4BBRG

Structure of rna polymerase ii-tfiib complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 28
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4bbrG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4bbrG01
4X66Q 1HZAA 4IFDJ 1Q12A 5JEAG 3HOVG 4IPGA 5M5WH 4GLXA 4X64Q 3J81i 2EXDA 2NN6I 3RN2A 2VQEL 1OXSC 2VUMG 3M7NA 2KENA 2R7DA 1PHJA 4JG2A 3RLFA 3S1QH 1Q82C 4BY7H 4IPDA 4B3SL 2MNAA 2JA6G 1CUKA 4LFCQ 2VNUD 2EQSA 4LF4Q 4RG1A 3RR5A 3STBD 1W3SA 3W1GA 3J7ZC 1HH2P 4JBJA 4B3TL 3RZOH 1A62A 5C4JH 1PH6A 2VY3A 4DV7Q 2HIVA 4MZ9A 3OTOL 2IT1A 3I4NH 3L2PA 1X3FA 3HOZH 2BH8A 4BBSG 4YCWA 5IP9H 2HHHQ 2JA7H 4DR7L 3T1HL 2UXCL 4JYAQ 4DNIA 4XTCS 4JC0A 4GN5A 1KAWA 2Q2IA 1WI5A 4R1JA 3AQQA 1IBKL 4L5SA 1IBMQ 5LMNL 4DV0L 3GDEA 1K9MC 2JA8G 2RF4A 5C3EH 5AJ3L 4UP9A 1YZ6A 2L15A 3J81j 4DUZL 1V1QA 1EIYB 4LF5L 4K0KQ 2NVYH 4HIMA 1MJCA 1K8GA 3M4OH 3HOVH 4OO1I 4X6AH 1G291 2JA5H 3KLWA 4LF9Q 4YWLA 4JI1Q 1PH4A 2ZM6Q 1N32Q 3D31A 5JJLA 1WFQA 4MNOA 1YIJA 2JA6H 1YI2A 2PMZE 2NVXH 4LFAL 1SN8A 1X55A 3HOUG 4RMFA 3JAMi 2R7ZG 1TWHH 2GVAA 1XMQQ 2PI2E 1P8LA 3OYYA 1XTDA 2ID0A 2DUDA 3PUVA 3TRZA 3PO2G 2JE6I 4B3RL 1L0WA 3PGZA 1TWCH 4BY1G 4JI8L 4AYBG 2HIXA 3CCEA 1XJVA 3CC2A 4JV5Q 4HIDA 1EIFA 1WYDA 4AQYL 1HR0Q 3K81C 4DV5L 3H3VI 2MO0A 5GQOA 5ELNA 3DM3A 4X62Q 4DV6Q 1QVFA 1VQHA 1L1OB 4DUYL 4DR1Q 2AHOB 3UDFA 1IYJB 1KL9A 1N9WA 2AKWB 4BA2I 1S3OA 4DR6L 3FKIG 5IYBG 2ZJQA 1GKHA 3ULPA 3G4SA 4POGA 2YV5A 4YY3Q 4R4QA 2WFWA 2JA8H 3GTPH 3I4MG 2UXBQ 2MQHA 2I5MX 2UUBQ 1HZCA 3GD7A 4OWTB 1FJGL 2KCTA 1LM0A 5C0XG 2JK8A 1IL2A 1K8AC 4A3FH 1HZBA 4QY7A 1MJEA 2FXQA 4L5TA 1VQ9A 2F4VL 1C7YA 1PYBA 1KXLA 3S2HH 3CW2C 1I3QH 4P73A 4PMWA 4LFBQ 5GADC 2NN6G 2YYZA 3HOUH 2N8NA 1X65A 2R7ZH 1QVGA 2VL6A 3ULLA 1PH1A 4KHPL 5M5YH 2VZAA 4JI2Q 4JOIA 1P16A 4IPCA 4R4IA 4DV1Q 4LF6L 4OWWB 2R93H 1JT8A 2PNHA 4L5QA 3KJOA 4AIMA 1NMGA 3S24A 1B7YB 1N34L 4GOPB 4A3LH 2E5LQ 4A3MH 3I4NG 2LSSA 3CPFA 3A0JA 4DV3L 2JQOA 2B63G 4JI3Q 1U0LA 1XPUA 4JI5L 1X9NA 4NXNL 1A8VA 5IP9G 1HNXL 3HOZG 3FKIH 5IYBH 3S16H 4BBRG 3J7A5 2BA1A 4IFDI 2V1CC 1BBUA 5LMUQ 1MIUA 5GAEC 1NJIC 1VQGA 2CQOA 3M3YH 3I4MH 4O2DA 5GAHC 3LGJA 4A93G 4HJ7A 1K83H 4YCUA 1PFSA 3CC4A 2OQKA 2Q2HA 1PH9A 4IJHA 5J3BA 2F3IA 4A3IG 1VQBA 1Y1WH 2YU9H 5C3EG 5M3MH 1A63A 3I56A 1XMOQ 1VQKA 2H5XA 2PI2A 1ASYA 4A3GH 1YHQA 2Z6KA 4OXPA 3OW2A 4KHZA 3PIPA 4DR7Q 2UU9L 3WWVA 3T1HQ 2JA5G 4R4TA 5BR8L 1VQNA 5GROA 4DR3L 4JI7L 1YHAA 4DR5L 4YHHQ 2AMCB 2UUCL 3A74A 1VQJA 2ZTDA 4LF8L 3U4ZA 2B29A 4P74A 4XIGS 4A3JH 4GKKQ 5IYDH 4DR4L 3F2DA 1L1OA 5M3FH 2IX1A 3F2BA 4DR2L 3TS2A 2E2HH 4B3MQ 2D62A 2KCMA 1IBLQ 2VQFL 4BXXH 3CC7A 1TWGH 4C2MH 1VS0A 2K4KA 1OXTA 2Y0SG 3AYHB 1VQCA 3ERSX 1TWAH 4KI0A 1EWIA 5E7NA 1PH2A 2QA4A 4OX9Q 2B63H 1E7ZA 3S1NH 4IPHA 4BBRH 4P75A 1QVCA 1XNRQ 2JJQA 5C0XJ 1X6OA 1Z9FA 1I6HH 3I4OA 4IO9A 2I5LX 3S14H 3CCUA 4P72A 3H15A 4HIOA 4A93H 1OXUA 1NTGA 1N33L 1AH9A 3HOXH 3GO5A 4A3IH 2VW9A 1L1OC 2DGYA 1HNZQ 2R7FA 1FL0A 1I50H 4QL5A 1GM5A 2UXDL 3KF6B 3CCLA 2CWAA 1AE3A 3E0EA 2KBNA 4A3CG 4GKJL 1E22A 1HJPA 1QUQB 4DV5Q 3T1YQ 1DGSA 3K80C 3U4VA 4GLAC 3GTJH 4LF7L 4X66L 4DUYQ 4A3FG 3AFPA 1GD7A 3CAMA 1PH7A 1J5EQ 5IWAQ 4WJ4A 3RLOA 4A3KH 5FLXc 1SMXA 1CSQA 2YTVA 5ELOA 4X64L 3ZJYC 3GTGH 1KHIA 4WJ3M 4GOPA 1N36L 1JJ2A 2OTLA 4L5RC 3J80c 4UY8C 1CKNB 4R4OA 4BA1I 1T9HA 3CPWA 3KOJA 1ASZA 5JJIA 4FDBA 1S72A 3CF5A 3PO3H 4LFCL 4X65Q 3J81c 3EN2A 4AYBE 4YWKA 2R93G 4IOCA 3BU2A 1J6QA 4APVA 3GTLH 4ME3A 2QGQA 4DV7L 4IOAA 1Y1VH 1K0RA 4A3LG 1VQEA 1AE2A 3K7AH 1OXVA 4A3MG 4PZ6A 1KQSA 3H3VH 5C4XH 4A3EG 2HHHL 4GOPC 4YCVA 4NXMQ 4GLVB 4JYAL 4DV4Q 3RNUA 3CXCA 4DKAC 1HNWL 1M90C 1PH5A 1IBML 1RL2A 2UUAQ 3CCQA 4A3CH 1Y1WG 2K5HA 5M3MG 4LUOA 4LWCA 4OWXB 4A3GG 1NE3A 2IHFA 2XGTA 1VQ5A 2OQ0A 2NZHA 1PVOA 1QZGA 5JJKA 4IJLA 3A5ZB 2EIFA 3PF5A 1GO3E 4Y52H 3HOYH 4JI0Q 3G71A 3BJUA 4GS3A 4LF9L 1WCMH 2QEXA 1N32L 3CCSA 1YVCA 2WAQG 5FJ8H 1G51A 1I5FA 1Q7YC 4A3JG 4JI6Q 1Q1EA 1Q1BA 4LUVA 5IYDG 4JI4Q 3E9HA 3AEVA 1WJJA 2E2IH 5IP7G 3U50C 4GNXA 1UEBA 5M3FG 1XMQL 2ZTCA 2JA9A 2ASBA 1X54A 3UDIA 2CWPA 2UU9Q 1UE1A 1VQOA 4BXXG 3HKZG 4OONA 2K75A 3KDFB 2VQEQ 3IRBA 4DR3Q 1FGUA 4HJ9A 4JV5L 3KF6A 4DR5Q 3M4PA 1CKMA 1HR0L 4B3SQ 3PV0A 4LF8Q 1SLJA 4A3EH 1VQ7A 4C3HH 3PF4A 4UP7A 1QUQA 4DV6L 4X62L 4JBKA 2E8GA 3GTQH 3GTOH 4C3JH 4DR1L 3F1ZA 2B3GA 1YNXA 2ATWA 4B3TQ 2Z0SA 1KD1C 2NVTH 1K3RA 1X56A 1IZ6A 3PUWA 1UE6A 1NY4A 2D0PA 4JBWA 4JOIC 4YY3L 3HOXG 1JJGA 2IX0A 2N3SA 2AWNA 1LTLA 5HGQA 3OTOQ 4DV2L 3CD6A 2UXBL 2NVQH 1LUZA 1Y14B 1CKNA 2OCEA 3L0OA 4TQUS 1Q81C 3DLLA 1YITA 3E9IA 2UXCQ 1N8RC 4EQ5A 4OO1G 2RCNA 1PYSB 1SE8A 1X3EA 2HQLA 1Q8KA 1L2FA 4A3KG 1JMCA 1YEZA 3KF8B 4PG3A 3UDGA 3STBC 1FVIA 5C44G 1IBKQ 5LMNQ 1XNQL 4DV0Q 2AWOA 3MXNB 4LFBL 3TQYA 3F8TA 5AJ3Q 2WB1G 5IYCH 2UXDQ 3BZKA 5IP7H 4DUZQ 2YTXA 2Q2TA 1QZHA 3TS0A 4LF5Q 4H02A 3D0FA 3PO3G 4POFA 1CSPA 4EX5A 4TVAB 3Q8DA 2N49A 4JI2L 3H0GH 4PZ7A 3J80i 3I7FA 4A3DH 2Y0SE 2Z6KC 3B6YA 3RN5A 2JEBI 1VQDA 1Z47A 4O0AA 2PQAB 1D8LA 4KLKA 1Y1VG 2GN5A 5HY6A 1VQMA 2E5LL 3KFUA 1VQ6A 5K36G 4Y7NH 2ZJRA 1D7QA 1N36Q 3U58A 1YJNA 1PH8A 4LFAQ 3BZCA 4JI3L 1BVSA 4GNXB 5C4XG 1I94L 2KHIA 4PZ8A 1SFOH 1EQQA 3S1RH 5FLMG 3HOWG 5LMUL 2JEAI 2CCZA 4B3RQ 4GN4B 3NBHB 3PIOA 3A5UA 4JI8Q 3MEFA 3F2CA 3KYHC 3PUYA 1O7IA 3HKSA 1YBYA 1V43A 4J15A 4C3IH 4A76A 4AQYQ 1E1OA 4QJFA 4HJ8A 4UP8A 2XTIA 4HJAA 1XMOL 1VQFA 5IT9c 2OTJA 4DR6Q 2ES2A 3GTMH 3K0XA 5H1SE 1HR0W 1C9OA 2HT1A 3CMAA 3PUZA 5C44H 3GTKH 3HOYG 1M1KC 2IY5B 5M5XH 1A0IA 3KDFA 1WCMG 1SROA 1HNWQ 4YHHL 4DAYB 3CCJA 2K14A 5FJ8G 1H95A 4GKKL 2CFMA 1B8AA 1VQIA 4A3BG 2C35B 4DK6C 4LF4L 1FJGQ 3UDXA 2ALYB 3I55A 1PA6A 4LNQA 2I5HA 3PSIA 3S2DH 1E1TA 1NBWA 4B3ML 1IBLL 2K5VA 2F4VQ 5EAYA 2VUMH 2K5NA 1LYLA 4OX9L 2R6GA 2YTYA 4JBMA 1OXXK 1W2BA 5FLMH 3AFQA 5IY0A 3HOWH 4NPSA 4KHPQ 1XNRL 1YHBA 3M9BA 4QGUA 4LF6Q 3SGIA 4IFDG 1JJCB 1EUJA 1VCIA 4YWMA 4QIWE 3EBEA 1EOVA 1EQRA 3G6EA 1B70B 1N34Q 1HNZL 3CCMA 4JCVE 1PV4A 3W5OA 3K8AA 4DV3Q 4P71A 4K0KL 1RIPA 4BBSH 4JI5Q 1HNXQ 4NXNQ 3T1YL 4DAMA 4UPAA 1XPRA 2A19A 3FP9A 2LXJA 2F52A 3ER0A 1S40A 4JI1L 5IE8A 1J5EL 5IWAL 2ZM6L 1E24A 2WAQE 1X3GA 2R92G 4NB3A 1UWVA 2NZOA 5JEAJ 1HZ9A 2PQAA 2LXKA 1BBWA 4A3BH 4LUZA 3RZDH 4DV2Q 4HJ5A 5IYCG 1MKHA 3G48A 1Q86C 4GN3B 1K73C 1KRTA 5GAGC 1E3PA 4X65L 1V9PA 3M85A 2RHSB 1Q46A 3HKZE 3PCOB 2K50A 3H0GG 1GVPA 4A3DG 2VS1A 1C0AA 5BR8Q 1KIXA 3I2ZA 1EYGA 2MFIA 3NEMA 4JI7Q 1VQ4A 2UUCQ 3UE1A 1UE7A 3JAMc 3TREA 2ZJPA 1XNQQ 2ZTEA 3CP0A 2BH2A 3JC66 1XPOA 1UE5A 4DR4Q 2MO1A 1YJ9A 1G6PA 3W1BA 4BY7G 3RLNA 1VQPA 1BKBA 2E2JH 4AH6A 3K7UC 3CQZH 2KHJA 5LMNW 1IXRA 4DR2Q 4NXML 4DV4L 2N78A 1OTCA 2VQFQ 1JE5A 3PO2H 4GNXC 1YJWA 3L7ZC 4BY1H 3TEHB 3ULJA 4A4IA 4DPGA 1SRUA 1JB7A 2UUBL 4A75A 4R4CA 2UUAL 1VQLA 1SR3A 1NMFA 2OWOA 4QQBX 2RHQB 1KC8C 3M4QA 3PUXA 3VDYA 1PH3A 3FHWA 1CKOA 1I94Q 2JA7G 4LW1A 2R92H 3CCRA 1TXYA 4HIKA 1VQ8A 2D0OA 1N33Q 2I0QA 3NENA 1U5KA 2IHEA 4MTNA 2K52A 4DK3C 3KJPA 4JI0L 3S1MH 2WB1E 1R9TH 2GVBA 2CKZB 3S17H 3CCVA 3UE0A 3S15H 2BA0A 4JI6L 4ALPA 3ICEA 1VQAA 1KRSA 5C0XI 3HFZB 1WOCA 2A1AA 3CMEA 2Q2UA 5DLQE 4JI4L 3EIVA 2A8VA 4GKJQ 4DV1L 3NELA 1EFWA 1TWFH 4LF7Q 2WP8J
chains in the Genus database with same CATH superfamily
4X66Q 1Y1VB 3R2TA 4IPGA 2FMAA 1EY0A 5ELFA 1SYFA 5M5WH 3RN2A 2VUMG 1LTGD 2SDFA 4L8JA 3SE0A 1ZHSA 3RLFA 3S1QH 1LTTD 4K2LA 3HOWB 4BY7H 5KFDA 4FBTA 5JPMC 1W3SA 4MTKA 1IW7D 1HH2P 1WTXA 3GQCA 4KV6A 2EYFA 2V59A 5CBAE 2QYZA 1DOKA 3SVMA 4MZ9A 1O80A 3OTOL 1I6VC 2E2HA 3R5XA 3KHRA 4BBSG 3H0GA 1TWGA 4YJ3F 3I91A 5T1IA 4JC0A 1TWAA 4X66H 2YL2A 2Q2IA 4C56C 1SEIA 4R1JA 3CVZA 1IBKL 2F4IA 4L5SA 1K9MC 3GDEA 2JA8G 3QJYA 2RF4A 3FEWX 2M2LA 4DUZL 1V1QA 2W7OA 4CJ1B 4LF5L 4HIMA 5JVDF 3P20A 5I2XA 1FD7D 3MJFA 1CA5A 3RB6A 2B2TA 2ZM6Q 4FXKC 3D31A 5JVG3 5KFJA 1PMRA 3U9OA 5J22A 4MNOA 3IL8A 3IG0A 2K5WA 2KEEA 2KQ3A 1BF4A 4LFAL 4YJ2F 1EEFD 3GTKA 3JAMi 1IKMA 4ED0A 1KNAA 2PI2E 3LWEA 1N48A 2DUDA 3TRZA 1IOWA 2Z8LA 4XQJA 4YBZB 3BVMA 1L0WA 3R23A 1XJVA 4RH6A 2W70A 4OIJA 3EQLC 3I72A 4HIDA 2R8IA 4TSSA 5GQOA 1HA6A 3DM3A 4DV6Q 1STNA 1TT2A 4DUYL 2YZGA 1KL9A 3D3RA 1LT5D 1N9WA 2AKWB 1S3OA 2C28A 3G4SA 4V190 1STHA 5IGDA 4YY3Q 4OHJA 4ZKCB 2JA8H 3GTPH 3I4MG 2JEIA 2ZM6H 1F2ZA 5DLGA 3FMAA 3OSOA 2UUBQ 3H0GB 3OMCA 1JXLA 4EBCA 4ECVA 3SK8A 4DL2A 2L12A 1EZ8A 1HZBA 4L5TA 4E4TA 2FK2A 4PQXA 5KG5A 3JRWA 3S2HH 3HS0C 4RHSA 4UCRA 5I47A 4ED2A 3A56A 3BDCA 1D6EC 1EIGA 1GUOA 4PMWA 4KTAA 1IYVA 5KFGA 1X65A 1SXTA 2Z4IA 2A68D 3ULLA 1WCMA 3P75A 4KHPL 4DV6H 1CTMA 2VZAA 2XNAC 3NXWA 5KRUA 1H9MA 1KDAA 4R4IA 4LF6L 4OWWB 5EGTA 4L1KA 2PNHA 4L5QA 3KJOA 4XYLB 4K8IA 4AIMA 2A69D 3M7GA 3SDZA 1EUCB 5KFVA 4ECTA 1QNKA 2JA7B 1VMCA 2LSSA 3CPFA 1DV2A 3T5HA 2W9CA 2UUBH 3D6CA 3RF2A 1A8VA 2NU7B 4O3SA 5C5JA 2CQOA 3EPIA 1EYCA 3I4MH 3LGJA 3OSNA 1PFSA 3CC4A 2Q2HA 3MHBA 3KAJA 2PCFB 4ZAIA 4IJHA 1PH9A 2X0SA 4O3PA 4A3IG 4RB3C 1UNSA 1VQBA 3NPPA 4J1MA 4HEDA 1Y1WH 2W7PA 5M3MH 2NVYB 3M4OB 3I56A 3CQZA 1STYA 4R8IA 3ND9A 4EGJA 4EYIB 2UU9L 3T1HQ 2V5AA 2JA5G 1B1ZA 4R4TA 5BR8L 3D4WA 2R8JA 2JA6B 2UUCL 2NVXB 2ZTDA 4MTEA 1EUDB 4A3JH 1IW7C 4GKKQ 1ZQ7A 1ZXTA 2K5QA 1L1OA 4MHEA 4HSVA 2W6ZA 1JC7A 4YAJB 2A5HA 3J80L 4O4IF 3QOJA 2YW2A 1OXTA 5CA0F 1EWHA 1CT1D 2Y0SG 2WINB 3PR4A 2PBZA 1MHWC 2XRSD 3ONAB 2JJQA 1X6OA 4F4ZA 4IO9A 3S14H 1KJJA 2KOLA 4P72A 4F7XA 2FJZA 5BPHA 1OXUA 5KYIA 1Q90A 1AH9A 3T1HH 3HOXH 4A3IH 1HNZQ 2R7FA 5KT5A 3DMUA 1PZKD 4ABNA 3CCLA 2UVVA 4JV0A 1PTOB 5LMNH 2KBNA 3FRPB 2EJMA 4U673 5KFMA 3T1YQ 1QUQB 3BJYA 1DGSA 3K80C 3U4VA 3GTJH 1K8OA 2JEGA 2IP4A 2ICEC 5E3FA 4OO1H 3WO0A 2RDGA 3AFPA 1I3QB 3CAMA 1AN7A 2RDIA 4DAPA 4NLGA 1HTLD 4X64L 5ISRA 3TP5A 4FNFA 4GOPA 2B2UA 4ED6A 1JJ2A 1FNUA 3ITPA 4L5RC 4V0BA 2NWGA 4XQNA 3CPWA 1HRJA 3H09A 1C30A 4AYBB 1PTOF 4ULLA 3WOFA 4DL3A 2EJGC 5KG3A 1E4EB 2V4RA 1QB5D 1J6QA 4APVA 4ME3A 4X3SA 1HPCA 1PDQA 1Y1VH 1K0RA 4Q0FA 3Q8SB 4A3LG 2R7MA 5K36H 5KFZA 4OL7A 1HNZH 4JI8H 5CA1F 1KBLA 2HHHL 4C3HG 3T1YH 2MUYA 2HVRA 4L63B 3RBEA 2NTSA 1M90C 1PH5A 4ECZA 4ECSA 2AU0A 2UUAQ 3R3OA 4XT3B 5G3LD 2PYKA 3J80W 5FLXE 2IX3A 1M0WA 5JJKA 4MA5A 5GONF 1W6KA 4NMZA 2RDHA 1TWCA 4FS2A 2WV6D 1RKNA 1GUTA 2WAQB 4LF9L 1HFNA 1CE8A 3OUZA 3T5LA 2A68C 2QEXA 3V05A 1N32L 4J9KA 2F4VH 2QKIC 1KEEA 2JP1A 1Q1EA 4EBDA 2E2IH 1CHPD 5IP7G 1A3UA 3T56B 3HKZB 1LTBD 2EYJA 4BXXG 2AQ4A 2B63B 1G6ZA 2JXMB 3HOZB 1MGSA 2SNMA 5KT6A 4DR5Q 2B2VA 1AW7A 4FXGC 4LF8Q 2R7KA 4C3HH 2DN8A 2JSOA 3KBXA 4RB2C 1XDNA 4DR1L 3VR6A 4R8NA 5KFAA 1YNXA 3MR3A 1BQQT 4HNVA 3MTSA 1IZ6A 1NY4A 3M9OB 1JOKA 5J1ZA 1SNQA 5EWGA 5HGQA 3OTOQ 1K1QA 2A6HD 1T5EA 1Y14B 1WTHA 3K57A 2KJXA 4HMIA 2RGVA 3DLLA 1EY6A 3E9IA 4LSAA 3TINA 3DUZA 1N8RC 4EQ5A 3GTGB 1PYSB 1SE8A 5I9PA 2HQLA 1L2FA 4A3KG 3KF8B 1IBKQ 3TZDA 5C44G 1FVIA 1XX8A 4X3TA 1TWHB 3TQYA 4JI7H 2YS6A 5I2YA 3FKIA 4DR5H 4K5XA 5IP7H 3T5JA 4DUZQ 4LF8H 4LF5Q 5KFIA 1B9MA 4BWSC 3GV3A 1ESFA 1II3A 3H0GH 2RCFA 4JI2L 1MSGA 2Y0SE 2Z6KC 2LY7A 3B6YA 3MFYA 3RN5A 2YU9A 1VQDA 1NAPA 1NR2A 4KLKA 2E5LL 3KFUA 4HN7A 2NZ1D 3OTOH 1TY0A 3NQIA 4ZLTF 4LFAQ 3BZCA 5KFSA 4Z9CB 2KHIA 2DWCA 1T5XD 5JJZA 1EQQA 1VAJA 2K5DA 1WR2A 2R85A 4YQWA 2IWHA 4GN4B 3PIOA 2R7NA 4KMUC 5E1FA 1IBKH 1N33H 3HKSA 1YBYA 1V43A 4J15A 5CAEB 2K7VA 2L11A 3I4LA 1E1OA 