A 1EUJA 4BY1B 4RHSA 2JE6I 4C3IB 4IFDI 5CAEB 1FNUA 4O4IF 1SMYC 5JEAJ 3JSNA 5DNFA 3OUUA 5C4ZA 4A2BA 4HAEA 3PCOB 2EQSA 2DUDA 1C8CA 1HRJA 1X32A 1WTVA 2EYPA 3HXLA 5C4HA 2PI2A 1SNOA 1P8LA 1YBYA 3S1MB 1G291 4LF8H 1EY5A 1BF4A 4IWXA 3BZDB 4XIGS 5K5PA 2F0HA 2H4OA 3I56A 3PW0A 1FJGQ 3V6HA 3S1QH 1FNVA 1STAA 3RZOH 3S16H 1AP0A 4GN5A 2A6EC 3FKIB 4A2AA 3R2TA 3SK6A 4GLVB 3HOYG 3ORRA 4HSPA 3HOXH 3QOJA 3JAMi 3E6ZX 2WV6D 3VYTA 2R92H 4DF7A 1BDOA 3GQBA 4UPAA 3N43B 3R23A 1JXLA 5C0XH 2FB9A 2R7ZG 3STBC 4CDDC 5KG0A 1NMFA 1YNXA 1AFPA 3GLKA 3HEJA 1VQPA 2R82A 3Q8QB 1LTID 3F8NA 1T94A 3CCRA 1X9NA 2GPSA 2YV5A 3KTMA 3MJFA 3J7ZC 4JI3L 5IYDG 3RUPA 4LF6H 4IOCA 1PRTB 4I7ZC 3J7AF 4HYKA 5IWAL 3WO0A 3OSNA 4DV1Q 2UVWA 2K5VA 1HNWQ 1U4LA 1OXVA 3D8GA 5IGEA 4N8FA 5A2QL 2VR1A 1RL2A 2HHHH 2QDLA 2RF4A 3D6WA 4DNTB 4A3EB 4LF5H 1QILA 3RUZA 1MZBA 1AE3A 2JEBI 2UXDL 3I2ZA 1EUDB 4JI3H 4DUZL 4B9XA 4ECQA 4HNUA 3WDNA 1VQIA 1YHBA 2KOLA 1HZBA 4LF5Q 2PCFB 3HBLA 1A0IA 5FPRA 4WJWA 5KFIA 1SYGA 3KF6A 3BA8A 2FFKB 2F0FA 2NU6B 2XCPA 1VS0A 2WINB 3AQQA 2ENBA 4APVA 2ALYB 2MFIA 3HKZA 2ZT9C 1CTMA 4JYAL 3Q2OA 4JI5L 4CGYB 5FJ8G 4A3BB 2KCNA 1MKHA 2Y0SE 4DPGA 1ICFB 2VUMB 1B04A 5KFBA 5JJKA 1VQBA 1LACA 1V4YA 4NPSA 1H9SA 1TWHA 1OTCA 2DNCA 5HGTA 1K0SA 2EJGC 2AQ2B 4A3BH 2QA4A 4ED6A 4DAMA 1E4EB 5IYBH 2VQEL 3FKIG 1QVFA 5KFQA 1IYUA 4JOIC 1AUXA 3MFIA 3E9IA 1HR0H 4C3IH 3CVZA 4HNVA 3TIIA 1TWCH 2CCZA 3W3AA 4KD4A 1WFQA 5IYZF 1QCBD 3GTGA 4B3RH 4A93B 1HQRD 1SJHD 2K04A 2F3WA 3JAMc 1PH9A 4OO1I 5JEAG 1I6HH 2ZDQA 5ELDA 4HTHA 2Z4IA 3OWFA 1VQFA 2R93A 1S5CD 2WKCA 1SNQA 3PF4A 4H02A 5IT9c 4KHPQ 4DUYQ 2SNMA 5C1OA 3FDTA 4R4CA 4EGJA 2F0MA 3QZ8A 2ASDA 2K5HA 4C2MB 2DPIA 4JG2A 3K5IA 2K5NA 3H4BA 2QW7A 1IBLQ 5H80A 1NSNS 1IBMH 1VQ4A 4MV4A 4LSAA 4RNOA 3P75A 3UI2A 2BDNA 2W6QA 4A3IH 2C35B 2O5JC 2B63A 3OHBA 2VQFH 4RZQA 3QWNA 1IW7C 3MVVA 2SOBA 1EWIA 1VQ6A 2W9CB 1G2TA 1V1PB 2PMZE 2N78A 1A9XA 3CCLA 1ZYRD 1I4HA 4DV7L 2K1BA 2VQFQ 4BA2I 4LSXA 2ZDGA 2AGQA 3N8DA 1UNNC 4ZCKA 3D0FA 2W9BA 2UVUA 1ONLA 2YU9A 3DHQA 3G6XA 3H6MA 4F4XA 1E7ZA 3K7AB 3RR5A 3CC2A 4NXMH 1WTXA 1E3PA 3Q6SA 5FJ8H 5M3FB 1D5XC 1EL0A 2W7PA 1ENCA 4DV4L 5DLFA 1CSQA 1WCMA 3KYHC 1VQOA 1RDPD 2F03A 3EFXD 3I4NB 3TP6A 2FLPA 2PYKA 2E5LL 2CW0D 4QGUA 2R93H 2YS7A 3H15A 1E22A 4A3EH 3AU7A 2K50A 3M4IA 4C5AA 2YTVA 5LMNQ 2A6HD 1D7QA 1A3UA 1SMXA 2W6OA 4J1MA 2P0AA 1JMCA 4NP5A 1WYDA 2FK1A 4IFDG 1DXMA 3K59A 3KLWA 4UCTA 3M85A 4TKOB 5KFDA 3GDEA 4J9OA 4K0KQ 1TT2A 4G7HC 2FMAA 3VR3A 2LXKA 2VPSA 4IZOA 4L1KA 1TWFA 4O3OA 1PH1A 2I5MX 3J81L 2UU9Q 1B44D 3MWEA 5FLMG 2VOBA 4A76A 1CZGA 1TWHH 2VZAA 1HNXH 5KIXA 5EQ0A 5HV6A 3G4SA 2JA6H 3FPUB 1I6UA 4A3KG 4E6IA 3RN2A 1C0AA 4DR7L 1STEA 5M3MG 3OTOL 2K5QA 1STGA 3A7LA 4DA2A 1K83H 4HN7A 2OTLA 4ZQIA 2M9VA 2NU8B 3U50C 5DGBA 3H0GB 5KT2A 4ZUIA 1HJPA 5C4JH 1D8LA 5D3DA 1K3BC 3DXJC 2CWPA 1A62A 5JPNC 1W2BA 1RYRA 2ZJPA 1ZHQA 1XNRL 4B3RQ 3FMCA 2J6SA 3T53B 4A75A 2FLNA 1I6HB 3R5XA 3EPGA 1YJWA 4R8UB 2KBNA 3KK7A 1N33L 1XNRH 4U6PA 2C5CA 5BN3A 2B2YA 3HOXG 3DWPA 3DMUA 2PPBC 4PQXA 1ICWA 4PDBA 1EYCA 2PW5A 2M00A 5JJLA 1BO0A 1LO5D 2CH4A 1I50B 4JI7L 4RAZA 1N34H 2F4VQ 3J7A5 4JI8Q 1N32L 1IYVA 4AQYH 1N33H 4B3ML 5KT7A 1VQLA 4YWKA 2MCTA 2IMWP 1QJOA 4DL7A 3RGXA 1K1SA 4APMA 1HHVA 2B2UA 1ET9A 5KG3A 2AQ4A 3GTQA 2R92B 1E24A 3K5LA 3L9AX 2C28A 4IUVA 4QJFA 4JI5Q 1HNXL 2A1AA 3ULJA 4J9QA 1HZAA 2M05A 2RDJA 2IJ0A 5T14A 5IODA 4OL7A 1YEZA 4R1JA 3L4KA 1EY7A 2IX3A 4Y7NH 3C3LA 1IKLA 3GTLB 5EOYA 4XYMB 3BAAA 4K2KA 3MC0B 4E4TA 5I9PA 3C0FB 3I55A 1PRTD 3RLFA 5F2DA 3BDLA 1W6JA 4N9TA 2SCUB 4JI2Q 1PZKD 5LA6F 2KECA 4LMQD 4DU9A 4UY8C 5LOVF 4GOPA 1ILQA 5ELNA 2QILA 2YL2A 2HQEA 4MA0A 1RK6A 4Q5VA 5KFKA 3H91A 4L5SA 2IY5B 2DLNA 5L1KA 3U9SA 4GNXA 4O2BF 1X3EA 2NU7B 5KFZA 3S1RB 4DL2A 1HUNA 1KJIA 2ZTDA 5I2XA 3OW2A 2G9HD 4ZQ3A 3M4QA 1K9MC 1MIUA 1HZ9A 2AWOA 3BDOA 3VR5A 3GTQB 3ERSX 1A6XA 3SI8A 4QB4A 2SDFA 2UVRA 2B63H 4IFDJ 3SE7A 1JR0D 2E2JB 4F50A 3BQ0A 2QCPX 4EYIB 4IN3A 3BYYB 3K3PA 4A3BG 3T51B 5EKKA 1IBKQ 5D1OA 1STHA 2G5DA 1JX4A 4DR7H 2R3ZA 2IA6A 1NR2A 1EY8A 4GOPC 5GONF 5I4DA 2I8CA 3KAJA 3N6XA 4L8JA 2DNEA 5LL6b 1X55A 5LMUL 3KF8A 3NBHA 3SE0A 1N36L 2YYZA 4RCNA 3Q23A 1PTOF 3UFXB 5M5YB 3KALA 3H0GA 3U9TA 3J80i 1I5FA 4JV5L 4HNTA 4GOPB 4ID6A 1GO3E 2ES2A 3GP7A 2XCAA 2UXCH 2AKWB 3CD6A 3I4MG 3N40P 5CBEE 4RWSC 4I50F 4Q8FA 4ECXA 2O5IC 1UEAB 3M7NA 1R4QB 1PRTC 1T3NA 1UE7A 2NZHA 5AJ3Q 4DGZA 4Y8VB 3MEFA 5FD5A 4DV6Q 3I4NH 1EQTA 3FKIA 4JV1A 1OWTA 1T5EA 4DK1A 5TSSA 4N8X1 2YYAA 4P72A 2R8JA 1GSOA 3KLSA 1PFBA 3NWTA 2UUCL 4PWQA 2JEIA 2W6NA 4LF7Q 4Y52H 1AEXA 1RCVD 1C9OA 3OSPA 2AMCB 2V58A 3G71A 3R93A 2E8GA 5FK9C 1B6SA 1NE3A 1SDFA 4ULLA 1WCMG 3GD7A 2VUMG 3TEHB 2R92A 1U4PA 2FJ2A 4J9SA 1WD1A 2C2DA 4A3FG 5DAUA 1AH9A 3KF8B 3NBHB 2FPIB 5KFXA 3T5HA 4AQYQ 1W93A 4LUOA 2EYHA 1WSCA 1FVIA 1E2WA 2DWCA 4R8NA 3S17B 3K58A 5FLXc 4LF5L 5KFAA 3J81E 4Q8EA 1L1OB 1Q12A 4CHTB 1K83B 2F0WA 3T1YQ 5C4XB 1HTLD 5IGCA 2Z8LA 4C3HG 1MHWC 1YHAA 2NZOA 3NQIA 4ZLTF 4RKLA 1A3VA 2F0LA 4DXGA 4A3MB 1EYDA 4DKAC 1CFMA 2SEBD 3S24A 3M9OB 4DUZH 3CC4A 3RB3A 4RZRA 4JI6H 1F2ZA 1VQMA 3RAQA 3HGBA 3MEHA 3CMAA 3OHXC 4FS2A 2K5DA 5CV9A 3D4DA 1HUMA 3S16B 2ZDHA 4IQZA 4RG1A 1ZQ7A 4HIDA 2F0IA 2F3IA 5FOBB 3G6EA 4Q43A 3TRZA 4PNYA 4OX9Q 4DV5H 2ZTEA 2K32A 2BCOA 4A3JB 1G8ZD 4O4LF 5C3EG 4ZI7F 2VXWA 3G6VA 5J2UF 3JAME 1D6EC 1BOSA 3C2PA 3U9OA 3DWAA 1E1OA 2HCIA 2W7OA 1RKNA 3V96A 1I4PA 4RUCA 2P5ZX 4OIKA 2IHFA 1Q86C 2KQ3A 3K7UC 2F0PA 1WJJA 1O80A 4GKJL 4X64Q 5E1FA 4X3UA 1WVLA 3HOYH 4JV2A 1GUOA 1FD7D 1KLGD 2CQYA 5CA0F 1SYEA 2WB1E 2D2CC 2N8NA 3GTGB 5C8YF 4ODGA 1B53A 1I4RA 1EWCA 1K0RA 1YJ9A 2CW8A 4DV6L 2V5AA 5ELEA 3LWUA 1SYCA 3UE0A 3FRPB 4DR1L 5KFWA 5KFMA 2FPPB 4FNFA 4ZKCB 2A19A 2ATLA 4X62Q 4ECTA 1TIID 4POFA 4J6HA 1FNWA 3KUPA 2VY3A 2HHHQ 4C56C 2WB1B 3PIPA 4ED0A 4DV5L 5EDWA 2BQ3A 3J80E 2WYOA 4ME6A 2ZJRA 2E2JH 4JV5Q 4ED7A 1EIYB 5C1PA 2JEJA 3K5MA 2O03A 2FK2A 4PZ8A 2AGOA 2XRSD 2YCHA 3H4DA 2IX0A 1HQMC 3LMLA 3S1RH 1XMOQ 5EWEA 5I9OA 1PRTF 3AYHB 1BUVT 1V1PA 3R5HA 4ZHQF 2VS1A 3I73A 3HKZB 2KEDA 3RFCA 3K8AA 3Q24A 1D5ZC 1JJGA 2IPKD 2CHBD 3PUXA 3PQIA 3V6KA 3OW7A 2N55A 1PH2A 4I7HA 1A15A 2B8FA 1EY0A 3FP9A 1Q1EA 3G48A 4LFBH 2Q8IB 2HIVA 3P20A 1JLLB 1SYBA 4KMUC 4JI4H 4IPGA 5C3EH 2WAQE 5KFEA 4UFZA 1T5XD 3M4YA 3PW7A 4DV2Q 2RSNA 1DYQA 2YRWA 2JEFA 3BVMA 5GAHC 1I7LA 1K28A 2K6AA 3PO2H 2Z6BA 4F4YA 2LS01 5M3FH 1RYSA 4LWCA 1TA8A 4CDEC 4KN4C 2AU0A 1N48A 2D5DA 2UUAQ 1M6VA 5KG2A 2NN6G 1LTTD 2ZTCA 4AYBB 1E4GT 2XD4A 1ZKOA 1EEFD 2CVRA 4I7AA 4LFCQ 3HOWH 2WE6A 4QW8A 4RB2C 4XT1B 1EY4A 2NVYH 4EG0A 1RF2D 1WTOA 2R7ZB 3K3VA 3WNZA 2JA9A 4X66Q 1UC8A 1HA5A 4YAKB 4GS3A 3S17H 1O78A 1X3QA 4X65Q 1N32H 3CCSA 2W9CA 2K14A 4EYHB 3PSIA 1CHQD 2CW7A 2LKVA 4BXXH 4K6DA 5FLXL 4HR7A 2J6UA 5C3EB 1F2YA 3KJOA 2EE1A 4IPDA 4YY3L 3F8TA 4ED2A 1RJTA 1X54A 2AQ1B 1HXYD 1KDBA 5IGDA 3QZ7A 4KJNA 1F9SA 2B39A 1JICA 3TP5A 1PX2A 4FBTA 4K8IA 1HR0W 4O2DA 1YNNC 4DL3A 1WI5A 2R8KA 2AQ3B 4OX9H 4AYBG 2F4IA 3NTHA 1KC8C 2KCTA 3N41B 2K28A 4A3JH 1SE4A 1H9MA 2KVMA 4MA5A 2BDOA 1B2TA 4UCSA 2VUMH 1Y1VG 3FKIH 2FHTA 2F3VA 3MFYA 3GTJB 3H3VI 2BQRA 1S0MA 2MPMA 4IPHA 4B9WA 1WTWA 5LP6F 2J7ZA 4NW2A 1Z6HA 1XPUA 2LSSA 3UDGA 4DK3C 1B3AA 3CC7A 3MR3A 1H9SB 1TWHB 5GAEC 5KFOA 4G7ZC 4CKBA 2R6GA 3ULPA 1EEID 2K03A 2KCCA 2I5LX 1LT6D 4JI1L 3SK8A 1SCUB 2Z0SA 4IR9A 4LNQA 2QKIC 1NY4A 5IT9L 4DR3L 4DR3Q 3OPOA 5IYCH 1XNQL 1E4FT 5DG7A 2ZXRA 3TS2A 1I94Q 3CRKC 5BPFA 3CAMA 2JJQA 3SEBA 5I6WA 1YZ6A 3TINA 1NMGA 4ECWA 4CKCA 4AQYL 2JA5A 1MJEA 3QO2A 4LK1C 3HS0C 1BQQT 1CSPA 2HGSA 1J5EH 4HIOA 5L37A 1F2MA 1JKJB 4K8JA 4GNXB 4ILWA 1VKZA 1BJTA 2FE3A 3GIQA 3GTGH 1PK8A 4BBSB 1PVOA 1EZ6A 1IW7D 3M9MB 5JQWA 1HNZL 4JI3Q 4JBKA 3MR6A 3K80C 3CRLC 5C3XA 4NLGA 4NXML 3TIGA 2NWGA 2JN4A 1ZYRC 5CV6A 4XQJA 4DV2L 2UXCQ 4FF4A 1MSHA 2X69A 4WBNF 3RBDA 3V4SA 1I50H 3MFHA 1TKWB 4IALA 2OXPA 2RHSB 1GOZA 4YHHL 3PO3B 2ID0A 4KN7C 4DR6H 2W8KA 1AZQA 1O7IA 5EZYF 4YQWA 4L6TB 4DV7Q 2QDBA 4AYBA 4ECSA 4M8AA 1C4QA 5M5XB 1BBXC 4I65A 5IGBA 4UCUA 3PUWA 3N44B 1HFGA 1FGBD 5JVLA 1LM0A 1NJIC 4CC5A 1C3OA 2BR0A 4GKKH 3KHHA 1Y8OB 4WRDA 4A3DG 3W1GA 4DNRB 5I6YA 4B3TH 3UE1A 1BCPD 1PV4A 2F4VL 2EPBA 1N32Q 4X65H 1S5DD 3CW2C 4A3LH 1PLFA 3F1ZA 2Z6KA 4A3KB 3KOJA 3ERQA 4XQQA 5ELOA 3KBXA 1V43A 1V9PA 4IFDH 2C2RA 5IOCA 3TP7A 1ZETA 2GVBA 1VQJA 4PMBA 2HDLA 2MNAA 2UUAH 2CH4W 3JC66 1FR3A 4JI2H 4B3RL 4R4TA 5GAGC 1XPRA 1IBMQ 1VQGA 1RTNA 2HT1A 2J0TD 2PO4A 4B3SQ 1CKOA 4GLXA 1JWMD 2DJFC 5IIFA 3TDQA 4HJ8A 4LMYA 3HOWB 3KBGA 3GIDA 3Q1KA 4JI0H 2KHIA 1CQFA 3DWQA 1VQ9A 2J6TA 5CORA 4DV4H 2MHVA 1PMRA 5FO9B 3CCQA 3NXWA 5E4XA 1YITA 4KD3A 3KLRA 3MHBA 1M8AA 1XMQL 1VBHA 1CA6A 2DIKA 4O3RA 2NVXA 3BVZA 3H40A 1V8QA 2R8HA 2B2TC 2VQEH 4EQ5A 4RAYA 1CQIB 1GGOA 5KFGA 2LFNA
