4BBRJ

Structure of rna polymerase ii-tfiib complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 17
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4bbrJ00
3B6AA 1ORKA 5EG0A 3S1QJ 2E19A 5GPAA 1ZTRA 3BTJA 2LKXA 1TWHJ 2JA7J 4XICA 3GBGA 3BTCA 1AKHA 1EF4A 2R5YB 3BQZA 3SJMA 4CYCA 4A3MJ 3BR6A 1JJ6C 1SANA 1FJLA 3CDLA 1MBGA 4C3IJ 2LY9A 2M8GX 2Y9ZA 2ZB9A 2K9NA 5K7FA 3PM1A 1OCTC 3K2AA 3A01A 1HDPA 3BG3A 1JKOC 3IV5A 1ZK8A 2NOGA 4W97A 2EZKA 4A3EJ 1TWCJ 2TCTA 1O4XA 2COBA 2LTPA 3GTMJ 2FQ4A 2CUFA 1B72A 3HOWJ 2DMQA 4AUXA 1ITYA 2X9DA 4V2FA 5IYDJ 5FKMA 5J3LA 1NK2P 1T33A 3Q0WA 3GTPJ 1BL0A 5EDNA 3JRDA 5IP9J 2EBIA 5IOYA 2LP0A 3A03A 5IPAA 1JKQC 2DJNA 5M5WJ 4A3DJ 4MO7A 4JX6A 1MBHA 4DYQA 2K9QA 1JGGA 2NVYJ 2WAQN 1GV5A 3A01B 4IHXA 1JUPA 2Y9YA 3SFIA 5GPCA 4MIMA 5C44J 1RKTA 2E2IJ 1MBJA 2DA3A 2ELKA 2Y2ZA 3G1MA 3LOCA 2HOTA 1YRNB 2L7MP 3JREA 4RBOA 3BR2A 2L0KA 3CMYA 1FEXA 1XC5A 2LD5A 4MLOA 3Q3SA 1LE8B 1E3OC 4BXXJ 1ZQ3P 1P7IA 1GDTA 1IRZA 1LFBA 5EG0B 2DMUA 3BTLA 3MKLA 1FIPA 4BKXA 4D5FA 2OPTA 1U78A 5F08A 3HM5A 1P7JA 1MSFC 1X58A 3MVPA 3LSPA 3ZQLA 2EZHA 2YUSA 1JUMA 2W48A 2YU9J 1IDYA 1HDDC 2NVQJ 4C3JJ 2VKEA 4A69C 5FKKA 4XRSG 3BR3A 4BBSJ 2QF7A 4I76A 4JX5A 3CCYA 4MFDA 2CU7A 3RZOJ 4C3HJ 4BY1J 3JRAA 3OIOA 2K9SA 5J1UA 4DYRA 1TWFJ 3H3VK 3BT9A 1IC8A 4Y52J 3ZQGA 2IAIA 4JX4A 2JN6A 5BNGA 1JUSA 2JWTA 3S17J 1OCPA 3TW7A 1I50J 2PMZN 3OOUA 1JT0A 5J1YA 3NAUA 4M3BA 1QVUA 3W6VA 2HQ5A 4X1EA 2O9LA 3QPLA 1MBFA 5EGOA 1LE8A 2JMWA 5IP7J 3GTOJ 3HOUJ 1WI3A 4J19A 1IG7A 1K61A 4G12A 4IHVA 5E3MA 1PUFB 2P81A 5GP9A 4B4CA 3BR0A 2DTZA 5F04A 5DS9A 1IDZA 2XPUA 3JRGA 2DMNA 1Y1WJ 3S16J 3A02A 3UKGA 2LFBA 3JRFA 1F36A 2B63J 2NS7A 3HKZN 5DTDA 2M9HA 1H89C 2GM4A 2ECBA 2EQRA 3ZQHA 4AC0A 4ABZA 4UUSA 5M5XJ 2L7FP 3QPSA 2XRLA 1OJLA 5F1JA 1A5JA 2Y31A 3BG9A 4A3IJ 2DA4A 4IEJA 3IH2A 1W0TA 1HCRA 3OSGA 3M3YJ 4QTRA 4X6AJ 3JR9A 4HNVA 5M3MJ 1ETWA 1XS9A 2LLKA 2AO9A 5C3EJ 5K7ZA 1HLVA 1QVTA 2FD5A 3LNQA 4DZPA 1NK3P 2N8GA 1MNMC 2MW8A 1U8BA 3HOVJ 9ANTA 1IUFA 2KT0A 2X6OA 5FJ8J 2H8RA 1MH3A 3ZQFA 5FKLA 2Y0SN 4LOCA 2Y30A 4FE7A 2LR8A 2DA7A 4M3GA 2E2HJ 5M5YJ 3NARA 3RKQA 4A93J 1W0UA 2DMPA 2DA2A 1DU0A 1VF9A 2ID3A 2HXOA 4A3CJ 4D5CA 3O8GA 2D5VA 1HOMA 2JA5J 3JRHA 5E3LA 1I3QJ 3TEDA 4A3FJ 2VKVA 3HEFA 2MG4A 5EGOB 1Z77A 2XGDA 3S2HJ 1UMQA 1IGNA 3Q0VA 2CJJA 1JJ8C 2DA5A 1RR7A 3LSGA 1BA5A 3JRCA 3PO2J 1WGXA 3FK6A 3I4MJ 3HGGA 1BW6A 5FLMJ 4BY7J 3PO3J 1U9OA 3GTKJ 2WV1A 2M2EA 5F0CA 3G1LA 1JT6A 2R7ZJ 2MGQA 3IH3A 1RESA 1RETA 1BJZA 1Z0XA 2X48A 2ID6A 2DMTA 1RKWA 3BR5A 3BQYA 3WHCA 5FKOA 2L9RA 1ETKA 4A3KJ 1U9NA 1WCMJ 3FKIJ 3HGYA 2GBYA 3MN2A 3WHBA 1JTXA 3BG5A 4M6VA 2EZIA 5F27A 2R5ZB 1H8AC 2NVTJ 5JLXA 1MBEA 2QCOA 5EZGA 2NS8A 3TP0A 3LSRA 1UHSA 2HDDA 1R9TJ 1ETYA 4A3BJ 2XGEA 1ETXA 5FLVA 3HBLA 4FTHA 3RZDJ 4JYKA 1CQTA 4MFEA 4FE4A 3S1NJ 3C2BA 2XGCA 1GVDA 2CQQA 2IBDA 2XPVA 2LVSA 1VNDA 4DYCA 2HOSA 4XIDA 1JKRC 1F43A 1POGA 2R93J 2O7OA 4QSHA 3Q0UA 3HOZJ 2JK3A 2E2JJ 4UUSB 2MSYA 5EEAA 2GLOA 1LFUP 1B8IA 1ZR2A 4A3GJ 1GUUA 5F0HA 5K7HA 2E1OA 1TWAJ 3G1OA 1QRYA 3OSFA 3LSJA 3M4OJ 3IH4A 3SDGA 5IP6A 2IEKA 2FX0A 4EEFG 3BTIA 3F0CA 4AYBN 4BBRJ 1UG2A 4Y7NJ 1MH4A 3ZOBA 2NVXJ 4NDLA 2EZLA 1RPWA 2HI3A 2ME0A 4W1UA 3DCFA 3GTGJ 1ZR4A 3L1PA 3FISA 2L7ZA 2VUMJ 2KDZA 3S1RJ 2VI6A 1XG1A 5C4JJ 3JRIA 1MBKA 1ZKGA 5IYBJ 1GT0C 1FIAA 2CRGA 3HB9A 4C2MJ 1YRNA 3TW6A 4A3JJ 2XB0X 1PUFA 3HDDA 2JA6J 5J1RA 4DW6A 1ETOA 1BW5A 1MSEC 4RDUA 4XK4A 2I10A 3GTQJ 1AU7A 4UUTA 1IV6A 2O8KA 2DA6A 3E7LA 1TWGJ 3S14J 2XB5A 1WPKA 2R0QC 1VI0A 1WH7A 3S1MJ 2OF7A 1X2NA 2HOAA 1FTZA 4CYCB 2R5ZA 3GTLJ 1JTYA 4DZJA 5C4XJ 1HF0A 1X2MA 2ME6A 1GV2A 1NTCA 5EZHA 1WH5A 2CQXA 3GTJJ 1ENHA 1OFCX 5HODA 3K7AJ 3JRBA 3DEWA 5E3OA 2R5YA 1JKPC 4GFBA 3BR1A 2K40A 3VPRA 1SFOJ 4JP0A 1ZGWA 1QPIA 3QQAA 3D1NI 4M3EA 3HOXJ 4IHYA 2VPRA 1A6IA 1T56A 2RAEA 2M0CA 4S0HB 2XSDC 5JLWA 3FIWA 4IHWA 3B6CA 1VFCA 1FTTA 2FJ1A 2HYJA 2M34A 2DN0A 5IYCJ 2DA1A 3H0GJ 1Y1VJ 1S7EA 3S2DJ 4FISA 2CUEA 4B1RA 3ZQCA 2HXIA 2EH3A 5EF6A 2WB1N 1AHDP 2YS9A 4XRMA 5M3FJ 3HOYJ 3S15J 5F0FA 4D7NA 2H1KA 1B8IB 1G2HA 2R92J 1ETVA 1APLC 5E3NA 2AHQA 4A3LJ 1AKHB 1K83J 4M3FA 1Q1VA 4V2GA 3ZQIA 1D5YA 5EYRA 4FCYA 4XRSA 3CQZJ 4L5EA 1IJWC 4B3AA 3FK7A 5IOZA 2JA8J 1TC3C 2XPWA 4QIWN 3TP3A 1H88C 3I4NJ 1B72B 1DU6A 4D7MA 5FKNA 2JJ7A 1I6HJ 2ECCA 3O8HA 3RQIA 4I6ZA 2G0EA 2LK2A 2TRTA 4M3DA 1ETQA
chains in the Genus database with same CATH superfamily
1ORKA 5EG0A 4WK8F 2E19A 2DU9A 1CF7B 1ZTRA 2A6HF 1QA6A 1Z3YA 3WTZA 3ZMDA 1VQ6I 1WVRA 2JA7J 3GBGA 4XSZF 3BTCA 4AWXB 1T2KA 1DP7P 3F23A 4PJ0C 3KZYA 3FHNA 4HW0A 1JJ6C 1WHUA 4CYDA 5D6EA 1FJLA 3DTKA 1MBGA 3A4CA 2M8GX 4BQQA 2DFEA 2K9NA 2F5VA 4RA2A 1OCTC 2HDCA 1RRJA 1FMVA 1IXCA 3Q9VA 4ZZDA 4CICA 3FHZA 3CJRB 1WSUA 2UWMA 2EZKA 1SFEA 2LSOA 2TCTA 4A3EJ 2VOOA 3OYFA 2LTPA 1FYLA 5JFRA 3OY9A 1U8RA 1B72A 3IP4B 2O3FA 5CQGA 1QHGA 2HZDA 1G6NA 2M7BA 3CCQI 1V54H 1V5EA 2H8WA 2HPMA 1NK2P 3Q0WA 3KETA 1B6AA 1TQMA 2XUBA 4HZFA 3FX3A 1VQOI 1XSVA 2OJED 1J7KA 5KNLA 3JRDA 5IP9J 5IOYA 4HV6A 2IS1A 1GXPA 4OIRF 2WAFA 4PCQA 5IPAA 1WWXA 2H6CA 3GO5A 1KA8A 3FF5A 4MO7A 2ELJA 2E1MB 4EVIA 1JXSA 1GV5A 4F55A 1KYZA 1S29A 1W5TA 5DD8A 4IHXA 3BCBA 3K69A 4MIMA 3S3NA 3I58A 4CDGA 2OZ6A 4FETA 3TDZC 2XAGA 1XB4A 1R58A 3CP8A 4QLCU 2LNBA 3LOCA 4CO8A 4E70A 2OC6A 3A2KA 1J59A 3OYMA 2P5VA 2VBWA 2L0KA 2MD0A 2E7XA 2MLKA 1NG6A 3CMYA 4UVBA 2IP2A 3ECOA 2LD5A 1HA8A 3KEQA 3Q3SA 4F91B 2HPIA 3SYTA 2Z16A 1E3OC 4BYYA 4BXXJ 1Z3XA 1I27A 3EPZA 4G94A 1WRJA 4CA0A 2ETHA 5EG0B 2DMUA 2I8DA 4BKXA 3CD6I 2WBMA 3JAMZ 4FX0A 1MSFC 4F92B 2HGCA 4C30A 3CJQB 3KYLA 2OQGA 1YX5A 1HXDA 1IZ1A 2CV2A 1HDDC 4XLPF 3DTIA 2FSWA 4MGRA 2OD5A 1Z05A 1T6SA 1FOWA 1LEAA 4JX5A 1JHFA 4I0AA 2YPRA 1R23A 2PN6A 4LB5A 2COMA 5J1UA 3SZTA 1J75A 4U0WA 2KRFA 1LJ9A 5D6FA 2PQ8A 2E1NA 3FXQA 3ZPLA 2XF6A 3Q5FA 1VQMI 2PMZN 4A0XA 3OOUA 1JT0A 2YX7A 3NAUA 3RTRA 1FC3A 1QVUA 1E3HA 3CO7C 3H5AA 2HQ5A 2RDPA 2O9LA 2V1NA 4LGWA 1LE8A 1OCZH 1X1PA 2M5WA 3NQOA 5F6FA 2W82A 4RM2A 3I59A 2CW7A 4J19A 1FYKA 2YSRA 3ZP5A 4G12A 3FDYA 2CYYA 1CGPA 4NHJA 3BJAA 4XLFA 3F8BA 4B4CA 3BR0A 1MMNA 3WGGA 2IS2A 4AYBA 3DXJF 5FFXA 1YG2A 3F6VA 3UKGA 1MDMA 2LFBA 1H9TA 1TNSA 2K3FA 1N75A 4ENKA 3RDIA 4RB2C 2HQRA 1YHQI 2IRFG 3IWFA 4OOIA 2BVLA 2L4MA 4LG0B 5E1WA 5FB2A 4HLYA 4L5JA 1OCOH 1REPC 5KAFC 4UUSA 5EEGA 4Q47A 1BC7C 3QWLA 3U21A 2DA4A 1T39A 1A35A 4NBQA 4XN3A 2K7LA 1WZ2A 5TISC 2HKXA 5E18F 4YIRX 3TO6A 5B5EC 4AU7A 5JI6A 1XS9A 1V3FA 4ENMA 4H4KC 5GAGJ 5E79C 5C3EJ 1VZ0A 5CQEA 4MTDA 1YQAA 3IL2A 2E5ZA 2GWRA 2X1CA 4KT5C 5K5RA 3C2GA 3FXMA 2QSGX 4PSXA 2A3SA 2OZUA 2D1HA 3HOVJ 9ANTA 1D8KA 1D1BA 2KT0A 5ILSA 4BJ6C 1FBSA 1MH3A 2XF5A 3ZQFA 5IT3A 1X1CA 2Y30A 4UB8C 2K3PA 4L9NA 2LR8A 4YFKF 5M5YJ 2WC2A 2P0WA 3NARA 1K6YA 3WG7H 2GOMA 4KITB 3LL7A 2PEXA 2DQRA 1DU0A 5FRNA 3PSIA 4E4HA 1X4PA 1FBUA 4ENJA 1D3YA 3OYJA 4XLAA 3FKJA 3ZMTA 2JA5J 3RSNA 1OPCA 3JRHA 3GW2A 3OYIA 4A3FJ 1IO2A 1MJBA 4BAYA 3H36A 3F8MA 4V19K 4EM1A 2DA5A 1RR7A 4CXFA 3JRCA 4A2UA 3HGGA 5F0CA 2BEOA 3H35A 3CJNA 5E8IA 1U3EM 4MEXF 1ZG5A 1RKWA 1IRGA 3IRQA 3RIRA 3BQYA 2FA5A 3REOA 1X4OA 5BMZA 3WHCA 3LQQA 5FKOA 4KMFA 1ETKA 1FT9A 3KEYA 1U9NA 2DT7B 2G7UA 3H5NA 2BE5F 2GBYA 3MN2A 3WHBA 1JTXA 5BPDA 2O6GE 2PJRB 3DWLE 2R5ZB 3HKZA 3ELKA 3GF2A 1VQ7I 2Y0SA 4ZYDA 4EMSA 2JRTA 1W7PB 4QWQA 2NS8A 2OBPA 1YW7A 1W5CC 3QU3A 1XGSA 3HBLA 1Z91A 2CQKA 4JYKA 4CUGA 1CQTA 2FOKA 1T38A 4MQ9F 4BJTA 3IUOA 4YG2F 1GVDA 3BZ6A 4A0ZA 1USTA 2XPVA 2LVSA 2TDXA 2ICWG 2VBYA 2F4MB 4NQWB 1P92A 2ZFUA 4DYCA 2HNHA 3DBLB 1EKEA 2XKPA 1XGNA 3GCMA 1A31A 2R93J 2O7OA 3H0DA 3HTUA 3DF8A 2JZYA 3F21A 3MZYA 1ZR2A 3JTGA 2Q8KA 4A3GJ 3W6KB 2YX4A 1DP3A 2KIUA 3OSFA 1FY7A 4XKCA 2KDOA 2BYVE 2L3DA 4NUBA 5IP6A 1OYIA 2JSPA 4AYBN 1ON2A 1TZLA 4Y7NJ 1R5ID 2VQLA 4Y17A 3A0HC 1OCRH 2EZLA 2DJIA 3DCFA 1D0YA 1YIOA 2Q1ZB 2VUMJ 2KDZA 4IPAA 2MYSA 3B02A 3JSPA 2ESNA 5B1AH 5E17F 3JRIA 1N78A 2CFXA 3R60A 1GT0C 4CSWA 3F22A 4ZC3A 1YRNA 5FROA 1B4AA 3UNGC 1KQ9A 1E3PA 4EJTA 2JT1A 3I5UA 3KX2A 2BXZA 1UFMA 4XK4A 3VDXA 4ESFA 2I10A 4LG0A 3IKTA 1LVKA 2XRNA 2DDBA 2FNPA 3OOPA 2V1XA 3ZMUA 4NC6A 3L2UA 2DA6A 1DUXC 3J7AY 3E7LA 3I3LA 1IN8A 3FM5A 4HQEA 1WJAA 3C3WA 5KCMA 2B7EA 4IZZA 2CV0A 2OCCH 5TRDA 4NNJA 1TT0A 2WAQA 4DZJA 3KPHA 1GV2A 2VXZA 3AG3H 2DK5A 5JHFA 1ENHA 3DP7A 3K2ZA 5E3OA 3BPVA 3IHUA 3EUAA 2E36A 3HUGB 3K4NA 1ERDA 1T08B 4JP0A 1BOAA 5ERIA 4OMYA 4DQ2A 2ZJRF 5IT9K 2WB1A 2K9MA 4IHYA 2VPRA 4S0HB 2RAEA 1HBXG 2M0CA 4XQFA 3RI4A 3J7ZI 1J2XA 1PP7U 3B6CA 5TGTA 3MZHA 1VFCA 4IHWA 2FJ1A 2VODA 2M34A 4PGHA 4KDPA 1JHHA 4U87A 2PX9A 2V26A 4K2EA 1MMDA 1U2WA 3J80Z 4I2OA 4HF1A 1XCBA 3DEEA 4BEHB 2AS5F 2W4SA 4M6XA 2QGUA 4FISA 2XHKA 2CUEA 2V6EA 5D4RA 3S2DJ 2V7FA 1UCRA 4IJAA 3OWTA 2ZMEB 