2KVMA 4UP8A 2XIWA 2XTIA 3CKIB 1WTVA 4LF5H 4DL6A 2EOTA 2KCCA 5C5LA 5C44H 3GTKH 1A0IA 1WCMG 1KLGD 1MSHA 3Q6SA 4IURA 2O4XA 5BN3A 2R86A 4DA2A 5M5YB 5FJ8G 1TAEA 2D5DA 1QE6A 2CFMA 2Z1CA 2K6AA 2E2DC 2ALYB 5DNFA 4C1NK 5L1IA 1EU4A 2GA4B 4LFCH 4A3MB 3FDTA 4Q43A 1SNMA 4RGTA 1BUVT 4XX0B 4NKLA 2NBFA 1BCPB 1Z6HA 2K5NA 4DV7H 4RAUC 4XDXA 3GTQB 1OXXK 3A8JE 3M3YB 4PDBA 4KHPQ 2NVTB 1XNRL 1YHBA 4LF6Q 1F2MA 3SGIA 1PRTB 5I6YA 4YWMA 1S10A 1SYEA 1W6JA 4QIWE 5C1OA 1EOVA 1EQRA 1PZID 2VUGA 2F3WA 5KG1A 1RD9D 2DLNA 1PV4A 3W5OA 1BCPF 3V6KA 2M05A 4UPAA 5LL6b 2B8FA 3GTLA 2PNRC 5CV5A 3F8NA 4K6LA 3MWDA 5IE8A 1LTAD 1DD2A 5IWAL 2ZM6L 3CU7A 1PRTF 1Z2OX 2LXKA 1U4MA 5C3XA 5T14A 3DEOA 4LUZA 3G48A 1EEID 4Q5VA 3BZDB 4C2MB 3GTPA 4KHPH 2I8CA 2K50A 4A3DG 2ASDA 1FYCA 2VS1A 5BR8Q 3NBHA 3N8DA 3I2ZA 2MFIA 3DF7A 4APMA 2R84A 4EQNA 2UUCQ 2ZJPA 1UE7A 1S0NA 3Q8RB 3OIQA 3JC66 1UE5A 3W1BA 1U4RA 4Q0YA 2E2JH 4AH6A 3CQZH 2CW0D 2KHJA 1IXRA 2KUMA 3C2PA 2K32A 4OGQC 4ZOLF 3UQ8A 1TKWB 2LFNA 2X6GA 4J9LA 4BY1H 4J9RA 3EVQA 1STBA 4DAYA 4RWSC 2UUBL 2HCIA 4R4CA 2ZXPA 1D2BA 5KT4A 3MA2B 3PW7A 2UXBH 4QQBX 2B2WC 2MP1A 1F9PA 1UAPA 3M4QA 3PUXA 1PH3A 5CBEE 1CKOA 1I94Q 5FK9C 3CCRA 4DGZA 2R7LA 5D1PA 2WB1B 3DXJC 2C2EA 2FFKB 2K52A 5BR8H 2E74C 3CCVA 1SYGA 4ALPA 4G7ZC 1VQAA 2BQRA 1H9SA 5IGFA 1WOCA 3S2DB 5DLQE 1KLUD 3N41B 4O2BF 4JV2A 1K1SA 2L4NA 1H9RA 1HZAA 4G3IA 1V4YA 2VUMB 1Y1WA 5JEAG 3M4IA 4X64Q 3J81i 2EXDA 2NN6I 1BDOA 3Q8PB 2R7DA 2XVSA 3M9NB 3D4RA 4IPDA 4B3SL 1FGBD 3AB9A 1LTID 4FF2A 3TQTA 1CUKA 4LF4Q 3BVGA 3RR5A 4J0MA 3J7ZC 1K28A 4JI3H 4JBJA 1I94H 4B3TL 3RZOH 1VDZA 1JDEA 2WIIB 1F9QA 1Z2NX 3JSLA 1JDBB 4KJNA 1DYQA 3HOYB 3HOZH 2BH8A 2ALZA 2HHHQ 1E4FT 5IGEA 5KFNA 3T1HL 3L3OC 4DNIA 5JVH3 2W6PA 1RDPD 2XD4A 4A3BB 3RGZA 4HNUA 2G9HD 4YR2A 2IW3A 4X64H 5LMNL 1SYXB 5FD5A 5KT7A 5AJ3L 1SFOA 1SJHD 1YZ6A 2FMCA 5EBDA 1B2TA 3RUZA 1F2YA 4U68A 4RB0A 5KG4A 1MJCA 3I3CA 4LF4H 1G291 4CDCC 4CKBA 3KLWA 1FNVA 3LNNA 4HSPA 4LF9Q 4MV1A 4G7HC 1N32Q 3GTJA 1WFQA 1A9XA 2Z4HA 1X55A 4RMFA 4OX9H 1TWHH 2GVAA 1EOTA 1P8LA 3OYYA 3K5LA 4RNMA 1F77A 2ID0A 1CQFA 4JI8L 1DCZA 1TWCH 2HIXA 1V1PA 1EIFA 1DJRD 1WYDA 1TA8A 2OT2A 1M0TA 5ELNA 1QVFA 4BA2I 4DR1Q 2OH2A 1IYJB 4XT1B 3S1MB 3RTXA 3FKIG 2ZJQA 1GKHA 2BQ3A 3QO2A 2W57A 2HQEA 1HCZA 4LF9H 1ZYRD 3RD4A 1J5EH 5DLFA 2N88A 1N32H 2HVSA 2H1EA 2I5MX 2NUAB 2EY6A 2HD3A 2OLSA 4A2BA 1L2ZA 2KCTA 1LM0A 3MFGA 4J6HA 5C0XG 4C5CA 2JK8A 3T5KA 1XWEA 3N6RA 4RKBA 3T13A 1MJEA 5EOYA 3K5MA 4X65H 2F4VL 1KXLA 3J80E 3GILA 1NNXA 1JB3A 3WOEA 3RB0A 2FB9A 3TP7A 4QB4A 3S1RB 3UFXB 2YYZA 5CGKA 2NB0A 4DL7A 3RB4A 3ORRA 5H80A 1PH1A 1UC9A 5M5YH 5C4JB 4JI2Q 1NCVA 4JOIA 4FBUA 1HQMC 1B7YB 2A6EC 1N34L 2E5LQ 1BGWA 4A3MH 3J7AV 1U0LA 2W8KA 1XPUA 1SMYC 3FKIH 4RUCA 3J7A5 2V1CC 1BBUA 3AU7A 1MIUA 3E3XA 2L5TA 3Q1KA 3M3YH 4CC6A 2F3VA 5TSSA 2F3IA 4L6TB 4J9NA 2YU9H 3G6VA 2Z6BA 5C0XH 3C3LA 2F0HA 1VQKA 3HOVB 1G2TA 4X3KA 1AUXA 1D1IA 2BQUA 4OXPA 3OW2A 2F0MA 5DGAA 1QNUA 4JI2H 4WORA 2XRQD 4JI7L 4FYDA 2B39A 4DR5L 2AMCB 1Y8NB 1VQJA 3K5HA 4LF8L 2PPBC 2UVUA 4P74A 2E5LH 5IYDH 3OMGA 5E4XA 1GHJA 3N43B 3F2DA 5FPRA 3RUPA 5L9XA 1IHZA 5HV6A 5M3FH 4B9XA 3F2BA 3TS2A 2SCUB 4CDEC 4C2MH 2R82A 2XCPA 2K4KA 5KKNB 4RGOS 2M9VA 2RQXA 3N44B 1YNJD 4EQOA 3ERSX 1PH2A 3BA9A 1EWIA 4ZI7F 1PFBA 3H40A 2J6UA 2J6SA 1XNRQ 5C0XJ 1I6HH 5DG8A 5C1PA 3RZDB 1N33L 4G57A 1L1OC 3VPCA 1CI3M 4YIJA 4DAVA 4FO2A 1AE3A 2RGRA 2W9BB 1GUGA 4DV5Q 1KIXA 4RAYA 1IYUA 4LF7L 1PRTD 1GD7A 5IWAQ 3RLOA 1AP0A 1SMXA 3V96A 3ZJYC 5KG0A 4WJ3M 3HOUB 2OTLA 2R7ZB 2FE3A 2JA7A 1GHKA 3J80c 4A2AA 4UY8C 3MZ5A 4MV6A 4C5AA 3PO2B 3MXPA 3PMFA 3CF5A 4LFCL 1G8ZD 2PZUA 1SCUB 1T94A 4Q44A 4ECWA 1GGOA 1XNRH 1U4LA 3QR8A 1JKJB 4RUAA 4HCSA 4KK7A 5JPNC 1ILQA 1EY7A 4IOCA 3GTLH 3QOLA 1SSOA 4DV7L 4IOAA 1A6XA 3K58A 2F0FA 2A74C 3EJIA 1VQEA 2X69A 3K7AH 4KKSA 1OWTA 2NVYA 3S16B 1KQSA 3H3VH 4AQYH 5CV8A 4A3EG 1SNCA 4GOPC 2B2UC 3SR1A 4DV5H 2WDTA 3H6MA 1K83B 4GLVB 2F0PA 4HAEA 4CKCA 5I6WA 4EEQA 1B44D 4YB8B 5LL6S 4DR6H 2JA6A 2NTTA 5IWAH 2NVXA 2PW5A 2IL8A 1YNND 2EY5A 2AGQA 2XN9C 1Y1WG 1NSNS 5M3MG 2W6QA 2C2RA 4LWCA 4OWXB 4ED7A 1VQ5A 2OQ0A 1PVOA 1QZGA 2HGSA 4QF4A 3CRLC 1HHVA 3J81W 1ML0D 5DQHA 3G7LA 2QILA 3HOYH 4NDXA 1L0YB 2BE5C 4GS3A 3G71A 1SYBA 3NHHA 2KCNA 3CCSA 3OUUA 1G51A 5LA6F 4A3JG 4LUVA 4M9UA 4XYMB 4GNXA 4WRDA 1XMQL 4IUUA 2JA9A 1X54A 1SEBD 3I4NB 1VQOA 5CV4A 2L55A 2J9GA 2M00A 2YCHA 4BBRB 4EBEA 4B3SQ 1I4GA 4A3EH 3C1FA 1LT3D 1QUQA 4X62L 4A93B 5DM63 1EHIA 2PZTA 4PV1C 4DV3H 3OSPA 2B3GA 2W9AA 4B3TQ 4HR7B 3Q22A 1I3QA 4NXNH 1I50B 5C3EB 2GPSA 1VF5C 1DXMA 3NE5B 3PUWA 3HOXG 2D0PA 4CHTB 1JJGA 2EYPA 2N3SA 4TKOB 2UXBL 4I55F 1PLFA 1LUZA 3GIQA 5F9LA 3RAQA 1Q81C 4AYBA 1EWCA 4F50A 3MR5A 4N8X1 4OO1G 1E4EA 1JLLB 4HNTA 5KFUA 2R61A 1NR4A 3UDGA 5LMNQ 3MXNB 4LFBL 2UXDQ 5AJ3Q 1H9KA 1LABA 5C6AA 2YTXA 1B3QA 4B3SH 1QZHA 1WTQA 1BXRA 2MPMA 4TVAB 4DL5A 4DR4H 2F0WA 2FPIB 1QJOA 4O3OA 4B3TH 2ZT9C 1Z47A 5HY6A 5EPKA 1Y1VG 1X3QA 1VQMA 3BQ2A 1VQ6A 5K36G 2ZJRA 2ASJA 3OWFA 3FMCA 1S0OA 1YJNA 1PH8A 4JI3L 4GNXB 1I94L 1SFOH 3S1RH 3AMUA 4XQQA 3HOWG 2JEAI 5KG6A 3VMMA 5CV7A 3VR3A 2WAQA 4JI8Q 2DNCA 1Y8PB 4CKEA 4XZ3B 1KC7A 4A3FB 1A3VA 4H44C 3SXHA 2UXDH 4BWGB 4QIWA 2RVLA 1ZEQX 1BNCA 3HKZA 4EYHB 1C9OA 4GKJH 2VR1A 2KEDA 2IA6A 4HMJA 1S5ED 2B63A 4IZ8A 3CCJA 4TQRA 2F0LA 2XC9A 1W93A 4R7RA 5C4ZA 4YAKB 3PW0A 1B8AA 2R93B 1SE3A 4LF4L 1ONLA 3SI8A 4DU9A 2JEFA 1PA6A 4LNQA 1EYZA 2I5HA 1WD0A 4RAZA 4NW2A 1E1TA 5JVLA 1QWYA 3A8IE 1IBLL 4RU9A 2F4VQ 2F0JA 1PK8A 3GIMA 3MWYW 1LYLA 1CS0A 4OX9L 5DGBA 3GTOB 2R6GA 4HCEA 3K6OA 2FMMA 3HOWH 4KN4C 3JRXA 1RYRA 2V9WA 3CHBD 3JAML 3K5NA 1JJCB 3GTGA 2AUJD 2ICIA 4DFAA 3KF8A 3G6EA 2NVQB 1B6SA 4ZYSA 2F0SA 1N34Q 4A3GB 1TWHA 1O7ZA 1STAA 2WACA 1IBMH 3K8AA 4XXEA 1RIPA 5EWEA 3V2TA 1QG7A 4DAMA 3J7YW 1XPRA 4O2AF 4QW8A 4WD3A 2LXJA 1ULZA 3BDOA 1J5EL 1BO0A 1EY5A 1X3GA 2DY7A 1UWVA 2G5DA 1ESRA 1BBWA 3RZDH 4RGNA 4DV2Q 2CQYA 1Q86C 1K73C 4N9PA 4CJ0B 1ZHQA 4RB1A 2A69C 2WTFA 1ENFA 4X65L 4IUNA 3M85A 2RHSB 4XYQA 2AQ2B 1Z2PX 3PCOB 3H0GG 3MFHA 3S1NB 1EYGA 4EFBA 4RCNA 3I70A 4JI7Q 4Y7NB 3CRKC 1VQ4A 5KFYA 1XNQQ 1N34H 2ZTEA 1G91A 1I7LA 2HUGA 4ZCKA 4JV5H 1WTOA 1YJ9A 3TBIB 5EZYF 1VQPA 3F2UA 3KAKA 2CW7A 4DV4L 1OTCA 3PO2H 4GZYC 2OEOA 1YJWA 3TEHB 3ULJA 1JB7A 2V58A 1SRUA 3BQ0A 3Q0AA 4A75A 2ZJTA 1SR3A 4DNTB 4DV2H 4ME5A 2OWOA 1CQJB 2RHQB 1O78A 2QDLA 2PQEA 5KFXA 5F2DA 1KC8C 5FO9B 3Q8QB 3RAXA 3FHWA 2JA7G 4HIKA 5FPOA 2D0OA 5L37A 1N33Q 3P1HA 4DK3C 4YP3A 3KJPA 1S68A 1LTRD 5CV9A 5EDWA 4F4WA 1UC8A 3PO3B 4M8AA 2BA0A 3JAMW 1XNQH 3ICEA 3GTQA 2E76C 4LJZC 4J9OA 3HFZB 2A1AA 5EQ0A 3CMEA 4QWCA 1T3NA 1Y69U 3NELA 3NK9A 2L1BA 3I8ZA 4QUCA 3LWBA 1B04A 4LF7Q 2WP8J 2TSSA 2W71A 3RJ0A 1B53A 1GUSA 5KFQA 1OXSC 3SK4A 3M7NA 5C4XB 2KENA 1PHJA 5BPFA 2YZNA 4JG2A 1Q82C 4KD3A 2JA6G 4LH6A 4MV3A 4LFCQ 2VNUD 5KFPA 4RG1A 3W1GA 3STBD 1S5CD 3Q24A 2ZDHA 2DPJA 4IZOA 1A62A 2C5CA 3E6ZX 3BG3A 1CHQD 1PH6A 5LMUH 1SAPA 2VY3A 4DV7Q 2J6TA 2WYOA 1D1KA 1E0BA 2IT1A 4EG0A 4F4XA 4BS9A 3I4NH 2FKLA 3L4KA 3L2PA 1TVXA 5IP9H 2JA7H 4C2MA 1M6VA 1TS2A 4O1NA 1F9SA 4LF7H 2K33A 1KAWA 4MTDA 2F0DA 1HUMA 5DAUA 2BOSA 4UFZA 1D5XC 1DONA 3H20A 4DV0L 2TMPA 2EYHA 3L4JA 5C3EH 4UCVA 4UP9A 3PZPA 3L9AX 2NVYH 3M4OH 4Y8VB 1K8GA 3IAYA 3G6YA 4OO1I 4WJWA 5KG7A 1JOQA 5T1GA 1SBBB 2KHSA 4YWLA 5E4WC 2R8KA 2CQAA 3NTIA 5L1KA 4B3MH 3VPBA 4C3JB 2JA6H 3I73A 1W96A 1GLVA 1TS3A 2PMZE 2NVXH 1SN8A 2SNSA 2O2LD 2VPQA 4Q45A 2HJWA 1XMQQ 2ZDGA 1XTCD 4J9MA 5KGUA 1XTDA 2WB1A 3PUVA 2JE6I 4IRCA 3PGZA 4I65A 4BY1G 4AYBG 1JCKB 4KKUA 5LL6X 3CC2A 4RZRA 3IN5A 3QIAA 4AQYL 2OF1A 2B2YA 4DV5L 2VOBA 2MO0A 4J8QA 4OIKA 4X62Q 2R92B 4P2CB 2AHOB 4DR6L 2VUMA 4K2KA 2B8GA 4FVMA 3S17B 3HP3A 2YV5A 2WFWA 2AGPA 1AUVA 2UXBQ 1EY8A 2MQHA 1TWFB 1LT4D 3A55A 4OWTB 1PTOH 1IL2A 3MEHA 1HUNA 5M5WB 2O5IC 3DEPA 1TU2B 3C0FB 4A3FH 1XMQH 4QY7A 4ECXA 1VQ9A 1I4HA 2ZXRA 1I4PA 3S1QB 1I6UA 1I3QH 4BY7B 4LFBQ 4O4HF 5GADC 2F0EA 1QOHA 3GIKA 3NUCA 4ZKBB 1QVGA 2F1MA 2VL6A 4X62H 1PFMA 5KFOA 4DV1Q 2A6HC 1GOZA 1P16A 4IPCA 1S97A 2R93H 1JT8A 4C3IB 1JX4A 3K3PA 4NXMH 3R8BA 5JQWA 5BMVF 3S24A 1SDFA 1KJ9A 2PO4A 2JEJA 3BYYB 4O42A 1EL0A 1PX2A 3A0JA 4DV3L 1R4QB 2B63G 4JI3Q 1AFPA 1E4GT 4HTHA 4JI5L 4NXNL 1HNXL 3HOZG 4ETSA 3DM1A 2QCPX 3D8GA 2J4XA 3ETHA 4H7BA 2OQKA 3E5SA 5J3BA 4JI0H 2WKDA 5KX5F 4RCOA 3SHLA 1A63A 5D1OB 4LFBH 1TS5A 2ZXOA 1ASYA 4A3GH 1MI2A 1TR5A 1KNEA 4C1NI 4DNRB 2Z6KA 1YHQA 4DL4A 1ENAA 1SNDA 3EROA 3PIPA 4DR7Q 1E2VA 3MR2A 4DV1H 1IOVA 5KIXA 1NUCA 2FK3A 3P7JA 3ERQA 2K28A 3U4ZA 1PTOD 2B29A 1EYDA 4DR4L 3N40P 1JE4A 2N55A 1LT6D 4RNNA 4UCUA 5J2UF 1SE2A 2IX1A 2FLLA 2D62A 5IGGA 1IBLQ 1AEXA 1S5BD 2VQFL 5KT3A 1G2SA 3UI2A 1VKZA 2X6LA 3PIP3 1VS0A 4BBSB 5L1LA 4LMQD 3AYHB 3EA6A 1JIHA 1VQCA 4KI0A 2B63H 5E7NA 4OX9Q 3S1NH 3KXYT 2QA4A 4ME6A 4MV7A 2R3ZA 1RYSA 1BOSA 4P75A 1QVCA 4I7HA 5F9NA 1Z9FA 1LTSD 1OO9B 2I5LX 3CCUA 2JA8B 4DR7H 1WSCA 5A2QL 3O13A 3MC0B 3EFXD 4ZRZA 1GM5A 2UXDL 4IQZA 3KF6B 5EWFA 3E0EA 4IHJF 2MGSA 3Q23A 2AQ1B 4A3CG 4GKJL 1E22A 2W6OA 1RHPA 5ELBA 4GLAC 4MAMA 1VMPA 3RB3A 4ZQ3A 1S5FD 3S2HB 5I9OA 3J7AF 1J5EQ 1PH7A 4WJ4A 5HBRB 1IBLH 1CSQA 3GTGH 2P5ZX 1KHIA 4O3QA 2PN1A 1SYCA 2AGOA 1CA6A 1CKNB 4BA1I 1MZBA 4RKLA 5JJIA 4FDBA 3PO3H 4X65Q 3J81c 3EN2A 2EYLA 4AYBE 5LXTF 4ZUIA 5C4HA 1KJ8A 3GIPA 3GV6A 1V51A 3K3VA 5KG2A 4B3RH 1AE2A 1LACA 3LP8A 4A3MG 4G4KA 2B2TC 1WTPA 5C4XH 5J2TF 3I4MB 4YCVA 1R9TB 2I87A 5LP6F 2QEJC 4JYAL 4DV4Q 4DKAC 4WBNF 1RTNA 1SNPA 1F9RA 4JV1A 1IBML 1KDBA 2L9HA 4A3CH 4EEYA 1U4PA 2F0KA 1SYDA 4LAAA 4TV8F 4H13C 3PW5A 1DOLA 4OEMB 2K03A 3TDQA 2NZHA 3A5ZB 2EIFA 5CB4F 3TP6A 3PF5A 1GO3E 2RA4A 1FJGH 2RDFA 4Y52H 2RKSA 2DPIA 3BJUA 1U9RA 4A3JB 3TP8A 4ZUJA 4FF1A 2CW0C 1CM9A 5A2QW 2JN4A 4R8UB 5IYDG 1KJQA 3E9HA 3AEVA 2ATLA 3FVQA 4JK1C 4IUQA 5M3FG 4ID6A 2QF7A 2YZMA 5KFCA 4PMCA 5EJWA 2ASBA 1VF7A 3UDIA 2CWPA 4QUFA 5KFRA 4DV4H 4X3UA 3NWTA 5KFFA 4EFEA 4GC6A 2MJ8A 2K75A 3KDFB 4DR3Q 3IRBA 3MWEA 1FGUA 3TN2A 3GLKA 4UDUC 5EKIA 4JV5L 2I80A 3HXLA 3M4PA 1CKMA 1HR0L 3KALA 1HXYD 3PV0A 3NQTA 1VQ7A 3PF4A 2W9BA 4UP7A 2E8GA 3GTQH 4C3JH 1UEAB 3F1ZA 4A3IB 2OXPA 1KD1C 4K8JA 1K3RA 2NVTH 1ZETA 5DG9A 4JBWA 1UE6A 2A73B 2D9UA 3VYRA 3H4BA 2AWNA 3GP7A 5KYLA 4DV2L 3CD6A 2R7ZA 5JAVA 5J39A 3L0OA 4TQUS 2JA5B 1GYFA 3PQIA 3DWAA 1C8CA 4FP5D 2KECA 2RCNA 4O4LF 5KFBA 1Q8KA 1GJXA 4PG3A 1XNQL 1WH2A 4J9SA 2F0OA 4DV0Q 2AWOA 3G8CA 4DR3H 4IR9A 3F8TA 2WB1G 5IYCH 2Q8IB 3BZKA 4TUYF 5DEHA 1HTPA 4N9TA 1EIHA 4POFA 1S9FA 1CSPA 5BN4A 3SE7A 2Y0SB 2N49A 4DN4M 4PZ7A 3J80i 2BDOA 3I7FA 3JAME 4I50F 1K83A 4PNYA 4DR2H 1ENCA 4IAJA 2PQAB 4KKTA 5CYUA 3J81L 4MV8A 5JUMA 2I07B 1B9NA 2XWBB 1F2LA 1N36Q 2F0QA 1DZ1A 5EKKA 4UCTA 3I12A 1A3TA 4RZQA 3HB9A 5LMUL 4IUTA 1STGA 2J7ZA 2WE6A 3MWMA 1BCPD 3MEFA 2NU6B 1ET6A 3PUYA 1O7IA 2DJFC 2O5JC 1S4ZA 3IFDA 4C3IH 4AQYQ 1V1OA 4DV0H 1H9JA 1J9OA 4QJFA 4ZK9B 2K05A 4HJ8A 1XMOL 5IT9c 4QWEA 4DR6Q 2ES2A 5H1SE 3G6JB 1HR0W 2HT1A 2C2DA 3CMAA 1Q3LA 3PUZA 2IY5B 3HOYG 3BG5A 2FK1A 3Q2OA 1HNWQ 4YHHL 1AZQA 2K14A 3NP8A 2E2IB 1H95A 5KFTA 1VQIA 4A3BG 1N36H 3UDXA 3I55A 3PSIA 3KLSX 3S2DH 4HR7A 1SE4A 4B3ML 3V6HA 1I50A 4FF3A 5EAYA 3BA8A 2VUMH 2CVRA 4C3HB 3BABA 4O3NA 4JW0A 4U7CA 4OELB 3KLRA 2K01A 4JBMA 2PMZB 1K0SA 1W2BA 