chains in the Genus database with same CATH topology
4X6AH 2JA7H 3PO3G 4DUZQ 2R7ZH 3PGZA 4WJ4A 2ZM6L 2Y0SG 2QEXA 3I55A 3CF5A 2GN5A 1C7YA 3RLFA 4GLAC 2IX1A 1LTLA 1UE5A 4JI2Q 3M3YH 4DR5L 2UXDQ 2EIFA 3A0JA 3J81j 4LF9L 3GTPH 3M4OH 3CCMA 1UWVA 1M90C 4UY8C 5IYDH 1EIFA 4GN3B 4GOPA 4A3MH 5ELNA 3S1NH 1BBUA 1Q46A 1N9WA 3CCJA 4L5SA 3K0XA 2IY5B 1QZGA 4GNXA 1YIJA 1X3GA 1Q8KA 1X3EA 4QL5A 3T1YL 4JBMA 4JI6L 3BJUA 3UDFA 5IE8A 3S14H 1HNWL 1PFSA 1K8AC 4DUYL 4HIMA 2ZTDA 3OW2A 1K9MC 4LFBQ 3M4QA 4A3JG 1MIUA 1HZ9A 2AWOA 3FHWA 1I94L 3ERSX 5IP7H 1T9HA 4PZ7A 4JI7Q 2ZM6Q 3ZJYC 4NXNQ 2QGQA 2CQOA 2B63H 3RNUA 4IFDJ 4AYBE 4JCVE 1VQNA 4KHPL 4BY7H 2JEAI 1K3RA 4A3CH 2EXDA 5BR8Q 4A3BG 4DR4L 5GROA 2AHOB 4YY3Q 1EYGA 4C3JH 1KRTA 1IBKQ 3GTJH 1EOVA 3AFPA 1IBLL 3I4NG 2HQLA 4GKKL 4O0AA 4A3MG 4GOPC 3T1HQ 1VQAA 1FGUA 1ASZA 4A4IA 2UUBQ 2FXQA 2JK8A 1X55A 5LMUL 5C4XG 4DV5Q 1KXLA 1N36L 1VQ5A 1BVSA 2MO0A 2YYZA 3J80c 4BY1H 2UXBQ 2IT1A 3E9HA 1PA6A 2YTYA 1CKNA 1GVPA 1IZ6A 1Z47A 3J80i 1I5FA 1YVCA 4JC0A 4P74A 3AEVA 4JBWA 4JV5L 1SN8A 4DAYB 3CQZH 1OXUA 4X65L 4GOPB 1GO3E 3BZKA 1Q82C 4NB3A 2ES2A 2AKWB 4YWMA 3CD6A 2OWOA 3PO2G 3I4MG 3LGJA 5M3FG 4B3SL 1U0LA 3AFQA 1L1OA 4A3CG 3I7FA 5H1SE 4A3FH 3W5OA 2JA7G 2JQOA 3M4PA 3HOUG 3M7NA 1UE7A 2NZHA 3J81i 1M1KC 4DR1Q 5AJ3Q 4OWXB 1Y1VH 1G51A 3MEFA 3S2DH 4P75A 4DV6Q 3I4NH 2VNUD 3A5ZB 1W3SA 1L1OC 4JI0Q 1OXSC 4C2MH 4A3IG 4P72A 2BH8A 4JI6Q 2OCEA 4TQUS 3CXCA 3TQYA 1IYJB 4HJ7A 1I3QH 2UUCL 2JA8H 4GKKQ 5LMNL 4LF7Q 1P16A 4P73A 1CKMA 2HIXA 3HFZB 2CWAA 1PH8A 2UXCL 2F52A 4BY1G 4X64L 3KDFB 4Y52H 1C9OA 1SRUA 2AMCB 3L0OA 3G71A 3GO5A 2RHQB 2E8GA 3PF5A 1NE3A 1AE2A 1U5KA 1QUQB 1WCMG 3RLOA 3GD7A 5M5XH 4LFAL 2VUMG 3TEHB 4X66L 3BZCA 1B70B 5J3BA 1KIXA 4A93G 1PH7A 1A8VA 2E5LQ 5BR8L 4A3FG 1AH9A 4A3DH 3KF8B 2PNHA 3NBHB 2XTIA 4DV4Q 4AQYQ 1PHJA 1JT8A 2OQKA 4LUVA 4NXNL 2D0OA 4LUOA 3STBD 4BXXG 4BY7G 1FVIA 3IRBA 5GQOA 1EQQA 3PIOA 3HOVG 2I0QA 5C0XI 5FLXc 4LF5L 1XPOA 2K4KA 3S15H 1L1OB 1Q12A 4HIKA 2Q2TA 3T1YQ 1HNXQ 1BBWA 4IO9A 1MJCA 3CPFA 1YHAA 2NZOA 1RIPA 4L5QA 3NELA 2R92G 2R7FA 3L7ZC 5IP9H 4LF8L 1WCMH 4DKAC 3J81c 4LF7L 3S24A 3CC4A 1J5EQ 5C0XG 4DR2Q 4A93H 2XGTA 4IJLA 1VQMA 4IJHA 3B6YA 4MZ9A 3KF6B 3CMAA 4JI2L 4QIWE 3KDFA 1E1TA 3HOZH 1Q1BA 3EN2A 4JBJA 4OXPA 4RG1A 3PV0A 4J15A 4YCVA 4HIDA 2N3SA 2F3IA 3UDXA 3G6EA 1JB7A 2V1CC 1HR0Q 3TRZA 5C44H 4OX9Q 2ZTEA 5C3EG 1XMQQ 1YI2A 2KHJA 4A3LG 1XNRQ 3GTQH 1SR3A 5EAYA 3CCEA 1TWGH 1E1OA 4OWWB 1K73C 2NVXH 1N36Q 2UXBL 2JA8G 5FLMH 2IHFA 3K81C 5HY6A 1Q81C 1Q86C 2CKZB 3GTKH 3K7UC 1VQHA 1WJJA 5IYCG 4GKJL 4X64Q 3CCUA 3HOYH 4BBRG 2IHEA 4A3KH 4P71A 4YCUA 4DV0L 2WB1E 1EUJA 4JI8L 2N8NA 4DR6L 5M3MH 2JE6I 4PG3A 1QZHA 4IFDI 1K0RA 4PMWA 5JEAJ 3NEMA 1YJ9A 1GD7A 2KCMA 3EIVA 4DV6L 1CKNB 1L0WA 3UE0A 4DR7Q 3PCOB 2EQSA 2DUDA 4L5TA 3M9BA 4DR1L 2D0PA 2A19A 1IL2A 4X62Q 4POFA 3W1BA 2PI2A 1YBYA 1P8LA 2VY3A 2Z6KC 3WWVA 2HHHQ 1G291 3PIPA 4HJAA 4KLKA 4DV5L 1X56A 4XIGS 4OX9L 3PUYA 3I56A 2ZJRA 2E2JH 4LUZA 1FJGQ 1VQDA 3S1QH 1EIYB 4JV5Q 4R4QA 3RZOH 3S16H 1J5EL 1OXXK 1VQCA 1WOCA 4GN5A 4DNIA 4PZ8A 1VQKA 4GLVB 3HOYG 3HOXH 3JAMi 1NTGA 2VQEQ 2IX0A 4ALPA 2R92H 3EBEA 1XJVA 4OO1G 3S1RH 4UPAA 1XMOQ 3F2DA 1G6PA 3AYHB 2VS1A 2ZJQA 1VQ7A 2R7ZG 3STBC 3K8AA 2B3GA 1QVCA 1NMFA 1YNXA 5IY0A 2JA5H 1VQPA 1GKHA 1JJGA 4DR4Q 3PUXA 4GN4B 1PH2A 3S2HH 4DR5Q 3FP9A 1Q1EA 3G48A 2PQAA 3CCRA 3VDYA 3RZDH 1X9NA 1Q7YC 2HIVA 2YV5A 5C44G 1X65A 3J7ZC 4JI3L 5M5WH 5IYDG 4IPGA 4IOCA 4K0KL 5C3EH 2MO1A 2Q2UA 2WAQE 5IWAL 4LFBL 4DV1Q 1R9TH 4DV2Q 2K5VA 4B3TQ 1HZCA 1HNWQ 1OXVA 5GAHC 3CCVA 1RL2A 2RF4A 3PO2H 5M3FH 1S40A 4MTNA 4QY7A 4AH6A 1NBWA 1LYLA 4LWCA 2E2IH 2BA1A 2NN6I 1UEBA 3U4ZA 2NVTH 1AE3A 2JEBI 2UXDL 3I2ZA 2JA5G 4DUZL 4HJ9A 1VQIA 1YHBA 2VL6A 1HZBA 1Z9FA 1KD1C 2UUAQ 4LF5Q 4AIMA 2NN6G 1A0IA 3NENA 2UUCQ 2BA0A 2ZTCA 1N34L 4L5RC 4BBSH 3KF6A 4OONA 4X62L 4RMFA 1VS0A 5LMNW 3AQQA 4ME3A 4APVA 2ALYB 2MFIA 4LFCQ 3HOWH 1DGSA 3F2CA 2VQFL 4JYAL 5K36G 4JOIA 4JI5L 5FJ8G 4HJ5A 2NVYH 3H3VH 1MKHA 2WP8J 2WFWA 2Y0SE 4DPGA 3HKZG 5IP7G 3U4VA 3ULLA 4LF6L 5JJKA 1VQBA 2JA9A 4X66Q 1IBML 1JJ2A 2D62A 4NPSA 2B63G 4GS3A 4XTCS 3S17H 1OTCA 3PUVA 4MNOA 3U58A 1YJNA 4X65Q 3SGIA 3CCSA 4A3BH 2QA4A 2K14A 4GKJQ 4DAMA 5IYBH 4LW1A 2VQEL 4R4OA 3FKIG 3PSIA 3TS0A 1QVFA 4JOIC 4BXXH 3E9IA 5AJ3L 3ER0A 4C3IH 1YHQA 1ASYA 4POGA 1TWCH 3HOVH 3KJOA 1JE5A 2CCZA 1IBKL 3S1MH 3E0EA 4IPDA 4YY3L 1WFQA 3F8TA 1X54A 1N8RC 3T1HL 2RCNA 4YCWA 1K8GA 4JYAQ 3K7AH 3JAMc 1PH9A 4OO1I 3BU2A 5JEAG 4LFCL 1I6HH 4C3HH 1S3OA 5M5YH 1TXYA 1KQSA 1HR0W 1VQFA 4O2DA 5IP9G 1WI5A 4DV3Q 3PF4A 4AYBG 4H02A 5LMUQ 3RLNA 5IT9c 4PZ6A 4KHPQ 2H5XA 3DLLA 4DUYQ 1EQRA 2KCTA 1KC8C 5E7NA 4A3JH 4R4CA 1BKBA 2AWNA 2JA6G 4DR2L 2K5HA 1B7YB 1KL9A 1TWFH 1SFOH 4UP8A 2E2HH 4DV0Q 3HOUH 4IOAA 3HKSA 5IYBG 4JG2A 2VUMH 1Y1VG 2K5NA 3FKIH 3H3VI 4A3GH 1IBLQ 4IPHA 1VQ4A 1X6OA 3ICEA 3RN5A 2LSSA 4JI4L 3UDGA 4LF4Q 1XPUA 4DK3C 4A3IH 2C35B 1Y1WH 1HNZQ 1VQ8A 3CC7A 5GAEC 4TVAB 1S72A 1HR0L 1PH4A 4KHZA 1EWIA 1SLJA 2R6GA 2WAQG 4YHHQ 5C0XJ 3ULPA 1VQ6A 1PH3A 2I5LX 1N34Q 1UE6A 2PMZE 4JI1L 3TREA 3GTMH 1OXTA 2N78A 3KFUA 4BBSG 2Z0SA 3CCLA 4LNQA 4DV7L 1XNQQ 2VQFQ 4BA2I 1NY4A 4DR3L 4DR3Q 5C4XH 3D0FA 5IYCH 1XNQL 3HOWG 2BH2A 1E7ZA 3RR5A 3CC2A 4YWLA 1E3PA 5FJ8H 3TS2A 2PQAB 1I94Q 1PYSB 2JJQA 2YTXA 3CAMA 4LF8Q 2L15A 1H95A 1YZ6A 1EFWA 1NMGA 1A63A 3I4OA 4DV4L 4AQYL 4UP9A 1CSQA 1MJEA 4A3GG 3KYHC 1CSPA 1VQOA 3I4MH 5JJIA 4LF9Q 4HIOA 4UP7A 4WJ3M 2CFMA 2E5LL 1IXRA 4GNXC 4QGUA 2R93H 1VCIA 1GM5A 3H15A 4GNXB 1E22A 3MXNB 4A3EH 3CP0A 3GTGH 2K50A 2YTVA 3OYYA 1PVOA 1XTDA 5LMNQ 1D7QA 1SMXA 1HNZL 4JI3Q 4JBKA 3GTOH 3K80C 4NXML 4JI4Q 1JMCA 3CPWA 4LF4L 4IPCA 3CMEA 1FJGL 1WYDA 4DV2L 5GADC 5DLQE 2UXCQ 4IFDG 3A5UA 3KLWA 3HKZE 2LXJA 1I50H 3M85A 3GDEA 4JI1Q 4K0KQ 2HHHL 2RHSB 4YHHL 2LXKA 2ID0A 1N33Q 4EX5A 2OTJA 1PH1A 2I5MX 1O7IA 4LFAQ 2UU9Q 5FLMG 4DV7Q 4A76A 1TWHH 2VZAA 3F2BA 3HOZG 2I5HA 3G4SA 3PUWA 2JA6H 1LM0A 1NJIC 1LUZA 4A3KG 3PUZA 3RN2A 2NVQH 1B8AA 4A3DG 1C0AA 4B3MQ 3W1GA 4A3EG 4DR7L 5M3MG 2MQHA 3UE1A 3OTOL 1PV4A 2Q2IA 2VW9A 1XMOL 2YU9H 2F4VL 1N32Q 1SROA 2N49A 3CW2C 4QQBX 4A3LH 1K83H 4JI0L 3H0GH 3F1ZA 2OTLA 2Z6KA 3U50C 3KOJA 3OTOQ 4BA1I 1HJPA 1TWAH 4KI0A 5ELOA 1PYBA 1D8LA 1V43A 1V9PA 2GVAA 5C4JH 2CWPA 1A62A 5HGQA 3L2PA 2PI2E 3GTLH 1W2BA 1KHIA 2ZJPA 1XNRL 4R4IA 4B3RQ 2GVBA 1VQJA 3A74A 4OWTB 2MNAA 4A75A 4DV3L 3JC66 4BBRH 2KENA 4B3RL 4R4TA 1L2FA 2UU9L 5GAGC 1YJWA 1XPRA 1IBMQ 2KBNA 1N33L 1VQGA 3DM3A 1CUKA 2OQ0A 1PH6A 2ASBA 2ATWA 2HT1A 4B3SQ 1Y14B 3UDIA 1CKOA 3PO3H 3HOXG 4GLXA 4HJ8A 1UE1A 1HH2P 2KHIA 1VQ9A 5JJLA 1KAWA 4JI7L 2K52A 1KRSA 2F4VQ 3J7A5 3Q8DA 4JI8Q 4DR6Q 1N32L 4B3ML 1X3FA 3H0GG 1VQLA 4YWKA 1SE8A 3CCQA 1PH5A 2R93G 1QUQA 2K75A 2UUAL 1J6QA 1YITA 2UUBL 2Q2HA 1QVGA 1E24A 4NXMQ 3D31A 1XMQL 4QJFA 4JI5Q 1HNXL 2A1AA 1FL0A 2A8VA 3ULJA 1HZAA 4DK6C 4LF6Q 4DV1L 1V1QA 2WB1G 5IWAQ 1YEZA 4R1JA 4EQ5A 4Y7NH 4FDBA 1JJCB 3KJPA 2DGYA 1Y1WG 2R7DA 1VQEA 4B3TL 2B29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X6A H;  2JA7 H;  3PO3 G;  4DUZ Q;  2R7Z H;  3PGZ A;  4WJ4 A;  2ZM6 L;  2Y0S G;  2QEX A;  3I55 A;  3CF5 A;  2GN5 A;  1C7Y A;  3RLF A;  4GLA C;  2IX1 A;  1LTL A;  1UE5 A;  4JI2 Q;  3M3Y H;  4DR5 L;  2UXD Q;  2EIF A;  3A0J A;  3J81 j;  4LF9 L;  3GTP H;  3M4O H;  3CCM A;  1UWV A;  1M90 C;  4UY8 C;  5IYD H;  1EIF A;  4GN3 B;  4GOP A;  4A3M H;  5ELN A;  3S1N H;  1BBU A;  1Q46 A;  1N9W A;  3CCJ A;  4L5S A;  3K0X A;  2IY5 B;  1QZG A;  4GNX A;  1YIJ A;  1X3G A;  1Q8K A;  1X3E A;  4QL5 A;  3T1Y L;  4JBM A;  4JI6 L;  3BJU A;  3UDF A;  5IE8 A;  3S14 H;  1HNW L;  1PFS A;  1K8A C;  4DUY L;  4HIM A;  2ZTD A;  3OW2 A;  1K9M C;  4LFB Q;  3M4Q A;  4A3J G;  1MIU A;  1HZ9 A;  2AWO A;  3FHW A;  1I94 L;  3ERS X;  5IP7 H;  1T9H A;  4PZ7 A;  4JI7 Q;  2ZM6 Q;  3ZJY C;  4NXN Q;  2QGQ A;  2CQO A;  2B63 H;  3RNU A;  4IFD J;  4AYB E;  4JCV E;  1VQN A;  4KHP L;  4BY7 H;  2JEA I;  1K3R A;  4A3C H;  2EXD A;  5BR8 Q;  4A3B G;  4DR4 L;  5GRO A;  2AHO B;  4YY3 Q;  1EYG A;  4C3J H;  1KRT A;  1IBK Q;  3GTJ H;  1EOV A;  3AFP A;  1IBL L;  3I4N G;  2HQL A;  4GKK L;  4O0A A;  4A3M G;  4GOP C;  3T1H Q;  1VQA A;  1FGU A;  1ASZ A;  4A4I A;  2UUB Q;  2FXQ A;  2JK8 A;  1X55 A;  5LMU L;  5C4X G;  4DV5 Q;  1KXL A;  1N36 L;  1VQ5 A;  1BVS A;  2MO0 A;  2YYZ A;  3J80 c;  4BY1 H;  2UXB Q;  2IT1 A;  3E9H A;  1PA6 A;  2YTY A;  1CKN A;  1GVP A;  1IZ6 A;  1Z47 A;  3J80 i;  1I5F A;  1YVC A;  4JC0 A;  4P74 A;  3AEV A;  4JBW A;  4JV5 L;  1SN8 A;  4DAY B;  3CQZ H;  1OXU A;  4X65 L;  4GOP B;  1GO3 E;  