3M07A 1M1EB 3FXOA 4YELA 1PDNC 4UNOA 1AHDP 2A69F 2YS9A 1V5GA 4XRMA 3HOYJ 3S15J 3OYNA 1S9HA 4D7NA 3DBRB 1G2HA 3AG1H 5E1ZB 2R92J 5KK1A 1K79A 1APLC 2KMUA 1S3JA 3GFLA 3MMYB 4U0VA 4BGDA 2DT5A 2EB7A 1K83J 3ASNH 1G4DA 2FMYA 2W25A 2QKLB 2ZXHA 5K5OA 3BOQA 3QOEA 3OYBA 4FCYA 2IGOA 3OR1C 4PUSA 2L01A 2WTEA 3CQZJ 2QBYB 4B3AA 1UG0A 3FK7A 3VWBA 1R22A 3I59B 2KZVA 5CYVA 2R7UA 3TP3A 2CWEA 1TBXA 1DGRM 2W1OA 2K5CA 3ML6A 4D7MA 5FKNA 3BDDA 1V5FA 4KJZA 4RB0A 1I6HJ 2ZO4A 1YX3A 4M3DA 5L3DA 4OMZA 3DKYA 1LVAA 4HYEA 5GPAA 1X3ZB 2PBIA 3K6GA 1TWHJ 1YITI 3OS0A 3LAPA 3E6CC 3KP6A 4EJWA 2Q2EB 4BU2A 1FOXA 2ZFWA 3TOAA 4YRVA 3MFKA 3BQZA 1QPMA 2ISYA 5FLXK 2HTSA 1SANA 1R5HA 1QHHD 1MKMA 2LY9A 3RCOA 3OYKA 2LDUA 4EJOA 4ZYGA 2LKPA 3DPLC 3EUHA 3QPHA 5K7FA 2FBIA 1LPQA 3PQKA 1P4XA 4RAYA 1K7AA 1HDPA 3BG3A 5EEHA 1FBQA 3IRRA 2EIKH 1TWCJ 4HF0A 3ONQA 1SAUA 3AKZA 2FQ4A 5K1YA 3G71I 1MJAA 1OYWA 1T33A 3FZVA 5LGUA 1BL0A 1XSXA 2F5DA 2EA4A 1RNLA 2UXXA 1U0JA 4L0ZB 1HW1A 2R7QA 3DKXA 1JKQC 2DJNA 2W57A 5M5WJ 4A3DJ 4JX6A 3OS2A 4DYQA 3OYEA 3RYPA 3VYUB 5D5XB 1ZRFA 3A01B 5LRRA 4J01A 3H1CA 4OWRB 3SFIA 3LA7A 1X1AA 3S93A 1ZREA 2DPDA 3HG9A 2E2IJ 1MBJA 1HKSA 2DA3A 3MCZA 3SZPA 2HOTA 4CH7A 1R4NB 2R7WA 3E0JB 4M9SA 2EV6A 4UB6C 1J09A 4RBOA 4GDFA 2P7CB 5F1RA 1TQPA 2KKOA 1E0EA 4BJ5C 3WU1B 2LBFB 1SVLA 4HX8A 2KIMA 2MC4A 2OAZA 2Z1DA 4IRHA 1G3TA 1YS6A 2CMPA 5GAEJ 1ZQ3P 1P7IA 2O03A 4M73A 5BPIA 1GDTA 4I0BA 1FP1D 1ZAOA 2LH9A 3MKLA 1O3RA 1FIPA 4D5FA 1FYMA 1Y39A 1U78A 5F08A 3B73A 1QQIA 2CW8A 3V8KA 2H09A 2RREA 4HX4A 1SD6A 2W85A 2NVQJ 4C3JJ 3HHGA 1EH6A 4XRSG 4A12A 2XAQA 3BR3A 4ZH4F 4AIHA 4KFCA 1W36D 4BBSJ 4I76A 2AQFA 2JRMA 3CCYA 4M6YA 4PK4A 5FFZA 3FXJA 1LDDA 2VASA 2JUCA 2XAUA 3TQNA 2K4BA 3JRAA 1S6LA 4ETSA 3JCUC 5DUKA 3BT9A 1D0ZA 2A07F 2ZCWA 4JK1X 3H9JA 3T1BA 1MW7A 1CF7A 4JX4A 4XM3A 1FZPB 2DPUA 2VJ4A 5BNGA 1JUSA 2EIJH 1VQ4I 3S17J 4TV7A 1I50J 2AXLA 3ZQ7A 1QBJA 2DAOA 2P5KA 4LB6B 5DM6F 4Q5SF 4PJMA 3L00A 2BY2A 5AIPA 1MGTA 3FXKA 1E2XA 1EV7A 3C18A 2VE8A 3GTOJ 4Q48A 1G3SA 2ZXIA 4RB3C 4E7SA 5CKTA 3ERMA 3V7CA 4YIFA 3D5SC 1K61A 3HYIA 2STWA 4IHVA 2LBFA 5CVIA 2GA2A 4MEYF 4BL0B 4PFOA 2VQHA 4DJAA 2P81A 2F4OB 5GP9A 2XGXA 2R7RA 1X1DA 1D1CA 3AAFA 1Y1WJ 2DMNA 3X2QH 2WAEA 5HLHA 2MBFA 2LKSA 5HOOA 3K1NA 4IHSA 1P2FA 2B63J 2IGKA 4UVCA 2M7AA 4S04A 4L18B 3DPTA 2K27A 2GXBA 2QUFA 2RC4A 2EFWA 2HVRA 2K9LA 2E1MC 2CV1A 5H20A 1A5JA 2HEOA 2Y31A 3LSIA 3BG9A 3VEPA 1W0TA 2IA1A 1MDMB 1HCRA 3V42A 1Z1DA 3M3YJ 3SZGA 4QTRA 1UHWA 1Q1HA 3PIOF 4BHBA 5ED4A 1QZYA 3QU6A 4G9YA 5M3MJ 1YI2I 2YU3A 5HNHA 4P9FA 3LSKA 3K1MA 1HLVA 2DT6A 4IRIA 3M8FA 3ABTA 3HIFA 5GTIC 5LEJA 1Z67A 3L09A 1TQIA 3VYRB 4A0YA 2FD5A 2KLOA 3ECHA 1NK3P 4RGXA 4KISA 1N25A 5E8GA 1FWZA 1U8BA 5HDKA 3DBHB 1ZELA 2X6OA 3U1DA 2H8RA 2JUGA 2NNNA 3I0TA 4LOCA 2WY7Q 5FKLA 2VBXA 5D4SA 4CCLA 5E1XA 2PJRA 3QODA 4U7BA 5LHIA 3TGNA 4BQAA 1BM9A 1W0UA 2DMPA 2DA2A 3OV8A 2X6XA 1PJRA 4A3CJ 1I3AA 2D5VA 1HOMA 5D8LB 5LHGA 5E3LA 2R4GA 4RB1A 4IHTA 2DW4A 1I3QJ 3SEZA 2MH9A 4RS8A 2IJLA 3RQ4A 3ZN0A 4DBQA 2XROA 1AOYA 1UHMA 3K0LA 2XGDA 2MLGA 1FNNA 3S2HJ 1UMQA 2KISA 4I99C 2KHMA 2CJJA 5KHDA 1XMKA 2WADA 4P1WA 1WGXA 3FK6A 2XKOA 1ZN2A 3KP4A 1NHAA 3PO3J 1SD7A 5FO5A 3G1LA 5HVQC 3GFJA 3PJRA 2BY1A 1IN4A 2Z2SB 3IH3A 2BV6A 2RGVA 2VJ5A 4I09A 1RETA 4XN0A 1BJZA 4ITVA 5IY5H 1IN5A 4II2A 1IRFA 4FX4A 3CF2A 3RKXA 3VYSB 4Y33A 2HOEA 2JVHA 1FSEA 5CVJA 4QPOA 3WGHA 1MMGA 3ZCOA 3FKIJ 3F8NA 2JTVA 2XDVA 2NVUB 1LQ1A 1YLFA 3PSFA 3W6JB 4BXFA 5JVGF 3E6DA 1YJ9I 2QCOA 5EZGA 1UHSA 2HDDA 3FWEA 5FLVA 2PJPA 1BI0A 4XLNF 5AIQA 1IN7A 3QYFA 4MFEA 4Y13A 1ODDA 3C2BA 4HSRA 2E7WA 2P7VB 4LLLA 2MABA 4BEHA 4WX9A 1VNDA 3CC7I 3CUQC 4YEJA 3GZ5A 1GVJA 4GYIA 4IXAA 1KQ0A 2V9PA 2X1EA 3BROA 1LUJB 5HDNA 2R3SA 2Z33A 3KP3A 2A68F 3I71A 4HBLA 3C2HA 5DUIA 1POGA 3ZMSA 2NS0A 3HRSA 5ICGA 1STZA 3L2CA 3Q0UA 4G6QA 2JK3A 4UUSB 2L9VA 2MSYA 2DDAA 2EFQA 1BI3A 4LJZF 1B8IA 5JVTA 3WGIA 4ESJA 2BY3A 2E1OA 1VQLI 2OU2A 1QRYA 3K70D 2DYRH 4L9JA 3SDGA 1YJWI 3MAJA 1HW5A 2HKOA 4BACA 3BTIA 4GYGA 4BQNA 4BBRJ 4BDYA 2HDWA 3H9GA 4FT8A 3ESWB 1USSA 4OU0A 1VQ9I 3ZOBA 2HI3A 1RPWA 2ME0A 2HYGD 4NDLA 3GTGJ 1RC9A 3WTSC 4OINF 4CCNA 4Q4ZF 4D9JA 3LQRA 3MEXA 1I1GA 3CZ6A 1XG1A 4BH9A 5C4JJ 4P55A 5JHUA 1O7FA 3LSMA 1ZKGA 3RKYA 5IYBJ 2CRGA 3HB9A 4C2MJ 4EJVA 1KU2A 3MD2A 5CVUA 4A3JJ 2G7HA 5J1RA 1ETOA 1BW5A 2DOFA 1MSEC 2CFOA 4RDUA 1GLNA 2IT0A 1JGSA 4E7KA 5HS7A 3GTQJ 2EWNA 2IXSA 2XIGA 3E97A 4UUTA 5L3GA 4AVZA 5DCFA 4Z2YA 4EGZA 3P7NA 4UVAA 3SEQA 3CUOA 4XLCA 1X1BA 1HKQA 2R0QC 1WH7A 2UZKA 5CJ9A 2OF7A 1SC7A 2ZSHB 1AA7A 1FTZA 2GXGA 3GTLJ 2QYOA 1JTYA 3F8FA 3O6BB 4N9IA 1X2MA 4KA4A 1EA3A 3IWZA 3BJ6A 5HLIA 1K78A 3PQJA 1WH5A 1KU3A 2CQXA 3GTJJ 1RZ4A 1BR4A 2R5YA 1UAAA 3MKYB 2CQNA 2PMHA 3ZGKA 3S32A 3DQVC 4XKVA 4B8XA 2K40A 1KQ8A 1V55H 3VPRA 1SFOJ 3CMEI 1XMXA 1QPIA 3RPQA 1Z7LA 2J5OA 2VBZA 2VIXA 3S2WA 3HOXJ 3SHFA 2UUZA 1A6IA 1ZYRF 2KRCA 5HS9A 5ICFA 2WWYA 2R7VA 1OISA 1FTTA 1IV8A 2QQ8A 1R1TA 2HYJA 4IL6C 3VOEA 2QBYA 2XVCA 1VQPI 2M0MA 4B47A 4F7ZA 3GMEA 1LFPA 2XC7A 1S7EA 2BY0A 1S8NA 2P6SA 3BZKA 2RNGA 2ADUA 3KIOA 3TL4X 4B1RA 3ZQCA 4ZDPA 4LG3A 2EH3A 4RGRA 1Z9CA 4XL9A 5EF6A 3WE2A 2VC1A 1OYYA 4RLFA 5M3FJ 3PNYA 3E3VA 5LEKA 4LITA 1B8IB 2CSOA 2HU9A 2ACJA 1F5TA 1D8JA 2WA0A 4E7IA 5E3NA 4X0GA 2AHQA 4L9VA 3J81K 3PIPF 1AKHB 2EA2A 4WWCA 4V2GA 2OUMA 3ERED 1FMWA 1FOYA 5EYRA 2P4WA 1X3UA 2L5QA 3W2AA 1TTYA 2VPLA 2CH0A 4L5EA 1HSTA 1YFHA 1S72I 3BWGA 2JA8J 1SFXA 3CO6C 2XPWA 1H88C 3U9GA 2ISZA 3MZ8A 3V8JA 2F6CA 1K6OA 2JJ7A 3E5QA 3O8HA 4XRFA 1KU9A 3RKWA 1DGWY 2VL8A 4UY8I 2V6CA 2DODA 3IAM2 2KJCA 2VKDA 3S1QJ 2LY2A 2QZ8A 3OR2C 2M8EA 1YJNI 1BC8C 2LKXA 3GUDA 4KN7X 4HA8A 4XICA 3AL0C 1EF4A 2ZSIB 1G59A 3SJMA 2HFHA 1G3YA 2CUJA 3ZMVA 4A3MJ 4O3MA 5LD2C 3T0YA 1B9NA 3CF5F 3I53A 4E7HA 1BIAA 2DI3A 2F4IA 2RKHA 2FNAA 3G3ZA 3HL2A 2Y9ZA 2ZB9A 2Q0OA 2VXDA 4O6JA 2I5UA 3PM1A 1U5TB 3K70C 3K2AA 4PJLA 3L7WA 1MD0A 1ZGJA 5EJCA 3IV5A 1ZK8A 3GFMA 1JKOC 3BPXA 2COBA 2RVCA 3H92A 4GRIA 4LFUA 2LC2A 1DQUA 3W3CA 4AUXA 3PNVA 2X9DA 4CCKA 3LSTA 4D0PA 3ZXSA 1Z21A 3GTPJ 5L3FA 4KT6A 4XKBA 2EBIA 1P4AA 3RYRA 2LP0A 1MZBA 2KPMA 1RR8C 1R6RA 1WQ2A 1NH3A 4PGGA 3M1CA 1YTYA 1MBHA 2K9QA 3BZCA 2Q2EA 1JGGA 5FD5A 2WAQN 3ABMH 3AG2H 2FBHA 3CUQA 2HWVA 4AM3A 2IGMA 3F9KA 2Y2ZA 1BR2A 2CQ7A 4Y3OA 1T98A 2P8TA 1OR7A 1MMAA 1ACIA 3KZZA 3BG6A 3BR2A 3EYIA 5DD4A 4HG2A 3EYYA 1IUYA 5D8KB 1WJDA 3KP5A 2LF7A 2BGCA 2DLLA 4MLOA 4HNTA 1XGMA 1LE8B 2ZJPF 4NQWA 1IRZA 1LFBA 2VQCA 5B1BH 3I56I 4GGGA 2VQGA 2FQ3A 1BI2A 5DDGA 2IW5A 3MVPA 4BXUA 3ZN1A 2H1LA 3HSRA 4G7ZF 2EZHA 2YUSA 1B1BA 1JUMA 2W48A 4HDVA 2YU9J 1XSDA 1R5GA 5FKKA 5HNFA 4RAZA 4KICA 3FMQA 4MFDA 3KP2A 2CU7A 4G6DA 4C3HJ 4BY1J 4XLEA 3OIOA 1ZG1A 4DYRA 5D5WB 1TWFJ 4HV5A 3HHHA 1I6XA 1IC8A 2JN6A 2ELHA 3ASOH 3H3ZA 4PDKA 3W2VA 3CESA 3C1DA 4RGUA 4ZDOA 5J8CA 4M3BA 2FE3A 2ZNZA 5JR3A 3G6EI 3W6VA 4AD9A 5GAHJ 4IO9F 2DQLA 4X1EA 2R7OA 3K4KA 2C6YA 3OYCA 5K5QA 5EGOA 3LA3A 2D2WA 5IP7J 3P9KA 2WV0A 3OMYA 1TT5B 2VJIA 2F48A 3D5LA 5BS6A 1PUFB 3P9IA 2UXNA 5FD6A 6PAXA 2ZBKA 2LYCA 2W24A 5DS9A 1IDZA 5DV5A 4G6TB 1ZLJA 1W7PD 3A02A 3DFGA 1R7JA 4E7ZA 3MKZA 2X85A 1QU3A 1F36A 4UHTA 1RUNA 4Z6YA 2M9HA 2GM4A 2BW3A 4UV8A 2ECBA 4C2TA 3LAJA 1MMSA 2VC0A 1WJCA 4ABZA 3WG9A 1HW2A 1O3SA 2JSCA 2VN2A 5M5XJ 2ZJQF 3QPSA 5F1JA 4ANJA 1K78B 4A3IJ 4MHGA 4IEJA 3OYGA 3Q9SA 1QNTA 3OSGA 3KEOA 2K4JA 1SVMA 2K85A 3SQNA 3WODF 5FRMA 1F9NA 1ETWA 2LLKA 2AO9A 2E5NA 4AVPA 2XASA 3BJOA 1OQYA 5K7ZA 5L3BA 1QVTA 2XAJA 4EGYA 1XD7A 2BXYA 1BOBA 1A6QA 4DZPA 5KVRA 2N8GA 4B3XA 1MNMC 5HLTA 2BW3B 1S5LC 3RPUD 1IUFA 4WF2A 5J4YA 1DPUA 3CMAI 2GZWA 4XR6A 2Y0SN 1G8XA 2FBKA 4HF2A 1EJ9A 2NYXA 4JOMA 4KIGA 2DA7A 3K10A 2E2HJ 3FM3A 1WJFA 1Y56A 4P9UA 1QZEA 5CVRA 1VF9A 2E34A 4LMYA 2KP6A 4A6EA 2G9WA 4BUPA 1SFUA 2F5CA 1UB9A 2L4AA 3DPUA 2VKVA 3HEFA 2MG4A 5EGOB 1Z77A 1H0MA 1IXRC 4EQQA 1I5ZA 2HQNA 2FUG2 1BA5A 3LSGA 5AONA 4H0EA 3I4MJ 1SEUA 2QQBA 5FLMJ 4O5VA 4BY7J 1U9OA 3GTKJ 2WV1A 2M2EA 4M74A 1BN5A 1IF1A 3CDHA 3KZIC 3LWFA 5J6XA 1OKRA 4MTEA 3H9QA 1RESA 3HJEA 4XNFA 2ID6A 4XKWA 4ZJZA 1XX5A 4YFNF 1BI1A 2L54A 2FRHA 3BR5A 3FBNB 3OS1A 1V4RA 3ABLH 4XONA 2L9RA 1LB2A 4GO1A 1TW3A 3F3XA 3HGYA 1WCMJ 3KP7A 4B43A 1H8AC 3BG5A 1SMYF 2EZIA 3IKVA 2IA2A 2EFOA 2NVTJ 1WKMA 3BC8A 2HVQA 5JLXA 1VQ5I 1HSJA 4G7HF 3TP0A 3LSRA 2FEZA 1R9TJ 5DCMB 1ETXA 5FLXZ 4FTHA 3COAC 1YW8A 2DFHA 2HVSA 4FE4A 3S1NJ 2XGCA 2IBDA 3CTAA 1JE8A 3GXOA 3S3MA 4RAGA 1B59A 2O0YA 1UJ8A 2PMUA 1SVOA 4PJJA 2HOSA 1KGSA 3CC4I 2R7TA 1YE9A 3SXYA 1W4MA 3E6BA 3G2BA 4HNUA 1VQKI 2X0LA 3M1EA 1BBYA 3PUBA 4QSHA 4B44A 2KJBA 3JTHA 4XORA 1ONVA 4PSWA 1LFUP 2NOJB 4OAYA 4JQFA 1O3QA 5F0HA 1WJBA 3OL3A 3G1OA 1EH8A 1HQCA 4A6DA 3WTUC 2QEXI 1FSHA 4BNCA 4MNUA 2IEKA 