3GIIA 1FKAH 1ZYRC 3AFQA 3R93A 3IFTA 1ICFB 1CFMA 4NPSA 3BQ1A 4QCLA 1K3BC 4QGUA 4QIWB 5KEEA 4IFDG 1E2ZA 2C22A 1EUJA 1VCIA 2NU9B 2IJ0A 5L1JA 3EBEA 5COYA 3MXNA 4MIUA 3BDLA 1HNWH 4WFN3 5HURA 1EQTA 1SJED 1SNOA 4DV3Q 4BBSH 4JI5Q 1HNXQ 4NXNQ 2DNEA 4K6DA 4ED8A 1DM0B 3MFIA 3SK5A 3FP9A 1PFNA 2L0CA 3ER0A 2QDBA 5FOBB 1E24A 2VB2X 3NTKA 1HZ9A 3QWNA 4ILWA 3M9MB 4DF7A 4A3BH 2LMCB 4MV4A 2F0GA 2E2HB 1KRTA 4DK1A 1EYAA 5GAGC 3H94A 4TRDA 1TWGB 4DXFA 2W6MA 3N42B 1ZKOA 3LWUA 4M1UB 5LHY1 1C0AA 1GVPA 2LS01 1TWAB 4CJ2C 4JVZA 1KDCA 4S3SA 2V4QA 3RBDA 3UE1A 3JAMc 2MCTA 2YYAA 1JORA 1RF2D 4DR4Q 1G6PA 3T51B 4IFDH 1BKBA 2J0TD 1HNXH 4JI5H 1BXTA 3K7UC 4NXML 4I4TF 3PR5B 4IALA 4K5WA 2VQFQ 1JE5A 1LLRD 4A4IA 1KAAA 4YY3H 4KY6A 2R93A 2EYMA 1NMFA 2K04A 1MBYA 5D8DA 5LYJF 5KNDA 2B2VC 4A3KB 4ED1A 5C44B 3GTKB 3K0YA 1KABA 4LW1A 1TXYA 1VQ8A 3H91A 2I0QA 1EFID 1U5KA 2IHEA 4JI0L 3S1MH 2CW8A 3KUPA 1GUNA 2WB1E 5IT9L 1R9TH 2GVBA 2R6FA 4QMGA 4K14A 3UE0A 5C3WA 4JI6L 3G6XA 3GTOA 2HDLA 1KRSA 5C0XI 1C4QA 4JI4L 5DG7A 1GXDC 2A8VA 4GKJQ 3EIVA 4DV1L 2BCOA 1YNJC 2KA7A 1EFWA 1RJRA 4JCVE 1CQIB 3MR6A 4IFDJ 1Q12A 3HOVG 2EDGA 4YR3A 3J7AK 4GLXA 2VQFH 2YS7A 3OHAA 1DOMA 2VQEL 2FPPB 2MNAA 3OPOA 2RSNA 1BCPC 2EQSA 4Q8FA 2HCCA 1K8MA 1I4QA 5IOCA 3N6XA 1A15A 2BR0A 4QWBA 5C4JH 3HBLA 1MD2D 3M4YA 4EVOA 4I7AA 2HIVA 3MXUA 3HGBA 1E2WA 5DQGA 1PRTC 2EY1A 1BBXC 4QW9A 1X3FA 2VB3X 4YCWA 4DR7L 1WCMB 2UXCL 4JYAQ 4XTCS 4GN5A 1I4XA 1TY2A 1WI5A 1R4PB 3AQQA 2GPWA 1IBMQ 4LK1C 4FXDA 2EJFC 4J9PA 2L15A 3J81j 2W9CB 3A7AB 3X3NA 1EIYB 4K0KQ 3V4SA 2YRWA 4GKKH 3VYUA 2EE1A 1WD1A 3HOVH 4X6AH 3E0JA 2JA5H 2JYOA 4JI1Q 1PH4A 5CORA 3RMHA 5JJLA 4FS1A 5EBCA 1YIJA 1YI2A 2E2JB 3VR2A 3GTMA 2XSCA 3VR4A 1RJTA 3CQZB 5IT9W 1M8AA 1X32A 3HOUG 2RBMA 1YNNC 2R7ZG 1ILPA 1HQRD 2PW7A 4BY1B 2W6NA 1JICA 3PO2G 1DV1A 4B3RL 3GV5B 4JYAH 3NSWA 3CCEA 5M9OA 4JV5Q 4MV9A 1HR0Q 4KY7A 2XWJB 3K81C 4IUPA 2LKVA 2FHTA 3H3VI 3VPDA 3NGDA 1TS4A 1VQHA 1L1OB 4K0KH 3EPGA 3UDFA 4JPBW 4RGMA 4U6PA 3MAQA 3LMLA 5IYBG 4POGA 3ULPA 4RA8A 2XCAA 3BS1A 1PXUA 4R4QA 5FO8B 4JI1H 3MXGA 3TIIA 2G9DA 4ECQA 4ECUA 4ZQIA 4GC7A 5NUCA 1HZCA 4A3DB 4EGQA 1N56A 4IUVA 3GD7A 1FJGL 4YR0A 1S5DD 3QZ7A 3R5FA 4HQ6A 1K8AC 2C9OA 4IN3A 5IIFA 1GUWA 2B2YC 1QILA 2FXQA 2O03A 1HA5A 3U9SA 1PYBA 1C7YA 3CW2C 5ELEA 4P73A 1EY9A 2NN6G 4IWXA 1S03G 3HOUH 1HR0H 2N8NA 3JSNA 1GSOA 1EY4A 2R7ZH 3H3VC 5CMDA 3GV8B 2ZDQA 3OHBA 4EGVA 1EZ6A 3RZOB 5IODA 5EPLA 5A2QE 3ORQA 5LOVF 1NMGA 4KD4A 2V4DA 4GOPB 4A3LH 1JWMD 3C46A 3GTMB 3I4NG 1LO5D 5HGTA 5EPJA 2JQOA 3TZUA 5DQIA 4CDDC 1WTRA 1X9NA 2UUAH 5ELCA 5IP9G 5M5XB 5IYBH 3S16H 4BBRG 4IFDI 2BA1A 2SOBA 4ODGA 5LMUQ 1NJIC 5GAEC 4TV9F 1VQGA 2ENBA 3QB3A 4O2DA 5GAHC 4A93G 1UUPA 4HJ7A 1K83H 2AUKA 3I90A 4YCUA 2EZVA 3KK7A 2W8LA 3ND8A 5C3EG 4CC5A 1XMOQ 4H0LC 2H5XA 2PI2A 4FU0A 4XYOA 4KHZA 1C3OA 3KHGA 3WWVA 4N8FA 1VQNA 5FD6A 5GROA 4DR3L 4KY5A 3ZYYX 4UCSA 5KFWA 2YRXA 1ICWA 1YHAA 2NN6H 4YHHQ 1C48A 3A74A 1GSHA 4XIGS 4R9WA 2IMWP 2UVRA 1L0XB 3HZXA 1JWSD 1WTWA 2R92A 1RCVD 3VA5A 1TWCB 4DR2L 2E2HH 1EQVA 2KCMA 1EU3A 3TSSA 1LV9A 4B3MQ 4G7OC 4BXXH 3K5IA 3CC7A 5D14A 1TWGH 2P0AA 2PZWA 1TWAH 1E7ZA 1TWFA 3RGXA 4IPHA 4BBRH 1RODA 5KFKA 1XMOH 1Y8OB 2KSWA 5D65A 3I4OA 4A93H 3N52A 3H15A 4HIOA 3BVZA 1NTGA 1RTOA 3A7LA 4ECRA 2HDMA 3GO5A 2VW9A 1TQOA 2DGYA 4QL5A 1FL0A 1I50H 2RSOA 1B4OA 2BDNA 3RV4A 5KFEA 4YHHH 2R8HA 3VA7A 1STEA 2CWAA 3QG1A 2HVQA 4DXGA 2I46A 3BYTB 3X3MA 1HJPA 1RJPA 2CHBD 4DUZH 4X66L 1D5ZC 4DUYQ 4A3FG 3GQBA 1AZPA 1O75A 3WO1A 1IL8A 4FM9A 3KBGA 4B9WA 4A3KH 5FLXc 2YTVA 5ELOA 5C8YF 4QWAA 1ET9A 1N36L 2VQDA 4DLKA 4R4OA 1T9HA 2QK4A 3KOJA 2FJ2A 3PIO3 1ASZA 1GSAA 1S72A 2F03A 4LFAH 4YWKA 5K5PA 2R93G 4UCOA 4I7ZC 3BU2A 2EY2A 3VYTA 5DM73 3RV3A 2QGQA 3SEBA 1OXVA 5D1OA 3FKIB 1A2TA 4PZ6A 2R87A 3ETJA 2FLNA 2DIKA 4NXMQ 3JZIA 3S15B 4RNOA 3RNUA 3CXCA 4DUYH 3PVXA 1HNWL 5C5MA 2YU9B 4QWDA 3OW7A 5IGBA 1BR9A 1Z7TA 1I4RA 1RL2A 2NUCA 3T53B 3CCQA 2K5HA 4LUOA 2F0TA 3RIZA 4A3GG 1NE3A 2IHFA 2XGTA 4IJLA 4CGYB 5ELDA 1AN8A 1CZWA 1JQYD 2EPBA 4JI0Q 1WCMH 2FINB 4FF4A 3QFFA 1FNWA 1EZ1A 3J81E 1YVCA 2WAQG 3D6WA 5FJ8H 1I5FA 1Q7YC 4JI6Q 1Q1BA 5M3FB 4JI4Q 3FDSA 1WJJA 1TIID 3U50C 1UEBA 2H4OA 5FO7B 2ZTCA 3A8KE 1CZGA 2UU9Q 1UE1A 2CH4A 4LF6H 3R2IA 1O7YA 3HKZG 4OONA 4RHRA 2C00A 2VQEQ 3EYYA 4ED3A 4UHVA 4HJ9A 3PN1A 4ZHQF 3GV7B 3KF6A 1SLJA 1V8QA 1I6HB 3QZ8A 1XXGA 1IKLA 3HG9A 4CBVA 4DV6L 2AQ3B 2F0VA 4JBKA 3GTOH 3V4ZA 2EYOA 2ATWA 2Z0SA 3NTHA 5I4DA 1X56A 2CZGA 2VPSA 4YY3L 4JOIC 4F88A 2IX0A 5KFLA 1LTLA 1I7NA 4PMBA 2NVQH 1X3PA 2IBKA 3IKJA 1CKNA 2OCEA 5D3IB 3NWSA 4F8MA 4JI6H 2D2CC 2F0IA 4PWQA 1YITA 4JI4H 3V6JA 3R5HA 1M7JA 2A6ED 2UXCQ 5D3DA 3H4DA 1X3EA 3A54A 5IYZF 1S0MA 1KTKA 1JMCA 2UU9H 2WKCA 1CK1A 1YEZA 2Z9HA 2EVBA 3STBC 2RDJA 1BNZA 1B6RA 1SMYD 2E75C 3TIGA 3WNZA 2VQEH 3OIPA 1VBHA 2UUCH 5FKAC 2VA3A 4IR1A 5FLXL 2Q2TA 3TS0A 4H02A 3D0FA 5AFWA 3VYSA 3PO3G 3DWPA 2ASLA 1R9TA 3GTLB 4EX5A 3Q8DA 3VR5A 4A3DH 4M7EA 4Q8EA 3OWEB 2SEBD 4IWYA 4CDFC 3K7AB 2F0UA 2JEBI 3FPPA 1B50A 4O0AA 4DK0A 1D8LA 2GN5A 4EQPA 4Y7NH 1D7QA 5KNCA 3U58A 1BVSA 2CH4W 3W2DA 5C4XG 4PZ8A 5FLMG 3KHLA 3GTPB 2XIGA 2CCZA 5K2MA 2UXCH 4B3RQ 3NBHB 5CV6A 3A5UA 3SK6A 3F2CA 1JR0D 3KYHC 4F87A 4IRDA 4A76A 5KT2A 4R8UA 4LSXA 2XGPA 4HJAA 2OTJA 1VQFA 3GTMH 3K0XA 5KNBA 1RJQA 5CR3A 1M1KC 5M5XH 3KDFA 3KLSA 1SROA 3T16A 2QW7A 4DAYB 4KHVA 4GKKL 2C35B 4DK6C 1FJGQ 2FPGB 5JH7F 2NU8B 1XYIA 2DY8A 1NBWA 5JEAH 2K5VA 5IGCA 2EXZA 4E6IA 3D4DA 4A3EB 3PW2A 1CQVA 3GIJA 2YTYA 2JA5A 1H9SB 5FLMH 5IY0A 1DIKA 3TMEA 3M9BA 4C3JG 2IPKD 3W3AA 2HHHH 4IRKA 4MN3A 1Y1WB 5FLXW 5M3MB 1VBGA 1B70B 5IT9E 1HNZL 3LX0A 5A35A 4JUZA 1A2UA 3CCMA 4O3RA 5KFHA 1UNNC 4P71A 4K0KL 3T1YL 4RFBA 2Y0SA 2F0NA 1T36A 1O7LA 2A19A 1B3AA 2NYZD 2F52A 3RFCA 1S40A 4JI1L 1Y1VA 2FLPA 4HYKA 2R92G 2WAQE 3K59A 4NB3A 2NZOA 1KJIA 5JEAJ 3GIDA 5JOBA 2PQAA 2UVWA 2Q8TA 2PVPA 3KTMA 5EKLA 4F4YA 2VA2A 3DHQA 4HJ5A 4KN7C 5IYCG 1MKHA 1HFGA 3K5OA 3FPUB 4GN3B 2DJGC 3DWQA 1E3PA 1M4VA 1V9PA 1Q46A 1JOOA 3HKZE 3E5NA 4C5BA 5CC4A 3NEMA 1J8IA 3HRZC 2B2WA 3NBIA 4K5VA 3TREA 3CP0A 3OHXC 3URYA 1SFOB 2BH2A 3S14B 1B33N 1XPOA 1BJTA 2MO1A 4MA0A 4BY7G 3RLNA 2BE5D 3HOXB 1D5MC 4UAIA 4DR2Q 5LMNW 2GLTA 3PW4A 1FR3A 2N78A 3S9WA 4ECYA 4DR1H 4GNXC 1RK5A 1PYWD 3L7ZC 3MVVA 3OOCA 4DPGA 3GTJB 3HEJA 5BN5A 2E2IA 4C3IG 1VQLA 2UUAL 5G3LF 1WVLA 1PZJD 4KJOA 1PTOC 3T4AC 3VDYA 2R92H 2MHVA 2FP4B 3BAAA 4LMYA 3NENA 3C1EA 4MTNA 1JWUD 4B08A 2XGQA 4J9QA 1RK6A 2XCLA 1Q8IA 3S17H 2CKZB 4TQSA 3U9TA 3KHHA 3S15H 2DZDA 4LH7A 1V1PB 2Q8RE 2K1BA 2R8GA 2VXWA 2PMZA 1QCBD 2Q2UA 3WDNA 4NP5A 1TWFH 3TQ1A
chains in the Genus database with same CATH topology
4X66Q 1HZAA 4IFDJ 1Q12A 5JEAG 3HOVG 4IPGA 5M5WH 4GLXA 4X64Q 3J81i 2EXDA 2NN6I 3RN2A 2VQEL 1OXSC 2VUMG 3M7NA 2KENA 2R7DA 1PHJA 4JG2A 3RLFA 3S1QH 1Q82C 4BY7H 4IPDA 4B3SL 2MNAA 2JA6G 1CUKA 4LFCQ 2VNUD 2EQSA 4LF4Q 4RG1A 3RR5A 3STBD 1W3SA 3W1GA 3J7ZC 1HH2P 4JBJA 4B3TL 3RZOH 1A62A 5C4JH 1PH6A 2VY3A 4DV7Q 2HIVA 4MZ9A 3OTOL 2IT1A 3I4NH 3L2PA 1X3FA 3HOZH 2BH8A 4BBSG 4YCWA 5IP9H 2HHHQ 2JA7H 4DR7L 3T1HL 2UXCL 4JYAQ 4DNIA 4XTCS 4JC0A 4GN5A 1KAWA 2Q2IA 1WI5A 4R1JA 3AQQA 1IBKL 4L5SA 1IBMQ 5LMNL 4DV0L 3GDEA 1K9MC 2JA8G 2RF4A 5C3EH 5AJ3L 4UP9A 1YZ6A 2L15A 3J81j 4DUZL 1V1QA 1EIYB 4LF5L 4K0KQ 2NVYH 4HIMA 1MJCA 1K8GA 3M4OH 3HOVH 4OO1I 4X6AH 1G291 2JA5H 3KLWA 4LF9Q 4YWLA 4JI1Q 1PH4A 2ZM6Q 1N32Q 3D31A 5JJLA 1WFQA 4MNOA 1YIJA 2JA6H 1YI2A 2PMZE 2NVXH 4LFAL 1SN8A 1X55A 3HOUG 4RMFA 3JAMi 2R7ZG 1TWHH 2GVAA 1XMQQ 2PI2E 1P8LA 3OYYA 1XTDA 2ID0A 2DUDA 3PUVA 3TRZA 3PO2G 2JE6I 4B3RL 1L0WA 3PGZA 1TWCH 4BY1G 4JI8L 4AYBG 2HIXA 3CCEA 1XJVA 3CC2A 4JV5Q 4HIDA 1EIFA 1WYDA 4AQYL 1HR0Q 3K81C 4DV5L 3H3VI 2MO0A 5GQOA 5ELNA 3DM3A 4X62Q 4DV6Q 1QVFA 1VQHA 1L1OB 4DUYL 4DR1Q 2AHOB 3UDFA 1IYJB 1KL9A 1N9WA 2AKWB 4BA2I 1S3OA 4DR6L 3FKIG 5IYBG 2ZJQA 1GKHA 3ULPA 3G4SA 4POGA 2YV5A 4YY3Q 4R4QA 2WFWA 2JA8H 3GTPH 3I4MG 2UXBQ 2MQHA 2I5MX 2UUBQ 1HZCA 3GD7A 4OWTB 1FJGL 2KCTA 1LM0A 5C0XG 2JK8A 1IL2A 1K8AC 4A3FH 1HZBA 4QY7A 1MJEA 2FXQA 4L5TA 1VQ9A 2F4VL 1C7YA 1PYBA 1KXLA 3S2HH 3CW2C 1I3QH 4P73A 4PMWA 4LFBQ 5GADC 2NN6G 2YYZA 3HOUH 2N8NA 1X65A 2R7ZH 1QVGA 2VL6A 3ULLA 1PH1A 4KHPL 5M5YH 2VZAA 4JI2Q 4JOIA 1P16A 4IPCA 4R4IA 4DV1Q 4LF6L 4OWWB 2R93H 1JT8A 2PNHA 4L5QA 3KJOA 4AIMA 1NMGA 3S24A 1B7YB 1N34L 4GOPB 4A3LH 2E5LQ 4A3MH 3I4NG 2LSSA 3CPFA 3A0JA 4DV3L 2JQOA 2B63G 4JI3Q 1U0LA 1XPUA 4JI5L 1X9NA 4NXNL 1A8VA 5IP9G 1HNXL 3HOZG 3FKIH 5IYBH 3S16H 4BBRG 3J7A5 2BA1A 4IFDI 2V1CC 1BBUA 5LMUQ 1MIUA 5GAEC 1NJIC 1VQGA 2CQOA 3M3YH 3I4MH 4O2DA 5GAHC 3LGJA 4A93G 4HJ7A 1K83H 4YCUA 1PFSA 3CC4A 2OQKA 2Q2HA 1PH9A 4IJHA 5J3BA 2F3IA 4A3IG 1VQBA 1Y1WH 2YU9H 5C3EG 5M3MH 1A63A 3I56A 1XMOQ 1VQKA 2H5XA 2PI2A 1ASYA 4A3GH 1YHQA 2Z6KA 4OXPA 3OW2A 4KHZA 3PIPA 4DR7Q 2UU9L 3WWVA 3T1HQ 2JA5G 4R4TA 5BR8L 1VQNA 5GROA 4DR3L 4JI7L 1YHAA 4DR5L 4YHHQ 2AMCB 2UUCL 3A74A 1VQJA 2ZTDA 4LF8L 3U4ZA 2B29A 4P74A 4XIGS 4A3JH 4GKKQ 5IYDH 4DR4L 3F2DA 1L1OA 5M3FH 2IX1A 3F2BA 4DR2L 3TS2A 2E2HH 4B3MQ 2D62A 2KCMA 1IBLQ 2VQFL 4BXXH 3CC7A 1TWGH 4C2MH 1VS0A 2K4KA 1OXTA 2Y0SG 3AYHB 1VQCA 3ERSX 1TWAH 4KI0A 1EWIA 5E7NA 1PH2A 2QA4A 4OX9Q 2B63H 1E7ZA 3S1NH 4IPHA 4BBRH 4P75A 1QVCA 1XNRQ 2JJQA 5C0XJ 1X6OA 1Z9FA 1I6HH 3I4OA 4IO9A 2I5LX 3S14H 3CCUA 4P72A 3H15A 4HIOA 4A93H 1OXUA 1NTGA 1N33L 1AH9A 3HOXH 3GO5A 4A3IH 2VW9A 1L1OC 2DGYA 1HNZQ 2R7FA 1FL0A 1I50H 4QL5A 1GM5A 2UXDL 3KF6B 3CCLA 2CWAA 1AE3A 3E0EA 2KBNA 4A3CG 4GKJL 1E22A 1HJPA 1QUQB 4DV5Q 3T1YQ 1DGSA 3K80C 3U4VA 4GLAC 3GTJH 4LF7L 4X66L 4DUYQ 4A3FG 3AFPA 1GD7A 3CAMA 1PH7A 1J5EQ 5IWAQ 4WJ4A 3RLOA 4A3KH 5FLXc 1SMXA 1CSQA 2YTVA 5ELOA 4X64L 3ZJYC 3GTGH 1KHIA 4WJ3M 4GOPA 1N36L 1JJ2A 2OTLA 4L5RC 3J80c 4UY8C 1CKNB 4R4OA 4BA1I 1T9HA 3CPWA 3KOJA 1ASZA 5JJIA 4FDBA 1S72A 3CF5A 3PO3H 4LFCL 4X65Q 3J81c 3EN2A 4AYBE 4YWKA 2R93G 4IOCA 3BU2A 1J6QA 4APVA 3GTLH 4ME3A 2QGQA 4DV7L 4IOAA 1Y1VH 1K0RA 4A3LG 1VQEA 1AE2A 3K7AH 1OXVA 4A3MG 4PZ6A 1KQSA 3H3VH 5C4XH 4A3EG 2HHHL 4GOPC 4YCVA 4NXMQ 4GLVB 4JYAL 4DV4Q 3RNUA 3CXCA 4DKAC 1HNWL 1M90C 1PH5A 1IBML 1RL2A 2UUAQ 3CCQA 4A3CH 1Y1WG 2K5HA 5M3MG 4LUOA 4LWCA 4OWXB 4A3GG 1NE3A 2IHFA 2XGTA 1VQ5A 2OQ0A 2NZHA 1PVOA 1QZGA 5JJKA 4IJLA 3A5ZB 2EIFA 3PF5A 1GO3E 4Y52H 3HOYH 4JI0Q 3G71A 3BJUA 4GS3A 4LF9L 1WCMH 2QEXA 1N32L 3CCSA 1YVCA 2WAQG 5FJ8H 1G51A 1I5FA 1Q7YC 4A3JG 4JI6Q 1Q1EA 1Q1BA 4LUVA 5IYDG 4JI4Q 3E9HA 3AEVA 1WJJA 2E2IH 5IP7G 3U50C 4GNXA 1UEBA 5M3FG 1XMQL 2ZTCA 2JA9A 2ASBA 1X54A 3UDIA 2CWPA 2UU9Q 1UE1A 1VQOA 4BXXG 3HKZG 4OONA 2K75A 3KDFB 2VQEQ 3IRBA 4DR3Q 1FGUA 4HJ9A 4JV5L 3KF6A 4DR5Q 3M4PA 1CKMA 1HR0L 4B3SQ 3PV0A 4LF8Q 1SLJA 4A3EH 1VQ7A 4C3HH 3PF4A 4UP7A 1QUQA 4DV6L 4X62L 4JBKA 2E8GA 3GTQH 3GTOH 4C3JH 4DR1L 3F1ZA 2B3GA 1YNXA 2ATWA 4B3TQ 2Z0SA 1KD1C 2NVTH 1K3RA 1X56A 1IZ6A 3PUWA 1UE6A 1NY4A 2D0PA 4JBWA 4JOIC 4YY3L 3HOXG 1JJGA 2IX0A 2N3SA 2AWNA 1LTLA 5HGQA 3OTOQ 4DV2L 3CD6A 2UXBL 2NVQH 1LUZA 1Y14B 1CKNA 2OCEA 3L0OA 4TQUS 1Q81C 3DLLA 1YITA 3E9IA 2UXCQ 1N8RC 4EQ5A 4OO1G 2RCNA 1PYSB 1SE8A 1X3EA 2HQLA 1Q8KA 1L2FA 4A3KG 1JMCA 1YEZA 3KF8B 4PG3A 3UDGA 3STBC 1FVIA 5C44G 1IBKQ 5LMNQ 1XNQL 4DV0Q 2AWOA 3MXNB 4LFBL 3TQYA 3F8TA 5AJ3Q 2WB1G 5IYCH 2UXDQ 