3BZK A;  1Q82 C;  4NB3 A;  2ES2 A;  2AKW B;  4YWM A;  3CD6 A;  2OWO A;  3PO2 G;  3I4M G;  3LGJ A;  5M3F G;  4B3S L;  1U0L A;  3AFQ A;  1L1O A;  4A3C G;  3I7F A;  5H1S E;  4A3F H;  3W5O A;  2JA7 G;  2JQO A;  3M4P A;  3HOU G;  3M7N A;  1UE7 A;  2NZH A;  3J81 i;  1M1K C;  4DR1 Q;  5AJ3 Q;  4OWX B;  1Y1V H;  1G51 A;  3MEF A;  3S2D H;  4P75 A;  4DV6 Q;  3I4N H;  2VNU D;  3A5Z B;  1W3S A;  1L1O C;  4JI0 Q;  1OXS C;  4C2M H;  4A3I G;  4P72 A;  2BH8 A;  4JI6 Q;  2OCE A;  4TQU S;  3CXC A;  3TQY A;  1IYJ B;  4HJ7 A;  1I3Q H;  2UUC L;  2JA8 H;  4GKK Q;  5LMN L;  4LF7 Q;  1P16 A;  4P73 A;  1CKM A;  2HIX A;  3HFZ B;  2CWA A;  1PH8 A;  2UXC L;  2F52 A;  4BY1 G;  4X64 L;  3KDF B;  4Y52 H;  1C9O A;  1SRU A;  2AMC B;  3L0O A;  3G71 A;  3GO5 A;  2RHQ B;  2E8G A;  3PF5 A;  1NE3 A;  1AE2 A;  1U5K A;  1QUQ B;  1WCM G;  3RLO A;  3GD7 A;  5M5X H;  4LFA L;  2VUM G;  3TEH B;  4X66 L;  3BZC A;  1B70 B;  5J3B A;  1KIX A;  4A93 G;  1PH7 A;  1A8V A;  2E5L Q;  5BR8 L;  4A3F G;  1AH9 A;  4A3D H;  3KF8 B;  2PNH A;  3NBH B;  2XTI A;  4DV4 Q;  4AQY Q;  1PHJ A;  1JT8 A;  2OQK A;  4LUV A;  4NXN L;  2D0O A;  4LUO A;  3STB D;  4BXX G;  4BY7 G;  1FVI A;  3IRB A;  5GQO A;  1EQQ A;  3PIO A;  3HOV G;  2I0Q A;  5C0X I;  5FLX c;  4LF5 L;  1XPO A;  2K4K A;  3S15 H;  1L1O B;  1Q12 A;  4HIK A;  2Q2T A;  3T1Y Q;  1HNX Q;  1BBW A;  4IO9 A;  1MJC A;  3CPF A;  1YHA A;  2NZO A;  1RIP A;  4L5Q A;  3NEL A;  2R92 G;  2R7F A;  3L7Z C;  5IP9 H;  4LF8 L;  1WCM H;  4DKA C;  3J81 c;  4LF7 L;  3S24 A;  3CC4 A;  1J5E Q;  5C0X G;  4DR2 Q;  4A93 H;  2XGT A;  4IJL A;  1VQM A;  4IJH A;  3B6Y A;  4MZ9 A;  3KF6 B;  3CMA A;  4JI2 L;  4QIW E;  3KDF A;  1E1T A;  3HOZ H;  1Q1B A;  3EN2 A;  4JBJ A;  4OXP A;  4RG1 A;  3PV0 A;  4J15 A;  4YCV A;  4HID A;  2N3S A;  2F3I A;  3UDX A;  3G6E A;  1JB7 A;  2V1C C;  1HR0 Q;  3TRZ A;  5C44 H;  4OX9 Q;  2ZTE A;  5C3E G;  1XMQ Q;  1YI2 A;  2KHJ A;  4A3L G;  1XNR Q;  3GTQ H;  1SR3 A;  5EAY A;  3CCE A;  1TWG H;  1E1O A;  4OWW B;  1K73 C;  2NVX H;  1N36 Q;  2UXB L;  2JA8 G;  5FLM H;  2IHF A;  3K81 C;  5HY6 A;  1Q81 C;  1Q86 C;  2CKZ B;  3GTK H;  3K7U C;  1VQH A;  1WJJ A;  5IYC G;  4GKJ L;  4X64 Q;  3CCU A;  3HOY H;  4BBR G;  2IHE A;  4A3K H;  4P71 A;  4YCU A;  4DV0 L;  2WB1 E;  1EUJ A;  4JI8 L;  2N8N A;  4DR6 L;  5M3M H;  2JE6 I;  4PG3 A;  1QZH A;  4IFD I;  1K0R A;  4PMW A;  5JEA J;  3NEM A;  1YJ9 A;  1GD7 A;  2KCM A;  3EIV A;  4DV6 L;  1CKN B;  1L0W A;  3UE0 A;  4DR7 Q;  3PCO B;  2EQS A;  2DUD A;  4L5T A;  3M9B A;  4DR1 L;  2D0P A;  2A19 A;  1IL2 A;  4X62 Q;  4POF A;  3W1B A;  2PI2 A;  1YBY A;  1P8L A;  2VY3 A;  2Z6K C;  3WWV A;  2HHH Q;  1G29 1;  3PIP A;  4HJA A;  4KLK A;  4DV5 L;  1X56 A;  4XIG S;  4OX9 L;  3PUY A;  3I56 A;  2ZJR A;  2E2J H;  4LUZ A;  1FJG Q;  1VQD A;  3S1Q H;  1EIY B;  4JV5 Q;  4R4Q A;  3RZO H;  3S16 H;  1J5E L;  1OXX K;  1VQC A;  1WOC A;  4GN5 A;  4DNI A;  4PZ8 A;  1VQK A;  4GLV B;  3HOY G;  3HOX H;  3JAM i;  1NTG A;  2VQE Q;  2IX0 A;  4ALP A;  2R92 H;  3EBE A;  1XJV A;  4OO1 G;  3S1R H;  4UPA A;  1XMO Q;  3F2D A;  1G6P A;  3AYH B;  2VS1 A;  2ZJQ A;  1VQ7 A;  2R7Z G;  3STB C;  3K8A A;  2B3G A;  1QVC A;  1NMF A;  1YNX A;  5IY0 A;  2JA5 H;  1VQP A;  1GKH A;  1JJG A;  4DR4 Q;  3PUX A;  4GN4 B;  1PH2 A;  3S2H H;  4DR5 Q;  3FP9 A;  1Q1E A;  3G48 A;  2PQA A;  3CCR A;  3VDY A;  3RZD H;  1X9N A;  1Q7Y C;  2HIV A;  2YV5 A;  5C44 G;  1X65 A;  3J7Z C;  4JI3 L;  5M5W H;  5IYD G;  4IPG A;  4IOC A;  4K0K L;  5C3E H;  2MO1 A;  2Q2U A;  2WAQ E;  5IWA L;  4LFB L;  4DV1 Q;  1R9T H;  4DV2 Q;  2K5V A;  4B3T Q;  1HZC A;  1HNW Q;  1OXV A;  5GAH C;  3CCV A;  1RL2 A;  2RF4 A;  3PO2 H;  5M3F H;  1S40 A;  4MTN A;  4QY7 A;  4AH6 A;  1NBW A;  1LYL A;  4LWC A;  2E2I H;  2BA1 A;  2NN6 I;  1UEB A;  3U4Z A;  2NVT H;  1AE3 A;  2JEB I;  2UXD L;  3I2Z A;  2JA5 G;  4DUZ L;  4HJ9 A;  1VQI A;  1YHB A;  2VL6 A;  1HZB A;  1Z9F A;  1KD1 C;  2UUA Q;  4LF5 Q;  4AIM A;  2NN6 G;  1A0I A;  3NEN A;  2UUC Q;  2BA0 A;  2ZTC A;  1N34 L;  4L5R C;  4BBS H;  3KF6 A;  4OON A;  4X62 L;  4RMF A;  1VS0 A;  5LMN W;  3AQQ A;  4ME3 A;  4APV A;  2ALY B;  2MFI A;  4LFC Q;  3HOW H;  1DGS A;  3F2C A;  2VQF L;  4JYA L;  5K36 G;  4JOI A;  4JI5 L;  5FJ8 G;  4HJ5 A;  2NVY H;  3H3V H;  1MKH A;  2WP8 J;  2WFW A;  2Y0S E;  4DPG A;  3HKZ G;  5IP7 G;  3U4V A;  3ULL A;  4LF6 L;  5JJK A;  1VQB A;  2JA9 A;  4X66 Q;  1IBM L;  1JJ2 A;  2D62 A;  4NPS A;  2B63 G;  4GS3 A;  4XTC S;  3S17 H;  1OTC A;  3PUV A;  4MNO A;  3U58 A;  1YJN A;  4X65 Q;  3SGI A;  3CCS A;  4A3B H;  2QA4 A;  2K14 A;  4GKJ Q;  4DAM A;  5IYB H;  4LW1 A;  2VQE L;  4R4O A;  3FKI G;  3PSI A;  3TS0 A;  1QVF A;  4JOI C;  4BXX H;  3E9I A;  5AJ3 L;  3ER0 A;  4C3I H;  1YHQ A;  1ASY A;  4POG A;  1TWC H;  3HOV H;  3KJO A;  1JE5 A;  2CCZ A;  1IBK L;  3S1M H;  3E0E A;  4IPD A;  4YY3 L;  1WFQ A;  3F8T A;  1X54 A;  1N8R C;  3T1H L;  2RCN A;  4YCW A;  1K8G A;  4JYA Q;  3K7A H;  3JAM c;  1PH9 A;  4OO1 I;  3BU2 A;  5JEA G;  4LFC L;  1I6H H;  4C3H H;  1S3O A;  5M5Y H;  1TXY A;  1KQS A;  1HR0 W;  1VQF A;  4O2D A;  5IP9 G;  1WI5 A;  4DV3 Q;  3PF4 A;  4AYB G;  4H02 A;  5LMU Q;  3RLN A;  5IT9 c;  4PZ6 A;  4KHP Q;  2H5X A;  3DLL A;  4DUY Q;  1EQR A;  2KCT A;  1KC8 C;  5E7N A;  4A3J H;  4R4C A;  1BKB A;  2AWN A;  2JA6 G;  4DR2 L;  2K5H A;  1B7Y B;  1KL9 A;  1TWF H;  1SFO H;  4UP8 A;  2E2H H;  4DV0 Q;  3HOU H;  4IOA A;  3HKS A;  5IYB G;  4JG2 A;  2VUM H;  1Y1V G;  2K5N A;  3FKI H;  3H3V I;  4A3G H;  1IBL Q;  4IPH A;  1VQ4 A;  1X6O A;  3ICE A;  3RN5 A;  2LSS A;  4JI4 L;  3UDG A;  4LF4 Q;  1XPU A;  4DK3 C;  4A3I H;  2C35 B;  1Y1W H;  1HNZ Q;  1VQ8 A;  3CC7 A;  5GAE C;  4TVA B;  1S72 A;  1HR0 L;  1PH4 A;  4KHZ A;  1EWI A;  1SLJ A;  2R6G A;  2WAQ G;  4YHH Q;  5C0X J;  3ULP A;  1VQ6 A;  1PH3 A;  2I5L X;  1N34 Q;  1UE6 A;  2PMZ E;  4JI1 L;  3TRE A;  3GTM H;  1OXT A;  2N78 A;  3KFU A;  4BBS G;  2Z0S A;  3CCL A;  4LNQ A;  4DV7 L;  1XNQ Q;  2VQF Q;  4BA2 I;  1NY4 A;  4DR3 L;  4DR3 Q;  5C4X H;  3D0F A;  5IYC H;  1XNQ L;  3HOW G;  2BH2 A;  1E7Z A;  3RR5 A;  3CC2 A;  4YWL A;  1E3P A;  5FJ8 H;  3TS2 A;  2PQA B;  1I94 Q;  1PYS B;  2JJQ A;  2YTX A;  3CAM A;  4LF8 Q;  2L15 A;  1H95 A;  1YZ6 A;  1EFW A;  1NMG A;  1A63 A;  3I4O A;  4DV4 L;  4AQY L;  4UP9 A;  1CSQ A;  1MJE A;  4A3G G;  3KYH C;  1CSP A;  1VQO A;  3I4M H;  5JJI A;  4LF9 Q;  4HIO A;  4UP7 A;  4WJ3 M;  2CFM A;  2E5L L;  1IXR A;  4GNX C;  4QGU A;  2R93 H;  1VCI A;  1GM5 A;  3H15 A;  4GNX B;  1E22 A;  3MXN B;  4A3E H;  3CP0 A;  3GTG H;  2K50 A;  2YTV A;  3OYY A;  1PVO A;  1XTD A;  5LMN Q;  1D7Q A;  1SMX A;  1HNZ L;  4JI3 Q;  4JBK A;  3GTO H;  3K80 C;  4NXM L;  4JI4 Q;  1JMC A;  3CPW A;  4LF4 L;  4IPC A;  3CME A;  1FJG L;  1WYD A;  4DV2 L;  5GAD C;  5DLQ E;  2UXC Q;  4IFD G;  3A5U A;  3KLW A;  3HKZ E;  2LXJ A;  1I50 H;  3M85 A;  3GDE A;  4JI1 Q;  4K0K Q;  2HHH L;  2RHS B;  4YHH L;  2LXK A;  2ID0 A;  1N33 Q;  4EX5 A;  2OTJ A;  1PH1 A;  2I5M X;  1O7I A;  4LFA Q;  2UU9 Q;  5FLM G;  4DV7 Q;  4A76 A;  1TWH H;  2VZA A;  3F2B A;  3HOZ G;  2I5H A;  3G4S A;  3PUW A;  2JA6 H;  1LM0 A;  1NJI C;  1LUZ A;  4A3K G;  3PUZ A;  3RN2 A;  2NVQ H;  1B8A A;  4A3D G;  1C0A A;  4B3M Q;  3W1G A;  4A3E G;  4DR7 L;  5M3M G;  2MQH A;  3UE1 A;  3OTO L;  1PV4 A;  2Q2I A;  2VW9 A;  1XMO L;  2YU9 H;  2F4V L;  1N32 Q;  1SRO A;  2N49 A;  3CW2 C;  4QQB X;  4A3L H;  1K83 H;  4JI0 L;  3H0G H;  3F1Z A;  2OTL A;  2Z6K A;  3U50 C;  3KOJ A;  3OTO Q;  4BA1 I;  1HJP A;  1TWA H;  4KI0 A;  5ELO A;  1PYB A;  1D8L A;  1V43 A;  1V9P A;  2GVA A;  5C4J H;  2CWP A;  1A62 A;  5HGQ A;  3L2P A;  2PI2 E;  3GTL H;  1W2B A;  1KHI A;  2ZJP A;  1XNR L;  4R4I A;  4B3R Q;  2GVB A;  1VQJ A;  3A74 A;  4OWT B;  2MNA A;  4A75 A;  4DV3 L;  3JC6 6;  4BBR H;  2KEN A;  4B3R L;  4R4T A;  1L2F A;  2UU9 L;  5GAG C;  1YJW A;  1XPR A;  1IBM Q;  2KBN A;  1N33 L;  1VQG A;  3DM3 A;  1CUK A;  2OQ0 A;  1PH6 A;  2ASB A;  2ATW A;  2HT1 A;  4B3S Q;  1Y14 B;  3UDI A;  1CKO A;  3PO3 H;  3HOX G;  4GLX A;  4HJ8 A;  1UE1 A;  1HH2 P;  2KHI A;  1VQ9 A;  5JJL A;  1KAW A;  4JI7 L;  2K52 A;  1KRS A;  2F4V Q;  3J7A 5;  3Q8D A;  4JI8 Q;  4DR6 Q;  1N32 L;  4B3M L;  1X3F A;  3H0G G;  1VQL A;  4YWK A;  1SE8 A;  3CCQ A;  1PH5 A;  2R93 G;  1QUQ A;  2K75 A;  2UUA L;  1J6Q A;  1YIT A;  2UUB L;  2Q2H A;  1QVG A;  1E24 A;  4NXM Q;  3D31 A;  1XMQ L;  4QJF A;  4JI5 Q;  1HNX L;  2A1A A;  1FL0 A;  2A8V A;  3ULJ A;  1HZA A;  4DK6 C;  4LF6 Q;  4DV1 L;  1V1Q A;  2WB1 G;  5IWA Q;  1YEZ A;  4R1J A;  4EQ5 A;  4Y7N H;  4FDB A;  1JJC B;  3KJP A;  2DGY A;  1Y1W G;  2R7D A;  1VQE A;  4B3T L;  2B29 A; 