2FX0A 2IGNA 2FOWA 2GQQA 2NXNB 3WU0A 3G73A 1T8IA 1IXSB 1L0OC 3CCUI 4NC8A 1SD5A 4W1UA 4CCMA 2A6TA 1FOKA 5LGTA 3L1PA 2OTJI 3FISA 1O57A 3QRFF 2L7ZA 4IF4A 4BS9A 3L2WA 2ZNYA 1YYVA 2DFIA 3O3KA 3K9TA 3GWZA 3QOPA 2BHZA 3RJPA 2YR2A 2RNJA 3NWSA 1MBKA 3CLOA 3U2RA 1AWCA 1FIAA 2QVOA 2Z9OA 2XB0X 2CUZA 3WTVC 4I7HA 2D45A 4B48A 1P4WA 3S3OA 1AU7A 4LLGF 1U6GA 3AFHA 2J5PA 3O2PE 4M71A 1S7OA 3PL8A 2E1CA 1X3WB 2KIQA 2L02A 3OYLA 2VLAA 1OCCH 1RIOH 1R1UA 4ESBA 1LEBA 4BHPA 5DM7F 1R71A 2VONA 5H2FC 2ZMEC 4BDZA 1HF0A 4CHUA 1Y8RB 3LSHA 2ME6A 3I9V2 1NTCA 3ABUA 5EZHA 4YFXF 2QQ9A 1JKPC 4G8XA 1N77A 3DEWA 4FHTA 2M45A 5CLSA 3S8PA 4R79A 3H3UA 4GFBA 1VQNI 1Z6RA 2O61A 2RQQA 3A1YA 3HZJA 5D5UB 1ZGWA 3EUHC 2M1BA 1PP8F 3QQAA 2IA0A 4KIFA 4HEA2 1XGOA 2DXIA 1I1SA 1QGPA 3L9FA 3T8TA 1O7LA 3TO9A 5JLWA 1W5SA 2L9SA 2MC3A 4ENNA 2DN0A 3CCVI 2DA1A 3CP2A 1OLTA 5D5VB 3H0GJ 4CZZA 3L2VA 1Y1VJ 3LA2A 3F72A 2KQRA 2L7KA 3LMMA 2HXIA 4NC7A 2WB1N 2GA1A 3HUGA 2BOLA 2KZGA 1H9GA 1Y0NA 4I98B 5F0FA 1R4MB 2H1KA 4GXOA 4C9YA 1Z6TA 2PLYA 4AIJA 3VODA 3LFUA 1ETVA 4EJUA 3U1KA 1HKTA 4A3LJ 2DBBA 2XSJC 3QYEA 3ZQIA 3J80K 1D5YA 2GIVA 4IQJA 2A6EF 3E5UA 4IOAF 4HRIA 3ZRGA 4XRSA 1O3TA 4R8HA 3GEZA 1IJWC 3CMMA 1TC3C 4A5NA 4ZDLA 2OQRA 4QIWN 3GX4X 3I4NJ 4KIBA 4D1QA 4IX7A 1DU6A 4E7LA 2E35A 3T8RA 1PYVA 3HPGA 3I4PA 2QLZA 3RQIA 3I55I 2H94A 1F4KA 2PFBA 4F52A 5BQTA 2XV4S 3EDPA 1ETQA 2HYFA 3B6AA 2GIZA 5A2QZ 4L5IA 2R7XA 4QPQA 3BTJA 4M9XA 5F64A 4CZCA 1QZZA 3OIPA 1AKHA 1G3WA 3BLYA 2R5YB 3DV8A 3RPUA 2FXAA 2P6TA 1A04A 4CYCA 5GTHC 3BR6A 1C0WA 3NWTA 1R49A 3CDLA 4E7JA 1Y6IA 4CCJA 3AL0B 4C3IJ 1ZRCA 3HPHA 5FGMA 4YIIA 1BJAA 4AIKA 2F2EA 1ON1A 1QO0D 5HDGA 3HTSB 1FLIA 3DLLF 3M8EA 3A01A 5A2QK 2L9NA 3H5RA 2X6WA 3VYTB 3TMOA 1B9MA 2EJRA 1LDKB 2NOGA 4W97A 3VB2A 3WU2C 1O4XA 3R4KA 2BVMA 3GTMJ 2CUFA 2QA4I 1XDUA 2FMLA 2H6BA 4FASD 4OIQF 2DMQA 3HOWJ 2HS5A 1ITYA 3FXLA 4V2FA 3W2WA 5FKMA 5J3LA 4OIOF 5IYDJ 2CS3A 2CW0F 2ZXWH 3FBIB 4XOTA 2WY8Q 3VSKA 2LOOA 2B0LA 3V7RA 5EDNA 1GXQA 4IRGA 1KONA 3GLLA 2VE9A 3A03A 2JQ7A 2E60A 3M8JA 1LDJA 2Y69H 4N4OB 3K4LA 5H6QA 2QWWA 1MNDA 2NVYJ 3NEUA 3P9CA 3FMRA 4JBAA 2OTLI 3K4BA 1JUPA 2Y9YA 5GPCA 1P6RA 4DOZA 4HQMA 5C44J 1RKTA 2DYSH 2ZKZA 3DLAA 3FMSA 3QP5A 1SAXA 2ELKA 1T95A 3G1MA 4ZYEA 1R00A 1YRNB 2EV5A 2L7MP 4J00A 3JREA 1UELB 4A5MA 3ZR8X 1FEXA 1XC5A 1LNWA 2V79A 2Z5UA 4IQ4A 2F5FA 3BTLA 2DOEA 2OPTA 2NNYA 1U5TA 3HM5A 1P7JA 3CCMI 1X58A 3LSPA 3ZQLA 2VKHA 3DKWA 3HSEA 4N9HA 5BOXA 2PG4A 1BR1A 2ESHA 1IN6A 1IDYA 1S7AA 4DNCA 2VKEA 4A69C 4LIVA 4N4NB 2DCEA 1ZARA 2HR3A 2V9KA 4HOBA 2QF7A 5ILUA 1X19A 2M3AA 5ILVA 3RZOJ 3ZQQA 1HC8A 2R7DA 4XLHA 2K9SA 3DU5A 2M87A 3H3VK 3UR3C 4Y52J 3ZQGA 2IAIA 3N4MA 2IS4A 2Y75A 2JWTA 4HSTA 1W36C 1OCPA 3TW7A 2A05A 1ZRDA 4OAZA 1VTNC 1BIBA 5J1YA 1D1AA 3K1PA 2VT2A 1ZG3A 3QPTA 5GADJ 3KFWX 4KNYA 1WFXA 1MBFA 3QPLA 2XAHA 2BBYA 2JMWA 3HOUJ 1JI8A 3K4JA 4IOCF 1XDSA 1WI3A 1FX7A 3R0JA 1IG7A 5E3MA 2LF8A 3KYCB 4C2UA 1GHCA 1IAWA 2DTZA 1XPXA 4BHCA 3HXLA 4CGZA 5F04A 2A5WA 4L0YB 2XPUA 3F6OA 4NB5A 3JRGA 1PUEE 2IPQX 1SD4A 2K02A 3S16J 2V1DA 4G7OF 4P96A 4WXDA 5B3SH 3JRFA 2PI0A 4IVNA 4I01A 4BE1A 4E6KG 2NS7A 1ULYA 3HKZN 5DTDA 1H89C 2EQRA 3V4GA 3ZQHA 4AC0A 5B66C 3MQ0A 1I39A 2LG4A 2DOAA 3DEUA 2AQEA 2L7FP 2XRLA 1OJLA 4KN4X 1Z7UA 2VOPA 4P5OA 2P5LC 3L2QA 3IH2A 4PZJA 4CCOA 3TBIA 2A5YB 2XAFA 3CCSI 1YIJI 4X6AJ 3JR9A 4Y4RA 2EFNA 3M9AA 4MQVA 4HNVA 3GZNB 2IS6A 2X51A 3D0SA 2Y0MA 1OMIA 3MWMA 1TP4A 3P5JA 4II3A 2DTRA 3J7AO 3K4CA 1IRXA 4LD5A 3LNQA 1T0FC 2LREA 3E5XA 1D5VA 2DFFA 3NRVA 1RI7A 2MW8A 4U88A 1K4SA 3QP6A 4EATA 1TW2A 4HAMA 5FJ8J 3ISPA 2VT3A 2RV8A 3CCLI 1SFKA 3JW4A 2X1DA 4FE7A 3BCAA 1XN7A 4M3GA 1WJEA 4HPQA 3WTTC 1J5YA 3RKQA 5E20A 2LY1A 2OA4A 3CCEI 2PMZA 4A93J 5IT9Z 3AG4H 2ZMEA 4M9ZA 5DCMA 1TL8A 1LKXA 2ID3A 1E17A 3KLNA 2HXOA 2DO7A 4D5CA 4ZYHA 1KYWA 3O8GA 3GLXA 2B9SA 3BG7A 3PUFA 1ZLKA 3TEDA 2MFZA 2KL4A 2V9VA 4LLNA 1A36A 3GYHX 2W84A 3HRTA 3E1SA 3I54A 3QYBA 4PFPA 3CCJI 3Q0VA 4I02A 4KUMA 1IGNA 5L3CA 3L2RA 5ICCA 1JJ8C 3PO2J 4RAFA 2MH2A 1XTAA 3WTYC 2QKMB 5J47A 1BW6A 3PFYA 5HS8A 2Z3YA 3FXRA 4U0YA 1JT6A 2QSFX 2R7ZJ 3G4SI 2MGQA 1P9QC 3DU6A 1FPQA 1Z0XA 2X48A 3J81Z 3ROUA 3TOBA 2DMTA 3PNTA 3QAHA 1WJ5A 1D0XA 1XCVA 5H6RA 2LMDA 2BZTA 5LHHA 3EETA 2FU4A 3F8CA 2ZXJA 2R7SA 2BHYA 4A3KJ 1YW9A 4M6VA 5F27A 3FXUA 1DPRA 2KIFA 2M4KA 4RM3A 2MA3A 2VJJA 4HDUA 1PVEA 1MBEA 1R36A 3OIQA 4A3BJ 1ETYA 4ZZLA 2CO5A 2XGEA 1T0FA 1L3LA 3RZDJ 2O5RA 3SFZA 1RUOA 4LIUA 4AIDA 3C7JA 4DGWB 4S05A 3OYHA 2E71A 3IC7A 3OYDA 2CQQA 2EIMH 3J7YJ 5DYMA 4XBFA 4EV0A 3WTXC 4XIDA 1VQ8I 1W1WE 5LBQA 4XMYA 1JKRC 2VB6A 1F43A 1Y0UA 4DIQA 4HX7A 2STTA 4UUVA 2HZTA 4LK1F 3HOZJ 2E2JJ 1K4TA 3KYDB 3KE2A 5EEAA 2GLOA 4F3QA 1YO5C 2HTJA 5CVVA 3EUKL 1GUUA 1YS7A 4B09A 2QSHX 5K7HA 1TWAJ 2X4HA 1MNEA 4Y15A 1UZCA 3LSJA 4UV9A 3M4OJ 3D5RC 3IH4A 3ZMZA 3WTWC 2NRAC 2H27A 3HRMA 4EEFG 3F0CA 2OV7A 4M72A 4BE2A 3KCCA 1UG2A 1MH4A 1NG7A 1ZH5A 2NVXJ 3EQLF 2EV0A 2R7FA 1ZR4A 3A0BC 2AXTC 3N05A 3BP8A 3HSFA 2VI6A 3OL4A 2L2OA 3R6SA 3S1RJ 3VSLA 4IKFA 3I64A 4N0BA 4KMUX 1J9IA 1R1VA 3WE3A 4RMNA 4GCVA 1TNTA 2GOXB 3TW6A 2JPBA 1PUFA 3HDDA 2ZC2A 2JA6J 3CC2I 3KLOA 2CGPA 4DW6A 5L3EA 2GXAA 2O8XA 2M30A 2W00A 4ZYAA 4RLQA 5HLGA 4U7DA 5KAIC 1MIJA 3V8LA 1OR7C 1IV6A 2O8KA 2UV1A 1TLHB 3DTEA 3E6MA 1TWGJ 3GZ6A 3S14J 2XB5A 5J40A 4RGSA 1WPKA 5J4VA 1VI0A 4ON0A 4ASNA 3S1MJ 4F93B 1FP2A 1KU7A 1DDNA 2Y48A 1X2NA 2HOAA 4XSXF 3T5XA 4KYWA 3JAMK 4CYCB 2R5ZA 4L9TA 3N97A 3K4MA 5C4XJ 1Y8QB 4WXCA 3IAS2 4BQOA 3CCRI 4OIPF 1U5TC 2FF4A 4WXHA 3TDUC 2KRHA 1OFCX 5HODA 1ZHFA 3K7AJ 3BY6A 3JRBA 4WCGA 1ZGAA 2ZJ2A 1MJ9A 3CDIA 2XF7A 2V1UA 3BR1A 3GFIA 3D1NI 4M3EA 2KFDA 2QM3A 4BE0A 3R61A 3M7GA 1T56A 3TKYA 5J8FA 2XSDC 4LK0F 3FIWA 3CLQA 2A61A 3HRUA 5ICEA 1EH7A 5LRSA 2RQPA 2IVMA 3HC7A 4EM0B 5IYCJ 2EFPA 3HOTA 5DEQA 4PJNA 2W7NA 3PFIA 2EILH 4DBRA 2M4GA 2V4JC 2MD5A 1XMAA 4XOPA 3MKWB 3R0AA 1IW7F 1SMTA 3ULQB 3TO7A 5LGNA 4HLXA 3GVAA 1J0RA 2CG4A 2JVGA 3CUQB 1KZHA 2LRDA 2QQAA 2EINH 2HQAA 3HOSA 3LFKA 2X6YA 2EPFA 2D1VA 3SDBA 4M3FA 1W7PA 1Q1VA 5LFAA 5CPRB 3VFZA 2Z99A 2NAZA 2JPCA 3V7SA 2GAUA 5TJJA 3JSOA 5LLQA 2QENA 2K86A 3CJTB 5IOZA 1WI9A 1YOVB 4FQGA 4UXNA 1F1ZA 3ABKH 2F5EA 1B72B 2RN7A 4R1HA 4ZTJA 2OCEA 2ECCA 2JA2A 4EM2A 4I6ZA 3OYAA 2G0EA 2LK2A 2TRTA 4ZTFA 2EK5A 2DK8A
chains in the Genus database with same CATH topology
3B6AA 1ORKA 5EG0A 3S1QJ 2E19A 5GPAA 1ZTRA 3BTJA 2LKXA 1TWHJ 2JA7J 4XICA 3GBGA 3BTCA 1AKHA 1EF4A 2R5YB 3BQZA 3SJMA 4CYCA 4A3MJ 3BR6A 1JJ6C 1SANA 1FJLA 3CDLA 1MBGA 4C3IJ 2LY9A 2M8GX 2Y9ZA 2ZB9A 2K9NA 5K7FA 3PM1A 1OCTC 3K2AA 3A01A 1HDPA 3BG3A 1JKOC 3IV5A 1ZK8A 2NOGA 4W97A 2EZKA 4A3EJ 1TWCJ 2TCTA 1O4XA 2COBA 2LTPA 3GTMJ 2FQ4A 2CUFA 1B72A 3HOWJ 2DMQA 4AUXA 1ITYA 2X9DA 4V2FA 5IYDJ 5FKMA 5J3LA 1NK2P 1T33A 3Q0WA 3GTPJ 1BL0A 5EDNA 3JRDA 5IP9J 2EBIA 5IOYA 2LP0A 3A03A 5IPAA 1JKQC 2DJNA 5M5WJ 4A3DJ 4MO7A 4JX6A 1MBHA 4DYQA 2K9QA 1JGGA 2NVYJ 2WAQN 1GV5A 3A01B 4IHXA 1JUPA 2Y9YA 3SFIA 5GPCA 4MIMA 5C44J 1RKTA 2E2IJ 1MBJA 2DA3A 2ELKA 2Y2ZA 3G1MA 3LOCA 2HOTA 1YRNB 2L7MP 3JREA 4RBOA 3BR2A 2L0KA 3CMYA 1FEXA 1XC5A 2LD5A 4MLOA 3Q3SA 1LE8B 1E3OC 4BXXJ 1ZQ3P 1P7IA 1GDTA 1IRZA 1LFBA 5EG0B 2DMUA 3BTLA 3MKLA 1FIPA 4BKXA 4D5FA 2OPTA 1U78A 5F08A 3HM5A 1P7JA 1MSFC 1X58A 3MVPA 3LSPA 3ZQLA 2EZHA 2YUSA 1JUMA 2W48A 2YU9J 1IDYA 1HDDC 2NVQJ 4C3JJ 2VKEA 4A69C 5FKKA 4XRSG 3BR3A 4BBSJ 2QF7A 4I76A 4JX5A 3CCYA 4MFDA 2CU7A 3RZOJ 4C3HJ 4BY1J 3JRAA 3OIOA 2K9SA 5J1UA 4DYRA 1TWFJ 3H3VK 3BT9A 1IC8A 4Y52J 3ZQGA 2IAIA 4JX4A 2JN6A 5BNGA 1JUSA 2JWTA 3S17J 1OCPA 3TW7A 1I50J 2PMZN 3OOUA 1JT0A 5J1YA 3NAUA 4M3BA 1QVUA 3W6VA 2HQ5A 4X1EA 2O9LA 3QPLA 1MBFA 5EGOA 1LE8A 2JMWA 5IP7J 3GTOJ 3HOUJ 1WI3A 4J19A 1IG7A 1K61A 4G12A 4IHVA 5E3MA 1PUFB 2P81A 5GP9A 4B4CA 3BR0A 2DTZA 5F04A 5DS9A 1IDZA 2XPUA 3JRGA 2DMNA 1Y1WJ 3S16J 3A02A 3UKGA 2LFBA 3JRFA 1F36A 2B63J 2NS7A 3HKZN 5DTDA 2M9HA 1H89C 2GM4A 2ECBA 2EQRA 3ZQHA 4AC0A 4ABZA 4UUSA 5M5XJ 2L7FP 3QPSA 2XRLA 1OJLA 5F1JA 1A5JA 2Y31A 3BG9A 4A3IJ 2DA4A 4IEJA 3IH2A 1W0TA 1HCRA 3OSGA 3M3YJ 4QTRA 4X6AJ 3JR9A 4HNVA 5M3MJ 1ETWA 1XS9A 2LLKA 2AO9A 5C3EJ 5K7ZA 1HLVA 1QVTA 2FD5A 3LNQA 4DZPA 1NK3P 2N8GA 1MNMC 2MW8A 1U8BA 3HOVJ 9ANTA 1IUFA 2KT0A 2X6OA 5FJ8J 2H8RA 1MH3A 3ZQFA 5FKLA 2Y0SN 4LOCA 2Y30A 4FE7A 2LR8A 2DA7A 4M3GA 2E2HJ 5M5YJ 3NARA 3RKQA 4A93J 1W0UA 2DMPA 2DA2A 1DU0A 1VF9A 2ID3A 2HXOA 4A3CJ 4D5CA 3O8GA 2D5VA 1HOMA 2JA5J 3JRHA 5E3LA 1I3QJ 3TEDA 4A3FJ 2VKVA 3HEFA 2MG4A 5EGOB 1Z77A 2XGDA 3S2HJ 1UMQA 1IGNA 3Q0VA 2CJJA 1JJ8C 2DA5A 1RR7A 3LSGA 1BA5A 3JRCA 3PO2J 1WGXA 3FK6A 3I4MJ 3HGGA 1BW6A 5FLMJ 4BY7J 3PO3J 1U9OA 3GTKJ 2WV1A 2M2EA 5F0CA 3G1LA 1JT6A 2R7ZJ 2MGQA 3IH3A 1RESA 1RETA 1BJZA 1Z0XA 2X48A 2ID6A 