3BZKA 5IP7H 4DUZQ 2YTXA 2Q2TA 1QZHA 3TS0A 4LF5Q 4H02A 3D0FA 3PO3G 4POFA 1CSPA 4EX5A 4TVAB 3Q8DA 2N49A 4JI2L 3H0GH 4PZ7A 3J80i 3I7FA 4A3DH 2Y0SE 2Z6KC 3B6YA 3RN5A 2JEBI 1VQDA 1Z47A 4O0AA 2PQAB 1D8LA 4KLKA 1Y1VG 2GN5A 5HY6A 1VQMA 2E5LL 3KFUA 1VQ6A 5K36G 4Y7NH 2ZJRA 1D7QA 1N36Q 3U58A 1YJNA 1PH8A 4LFAQ 3BZCA 4JI3L 1BVSA 4GNXB 5C4XG 1I94L 2KHIA 4PZ8A 1SFOH 1EQQA 3S1RH 5FLMG 3HOWG 5LMUL 2JEAI 2CCZA 4B3RQ 4GN4B 3NBHB 3PIOA 3A5UA 4JI8Q 3MEFA 3F2CA 3KYHC 3PUYA 1O7IA 3HKSA 1YBYA 1V43A 4J15A 4C3IH 4A76A 4AQYQ 1E1OA 4QJFA 4HJ8A 4UP8A 2XTIA 4HJAA 1XMOL 1VQFA 5IT9c 2OTJA 4DR6Q 2ES2A 3GTMH 3K0XA 5H1SE 1HR0W 1C9OA 2HT1A 3CMAA 3PUZA 5C44H 3GTKH 3HOYG 1M1KC 2IY5B 5M5XH 1A0IA 3KDFA 1WCMG 1SROA 1HNWQ 4YHHL 4DAYB 3CCJA 2K14A 5FJ8G 1H95A 4GKKL 2CFMA 1B8AA 1VQIA 4A3BG 2C35B 4DK6C 4LF4L 1FJGQ 3UDXA 2ALYB 3I55A 1PA6A 4LNQA 2I5HA 3PSIA 3S2DH 1E1TA 1NBWA 4B3ML 1IBLL 2K5VA 2F4VQ 5EAYA 2VUMH 2K5NA 1LYLA 4OX9L 2R6GA 2YTYA 4JBMA 1OXXK 1W2BA 5FLMH 3AFQA 5IY0A 3HOWH 4NPSA 4KHPQ 1XNRL 1YHBA 3M9BA 4QGUA 4LF6Q 3SGIA 4IFDG 1JJCB 1EUJA 1VCIA 4YWMA 4QIWE 3EBEA 1EOVA 1EQRA 3G6EA 1B70B 1N34Q 1HNZL 3CCMA 4JCVE 1PV4A 3W5OA 3K8AA 4DV3Q 4P71A 4K0KL 1RIPA 4BBSH 4JI5Q 1HNXQ 4NXNQ 3T1YL 4DAMA 4UPAA 1XPRA 2A19A 3FP9A 2LXJA 2F52A 3ER0A 1S40A 4JI1L 5IE8A 1J5EL 5IWAL 2ZM6L 1E24A 2WAQE 1X3GA 2R92G 4NB3A 1UWVA 2NZOA 5JEAJ 1HZ9A 2PQAA 2LXKA 1BBWA 4A3BH 4LUZA 3RZDH 4DV2Q 4HJ5A 5IYCG 1MKHA 3G48A 1Q86C 4GN3B 1K73C 1KRTA 5GAGC 1E3PA 4X65L 1V9PA 3M85A 2RHSB 1Q46A 3HKZE 3PCOB 2K50A 3H0GG 1GVPA 4A3DG 2VS1A 1C0AA 5BR8Q 1KIXA 3I2ZA 1EYGA 2MFIA 3NEMA 4JI7Q 1VQ4A 2UUCQ 3UE1A 1UE7A 3JAMc 3TREA 2ZJPA 1XNQQ 2ZTEA 3CP0A 2BH2A 3JC66 1XPOA 1UE5A 4DR4Q 2MO1A 1YJ9A 1G6PA 3W1BA 4BY7G 3RLNA 1VQPA 1BKBA 2E2JH 4AH6A 3K7UC 3CQZH 2KHJA 5LMNW 1IXRA 4DR2Q 4NXML 4DV4L 2N78A 1OTCA 2VQFQ 1JE5A 3PO2H 4GNXC 1YJWA 3L7ZC 4BY1H 3TEHB 3ULJA 4A4IA 4DPGA 1SRUA 1JB7A 2UUBL 4A75A 4R4CA 2UUAL 1VQLA 1SR3A 1NMFA 2OWOA 4QQBX 2RHQB 1KC8C 3M4QA 3PUXA 3VDYA 1PH3A 3FHWA 1CKOA 1I94Q 2JA7G 4LW1A 2R92H 3CCRA 1TXYA 4HIKA 1VQ8A 2D0OA 1N33Q 2I0QA 3NENA 1U5KA 2IHEA 4MTNA 2K52A 4DK3C 3KJPA 4JI0L 3S1MH 2WB1E 1R9TH 2GVBA 2CKZB 3S17H 3CCVA 3UE0A 3S15H 2BA0A 4JI6L 4ALPA 3ICEA 1VQAA 1KRSA 5C0XI 3HFZB 1WOCA 2A1AA 3CMEA 2Q2UA 5DLQE 4JI4L 3EIVA 2A8VA 4GKJQ 4DV1L 3NELA 1EFWA 1TWFH 4LF7Q 2WP8J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 Q;  1HZA A;  4IFD J;  1Q12 A;  5JEA G;  3HOV G;  4IPG A;  5M5W H;  4GLX A;  4X64 Q;  3J81 i;  2EXD A;  2NN6 I;  3RN2 A;  2VQE L;  1OXS C;  2VUM G;  3M7N A;  2KEN A;  2R7D A;  1PHJ A;  4JG2 A;  3RLF A;  3S1Q H;  1Q82 C;  4BY7 H;  4IPD A;  4B3S L;  2MNA A;  2JA6 G;  1CUK A;  4LFC Q;  2VNU D;  2EQS A;  4LF4 Q;  4RG1 A;  3RR5 A;  3STB D;  1W3S A;  3W1G A;  3J7Z C;  1HH2 P;  4JBJ A;  4B3T L;  3RZO H;  1A62 A;  5C4J H;  1PH6 A;  2VY3 A;  4DV7 Q;  2HIV A;  4MZ9 A;  3OTO L;  2IT1 A;  3I4N H;  3L2P A;  1X3F A;  3HOZ H;  2BH8 A;  4BBS G;  4YCW A;  5IP9 H;  2HHH Q;  2JA7 H;  4DR7 L;  3T1H L;  2UXC L;  4JYA Q;  4DNI A;  4XTC S;  4JC0 A;  4GN5 A;  1KAW A;  2Q2I A;  1WI5 A;  4R1J A;  3AQQ A;  1IBK L;  4L5S A;  1IBM Q;  5LMN L;  4DV0 L;  3GDE A;  1K9M C;  2JA8 G;  2RF4 A;  5C3E H;  5AJ3 L;  4UP9 A;  1YZ6 A;  2L15 A;  3J81 j;  4DUZ L;  1V1Q A;  1EIY B;  4LF5 L;  4K0K Q;  2NVY H;  4HIM A;  1MJC A;  1K8G A;  3M4O H;  3HOV H;  4OO1 I;  4X6A H;  1G29 1;  2JA5 H;  3KLW A;  4LF9 Q;  4YWL A;  4JI1 Q;  1PH4 A;  2ZM6 Q;  1N32 Q;  3D31 A;  5JJL A;  1WFQ A;  4MNO A;  1YIJ A;  2JA6 H;  1YI2 A;  2PMZ E;  2NVX H;  4LFA L;  1SN8 A;  1X55 A;  3HOU G;  4RMF A;  3JAM i;  2R7Z G;  1TWH H;  2GVA A;  1XMQ Q;  2PI2 E;  1P8L A;  3OYY A;  1XTD A;  2ID0 A;  2DUD A;  3PUV A;  3TRZ A;  3PO2 G;  2JE6 I;  4B3R L;  1L0W A;  3PGZ A;  1TWC H;  4BY1 G;  4JI8 L;  4AYB G;  2HIX A;  3CCE A;  1XJV A;  3CC2 A;  4JV5 Q;  4HID A;  1EIF A;  1WYD A;  4AQY L;  1HR0 Q;  3K81 C;  4DV5 L;  3H3V I;  2MO0 A;  5GQO A;  5ELN A;  3DM3 A;  4X62 Q;  4DV6 Q;  1QVF A;  1VQH A;  1L1O B;  4DUY L;  4DR1 Q;  2AHO B;  3UDF A;  1IYJ B;  1KL9 A;  1N9W A;  2AKW B;  4BA2 I;  1S3O A;  4DR6 L;  3FKI G;  5IYB G;  2ZJQ A;  1GKH A;  3ULP A;  3G4S A;  4POG A;  2YV5 A;  4YY3 Q;  4R4Q A;  2WFW A;  2JA8 H;  3GTP H;  3I4M G;  2UXB Q;  2MQH A;  2I5M X;  2UUB Q;  1HZC A;  3GD7 A;  4OWT B;  1FJG L;  2KCT A;  1LM0 A;  5C0X G;  2JK8 A;  1IL2 A;  1K8A C;  4A3F H;  1HZB A;  4QY7 A;  1MJE A;  2FXQ A;  4L5T A;  1VQ9 A;  2F4V L;  1C7Y A;  1PYB A;  1KXL A;  3S2H H;  3CW2 C;  1I3Q H;  4P73 A;  4PMW A;  4LFB Q;  5GAD C;  2NN6 G;  2YYZ A;  3HOU H;  2N8N A;  1X65 A;  2R7Z H;  1QVG A;  2VL6 A;  3ULL A;  1PH1 A;  4KHP L;  5M5Y H;  2VZA A;  4JI2 Q;  4JOI A;  1P16 A;  4IPC A;  4R4I A;  4DV1 Q;  4LF6 L;  4OWW B;  2R93 H;  1JT8 A;  2PNH A;  4L5Q A;  3KJO A;  4AIM A;  1NMG A;  3S24 A;  1B7Y B;  1N34 L;  4GOP B;  4A3L H;  2E5L Q;  4A3M H;  3I4N G;  2LSS A;  3CPF A;  3A0J A;  4DV3 L;  2JQO A;  2B63 G;  4JI3 Q;  1U0L A;  1XPU A;  4JI5 L;  1X9N A;  4NXN L;  1A8V A;  5IP9 G;  1HNX L;  3HOZ G;  3FKI H;  5IYB H;  3S16 H;  4BBR G;  3J7A 5;  2BA1 A;  4IFD I;  2V1C C;  1BBU A;  5LMU Q;  1MIU A;  5GAE C;  1NJI C;  1VQG A;  2CQO A;  3M3Y H;  3I4M H;  4O2D A;  5GAH C;  3LGJ A;  4A93 G;  4HJ7 A;  1K83 H;  4YCU A;  1PFS A;  3CC4 A;  2OQK A;  2Q2H A;  1PH9 A;  4IJH A;  5J3B A;  2F3I A;  4A3I G;  1VQB A;  1Y1W H;  2YU9 H;  5C3E G;  5M3M H;  1A63 A;  3I56 A;  1XMO Q;  1VQK A;  2H5X A;  2PI2 A;  1ASY A;  4A3G H;  1YHQ A;  2Z6K A;  4OXP A;  3OW2 A;  4KHZ A;  3PIP A;  4DR7 Q;  2UU9 L;  3WWV A;  3T1H Q;  2JA5 G;  4R4T A;  5BR8 L;  1VQN A;  5GRO A;  4DR3 L;  4JI7 L;  1YHA A;  4DR5 L;  4YHH Q;  2AMC B;  2UUC L;  3A74 A;  1VQJ A;  2ZTD A;  4LF8 L;  3U4Z A;  2B29 A;  4P74 A;  4XIG S;  4A3J H;  4GKK Q;  5IYD H;  4DR4 L;  3F2D A;  1L1O A;  5M3F H;  2IX1 A;  3F2B A;  4DR2 L;  3TS2 A;  2E2H H;  4B3M Q;  2D62 A;  2KCM A;  1IBL Q;  2VQF L;  4BXX H;  3CC7 A;  1TWG H;  4C2M H;  1VS0 A;  2K4K A;  1OXT A;  2Y0S G;  3AYH B;  1VQC A;  3ERS X;  1TWA H;  4KI0 A;  1EWI A;  5E7N A;  1PH2 A;  2QA4 A;  4OX9 Q;  2B63 H;  1E7Z A;  3S1N H;  4IPH A;  4BBR H;  4P75 A;  1QVC A;  1XNR Q;  2JJQ A;  5C0X J;  1X6O A;  1Z9F A;  1I6H H;  3I4O A;  4IO9 A;  2I5L X;  3S14 H;  3CCU A;  4P72 A;  3H15 A;  4HIO A;  4A93 H;  1OXU A;  1NTG A;  1N33 L;  1AH9 A;  3HOX H;  3GO5 A;  4A3I H;  2VW9 A;  1L1O C;  2DGY A;  1HNZ Q;  2R7F A;  1FL0 A;  1I50 H;  4QL5 A;  1GM5 A;  2UXD L;  3KF6 B;  3CCL A;  2CWA A;  1AE3 A;  3E0E A;  2KBN A;  4A3C G;  4GKJ L;  1E22 A;  1HJP A;  1QUQ B;  4DV5 Q;  3T1Y Q;  1DGS A;  3K80 C;  3U4V A;  4GLA C;  3GTJ H;  4LF7 L;  4X66 L;  4DUY Q;  4A3F G;  3AFP A;  1GD7 A;  3CAM A;  1PH7 A;  1J5E Q;  5IWA Q;  4WJ4 A;  3RLO A;  4A3K H;  5FLX c;  1SMX A;  1CSQ A;  2YTV A;  5ELO A;  4X64 L;  3ZJY C;  3GTG H;  1KHI A;  4WJ3 M;  4GOP A;  1N36 L;  1JJ2 A;  2OTL A;  4L5R C;  3J80 c;  4UY8 C;  1CKN B;  4R4O A;  4BA1 I;  1T9H A;  3CPW A;  3KOJ A;  1ASZ A;  5JJI A;  4FDB A;  1S72 A;  3CF5 A;  3PO3 H;  4LFC L;  4X65 Q;  3J81 c;  3EN2 A;  4AYB E;  4YWK A;  2R93 G;  4IOC A;  3BU2 A;  1J6Q A;  4APV A;  3GTL H;  4ME3 A;  2QGQ A;  4DV7 L;  4IOA A;  1Y1V H;  1K0R A;  4A3L G;  1VQE A;  1AE2 A;  3K7A H;  1OXV A;  4A3M G;  4PZ6 A;  1KQS A;  3H3V H;  5C4X H;  4A3E G;  2HHH L;  4GOP C;  4YCV A;  4NXM Q;  4GLV B;  4JYA L;  4DV4 Q;  3RNU A;  3CXC A;  4DKA C;  1HNW L;  1M90 C;  1PH5 A;  1IBM L;  1RL2 A;  2UUA Q;  3CCQ A;  4A3C H;  1Y1W G;  2K5H A;  5M3M G;  4LUO A;  4LWC A;  4OWX B;  4A3G G;  1NE3 A;  2IHF A;  2XGT A;  1VQ5 A;  2OQ0 A;  2NZH A;  1PVO A;  1QZG A;  5JJK A;  4IJL A;  3A5Z B;  2EIF A;  3PF5 A;  1GO3 E;  4Y52 H;  3HOY H;  4JI0 Q;  3G71 A;  3BJU A;  4GS3 A;  4LF9 L;  1WCM H;  2QEX A;  1N32 L;  3CCS A;  1YVC A;  2WAQ G;  5FJ8 H;  1G51 A;  1I5F A;  1Q7Y C;  4A3J G;  4JI6 Q;  1Q1E A;  1Q1B A;  4LUV A;  5IYD G;  4JI4 Q;  3E9H A;  3AEV A;  1WJJ A;  2E2I H;  5IP7 G;  3U50 C;  4GNX A;  1UEB A;  5M3F G;  1XMQ L;  2ZTC A;  2JA9 A;  2ASB A;  1X54 A;  3UDI A;  2CWP A;  2UU9 Q;  1UE1 A;  1VQO A;  4BXX G;  3HKZ G;  4OON A;  2K75 A;  3KDF B;  2VQE Q;  3IRB A;  4DR3 Q;  1FGU A;  4HJ9 A;  4JV5 L;  3KF6 A;  4DR5 Q;  3M4P A;  1CKM A;  1HR0 L;  4B3S Q;  3PV0 A;  4LF8 Q;  1SLJ A;  4A3E H;  1VQ7 A;  4C3H H;  3PF4 A;  4UP7 A;  1QUQ A;  4DV6 L;  4X62 L;  4JBK A;  2E8G A;  3GTQ H;  3GTO H;  4C3J H;  4DR1 L;  3F1Z A;  2B3G A;  1YNX A;  2ATW A;  4B3T Q;  2Z0S A;  1KD1 C;  2NVT H;  1K3R A;  1X56 A;  1IZ6 A;  3PUW A;  1UE6 A;  1NY4 A;  2D0P A;  4JBW A;  4JOI C;  4YY3 L;  3HOX G;  1JJG A;  2IX0 A;  2N3S A;  2AWN A;  1LTL A;  5HGQ A;  3OTO Q;  4DV2 L;  3CD6 A;  2UXB L;  2NVQ H;  1LUZ A;  1Y14 B;  1CKN A;  2OCE A;  3L0O A;  4TQU S;  1Q81 C;  3DLL A;  1YIT A;  3E9I A;  2UXC Q;  1N8R C;  4EQ5 A;  4OO1 G;  2RCN A;  1PYS B;  1SE8 A;  1X3E A;  2HQL A;  1Q8K A;  1L2F A;  4A3K G;  1JMC A;  1YEZ A;  3KF8 B;  4PG3 A;  3UDG A;  3STB C;  1FVI A;  5C44 G;  1IBK Q;  5LMN Q;  1XNQ L;  4DV0 Q;  2AWO A;  3MXN B;  4LFB L;  3TQY A;  3F8T A;  5AJ3 Q;  2WB1 G;  5IYC H;  2UXD Q;  3BZK A;  5IP7 H;  4DUZ Q;  2YTX A;  2Q2T A;  1QZH A;  3TS0 A;  4LF5 Q;  4H02 A;  3D0F A;  3PO3 G;  4POF A;  1CSP A;  4EX5 A;  4TVA B;  3Q8D A;  2N49 A;  4JI2 L;  3H0G H;  4PZ7 A;  3J80 i;  3I7F A;  4A3D H;  2Y0S E;  2Z6K C;  3B6Y A;  3RN5 A;  2JEB I;  1VQD A;  1Z47 A;  4O0A A;  2PQA B;  1D8L A;  4KLK A;  1Y1V G;  2GN5 A;  5HY6 A;  1VQM A;  2E5L L;  3KFU A;  1VQ6 A;  5K36 G;  4Y7N H;  2ZJR A;  1D7Q A;  1N36 Q;  3U58 A;  1YJN A;  1PH8 A;  4LFA Q;  3BZC A;  4JI3 L;  1BVS A;  4GNX B;  5C4X G;  1I94 L;  2KHI A;  4PZ8 A;  1SFO H;  1EQQ A;  3S1R H;  5FLM G;  3HOW G;  5LMU L;  2JEA I;  2CCZ A;  4B3R Q;  4GN4 B;  3NBH B;  3PIO A;  3A5U A;  4JI8 Q;  3MEF A;  3F2C A;  3KYH C;  3PUY A;  1O7I A;  3HKS A;  1YBY A;  1V43 A;  4J15 A;  4C3I H;  4A76 A;  4AQY Q;  1E1O A;  4QJF A;  4HJ8 A;  4UP8 A;  2XTI A;  4HJA A;  1XMO L;  1VQF A;  5IT9 c;  2OTJ A;  4DR6 Q;  2ES2 A;  3GTM H;  3K0X A;  5H1S E;  1HR0 W;  1C9O A;  2HT1 A;  3CMA A;  3PUZ A;  5C44 H;  3GTK H;  3HOY G;  1M1K C;  2IY5 B;  5M5X H;  1A0I A;  3KDF A;  1WCM G;  1SRO A;  1HNW Q;  4YHH L;  4DAY B;  3CCJ A;  2K14 A;  5FJ8 G;  1H95 A;  4GKK L;  2CFM A;  1B8A A;  1VQI A;  4A3B G;  2C35 B;  4DK6 C;  4LF4 L;  1FJG Q;  3UDX A;  2ALY B;  3I55 A;  1PA6 A;  4LNQ A;  2I5H A;  3PSI A;  3S2D H;  1E1T A;  1NBW A;  4B3M L;  1IBL L;  2K5V A;  2F4V Q;  5EAY A;  2VUM H;  2K5N A;  1LYL A;  4OX9 L;  2R6G A;  2YTY A;  4JBM A;  1OXX K;  1W2B A;  5FLM H;  3AFQ A;  5IY0 A;  3HOW H;  4NPS A;  4KHP Q;  1XNR L;  1YHB A;  3M9B A;  4QGU A;  4LF6 Q;  3SGI A;  4IFD G;  1JJC B;  1EUJ A;  1VCI A;  4YWM A;  4QIW E;  3EBE A;  1EOV A;  1EQR A;  3G6E A;  1B70 B;  1N34 Q;  1HNZ L;  3CCM A;  4JCV E;  1PV4 A;  3W5O A;  3K8A A;  4DV3 Q;  4P71 A;  4K0K L;  1RIP A;  4BBS H;  4JI5 Q;  1HNX Q;  4NXN Q;  3T1Y L;  4DAM A;  4UPA A;  1XPR A;  2A19 A;  3FP9 A;  2LXJ A;  2F52 A;  3ER0 A;  1S40 A;  4JI1 L;  5IE8 A;  1J5E L;  5IWA L;  2ZM6 L;  1E24 A;  2WAQ E;  1X3G A;  2R92 G;  4NB3 A;  1UWV A;  2NZO A;  5JEA J;  1HZ9 A;  2PQA A;  2LXK A;  1BBW A;  4A3B H;  4LUZ A;  3RZD H;  4DV2 Q;  4HJ5 A;  5IYC G;  1MKH A;  3G48 A;  1Q86 C;  4GN3 B;  1K73 C;  1KRT A;  5GAG C;  1E3P A;  4X65 L;  1V9P A;  3M85 A;  2RHS B;  1Q46 A;  3HKZ E;  3PCO B;  2K50 A;  3H0G G;  1GVP A;  4A3D G;  2VS1 A;  1C0A A;  5BR8 Q;  1KIX A;  3I2Z A;  1EYG A;  2MFI A;  3NEM A;  4JI7 Q;  1VQ4 A;  2UUC Q;  3UE1 A;  1UE7 A;  3JAM c;  3TRE A;  2ZJP A;  1XNQ Q;  2ZTE A;  3CP0 A;  2BH2 A;  3JC6 6;  1XPO A;  1UE5 A;  4DR4 Q;  2MO1 A;  1YJ9 A;  1G6P A;  3W1B A;  4BY7 G;  3RLN A;  1VQP A;  1BKB A;  2E2J H;  4AH6 A;  3K7U C;  3CQZ H;  2KHJ A;  5LMN W;  1IXR A;  4DR2 Q;  4NXM L;  4DV4 L;  2N78 A;  1OTC A;  2VQF Q;  1JE5 A;  3PO2 H;  4GNX C;  1YJW A;  3L7Z C;  4BY1 H;  3TEH B;  3ULJ A;  4A4I A;  4DPG A;  1SRU A;  1JB7 A;  2UUB L;  4A75 A;  4R4C A;  2UUA L;  1VQL A;  1SR3 A;  1NMF A;  2OWO A;  4QQB X;  2RHQ B;  1KC8 C;  3M4Q A;  3PUX A;  3VDY A;  1PH3 A;  3FHW A;  1CKO A;  1I94 Q;  2JA7 G;  4LW1 A;  2R92 H;  3CCR A;  1TXY A;  4HIK A;  1VQ8 A;  2D0O A;  1N33 Q;  2I0Q A;  3NEN A;  1U5K A;  2IHE A;  4MTN A;  2K52 A;  4DK3 C;  3KJP A;  4JI0 L;  3S1M H;  2WB1 E;  1R9T H;  2GVB A;  2CKZ B;  3S17 H;  3CCV A;  3UE0 A;  3S15 H;  2BA0 A;  4JI6 L;  4ALP A;  3ICE A;  1VQA A;  1KRS A;  5C0X I;  3HFZ B;  1WOC A;  2A1A A;  3CME A;  2Q2U A;  5DLQ E;  4JI4 L;  3EIV A;  2A8V A;  4GKJ Q;  4DV1 L;  3NEL A;  1EFW A;  1TWF H;  4LF7 Q;  2WP8 J; 