#chains in the Genus database with same CATH topology
 4X6A H;  5I2Y A;  5J39 A;  4UDU C;  2R7Z H;  4WJ4 A;  2ZM6 L;  3QFF A;  1EZ1 A;  1IBL H;  2ZXP A;  1K83 A;  1VBG A;  5KT6 A;  3RAX A;  5KFV A;  1UE5 A;  1U9R A;  4FF3 A;  4DR5 L;  2KEE A;  4F8M A;  2UXD Q;  2EIF A;  3J81 j;  1LTB D;  3GTP H;  3IFD A;  5IYD H;  1UWV A;  1M90 C;  5IT9 W;  3M4O B;  4GN3 B;  4DAY A;  3PIP 3;  1PYW D;  3S1N H;  1JDE A;  1KNA A;  1Q46 A;  1G91 A;  2R6F A;  4RB1 A;  1YIJ A;  1I50 A;  4QWD A;  1X3G A;  3MXN A;  5NUC A;  4JI6 L;  4DLK A;  4Q0Y A;  5IE8 A;  1HNW L;  3S14 H;  4HIM A;  1LTA D;  2E2H B;  4DV6 H;  5EKL A;  1EHI A;  4EBD A;  4HCS A;  1GUN A;  2WII B;  1ENA A;  3GTK A;  1T9H A;  4PZ7 A;  4JI7 Q;  2ZM6 Q;  2F0N A;  3ZJY C;  2E2D C;  4S3S A;  2QGQ A;  3HG9 A;  4Y7N B;  4HSV A;  1B50 A;  1AW7 A;  4BY7 H;  2VA3 A;  2JEA I;  3BJY A;  3URY A;  2R8I A;  1E2V A;  3R8B A;  2XVS A;  3I90 A;  4GKJ H;  4YY3 Q;  1EYG A;  1C30 A;  3T5J A;  1KRT A;  2B2Y C;  3PIO 3;  2Z1C A;  4ED3 A;  5C5J A;  3GTJ H;  1EOV A;  2JXM B;  1IBL L;  2CZG A;  3I4N G;  4F4Z A;  2L0C A;  4O0A A;  1XX8 A;  1SEI A;  3T1H Q;  1VQA A;  3P1H A;  3SDZ A;  1ASZ A;  1GUT A;  3GIM A;  3UQ8 A;  1HFN A;  2NUC A;  1E2Z A;  1VF5 C;  4MV1 A;  2UXB Q;  1VF7 A;  3V05 A;  3E9H A;  1PA6 A;  2YTY A;  1GVP A;  4JC0 A;  3JAM W;  4NKL A;  1GUW A;  2L1B A;  5D3I B;  4YWM A;  3PO2 G;  4PMC A;  1K1Q A;  5EWG A;  1Y8P B;  3K0Y A;  4RGT A;  5H1S E;  4A3F H;  1AUV A;  3MR2 A;  3M4P A;  3HOU G;  2JA8 B;  2B8G A;  1M1K C;  4FVM A;  4RUA A;  2XSC A;  4OWX B;  4K14 A;  3S2D H;  2PW7 A;  2K33 A;  4P75 A;  4RCO A;  1W3S A;  4JI0 Q;  1L0Y B;  4MTE A;  2LY7 A;  4OIJ A;  3NBI A;  2B2T A;  2BH8 A;  2JSO A;  4X3K A;  2OCE A;  4HJ7 A;  3TQY A;  1IYJ B;  4GKK Q;  2JA8 H;  2HVQ A;  4NDX A;  2HIX A;  1PH8 A;  2CWA A;  2UXC L;  2F52 A;  1JB3 A;  4BY1 G;  1WTQ A;  4TRD A;  1SRU A;  3L0O A;  3NWS A;  1ULZ A;  2RHQ B;  1AE2 A;  1U5K A;  1QUQ B;  3KAK A;  5DQI A;  2NUA B;  4J0M A;  1QOH A;  1VAJ A;  3GQC A;  3ONA B;  4ZUJ A;  2RDG A;  4RGN A;  1A8V A;  4OHJ A;  4CDF C;  4XQN A;  2RDI A;  5LHY 1;  1HCZ A;  2XTI A;  2EY1 A;  3JAM L;  4DV4 Q;  1CE8 A;  4JK1 C;  1PHJ A;  4K2L A;  2FKL A;  2OQK A;  4LUV A;  3STB D;  4BXX G;  4DL5 A;  1B4O A;  1EQV A;  3A8I E;  3I70 A;  4EVO A;  5D65 A;  5LL6 S;  2KUM A;  3VPC A;  4HIK A;  2XGQ A;  1JOQ A;  2ASJ A;  3D4W A;  1EYA A;  4IO9 A;  2ALZ A;  1IOW A;  4HED A;  5AFW A;  2FIN B;  4TUY F;  4L5Q A;  2R92 G;  1MD2 D;  5IP9 H;  4LF8 L;  5J2T F;  1X3P A;  4LF7 L;  1SND A;  2F1M A;  2RBM A;  2FPG B;  1BR9 A;  3EJI A;  4RHR A;  1J9O A;  5C0X G;  4IJL A;  2WKD A;  3MWY W;  4IJH A;  3C1E A;  2XN9 C;  5EGT A;  2YW2 A;  5KG7 A;  3HOZ H;  4H13 C;  3EN2 A;  1UC9 A;  4OXP A;  3T5K A;  4IHJ F;  2ICI A;  3RB4 A;  4C1N I;  3BDC A;  1K8O A;  5KT5 A;  1JB7 A;  3T13 A;  2V1C C;  2NB0 A;  5FKA C;  4A3L G;  2KHJ A;  3HP3 A;  3WOF A;  1PZI D;  4O3P A;  1Y1W A;  5EAY A;  2NVQ B;  2RCF A;  3BQ1 A;  3TQT A;  2UXB L;  2JA8 G;  4XT3 B;  5IGF A;  5HY6 A;  4BWG B;  5KNC A;  1Q81 C;  5L1L A;  2BOS A;  1VQH A;  4HR7 B;  5IYC G;  4MAM A;  3KXY T;  1QNU A;  4ECR A;  3FEW X;  5CV5 A;  3I12 A;  4XYO A;  3IKJ A;  4A3K H;  4P71 A;  1N36 H;  3R3O A;  5L9X A;  4DV0 L;  4JI8 L;  3R2I A;  4XYQ A;  4PG3 A;  5M3M H;  2PMZ B;  5KFY A;  3J80 W;  3PW2 A;  3D3R A;  2RDF A;  4CJ1 B;  3Q8P B;  1DON A;  3JZI A;  3M3Y B;  1H9K A;  3EIV A;  5KG5 A;  4DR7 Q;  5M5W B;  3M9B A;  3MXU A;  3E3X A;  2D0P A;  4G4K A;  1SEB D;  4JI7 H;  5K36 H;  4X3T A;  2I80 A;  1TWA A;  3NE5 B;  2R7L A;  3QOL A;  2R87 A;  4OX9 L;  3PUY A;  3DUZ A;  4BY7 B;  4LUZ A;  4R4Q A;  3LWB A;  2QYZ A;  4Q0F A;  4DL6 A;  4R7R A;  1VQC A;  5CGK A;  1W6K A;  4O3Q A;  4XYL B;  1KTK A;  1NTG A;  2IW3 A;  4Z9C B;  2D9U A;  4ALP A;  2R85 A;  2JA7 A;  3EBE A;  1XJV A;  2KA7 A;  1Y1W B;  1TVX A;  2HD3 A;  3OIQ A;  3T56 B;  3VYR A;  2J4X A;  2B3G A;  2JA5 H;  4PV1 C;  1GKH A;  4DR4 Q;  4GN4 B;  2XGP A;  2ZJT A;  3S2H H;  1L0X B;  4C5C A;  2NN6 H;  2O2L D;  3RZD H;  4MV7 A;  2B2U C;  2RGR A;  5C44 G;  1X65 A;  5COY A;  5KG1 A;  4ECZ A;  5FPO A;  5EWF A;  2MO1 A;  2Q2U A;  1MGS A;  1R9T H;  5DQG A;  1S97 A;  3TSS A;  4B3T Q;  2EYL A;  5BR8 H;  3HOY B;  1NUC A;  1S68 A;  1JOK A;  1TWA B;  3QIA A;  3T4A C;  1DV1 A;  4M7E A;  1F77 A;  1S40 A;  3J80 L;  1WTR A;  3I72 A;  4TSS A;  2FJZ A;  1DM0 B;  1LYL A;  2EYM A;  2E2I H;  1XXG A;  2NN6 I;  1KJ9 A;  1Y1V B;  2NVT H;  3OIP A;  4F87 A;  4HJ9 A;  2VL6 A;  3KHL A;  1Z9F A;  2YZM A;  4OGQ C;  4UAI A;  5IGG A;  2V4R A;  2UUC Q;  1N34 L;  4BBS H;  4FS1 A;  2E5L H;  4OON A;  4RMF A;  1QWY A;  4ME3 A;  4EQN A;  4X66 H;  3F2C A;  4KV6 A;  2IL8 A;  3OMG A;  5KYL A;  3A8K E;  1PTO H;  2K05 A;  5K36 G;  3ETJ A;  5KG4 A;  4HJ5 A;  3H3V H;  3FDS A;  2WP8 J;  3MWD A;  2WFW A;  3V2T A;  4G3I A;  4IWY A;  1GHK A;  4CJ0 B;  1DZ1 A;  5CMD A;  4O3S A;  2A68 C;  1GSH A;  2D62 A;  4NXN H;  2B63 G;  1WH2 A;  3SR1 A;  3OWE B;  3PUV A;  5CYU A;  1JQY D;  1YJN A;  3NGD A;  3S2H B;  1HA6 A;  2XWJ B;  4LW1 A;  4C3J G;  3TS0 A;  4FO2 A;  3VPB A;  4ZK9 B;  2CW0 C;  4IUN A;  5CC4 A;  2YZN A;  5AJ3 L;  3ER0 A;  5M3M B;  4C3H B;  1ASY A;  3GIK A;  4IRK A;  4POG A;  1TQO A;  4EGQ A;  2EJF C;  2JA6 A;  1IBK L;  3E0E A;  2C22 A;  3T1H L;  1CQV A;  2RCN A;  4YCW A;  2W6Z A;  4LJZ C;  1K8G A;  1ILP A;  2V4Q A;  4LFC L;  4C3H H;  4YY3 H;  1SYD A;  1WCM B;  4FF1 A;  2XC9 A;  3GIL A;  2BQU A;  1JCK B;  3VA5 A;  4DV3 Q;  2F0G A;  2KSW A;  4K6L A;  4DV0 H;  3LWE A;  5LMU Q;  1FKA H;  3DLL A;  5E3F A;  3GII A;  3V6J A;  2JA6 G;  4CJ2 C;  1M0W A;  2AWN A;  2XRQ D;  2ZXO A;  4DR2 L;  1B7Y B;  1TWF H;  4DV0 Q;  4FF2 A;  4ABN A;  4IOA A;  2UXB H;  4DR1 H;  5L1J A;  4UCV A;  4TV8 F;  4A3G H;  1RJQ A;  3RMH A;  5D1P A;  2TSS A;  2I07 B;  3RN5 A;  1I7N A;  5D14 A;  3GTM A;  1VQ8 A;  1ML0 D;  1TWF B;  5G3L D;  5KNB A;  1KJ8 A;  1HR0 L;  4FXK C;  4DV7 H;  1EY6 A;  4KHZ A;  1CI3 M;  2WAQ G;  4YHH Q;  4HQ6 A;  1N34 Q;  1UE6 A;  3GTM H;  1OXT A;  1CK1 A;  3KFU A;  4BBS G;  3TQ1 A;  2M2L A;  1XNQ Q;  1FYC A;  1XWE A;  1D2B A;  2R8G A;  5C4X H;  4QWA A;  1UAP A;  5FLX W;  2B2W A;  4G57 A;  2A68 D;  2YTX A;  4ME5 A;  3S1N B;  2DZD A;  3BAB A;  3ORQ A;  4JYA H;  2W71 A;  1SYX B;  2DY8 A;  3EPI A;  1BXT A;  3H09 A;  4YR0 A;  2B2W C;  4DN4 M;  2R93 B;  5JUM A;  1IXR A;  1LAB A;  3ND8 A;  4GNX C;  1GM5 A;  1STN A;  5HUR A;  2I46 A;  3MXN B;  1UUP A;  3CP0 A;  5CB4 F;  3G7L A;  5DLG A;  2SNS A;  1H9J A;  3PMF A;  5DG9 A;  3T1Y H;  3L4J A;  4JI4 Q;  4LF4 L;  4EEY A;  1VMP A;  4IPC A;  3CME A;  2E74 C;  5DLQ E;  5DGA A;  2EJM A;  4MHE A;  5CR3 A;  3A5U A;  1GJX A;  2LXJ A;  3J7A V;  2Y0S B;  2HHH L;  4YJ3 F;  1N33 Q;  4EX5 A;  2OTJ A;  4JI8 H;  4LFA Q;  2R84 A;  4YJ2 F;  1AN7 A;  3Q22 A;  3F2B A;  2I5H A;  1ZXT A;  4DK0 A;  3MR5 A;  2MP1 A;  4IRD A;  5C5L A;  1LUZ A;  3PUZ A;  2NVQ H;  1B8A A;  4YAJ B;  5KFN A;  1KAA A;  1U4R A;  1BCP C;  4B3M Q;  2YU9 H;  2MQH A;  2Q2I A;  2VW9 A;  1I4X A;  1SAP A;  1XMO L;  3VYS A;  1SRO A;  2N49 A;  1ROD A;  3H0G H;  4XXE A;  2K7V A;  1ENF A;  3OTO Q;  4BA1 I;  2DY7 A;  1TWA H;  2VA2 A;  2JA5 B;  2GVA A;  4HCE A;  1EY9 A;  3GV5 B;  2WAQ A;  1KHI A;  4R4I A;  2NVT B;  5KFT A;  4OWT B;  3A74 A;  4DV3 L;  1D5M C;  1FJG H;  2E2I A;  1L2F A;  2NYZ D;  2UU9 L;  2UUC H;  2UXD H;  3KHR A;  2OQ0 A;  3CQZ A;  1PH6 A;  1T36 A;  3E0J A;  4YR3 A;  3UDI A;  2GPW A;  2A69 D;  1A2U A;  3PO3 H;  4DL4 A;  5KFC A;  2XIW A;  3P7J A;  2EY5 A;  3C1F A;  4MN3 A;  1HH2 P;  1DJR D;  4ZYS A;  2F0T A;  3DF7 A;  1LT3 D;  2K52 A;  1TS5 A;  1SE8 A;  1R4P B;  1PH5 A;  2R93 G;  1QUQ A;  2K75 A;  3FVQ A;  2R7K A;  1HNW H;  5ELF A;  5A35 A;  1QVG A;  1O7L A;  4NXM Q;  5KYI A;  4JV5 H;  3N42 B;  4QCL A;  3GTJ A;  1PZJ D;  3M7G A;  1TWG A;  1CS0 A;  2A8V A;  2W70 A;  5JAV A;  4DK6 C;  1CHP D;  4LF6 Q;  4NMZ A;  5IWA Q;  3GTM B;  4X62 H;  4YIJ A;  2Z9H A;  1JJC B;  4FDB A;  2DGY A;  3RTX A;  2J9G A;  1XMO H;  3J7Y W;  5LXT F;  2JA7 H;  5IWA H;  3GV8 B;  2WAQ B;  2Y0S G;  4RNN A;  2B2V A;  2QEX A;  3FMA A;  1RTO A;  1B9M A;  5KFP A;  4RKB A;  2GN5 A;  3LX0 A;  4LH7 A;  2L4N A;  2IX1 A;  1LTL A;  2A6H C;  5CV7 A;  5EPK A;  4FU0 A;  3SVM A;  1IL8 A;  3VYU A;  1YNJ D;  2NTS A;  5JPM C;  4QF4 A;  3CCM A;  2RA4 A;  5ELC A;  4J9M A;  