2DMTA 1RKWA 3BR5A 3BQYA 3WHCA 5FKOA 2L9RA 1ETKA 4A3KJ 1U9NA 1WCMJ 3FKIJ 3HGYA 2GBYA 3MN2A 3WHBA 1JTXA 3BG5A 4M6VA 2EZIA 5F27A 2R5ZB 1H8AC 2NVTJ 5JLXA 1MBEA 2QCOA 5EZGA 2NS8A 3TP0A 3LSRA 1UHSA 2HDDA 1R9TJ 1ETYA 4A3BJ 2XGEA 1ETXA 5FLVA 3HBLA 4FTHA 3RZDJ 4JYKA 1CQTA 4MFEA 4FE4A 3S1NJ 3C2BA 2XGCA 1GVDA 2CQQA 2IBDA 2XPVA 2LVSA 1VNDA 4DYCA 2HOSA 4XIDA 1JKRC 1F43A 1POGA 2R93J 2O7OA 4QSHA 3Q0UA 3HOZJ 2JK3A 2E2JJ 4UUSB 2MSYA 5EEAA 2GLOA 1LFUP 1B8IA 1ZR2A 4A3GJ 1GUUA 5F0HA 5K7HA 2E1OA 1TWAJ 3G1OA 1QRYA 3OSFA 3LSJA 3M4OJ 3IH4A 3SDGA 5IP6A 2IEKA 2FX0A 4EEFG 3BTIA 3F0CA 4AYBN 4BBRJ 1UG2A 4Y7NJ 1MH4A 3ZOBA 2NVXJ 4NDLA 2EZLA 1RPWA 2HI3A 2ME0A 4W1UA 3DCFA 3GTGJ 1ZR4A 3L1PA 3FISA 2L7ZA 2VUMJ 2KDZA 3S1RJ 2VI6A 1XG1A 5C4JJ 3JRIA 1MBKA 1ZKGA 5IYBJ 1GT0C 1FIAA 2CRGA 3HB9A 4C2MJ 1YRNA 3TW6A 4A3JJ 2XB0X 1PUFA 3HDDA 2JA6J 5J1RA 4DW6A 1ETOA 1BW5A 1MSEC 4RDUA 4XK4A 2I10A 3GTQJ 1AU7A 4UUTA 1IV6A 2O8KA 2DA6A 3E7LA 1TWGJ 3S14J 2XB5A 1WPKA 2R0QC 1VI0A 1WH7A 3S1MJ 2OF7A 1X2NA 2HOAA 1FTZA 4CYCB 2R5ZA 3GTLJ 1JTYA 4DZJA 5C4XJ 1HF0A 1X2MA 2ME6A 1GV2A 1NTCA 5EZHA 1WH5A 2CQXA 3GTJJ 1ENHA 1OFCX 5HODA 3K7AJ 3JRBA 3DEWA 5E3OA 2R5YA 1JKPC 4GFBA 3BR1A 2K40A 3VPRA 1SFOJ 4JP0A 1ZGWA 1QPIA 3QQAA 3D1NI 4M3EA 3HOXJ 4IHYA 2VPRA 1A6IA 1T56A 2RAEA 2M0CA 4S0HB 2XSDC 5JLWA 3FIWA 4IHWA 3B6CA 1VFCA 1FTTA 2FJ1A 2HYJA 2M34A 2DN0A 5IYCJ 2DA1A 3H0GJ 1Y1VJ 1S7EA 3S2DJ 4FISA 2CUEA 4B1RA 3ZQCA 2HXIA 2EH3A 5EF6A 2WB1N 1AHDP 2YS9A 4XRMA 5M3FJ 3HOYJ 3S15J 5F0FA 4D7NA 2H1KA 1B8IB 1G2HA 2R92J 1ETVA 1APLC 5E3NA 2AHQA 4A3LJ 1AKHB 1K83J 4M3FA 1Q1VA 4V2GA 3ZQIA 1D5YA 5EYRA 4FCYA 4XRSA 3CQZJ 4L5EA 1IJWC 4B3AA 3FK7A 5IOZA 2JA8J 1TC3C 2XPWA 4QIWN 3TP3A 1H88C 3I4NJ 1B72B 1DU6A 4D7MA 5FKNA 2JJ7A 1I6HJ 2ECCA 3O8HA 3RQIA 4I6ZA 2G0EA 2LK2A 2TRTA 4M3DA 1ETQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6A A;  1ORK A;  5EG0 A;  3S1Q J;  2E19 A;  5GPA A;  1ZTR A;  3BTJ A;  2LKX A;  1TWH J;  2JA7 J;  4XIC A;  3GBG A;  3BTC A;  1AKH A;  1EF4 A;  2R5Y B;  3BQZ A;  3SJM A;  4CYC A;  4A3M J;  3BR6 A;  1JJ6 C;  1SAN A;  1FJL A;  3CDL A;  1MBG A;  4C3I J;  2LY9 A;  2M8G X;  2Y9Z A;  2ZB9 A;  2K9N A;  5K7F A;  3PM1 A;  1OCT C;  3K2A A;  3A01 A;  1HDP A;  3BG3 A;  1JKO C;  3IV5 A;  1ZK8 A;  2NOG A;  4W97 A;  2EZK A;  4A3E J;  1TWC J;  2TCT A;  1O4X A;  2COB A;  2LTP A;  3GTM J;  2FQ4 A;  2CUF A;  1B72 A;  3HOW J;  2DMQ A;  4AUX A;  1ITY A;  2X9D A;  4V2F A;  5IYD J;  5FKM A;  5J3L A;  1NK2 P;  1T33 A;  3Q0W A;  3GTP J;  1BL0 A;  5EDN A;  3JRD A;  5IP9 J;  2EBI A;  5IOY A;  2LP0 A;  3A03 A;  5IPA A;  1JKQ C;  2DJN A;  5M5W J;  4A3D J;  4MO7 A;  4JX6 A;  1MBH A;  4DYQ A;  2K9Q A;  1JGG A;  2NVY J;  2WAQ N;  1GV5 A;  3A01 B;  4IHX A;  1JUP A;  2Y9Y A;  3SFI A;  5GPC A;  4MIM A;  5C44 J;  1RKT A;  2E2I J;  1MBJ A;  2DA3 A;  2ELK A;  2Y2Z A;  3G1M A;  3LOC A;  2HOT A;  1YRN B;  2L7M P;  3JRE A;  4RBO A;  3BR2 A;  2L0K A;  3CMY A;  1FEX A;  1XC5 A;  2LD5 A;  4MLO A;  3Q3S A;  1LE8 B;  1E3O C;  4BXX J;  1ZQ3 P;  1P7I A;  1GDT A;  1IRZ A;  1LFB A;  5EG0 B;  2DMU A;  3BTL A;  3MKL A;  1FIP A;  4BKX A;  4D5F A;  2OPT A;  1U78 A;  5F08 A;  3HM5 A;  1P7J A;  1MSF C;  1X58 A;  3MVP A;  3LSP A;  3ZQL A;  2EZH A;  2YUS A;  1JUM A;  2W48 A;  2YU9 J;  1IDY A;  1HDD C;  2NVQ J;  4C3J J;  2VKE A;  4A69 C;  5FKK A;  4XRS G;  3BR3 A;  4BBS J;  2QF7 A;  4I76 A;  4JX5 A;  3CCY A;  4MFD A;  2CU7 A;  3RZO J;  4C3H J;  4BY1 J;  3JRA A;  3OIO A;  2K9S A;  5J1U A;  4DYR A;  1TWF J;  3H3V K;  3BT9 A;  1IC8 A;  4Y52 J;  3ZQG A;  2IAI A;  4JX4 A;  2JN6 A;  5BNG A;  1JUS A;  2JWT A;  3S17 J;  1OCP A;  3TW7 A;  1I50 J;  2PMZ N;  3OOU A;  1JT0 A;  5J1Y A;  3NAU A;  4M3B A;  1QVU A;  3W6V A;  2HQ5 A;  4X1E A;  2O9L A;  3QPL A;  1MBF A;  5EGO A;  1LE8 A;  2JMW A;  5IP7 J;  3GTO J;  3HOU J;  1WI3 A;  4J19 A;  1IG7 A;  1K61 A;  4G12 A;  4IHV A;  5E3M A;  1PUF B;  2P81 A;  5GP9 A;  4B4C A;  3BR0 A;  2DTZ A;  5F04 A;  5DS9 A;  1IDZ A;  2XPU A;  3JRG A;  2DMN A;  1Y1W J;  3S16 J;  3A02 A;  3UKG A;  2LFB A;  3JRF A;  1F36 A;  2B63 J;  2NS7 A;  3HKZ N;  5DTD A;  2M9H A;  1H89 C;  2GM4 A;  2ECB A;  2EQR A;  3ZQH A;  4AC0 A;  4ABZ A;  4UUS A;  5M5X J;  2L7F P;  3QPS A;  2XRL A;  1OJL A;  5F1J A;  1A5J A;  2Y31 A;  3BG9 A;  4A3I J;  2DA4 A;  4IEJ A;  3IH2 A;  1W0T A;  1HCR A;  3OSG A;  3M3Y J;  4QTR A;  4X6A J;  3JR9 A;  4HNV A;  5M3M J;  1ETW A;  1XS9 A;  2LLK A;  2AO9 A;  5C3E J;  5K7Z A;  1HLV A;  1QVT A;  2FD5 A;  3LNQ A;  4DZP A;  1NK3 P;  2N8G A;  1MNM C;  2MW8 A;  1U8B A;  3HOV J;  9ANT A;  1IUF A;  2KT0 A;  2X6O A;  5FJ8 J;  2H8R A;  1MH3 A;  3ZQF A;  5FKL A;  2Y0S N;  4LOC A;  2Y30 A;  4FE7 A;  2LR8 A;  2DA7 A;  4M3G A;  2E2H J;  5M5Y J;  3NAR A;  3RKQ A;  4A93 J;  1W0U A;  2DMP A;  2DA2 A;  1DU0 A;  1VF9 A;  2ID3 A;  2HXO A;  4A3C J;  4D5C A;  3O8G A;  2D5V A;  1HOM A;  2JA5 J;  3JRH A;  5E3L A;  1I3Q J;  3TED A;  4A3F J;  2VKV A;  3HEF A;  2MG4 A;  5EGO B;  1Z77 A;  2XGD A;  3S2H J;  1UMQ A;  1IGN A;  3Q0V A;  2CJJ A;  1JJ8 C;  2DA5 A;  1RR7 A;  3LSG A;  1BA5 A;  3JRC A;  3PO2 J;  1WGX A;  3FK6 A;  3I4M J;  3HGG A;  1BW6 A;  5FLM J;  4BY7 J;  3PO3 J;  1U9O A;  3GTK J;  2WV1 A;  2M2E A;  5F0C A;  3G1L A;  1JT6 A;  2R7Z J;  2MGQ A;  3IH3 A;  1RES A;  1RET A;  1BJZ A;  1Z0X A;  2X48 A;  2ID6 A;  2DMT A;  1RKW A;  3BR5 A;  3BQY A;  3WHC A;  5FKO A;  2L9R A;  1ETK A;  4A3K J;  1U9N A;  1WCM J;  3FKI J;  3HGY A;  2GBY A;  3MN2 A;  3WHB A;  1JTX A;  3BG5 A;  4M6V A;  2EZI A;  5F27 A;  2R5Z B;  1H8A C;  2NVT J;  5JLX A;  1MBE A;  2QCO A;  5EZG A;  2NS8 A;  3TP0 A;  3LSR A;  1UHS A;  2HDD A;  1R9T J;  1ETY A;  4A3B J;  2XGE A;  1ETX A;  5FLV A;  3HBL A;  4FTH A;  3RZD J;  4JYK A;  1CQT A;  4MFE A;  4FE4 A;  3S1N J;  3C2B A;  2XGC A;  1GVD A;  2CQQ A;  2IBD A;  2XPV A;  2LVS A;  1VND A;  4DYC A;  2HOS A;  4XID A;  1JKR C;  1F43 A;  1POG A;  2R93 J;  2O7O A;  4QSH A;  3Q0U A;  3HOZ J;  2JK3 A;  2E2J J;  4UUS B;  2MSY A;  5EEA A;  2GLO A;  1LFU P;  1B8I A;  1ZR2 A;  4A3G J;  1GUU A;  5F0H A;  5K7H A;  2E1O A;  1TWA J;  3G1O A;  1QRY A;  3OSF A;  3LSJ A;  3M4O J;  3IH4 A;  3SDG A;  5IP6 A;  2IEK A;  2FX0 A;  4EEF G;  3BTI A;  3F0C A;  4AYB N;  4BBR J;  1UG2 A;  4Y7N J;  1MH4 A;  3ZOB A;  2NVX J;  4NDL A;  2EZL A;  1RPW A;  2HI3 A;  2ME0 A;  4W1U A;  3DCF A;  3GTG J;  1ZR4 A;  3L1P A;  3FIS A;  2L7Z A;  2VUM J;  2KDZ A;  3S1R J;  2VI6 A;  1XG1 A;  5C4J J;  3JRI A;  1MBK A;  1ZKG A;  5IYB J;  1GT0 C;  1FIA A;  2CRG A;  3HB9 A;  4C2M J;  1YRN A;  3TW6 A;  4A3J J;  2XB0 X;  1PUF A;  3HDD A;  2JA6 J;  5J1R A;  4DW6 A;  1ETO A;  1BW5 A;  1MSE C;  4RDU A;  4XK4 A;  2I10 A;  3GTQ J;  1AU7 A;  4UUT A;  1IV6 A;  2O8K A;  2DA6 A;  3E7L A;  1TWG J;  3S14 J;  2XB5 A;  1WPK A;  2R0Q C;  1VI0 A;  1WH7 A;  3S1M J;  2OF7 A;  1X2N A;  2HOA A;  1FTZ A;  4CYC B;  2R5Z A;  3GTL J;  1JTY A;  4DZJ A;  5C4X J;  1HF0 A;  1X2M A;  2ME6 A;  1GV2 A;  1NTC A;  5EZH A;  1WH5 A;  2CQX A;  3GTJ J;  1ENH A;  1OFC X;  5HOD A;  3K7A J;  3JRB A;  3DEW A;  5E3O A;  2R5Y A;  1JKP C;  4GFB A;  3BR1 A;  2K40 A;  3VPR A;  1SFO J;  4JP0 A;  1ZGW A;  1QPI A;  3QQA A;  3D1N I;  4M3E A;  3HOX J;  4IHY A;  2VPR A;  1A6I A;  1T56 A;  2RAE A;  2M0C A;  4S0H B;  2XSD C;  5JLW A;  3FIW A;  4IHW A;  3B6C A;  1VFC A;  1FTT A;  2FJ1 A;  2HYJ A;  2M34 A;  2DN0 A;  5IYC J;  2DA1 A;  3H0G J;  1Y1V J;  1S7E A;  3S2D J;  4FIS A;  2CUE A;  4B1R A;  3ZQC A;  2HXI A;  2EH3 A;  5EF6 A;  2WB1 N;  1AHD P;  2YS9 A;  4XRM A;  5M3F J;  3HOY J;  3S15 J;  5F0F A;  4D7N A;  2H1K A;  1B8I B;  1G2H A;  2R92 J;  1ETV A;  1APL C;  5E3N A;  2AHQ A;  4A3L J;  1AKH B;  1K83 J;  4M3F A;  1Q1V A;  4V2G A;  3ZQI A;  1D5Y A;  5EYR A;  4FCY A;  4XRS A;  3CQZ J;  4L5E A;  1IJW C;  4B3A A;  3FK7 A;  5IOZ A;  2JA8 J;  1TC3 C;  2XPW A;  4QIW N;  3TP3 A;  1H88 C;  3I4N J;  1B72 B;  1DU6 A;  4D7M A;  5FKN A;  2JJ7 A;  1I6H J;  2ECC A;  3O8H A;  3RQI A;  4I6Z A;  2G0E A;  2LK2 A;  2TRT A;  4M3D A;  1ETQ A; 
#chains in the Genus database with same CATH topology