#chains in the Genus database with same CATH topology
 4X66 Q;  1Y1V B;  3R2T A;  4IPG A;  2FMA A;  1EY0 A;  5ELF A;  1SYF A;  5M5W H;  3RN2 A;  2VUM G;  1LTG D;  2SDF A;  4L8J A;  3SE0 A;  1ZHS A;  3RLF A;  3S1Q H;  1LTT D;  4K2L A;  3HOW B;  4BY7 H;  5KFD A;  4FBT A;  5JPM C;  1W3S A;  4MTK A;  1IW7 D;  1HH2 P;  1WTX A;  3GQC A;  4KV6 A;  2EYF A;  2V59 A;  5CBA E;  2QYZ A;  1DOK A;  3SVM A;  4MZ9 A;  1O80 A;  3OTO L;  1I6V C;  2E2H A;  3R5X A;  3KHR A;  4BBS G;  3H0G A;  1TWG A;  4YJ3 F;  3I91 A;  5T1I A;  4JC0 A;  1TWA A;  4X66 H;  2YL2 A;  2Q2I A;  4C56 C;  1SEI A;  4R1J A;  3CVZ A;  1IBK L;  2F4I A;  4L5S A;  1K9M C;  3GDE A;  2JA8 G;  3QJY A;  2RF4 A;  3FEW X;  2M2L A;  4DUZ L;  1V1Q A;  2W7O A;  4CJ1 B;  4LF5 L;  4HIM A;  5JVD F;  3P20 A;  5I2X A;  1FD7 D;  3MJF A;  1CA5 A;  3RB6 A;  2B2T A;  2ZM6 Q;  4FXK C;  3D31 A;  5JVG 3;  5KFJ A;  1PMR A;  3U9O A;  5J22 A;  4MNO A;  3IL8 A;  3IG0 A;  2K5W A;  2KEE A;  2KQ3 A;  1BF4 A;  4LFA L;  4YJ2 F;  1EEF D;  3GTK A;  3JAM i;  1IKM A;  4ED0 A;  1KNA A;  2PI2 E;  3LWE A;  1N48 A;  2DUD A;  3TRZ A;  1IOW A;  2Z8L A;  4XQJ A;  4YBZ B;  3BVM A;  1L0W A;  3R23 A;  1XJV A;  4RH6 A;  2W70 A;  4OIJ A;  3EQL C;  3I72 A;  4HID A;  2R8I A;  4TSS A;  5GQO A;  1HA6 A;  3DM3 A;  4DV6 Q;  1STN A;  1TT2 A;  4DUY L;  2YZG A;  1KL9 A;  3D3R A;  1LT5 D;  1N9W A;  2AKW B;  1S3O A;  2C28 A;  3G4S A;  4V19 0;  1STH A;  5IGD A;  4YY3 Q;  4OHJ A;  4ZKC B;  2JA8 H;  3GTP H;  3I4M G;  2JEI A;  2ZM6 H;  1F2Z A;  5DLG A;  3FMA A;  3OSO A;  2UUB Q;  3H0G B;  3OMC A;  1JXL A;  4EBC A;  4ECV A;  3SK8 A;  4DL2 A;  2L12 A;  1EZ8 A;  1HZB A;  4L5T A;  4E4T A;  2FK2 A;  4PQX A;  5KG5 A;  3JRW A;  3S2H H;  3HS0 C;  4RHS A;  4UCR A;  5I47 A;  4ED2 A;  3A56 A;  3BDC A;  1D6E C;  1EIG A;  1GUO A;  4PMW A;  4KTA A;  1IYV A;  5KFG A;  1X65 A;  1SXT A;  2Z4I A;  2A68 D;  3ULL A;  1WCM A;  3P75 A;  4KHP L;  4DV6 H;  1CTM A;  2VZA A;  2XNA C;  3NXW A;  5KRU A;  1H9M A;  1KDA A;  4R4I A;  4LF6 L;  4OWW B;  5EGT A;  4L1K A;  2PNH A;  4L5Q A;  3KJO A;  4XYL B;  4K8I A;  4AIM A;  2A69 D;  3M7G A;  3SDZ A;  1EUC B;  5KFV A;  4ECT A;  1QNK A;  2JA7 B;  1VMC A;  2LSS A;  3CPF A;  1DV2 A;  3T5H A;  2W9C A;  2UUB H;  3D6C A;  3RF2 A;  1A8V A;  2NU7 B;  4O3S A;  5C5J A;  2CQO A;  3EPI A;  1EYC A;  3I4M H;  3LGJ A;  3OSN A;  1PFS A;  3CC4 A;  2Q2H A;  3MHB A;  3KAJ A;  2PCF B;  4ZAI A;  4IJH A;  1PH9 A;  2X0S A;  4O3P A;  4A3I G;  4RB3 C;  1UNS A;  1VQB A;  3NPP A;  4J1M A;  4HED A;  1Y1W H;  2W7P A;  5M3M H;  2NVY B;  3M4O B;  3I56 A;  3CQZ A;  1STY A;  4R8I A;  3ND9 A;  4EGJ A;  4EYI B;  2UU9 L;  3T1H Q;  2V5A A;  2JA5 G;  1B1Z A;  4R4T A;  5BR8 L;  3D4W A;  2R8J A;  2JA6 B;  2UUC L;  2NVX B;  2ZTD A;  4MTE A;  1EUD B;  4A3J H;  1IW7 C;  4GKK Q;  1ZQ7 A;  1ZXT A;  2K5Q A;  1L1O A;  4MHE A;  4HSV A;  2W6Z A;  1JC7 A;  4YAJ B;  2A5H A;  3J80 L;  4O4I F;  3QOJ A;  2YW2 A;  1OXT A;  5CA0 F;  1EWH A;  1CT1 D;  2Y0S G;  2WIN B;  3PR4 A;  2PBZ A;  1MHW C;  2XRS D;  3ONA B;  2JJQ A;  1X6O A;  4F4Z A;  4IO9 A;  3S14 H;  1KJJ A;  2KOL A;  4P72 A;  4F7X A;  2FJZ A;  5BPH A;  1OXU A;  5KYI A;  1Q90 A;  1AH9 A;  3T1H H;  3HOX H;  4A3I H;  1HNZ Q;  2R7F A;  5KT5 A;  3DMU A;  1PZK D;  4ABN A;  3CCL A;  2UVV A;  4JV0 A;  1PTO B;  5LMN H;  2KBN A;  3FRP B;  2EJM A;  4U67 3;  5KFM A;  3T1Y Q;  1QUQ B;  3BJY A;  1DGS A;  3K80 C;  3U4V A;  3GTJ H;  1K8O A;  2JEG A;  2IP4 A;  2ICE C;  5E3F A;  4OO1 H;  3WO0 A;  2RDG A;  3AFP A;  1I3Q B;  3CAM A;  1AN7 A;  2RDI A;  4DAP A;  4NLG A;  1HTL D;  4X64 L;  5ISR A;  3TP5 A;  4FNF A;  4GOP A;  2B2U A;  4ED6 A;  1JJ2 A;  1FNU A;  3ITP A;  4L5R C;  4V0B A;  2NWG A;  4XQN A;  3CPW A;  1HRJ A;  3H09 A;  1C30 A;  4AYB B;  1PTO F;  4ULL A;  3WOF A;  4DL3 A;  2EJG C;  5KG3 A;  1E4E B;  2V4R A;  1QB5 D;  1J6Q A;  4APV A;  4ME3 A;  4X3S A;  1HPC A;  1PDQ A;  1Y1V H;  1K0R A;  4Q0F A;  3Q8S B;  4A3L G;  2R7M A;  5K36 H;  5KFZ A;  4OL7 A;  1HNZ H;  4JI8 H;  5CA1 F;  1KBL A;  2HHH L;  4C3H G;  3T1Y H;  2MUY A;  2HVR A;  4L63 B;  3RBE A;  2NTS A;  1M90 C;  1PH5 A;  4ECZ A;  4ECS A;  2AU0 A;  2UUA Q;  3R3O A;  4XT3 B;  5G3L D;  2PYK A;  3J80 W;  5FLX E;  2IX3 A;  1M0W A;  5JJK A;  4MA5 A;  5GON F;  1W6K A;  4NMZ A;  2RDH A;  1TWC A;  4FS2 A;  2WV6 D;  1RKN A;  1GUT A;  2WAQ B;  4LF9 L;  1HFN A;  1CE8 A;  3OUZ A;  3T5L A;  2A68 C;  2QEX A;  3V05 A;  1N32 L;  4J9K A;  2F4V H;  2QKI C;  1KEE A;  2JP1 A;  1Q1E A;  4EBD A;  2E2I H;  1CHP D;  5IP7 G;  1A3U A;  3T56 B;  3HKZ B;  1LTB D;  2EYJ A;  4BXX G;  2AQ4 A;  2B63 B;  1G6Z A;  2JXM B;  3HOZ B;  1MGS A;  2SNM A;  5KT6 A;  4DR5 Q;  2B2V A;  1AW7 A;  4FXG C;  4LF8 Q;  2R7K A;  4C3H H;  2DN8 A;  2JSO A;  3KBX A;  4RB2 C;  1XDN A;  4DR1 L;  3VR6 A;  4R8N A;  5KFA A;  1YNX A;  3MR3 A;  1BQQ T;  4HNV A;  3MTS A;  1IZ6 A;  1NY4 A;  3M9O B;  1JOK A;  5J1Z A;  1SNQ A;  5EWG A;  5HGQ A;  3OTO Q;  1K1Q A;  2A6H D;  1T5E A;  1Y14 B;  1WTH A;  3K57 A;  2KJX A;  4HMI A;  2RGV A;  3DLL A;  1EY6 A;  3E9I A;  4LSA A;  3TIN A;  3DUZ A;  1N8R C;  4EQ5 A;  3GTG B;  1PYS B;  1SE8 A;  5I9P A;  2HQL A;  1L2F A;  4A3K G;  3KF8 B;  1IBK Q;  3TZD A;  5C44 G;  1FVI A;  1XX8 A;  4X3T A;  1TWH B;  3TQY A;  4JI7 H;  2YS6 A;  5I2Y A;  3FKI A;  4DR5 H;  4K5X A;  5IP7 H;  3T5J A;  4DUZ Q;  4LF8 H;  4LF5 Q;  5KFI A;  1B9M A;  4BWS C;  3GV3 A;  1ESF A;  1II3 A;  3H0G H;  2RCF A;  4JI2 L;  1MSG A;  2Y0S E;  2Z6K C;  2LY7 A;  3B6Y A;  3MFY A;  3RN5 A;  2YU9 A;  1VQD A;  1NAP A;  1NR2 A;  4KLK A;  2E5L L;  3KFU A;  4HN7 A;  2NZ1 D;  3OTO H;  1TY0 A;  3NQI A;  4ZLT F;  4LFA Q;  3BZC A;  5KFS A;  4Z9C B;  2KHI A;  2DWC A;  1T5X D;  5JJZ A;  1EQQ A;  1VAJ A;  2K5D A;  1WR2 A;  2R85 A;  4YQW A;  2IWH A;  4GN4 B;  3PIO A;  2R7N A;  4KMU C;  5E1F A;  1IBK H;  1N33 H;  3HKS A;  1YBY A;  1V43 A;  4J15 A;  5CAE B;  2K7V A;  2L11 A;  3I4L A;  1E1O A;  2KVM A;  4UP8 A;  2XIW A;  2XTI A;  3CKI B;  1WTV A;  4LF5 H;  4DL6 A;  2EOT A;  2KCC A;  5C5L A;  5C44 H;  3GTK H;  1A0I A;  1WCM G;  1KLG D;  1MSH A;  3Q6S A;  4IUR A;  2O4X A;  5BN3 A;  2R86 A;  4DA2 A;  5M5Y B;  5FJ8 G;  1TAE A;  2D5D A;  1QE6 A;  2CFM A;  2Z1C A;  2K6A A;  2E2D C;  2ALY B;  5DNF A;  4C1N K;  5L1I A;  1EU4 A;  2GA4 B;  4LFC H;  4A3M B;  3FDT A;  4Q43 A;  1SNM A;  4RGT A;  1BUV T;  4XX0 B;  4NKL A;  2NBF A;  1BCP B;  1Z6H A;  2K5N A;  4DV7 H;  4RAU C;  4XDX A;  3GTQ B;  1OXX K;  3A8J E;  3M3Y B;  4PDB A;  4KHP Q;  2NVT B;  1XNR L;  1YHB A;  4LF6 Q;  1F2M A;  3SGI A;  1PRT B;  5I6Y A;  4YWM A;  1S10 A;  1SYE A;  1W6J A;  4QIW E;  5C1O A;  1EOV A;  1EQR A;  1PZI D;  2VUG A;  2F3W A;  5KG1 A;  1RD9 D;  2DLN A;  1PV4 A;  3W5O A;  1BCP F;  3V6K A;  2M05 A;  4UPA A;  5LL6 b;  2B8F A;  3GTL A;  2PNR C;  5CV5 A;  3F8N A;  4K6L A;  3MWD A;  5IE8 A;  1LTA D;  1DD2 A;  5IWA L;  2ZM6 L;  3CU7 A;  1PRT F;  1Z2O X;  2LXK A;  1U4M A;  5C3X A;  5T14 A;  3DEO A;  4LUZ A;  3G48 A;  1EEI D;  4Q5V A;  3BZD B;  4C2M B;  3GTP A;  4KHP H;  2I8C A;  2K50 A;  4A3D G;  2ASD A;  1FYC A;  2VS1 A;  5BR8 Q;  3NBH A;  3N8D A;  3I2Z A;  2MFI A;  3DF7 A;  4APM A;  2R84 A;  4EQN A;  2UUC Q;  2ZJP A;  1UE7 A;  1S0N A;  3Q8R B;  3OIQ A;  3JC6 6;  1UE5 A;  3W1B A;  1U4R A;  4Q0Y A;  2E2J H;  4AH6 A;  3CQZ H;  2CW0 D;  2KHJ A;  1IXR A;  2KUM A;  3C2P A;  2K32 A;  4OGQ C;  4ZOL F;  3UQ8 A;  1TKW B;  2LFN A;  2X6G A;  4J9L A;  4BY1 H;  4J9R A;  3EVQ A;  1STB A;  4DAY A;  4RWS C;  2UUB L;  2HCI A;  4R4C A;  2ZXP A;  1D2B A;  5KT4 A;  3MA2 B;  3PW7 A;  2UXB H;  4QQB X;  2B2W C;  2MP1 A;  1F9P A;  1UAP A;  3M4Q A;  3PUX A;  1PH3 A;  5CBE E;  1CKO A;  1I94 Q;  5FK9 C;  3CCR A;  4DGZ A;  2R7L A;  5D1P A;  2WB1 B;  3DXJ C;  2C2E A;  2FFK B;  2K52 A;  5BR8 H;  2E74 C;  3CCV A;  1SYG A;  4ALP A;  4G7Z C;  1VQA A;  2BQR A;  1H9S A;  5IGF A;  1WOC A;  3S2D B;  5DLQ E;  1KLU D;  3N41 B;  4O2B F;  4JV2 A;  1K1S A;  2L4N A;  1H9R A;  1HZA A;  4G3I A;  1V4Y A;  2VUM B;  1Y1W A;  5JEA G;  3M4I A;  4X64 Q;  3J81 i;  2EXD A;  2NN6 I;  1BDO A;  3Q8P B;  2R7D A;  2XVS A;  3M9N B;  3D4R A;  4IPD A;  4B3S L;  1FGB D;  3AB9 A;  1LTI D;  4FF2 A;  3TQT A;  1CUK A;  4LF4 Q;  3BVG A;  3RR5 A;  4J0M A;  3J7Z C;  1K28 A;  4JI3 H;  4JBJ A;  1I94 H;  4B3T L;  3RZO H;  1VDZ A;  1JDE A;  2WII B;  1F9Q A;  1Z2N X;  3JSL A;  1JDB B;  4KJN A;  1DYQ A;  3HOY B;  3HOZ H;  2BH8 A;  2ALZ A;  2HHH Q;  1E4F T;  5IGE A;  5KFN A;  3T1H L;  3L3O C;  4DNI A;  5JVH 3;  2W6P A;  1RDP D;  2XD4 A;  4A3B B;  3RGZ A;  4HNU A;  2G9H D;  4YR2 A;  2IW3 A;  4X64 H;  5LMN L;  1SYX B;  5FD5 A;  5KT7 A;  5AJ3 L;  1SFO A;  1SJH D;  1YZ6 A;  2FMC A;  5EBD A;  1B2T A;  3RUZ A;  1F2Y A;  4U68 A;  4RB0 A;  5KG4 A;  1MJC A;  3I3C A;  4LF4 H;  1G29 1;  4CDC C;  4CKB A;  3KLW A;  1FNV A;  3LNN A;  4HSP A;  4LF9 Q;  4MV1 A;  4G7H C;  1N32 Q;  3GTJ A;  1WFQ A;  1A9X A;  2Z4H A;  1X55 A;  4RMF A;  4OX9 H;  1TWH H;  2GVA A;  1EOT A;  1P8L A;  3OYY A;  3K5L A;  4RNM A;  1F77 A;  2ID0 A;  1CQF A;  4JI8 L;  1DCZ A;  1TWC H;  2HIX A;  1V1P A;  1EIF A;  1DJR D;  1WYD A;  1TA8 A;  2OT2 A;  1M0T A;  5ELN A;  1QVF A;  4BA2 I;  4DR1 Q;  2OH2 A;  1IYJ B;  4XT1 B;  3S1M B;  3RTX A;  3FKI G;  2ZJQ A;  1GKH A;  2BQ3 A;  3QO2 A;  2W57 A;  2HQE A;  1HCZ A;  4LF9 H;  1ZYR D;  3RD4 A;  1J5E H;  5DLF A;  2N88 A;  1N32 H;  2HVS A;  2H1E A;  2I5M X;  2NUA B;  2EY6 A;  2HD3 A;  2OLS A;  4A2B A;  