4YR2 A;  4ECY A;  4XX0 B;  1BBU A;  2MGS A;  1I6V C;  4UCR A;  1HTP A;  3MFG A;  4LF4 H;  1Q8K A;  4QL5 A;  5M9O A;  3T1Y L;  4CC6 A;  4TQR A;  1O7Z A;  3BJU A;  4KHV A;  3UDF A;  2NZ1 D;  2ZM6 H;  4IAJ A;  1S5F D;  4DUY L;  1I3Q A;  2VQD A;  4LFB Q;  5F9N A;  3CU7 A;  4A3J G;  1KLU D;  4X3S A;  2R7M A;  3DM1 A;  5D8D A;  2A69 C;  2CQO A;  2K5W A;  3RNU A;  4BWS C;  4JCV E;  2HUG A;  3ZYY X;  2EY6 A;  2FP4 B;  2EYO A;  3EA6 A;  3MTS A;  4O1N A;  3E5N A;  2EXD A;  5GRO A;  2AHO B;  1XMQ H;  3HRZ C;  3X3N A;  4C3J H;  2FK3 A;  5C3W A;  1Z7T A;  2L5T A;  4J8Q A;  1DOM A;  4A3M G;  5EPL A;  1FGU A;  1Z2P X;  4A4I A;  3NTI A;  5DM6 3;  4XZ3 B;  5G3L F;  2X6G A;  3CKI B;  2C2E A;  1VQ5 A;  1BVS A;  3J80 c;  4BY1 H;  2PQE A;  2IT1 A;  3ND9 A;  5JVH 3;  4MTD A;  3T16 A;  1IZ6 A;  1Z47 A;  2UVV A;  1YVC A;  4P74 A;  3NQT A;  4JBW A;  5CA1 F;  1SN8 A;  4RGO S;  1OXU A;  3CQZ H;  4X65 L;  1Q82 C;  4LFC H;  2F4V H;  4B08 A;  4NB3 A;  2OWO A;  1BXR A;  3NTK A;  4B3S L;  2XWB B;  1U0L A;  4B3M H;  4A3C G;  3K6O A;  3W5O A;  2JA7 G;  2JQO A;  2NBF A;  3X3M A;  2YRX A;  1G51 A;  4EEQ A;  3K5N A;  2MUY A;  4R8U A;  5L1I A;  1KJJ A;  2VNU D;  4JVZ A;  4EBC A;  2CQA A;  5C44 B;  1EIH A;  4WFN 3;  4A3I G;  1PDQ A;  4DAP A;  4JI6 Q;  3VR2 A;  3CXC A;  4TQU S;  4DR5 H;  2R86 A;  2RVL A;  4KY6 A;  1P16 A;  4P73 A;  1CKM A;  3SXH A;  3HFZ B;  3TZD A;  1KC7 A;  4A3G B;  2HVS A;  3KDF B;  1JWS D;  3GIP A;  3S14 B;  4XDX A;  3GO5 A;  4A3D B;  4R8I A;  1IBK H;  2ASL A;  4U68 A;  4J9R A;  4M9U A;  4RA8 A;  3RLO A;  4KK7 A;  4LFA L;  1KDC A;  4X66 L;  1JDB B;  2F0O A;  1KIX A;  4A93 G;  2X0S A;  1PH7 A;  3OOC A;  3TME A;  2E5L Q;  3HOV B;  3Q8S B;  4A3D H;  2V4D A;  2PNH A;  4KTA A;  3GV3 A;  3R5F A;  1JT8 A;  5A2Q W;  4NXN L;  3W2D A;  4QWE A;  3RGZ A;  3IRB A;  4CBV A;  4K0K H;  5GQO A;  1AN8 A;  4X64 H;  5C4J B;  2I0Q A;  4MIU A;  4N9P A;  4ZOL F;  3L3O C;  5KEE A;  5JJZ A;  1DOK A;  1B1Z A;  5T1I A;  2Q2T A;  1HNX Q;  2LMC B;  2L11 A;  5JEA H;  5T1G A;  3PW5 A;  1MJC A;  3CPF A;  1C48 A;  3RF2 A;  1R9T A;  3RZO B;  3NEL A;  2MJ8 A;  4IR1 A;  3J81 c;  2W57 A;  4RFB A;  3G6J B;  1S4Z A;  2VPQ A;  4DR2 Q;  2XGT A;  3GIJ A;  3A55 A;  2A74 C;  2AGP A;  1XNQ H;  4JI2 L;  4MZ9 A;  3KF6 B;  3K57 A;  1EZ8 A;  4DR3 H;  3TN2 A;  3QG1 A;  2F0S A;  3KDF A;  1E1T A;  2XIG A;  1Q1B A;  4JBJ A;  3MXG A;  3PV0 A;  4KY5 A;  5KRU A;  2V9W A;  1QG7 A;  4FBU A;  2EDG A;  1N56 A;  4IUR A;  1DIK A;  3GTO A;  4WOR A;  5EJW A;  1XNR Q;  4QW9 A;  1TWC A;  4QIW B;  3CCE A;  1TWG H;  1EU3 A;  3E5S A;  1K73 C;  2NVX H;  2B29 A;  1N36 Q;  3NPP A;  3K81 C;  3J7A K;  2CKZ B;  5F9L A;  1VMC A;  2XNA C;  1SXT A;  3MA2 B;  4DR4 H;  2A6E D;  3RZD B;  3CCU A;  4FXD A;  2IHE A;  4V0B A;  1SYF A;  2FLL A;  3VMM A;  3BQ2 A;  4IUQ A;  4DR6 L;  2PVP A;  1M0T A;  1QZH A;  3QB3 A;  2W8L A;  1R9T B;  4PMW A;  3NEM A;  1GD7 A;  2KCM A;  1G2S A;  3ETH A;  1CKN B;  4IUP A;  1L0W A;  1LTS D;  2IP4 A;  2XCL A;  4DV2 H;  4L5T A;  4DAV A;  1EYZ A;  3BG5 A;  1IL2 A;  3W1B A;  2F0K A;  1LTG D;  2Z6K C;  3WWV A;  4HJA A;  3OMC A;  4KLK A;  1X56 A;  3T5L A;  4H0L C;  3S2D B;  4EFB A;  2KJX A;  1IKM A;  1VQD A;  3NK9 A;  4H44 C;  5ELB A;  1J5E L;  1Y1V A;  1B3Q A;  1OXX K;  1SJE D;  3RB0 A;  1WOC A;  4DNI A;  1HPC A;  2L9H A;  5JH7 F;  1YNN D;  2AUJ D;  4B3S H;  1VQK A;  2HVR A;  2VQE Q;  3GTO B;  1H9R A;  4OO1 G;  4QWB A;  5LL6 X;  3F2D A;  1G6P A;  2C9O A;  4ZRZ A;  2ZJQ A;  3F2U A;  1VQ7 A;  2F0U A;  1W96 A;  1QVC A;  4JI1 H;  5IY0 A;  4MV8 A;  3A54 A;  3QJY A;  2W9B B;  2VUM A;  5K2M A;  1F2L A;  4ECU A;  4P2C B;  2F0Q A;  4DR5 Q;  2PQA A;  1SNP A;  4EQO A;  3VDY A;  2I87 A;  2F0E A;  5M5W H;  4K0K L;  1M7J A;  3IL8 A;  1SNC A;  3I4L A;  2PBZ A;  2R7N A;  4FYD A;  4LFB L;  3QR8 A;  1KJQ A;  2EYJ A;  1ZEQ X;  1HZC A;  2W9A A;  3CCV A;  3PO2 B;  1GYF A;  2L12 A;  2WB1 A;  4DV1 H;  2EVB A;  1U4M A;  3G8C A;  4MTN A;  4QY7 A;  4AH6 A;  5E4W C;  1BCP F;  1NBW A;  1S0N A;  2BA1 A;  1UEB A;  3EVQ A;  3U4Z A;  2W6P A;  4RB0 A;  2JA5 G;  2UUB H;  3S1Q B;  1XYI A;  2JP1 A;  4KKS A;  1KD1 C;  3HOU B;  1TR5 A;  4AIM A;  1NAP A;  3NEN A;  2BA0 A;  3HOX B;  1F9P A;  4X62 L;  5LMN W;  1Q8I A;  2VB3 X;  4ECV A;  1DGS A;  2VQF L;  1GUS A;  3BVG A;  3MXP A;  4JOI A;  4CDC C;  1IHZ A;  4CKE A;  3HKZ G;  5BN5 A;  5IP7 G;  3U4V A;  4RGM A;  3ULL A;  3Q0A A;  4LF6 L;  1IBM L;  1L2Z A;  1JJ2 A;  5FD6 A;  3IG0 A;  2A73 B;  1BNC A;  4XTC S;  2PZW A;  3U58 A;  4MNO A;  1LT4 D;  3RIZ A;  3SGI A;  1JWU D;  1RD9 D;  1AZP A;  4GKJ Q;  1V51 A;  4ETS A;  4R4O A;  1DOL A;  2QK4 A;  1ESF A;  1YHQ A;  1RHP A;  4R9W A;  3HOV H;  4C1N K;  1JE5 A;  1V1O A;  2B2V C;  3S1M H;  1NCV A;  2HCC A;  3M9N B;  1N8R C;  1MBY A;  1B6R A;  4DV3 H;  4JYA Q;  3K7A H;  4F4W A;  3BU2 A;  4J9P A;  1O75 A;  2Q8T A;  2W6M A;  1S3O A;  5M5Y H;  1TXY A;  1KQS A;  3EQL C;  4JW0 A;  3KLS X;  5IP9 G;  2ICE C;  4F7X A;  3NSW A;  1S10 A;  3RLN A;  4PZ6 A;  4RAU C;  5CV4 A;  2H5X A;  1J8I A;  4LAA A;  1EQR A;  1STY A;  2JEG A;  5E7N A;  1BKB A;  5KFS A;  3KHG A;  1KL9 A;  1SFO H;  4UP8 A;  2E2H H;  3HOU H;  3HKS A;  5IYB G;  4J9K A;  2E75 C;  1SMY D;  4DUY H;  1TWG B;  1CA5 A;  1CZW A;  3IN5 A;  5KT4 A;  1XDN A;  1X6O A;  5J22 A;  3ICE A;  2R7Z A;  4JI4 L;  4LF4 Q;  2Y0S A;  3NHH A;  1Y1W H;  1HNZ Q;  1JE4 A;  1S0O A;  1GHJ A;  1SFO B;  5JOB A;  2JA7 B;  4JI5 H;  4TVA B;  1S72 A;  1PH4 A;  1YNJ C;  1Z2O X;  5DM7 3;  1SLJ A;  3I8Z A;  5C0X J;  1KBL A;  3D4R A;  1KAB A;  2HDM A;  4DXF A;  1PH3 A;  2VB2 X;  3TRE A;  2DN8 A;  5KKN B;  4YB8 B;  3PR4 A;  4ED8 A;  1PTO B;  3PVX A;  1NNX A;  5ISR A;  3HOW G;  2BH2 A;  3JRX A;  2JA6 B;  4HMJ A;  4YWL A;  2PQA B;  4M1U B;  1TY2 A;  1PYS B;  1SE3 A;  4LF8 Q;  2L15 A;  1H95 A;  4L63 B;  3VA7 A;  1EFW A;  1TS2 A;  1A63 A;  3I4O A;  2RGV A;  4UP9 A;  4A3G G;  5JJI A;  1PTO D;  3I4M H;  4LF9 Q;  1LTR D;  4QUC A;  4UP7 A;  4WJ3 M;  2CFM A;  1S5E D;  1VCI A;  5EPJ A;  1QNK A;  1WR2 A;  4IRC A;  3HZX A;  5IT9 E;  2G9D A;  3OYY A;  1XTD A;  1GSA A;  4QUF A;  1B33 N;  3RV4 A;  5BMV F;  1TY0 A;  4C2M A;  4O42 A;  3GTO H;  3SK4 A;  3A8J E;  3CPW A;  1FJG L;  1SSO A;  5GAD C;  1XTC D;  1GUG A;  2N88 A;  2A5H A;  3HKZ E;  2VUG A;  4JI1 Q;  3TP8 A;  3IFT A;  3HB9 A;  5KFL A;  3RB6 A;  2L55 A;  1LLR D;  1BNZ A;  4FP5 D;  1SFO A;  4YP3 A;  2K01 A;  4FXG C;  5FLX E;  5D1O B;  1II3 A;  4U7C A;  4O4H F;  3HOZ G;  5KFU A;  4HMI A;  4RH6 A;  2NTT A;  1D1I A;  2UU9 H;  1B9N A;  3LNN A;  1CQJ B;  2NVY A;  4A3E G;  3GV7 B;  1SNM A;  1A2T A;  1VDZ A;  4OEM B;  1S03 G;  1DCZ A;  3O13 A;  4QQB X;  3VR4 A;  2PNR C;  4DR2 H;  4JI0 L;  1A3T A;  4K5X A;  4KI0 A;  1Y1W G;  1PYB A;  3L2P A;  1Q7Y C;  5LMU H;  1E4E A;  5HGQ A;  1EU4 A;  2PI2 E;  4UHV A;  3GTL H;  1IOV A;  4K5W A;  4OEL B;  3DEO A;  5DEH A;  1WTH A;  2C00 A;  3G6Y A;  4MV9 A;  4BBR H;  2KEN A;  3I3C A;  5LMN H;  3T1H H;  4GC7 A;  3OUZ A;  3BYT B;  3DM3 A;  1CUK A;  2RDH A;  2ASB A;  2ATW A;  2NU9 B;  1Y14 B;  1TAE A;  4KY7 A;  1PXU A;  2OEO A;  4TQS A;  1PTO C;  5I47 A;  4F88 A;  4V19 0;  1UE1 A;  1OO9 B;  5DQH A;  5C5M A;  1NR4 A;  1GLV A;  4EBE A;  1KAW A;  1KRS A;  1QE6 A;  3Q8D A;  3GV6 A;  4DR6 Q;  2OLS A;  1X3F A;  3HOZ B;  3H0G G;  2WDT A;  2F0V A;  1I3Q B;  2R61 A;  3BS1 A;  2UUA L;  4QWC A;  3VR6 A;  1J6Q A;  1ESR A;  2UUB L;  1RJP A;  2Q2H A;  4YBZ B;  3D31 A;  1RK5 A;  3GTK B;  1FL0 A;  5DG8 A;  1JOO A;  4GZY C;  3FPP A;  2NVY B;  5BN4 A;  1S9F A;  4DV1 L;  2V59 A;  1V1Q A;  2WB1 G;  2YZG A;  3A7A B;  2B63 B;  4J9N A;  3KJP A;  3V4Z A;  5KFH A;  2DPJ A;  2R7D A;  1VQE A;  5J1Z A;  3JRW A;  5CV8 A;  4B3T L;  2EYF A;  1Q90 A;  4KKT A;  3PO3 G;  1KEE A;  4DUZ Q;  3N6R A;  3PGZ A;  1EWH A;  3PR5 B;  3I91 A;  3CF5 A;  4C3I G;  1Y69 U;  1C7Y A;  2YU9 B;  1JOR A;  4GLA C;  3WO1 A;  2E2I B;  3M3Y H;  1MSG A;  4KHP H;  3N52 A;  4RNM A;  4LF9 L;  1Y8N B;  3A0J A;  3CQZ B;  3S9W A;  3M4O H;  4YHH H;  4GC6 A;  1JIH A;  1LT5 D;  3D6C A;  1EIF A;  3ERO A;  3GTP B;  1ZHS A;  4IUU A;  2HJW A;  2YS6 A;  2E76 C;  4A3M H;  3CCJ A;  1N9W A;  1O7Y A;  1TS3 A;  4JUZ A;  3K0X A;  1Q3L A;  1QZG A;  2KHS A;  1LV9 A;  1BCP B;  2FMM A;  3TZU A;  4JBM A;  1JC7 A;  5JVG 3;  1HNZ H;  1PFS A;  2BE5 D;  1K8A C;  2O4X A;  1BGW A;  3CHB D;  2Q8R E;  2F0J A;  5KG6 A;  3FHW A;  2RSO A;  1I94 L;  3LP8 A;  3K5H A;  5IP7 H;  2EZV A;  2IBK A;  1D1K A;  2X6L A;  