 1ORK A;  5EG0 A;  4WK8 F;  2E19 A;  2DU9 A;  1CF7 B;  1ZTR A;  2A6H F;  1QA6 A;  1Z3Y A;  3WTZ A;  3ZMD A;  1VQ6 I;  1WVR A;  2JA7 J;  3GBG A;  4XSZ F;  3BTC A;  4AWX B;  1T2K A;  1DP7 P;  3F23 A;  4PJ0 C;  3KZY A;  3FHN A;  4HW0 A;  1JJ6 C;  1WHU A;  4CYD A;  5D6E A;  1FJL A;  3DTK A;  1MBG A;  3A4C A;  2M8G X;  4BQQ A;  2DFE A;  2K9N A;  2F5V A;  4RA2 A;  1OCT C;  2HDC A;  1RRJ A;  1FMV A;  1IXC A;  3Q9V A;  4ZZD A;  4CIC A;  3FHZ A;  3CJR B;  1WSU A;  2UWM A;  2EZK A;  1SFE A;  2LSO A;  2TCT A;  4A3E J;  2VOO A;  3OYF A;  2LTP A;  1FYL A;  5JFR A;  3OY9 A;  1U8R A;  1B72 A;  3IP4 B;  2O3F A;  5CQG A;  1QHG A;  2HZD A;  1G6N A;  2M7B A;  3CCQ I;  1V54 H;  1V5E A;  2H8W A;  2HPM A;  1NK2 P;  3Q0W A;  3KET A;  1B6A A;  1TQM A;  2XUB A;  4HZF A;  3FX3 A;  1VQO I;  1XSV A;  2OJE D;  1J7K A;  5KNL A;  3JRD A;  5IP9 J;  5IOY A;  4HV6 A;  2IS1 A;  1GXP A;  4OIR F;  2WAF A;  4PCQ A;  5IPA A;  1WWX A;  2H6C A;  3GO5 A;  1KA8 A;  3FF5 A;  4MO7 A;  2ELJ A;  2E1M B;  4EVI A;  1JXS A;  1GV5 A;  4F55 A;  1KYZ A;  1S29 A;  1W5T A;  5DD8 A;  4IHX A;  3BCB A;  3K69 A;  4MIM A;  3S3N A;  3I58 A;  4CDG A;  2OZ6 A;  4FET A;  3TDZ C;  2XAG A;  1XB4 A;  1R58 A;  3CP8 A;  4QLC U;  2LNB A;  3LOC A;  4CO8 A;  4E70 A;  2OC6 A;  3A2K A;  1J59 A;  3OYM A;  2P5V A;  2VBW A;  2L0K A;  2MD0 A;  2E7X A;  2MLK A;  1NG6 A;  3CMY A;  4UVB A;  2IP2 A;  3ECO A;  2LD5 A;  1HA8 A;  3KEQ A;  3Q3S A;  4F91 B;  2HPI A;  3SYT A;  2Z16 A;  1E3O C;  4BYY A;  4BXX J;  1Z3X A;  1I27 A;  3EPZ A;  4G94 A;  1WRJ A;  4CA0 A;  2ETH A;  5EG0 B;  2DMU A;  2I8D A;  4BKX A;  3CD6 I;  2WBM A;  3JAM Z;  4FX0 A;  1MSF C;  4F92 B;  2HGC A;  4C30 A;  3CJQ B;  3KYL A;  2OQG A;  1YX5 A;  1HXD A;  1IZ1 A;  2CV2 A;  1HDD C;  4XLP F;  3DTI A;  2FSW A;  4MGR A;  2OD5 A;  1Z05 A;  1T6S A;  1FOW A;  1LEA A;  4JX5 A;  1JHF A;  4I0A A;  2YPR A;  1R23 A;  2PN6 A;  4LB5 A;  2COM A;  5J1U A;  3SZT A;  1J75 A;  4U0W A;  2KRF A;  1LJ9 A;  5D6F A;  2PQ8 A;  2E1N A;  3FXQ A;  3ZPL A;  2XF6 A;  3Q5F A;  1VQM I;  2PMZ N;  4A0X A;  3OOU A;  1JT0 A;  2YX7 A;  3NAU A;  3RTR A;  1FC3 A;  1QVU A;  1E3H A;  3CO7 C;  3H5A A;  2HQ5 A;  2RDP A;  2O9L A;  2V1N A;  4LGW A;  1LE8 A;  1OCZ H;  1X1P A;  2M5W A;  3NQO A;  5F6F A;  2W82 A;  4RM2 A;  3I59 A;  2CW7 A;  4J19 A;  1FYK A;  2YSR A;  3ZP5 A;  4G12 A;  3FDY A;  2CYY A;  1CGP A;  4NHJ A;  3BJA A;  4XLF A;  3F8B A;  4B4C A;  3BR0 A;  1MMN A;  3WGG A;  2IS2 A;  4AYB A;  3DXJ F;  5FFX A;  1YG2 A;  3F6V A;  3UKG A;  1MDM A;  2LFB A;  1H9T A;  1TNS A;  2K3F A;  1N75 A;  4ENK A;  3RDI A;  4RB2 C;  2HQR A;  1YHQ I;  2IRF G;  3IWF A;  4OOI A;  2BVL A;  2L4M A;  4LG0 B;  5E1W A;  5FB2 A;  4HLY A;  4L5J A;  1OCO H;  1REP C;  5KAF C;  4UUS A;  5EEG A;  4Q47 A;  1BC7 C;  3QWL A;  3U21 A;  2DA4 A;  1T39 A;  1A35 A;  4NBQ A;  4XN3 A;  2K7L A;  1WZ2 A;  5TIS C;  2HKX A;  5E18 F;  4YIR X;  3TO6 A;  5B5E C;  4AU7 A;  5JI6 A;  1XS9 A;  1V3F A;  4ENM A;  4H4K C;  5GAG J;  5E79 C;  5C3E J;  1VZ0 A;  5CQE A;  4MTD A;  1YQA A;  3IL2 A;  2E5Z A;  2GWR A;  2X1C A;  4KT5 C;  5K5R A;  3C2G A;  3FXM A;  2QSG X;  4PSX A;  2A3S A;  2OZU A;  2D1H A;  3HOV J;  9ANT A;  1D8K A;  1D1B A;  2KT0 A;  5ILS A;  4BJ6 C;  1FBS A;  1MH3 A;  2XF5 A;  3ZQF A;  5IT3 A;  1X1C A;  2Y30 A;  4UB8 C;  2K3P A;  4L9N A;  2LR8 A;  4YFK F;  5M5Y J;  2WC2 A;  2P0W A;  3NAR A;  1K6Y A;  3WG7 H;  2GOM A;  4KIT B;  3LL7 A;  2PEX A;  2DQR A;  1DU0 A;  5FRN A;  3PSI A;  4E4H A;  1X4P A;  1FBU A;  4ENJ A;  1D3Y A;  3OYJ A;  4XLA A;  3FKJ A;  3ZMT A;  2JA5 J;  3RSN A;  1OPC A;  3JRH A;  3GW2 A;  3OYI A;  4A3F J;  1IO2 A;  1MJB A;  4BAY A;  3H36 A;  3F8M A;  4V19 K;  4EM1 A;  2DA5 A;  1RR7 A;  4CXF A;  3JRC A;  4A2U A;  3HGG A;  5F0C A;  2BEO A;  3H35 A;  3CJN A;  5E8I A;  1U3E M;  4MEX F;  1ZG5 A;  1RKW A;  1IRG A;  3IRQ A;  3RIR A;  3BQY A;  2FA5 A;  3REO A;  1X4O A;  5BMZ A;  3WHC A;  3LQQ A;  5FKO A;  4KMF A;  1ETK A;  1FT9 A;  3KEY A;  1U9N A;  2DT7 B;  2G7U A;  3H5N A;  2BE5 F;  2GBY A;  3MN2 A;  3WHB A;  1JTX A;  5BPD A;  2O6G E;  2PJR B;  3DWL E;  2R5Z B;  3HKZ A;  3ELK A;  3GF2 A;  1VQ7 I;  2Y0S A;  4ZYD A;  4EMS A;  2JRT A;  1W7P B;  4QWQ A;  2NS8 A;  2OBP A;  1YW7 A;  1W5C C;  3QU3 A;  1XGS A;  3HBL A;  1Z91 A;  2CQK A;  4JYK A;  4CUG A;  1CQT A;  2FOK A;  1T38 A;  4MQ9 F;  4BJT A;  3IUO A;  4YG2 F;  1GVD A;  3BZ6 A;  4A0Z A;  1UST A;  2XPV A;  2LVS A;  2TDX A;  2ICW G;  2VBY A;  2F4M B;  4NQW B;  1P92 A;  2ZFU A;  4DYC A;  2HNH A;  3DBL B;  1EKE A;  2XKP A;  1XGN A;  3GCM A;  1A31 A;  2R93 J;  2O7O A;  3H0D A;  3HTU A;  3DF8 A;  2JZY A;  3F21 A;  3MZY A;  1ZR2 A;  3JTG A;  2Q8K A;  4A3G J;  3W6K B;  2YX4 A;  1DP3 A;  2KIU A;  3OSF A;  1FY7 A;  4XKC A;  2KDO A;  2BYV E;  2L3D A;  4NUB A;  5IP6 A;  1OYI A;  2JSP A;  4AYB N;  1ON2 A;  1TZL A;  4Y7N J;  1R5I D;  2VQL A;  4Y17 A;  3A0H C;  1OCR H;  2EZL A;  2DJI A;  3DCF A;  1D0Y A;  1YIO A;  2Q1Z B;  2VUM J;  2KDZ A;  4IPA A;  2MYS A;  3B02 A;  3JSP A;  2ESN A;  5B1A H;  5E17 F;  3JRI A;  1N78 A;  2CFX A;  3R60 A;  1GT0 C;  4CSW A;  3F22 A;  4ZC3 A;  1YRN A;  5FRO A;  1B4A A;  3UNG C;  1KQ9 A;  1E3P A;  4EJT A;  2JT1 A;  3I5U A;  3KX2 A;  2BXZ A;  1UFM A;  4XK4 A;  3VDX A;  4ESF A;  2I10 A;  4LG0 A;  3IKT A;  1LVK A;  2XRN A;  2DDB A;  2FNP A;  3OOP A;  2V1X A;  3ZMU A;  4NC6 A;  3L2U A;  2DA6 A;  1DUX C;  3J7A Y;  3E7L A;  3I3L A;  1IN8 A;  3FM5 A;  4HQE A;  1WJA A;  3C3W A;  5KCM A;  2B7E A;  4IZZ A;  2CV0 A;  2OCC H;  5TRD A;  4NNJ A;  1TT0 A;  2WAQ A;  4DZJ A;  3KPH A;  1GV2 A;  2VXZ A;  3AG3 H;  2DK5 A;  5JHF A;  1ENH A;  3DP7 A;  3K2Z A;  5E3O A;  3BPV A;  3IHU A;  3EUA A;  2E36 A;  3HUG B;  3K4N A;  1ERD A;  1T08 B;  4JP0 A;  1BOA A;  5ERI A;  4OMY A;  4DQ2 A;  2ZJR F;  5IT9 K;  2WB1 A;  2K9M A;  4IHY A;  2VPR A;  4S0H B;  2RAE A;  1HBX G;  2M0C A;  4XQF A;  3RI4 A;  3J7Z I;  1J2X A;  1PP7 U;  3B6C A;  5TGT A;  3MZH A;  1VFC A;  4IHW A;  2FJ1 A;  2VOD A;  2M34 A;  4PGH A;  4KDP A;  1JHH A;  4U87 A;  2PX9 A;  2V26 A;  4K2E A;  1MMD A;  1U2W A;  3J80 Z;  4I2O A;  4HF1 A;  1XCB A;  3DEE A;  4BEH B;  2AS5 F;  2W4S A;  4M6X A;  2QGU A;  4FIS A;  2XHK A;  2CUE A;  2V6E A;  5D4R A;  3S2D J;  2V7F A;  1UCR A;  4IJA A;  3OWT A;  2ZME B;  3M07 A;  1M1E B;  3FXO A;  4YEL A;  1PDN C;  4UNO A;  1AHD P;  2A69 F;  2YS9 A;  1V5G A;  4XRM A;  3HOY J;  3S15 J;  3OYN A;  1S9H A;  4D7N A;  3DBR B;  1G2H A;  3AG1 H;  5E1Z B;  2R92 J;  5KK1 A;  1K79 A;  1APL C;  2KMU A;  1S3J A;  3GFL A;  3MMY B;  4U0V A;  4BGD A;  2DT5 A;  2EB7 A;  1K83 J;  3ASN H;  1G4D A;  2FMY A;  2W25 A;  2QKL B;  2ZXH A;  5K5O A;  3BOQ A;  3QOE A;  3OYB A;  4FCY A;  2IGO A;  3OR1 C;  4PUS A;  2L01 A;  2WTE A;  3CQZ J;  2QBY B;  4B3A A;  1UG0 A;  3FK7 A;  3VWB A;  1R22 A;  3I59 B;  2KZV A;  5CYV A;  2R7U A;  3TP3 A;  2CWE A;  1TBX A;  1DGR M;  2W1O A;  2K5C A;  3ML6 A;  4D7M A;  5FKN A;  3BDD A;  1V5F A;  4KJZ A;  4RB0 A;  1I6H J;  2ZO4 A;  1YX3 A;  4M3D A;  5L3D A;  4OMZ A;  3DKY A;  1LVA A;  4HYE A;  5GPA A;  1X3Z B;  2PBI A;  3K6G A;  1TWH J;  1YIT I;  3OS0 A;  3LAP A;  3E6C C;  3KP6 A;  4EJW A;  2Q2E B;  4BU2 A;  1FOX A;  2ZFW A;  3TOA A;  4YRV A;  3MFK A;  3BQZ A;  1QPM A;  2ISY A;  5FLX K;  2HTS A;  1SAN A;  1R5H A;  1QHH D;  1MKM A;  2LY9 A;  3RCO A;  3OYK A;  2LDU A;  4EJO A;  4ZYG A;  2LKP A;  3DPL C;  3EUH A;  3QPH A;  5K7F A;  2FBI A;  1LPQ A;  3PQK A;  1P4X A;  4RAY A;  1K7A A;  1HDP A;  3BG3 A;  5EEH A;  1FBQ A;  3IRR A;  2EIK H;  1TWC J;  4HF0 A;  3ONQ A;  1SAU A;  3AKZ A;  2FQ4 A;  5K1Y A;  3G71 I;  1MJA A;  1OYW A;  1T33 A;  3FZV A;  5LGU A;  1BL0 A;  1XSX A;  2F5D A;  2EA4 A;  1RNL A;  2UXX A;  1U0J A;  4L0Z B;  1HW1 A;  2R7Q A;  3DKX A;  1JKQ C;  2DJN A;  2W57 A;  5M5W J;  4A3D J;  4JX6 A;  3OS2 A;  4DYQ A;  3OYE A;  3RYP A;  3VYU B;  5D5X B;  1ZRF A;  3A01 B;  5LRR A;  4J01 A;  3H1C A;  4OWR B;  3SFI A;  3LA7 A;  1X1A A;  3S93 A;  1ZRE A;  2DPD A;  3HG9 A;  2E2I J;  1MBJ A;  1HKS A;  2DA3 A;  3MCZ A;  3SZP A;  2HOT A;  4CH7 A;  1R4N B;  2R7W A;  3E0J B;  4M9S A;  2EV6 A;  4UB6 C;  1J09 A;  4RBO A;  4GDF A;  2P7C B;  5F1R A;  1TQP A;  2KKO A;  1E0E A;  4BJ5 C;  3WU1 B;  2LBF B;  1SVL A;  4HX8 A;  2KIM A;  2MC4 A;  2OAZ A;  2Z1D A;  4IRH A;  1G3T A;  1YS6 A;  2CMP A;  5GAE J;  1ZQ3 P;  1P7I A;  2O03 A;  4M73 A;  5BPI A;  1GDT A;  4I0B A;  1FP1 D;  1ZAO A;  2LH9 A;  3MKL A;  1O3R A;  1FIP A;  4D5F A;  1FYM A;  1Y39 A;  1U78 A;  5F08 A;  3B73 A;  1QQI A;  2CW8 A;  3V8K A;  2H09 A;  2RRE A;  4HX4 A;  1SD6 A;  2W85 A;  2NVQ J;  4C3J J;  3HHG A;  1EH6 A;  4XRS G;  4A12 A;  2XAQ A;  3BR3 A;  4ZH4 F;  4AIH A;  4KFC A;  1W36 D;  4BBS J;  4I76 A;  2AQF A;  2JRM A;  3CCY A;  4M6Y A;  4PK4 A;  5FFZ A;  3FXJ A;  1LDD A;  2VAS A;  2JUC A;  2XAU A;  3TQN A;  2K4B A;  3JRA A;  1S6L A;  4ETS A;  3JCU C;  5DUK A;  3BT9 A;  1D0Z A;  2A07 F;  2ZCW A;  4JK1 X;  3H9J A;  3T1B A;  1MW7 A;  1CF7 A;  4JX4 A;  4XM3 A;  1FZP B;  2DPU