1L2Z A;  2KCT A;  1LM0 A;  3MFG A;  4J6H A;  5C0X G;  4C5C A;  2JK8 A;  3T5K A;  1XWE A;  3N6R A;  4RKB A;  3T13 A;  1MJE A;  5EOY A;  3K5M A;  4X65 H;  2F4V L;  1KXL A;  3J80 E;  3GIL A;  1NNX A;  1JB3 A;  3WOE A;  3RB0 A;  2FB9 A;  3TP7 A;  4QB4 A;  3S1R B;  3UFX B;  2YYZ A;  5CGK A;  2NB0 A;  4DL7 A;  3RB4 A;  3ORR A;  5H80 A;  1PH1 A;  1UC9 A;  5M5Y H;  5C4J B;  4JI2 Q;  1NCV A;  4JOI A;  4FBU A;  1HQM C;  1B7Y B;  2A6E C;  1N34 L;  2E5L Q;  1BGW A;  4A3M H;  3J7A V;  1U0L A;  2W8K A;  1XPU A;  1SMY C;  3FKI H;  4RUC A;  3J7A 5;  2V1C C;  1BBU A;  3AU7 A;  1MIU A;  3E3X A;  2L5T A;  3Q1K A;  3M3Y H;  4CC6 A;  2F3V A;  5TSS A;  2F3I A;  4L6T B;  4J9N A;  2YU9 H;  3G6V A;  2Z6B A;  5C0X H;  3C3L A;  2F0H A;  1VQK A;  3HOV B;  1G2T A;  4X3K A;  1AUX A;  1D1I A;  2BQU A;  4OXP A;  3OW2 A;  2F0M A;  5DGA A;  1QNU A;  4JI2 H;  4WOR A;  2XRQ D;  4JI7 L;  4FYD A;  2B39 A;  4DR5 L;  2AMC B;  1Y8N B;  1VQJ A;  3K5H A;  4LF8 L;  2PPB C;  2UVU A;  4P74 A;  2E5L H;  5IYD H;  3OMG A;  5E4X A;  1GHJ A;  3N43 B;  3F2D A;  5FPR A;  3RUP A;  5L9X A;  1IHZ A;  5HV6 A;  5M3F H;  4B9X A;  3F2B A;  3TS2 A;  2SCU B;  4CDE C;  4C2M H;  2R82 A;  2XCP A;  2K4K A;  5KKN B;  4RGO S;  2M9V A;  2RQX A;  3N44 B;  1YNJ D;  4EQO A;  3ERS X;  1PH2 A;  3BA9 A;  1EWI A;  4ZI7 F;  1PFB A;  3H40 A;  2J6U A;  2J6S A;  1XNR Q;  5C0X J;  1I6H H;  5DG8 A;  5C1P A;  3RZD B;  1N33 L;  4G57 A;  1L1O C;  3VPC A;  1CI3 M;  4YIJ A;  4DAV A;  4FO2 A;  1AE3 A;  2RGR A;  2W9B B;  1GUG A;  4DV5 Q;  1KIX A;  4RAY A;  1IYU A;  4LF7 L;  1PRT D;  1GD7 A;  5IWA Q;  3RLO A;  1AP0 A;  1SMX A;  3V96 A;  3ZJY C;  5KG0 A;  4WJ3 M;  3HOU B;  2OTL A;  2R7Z B;  2FE3 A;  2JA7 A;  1GHK A;  3J80 c;  4A2A A;  4UY8 C;  3MZ5 A;  4MV6 A;  4C5A A;  3PO2 B;  3MXP A;  3PMF A;  3CF5 A;  4LFC L;  1G8Z D;  2PZU A;  1SCU B;  1T94 A;  4Q44 A;  4ECW A;  1GGO A;  1XNR H;  1U4L A;  3QR8 A;  1JKJ B;  4RUA A;  4HCS A;  4KK7 A;  5JPN C;  1ILQ A;  1EY7 A;  4IOC A;  3GTL H;  3QOL A;  1SSO A;  4DV7 L;  4IOA A;  1A6X A;  3K58 A;  2F0F A;  2A74 C;  3EJI A;  1VQE A;  2X69 A;  3K7A H;  4KKS A;  1OWT A;  2NVY A;  3S16 B;  1KQS A;  3H3V H;  4AQY H;  5CV8 A;  4A3E G;  1SNC A;  4GOP C;  2B2U C;  3SR1 A;  4DV5 H;  2WDT A;  3H6M A;  1K83 B;  4GLV B;  2F0P A;  4HAE A;  4CKC A;  5I6W A;  4EEQ A;  1B44 D;  4YB8 B;  5LL6 S;  4DR6 H;  2JA6 A;  2NTT A;  5IWA H;  2NVX A;  2PW5 A;  2IL8 A;  1YNN D;  2EY5 A;  2AGQ A;  2XN9 C;  1Y1W G;  1NSN S;  5M3M G;  2W6Q A;  2C2R A;  4LWC A;  4OWX B;  4ED7 A;  1VQ5 A;  2OQ0 A;  1PVO A;  1QZG A;  2HGS A;  4QF4 A;  3CRL C;  1HHV A;  3J81 W;  1ML0 D;  5DQH A;  3G7L A;  2QIL A;  3HOY H;  4NDX A;  1L0Y B;  2BE5 C;  4GS3 A;  3G71 A;  1SYB A;  3NHH A;  2KCN A;  3CCS A;  3OUU A;  1G51 A;  5LA6 F;  4A3J G;  4LUV A;  4M9U A;  4XYM B;  4GNX A;  4WRD A;  1XMQ L;  4IUU A;  2JA9 A;  1X54 A;  1SEB D;  3I4N B;  1VQO A;  5CV4 A;  2L55 A;  2J9G A;  2M00 A;  2YCH A;  4BBR B;  4EBE A;  4B3S Q;  1I4G A;  4A3E H;  3C1F A;  1LT3 D;  1QUQ A;  4X62 L;  4A93 B;  5DM6 3;  1EHI A;  2PZT A;  4PV1 C;  4DV3 H;  3OSP A;  2B3G A;  2W9A A;  4B3T Q;  4HR7 B;  3Q22 A;  1I3Q A;  4NXN H;  1I50 B;  5C3E B;  2GPS A;  1VF5 C;  1DXM A;  3NE5 B;  3PUW A;  3HOX G;  2D0P A;  4CHT B;  1JJG A;  2EYP A;  2N3S A;  4TKO B;  2UXB L;  4I55 F;  1PLF A;  1LUZ A;  3GIQ A;  5F9L A;  3RAQ A;  1Q81 C;  4AYB A;  1EWC A;  4F50 A;  3MR5 A;  4N8X 1;  4OO1 G;  1E4E A;  1JLL B;  4HNT A;  5KFU A;  2R61 A;  1NR4 A;  3UDG A;  5LMN Q;  3MXN B;  4LFB L;  2UXD Q;  5AJ3 Q;  1H9K A;  1LAB A;  5C6A A;  2YTX A;  1B3Q A;  4B3S H;  1QZH A;  1WTQ A;  1BXR A;  2MPM A;  4TVA B;  4DL5 A;  4DR4 H;  2F0W A;  2FPI B;  1QJO A;  4O3O A;  4B3T H;  2ZT9 C;  1Z47 A;  5HY6 A;  5EPK A;  1Y1V G;  1X3Q A;  1VQM A;  3BQ2 A;  1VQ6 A;  5K36 G;  2ZJR A;  2ASJ A;  3OWF A;  3FMC A;  1S0O A;  1YJN A;  1PH8 A;  4JI3 L;  4GNX B;  1I94 L;  1SFO H;  3S1R H;  3AMU A;  4XQQ A;  3HOW G;  2JEA I;  5KG6 A;  3VMM A;  5CV7 A;  3VR3 A;  2WAQ A;  4JI8 Q;  2DNC A;  1Y8P B;  4CKE A;  4XZ3 B;  1KC7 A;  4A3F B;  1A3V A;  4H44 C;  3SXH A;  2UXD H;  4BWG B;  4QIW A;  2RVL A;  1ZEQ X;  1BNC A;  3HKZ A;  4EYH B;  1C9O A;  4GKJ H;  2VR1 A;  2KED A;  2IA6 A;  4HMJ A;  1S5E D;  2B63 A;  4IZ8 A;  3CCJ A;  4TQR A;  2F0L A;  2XC9 A;  1W93 A;  4R7R A;  5C4Z A;  4YAK B;  3PW0 A;  1B8A A;  2R93 B;  1SE3 A;  4LF4 L;  1ONL A;  3SI8 A;  4DU9 A;  2JEF A;  1PA6 A;  4LNQ A;  1EYZ A;  2I5H A;  1WD0 A;  4RAZ A;  4NW2 A;  1E1T A;  5JVL A;  1QWY A;  3A8I E;  1IBL L;  4RU9 A;  2F4V Q;  2F0J A;  1PK8 A;  3GIM A;  3MWY W;  1LYL A;  1CS0 A;  4OX9 L;  5DGB A;  3GTO B;  2R6G A;  4HCE A;  3K6O A;  2FMM A;  3HOW H;  4KN4 C;  3JRX A;  1RYR A;  2V9W A;  3CHB D;  3JAM L;  3K5N A;  1JJC B;  3GTG A;  2AUJ D;  2ICI A;  4DFA A;  3KF8 A;  3G6E A;  2NVQ B;  1B6S A;  4ZYS A;  2F0S A;  1N34 Q;  4A3G B;  1TWH A;  1O7Z A;  1STA A;  2WAC A;  1IBM H;  3K8A A;  4XXE A;  1RIP A;  5EWE A;  3V2T A;  1QG7 A;  4DAM A;  3J7Y W;  1XPR A;  4O2A F;  4QW8 A;  4WD3 A;  2LXJ A;  1ULZ A;  3BDO A;  1J5E L;  1BO0 A;  1EY5 A;  1X3G A;  2DY7 A;  1UWV A;  2G5D A;  1ESR A;  1BBW A;  3RZD H;  4RGN A;  4DV2 Q;  2CQY A;  1Q86 C;  1K73 C;  4N9P A;  4CJ0 B;  1ZHQ A;  4RB1 A;  2A69 C;  2WTF A;  1ENF A;  4X65 L;  4IUN A;  3M85 A;  2RHS B;  4XYQ A;  2AQ2 B;  1Z2P X;  3PCO B;  3H0G G;  3MFH A;  3S1N B;  1EYG A;  4EFB A;  4RCN A;  3I70 A;  4JI7 Q;  4Y7N B;  3CRK C;  1VQ4 A;  5KFY A;  1XNQ Q;  1N34 H;  2ZTE A;  1G91 A;  1I7L A;  2HUG A;  4ZCK A;  4JV5 H;  1WTO A;  1YJ9 A;  3TBI B;  5EZY F;  1VQP A;  3F2U A;  3KAK A;  2CW7 A;  4DV4 L;  1OTC A;  3PO2 H;  4GZY C;  2OEO A;  1YJW A;  3TEH B;  3ULJ A;  1JB7 A;  2V58 A;  1SRU A;  3BQ0 A;  3Q0A A;  4A75 A;  2ZJT A;  1SR3 A;  4DNT B;  4DV2 H;  4ME5 A;  2OWO A;  1CQJ B;  2RHQ B;  1O78 A;  2QDL A;  2PQE A;  5KFX A;  5F2D A;  1KC8 C;  5FO9 B;  3Q8Q B;  3RAX A;  3FHW A;  2JA7 G;  4HIK A;  5FPO A;  2D0O A;  5L37 A;  1N33 Q;  3P1H A;  4DK3 C;  4YP3 A;  3KJP A;  1S68 A;  1LTR D;  5CV9 A;  5EDW A;  4F4W A;  1UC8 A;  3PO3 B;  4M8A A;  2BA0 A;  3JAM W;  1XNQ H;  3ICE A;  3GTQ A;  2E76 C;  4LJZ C;  4J9O A;  3HFZ B;  2A1A A;  5EQ0 A;  3CME A;  4QWC A;  1T3N A;  1Y69 U;  3NEL A;  3NK9 A;  2L1B A;  3I8Z A;  4QUC A;  3LWB A;  1B04 A;  4LF7 Q;  2WP8 J;  2TSS A;  2W71 A;  3RJ0 A;  1B53 A;  1GUS A;  5KFQ A;  1OXS C;  3SK4 A;  3M7N A;  5C4X B;  2KEN A;  1PHJ A;  5BPF A;  2YZN A;  4JG2 A;  1Q82 C;  4KD3 A;  2JA6 G;  4LH6 A;  4MV3 A;  4LFC Q;  2VNU D;  5KFP A;  4RG1 A;  3W1G A;  3STB D;  1S5C D;  3Q24 A;  2ZDH A;  2DPJ A;  4IZO A;  1A62 A;  2C5C A;  3E6Z X;  3BG3 A;  1CHQ D;  1PH6 A;  5LMU H;  1SAP A;  2VY3 A;  4DV7 Q;  2J6T A;  2WYO A;  1D1K A;  1E0B A;  2IT1 A;  4EG0 A;  4F4X A;  4BS9 A;  3I4N H;  2FKL A;  3L4K A;  3L2P A;  1TVX A;  5IP9 H;  2JA7 H;  4C2M A;  1M6V A;  1TS2 A;  4O1N A;  1F9S A;  4LF7 H;  2K33 A;  1KAW A;  4MTD A;  2F0D A;  1HUM A;  5DAU A;  2BOS A;  4UFZ A;  1D5X C;  1DON A;  3H20 A;  4DV0 L;  2TMP A;  2EYH A;  3L4J A;  5C3E H;  4UCV A;  4UP9 A;  3PZP A;  3L9A X;  2NVY H;  3M4O H;  4Y8V B;  1K8G A;  3IAY A;  3G6Y A;  4OO1 I;  4WJW A;  5KG7 A;  1JOQ A;  5T1G A;  1SBB B;  2KHS A;  4YWL A;  5E4W C;  2R8K A;  2CQA A;  3NTI A;  5L1K A;  4B3M H;  3VPB A;  4C3J B;  2JA6 H;  3I73 A;  1W96 A;  1GLV A;  1TS3 A;  2PMZ E;  2NVX H;  1SN8 A;  2SNS A;  2O2L D;  2VPQ A;  4Q45 A;  2HJW A;  1XMQ Q;  2ZDG A;  1XTC D;  4J9M A;  5KGU A;  1XTD A;  2WB1 A;  3PUV A;  2JE6 I;  4IRC A;  3PGZ A;  4I65 A;  4BY1 G;  4AYB G;  1JCK B;  4KKU A;  5LL6 X;  3CC2 A;  4RZR A;  3IN5 A;  3QIA A;  4AQY L;  2OF1 A;  2B2Y A;  4DV5 L;  2VOB A;  2MO0 A;  4J8Q A;  4OIK A;  4X62 Q;  2R92 B;  4P2C B;  2AHO B;  4DR6 L;  2VUM A;  4K2K A;  2B8G A;  4FVM A;  3S17 B;  3HP3 A;  2YV5 A;  2WFW A;  2AGP A;  1AUV A;  2UXB Q;  1EY8 A;  2MQH A;  1TWF B;  1LT4 D;  3A55 A;  4OWT B;  1PTO H;  1IL2 A;  3MEH A;  1HUN A;  5M5W B;  2O5I C;  3DEP A;  1TU2 B;  3C0F B;  4A3F H;  1XMQ H;  4QY7 A;  4ECX A;  1VQ9 A;  1I4H A;  2ZXR A;  1I4P A;  3S1Q B;  1I6U A;  1I3Q H;  4BY7 B;  4LFB Q;  4O4H F;  5GAD C;  2F0E A;  1QOH A;  3GIK A;  3NUC A;  4ZKB B;  1QVG A;  2F1M A;  2VL6 A;  4X62 H;  1PFM A;  5KFO A;  4DV1 Q;  2A6H C;  1GOZ A;  1P16 A;  4IPC A;  1S97 A;  2R93 H;  1JT8 A;  4C3I B;  1JX4 A;  3K3P A;  4NXM H;  3R8B A;  5JQW A;  5BMV F;  3S24 A;  1SDF A;  1KJ9 A;  2PO4 A;  2JEJ A;  3BYY B;  4O42 A;  1EL0 A;  1PX2 A;  3A0J A;  4DV3 L;  1R4Q B;  2B63 G;  4JI3 Q;  1AFP A;  1E4G T;  4HTH A;  4JI5 L;  4NXN L;  1HNX L;  3HOZ G;  4ETS A;  3DM1 A;  2QCP X;  3D8G A;  2J4X A;  3ETH A;  4H7B A;  2OQK A;  3E5S A;  5J3B A;  4JI0 H;  2WKD A;  5KX5 F;  4RCO A;  3SHL A;  1A63 A;  5D1O B;  4LFB H;  1TS5 A;  2ZXO A;  1ASY A;  4A3G H;  1MI2 A;  1TR5 A;  1KNE A;  4C1N I;  4DNR B;  2Z6K A;  1YHQ A;  4DL4 A;  1ENA A;  1SND A;  3ERO A;  3PIP A;  4DR7 Q;  1E2V A;  3MR2 A;  4DV1 H;  1IOV A;  5KIX A;  1NUC A;  2FK3 A;  3P7J A;  3ERQ A;  2K28 A;  3U4Z A;  1PTO D;  2B29 A;  1EYD A;  4DR4 L;  3N40 P;  1JE4 A;  2N55 A;  1LT6 D;  4RNN A;  4UCU A;  5J2U F;  1SE2 A;  2IX1 A;  2FLL A;  2D62 A;  5IGG A;  1IBL Q;  1AEX A;  1S5B D;  2VQF L;  5KT3 A;  1G2S A;  3UI2 A;  1VKZ A;  2X6L A;  3PIP 3;  1VS0 A;  4BBS B;  5L1L A;  4LMQ D;  3AYH B;  3EA6 A;  1JIH A;  1VQC A;  4KI0 A;  2B63 H;  5E7N A;  4OX9 Q;  3S1N H;  3KXY T;  2QA4 A;  4ME6 A;  4MV7 A;  2R3Z A;  1RYS A;  1BOS A;  4P75 A;  1QVC A;  4I7H A;  5F9N A;  1Z9F A;  1LTS D;  1OO9 B;  2I5L X;  3CCU A;  2JA8 B;  4DR7 H;  1WSC A;  5A2Q L;  3O13 A;  3MC0 B;  3EFX D;  4ZRZ A;  1GM5 A;  2UXD L;  4IQZ A;  3KF6 B;  5EWF A;  3E0E A;  4IHJ F;  2MGS A;  3Q23 A;  2AQ1 B;  4A3C G;  4GKJ L;  1E22 A;  2W6O A;  1RHP A;  5ELB A;  4GLA C;  4MAM A;  1VMP A;  3RB3 A;  4ZQ3 A;  1S5F D;  3S2H B;  5I9O A;  3J7A F;  1J5E Q;  1PH7 A;  4WJ4 A;  5HBR B;  1IBL H;  1CSQ A;  3GTG H;  2P5Z X;  1KHI A;  4O3Q A;  2PN1 A;  1SYC A;  2AGO A;  1CA6 A;  1CKN B;  4BA1 I;  1MZB A;  4RKL A;  5JJI A;  4FDB A;  3PO3 H;  4X65 Q;  3J81 c;  3EN2 A;  2EYL A;  4AYB E;  5LXT F;  4ZUI A;  5C4H A;  1KJ8 A;  3GIP A;  3GV6 A;  1V51 A;  3K3V A;  5KG2 A;  4B3R H;  1AE2 A;  1LAC A;  3LP8 A;  4A3M G;  4G4K A;  2B2T C;  1WTP A;  5C4X H;  5J2T F;  3I4M B;  4YCV A;  1R9T B;  2I87 A;  5LP6 F;  2QEJ C;  4JYA L;  4DV4 Q;  4DKA C;  4WBN F;  1RTN A;  1SNP A;  1F9R A;  4JV1 A;  1IBM L;  1KDB A;  2L9H A;  4A3C H;  4EEY A;  1U4P A;  2F0K A;  1SYD A;  4LAA A;  4TV8 F;  4H13 C;  3PW5 A;  1DOL A;  4OEM B;  2K03 A;  3TDQ A;  2NZH A;  3A5Z B;  2EIF A;  5CB4 F;  3TP6 A;  3PF5 A;  1GO3 E;  2RA4 A;  1FJG H;  2RDF A;  4Y52 H;  2RKS A;  2DPI A;  3BJU A;  1U9R A;  4A3J B;  3TP8 A;  4ZUJ A;  4FF1 A;  2CW0 C;  1CM9 A;  5A2Q W;  2JN4 A;  4R8U B;  5IYD G;  1KJQ A;  3E9H A;  3AEV A;  2ATL A;  3FVQ A;  4JK1 C;  4IUQ A;  5M3F G;  4ID6 A;  2QF7 A;  2YZM A;  5KFC A;  4PMC A;  5EJW A;  2ASB A;  1VF7 A;  3UDI A;  2CWP A;  4QUF A;  5KFR A;  4DV4 H;  4X3U