4OO1 H;  5EBD A;  4LF9 H;  4NXN Q;  4AYB E;  1VQN A;  4KHP L;  3Q8R B;  4QIW A;  1K3R A;  4A3C H;  3H20 A;  5FO7 B;  5KGU A;  5BR8 Q;  4BS9 A;  4DR4 L;  1CM9 A;  3GTL A;  3J81 W;  4JPB W;  4WD3 A;  4ED1 A;  4EFE A;  3AFP A;  1E0B A;  1KDA A;  2HQL A;  2H1E A;  4ZAI A;  1KNE A;  3MAQ A;  2WTF A;  4GKK L;  1PFN A;  3OSO A;  2EY2 A;  2UUB Q;  2FXQ A;  3PZP A;  2JK8 A;  1DD2 A;  1S5B D;  1EIG A;  5KFF A;  5C4X G;  1KXL A;  4DV5 Q;  5JVD F;  2Z4H A;  2MO0 A;  4LFA H;  2IWH A;  3DEP A;  1CKN A;  2OH2 A;  3NP8 A;  4I4T F;  1EOT A;  2QF7 A;  4MTK A;  3AEV A;  3RJ0 A;  1DV2 A;  3BA9 A;  3GTP A;  1F9Q A;  1SE2 A;  4DAY B;  4L5R C;  4U67 3;  3BZK A;  2DJG C;  4BBR B;  3C46 A;  4TV9 F;  4O2A F;  2PZT A;  3LGJ A;  5M3F G;  5KX5 F;  3AFQ A;  1L1O A;  3EYY A;  3I7F A;  4IZ8 A;  4A3F B;  3J81 i;  4DR1 Q;  1Y1V H;  2AUK A;  3JSL A;  5HBR B;  2E2H A;  3OHA A;  3A5Z B;  4JV0 A;  1L1O C;  1OXS C;  4KJO A;  4FM9 A;  4C2M H;  4UCO A;  1I94 H;  2PZU A;  4G7O C;  1I3Q H;  1CT1 D;  5LMN L;  1UNS A;  1G6Z A;  1TS4 A;  4KKU A;  4X64 L;  5KFR A;  1M4V A;  3ITP A;  3SHL A;  3PF5 A;  2F0D A;  2BE5 C;  4MV3 A;  4DFA A;  5FO8 B;  4K5V A;  1ET6 A;  5M5X H;  3A56 A;  3BZC A;  2EOT A;  1WTP A;  3PW4 A;  1B70 B;  5J3B A;  1QB5 D;  3MWM A;  5BR8 L;  1TWC B;  2NVX B;  2GLT A;  3WOE A;  1RJR A;  1Z2N X;  1PFM A;  4MV6 A;  1MI2 A;  3H3V C;  2D0O A;  3PN1 A;  4Q45 A;  4BY7 G;  4RB3 C;  5A2Q E;  4O3N A;  1EQQ A;  3PIO A;  3HOV G;  5KND A;  4H7B A;  5C0X I;  1I4G A;  1XPO A;  5CBA E;  5KFJ A;  2K4K A;  3S15 H;  2PN1 A;  4I55 F;  4J9L A;  2WAC A;  3AMU A;  1BBW A;  2JYO A;  2PMZ A;  3I4M B;  3NUC A;  1SBB B;  2OT2 A;  1RIP A;  1WD0 A;  4IUT A;  2R7F A;  3L7Z C;  1WCM H;  3TBI B;  3VPD A;  3BG3 A;  3S15 B;  2EXZ A;  1J5E Q;  5C6A A;  4A93 H;  1STB A;  1TU2 B;  3MZ5 A;  3B6Y A;  4A3I B;  1EUC B;  4LF7 H;  4RU9 A;  4QIW E;  4QMG A;  4EQP A;  5KT3 A;  5LYJ F;  2RQX A;  3K5O A;  1GXD C;  4J15 A;  4YCV A;  2N3S A;  3UDX A;  5EKI A;  1HR0 Q;  5BPH A;  5C44 H;  2OF1 A;  2RKS A;  1K8M A;  3AB9 A;  1YI2 A;  2GA4 B;  1XMQ Q;  5EBC A;  3GTQ H;  3RD4 A;  1SR3 A;  3H94 A;  3OTO H;  4C3J B;  1I4Q A;  4OWW B;  4LH6 A;  4ZKB B;  5FLM H;  3SK5 A;  3GTK H;  4C5B A;  3IAY A;  4EGV A;  3RBE A;  1F9R A;  1EFI D;  2QEJ C;  2FMC A;  4BBR G;  3RV3 A;  2TMP A;  4YCU A;  4Q44 A;  1EUJ A;  4BY1 B;  4RHS A;  2JE6 I;  4C3I B;  4IFD I;  5CAE B;  1FNU A;  4O4I F;  1SMY C;  5JEA J;  3JSN A;  5DNF A;  3OUU A;  5C4Z A;  4A2B A;  4HAE A;  3PCO B;  2EQS A;  2DUD A;  1C8C A;  1HRJ A;  1X32 A;  1WTV A;  2EYP A;  3HXL A;  5C4H A;  2PI2 A;  1SNO A;  1P8L A;  1YBY A;  3S1M B;  1G29 1;  4LF8 H;  1EY5 A;  1BF4 A;  4IWX A;  3BZD B;  4XIG S;  5K5P A;  2F0H A;  2H4O A;  3I56 A;  3PW0 A;  1FJG Q;  3V6H A;  3S1Q H;  1FNV A;  1STA A;  3RZO H;  3S16 H;  1AP0 A;  4GN5 A;  2A6E C;  3FKI B;  4A2A A;  3R2T A;  3SK6 A;  4GLV B;  3HOY G;  3ORR A;  4HSP A;  3HOX H;  3QOJ A;  3JAM i;  3E6Z X;  2WV6 D;  3VYT A;  2R92 H;  4DF7 A;  1BDO A;  3GQB A;  4UPA A;  3N43 B;  3R23 A;  1JXL A;  5C0X H;  2FB9 A;  2R7Z G;  3STB C;  4CDD C;  5KG0 A;  1NMF A;  1YNX A;  1AFP A;  3GLK A;  3HEJ A;  1VQP A;  2R82 A;  3Q8Q B;  1LTI D;  3F8N A;  1T94 A;  3CCR A;  1X9N A;  2GPS A;  2YV5 A;  3KTM A;  3MJF A;  3J7Z C;  4JI3 L;  5IYD G;  3RUP A;  4LF6 H;  4IOC A;  1PRT B;  4I7Z C;  3J7A F;  4HYK A;  5IWA L;  3WO0 A;  3OSN A;  4DV1 Q;  2UVW A;  2K5V A;  1HNW Q;  1U4L A;  1OXV A;  3D8G A;  5IGE A;  4N8F A;  5A2Q L;  2VR1 A;  1RL2 A;  2HHH H;  2QDL A;  2RF4 A;  3D6W A;  4DNT B;  4A3E B;  4LF5 H;  1QIL A;  3RUZ A;  1MZB A;  1AE3 A;  2JEB I;  2UXD L;  3I2Z A;  1EUD B;  4JI3 H;  4DUZ L;  4B9X A;  4ECQ A;  4HNU A;  3WDN A;  1VQI A;  1YHB A;  2KOL A;  1HZB A;  4LF5 Q;  2PCF B;  3HBL A;  1A0I A;  5FPR A;  4WJW A;  5KFI A;  1SYG A;  3KF6 A;  3BA8 A;  2FFK B;  2F0F A;  2NU6 B;  2XCP A;  1VS0 A;  2WIN B;  3AQQ A;  2ENB A;  4APV A;  2ALY B;  2MFI A;  3HKZ A;  2ZT9 C;  1CTM A;  4JYA L;  3Q2O A;  4JI5 L;  4CGY B;  5FJ8 G;  4A3B B;  2KCN A;  1MKH A;  2Y0S E;  4DPG A;  1ICF B;  2VUM B;  1B04 A;  5KFB A;  5JJK A;  1VQB A;  1LAC A;  1V4Y A;  4NPS A;  1H9S A;  1TWH A;  1OTC A;  2DNC A;  5HGT A;  1K0S A;  2EJG C;  2AQ2 B;  4A3B H;  2QA4 A;  4ED6 A;  4DAM A;  1E4E B;  5IYB H;  2VQE L;  3FKI G;  1QVF A;  5KFQ A;  1IYU A;  4JOI C;  1AUX A;  3MFI A;  3E9I A;  1HR0 H;  4C3I H;  3CVZ A;  4HNV A;  3TII A;  1TWC H;  2CCZ A;  3W3A A;  4KD4 A;  1WFQ A;  5IYZ F;  1QCB D;  3GTG A;  4B3R H;  4A93 B;  1HQR D;  1SJH D;  2K04 A;  2F3W A;  3JAM c;  1PH9 A;  4OO1 I;  5JEA G;  1I6H H;  2ZDQ A;  5ELD A;  4HTH A;  2Z4I A;  3OWF A;  1VQF A;  2R93 A;  1S5C D;  2WKC A;  1SNQ A;  3PF4 A;  4H02 A;  5IT9 c;  4KHP Q;  4DUY Q;  2SNM A;  5C1O A;  3FDT A;  4R4C A;  4EGJ A;  2F0M A;  3QZ8 A;  2ASD A;  2K5H A;  4C2M B;  2DPI A;  4JG2 A;  3K5I A;  2K5N A;  3H4B A;  2QW7 A;  1IBL Q;  5H80 A;  1NSN S;  1IBM H;  1VQ4 A;  4MV4 A;  4LSA A;  4RNO A;  3P75 A;  3UI2 A;  2BDN A;  2W6Q A;  4A3I H;  2C35 B;  2O5J C;  2B63 A;  3OHB A;  2VQF H;  4RZQ A;  3QWN A;  1IW7 C;  3MVV A;  2SOB A;  1EWI A;  1VQ6 A;  2W9C B;  1G2T A;  1V1P B;  2PMZ E;  2N78 A;  1A9X A;  3CCL A;  1ZYR D;  1I4H A;  4DV7 L;  2K1B A;  2VQF Q;  4BA2 I;  4LSX A;  2ZDG A;  2AGQ A;  3N8D A;  1UNN C;  4ZCK A;  3D0F A;  2W9B A;  2UVU A;  1ONL A;  2YU9 A;  3DHQ A;  3G6X A;  3H6M A;  4F4X A;  1E7Z A;  3K7A B;  3RR5 A;  3CC2 A;  4NXM H;  1WTX A;  1E3P A;  3Q6S A;  5FJ8 H;  5M3F B;  1D5X C;  1EL0 A;  2W7P A;  1ENC A;  4DV4 L;  5DLF A;  1CSQ A;  1WCM A;  3KYH C;  1VQO A;  1RDP D;  2F03 A;  3EFX D;  3I4N B;  3TP6 A;  2FLP A;  2PYK A;  2E5L L;  2CW0 D;  4QGU A;  2R93 H;  2YS7 A;  3H15 A;  1E22 A;  4A3E H;  3AU7 A;  2K50 A;  3M4I A;  4C5A A;  2YTV A;  5LMN Q;  2A6H D;  1D7Q A;  1A3U A;  1SMX A;  2W6O A;  4J1M A;  2P0A A;  1JMC A;  4NP5 A;  1WYD A;  2FK1 A;  4IFD G;  1DXM A;  3K59 A;  3KLW A;  4UCT A;  3M85 A;  4TKO B;  5KFD A;  3GDE A;  4J9O A;  4K0K Q;  1TT2 A;  4G7H C;  2FMA A;  3VR3 A;  2LXK A;  2VPS A;  4IZO A;  4L1K A;  1TWF A;  4O3O A;  1PH1 A;  2I5M X;  3J81 L;  2UU9 Q;  1B44 D;  3MWE A;  5FLM G;  2VOB A;  4A76 A;  1CZG A;  1TWH H;  2VZA A;  1HNX H;  5KIX A;  5EQ0 A;  5HV6 A;  3G4S A;  2JA6 H;  3FPU B;  1I6U A;  4A3K G;  4E6I A;  3RN2 A;  1C0A A;  4DR7 L;  1STE A;  5M3M G;  3OTO L;  2K5Q A;  1STG A;  3A7L A;  4DA2 A;  1K83 H;  4HN7 A;  2OTL A;  4ZQI A;  2M9V A;  2NU8 B;  3U50 C;  5DGB A;  3H0G B;  5KT2 A;  4ZUI A;  1HJP A;  5C4J H;  1D8L A;  5D3D A;  1K3B C;  3DXJ C;  2CWP A;  1A62 A;  5JPN C;  1W2B A;  1RYR A;  2ZJP A;  1ZHQ A;  1XNR L;  4B3R Q;  3FMC A;  2J6S A;  3T53 B;  4A75 A;  2FLN A;  1I6H B;  3R5X A;  3EPG A;  1YJW A;  4R8U B;  2KBN A;  3KK7 A;  1N33 L;  1XNR H;  4U6P A;  2C5C A;  5BN3 A;  2B2Y A;  3HOX G;  3DWP A;  3DMU A;  2PPB C;  4PQX A;  1ICW A;  4PDB A;  1EYC A;  2PW5 A;  2M00 A;  5JJL A;  1BO0 A;  1LO5 D;  2CH4 A;  1I50 B;  4JI7 L;  4RAZ A;  1N34 H;  2F4V Q;  3J7A 5;  4JI8 Q;  1N32 L;  1IYV A;  4AQY H;  1N33 H;  4B3M L;  5KT7 A;  1VQL A;  4YWK A;  2MCT A;  2IMW P;  1QJO A;  4DL7 A;  3RGX A;  1K1S A;  4APM A;  1HHV A;  2B2U A;  1ET9 A;  5KG3 A;  2AQ4 A;  3GTQ A;  2R92 B;  1E24 A;  3K5L A;  3L9A X;  2C28 A;  4IUV A;  4QJF A;  4JI5 Q;  1HNX L;  2A1A A;  3ULJ A;  4J9Q A;  1HZA A;  2M05 A;  2RDJ A;  2IJ0 A;  5T14 A;  5IOD A;  4OL7 A;  1YEZ A;  4R1J A;  3L4K A;  1EY7 A;  2IX3 A;  4Y7N H;  3C3L A;  1IKL A;  3GTL B;  5EOY A;  4XYM B;  3BAA A;  4K2K A;  3MC0 B;  4E4T A;  5I9P A;  3C0F B;  3I55 A;  1PRT D;  3RLF A;  5F2D A;  3BDL A;  1W6J A;  4N9T A;  2SCU B;  4JI2 Q;  1PZK D;  5LA6 F;  2KEC A;  4LMQ D;  4DU9 A;  4UY8 C;  5LOV F;  4GOP A;  1ILQ A;  5ELN A;  2QIL A;  2YL2 A;  2HQE A;  4MA0 A;  1RK6 A;  4Q5V A;  5KFK A;  3H91 A;  4L5S A;  2IY5 B;  2DLN A;  5L1K A;  3U9S A;  4GNX A;  4O2B F;  1X3E A;  2NU7 B;  5KFZ A;  3S1R B;  4DL2 A;  1HUN A;  1KJI A;  2ZTD A;  5I2X A;  3OW2 A;  2G9H D;  4ZQ3 A;  3M4Q A;  1K9M C;  1MIU A;  1HZ9 A;  2AWO A;  3BDO A;  3VR5 A;  3GTQ B;  3ERS X;  1A6X A;  3SI8 A;  4QB4 A;  2SDF A;  2UVR A;  2B63 H;  4IFD J;  3SE7 A;  1JR0 D;  2E2J B;  4F50 A;  3BQ0 A;  2QCP X;  4EYI B;  4IN3 A;  3BYY B;  3K3P A;  4A3B G;  3T51 B;  5EKK A;  1IBK Q;  5D1O A;  1STH A;  2G5D A;  1JX4 A;  4DR7 H;  2R3Z A;  2IA6 A;  1NR2 A;  1EY8 A;  4GOP C;  5GON F;  5I4D A;  2I8C A;  3KAJ A;  3N6X A;  4L8J A;  2DNE A;  5LL6 b;  1X55 A;  5LMU L;  3KF8 A;  3NBH A;  3SE0 A;  1N36 L;  2YYZ A;  4RCN A;  