A;  2VJ4 A;  5BNG A;  1JUS A;  2EIJ H;  1VQ4 I;  3S17 J;  4TV7 A;  1I50 J;  2AXL A;  3ZQ7 A;  1QBJ A;  2DAO A;  2P5K A;  4LB6 B;  5DM6 F;  4Q5S F;  4PJM A;  3L00 A;  2BY2 A;  5AIP A;  1MGT A;  3FXK A;  1E2X A;  1EV7 A;  3C18 A;  2VE8 A;  3GTO J;  4Q48 A;  1G3S A;  2ZXI A;  4RB3 C;  4E7S A;  5CKT A;  3ERM A;  3V7C A;  4YIF A;  3D5S C;  1K61 A;  3HYI A;  2STW A;  4IHV A;  2LBF A;  5CVI A;  2GA2 A;  4MEY F;  4BL0 B;  4PFO A;  2VQH A;  4DJA A;  2P81 A;  2F4O B;  5GP9 A;  2XGX A;  2R7R A;  1X1D A;  1D1C A;  3AAF A;  1Y1W J;  2DMN A;  3X2Q H;  2WAE A;  5HLH A;  2MBF A;  2LKS A;  5HOO A;  3K1N A;  4IHS A;  1P2F A;  2B63 J;  2IGK A;  4UVC A;  2M7A A;  4S04 A;  4L18 B;  3DPT A;  2K27 A;  2GXB A;  2QUF A;  2RC4 A;  2EFW A;  2HVR A;  2K9L A;  2E1M C;  2CV1 A;  5H20 A;  1A5J A;  2HEO A;  2Y31 A;  3LSI A;  3BG9 A;  3VEP A;  1W0T A;  2IA1 A;  1MDM B;  1HCR A;  3V42 A;  1Z1D A;  3M3Y J;  3SZG A;  4QTR A;  1UHW A;  1Q1H A;  3PIO F;  4BHB A;  5ED4 A;  1QZY A;  3QU6 A;  4G9Y A;  5M3M J;  1YI2 I;  2YU3 A;  5HNH A;  4P9F A;  3LSK A;  3K1M A;  1HLV A;  2DT6 A;  4IRI A;  3M8F A;  3ABT A;  3HIF A;  5GTI C;  5LEJ A;  1Z67 A;  3L09 A;  1TQI A;  3VYR B;  4A0Y A;  2FD5 A;  2KLO A;  3ECH A;  1NK3 P;  4RGX A;  4KIS A;  1N25 A;  5E8G A;  1FWZ A;  1U8B A;  5HDK A;  3DBH B;  1ZEL A;  2X6O A;  3U1D A;  2H8R A;  2JUG A;  2NNN A;  3I0T A;  4LOC A;  2WY7 Q;  5FKL A;  2VBX A;  5D4S A;  4CCL A;  5E1X A;  2PJR A;  3QOD A;  4U7B A;  5LHI A;  3TGN A;  4BQA A;  1BM9 A;  1W0U A;  2DMP A;  2DA2 A;  3OV8 A;  2X6X A;  1PJR A;  4A3C J;  1I3A A;  2D5V A;  1HOM A;  5D8L B;  5LHG A;  5E3L A;  2R4G A;  4RB1 A;  4IHT A;  2DW4 A;  1I3Q J;  3SEZ A;  2MH9 A;  4RS8 A;  2IJL A;  3RQ4 A;  3ZN0 A;  4DBQ A;  2XRO A;  1AOY A;  1UHM A;  3K0L A;  2XGD A;  2MLG A;  1FNN A;  3S2H J;  1UMQ A;  2KIS A;  4I99 C;  2KHM A;  2CJJ A;  5KHD A;  1XMK A;  2WAD A;  4P1W A;  1WGX A;  3FK6 A;  2XKO A;  1ZN2 A;  3KP4 A;  1NHA A;  3PO3 J;  1SD7 A;  5FO5 A;  3G1L A;  5HVQ C;  3GFJ A;  3PJR A;  2BY1 A;  1IN4 A;  2Z2S B;  3IH3 A;  2BV6 A;  2RGV A;  2VJ5 A;  4I09 A;  1RET A;  4XN0 A;  1BJZ A;  4ITV A;  5IY5 H;  1IN5 A;  4II2 A;  1IRF A;  4FX4 A;  3CF2 A;  3RKX A;  3VYS B;  4Y33 A;  2HOE A;  2JVH A;  1FSE A;  5CVJ A;  4QPO A;  3WGH A;  1MMG A;  3ZCO A;  3FKI J;  3F8N A;  2JTV A;  2XDV A;  2NVU B;  1LQ1 A;  1YLF A;  3PSF A;  3W6J B;  4BXF A;  5JVG F;  3E6D A;  1YJ9 I;  2QCO A;  5EZG A;  1UHS A;  2HDD A;  3FWE A;  5FLV A;  2PJP A;  1BI0 A;  4XLN F;  5AIQ A;  1IN7 A;  3QYF A;  4MFE A;  4Y13 A;  1ODD A;  3C2B A;  4HSR A;  2E7W A;  2P7V B;  4LLL A;  2MAB A;  4BEH A;  4WX9 A;  1VND A;  3CC7 I;  3CUQ C;  4YEJ A;  3GZ5 A;  1GVJ A;  4GYI A;  4IXA A;  1KQ0 A;  2V9P A;  2X1E A;  3BRO A;  1LUJ B;  5HDN A;  2R3S A;  2Z33 A;  3KP3 A;  2A68 F;  3I71 A;  4HBL A;  3C2H A;  5DUI A;  1POG A;  3ZMS A;  2NS0 A;  3HRS A;  5ICG A;  1STZ A;  3L2C A;  3Q0U A;  4G6Q A;  2JK3 A;  4UUS B;  2L9V A;  2MSY A;  2DDA A;  2EFQ A;  1BI3 A;  4LJZ F;  1B8I A;  5JVT A;  3WGI A;  4ESJ A;  2BY3 A;  2E1O A;  1VQL I;  2OU2 A;  1QRY A;  3K70 D;  2DYR H;  4L9J A;  3SDG A;  1YJW I;  3MAJ A;  1HW5 A;  2HKO A;  4BAC A;  3BTI A;  4GYG A;  4BQN A;  4BBR J;  4BDY A;  2HDW A;  3H9G A;  4FT8 A;  3ESW B;  1USS A;  4OU0 A;  1VQ9 I;  3ZOB A;  2HI3 A;  1RPW A;  2ME0 A;  2HYG D;  4NDL A;  3GTG J;  1RC9 A;  3WTS C;  4OIN F;  4CCN A;  4Q4Z F;  4D9J A;  3LQR A;  3MEX A;  1I1G A;  3CZ6 A;  1XG1 A;  4BH9 A;  5C4J J;  4P55 A;  5JHU A;  1O7F A;  3LSM A;  1ZKG A;  3RKY A;  5IYB J;  2CRG A;  3HB9 A;  4C2M J;  4EJV A;  1KU2 A;  3MD2 A;  5CVU A;  4A3J J;  2G7H A;  5J1R A;  1ETO A;  1BW5 A;  2DOF A;  1MSE C;  2CFO A;  4RDU A;  1GLN A;  2IT0 A;  1JGS A;  4E7K A;  5HS7 A;  3GTQ J;  2EWN A;  2IXS A;  2XIG A;  3E97 A;  4UUT A;  5L3G A;  4AVZ A;  5DCF A;  4Z2Y A;  4EGZ A;  3P7N A;  4UVA A;  3SEQ A;  3CUO A;  4XLC A;  1X1B A;  1HKQ A;  2R0Q C;  1WH7 A;  2UZK A;  5CJ9 A;  2OF7 A;  1SC7 A;  2ZSH B;  1AA7 A;  1FTZ A;  2GXG A;  3GTL J;  2QYO A;  1JTY A;  3F8F A;  3O6B B;  4N9I A;  1X2M A;  4KA4 A;  1EA3 A;  3IWZ A;  3BJ6 A;  5HLI A;  1K78 A;  3PQJ A;  1WH5 A;  1KU3 A;  2CQX A;  3GTJ J;  1RZ4 A;  1BR4 A;  2R5Y A;  1UAA A;  3MKY B;  2CQN A;  2PMH A;  3ZGK A;  3S32 A;  3DQV C;  4XKV A;  4B8X A;  2K40 A;  1KQ8 A;  1V55 H;  3VPR A;  1SFO J;  3CME I;  1XMX A;  1QPI A;  3RPQ A;  1Z7L A;  2J5O A;  2VBZ A;  2VIX A;  3S2W A;  3HOX J;  3SHF A;  2UUZ A;  1A6I A;  1ZYR F;  2KRC A;  5HS9 A;  5ICF A;  2WWY A;  2R7V A;  1OIS A;  1FTT A;  1IV8 A;  2QQ8 A;  1R1T A;  2HYJ A;  4IL6 C;  3VOE A;  2QBY A;  2XVC A;  1VQP I;  2M0M A;  4B47 A;  4F7Z A;  3GME A;  1LFP A;  2XC7 A;  1S7E A;  2BY0 A;  1S8N A;  2P6S A;  3BZK A;  2RNG A;  2ADU A;  3KIO A;  3TL4 X;  4B1R A;  3ZQC A;  4ZDP A;  4LG3 A;  2EH3 A;  4RGR A;  1Z9C A;  4XL9 A;  5EF6 A;  3WE2 A;  2VC1 A;  1OYY A;  4RLF A;  5M3F J;  3PNY A;  3E3V A;  5LEK A;  4LIT A;  1B8I B;  2CSO A;  2HU9 A;  2ACJ A;  1F5T A;  1D8J A;  2WA0 A;  4E7I A;  5E3N A;  4X0G A;  2AHQ A;  4L9V A;  3J81 K;  3PIP F;  1AKH B;  2EA2 A;  4WWC A;  4V2G A;  2OUM A;  3ERE D;  1FMW A;  1FOY A;  5EYR A;  2P4W A;  1X3U A;  2L5Q A;  3W2A A;  1TTY A;  2VPL A;  2CH0 A;  4L5E A;  1HST A;  1YFH A;  1S72 I;  3BWG A;  2JA8 J;  1SFX A;  3CO6 C;  2XPW A;  1H88 C;  3U9G A;  2ISZ A;  3MZ8 A;  3V8J A;  2F6C A;  1K6O A;  2JJ7 A;  3E5Q A;  3O8H A;  4XRF A;  1KU9 A;  3RKW A;  1DGW Y;  2VL8 A;  4UY8 I;  2V6C A;  2DOD A;  3IAM 2;  2KJC A;  2VKD A;  3S1Q J;  2LY2 A;  2QZ8 A;  3OR2 C;  2M8E A;  1YJN I;  1BC8 C;  2LKX A;  3GUD A;  4KN7 X;  4HA8 A;  4XIC A;  3AL0 C;  1EF4 A;  2ZSI B;  1G59 A;  3SJM A;  2HFH A;  1G3Y A;  2CUJ A;  3ZMV A;  4A3M J;  4O3M A;  5LD2 C;  3T0Y A;  1B9N A;  3CF5 F;  3I53 A;  4E7H A;  1BIA A;  2DI3 A;  2F4I A;  2RKH A;  2FNA A;  3G3Z A;  3HL2 A;  2Y9Z A;  2ZB9 A;  2Q0O A;  2VXD A;  4O6J A;  2I5U A;  3PM1 A;  1U5T B;  3K70 C;  3K2A A;  4PJL A;  3L7W A;  1MD0 A;  1ZGJ A;  5EJC A;  3IV5 A;  1ZK8 A;  3GFM A;  1JKO C;  3BPX A;  2COB A;  2RVC A;  3H92 A;  4GRI A;  4LFU A;  2LC2 A;  1DQU A;  3W3C A;  4AUX A;  3PNV A;  2X9D A;  4CCK A;  3LST A;  4D0P A;  3ZXS A;  1Z21 A;  3GTP J;  5L3F A;  4KT6 A;  4XKB A;  2EBI A;  1P4A A;  3RYR A;  2LP0 A;  1MZB A;  2KPM A;  1RR8 C;  1R6R A;  1WQ2 A;  1NH3 A;  4PGG A;  3M1C A;  1YTY A;  1MBH A;  2K9Q A;  3BZC A;  2Q2E A;  1JGG A;  5FD5 A;  2WAQ N;  3ABM H;  3AG2 H;  2FBH A;  3CUQ A;  2HWV A;  4AM3 A;  2IGM A;  3F9K A;  2Y2Z A;  1BR2 A;  2CQ7 A;  4Y3O A;  1T98 A;  2P8T A;  1OR7 A;  1MMA A;  1ACI A;  3KZZ A;  3BG6 A;  3BR2 A;  3EYI A;  5DD4 A;  4HG2 A;  3EYY A;  1IUY A;  5D8K B;  1WJD A;  3KP5 A;  2LF7 A;  2BGC A;  2DLL A;  4MLO A;  4HNT A;  1XGM A;  1LE8 B;  2ZJP F;  4NQW A;  1IRZ A;  1LFB A;  2VQC A;  5B1B H;  3I56 I;  4GGG A;  2VQG A;  2FQ3 A;  1BI2 A;  5DDG A;  2IW5 A;  3MVP A;  4BXU A;  3ZN1 A;  2H1L A;  3HSR A;  4G7Z F;  2EZH A;  2YUS A;  1B1B A;  1JUM A;  2W48 A;  4HDV A;  2YU9 J;  1XSD A;  1R5G A;  5FKK A;  5HNF A;  4RAZ A;  4KIC A;  3FMQ A;  4MFD A;  3KP2 A;  2CU7 A;  4G6D A;  4C3H J;  4BY1 J;  4XLE A;  3OIO A;  1ZG1 A;  4DYR A;  5D5W B;  1TWF J;  4HV5 A;  3HHH A;  1I6X A;  1IC8 A;  2JN6 A;  2ELH A;  3ASO H;  3H3Z A;  4PDK A;  3W2V A;  3CES A;  3C1D A;  4RGU A;  4ZDO A;  5J8C A;  4M3B A;  2FE3 A;  2ZNZ A;  5JR3 A;  3G6E I;  3W6V A;  4AD9 A;  5GAH J;  4IO9 F;  2DQL A;  4X1E A;  2R7O A;  3K4K A;  2C6Y A;  3OYC A;  5K5Q A;  5EGO A;  3LA3 A;  2D2W A;  5IP7 J;  3P9K A;  2WV0 A;  3OMY A;  1TT5 B;  2VJI A;  2F48 A;  3D5L A;  5BS6 A;  1PUF B;  3P9I A;  2UXN A;  5FD6 A;  6PAX A;  2ZBK A;  2LYC A;  2W24 A;  5DS9 A;  1IDZ A;  5DV5 A;  4G6T B;  1ZLJ A;  1W7P D;  3A02 A;  3DFG A;  1R7J A;  4E7Z A;  3MKZ A;  2X85 A;  1QU3 A;  1F36 A;  4UHT A;  1RUN A;  4Z6Y A;  2M9H A;  2GM4 A;  2BW3 A;  4UV8 A;  2ECB A;  4C2T A;  3LAJ A;  1MMS A;  2VC0 A;  1WJC A;  4ABZ A;  3WG9 A;  1HW2 A;  1O3S A;  2JSC A;  2VN2 A;  5M5X J;  2ZJQ F;  3QPS A;  5F1J A;  4ANJ A;  1K78 B;  4A3I J;  4MHG A;  4IEJ A;  3OYG A;  3Q9S A;  1QNT A;  3OSG A;  3KEO A;  2K4J A;  1SVM A;  2K85 A;  3SQN A;  3WOD F;  5FRM A;  1F9N A;  1ETW A;  2LLK A;  2AO9 A;  2E5N A;  4AVP A;  2XAS A;  3BJO A;  1OQY A;  5K7Z A;  5L3B A;  1QVT A;  2XAJ A;  4EGY A;  1XD7 A;  2BXY A;  1BOB A;  1A6Q A;  4DZP A;  5KVR A;  2N8G A;  4B3X A;  1MNM C;  5HLT A;  2BW3 B;  1S5L C;  3RPU D;  1IUF A;  4WF2 A;  5J4Y A;  1DPU A;  3CMA I;  2GZW A;  4XR6 A;  2Y0S N;  1G8X A;  2FBK A;  4HF2 A;  1EJ9 A;  2NYX A;  4JOM A;  4KIG