A;  3NWT A;  5KFF A;  4EFE A;  4GC6 A;  2MJ8 A;  2K75 A;  3KDF B;  4DR3 Q;  3IRB A;  3MWE A;  1FGU A;  3TN2 A;  3GLK A;  4UDU C;  5EKI A;  4JV5 L;  2I80 A;  3HXL A;  3M4P A;  1CKM A;  1HR0 L;  3KAL A;  1HXY D;  3PV0 A;  3NQT A;  1VQ7 A;  3PF4 A;  2W9B A;  4UP7 A;  2E8G A;  3GTQ H;  4C3J H;  1UEA B;  3F1Z A;  4A3I B;  2OXP A;  1KD1 C;  4K8J A;  1K3R A;  2NVT H;  1ZET A;  5DG9 A;  4JBW A;  1UE6 A;  2A73 B;  2D9U A;  3VYR A;  3H4B A;  2AWN A;  3GP7 A;  5KYL A;  4DV2 L;  3CD6 A;  2R7Z A;  5JAV A;  5J39 A;  3L0O A;  4TQU S;  2JA5 B;  1GYF A;  3PQI A;  3DWA A;  1C8C A;  4FP5 D;  2KEC A;  2RCN A;  4O4L F;  5KFB A;  1Q8K A;  1GJX A;  4PG3 A;  1XNQ L;  1WH2 A;  4J9S A;  2F0O A;  4DV0 Q;  2AWO A;  3G8C A;  4DR3 H;  4IR9 A;  3F8T A;  2WB1 G;  5IYC H;  2Q8I B;  3BZK A;  4TUY F;  5DEH A;  1HTP A;  4N9T A;  1EIH A;  4POF A;  1S9F A;  1CSP A;  5BN4 A;  3SE7 A;  2Y0S B;  2N49 A;  4DN4 M;  4PZ7 A;  3J80 i;  2BDO A;  3I7F A;  3JAM E;  4I50 F;  1K83 A;  4PNY A;  4DR2 H;  1ENC A;  4IAJ A;  2PQA B;  4KKT A;  5CYU A;  3J81 L;  4MV8 A;  5JUM A;  2I07 B;  1B9N A;  2XWB B;  1F2L A;  1N36 Q;  2F0Q A;  1DZ1 A;  5EKK A;  4UCT A;  3I12 A;  1A3T A;  4RZQ A;  3HB9 A;  5LMU L;  4IUT A;  1STG A;  2J7Z A;  2WE6 A;  3MWM A;  1BCP D;  3MEF A;  2NU6 B;  1ET6 A;  3PUY A;  1O7I A;  2DJF C;  2O5J C;  1S4Z A;  3IFD A;  4C3I H;  4AQY Q;  1V1O A;  4DV0 H;  1H9J A;  1J9O A;  4QJF A;  4ZK9 B;  2K05 A;  4HJ8 A;  1XMO L;  5IT9 c;  4QWE A;  4DR6 Q;  2ES2 A;  5H1S E;  3G6J B;  1HR0 W;  2HT1 A;  2C2D A;  3CMA A;  1Q3L A;  3PUZ A;  2IY5 B;  3HOY G;  3BG5 A;  2FK1 A;  3Q2O A;  1HNW Q;  4YHH L;  1AZQ A;  2K14 A;  3NP8 A;  2E2I B;  1H95 A;  5KFT A;  1VQI A;  4A3B G;  1N36 H;  3UDX A;  3I55 A;  3PSI A;  3KLS X;  3S2D H;  4HR7 A;  1SE4 A;  4B3M L;  3V6H A;  1I50 A;  4FF3 A;  5EAY A;  3BA8 A;  2VUM H;  2CVR A;  4C3H B;  3BAB A;  4O3N A;  4JW0 A;  4U7C A;  4OEL B;  3KLR A;  2K01 A;  4JBM A;  2PMZ B;  1K0S A;  1W2B A;  3GII A;  1FKA H;  1ZYR C;  3AFQ A;  3R93 A;  3IFT A;  1ICF B;  1CFM A;  4NPS A;  3BQ1 A;  4QCL A;  1K3B C;  4QGU A;  4QIW B;  5KEE A;  4IFD G;  1E2Z A;  2C22 A;  1EUJ A;  1VCI A;  2NU9 B;  2IJ0 A;  5L1J A;  3EBE A;  5COY A;  3MXN A;  4MIU A;  3BDL A;  1HNW H;  4WFN 3;  5HUR A;  1EQT A;  1SJE D;  1SNO A;  4DV3 Q;  4BBS H;  4JI5 Q;  1HNX Q;  4NXN Q;  2DNE A;  4K6D A;  4ED8 A;  1DM0 B;  3MFI A;  3SK5 A;  3FP9 A;  1PFN A;  2L0C A;  3ER0 A;  2QDB A;  5FOB B;  1E24 A;  2VB2 X;  3NTK A;  1HZ9 A;  3QWN A;  4ILW A;  3M9M B;  4DF7 A;  4A3B H;  2LMC B;  4MV4 A;  2F0G A;  2E2H B;  1KRT A;  4DK1 A;  1EYA A;  5GAG C;  3H94 A;  4TRD A;  1TWG B;  4DXF A;  2W6M A;  3N42 B;  1ZKO A;  3LWU A;  4M1U B;  5LHY 1;  1C0A A;  1GVP A;  2LS0 1;  1TWA B;  4CJ2 C;  4JVZ A;  1KDC A;  4S3S A;  2V4Q A;  3RBD A;  3UE1 A;  3JAM c;  2MCT A;  2YYA A;  1JOR A;  1RF2 D;  4DR4 Q;  1G6P A;  3T51 B;  4IFD H;  1BKB A;  2J0T D;  1HNX H;  4JI5 H;  1BXT A;  3K7U C;  4NXM L;  4I4T F;  3PR5 B;  4IAL A;  4K5W A;  2VQF Q;  1JE5 A;  1LLR D;  4A4I A;  1KAA A;  4YY3 H;  4KY6 A;  2R93 A;  2EYM A;  1NMF A;  2K04 A;  1MBY A;  5D8D A;  5LYJ F;  5KND A;  2B2V C;  4A3K B;  4ED1 A;  5C44 B;  3GTK B;  3K0Y A;  1KAB A;  4LW1 A;  1TXY A;  1VQ8 A;  3H91 A;  2I0Q A;  1EFI D;  1U5K A;  2IHE A;  4JI0 L;  3S1M H;  2CW8 A;  3KUP A;  1GUN A;  2WB1 E;  5IT9 L;  1R9T H;  2GVB A;  2R6F A;  4QMG A;  4K14 A;  3UE0 A;  5C3W A;  4JI6 L;  3G6X A;  3GTO A;  2HDL A;  1KRS A;  5C0X I;  1C4Q A;  4JI4 L;  5DG7 A;  1GXD C;  2A8V A;  4GKJ Q;  3EIV A;  4DV1 L;  2BCO A;  1YNJ C;  2KA7 A;  1EFW A;  1RJR A;  4JCV E;  1CQI B;  3MR6 A;  4IFD J;  1Q12 A;  3HOV G;  2EDG A;  4YR3 A;  3J7A K;  4GLX A;  2VQF H;  2YS7 A;  3OHA A;  1DOM A;  2VQE L;  2FPP B;  2MNA A;  3OPO A;  2RSN A;  1BCP C;  2EQS A;  4Q8F A;  2HCC A;  1K8M A;  1I4Q A;  5IOC A;  3N6X A;  1A15 A;  2BR0 A;  4QWB A;  5C4J H;  3HBL A;  1MD2 D;  3M4Y A;  4EVO A;  4I7A A;  2HIV A;  3MXU A;  3HGB A;  1E2W A;  5DQG A;  1PRT C;  2EY1 A;  1BBX C;  4QW9 A;  1X3F A;  2VB3 X;  4YCW A;  4DR7 L;  1WCM B;  2UXC L;  4JYA Q;  4XTC S;  4GN5 A;  1I4X A;  1TY2 A;  1WI5 A;  1R4P B;  3AQQ A;  2GPW A;  1IBM Q;  4LK1 C;  4FXD A;  2EJF C;  4J9P A;  2L15 A;  3J81 j;  2W9C B;  3A7A B;  3X3N A;  1EIY B;  4K0K Q;  3V4S A;  2YRW A;  4GKK H;  3VYU A;  2EE1 A;  1WD1 A;  3HOV H;  4X6A H;  3E0J A;  2JA5 H;  2JYO A;  4JI1 Q;  1PH4 A;  5COR A;  3RMH A;  5JJL A;  4FS1 A;  5EBC A;  1YIJ A;  1YI2 A;  2E2J B;  3VR2 A;  3GTM A;  2XSC A;  3VR4 A;  1RJT A;  3CQZ B;  5IT9 W;  1M8A A;  1X32 A;  3HOU G;  2RBM A;  1YNN C;  2R7Z G;  1ILP A;  1HQR D;  2PW7 A;  4BY1 B;  2W6N A;  1JIC A;  3PO2 G;  1DV1 A;  4B3R L;  3GV5 B;  4JYA H;  3NSW A;  3CCE A;  5M9O A;  4JV5 Q;  4MV9 A;  1HR0 Q;  4KY7 A;  2XWJ B;  3K81 C;  4IUP A;  2LKV A;  2FHT A;  3H3V I;  3VPD A;  3NGD A;  1TS4 A;  1VQH A;  1L1O B;  4K0K H;  3EPG A;  3UDF A;  4JPB W;  4RGM A;  4U6P A;  3MAQ A;  3LML A;  5IYB G;  4POG A;  3ULP A;  4RA8 A;  2XCA A;  3BS1 A;  1PXU A;  4R4Q A;  5FO8 B;  4JI1 H;  3MXG A;  3TII A;  2G9D A;  4ECQ A;  4ECU A;  4ZQI A;  4GC7 A;  5NUC A;  1HZC A;  4A3D B;  4EGQ A;  1N56 A;  4IUV A;  3GD7 A;  1FJG L;  4YR0 A;  1S5D D;  3QZ7 A;  3R5F A;  4HQ6 A;  1K8A C;  2C9O A;  4IN3 A;  5IIF A;  1GUW A;  2B2Y C;  1QIL A;  2FXQ A;  2O03 A;  1HA5 A;  3U9S A;  1PYB A;  1C7Y A;  3CW2 C;  5ELE A;  4P73 A;  1EY9 A;  2NN6 G;  4IWX A;  1S03 G;  3HOU H;  1HR0 H;  2N8N A;  3JSN A;  1GSO A;  1EY4 A;  2R7Z H;  3H3V C;  5CMD A;  3GV8 B;  2ZDQ A;  3OHB A;  4EGV A;  1EZ6 A;  3RZO B;  5IOD A;  5EPL A;  5A2Q E;  3ORQ A;  5LOV F;  1NMG A;  4KD4 A;  2V4D A;  4GOP B;  4A3L H;  1JWM D;  3C46 A;  3GTM B;  3I4N G;  1LO5 D;  5HGT A;  5EPJ A;  2JQO A;  3TZU A;  5DQI A;  4CDD C;  1WTR A;  1X9N A;  2UUA H;  5ELC A;  5IP9 G;  5M5X B;  5IYB H;  3S16 H;  4BBR G;  4IFD I;  2BA1 A;  2SOB A;  4ODG A;  5LMU Q;  1NJI C;  5GAE C;  4TV9 F;  1VQG A;  2ENB A;  3QB3 A;  4O2D A;  5GAH C;  4A93 G;  1UUP A;  4HJ7 A;  1K83 H;  2AUK A;  3I90 A;  4YCU A;  2EZV A;  3KK7 A;  2W8L A;  3ND8 A;  5C3E G;  4CC5 A;  1XMO Q;  4H0L C;  2H5X A;  2PI2 A;  4FU0 A;  4XYO A;  4KHZ A;  1C3O A;  3KHG A;  3WWV A;  4N8F A;  1VQN A;  5FD6 A;  5GRO A;  4DR3 L;  4KY5 A;  3ZYY X;  4UCS A;  5KFW A;  2YRX A;  1ICW A;  1YHA A;  2NN6 H;  4YHH Q;  1C48 A;  3A74 A;  1GSH A;  4XIG S;  4R9W A;  2IMW P;  2UVR A;  1L0X B;  3HZX A;  1JWS D;  1WTW A;  2R92 A;  1RCV D;  3VA5 A;  1TWC B;  4DR2 L;  2E2H H;  1EQV A;  2KCM A;  1EU3 A;  3TSS A;  1LV9 A;  4B3M Q;  4G7O C;  4BXX H;  3K5I A;  3CC7 A;  5D14 A;  1TWG H;  2P0A A;  2PZW A;  1TWA H;  1E7Z A;  1TWF A;  3RGX A;  4IPH A;  4BBR H;  1ROD A;  5KFK A;  1XMO H;  1Y8O B;  2KSW A;  5D65 A;  3I4O A;  4A93 H;  3N52 A;  3H15 A;  4HIO A;  3BVZ A;  1NTG A;  1RTO A;  3A7L A;  4ECR A;  2HDM A;  3GO5 A;  2VW9 A;  1TQO A;  2DGY A;  4QL5 A;  1FL0 A;  1I50 H;  2RSO A;  1B4O A;  2BDN A;  3RV4 A;  5KFE A;  4YHH H;  2R8H A;  3VA7 A;  1STE A;  2CWA A;  3QG1 A;  2HVQ A;  4DXG A;  2I46 A;  3BYT B;  3X3M A;  1HJP A;  1RJP A;  2CHB D;  4DUZ H;  4X66 L;  1D5Z C;  4DUY Q;  4A3F G;  3GQB A;  1AZP A;  1O75 A;  3WO1 A;  1IL8 A;  4FM9 A;  3KBG A;  4B9W A;  4A3K H;  5FLX c;  2YTV A;  5ELO A;  5C8Y F;  4QWA A;  1ET9 A;  1N36 L;  2VQD A;  4DLK A;  4R4O A;  1T9H A;  2QK4 A;  3KOJ A;  2FJ2 A;  3PIO 3;  1ASZ A;  1GSA A;  1S72 A;  2F03 A;  4LFA H;  4YWK A;  5K5P A;  2R93 G;  4UCO A;  4I7Z C;  3BU2 A;  2EY2 A;  3VYT A;  5DM7 3;  3RV3 A;  2QGQ A;  3SEB A;  1OXV A;  5D1O A;  3FKI B;  1A2T A;  4PZ6 A;  2R87 A;  3ETJ A;  2FLN A;  2DIK A;  4NXM Q;  3JZI A;  3S15 B;  4RNO A;  3RNU A;  3CXC A;  4DUY H;  3PVX A;  1HNW L;  5C5M A;  2YU9 B;  4QWD A;  3OW7 A;  5IGB A;  1BR9 A;  1Z7T A;  1I4R A;  1RL2 A;  2NUC A;  3T53 B;  3CCQ A;  2K5H A;  4LUO A;  2F0T A;  3RIZ A;  4A3G G;  1NE3 A;  2IHF A;  2XGT A;  4IJL A;  4CGY B;  5ELD A;  1AN8 A;  1CZW A;  1JQY D;  2EPB A;  4JI0 Q;  1WCM H;  2FIN B;  4FF4 A;  3QFF A;  1FNW A;  1EZ1 A;  3J81 E;  1YVC A;  2WAQ G;  3D6W A;  5FJ8 H;  1I5F A;  1Q7Y C;  4JI6 Q;  1Q1B A;  5M3F B;  4JI4 Q;  3FDS A;  1WJJ A;  1TII D;  3U50 C;  1UEB A;  2H4O A;  5FO7 B;  2ZTC A;  3A8K E;  1CZG A;  2UU9 Q;  1UE1 A;  2CH4 A;  4LF6 H;  3R2I A;  1O7Y A;  3HKZ G;  4OON A;  4RHR A;  2C00 A;  2VQE Q;  3EYY A;  4ED3 A;  4UHV A;  4HJ9 A;  3PN1 A;  4ZHQ F;  3GV7 B;  3KF6 A;  1SLJ A;  1V8Q A;  1I6H B;  3QZ8 A;  1XXG A;  1IKL A;  3HG9 A;  4CBV A;  4DV6 L;  2AQ3 B;  2F0V A;  4JBK A;  3GTO H;  3V4Z A;  2EYO A;  2ATW A;  2Z0S A;  3NTH A;  5I4D A;  1X56 A;  2CZG A;  2VPS A;  4YY3 L;  4JOI C;  4F88 A;  2IX0 A;  5KFL A;  1LTL A;  1I7N A;  4PMB A;  2NVQ H;  1X3P A;  2IBK A;  3IKJ A;  1CKN A;  2OCE A;  5D3I B;  3NWS A;  4F8M A;  4JI6 H;  2D2C C;  2F0I A;  4PWQ A;  1YIT A;  4JI4 H;  3V6J A;  3R5H A;  1M7J A;  2A6E D;  2UXC Q;  5D3D A;  3H4D A;  1X3E A;  3A54 A;  5IYZ F;  1S0M A;  1KTK A;  1JMC A;  2UU9 H;  2WKC A;  1CK1 A;  1YEZ A;  2Z9H A;  2EVB A;  3STB C;  2RDJ A;  1BNZ A;  1B6R A;  1SMY D;  2E75 C;  3TIG A;  3WNZ A;  2VQE H;  3OIP A;  1VBH A;  2UUC H;  5FKA C;  2VA3 A;  4IR1 A;  5FLX L;  2Q2T A;  3TS0 A;  4H02 A;  3D0F A;  5AFW A;  3VYS A;  3PO3 G;  3DWP A;  2ASL A;  1R9T A;  3GTL B;  4EX5 A;  3Q8D A;  3VR5 A;  4A3D H;  4M7E A;  4Q8E A;  3OWE B;  2SEB D;  4IWY A;  4CDF C;  3K7A B;  2F0U A;  2JEB I;  3FPP A;  1B50 A;  4O0A A;  4DK0 A;  1D8L A;  2GN5 A;  4EQP A;  4Y7N H;  1D7Q A;  5KNC A;  3U58 A;  1BVS A;  2CH4 W;  3W2D A;  5C4X G;  4PZ8 A;  5FLM G;  3KHL A;  3GTP B;  2XIG A;  2CCZ A;  5K2M A;  2UXC H;  4B3R Q;  3NBH B;  5CV6 A;  3A5U A;  3SK6 A;  3F2C A;  1JR0 D;  3KYH C;  4F87 A;  4IRD A;  4A76 A;  5KT2 A;  4R8U A;  4LSX A;  2XGP A;  4HJA A;  2OTJ A;  1VQF A;  3GTM H;  3K0X A;  5KNB A;  1RJQ A;  5CR3 A;  1M1K C;  5M5X H;  3KDF A;  3KLS A;  1SRO A;  3T16 A;  2QW7 A;  4DAY B;  4KHV A;  4GKK L;  2C35 B;  4DK6 C;  1FJG Q;  2FPG B;  5JH7 F;  2NU8 B;  1XYI A;  2DY8 A;  1NBW A;  5JEA H;  2K5V A;  5IGC A;  2EXZ A;  4E6I A;  3D4D A;  4A3E B;  3PW2 A;  1CQV A;  3GIJ A;  2YTY A;  2JA5 A;  1H9S B;  5FLM H;  5IY0 A;  1DIK A;  3TME A;  3M9B A;  4C3J G;  2IPK D;  3W3A A;  2HHH H;  4IRK A;  4MN3 A;  1Y1W B;  5FLX W;  5M3M B;  1VBG A;  1B70 B;  5IT9 E;  1HNZ L;  3LX0 A;  5A35 A;  4JUZ A;  1A2U A;  3CCM A;  4O3R A;  5KFH A;  1UNN C;  4P71 A;  4K0K L;  3T1Y L;  4RFB A;  2Y0S A;  2F0N A;  1T36 A;  1O7L A;  2A19 A;  1B3A A;  2NYZ D;  2F52 A;  3RFC A;  1S40 A;  4JI1 L;  1Y1V A;  2FLP A;  4HYK A;  2R92 G;  2WAQ E;  3K59 A;  4NB3 A;  2NZO A;  1KJI A;  5JEA J;  3GID A;  5JOB A;  2PQA A;  2UVW A;  2Q8T A;  2PVP A;  3KTM A;  5EKL A;  4F4Y A;  2VA2 A;  3DHQ A;  4HJ5 A;  4KN7 C;  5IYC G;  1MKH A;  1HFG A;  3K5O A;  3FPU B;  4GN3 B;  2DJG C;  3DWQ A;  1E3P A;  1M4V A;  1V9P A;  1Q46 A;  1JOO A;  3HKZ E;  3E5N A;  4C5B A;  5CC4 A;  3NEM A;  1J8I A;  3HRZ C;  2B2W A;  3NBI A;  4K5V A;  3TRE A;  3CP0 A;  3OHX C;  3URY A;  1SFO B;  2BH2 A;  3S14 B;  1B33 N;  1XPO A;  1BJT A;  2MO1 A;  4MA0 A;  4BY7 G;  3RLN A;  2BE5 D;  3HOX B;  1D5M C;  4UAI A;  4DR2 Q;  5LMN W;  2GLT A;  3PW4 A;  1FR3 A;  2N78 A;  3S9W A;  4ECY A;  4DR1 H;  4GNX C;  1RK5 A;  1PYW D;  3L7Z C;  3MVV A;  3OOC A;  4DPG A;  3GTJ B;  3HEJ A;  5BN5 A;  2E2I A;  4C3I G;  1VQL A;  2UUA L;  5G3L F;  1WVL A;  1PZJ D;  4KJO A;  1PTO C;  3T4A C;  3VDY A;  2R92 H;  2MHV A;  2FP4 B;  3BAA A;  4LMY A;  3NEN A;  3C1E A;  4MTN A;  1JWU D;  4B08 A;  2XGQ A;  4J9Q A;  1RK6 A;  2XCL A;  1Q8I A;  3S17 H;  2CKZ B;  4TQS A;  3U9T A;  3KHH A;  3S15 H;  2DZD A;  4LH7 A;  1V1P B;  2Q8R E;  2K1B A;  2R8G A;  2VXW A;  2PMZ A;  1QCB D;  2Q2U A;  3WDN A;  4NP5 A;  1TWF H;  3TQ1 A; 