3Q23 A;  1PTO F;  3UFX B;  5M5Y B;  3KAL A;  3H0G A;  3U9T A;  3J80 i;  1I5F A;  4JV5 L;  4HNT A;  4GOP B;  4ID6 A;  1GO3 E;  2ES2 A;  3GP7 A;  2XCA A;  2UXC H;  2AKW B;  3CD6 A;  3I4M G;  3N40 P;  5CBE E;  4RWS C;  4I50 F;  4Q8F A;  4ECX A;  2O5I C;  1UEA B;  3M7N A;  1R4Q B;  1PRT C;  1T3N A;  1UE7 A;  2NZH A;  5AJ3 Q;  4DGZ A;  4Y8V B;  3MEF A;  5FD5 A;  4DV6 Q;  3I4N H;  1EQT A;  3FKI A;  4JV1 A;  1OWT A;  1T5E A;  4DK1 A;  5TSS A;  4N8X 1;  2YYA A;  4P72 A;  2R8J A;  1GSO A;  3KLS A;  1PFB A;  3NWT A;  2UUC L;  4PWQ A;  2JEI A;  2W6N A;  4LF7 Q;  4Y52 H;  1AEX A;  1RCV D;  1C9O A;  3OSP A;  2AMC B;  2V58 A;  3G71 A;  3R93 A;  2E8G A;  5FK9 C;  1B6S A;  1NE3 A;  1SDF A;  4ULL A;  1WCM G;  3GD7 A;  2VUM G;  3TEH B;  2R92 A;  1U4P A;  2FJ2 A;  4J9S A;  1WD1 A;  2C2D A;  4A3F G;  5DAU A;  1AH9 A;  3KF8 B;  3NBH B;  2FPI B;  5KFX A;  3T5H A;  4AQY Q;  1W93 A;  4LUO A;  2EYH A;  1WSC A;  1FVI A;  1E2W A;  2DWC A;  4R8N A;  3S17 B;  3K58 A;  5FLX c;  4LF5 L;  5KFA A;  3J81 E;  4Q8E A;  1L1O B;  1Q12 A;  4CHT B;  1K83 B;  2F0W A;  3T1Y Q;  5C4X B;  1HTL D;  5IGC A;  2Z8L A;  4C3H G;  1MHW C;  1YHA A;  2NZO A;  3NQI A;  4ZLT F;  4RKL A;  1A3V A;  2F0L A;  4DXG A;  4A3M B;  1EYD A;  4DKA C;  1CFM A;  2SEB D;  3S24 A;  3M9O B;  4DUZ H;  3CC4 A;  3RB3 A;  4RZR A;  4JI6 H;  1F2Z A;  1VQM A;  3RAQ A;  3HGB A;  3MEH A;  3CMA A;  3OHX C;  4FS2 A;  2K5D A;  5CV9 A;  3D4D A;  1HUM A;  3S16 B;  2ZDH A;  4IQZ A;  4RG1 A;  1ZQ7 A;  4HID A;  2F0I A;  2F3I A;  5FOB B;  3G6E A;  4Q43 A;  3TRZ A;  4PNY A;  4OX9 Q;  4DV5 H;  2ZTE A;  2K32 A;  2BCO A;  4A3J B;  1G8Z D;  4O4L F;  5C3E G;  4ZI7 F;  2VXW A;  3G6V A;  5J2U F;  3JAM E;  1D6E C;  1BOS A;  3C2P A;  3U9O A;  3DWA A;  1E1O A;  2HCI A;  2W7O A;  1RKN A;  3V96 A;  1I4P A;  4RUC A;  2P5Z X;  4OIK A;  2IHF A;  1Q86 C;  2KQ3 A;  3K7U C;  2F0P A;  1WJJ A;  1O80 A;  4GKJ L;  4X64 Q;  5E1F A;  4X3U A;  1WVL A;  3HOY H;  4JV2 A;  1GUO A;  1FD7 D;  1KLG D;  2CQY A;  5CA0 F;  1SYE A;  2WB1 E;  2D2C C;  2N8N A;  3GTG B;  5C8Y F;  4ODG A;  1B53 A;  1I4R A;  1EWC A;  1K0R A;  1YJ9 A;  2CW8 A;  4DV6 L;  2V5A A;  5ELE A;  3LWU A;  1SYC A;  3UE0 A;  3FRP B;  4DR1 L;  5KFW A;  5KFM A;  2FPP B;  4FNF A;  4ZKC B;  2A19 A;  2ATL A;  4X62 Q;  4ECT A;  1TII D;  4POF A;  4J6H A;  1FNW A;  3KUP A;  2VY3 A;  2HHH Q;  4C56 C;  2WB1 B;  3PIP A;  4ED0 A;  4DV5 L;  5EDW A;  2BQ3 A;  3J80 E;  2WYO A;  4ME6 A;  2ZJR A;  2E2J H;  4JV5 Q;  4ED7 A;  1EIY B;  5C1P A;  2JEJ A;  3K5M A;  2O03 A;  2FK2 A;  4PZ8 A;  2AGO A;  2XRS D;  2YCH A;  3H4D A;  2IX0 A;  1HQM C;  3LML A;  3S1R H;  1XMO Q;  5EWE A;  5I9O A;  1PRT F;  3AYH B;  1BUV T;  1V1P A;  3R5H A;  4ZHQ F;  2VS1 A;  3I73 A;  3HKZ B;  2KED A;  3RFC A;  3K8A A;  3Q24 A;  1D5Z C;  1JJG A;  2IPK D;  2CHB D;  3PUX A;  3PQI A;  3V6K A;  3OW7 A;  2N55 A;  1PH2 A;  4I7H A;  1A15 A;  2B8F A;  1EY0 A;  3FP9 A;  1Q1E A;  3G48 A;  4LFB H;  2Q8I B;  2HIV A;  3P20 A;  1JLL B;  1SYB A;  4KMU C;  4JI4 H;  4IPG A;  5C3E H;  2WAQ E;  5KFE A;  4UFZ A;  1T5X D;  3M4Y A;  3PW7 A;  4DV2 Q;  2RSN A;  1DYQ A;  2YRW A;  2JEF A;  3BVM A;  5GAH C;  1I7L A;  1K28 A;  2K6A A;  3PO2 H;  2Z6B A;  4F4Y A;  2LS0 1;  5M3F H;  1RYS A;  4LWC A;  1TA8 A;  4CDE C;  4KN4 C;  2AU0 A;  1N48 A;  2D5D A;  2UUA Q;  1M6V A;  5KG2 A;  2NN6 G;  1LTT D;  2ZTC A;  4AYB B;  1E4G T;  2XD4 A;  1ZKO A;  1EEF D;  2CVR A;  4I7A A;  4LFC Q;  3HOW H;  2WE6 A;  4QW8 A;  4RB2 C;  4XT1 B;  1EY4 A;  2NVY H;  4EG0 A;  1RF2 D;  1WTO A;  2R7Z B;  3K3V A;  3WNZ A;  2JA9 A;  4X66 Q;  1UC8 A;  1HA5 A;  4YAK B;  4GS3 A;  3S17 H;  1O78 A;  1X3Q A;  4X65 Q;  1N32 H;  3CCS A;  2W9C A;  2K14 A;  4EYH B;  3PSI A;  1CHQ D;  2CW7 A;  2LKV A;  4BXX H;  4K6D A;  5FLX L;  4HR7 A;  2J6U A;  5C3E B;  1F2Y A;  3KJO A;  2EE1 A;  4IPD A;  4YY3 L;  3F8T A;  4ED2 A;  1RJT A;  1X54 A;  2AQ1 B;  1HXY D;  1KDB A;  5IGD A;  3QZ7 A;  4KJN A;  1F9S A;  2B39 A;  1JIC A;  3TP5 A;  1PX2 A;  4FBT A;  4K8I A;  1HR0 W;  4O2D A;  1YNN C;  4DL3 A;  1WI5 A;  2R8K A;  2AQ3 B;  4OX9 H;  4AYB G;  2F4I A;  3NTH A;  1KC8 C;  2KCT A;  3N41 B;  2K28 A;  4A3J H;  1SE4 A;  1H9M A;  2KVM A;  4MA5 A;  2BDO A;  1B2T A;  4UCS A;  2VUM H;  1Y1V G;  3FKI H;  2FHT A;  2F3V A;  3MFY A;  3GTJ B;  3H3V I;  2BQR A;  1S0M A;  2MPM A;  4IPH A;  4B9W A;  1WTW A;  5LP6 F;  2J7Z A;  4NW2 A;  1Z6H A;  1XPU A;  2LSS A;  3UDG A;  4DK3 C;  1B3A A;  3CC7 A;  3MR3 A;  1H9S B;  1TWH B;  5GAE C;  5KFO A;  4G7Z C;  4CKB A;  2R6G A;  3ULP A;  1EEI D;  2K03 A;  2KCC A;  2I5L X;  1LT6 D;  4JI1 L;  3SK8 A;  1SCU B;  2Z0S A;  4IR9 A;  4LNQ A;  2QKI C;  1NY4 A;  5IT9 L;  4DR3 L;  4DR3 Q;  3OPO A;  5IYC H;  1XNQ L;  1E4F T;  5DG7 A;  2ZXR A;  3TS2 A;  1I94 Q;  3CRK C;  5BPF A;  3CAM A;  2JJQ A;  3SEB A;  5I6W A;  1YZ6 A;  3TIN A;  1NMG A;  4ECW A;  4CKC A;  4AQY L;  2JA5 A;  1MJE A;  3QO2 A;  4LK1 C;  3HS0 C;  1BQQ T;  1CSP A;  2HGS A;  1J5E H;  4HIO A;  5L37 A;  1F2M A;  1JKJ B;  4K8J A;  4GNX B;  4ILW A;  1VKZ A;  1BJT A;  2FE3 A;  3GIQ A;  3GTG H;  1PK8 A;  4BBS B;  1PVO A;  1EZ6 A;  1IW7 D;  3M9M B;  5JQW A;  1HNZ L;  4JI3 Q;  4JBK A;  3MR6 A;  3K80 C;  3CRL C;  5C3X A;  4NLG A;  4NXM L;  3TIG A;  2NWG A;  2JN4 A;  1ZYR C;  5CV6 A;  4XQJ A;  4DV2 L;  2UXC Q;  4FF4 A;  1MSH A;  2X69 A;  4WBN F;  3RBD A;  3V4S A;  1I50 H;  3MFH A;  1TKW B;  4IAL A;  2OXP A;  2RHS B;  1GOZ A;  4YHH L;  3PO3 B;  2ID0 A;  4KN7 C;  4DR6 H;  2W8K A;  1AZQ A;  1O7I A;  5EZY F;  4YQW A;  4L6T B;  4DV7 Q;  2QDB A;  4AYB A;  4ECS A;  4M8A A;  1C4Q A;  5M5X B;  1BBX C;  4I65 A;  5IGB A;  4UCU A;  3PUW A;  3N44 B;  1HFG A;  1FGB D;  5JVL A;  1LM0 A;  1NJI C;  4CC5 A;  1C3O A;  2BR0 A;  4GKK H;  3KHH A;  1Y8O B;  4WRD A;  4A3D G;  3W1G A;  4DNR B;  5I6Y A;  4B3T H;  3UE1 A;  1BCP D;  1PV4 A;  2F4V L;  2EPB A;  1N32 Q;  4X65 H;  1S5D D;  3CW2 C;  4A3L H;  1PLF A;  3F1Z A;  2Z6K A;  4A3K B;  3KOJ A;  3ERQ A;  4XQQ A;  5ELO A;  3KBX A;  1V43 A;  1V9P A;  4IFD H;  2C2R A;  5IOC A;  3TP7 A;  1ZET A;  2GVB A;  1VQJ A;  4PMB A;  2HDL A;  2MNA A;  2UUA H;  2CH4 W;  3JC6 6;  1FR3 A;  4JI2 H;  4B3R L;  4R4T A;  5GAG C;  1XPR A;  1IBM Q;  1VQG A;  1RTN A;  2HT1 A;  2J0T D;  2PO4 A;  4B3S Q;  1CKO A;  4GLX A;  1JWM D;  2DJF C;  5IIF A;  3TDQ A;  4HJ8 A;  4LMY A;  3HOW B;  3KBG A;  3GID A;  3Q1K A;  4JI0 H;  2KHI A;  1CQF A;  3DWQ A;  1VQ9 A;  2J6T A;  5COR A;  4DV4 H;  2MHV A;  1PMR A;  5FO9 B;  3CCQ A;  3NXW A;  5E4X A;  1YIT A;  4KD3 A;  3KLR A;  3MHB A;  1M8A A;  1XMQ L;  1VBH A;  1CA6 A;  2DIK A;  4O3R A;  2NVX A;  3BVZ A;  3H40 A;  1V8Q A;  2R8H A;  2B2T C;  2VQE H;  4EQ5 A;  4RAY A;  1CQI B;  1GGO A;  5KFG A;  2LFN A; 
#chains in the Genus database with same CATH homology
 4X6A H;  2JA7 H;  3PO3 G;  4DUZ Q;  2R7Z H;  3PGZ A;  4WJ4 A;  2ZM6 L;  2Y0S G;  2QEX A;  3I55 A;  3CF5 A;  2GN5 A;  1C7Y A;  3RLF A;  4GLA C;  2IX1 A;  1LTL A;  1UE5 A;  4JI2 Q;  3M3Y H;  4DR5 L;  2UXD Q;  2EIF A;  3A0J A;  3J81 j;  4LF9 L;  3GTP H;  3M4O H;  3CCM A;  1UWV A;  1M90 C;  4UY8 C;  5IYD H;  1EIF A;  4GN3 B;  4GOP A;  4A3M H;  5ELN A;  3S1N H;  1BBU A;  1Q46 A;  1N9W A;  3CCJ A;  4L5S A;  3K0X A;  2IY5 B;  1QZG A;  4GNX A;  1YIJ A;  1X3G A;  1Q8K A;  1X3E A;  4QL5 A;  3T1Y L;  4JBM A;  4JI6 L;  3BJU A;  3UDF A;  5IE8 A;  3S14 H;  1HNW L;  1PFS A;  1K8A C;  4DUY L;  4HIM A;  2ZTD A;  3OW2 A;  1K9M C;  4LFB Q;  3M4Q A;  4A3J G;  1MIU A;  1HZ9 A;  2AWO A;  3FHW A;  1I94 L;  3ERS X;  5IP7 H;  1T9H A;  4PZ7 A;  4JI7 Q;  2ZM6 Q;  3ZJY C;  4NXN Q;  2QGQ A;  2CQO A;  2B63 H;  3RNU A;  4IFD J;  4AYB E;  4JCV E;  1VQN A;  4KHP L;  4BY7 H;  2JEA I;  1K3R A;  4A3C H;  2EXD A;  5BR8 Q;  4A3B G;  4DR4 L;  5GRO A;  2AHO B;  4YY3 Q;  1EYG A;  4C3J H;  1KRT A;  1IBK Q;  3GTJ H;  1EOV A;  3AFP A;  1IBL L;  3I4N G;  2HQL A;  4GKK L;  4O0A A;  4A3M G;  4GOP C;  3T1H Q;  1VQA A;  1FGU A;  1ASZ A;  4A4I A;  2UUB Q;  2FXQ A;  2JK8 A;  1X55 A;  5LMU L;  5C4X G;  4DV5 Q;  1KXL A;  1N36 L;  1VQ5 A;  1BVS A;  2MO0 A;  2YYZ A;  3J80 c;  4BY1 H;  2UXB Q;  2IT1 A;  3E9H A;  1PA6 A;  2YTY A;  1CKN A;  1GVP A;  1IZ6 A;  1Z47 A;  3J80 i;  1I5F A;  1YVC A;  4JC0 A;  4P74 A;  3AEV A;  4JBW A;  4JV5 L;  1SN8 A;  4DAY B;  3CQZ H;  1OXU A;  4X65 L;  4GOP B;  1GO3 E;  3BZK A;  1Q82 C;  4NB3 A;  2ES2 A;  2AKW B;  4YWM A;  3CD6 A;  2OWO A;  3PO2 G;  3I4M G;  3LGJ A;  5M3F G;  4B3S L;  1U0L A;  3AFQ A;  1L1O A;  4A3C G;  3I7F A;  5H1S