A;  2DA7 A;  3K10 A;  2E2H J;  3FM3 A;  1WJF A;  1Y56 A;  4P9U A;  1QZE A;  5CVR A;  1VF9 A;  2E34 A;  4LMY A;  2KP6 A;  4A6E A;  2G9W A;  4BUP A;  1SFU A;  2F5C A;  1UB9 A;  2L4A A;  3DPU A;  2VKV A;  3HEF A;  2MG4 A;  5EGO B;  1Z77 A;  1H0M A;  1IXR C;  4EQQ A;  1I5Z A;  2HQN A;  2FUG 2;  1BA5 A;  3LSG A;  5AON A;  4H0E A;  3I4M J;  1SEU A;  2QQB A;  5FLM J;  4O5V A;  4BY7 J;  1U9O A;  3GTK J;  2WV1 A;  2M2E A;  4M74 A;  1BN5 A;  1IF1 A;  3CDH A;  3KZI C;  3LWF A;  5J6X A;  1OKR A;  4MTE A;  3H9Q A;  1RES A;  3HJE A;  4XNF A;  2ID6 A;  4XKW A;  4ZJZ A;  1XX5 A;  4YFN F;  1BI1 A;  2L54 A;  2FRH A;  3BR5 A;  3FBN B;  3OS1 A;  1V4R A;  3ABL H;  4XON A;  2L9R A;  1LB2 A;  4GO1 A;  1TW3 A;  3F3X A;  3HGY A;  1WCM J;  3KP7 A;  4B43 A;  1H8A C;  3BG5 A;  1SMY F;  2EZI A;  3IKV A;  2IA2 A;  2EFO A;  2NVT J;  1WKM A;  3BC8 A;  2HVQ A;  5JLX A;  1VQ5 I;  1HSJ A;  4G7H F;  3TP0 A;  3LSR A;  2FEZ A;  1R9T J;  5DCM B;  1ETX A;  5FLX Z;  4FTH A;  3COA C;  1YW8 A;  2DFH A;  2HVS A;  4FE4 A;  3S1N J;  2XGC A;  2IBD A;  3CTA A;  1JE8 A;  3GXO A;  3S3M A;  4RAG A;  1B59 A;  2O0Y A;  1UJ8 A;  2PMU A;  1SVO A;  4PJJ A;  2HOS A;  1KGS A;  3CC4 I;  2R7T A;  1YE9 A;  3SXY A;  1W4M A;  3E6B A;  3G2B A;  4HNU A;  1VQK I;  2X0L A;  3M1E A;  1BBY A;  3PUB A;  4QSH A;  4B44 A;  2KJB A;  3JTH A;  4XOR A;  1ONV A;  4PSW A;  1LFU P;  2NOJ B;  4OAY A;  4JQF A;  1O3Q A;  5F0H A;  1WJB A;  3OL3 A;  3G1O A;  1EH8 A;  1HQC A;  4A6D A;  3WTU C;  2QEX I;  1FSH A;  4BNC A;  4MNU A;  2IEK A;  2FX0 A;  2IGN A;  2FOW A;  2GQQ A;  2NXN B;  3WU0 A;  3G73 A;  1T8I A;  1IXS B;  1L0O C;  3CCU I;  4NC8 A;  1SD5 A;  4W1U A;  4CCM A;  2A6T A;  1FOK A;  5LGT A;  3L1P A;  2OTJ I;  3FIS A;  1O57 A;  3QRF F;  2L7Z A;  4IF4 A;  4BS9 A;  3L2W A;  2ZNY A;  1YYV A;  2DFI A;  3O3K A;  3K9T A;  3GWZ A;  3QOP A;  2BHZ A;  3RJP A;  2YR2 A;  2RNJ A;  3NWS A;  1MBK A;  3CLO A;  3U2R A;  1AWC A;  1FIA A;  2QVO A;  2Z9O A;  2XB0 X;  2CUZ A;  3WTV C;  4I7H A;  2D45 A;  4B48 A;  1P4W A;  3S3O A;  1AU7 A;  4LLG F;  1U6G A;  3AFH A;  2J5P A;  3O2P E;  4M71 A;  1S7O A;  3PL8 A;  2E1C A;  1X3W B;  2KIQ A;  2L02 A;  3OYL A;  2VLA A;  1OCC H;  1RIO H;  1R1U A;  4ESB A;  1LEB A;  4BHP A;  5DM7 F;  1R71 A;  2VON A;  5H2F C;  2ZME C;  4BDZ A;  1HF0 A;  4CHU A;  1Y8R B;  3LSH A;  2ME6 A;  3I9V 2;  1NTC A;  3ABU A;  5EZH A;  4YFX F;  2QQ9 A;  1JKP C;  4G8X A;  1N77 A;  3DEW A;  4FHT A;  2M45 A;  5CLS A;  3S8P A;  4R79 A;  3H3U A;  4GFB A;  1VQN I;  1Z6R A;  2O61 A;  2RQQ A;  3A1Y A;  3HZJ A;  5D5U B;  1ZGW A;  3EUH C;  2M1B A;  1PP8 F;  3QQA A;  2IA0 A;  4KIF A;  4HEA 2;  1XGO A;  2DXI A;  1I1S A;  1QGP A;  3L9F A;  3T8T A;  1O7L A;  3TO9 A;  5JLW A;  1W5S A;  2L9S A;  2MC3 A;  4ENN A;  2DN0 A;  3CCV I;  2DA1 A;  3CP2 A;  1OLT A;  5D5V B;  3H0G J;  4CZZ A;  3L2V A;  1Y1V J;  3LA2 A;  3F72 A;  2KQR A;  2L7K A;  3LMM A;  2HXI A;  4NC7 A;  2WB1 N;  2GA1 A;  3HUG A;  2BOL A;  2KZG A;  1H9G A;  1Y0N A;  4I98 B;  5F0F A;  1R4M B;  2H1K A;  4GXO A;  4C9Y A;  1Z6T A;  2PLY A;  4AIJ A;  3VOD A;  3LFU A;  1ETV A;  4EJU A;  3U1K A;  1HKT A;  4A3L J;  2DBB A;  2XSJ C;  3QYE A;  3ZQI A;  3J80 K;  1D5Y A;  2GIV A;  4IQJ A;  2A6E F;  3E5U A;  4IOA F;  4HRI A;  3ZRG A;  4XRS A;  1O3T A;  4R8H A;  3GEZ A;  1IJW C;  3CMM A;  1TC3 C;  4A5N A;  4ZDL A;  2OQR A;  4QIW N;  3GX4 X;  3I4N J;  4KIB A;  4D1Q A;  4IX7 A;  1DU6 A;  4E7L A;  2E35 A;  3T8R A;  1PYV A;  3HPG A;  3I4P A;  2QLZ A;  3RQI A;  3I55 I;  2H94 A;  1F4K A;  2PFB A;  4F52 A;  5BQT A;  2XV4 S;  3EDP A;  1ETQ A;  2HYF A;  3B6A A;  2GIZ A;  5A2Q Z;  4L5I A;  2R7X A;  4QPQ A;  3BTJ A;  4M9X A;  5F64 A;  4CZC A;  1QZZ A;  3OIP A;  1AKH A;  1G3W A;  3BLY A;  2R5Y B;  3DV8 A;  3RPU A;  2FXA A;  2P6T A;  1A04 A;  4CYC A;  5GTH C;  3BR6 A;  1C0W A;  3NWT A;  1R49 A;  3CDL A;  4E7J A;  1Y6I A;  4CCJ A;  3AL0 B;  4C3I J;  1ZRC A;  3HPH A;  5FGM A;  4YII A;  1BJA A;  4AIK A;  2F2E A;  1ON1 A;  1QO0 D;  5HDG A;  3HTS B;  1FLI A;  3DLL F;  3M8E A;  3A01 A;  5A2Q K;  2L9N A;  3H5R A;  2X6W A;  3VYT B;  3TMO A;  1B9M A;  2EJR A;  1LDK B;  2NOG A;  4W97 A;  3VB2 A;  3WU2 C;  1O4X A;  3R4K A;  2BVM A;  3GTM J;  2CUF A;  2QA4 I;  1XDU A;  2FML A;  2H6B A;  4FAS D;  4OIQ F;  2DMQ A;  3HOW J;  2HS5 A;  1ITY A;  3FXL A;  4V2F A;  3W2W A;  5FKM A;  5J3L A;  4OIO F;  5IYD J;  2CS3 A;  2CW0 F;  2ZXW H;  3FBI B;  4XOT A;  2WY8 Q;  3VSK A;  2LOO A;  2B0L A;  3V7R A;  5EDN A;  1GXQ A;  4IRG A;  1KON A;  3GLL A;  2VE9 A;  3A03 A;  2JQ7 A;  2E60 A;  3M8J A;  1LDJ A;  2Y69 H;  4N4O B;  3K4L A;  5H6Q A;  2QWW A;  1MND A;  2NVY J;  3NEU A;  3P9C A;  3FMR A;  4JBA A;  2OTL I;  3K4B A;  1JUP A;  2Y9Y A;  5GPC A;  1P6R A;  4DOZ A;  4HQM A;  5C44 J;  1RKT A;  2DYS H;  2ZKZ A;  3DLA A;  3FMS A;  3QP5 A;  1SAX A;  2ELK A;  1T95 A;  3G1M A;  4ZYE A;  1R00 A;  1YRN B;  2EV5 A;  2L7M P;  4J00 A;  3JRE A;  1UEL B;  4A5M A;  3ZR8 X;  1FEX A;  1XC5 A;  1LNW A;  2V79 A;  2Z5U A;  4IQ4 A;  2F5F A;  3BTL A;  2DOE A;  2OPT A;  2NNY A;  1U5T A;  3HM5 A;  1P7J A;  3CCM I;  1X58 A;  3LSP A;  3ZQL A;  2VKH A;  3DKW A;  3HSE A;  4N9H A;  5BOX A;  2PG4 A;  1BR1 A;  2ESH A;  1IN6 A;  1IDY A;  1S7A A;  4DNC A;  2VKE A;  4A69 C;  4LIV A;  4N4N B;  2DCE A;  1ZAR A;  2HR3 A;  2V9K A;  4HOB A;  2QF7 A;  5ILU A;  1X19 A;  2M3A A;  5ILV A;  3RZO J;  3ZQQ A;  1HC8 A;  2R7D A;  4XLH A;  2K9S A;  3DU5 A;  2M87 A;  3H3V K;  3UR3 C;  4Y52 J;  3ZQG A;  2IAI A;  3N4M A;  2IS4 A;  2Y75 A;  2JWT A;  4HST A;  1W36 C;  1OCP A;  3TW7 A;  2A05 A;  1ZRD A;  4OAZ A;  1VTN C;  1BIB A;  5J1Y A;  1D1A A;  3K1P A;  2VT2 A;  1ZG3 A;  3QPT A;  5GAD J;  3KFW X;  4KNY A;  1WFX A;  1MBF A;  3QPL A;  2XAH A;  2BBY A;  2JMW A;  3HOU J;  1JI8 A;  3K4J A;  4IOC F;  1XDS A;  1WI3 A;  1FX7 A;  3R0J A;  1IG7 A;  5E3M A;  2LF8 A;  3KYC B;  4C2U A;  1GHC A;  1IAW A;  2DTZ A;  1XPX A;  4BHC A;  3HXL A;  4CGZ A;  5F04 A;  2A5W A;  4L0Y B;  2XPU A;  3F6O A;  4NB5 A;  3JRG A;  1PUE E;  2IPQ X;  1SD4 A;  2K02 A;  3S16 J;  2V1D A;  4G7O F;  4P96 A;  4WXD A;  5B3S H;  3JRF A;  2PI0 A;  4IVN A;  4I01 A;  4BE1 A;  4E6K G;  2NS7 A;  1ULY A;  3HKZ N;  5DTD A;  1H89 C;  2EQR A;  3V4G A;  3ZQH A;  4AC0 A;  5B66 C;  3MQ0 A;  1I39 A;  2LG4 A;  2DOA A;  3DEU A;  2AQE A;  2L7F P;  2XRL A;  1OJL A;  4KN4 X;  1Z7U A;  2VOP A;  4P5O A;  2P5L C;  3L2Q A;  3IH2 A;  4PZJ A;  4CCO A;  3TBI A;  2A5Y B;  2XAF A;  3CCS I;  1YIJ I;  4X6A J;  3JR9 A;  4Y4R A;  2EFN A;  3M9A A;  4MQV A;  4HNV A;  3GZN B;  2IS6 A;  2X51 A;  3D0S A;  2Y0M A;  1OMI A;  3MWM A;  1TP4 A;  3P5J A;  4II3 A;  2DTR A;  3J7A O;  3K4C A;  1IRX A;  4LD5 A;  3LNQ A;  1T0F C;  2LRE A;  3E5X A;  1D5V A;  2DFF A;  3NRV A;  1RI7 A;  2MW8 A;  4U88 A;  1K4S A;  3QP6 A;  4EAT A;  1TW2 A;  4HAM A;  5FJ8 J;  3ISP A;  2VT3 A;  2RV8 A;  3CCL I;  1SFK A;  3JW4 A;  2X1D A;  4FE7 A;  3BCA A;  1XN7 A;  4M3G A;  1WJE A;  4HPQ A;  3WTT C;  1J5Y A;  3RKQ A;  5E20 A;  2LY1 A;  2OA4 A;  3CCE I;  2PMZ A;  4A93 J;  5IT9 Z;  3AG4 H;  2ZME A;  4M9Z A;  5DCM A;  1TL8 A;  1LKX A;  2ID3 A;  1E17 A;  3KLN A;  2HXO A;  2DO7 A;  4D5C A;  4ZYH A;  1KYW A;  3O8G A;  3GLX A;  2B9S A;  3BG7 A;  3PUF A;  1ZLK A;  3TED A;  2MFZ A;  2KL4 A;  2V9V A;  4LLN A;  1A36 A;  3GYH X;  2W84 A;  3HRT A;  3E1S A;  3I54 A;  3QYB A;  4PFP A;  3CCJ I;  3Q0V A;  4I02 A;  4KUM A;  1IGN A;  5L3C A;  3L2R A;  5ICC A;  1JJ8 C;  3PO2 J;  4RAF A;  2MH2 A;  1XTA A;  3WTY C;  2QKM B;  5J47 A;  1BW6 A;  3PFY A;  5HS8 A;  2Z3Y A;  3FXR A;  4U0Y A;  1JT6 A;  2QSF X;  2R7Z J;  3G4S I;  2MGQ A;  1P9Q C;  3DU6 A;  1FPQ A;  1Z0X A;  2X48 A;  3J81 Z;  3ROU A;  3TOB A;  2DMT A;  3PNT A;  3QAH A;  1WJ5 A;  1D0X A;  1XCV A;  5H6R A;  2LMD A;  2BZT A;  5LHH A;  3EET A;  2FU4 A;  3F8C A;  2ZXJ A;  2R7S A;  2BHY A;  4A3K J;  1YW9 A;  4M6V A;  5F27 A;  3FXU A;  1DPR A;  2KIF A;  2M4K A;  4RM3 A;  2MA3 A;  2VJJ A;  4HDU A;  1PVE A;  1MBE A;  1R36 A;  3OIQ A;  4A3B J;  1ETY A;  4ZZL A;  2CO5 A;  2XGE A;  1T0F A;  1L3L A;  3RZD J;  2O5R A;  3SFZ A;  1RUO A;  4LIU A;  4AID A;  3C7J A;  4DGW B;  4S05 A;  3OYH A;  2E71 A;  3IC7 A;  3OYD A;  2CQQ A;  2EIM H;  3J7Y J;  5DYM A;  4XBF A;  4EV0 A;  3WTX C;  4XID A;  1VQ8 I;  1W1W E;  5LBQ A;  4XMY A;  1JKR C;  2VB6 A;  1F43 A;  1Y0U A;  4DIQ A;  4HX7 A;  2STT A;  4UUV A;  2HZT A;  4LK1 F;  3HOZ J;  2E2J J;  1K4T A;  3KYD B;  3KE2 A;  5EEA A;  2GLO A;  4F3Q A;  1YO5 C;  2HTJ A;  5CVV A;  3EUK L;  1GUU A;  1YS7 A;  