#chains in the Genus database with same CATH homology
 4X66 Q;  1HZA A;  4IFD J;  1Q12 A;  5JEA G;  3HOV G;  4IPG A;  5M5W H;  4GLX A;  4X64 Q;  3J81 i;  2EXD A;  2NN6 I;  3RN2 A;  2VQE L;  1OXS C;  2VUM G;  3M7N A;  2KEN A;  2R7D A;  1PHJ A;  4JG2 A;  3RLF A;  3S1Q H;  1Q82 C;  4BY7 H;  4IPD A;  4B3S L;  2MNA A;  2JA6 G;  1CUK A;  4LFC Q;  2VNU D;  2EQS A;  4LF4 Q;  4RG1 A;  3RR5 A;  3STB D;  1W3S A;  3W1G A;  3J7Z C;  1HH2 P;  4JBJ A;  4B3T L;  3RZO H;  1A62 A;  5C4J H;  1PH6 A;  2VY3 A;  4DV7 Q;  2HIV A;  4MZ9 A;  3OTO L;  2IT1 A;  3I4N H;  3L2P A;  1X3F A;  3HOZ H;  2BH8 A;  4BBS G;  4YCW A;  5IP9 H;  2HHH Q;  2JA7 H;  4DR7 L;  3T1H L;  2UXC L;  4JYA Q;  4DNI A;  4XTC S;  4JC0 A;  4GN5 A;  1KAW A;  2Q2I A;  1WI5 A;  4R1J A;  3AQQ A;  1IBK L;  4L5S A;  1IBM Q;  5LMN L;  4DV0 L;  3GDE A;  1K9M C;  2JA8 G;  2RF4 A;  5C3E H;  5AJ3 L;  4UP9 A;  1YZ6 A;  2L15 A;  3J81 j;  4DUZ L;  1V1Q A;  1EIY B;  4LF5 L;  4K0K Q;  2NVY H;  4HIM A;  1MJC A;  1K8G A;  3M4O H;  3HOV H;  4OO1 I;  4X6A H;  1G29 1;  2JA5 H;  3KLW A;  4LF9 Q;  4YWL A;  4JI1 Q;  1PH4 A;  2ZM6 Q;  1N32 Q;  3D31 A;  5JJL A;  1WFQ A;  4MNO A;  1YIJ A;  2JA6 H;  1YI2 A;  2PMZ E;  2NVX H;  4LFA L;  1SN8 A;  1X55 A;  3HOU G;  4RMF A;  3JAM i;  2R7Z G;  1TWH H;  2GVA A;  1XMQ Q;  2PI2 E;  1P8L A;  3OYY A;  1XTD A;  2ID0 A;  2DUD A;  3PUV A;  3TRZ A;  3PO2 G;  2JE6 I;  4B3R L;  1L0W A;  3PGZ A;  1TWC H;  4BY1 G;  4JI8 L;  4AYB G;  2HIX A;  3CCE A;  1XJV A;  3CC2 A;  4JV5 Q;  4HID A;  1EIF A;  1WYD A;  4AQY L;  1HR0 Q;  3K81 C;  4DV5 L;  3H3V I;  2MO0 A;  5GQO A;  5ELN A;  3DM3 A;  4X62 Q;  4DV6 Q;  1QVF A;  1VQH A;  1L1O B;  4DUY L;  4DR1 Q;  2AHO B;  3UDF A;  1IYJ B;  1KL9 A;  1N9W A;  2AKW B;  4BA2 I;  1S3O A;  4DR6 L;  3FKI G;  5IYB G;  2ZJQ A;  1GKH A;  3ULP A;  3G4S A;  4POG A;  2YV5 A;  4YY3 Q;  4R4Q A;  2WFW A;  2JA8 H;  3GTP H;  3I4M G;  2UXB Q;  2MQH A;  2I5M X;  2UUB Q;  1HZC A;  3GD7 A;  4OWT B;  1FJG L;  2KCT A;  1LM0 A;  5C0X G;  2JK8 A;  1IL2 A;  1K8A C;  4A3F H;  1HZB A;  4QY7 A;  1MJE A;  2FXQ A;  4L5T A;  1VQ9 A;  2F4V L;  1C7Y A;  1PYB A;  1KXL A;  3S2H H;  3CW2 C;  1I3Q H;  4P73 A;  4PMW A;  4LFB Q;  5GAD C;  2NN6 G;  2YYZ A;  3HOU H;  2N8N A;  1X65 A;  2R7Z H;  1QVG A;  2VL6 A;  3ULL A;  1PH1 A;  4KHP L;  5M5Y H;  2VZA A;  4JI2 Q;  4JOI A;  1P16 A;  4IPC A;  4R4I A;  4DV1 Q;  4LF6 L;  4OWW B;  2R93 H;  1JT8 A;  2PNH A;  4L5Q A;  3KJO A;  4AIM A;  1NMG A;  3S24 A;  1B7Y B;  1N34 L;  4GOP B;  4A3L H;  2E5L Q;  4A3M H;  3I4N G;  2LSS A;  3CPF A;  3A0J A;  4DV3 L;  2JQO A;  2B63 G;  4JI3 Q;  1U0L A;  1XPU A;  4JI5 L;  1X9N A;  4NXN L;  1A8V A;  5IP9 G;  1HNX L;  3HOZ G;  3FKI H;  5IYB H;  3S16 H;  4BBR G;  3J7A 5;  2BA1 A;  4IFD I;  2V1C C;  1BBU A;  5LMU Q;  1MIU A;  5GAE C;  1NJI C;  1VQG A;  2CQO A;  3M3Y H;  3I4M H;  4O2D A;  5GAH C;  3LGJ A;  4A93 G;  4HJ7 A;  1K83 H;  4YCU A;  1PFS A;  3CC4 A;  2OQK A;  2Q2H A;  1PH9 A;  4IJH A;  5J3B A;  2F3I A;  4A3I G;  1VQB A;  1Y1W H;  2YU9 H;  5C3E G;  5M3M H;  1A63 A;  3I56 A;  1XMO Q;  1VQK A;  2H5X A;  2PI2 A;  1ASY A;  4A3G H;  1YHQ A;  2Z6K A;  4OXP A;  3OW2 A;  4KHZ A;  3PIP A;  4DR7 Q;  2UU9 L;  3WWV A;  3T1H Q;  2JA5 G;  4R4T A;  5BR8 L;  1VQN A;  5GRO A;  4DR3 L;  4JI7 L;  1YHA A;  4DR5 L;  4YHH Q;  2AMC B;  2UUC L;  3A74 A;  1VQJ A;  2ZTD A;  4LF8 L;  3U4Z A;  2B29 A;  4P74 A;  4XIG S;  4A3J H;  4GKK Q;  5IYD H;  4DR4 L;  3F2D A;  1L1O A;  5M3F H;  2IX1 A;  3F2B A;  4DR2 L;  3TS2 A;  2E2H H;  4B3M Q;  2D62 A;  2KCM A;  1IBL Q;  2VQF L;  4BXX H;  3CC7 A;  1TWG H;  4C2M H;  1VS0 A;  2K4K A;  1OXT A;  2Y0S G;  3AYH B;  1VQC A;  3ERS X;  1TWA H;  4KI0 A;  1EWI A;  5E7N A;  1PH2 A;  2QA4 A;  4OX9 Q;  2B63 H;  1E7Z A;  3S1N H;  4IPH A;  4BBR H;  4P75 A;  1QVC A;  1XNR Q;  2JJQ A;  5C0X J;  1X6O A;  1Z9F A;  1I6H H;  3I4O A;  4IO9 A;  2I5L X;  3S14 H;  3CCU A;  4P72 A;  3H15 A;  4HIO A;  4A93 H;  1OXU A;  1NTG A;  1N33 L;  1AH9 A;  3HOX H;  3GO5 A;  4A3I H;  2VW9 A;  1L1O C;  2DGY A;  1HNZ Q;  2R7F A;  1FL0 A;  1I50 H;  4QL5 A;  1GM5 A;  2UXD L;  3KF6 B;  3CCL A;  2CWA A;  1AE3 A;  3E0E A;  2KBN A;  4A3C G;  4GKJ L;  1E22 A;  1HJP A;  1QUQ B;  4DV5 Q;  3T1Y Q;  1DGS A;  3K80 C;  3U4V A;  4GLA C;  3GTJ H;  4LF7 L;  4X66 L;  4DUY Q;  4A3F G;  3AFP A;  1GD7 A;  3CAM A;  1PH7 A;  1J5E Q;  5IWA Q;  4WJ4 A;  3RLO A;  4A3K H;  5FLX c;  1SMX A;  1CSQ A;  2YTV A;  5ELO A;  4X64 L;  3ZJY C;  3GTG H;  1KHI A;  4WJ3 M;  4GOP A;  1N36 L;  1JJ2 A;  2OTL A;  4L5R C;  3J80 c;  4UY8 C;  1CKN B;  4R4O A;  4BA1 I;  1T9H A;  3CPW A;  3KOJ A;  1ASZ A;  5JJI A;  4FDB A;  1S72 A;  3CF5 A;  3PO3 H;  4LFC L;  4X65 Q;  3J81 c;  3EN2 A;  4AYB E;  4YWK A;  2R93 G;  4IOC A;  3BU2 A;  1J6Q A;  4APV A;  3GTL H;  4ME3 A;  2QGQ A;  4DV7 L;  4IOA A;  1Y1V H;  1K0R A;  4A3L G;  1VQE A;  1AE2 A;  3K7A H;  1OXV A;  4A3M G;  4PZ6 A;  1KQS A;  3H3V H;  5C4X H;  4A3E G;  2HHH L;  4GOP C;  4YCV A;  4NXM Q;  4GLV B;  4JYA L;  4DV4 Q;  3RNU A;  3CXC A;  4DKA C;  1HNW L;  1M90 C;  1PH5 A;  1IBM L;  1RL2 A;  2UUA Q;  3CCQ A;  4A3C H;  1Y1W G;  2K5H A;  5M3M G;  4LUO A;  4LWC A;  4OWX B;  4A3G G;  1NE3 A;  2IHF A;  2XGT A;  1VQ5 A;  2OQ0 A;  2NZH A;  1PVO A;  1QZG A;  5JJK A;  4IJL A;  3A5Z B;  2EIF A;  3PF5 A;  1GO3 E;  4Y52 H;  3HOY H;  4JI0 Q;  3G71 A;  3BJU A;  4GS3 A;  4LF9 L;  1WCM H;  2QEX A;  1N32 L;  3CCS A;  1YVC A;  2WAQ G;  5FJ8 H;  1G51 A;  1I5F A;  1Q7Y C;  4A3J G;  4JI6 Q;  1Q1E A;  1Q1B A;  4LUV A;  5IYD G;  4JI4 Q;  3E9H A;  3AEV A;  1WJJ A;  2E2I H;  5IP7 G;  3U50 C;  4GNX A;  1UEB A;  5M3F G;  1XMQ L;  2ZTC A;  2JA9 A;  2ASB A;  1X54 A;  3UDI A;  2CWP A;  2UU9 Q;  1UE1 A;  1VQO A;  4BXX G;  3HKZ G;  4OON A;  2K75 A;  3KDF B;  2VQE Q;  3IRB A;  4DR3 Q;  1FGU A;  4HJ9 A;  4JV5 L;  3KF6 A;  4DR5 Q;  3M4P A;  1CKM A;  1HR0 L;  4B3S Q;  3PV0 A;  4LF8 Q;  1SLJ A;  4A3E H;  1VQ7 A;  4C3H H;  3PF4 A;  4UP7 A;  1QUQ A;  4DV6 L;  4X62 L;  4JBK A;  2E8G A;  3GTQ H;  3GTO H;  4C3J H;  4DR1 L;  3F1Z A;  2B3G A;  1YNX A;  2ATW A;  4B3T Q;  2Z0S A;  1KD1 C;  2NVT H;  1K3R A;  1X56 A;  1IZ6 A;  3PUW A;  1UE6 A;  1NY4 A;  2D0P A;  4JBW A;  4JOI C;  4YY3 L;  3HOX G;  1JJG A;  2IX0 A;  2N3S A;  2AWN A;  1LTL A;  5HGQ A;  3OTO Q;  4DV2 L;  3CD6 A;  2UXB L;  2NVQ H;  1LUZ A;  1Y14 B;  1CKN A;  2OCE A;  3L0O A;  4TQU S;  1Q81 C;  3DLL A;  1YIT A;  3E9I A;  2UXC Q;  1N8R C;  4EQ5 A;  4OO1 G;  2RCN A;  1PYS B;  1SE8 A;  1X3E A;  2HQL A;  1Q8K A;  1L2F A;  4A3K G;  1JMC A;  1YEZ A;  3KF8 B;  4PG3 A;  3UDG A;  3STB C;  1FVI A;  5C44 G;  1IBK Q;  5LMN Q;  1XNQ L;  4DV0 Q;  2AWO A;  3MXN B;  4LFB L;  3TQY A;  3F8T A;  5AJ3 Q;  2WB1 G;  5IYC H;  2UXD Q;  3BZK A;  5IP7 H;  4DUZ Q;  2YTX A;  2Q2T A;  1QZH A;  3TS0 A;  4LF5 Q;  4H02 A;  3D0F A;  3PO3 G;  4POF A;  1CSP A;  4EX5 A;  4TVA B;  3Q8D A;  2N49 A;  4JI2 L;  3H0G H;  4PZ7 A;  3J80 i;  3I7F A;  4A3D H;  2Y0S E;  2Z6K C;  3B6Y A;  3RN5 A;  2JEB I;  1VQD A;  1Z47 A;  4O0A A;  2PQA B;  1D8L A;  4KLK A;  1Y1V G;  2GN5 A;  5HY6 A;  1VQM A;  2E5L L;  3KFU A;  1VQ6 A;  5K36 G;  4Y7N H;  2ZJR A;  1D7Q A;  1N36 Q;  3U58 A;  1YJN A;  1PH8 A;  4LFA Q;  3BZC A;  4JI3 L;  1BVS A;  4GNX B;  5C4X G;  1I94 L;  2KHI A;  4PZ8 A;  1SFO H;  1EQQ A;  3S1R H;  5FLM G;  3HOW G;  5LMU L;  2JEA I;  2CCZ A;  4B3R Q;  4GN4 B;  3NBH B;  3PIO A;  3A5U A;  4JI8 Q;  3MEF A;  3F2C A;  3KYH C;  3PUY A;  1O7I A;  3HKS A;  1YBY A;  1V43 A;  4J15 A;  4C3I H;  4A76 A;  4AQY Q;  1E1O A;  4QJF A;  4HJ8 A;  4UP8 A;  2XTI A;  4HJA A;  1XMO L;  1VQF A;  5IT9 c;  2OTJ A;  4DR6 Q;  2ES2 A;  3GTM H;  3K0X A;  5H1S E;  1HR0 W;  1C9O A;  2HT1 A;  3CMA A;  3PUZ A;  5C44 H;  3GTK H;  3HOY G;  1M1K C;  2IY5 B;  5M5X H;  1A0I A;  3KDF A;  1WCM G;  1SRO A;  1HNW Q;  4YHH L;  4DAY B;  3CCJ A;  2K14 A;  5FJ8 G;  1H95 A;  4GKK L;  2CFM A;  1B8A A;  1VQI A;  4A3B G;  2C35 B;  4DK6 C;  4LF4 L;  1FJG Q;  3UDX A;  2ALY B;  3I55 A;  1PA6 A;  4LNQ A;  2I5H A;  3PSI A;  3S2D H;  1E1T A;  1NBW A;  4B3M L;  1IBL L;  2K5V A;  2F4V Q;  5EAY A;  2VUM H;  2K5N A;  1LYL A;  4OX9 L;  2R6G A;  2YTY A;  4JBM A;  1OXX K;  1W2B A;  5FLM H;  3AFQ A;  5IY0 A;  3HOW H;  4NPS A;  4KHP Q;  1XNR L;  1YHB A;  3M9B A;  4QGU A;  4LF6 Q;  3SGI A;  4IFD G;  1JJC B;  1EUJ A;  1VCI A;  4YWM A;  4QIW E;  3EBE A;  1EOV A;  1EQR A;  3G6E A;  1B70 B;  1N34 Q;  1HNZ L;  3CCM A;  4JCV E;  1PV4 A;  3W5O A;  3K8A A;  4DV3 Q;  4P71 A;  4K0K L;  1RIP A;  4BBS H;  4JI5 Q;  1HNX Q;  4NXN Q;  3T1Y L;  4DAM A;  4UPA A;  1XPR A;  2A19 A;  3FP9 A;  2LXJ A;  2F52 A;  3ER0 A;  1S40 A;  4JI1 L;  5IE8 A;  1J5E L;  5IWA L;  2ZM6 L;  1E24 A;  2WAQ E;  1X3G A;  2R92 G;  4NB3 A;  1UWV A;  2NZO A;  5JEA J;  1HZ9 A;  2PQA A;  2LXK A;  1BBW A;  4A3B H;  4LUZ A;  3RZD H;  4DV2 Q;  4HJ5 A;  5IYC G;  1MKH A;  3G48 A;  1Q86 C;  4GN3 B;  1K73 C;  1KRT A;  5GAG C;  1E3P A;  4X65 L;  1V9P A;  3M85 A;  2RHS B;  1Q46 A;  3HKZ E;  3PCO B;  2K50 A;  3H0G G;  1GVP A;  4A3D G;  2VS1 A;  1C0A A;  5BR8 Q;  1KIX A;  3I2Z A;  1EYG A;  2MFI A;  3NEM A;  4JI7 Q;  1VQ4 A;  2UUC Q;  3UE1 A;  1UE7 A;  3JAM c;  3TRE A;  2ZJP A;  1XNQ Q;  2ZTE A;  3CP0 A;  2BH2 A;  3JC6 6;  1XPO A;  1UE5 A;  4DR4 Q;  2MO1 A;  1YJ9 A;  1G6P A;  3W1B A;  4BY7 G;  3RLN A;  1VQP A;  1BKB A;  2E2J H;  4AH6 A;  3K7U C;  3CQZ H;  2KHJ A;  5LMN W;  1IXR A;  4DR2 Q;  4NXM L;  4DV4 L;  2N78 A;  1OTC A;  2VQF Q;  1JE5 A;  3PO2 H;  4GNX C;  1YJW A;  3L7Z C;  4BY1 H;  3TEH B;  3ULJ A;  4A4I A;  4DPG A;  1SRU A;  1JB7 A;  2UUB L;  4A75 A;  4R4C A;  2UUA L;  1VQL A;  1SR3 A;  1NMF A;  2OWO A;  4QQB X;  2RHQ B;  1KC8 C;  3M4Q A;  3PUX A;  3VDY A;  1PH3 A;  3FHW A;  1CKO A;  1I94 Q;  2JA7 G;  4LW1 A;  2R92 H;  3CCR A;  1TXY A;  4HIK A;  1VQ8 A;  2D0O A;  1N33 Q;  2I0Q A;  3NEN A;  1U5K A;  2IHE A;  4MTN A;  2K52 A;  4DK3 C;  3KJP A;  4JI0 L;  3S1M H;  2WB1 E;  1R9T H;  2GVB A;  2CKZ B;  3S17 H;  3CCV A;  3UE0 A;  3S15 H;  2BA0 A;  4JI6 L;  4ALP A;  3ICE A;  1VQA A;  1KRS A;  5C0X I;  3HFZ B;  1WOC A;  2A1A A;  3CME A;  2Q2U A;  5DLQ E;  4JI4 L;  3EIV A;  2A8V A;  4GKJ Q;  4DV1 L;  3NEL A;  1EFW A;  1TWF H;  4LF7 Q;  2WP8 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...