E;  4A3F H;  3W5O A;  2JA7 G;  2JQO A;  3M4P A;  3HOU G;  3M7N A;  1UE7 A;  2NZH A;  3J81 i;  1M1K C;  4DR1 Q;  5AJ3 Q;  4OWX B;  1Y1V H;  1G51 A;  3MEF A;  3S2D H;  4P75 A;  4DV6 Q;  3I4N H;  2VNU D;  3A5Z B;  1W3S A;  1L1O C;  4JI0 Q;  1OXS C;  4C2M H;  4A3I G;  4P72 A;  2BH8 A;  4JI6 Q;  2OCE A;  4TQU S;  3CXC A;  3TQY A;  1IYJ B;  4HJ7 A;  1I3Q H;  2UUC L;  2JA8 H;  4GKK Q;  5LMN L;  4LF7 Q;  1P16 A;  4P73 A;  1CKM A;  2HIX A;  3HFZ B;  2CWA A;  1PH8 A;  2UXC L;  2F52 A;  4BY1 G;  4X64 L;  3KDF B;  4Y52 H;  1C9O A;  1SRU A;  2AMC B;  3L0O A;  3G71 A;  3GO5 A;  2RHQ B;  2E8G A;  3PF5 A;  1NE3 A;  1AE2 A;  1U5K A;  1QUQ B;  1WCM G;  3RLO A;  3GD7 A;  5M5X H;  4LFA L;  2VUM G;  3TEH B;  4X66 L;  3BZC A;  1B70 B;  5J3B A;  1KIX A;  4A93 G;  1PH7 A;  1A8V A;  2E5L Q;  5BR8 L;  4A3F G;  1AH9 A;  4A3D H;  3KF8 B;  2PNH A;  3NBH B;  2XTI A;  4DV4 Q;  4AQY Q;  1PHJ A;  1JT8 A;  2OQK A;  4LUV A;  4NXN L;  2D0O A;  4LUO A;  3STB D;  4BXX G;  4BY7 G;  1FVI A;  3IRB A;  5GQO A;  1EQQ A;  3PIO A;  3HOV G;  2I0Q A;  5C0X I;  5FLX c;  4LF5 L;  1XPO A;  2K4K A;  3S15 H;  1L1O B;  1Q12 A;  4HIK A;  2Q2T A;  3T1Y Q;  1HNX Q;  1BBW A;  4IO9 A;  1MJC A;  3CPF A;  1YHA A;  2NZO A;  1RIP A;  4L5Q A;  3NEL A;  2R92 G;  2R7F A;  3L7Z C;  5IP9 H;  4LF8 L;  1WCM H;  4DKA C;  3J81 c;  4LF7 L;  3S24 A;  3CC4 A;  1J5E Q;  5C0X G;  4DR2 Q;  4A93 H;  2XGT A;  4IJL A;  1VQM A;  4IJH A;  3B6Y A;  4MZ9 A;  3KF6 B;  3CMA A;  4JI2 L;  4QIW E;  3KDF A;  1E1T A;  3HOZ H;  1Q1B A;  3EN2 A;  4JBJ A;  4OXP A;  4RG1 A;  3PV0 A;  4J15 A;  4YCV A;  4HID A;  2N3S A;  2F3I A;  3UDX A;  3G6E A;  1JB7 A;  2V1C C;  1HR0 Q;  3TRZ A;  5C44 H;  4OX9 Q;  2ZTE A;  5C3E G;  1XMQ Q;  1YI2 A;  2KHJ A;  4A3L G;  1XNR Q;  3GTQ H;  1SR3 A;  5EAY A;  3CCE A;  1TWG H;  1E1O A;  4OWW B;  1K73 C;  2NVX H;  1N36 Q;  2UXB L;  2JA8 G;  5FLM H;  2IHF A;  3K81 C;  5HY6 A;  1Q81 C;  1Q86 C;  2CKZ B;  3GTK H;  3K7U C;  1VQH A;  1WJJ A;  5IYC G;  4GKJ L;  4X64 Q;  3CCU A;  3HOY H;  4BBR G;  2IHE A;  4A3K H;  4P71 A;  4YCU A;  4DV0 L;  2WB1 E;  1EUJ A;  4JI8 L;  2N8N A;  4DR6 L;  5M3M H;  2JE6 I;  4PG3 A;  1QZH A;  4IFD I;  1K0R A;  4PMW A;  5JEA J;  3NEM A;  1YJ9 A;  1GD7 A;  2KCM A;  3EIV A;  4DV6 L;  1CKN B;  1L0W A;  3UE0 A;  4DR7 Q;  3PCO B;  2EQS A;  2DUD A;  4L5T A;  3M9B A;  4DR1 L;  2D0P A;  2A19 A;  1IL2 A;  4X62 Q;  4POF A;  3W1B A;  2PI2 A;  1YBY A;  1P8L A;  2VY3 A;  2Z6K C;  3WWV A;  2HHH Q;  1G29 1;  3PIP A;  4HJA A;  4KLK A;  4DV5 L;  1X56 A;  4XIG S;  4OX9 L;  3PUY A;  3I56 A;  2ZJR A;  2E2J H;  4LUZ A;  1FJG Q;  1VQD A;  3S1Q H;  1EIY B;  4JV5 Q;  4R4Q A;  3RZO H;  3S16 H;  1J5E L;  1OXX K;  1VQC A;  1WOC A;  4GN5 A;  4DNI A;  4PZ8 A;  1VQK A;  4GLV B;  3HOY G;  3HOX H;  3JAM i;  1NTG A;  2VQE Q;  2IX0 A;  4ALP A;  2R92 H;  3EBE A;  1XJV A;  4OO1 G;  3S1R H;  4UPA A;  1XMO Q;  3F2D A;  1G6P A;  3AYH B;  2VS1 A;  2ZJQ A;  1VQ7 A;  2R7Z G;  3STB C;  3K8A A;  2B3G A;  1QVC A;  1NMF A;  1YNX A;  5IY0 A;  2JA5 H;  1VQP A;  1GKH A;  1JJG A;  4DR4 Q;  3PUX A;  4GN4 B;  1PH2 A;  3S2H H;  4DR5 Q;  3FP9 A;  1Q1E A;  3G48 A;  2PQA A;  3CCR A;  3VDY A;  3RZD H;  1X9N A;  1Q7Y C;  2HIV A;  2YV5 A;  5C44 G;  1X65 A;  3J7Z C;  4JI3 L;  5M5W H;  5IYD G;  4IPG A;  4IOC A;  4K0K L;  5C3E H;  2MO1 A;  2Q2U A;  2WAQ E;  5IWA L;  4LFB L;  4DV1 Q;  1R9T H;  4DV2 Q;  2K5V A;  4B3T Q;  1HZC A;  1HNW Q;  1OXV A;  5GAH C;  3CCV A;  1RL2 A;  2RF4 A;  3PO2 H;  5M3F H;  1S40 A;  4MTN A;  4QY7 A;  4AH6 A;  1NBW A;  1LYL A;  4LWC A;  2E2I H;  2BA1 A;  2NN6 I;  1UEB A;  3U4Z A;  2NVT H;  1AE3 A;  2JEB I;  2UXD L;  3I2Z A;  2JA5 G;  4DUZ L;  4HJ9 A;  1VQI A;  1YHB A;  2VL6 A;  1HZB A;  1Z9F A;  1KD1 C;  2UUA Q;  4LF5 Q;  4AIM A;  2NN6 G;  1A0I A;  3NEN A;  2UUC Q;  2BA0 A;  2ZTC A;  1N34 L;  4L5R C;  4BBS H;  3KF6 A;  4OON A;  4X62 L;  4RMF A;  1VS0 A;  5LMN W;  3AQQ A;  4ME3 A;  4APV A;  2ALY B;  2MFI A;  4LFC Q;  3HOW H;  1DGS A;  3F2C A;  2VQF L;  4JYA L;  5K36 G;  4JOI A;  4JI5 L;  5FJ8 G;  4HJ5 A;  2NVY H;  3H3V H;  1MKH A;  2WP8 J;  2WFW A;  2Y0S E;  4DPG A;  3HKZ G;  5IP7 G;  3U4V A;  3ULL A;  4LF6 L;  5JJK A;  1VQB A;  2JA9 A;  4X66 Q;  1IBM L;  1JJ2 A;  2D62 A;  4NPS A;  2B63 G;  4GS3 A;  4XTC S;  3S17 H;  1OTC A;  3PUV A;  4MNO A;  3U58 A;  1YJN A;  4X65 Q;  3SGI A;  3CCS A;  4A3B H;  2QA4 A;  2K14 A;  4GKJ Q;  4DAM A;  5IYB H;  4LW1 A;  2VQE L;  4R4O A;  3FKI G;  3PSI A;  3TS0 A;  1QVF A;  4JOI C;  4BXX H;  3E9I A;  5AJ3 L;  3ER0 A;  4C3I H;  1YHQ A;  1ASY A;  4POG A;  1TWC H;  3HOV H;  3KJO A;  1JE5 A;  2CCZ A;  1IBK L;  3S1M H;  3E0E A;  4IPD A;  4YY3 L;  1WFQ A;  3F8T A;  1X54 A;  1N8R C;  3T1H L;  2RCN A;  4YCW A;  1K8G A;  4JYA Q;  3K7A H;  3JAM c;  1PH9 A;  4OO1 I;  3BU2 A;  5JEA G;  4LFC L;  1I6H H;  4C3H H;  1S3O A;  5M5Y H;  1TXY A;  1KQS A;  1HR0 W;  1VQF A;  4O2D A;  5IP9 G;  1WI5 A;  4DV3 Q;  3PF4 A;  4AYB G;  4H02 A;  5LMU Q;  3RLN A;  5IT9 c;  4PZ6 A;  4KHP Q;  2H5X A;  3DLL A;  4DUY Q;  1EQR A;  2KCT A;  1KC8 C;  5E7N A;  4A3J H;  4R4C A;  1BKB A;  2AWN A;  2JA6 G;  4DR2 L;  2K5H A;  1B7Y B;  1KL9 A;  1TWF H;  1SFO H;  4UP8 A;  2E2H H;  4DV0 Q;  3HOU H;  4IOA A;  3HKS A;  5IYB G;  4JG2 A;  2VUM H;  1Y1V G;  2K5N A;  3FKI H;  3H3V I;  4A3G H;  1IBL Q;  4IPH A;  1VQ4 A;  1X6O A;  3ICE A;  3RN5 A;  2LSS A;  4JI4 L;  3UDG A;  4LF4 Q;  1XPU A;  4DK3 C;  4A3I H;  2C35 B;  1Y1W H;  1HNZ Q;  1VQ8 A;  3CC7 A;  5GAE C;  4TVA B;  1S72 A;  1HR0 L;  1PH4 A;  4KHZ A;  1EWI A;  1SLJ A;  2R6G A;  2WAQ G;  4YHH Q;  5C0X J;  3ULP A;  1VQ6 A;  1PH3 A;  2I5L X;  1N34 Q;  1UE6 A;  2PMZ E;  4JI1 L;  3TRE A;  3GTM H;  1OXT A;  2N78 A;  3KFU A;  4BBS G;  2Z0S A;  3CCL A;  4LNQ A;  4DV7 L;  1XNQ Q;  2VQF Q;  4BA2 I;  1NY4 A;  4DR3 L;  4DR3 Q;  5C4X H;  3D0F A;  5IYC H;  1XNQ L;  3HOW G;  2BH2 A;  1E7Z A;  3RR5 A;  3CC2 A;  4YWL A;  1E3P A;  5FJ8 H;  3TS2 A;  2PQA B;  1I94 Q;  1PYS B;  2JJQ A;  2YTX A;  3CAM A;  4LF8 Q;  2L15 A;  1H95 A;  1YZ6 A;  1EFW A;  1NMG A;  1A63 A;  3I4O A;  4DV4 L;  4AQY L;  4UP9 A;  1CSQ A;  1MJE A;  4A3G G;  3KYH C;  1CSP A;  1VQO A;  3I4M H;  5JJI A;  4LF9 Q;  4HIO A;  4UP7 A;  4WJ3 M;  2CFM A;  2E5L L;  1IXR A;  4GNX C;  4QGU A;  2R93 H;  1VCI A;  1GM5 A;  3H15 A;  4GNX B;  1E22 A;  3MXN B;  4A3E H;  3CP0 A;  3GTG H;  2K50 A;  2YTV A;  3OYY A;  1PVO A;  1XTD A;  5LMN Q;  1D7Q A;  1SMX A;  1HNZ L;  4JI3 Q;  4JBK A;  3GTO H;  3K80 C;  4NXM L;  4JI4 Q;  1JMC A;  3CPW A;  4LF4 L;  4IPC A;  3CME A;  1FJG L;  1WYD A;  4DV2 L;  5GAD C;  5DLQ E;  2UXC Q;  4IFD G;  3A5U A;  3KLW A;  3HKZ E;  2LXJ A;  1I50 H;  3M85 A;  3GDE A;  4JI1 Q;  4K0K Q;  2HHH L;  2RHS B;  4YHH L;  2LXK A;  2ID0 A;  1N33 Q;  4EX5 A;  2OTJ A;  1PH1 A;  2I5M X;  1O7I A;  4LFA Q;  2UU9 Q;  5FLM G;  4DV7 Q;  4A76 A;  1TWH H;  2VZA A;  3F2B A;  3HOZ G;  2I5H A;  3G4S A;  3PUW A;  2JA6 H;  1LM0 A;  1NJI C;  1LUZ A;  4A3K G;  3PUZ A;  3RN2 A;  2NVQ H;  1B8A A;  4A3D G;  1C0A A;  4B3M Q;  3W1G A;  4A3E G;  4DR7 L;  5M3M G;  2MQH A;  3UE1 A;  3OTO L;  1PV4 A;  2Q2I A;  2VW9 A;  1XMO L;  2YU9 H;  2F4V L;  1N32 Q;  1SRO A;  2N49 A;  3CW2 C;  4QQB X;  4A3L H;  1K83 H;  4JI0 L;  3H0G H;  3F1Z A;  2OTL A;  2Z6K A;  3U50 C;  3KOJ A;  3OTO Q;  4BA1 I;  1HJP A;  1TWA H;  4KI0 A;  5ELO A;  1PYB A;  1D8L A;  1V43 A;  1V9P A;  2GVA A;  5C4J H;  2CWP A;  1A62 A;  5HGQ A;  3L2P A;  2PI2 E;  3GTL H;  1W2B A;  1KHI A;  2ZJP A;  1XNR L;  4R4I A;  4B3R Q;  2GVB A;  1VQJ A;  3A74 A;  4OWT B;  2MNA A;  4A75 A;  4DV3 L;  3JC6 6;  4BBR H;  2KEN A;  4B3R L;  4R4T A;  1L2F A;  2UU9 L;  5GAG C;  1YJW A;  1XPR A;  1IBM Q;  2KBN A;  1N33 L;  1VQG A;  3DM3 A;  1CUK A;  2OQ0 A;  1PH6 A;  2ASB A;  2ATW A;  2HT1 A;  4B3S Q;  1Y14 B;  3UDI A;  1CKO A;  3PO3 H;  3HOX G;  4GLX A;  4HJ8 A;  1UE1 A;  1HH2 P;  2KHI A;  1VQ9 A;  5JJL A;  1KAW A;  4JI7 L;  2K52 A;  1KRS A;  2F4V Q;  3J7A 5;  3Q8D A;  4JI8 Q;  4DR6 Q;  1N32 L;  4B3M L;  1X3F A;  3H0G G;  1VQL A;  4YWK A;  1SE8 A;  3CCQ A;  1PH5 A;  2R93 G;  1QUQ A;  2K75 A;  2UUA L;  1J6Q A;  1YIT A;  2UUB L;  2Q2H A;  1QVG A;  1E24 A;  4NXM Q;  3D31 A;  1XMQ L;  4QJF A;  4JI5 Q;  1HNX L;  2A1A A;  1FL0 A;  2A8V A;  3ULJ A;  1HZA A;  4DK6 C;  4LF6 Q;  4DV1 L;  1V1Q A;  2WB1 G;  5IWA Q;  1YEZ A;  4R1J A;  4EQ5 A;  4Y7N H;  4FDB A;  1JJC B;  3KJP A;  2DGY A;  1Y1W G;  2R7D A;  1VQE A;  4B3T L;  2B29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...