4B09 A;  2QSH X;  5K7H A;  1TWA J;  2X4H A;  1MNE A;  4Y15 A;  1UZC A;  3LSJ A;  4UV9 A;  3M4O J;  3D5R C;  3IH4 A;  3ZMZ A;  3WTW C;  2NRA C;  2H27 A;  3HRM A;  4EEF G;  3F0C A;  2OV7 A;  4M72 A;  4BE2 A;  3KCC A;  1UG2 A;  1MH4 A;  1NG7 A;  1ZH5 A;  2NVX J;  3EQL F;  2EV0 A;  2R7F A;  1ZR4 A;  3A0B C;  2AXT C;  3N05 A;  3BP8 A;  3HSF A;  2VI6 A;  3OL4 A;  2L2O A;  3R6S A;  3S1R J;  3VSL A;  4IKF A;  3I64 A;  4N0B A;  4KMU X;  1J9I A;  1R1V A;  3WE3 A;  4RMN A;  4GCV A;  1TNT A;  2GOX B;  3TW6 A;  2JPB A;  1PUF A;  3HDD A;  2ZC2 A;  2JA6 J;  3CC2 I;  3KLO A;  2CGP A;  4DW6 A;  5L3E A;  2GXA A;  2O8X A;  2M30 A;  2W00 A;  4ZYA A;  4RLQ A;  5HLG A;  4U7D A;  5KAI C;  1MIJ A;  3V8L A;  1OR7 C;  1IV6 A;  2O8K A;  2UV1 A;  1TLH B;  3DTE A;  3E6M A;  1TWG J;  3GZ6 A;  3S14 J;  2XB5 A;  5J40 A;  4RGS A;  1WPK A;  5J4V A;  1VI0 A;  4ON0 A;  4ASN A;  3S1M J;  4F93 B;  1FP2 A;  1KU7 A;  1DDN A;  2Y48 A;  1X2N A;  2HOA A;  4XSX F;  3T5X A;  4KYW A;  3JAM K;  4CYC B;  2R5Z A;  4L9T A;  3N97 A;  3K4M A;  5C4X J;  1Y8Q B;  4WXC A;  3IAS 2;  4BQO A;  3CCR I;  4OIP F;  1U5T C;  2FF4 A;  4WXH A;  3TDU C;  2KRH A;  1OFC X;  5HOD A;  1ZHF A;  3K7A J;  3BY6 A;  3JRB A;  4WCG A;  1ZGA A;  2ZJ2 A;  1MJ9 A;  3CDI A;  2XF7 A;  2V1U A;  3BR1 A;  3GFI A;  3D1N I;  4M3E A;  2KFD A;  2QM3 A;  4BE0 A;  3R61 A;  3M7G A;  1T56 A;  3TKY A;  5J8F A;  2XSD C;  4LK0 F;  3FIW A;  3CLQ A;  2A61 A;  3HRU A;  5ICE A;  1EH7 A;  5LRS A;  2RQP A;  2IVM A;  3HC7 A;  4EM0 B;  5IYC J;  2EFP A;  3HOT A;  5DEQ A;  4PJN A;  2W7N A;  3PFI A;  2EIL H;  4DBR A;  2M4G A;  2V4J C;  2MD5 A;  1XMA A;  4XOP A;  3MKW B;  3R0A A;  1IW7 F;  1SMT A;  3ULQ B;  3TO7 A;  5LGN A;  4HLX A;  3GVA A;  1J0R A;  2CG4 A;  2JVG A;  3CUQ B;  1KZH A;  2LRD A;  2QQA A;  2EIN H;  2HQA A;  3HOS A;  3LFK A;  2X6Y A;  2EPF A;  2D1V A;  3SDB A;  4M3F A;  1W7P A;  1Q1V A;  5LFA A;  5CPR B;  3VFZ A;  2Z99 A;  2NAZ A;  2JPC A;  3V7S A;  2GAU A;  5TJJ A;  3JSO A;  5LLQ A;  2QEN A;  2K86 A;  3CJT B;  5IOZ A;  1WI9 A;  1YOV B;  4FQG A;  4UXN A;  1F1Z A;  3ABK H;  2F5E A;  1B72 B;  2RN7 A;  4R1H A;  4ZTJ A;  2OCE A;  2ECC A;  2JA2 A;  4EM2 A;  4I6Z A;  3OYA A;  2G0E A;  2LK2 A;  2TRT A;  4ZTF A;  2EK5 A;  2DK8 A; 
#chains in the Genus database with same CATH homology
 3B6A A;  1ORK A;  5EG0 A;  3S1Q J;  2E19 A;  5GPA A;  1ZTR A;  3BTJ A;  2LKX A;  1TWH J;  2JA7 J;  4XIC A;  3GBG A;  3BTC A;  1AKH A;  1EF4 A;  2R5Y B;  3BQZ A;  3SJM A;  4CYC A;  4A3M J;  3BR6 A;  1JJ6 C;  1SAN A;  1FJL A;  3CDL A;  1MBG A;  4C3I J;  2LY9 A;  2M8G X;  2Y9Z A;  2ZB9 A;  2K9N A;  5K7F A;  3PM1 A;  1OCT C;  3K2A A;  3A01 A;  1HDP A;  3BG3 A;  1JKO C;  3IV5 A;  1ZK8 A;  2NOG A;  4W97 A;  2EZK A;  4A3E J;  1TWC J;  2TCT A;  1O4X A;  2COB A;  2LTP A;  3GTM J;  2FQ4 A;  2CUF A;  1B72 A;  3HOW J;  2DMQ A;  4AUX A;  1ITY A;  2X9D A;  4V2F A;  5IYD J;  5FKM A;  5J3L A;  1NK2 P;  1T33 A;  3Q0W A;  3GTP J;  1BL0 A;  5EDN A;  3JRD A;  5IP9 J;  2EBI A;  5IOY A;  2LP0 A;  3A03 A;  5IPA A;  1JKQ C;  2DJN A;  5M5W J;  4A3D J;  4MO7 A;  4JX6 A;  1MBH A;  4DYQ A;  2K9Q A;  1JGG A;  2NVY J;  2WAQ N;  1GV5 A;  3A01 B;  4IHX A;  1JUP A;  2Y9Y A;  3SFI A;  5GPC A;  4MIM A;  5C44 J;  1RKT A;  2E2I J;  1MBJ A;  2DA3 A;  2ELK A;  2Y2Z A;  3G1M A;  3LOC A;  2HOT A;  1YRN B;  2L7M P;  3JRE A;  4RBO A;  3BR2 A;  2L0K A;  3CMY A;  1FEX A;  1XC5 A;  2LD5 A;  4MLO A;  3Q3S A;  1LE8 B;  1E3O C;  4BXX J;  1ZQ3 P;  1P7I A;  1GDT A;  1IRZ A;  1LFB A;  5EG0 B;  2DMU A;  3BTL A;  3MKL A;  1FIP A;  4BKX A;  4D5F A;  2OPT A;  1U78 A;  5F08 A;  3HM5 A;  1P7J A;  1MSF C;  1X58 A;  3MVP A;  3LSP A;  3ZQL A;  2EZH A;  2YUS A;  1JUM A;  2W48 A;  2YU9 J;  1IDY A;  1HDD C;  2NVQ J;  4C3J J;  2VKE A;  4A69 C;  5FKK A;  4XRS G;  3BR3 A;  4BBS J;  2QF7 A;  4I76 A;  4JX5 A;  3CCY A;  4MFD A;  2CU7 A;  3RZO J;  4C3H J;  4BY1 J;  3JRA A;  3OIO A;  2K9S A;  5J1U A;  4DYR A;  1TWF J;  3H3V K;  3BT9 A;  1IC8 A;  4Y52 J;  3ZQG A;  2IAI A;  4JX4 A;  2JN6 A;  5BNG A;  1JUS A;  2JWT A;  3S17 J;  1OCP A;  3TW7 A;  1I50 J;  2PMZ N;  3OOU A;  1JT0 A;  5J1Y A;  3NAU A;  4M3B A;  1QVU A;  3W6V A;  2HQ5 A;  4X1E A;  2O9L A;  3QPL A;  1MBF A;  5EGO A;  1LE8 A;  2JMW A;  5IP7 J;  3GTO J;  3HOU J;  1WI3 A;  4J19 A;  1IG7 A;  1K61 A;  4G12 A;  4IHV A;  5E3M A;  1PUF B;  2P81 A;  5GP9 A;  4B4C A;  3BR0 A;  2DTZ A;  5F04 A;  5DS9 A;  1IDZ A;  2XPU A;  3JRG A;  2DMN A;  1Y1W J;  3S16 J;  3A02 A;  3UKG A;  2LFB A;  3JRF A;  1F36 A;  2B63 J;  2NS7 A;  3HKZ N;  5DTD A;  2M9H A;  1H89 C;  2GM4 A;  2ECB A;  2EQR A;  3ZQH A;  4AC0 A;  4ABZ A;  4UUS A;  5M5X J;  2L7F P;  3QPS A;  2XRL A;  1OJL A;  5F1J A;  1A5J A;  2Y31 A;  3BG9 A;  4A3I J;  2DA4 A;  4IEJ A;  3IH2 A;  1W0T A;  1HCR A;  3OSG A;  3M3Y J;  4QTR A;  4X6A J;  3JR9 A;  4HNV A;  5M3M J;  1ETW A;  1XS9 A;  2LLK A;  2AO9 A;  5C3E J;  5K7Z A;  1HLV A;  1QVT A;  2FD5 A;  3LNQ A;  4DZP A;  1NK3 P;  2N8G A;  1MNM C;  2MW8 A;  1U8B A;  3HOV J;  9ANT A;  1IUF A;  2KT0 A;  2X6O A;  5FJ8 J;  2H8R A;  1MH3 A;  3ZQF A;  5FKL A;  2Y0S N;  4LOC A;  2Y30 A;  4FE7 A;  2LR8 A;  2DA7 A;  4M3G A;  2E2H J;  5M5Y J;  3NAR A;  3RKQ A;  4A93 J;  1W0U A;  2DMP A;  2DA2 A;  1DU0 A;  1VF9 A;  2ID3 A;  2HXO A;  4A3C J;  4D5C A;  3O8G A;  2D5V A;  1HOM A;  2JA5 J;  3JRH A;  5E3L A;  1I3Q J;  3TED A;  4A3F J;  2VKV A;  3HEF A;  2MG4 A;  5EGO B;  1Z77 A;  2XGD A;  3S2H J;  1UMQ A;  1IGN A;  3Q0V A;  2CJJ A;  1JJ8 C;  2DA5 A;  1RR7 A;  3LSG A;  1BA5 A;  3JRC A;  3PO2 J;  1WGX A;  3FK6 A;  3I4M J;  3HGG A;  1BW6 A;  5FLM J;  4BY7 J;  3PO3 J;  1U9O A;  3GTK J;  2WV1 A;  2M2E A;  5F0C A;  3G1L A;  1JT6 A;  2R7Z J;  2MGQ A;  3IH3 A;  1RES A;  1RET A;  1BJZ A;  1Z0X A;  2X48 A;  2ID6 A;  2DMT A;  1RKW A;  3BR5 A;  3BQY A;  3WHC A;  5FKO A;  2L9R A;  1ETK A;  4A3K J;  1U9N A;  1WCM J;  3FKI J;  3HGY A;  2GBY A;  3MN2 A;  3WHB A;  1JTX A;  3BG5 A;  4M6V A;  2EZI A;  5F27 A;  2R5Z B;  1H8A C;  2NVT J;  5JLX A;  1MBE A;  2QCO A;  5EZG A;  2NS8 A;  3TP0 A;  3LSR A;  1UHS A;  2HDD A;  1R9T J;  1ETY A;  4A3B J;  2XGE A;  1ETX A;  5FLV A;  3HBL A;  4FTH A;  3RZD J;  4JYK A;  1CQT A;  4MFE A;  4FE4 A;  3S1N J;  3C2B A;  2XGC A;  1GVD A;  2CQQ A;  2IBD A;  2XPV A;  2LVS A;  1VND A;  4DYC A;  2HOS A;  4XID A;  1JKR C;  1F43 A;  1POG A;  2R93 J;  2O7O A;  4QSH A;  3Q0U A;  3HOZ J;  2JK3 A;  2E2J J;  4UUS B;  2MSY A;  5EEA A;  2GLO A;  1LFU P;  1B8I A;  1ZR2 A;  4A3G J;  1GUU A;  5F0H A;  5K7H A;  2E1O A;  1TWA J;  3G1O A;  1QRY A;  3OSF A;  3LSJ A;  3M4O J;  3IH4 A;  3SDG A;  5IP6 A;  2IEK A;  2FX0 A;  4EEF G;  3BTI A;  3F0C A;  4AYB N;  4BBR J;  1UG2 A;  4Y7N J;  1MH4 A;  3ZOB A;  2NVX J;  4NDL A;  2EZL A;  1RPW A;  2HI3 A;  2ME0 A;  4W1U A;  3DCF A;  3GTG J;  1ZR4 A;  3L1P A;  3FIS A;  2L7Z A;  2VUM J;  2KDZ A;  3S1R J;  2VI6 A;  1XG1 A;  5C4J J;  3JRI A;  1MBK A;  1ZKG A;  5IYB J;  1GT0 C;  1FIA A;  2CRG A;  3HB9 A;  4C2M J;  1YRN A;  3TW6 A;  4A3J J;  2XB0 X;  1PUF A;  3HDD A;  2JA6 J;  5J1R A;  4DW6 A;  1ETO A;  1BW5 A;  1MSE C;  4RDU A;  4XK4 A;  2I10 A;  3GTQ J;  1AU7 A;  4UUT A;  1IV6 A;  2O8K A;  2DA6 A;  3E7L A;  1TWG J;  3S14 J;  2XB5 A;  1WPK A;  2R0Q C;  1VI0 A;  1WH7 A;  3S1M J;  2OF7 A;  1X2N A;  2HOA A;  1FTZ A;  4CYC B;  2R5Z A;  3GTL J;  1JTY A;  4DZJ A;  5C4X J;  1HF0 A;  1X2M A;  2ME6 A;  1GV2 A;  1NTC A;  5EZH A;  1WH5 A;  2CQX A;  3GTJ J;  1ENH A;  1OFC X;  5HOD A;  3K7A J;  3JRB A;  3DEW A;  5E3O A;  2R5Y A;  1JKP C;  4GFB A;  3BR1 A;  2K40 A;  3VPR A;  1SFO J;  4JP0 A;  1ZGW A;  1QPI A;  3QQA A;  3D1N I;  4M3E A;  3HOX J;  4IHY A;  2VPR A;  1A6I A;  1T56 A;  2RAE A;  2M0C A;  4S0H B;  2XSD C;  5JLW A;  3FIW A;  4IHW A;  3B6C A;  1VFC A;  1FTT A;  2FJ1 A;  2HYJ A;  2M34 A;  2DN0 A;  5IYC J;  2DA1 A;  3H0G J;  1Y1V J;  1S7E A;  3S2D J;  4FIS A;  2CUE A;  4B1R A;  3ZQC A;  2HXI A;  2EH3 A;  5EF6 A;  2WB1 N;  1AHD P;  2YS9 A;  4XRM A;  5M3F J;  3HOY J;  3S15 J;  5F0F A;  4D7N A;  2H1K A;  1B8I B;  1G2H A;  2R92 J;  1ETV A;  1APL C;  5E3N A;  2AHQ A;  4A3L J;  1AKH B;  1K83 J;  4M3F A;  1Q1V A;  4V2G A;  3ZQI A;  1D5Y A;  5EYR A;  4FCY A;  4XRS A;  3CQZ J;  4L5E A;  1IJW C;  4B3A A;  3FK7 A;  5IOZ A;  2JA8 J;  1TC3 C;  2XPW A;  4QIW N;  3TP3 A;  1H88 C;  3I4N J;  1B72 B;  1DU6 A;  4D7M A;  5FKN A;  2JJ7 A;  1I6H J;  2ECC A;  3O8H A;  3RQI A;  4I6Z A;  2G0E A;  2LK2 A;  2TRT A;  4M3D A;  1ETQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...