4BBRJ

Structure of rna polymerase ii-tfiib complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 17
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4bbrJ00
3HOWJ 1B72B 2CJJA 4BBRJ 5GPAA 2DMPA 4G12A 2XRLA 3OOUA 4A3DJ 3BQZA 9ANTA 3GTMJ 1AKHB 1ZR2A 3GTOJ 1ETQA 5E3OA 2O7OA 4A3JJ 1MBKA 5F0FA 1JT0A 4A3KJ 3QPSA 2LTPA 3Q0WA 5EG0A 3RQIA 4A93J 3C2BA 3JR9A 4UUSA 3BG3A 2LLKA 3HOYJ 1QPIA 3HGYA 1H89C 1GV2A 4M3FA 1IDYA 5FKLA 3OIOA 1PUFA 1GVDA 3W6VA 1IRZA 1BW6A 2E19A 3LNQA 3S1NJ 4I6ZA 4BXXJ 4A3EJ 5EG0B 3JRCA 1MNMC 1MH3A 1QVTA 1TWFJ 5FKNA 5FJ8J 3O8HA 4ABZA 1JUPA 2LY9A 2LFBA 2H1KA 4C3HJ 5J1YA 3TW7A 3S1QJ 2P81A 5EDNA 1JJ8C 3HGGA 4RDUA 2LP0A 3BTCA 3A02A 1IC8A 1MBFA 3BQYA 5C44J 3DEWA 2FJ1A 1FEXA 2YU9J 2D5VA 3GTQJ 1HOMA 2L9RA 4MFDA 1JUMA 4MFEA 4DW6A 1BW5A 3CCYA 1AHDP 1IJWC 2JJ7A 1WCMJ 2E2HJ 2FQ4A 2H8RA 2O9LA 2R93J 1WH5A 5FLVA 2R5YB 2X6OA 3CMYA 5IOYA 2M0CA 5F1JA 2MG4A 2GM4A 4V2FA 3BR3A 2CQXA 2L7ZA 5IYCJ 2AHQA 5FKMA 5IP9J 2DA7A 3RZDJ 2JA8J 2TCTA 3B6CA 1T33A 2HDDA 4S0HB 1X58A 3BR1A 3CDLA 4IEJA 1ORKA 1U78A 1DU6A 1WI3A 4X6AJ 2X9DA 3GTKJ 4A3FJ 3HOUJ 1MSFC 3D1NI 5K7FA 2EZLA 3BTJA 3TEDA 1U9OA 2RAEA 1ITYA 2CRGA 1SFOJ 2OF7A 3BR0A 3BTIA 4C3JJ 5IYBJ 4IHXA 1JKQC 2DA4A 1GV5A 3QQAA 2JA5J 2DMUA 1Y1VJ 4BY1J 1RR7A 1YRNA 3TW6A 1EF4A 4DYCA 2NS7A 1JT6A 4FISA 3ZQLA 3SDGA 2FX0A 3HDDA 4Y7NJ 3A03A 3GTGJ 3H0GJ 1JGGA 3SJMA 5F0HA 5EF6A 4IHVA 2X48A 2YS9A 1GT0C 1MBHA 2WAQN 5IYDJ 3TP0A 5E3NA 1JJ6C 4Y52J 3MN2A 2I10A 2LK2A 3MKLA 1A5JA 2R7ZJ 1ETVA 1UMQA 1R9TJ 4DYQA 5K7HA 2VPRA 4CYCB 2NS8A 1P7IA 1W0UA 1OCTC 5EGOA 4A3IJ 2R5ZA 2PMZN 4MIMA 4LOCA 2WB1N 2GBYA 3RZOJ 4D5CA 3Q0UA 2DMQA 1HDDC 2E2IJ 4B4CA 3O8GA 1Y1WJ 3SFIA 1MSEC 2HQ5A 4C2MJ 1WPKA 5HODA 5EGOB 4UUSB 3JREA 3K7AJ 5GPCA 1NK2P 1B8IA 2B63J 2R5ZB 3NAUA 1AU7A 2ECCA 2XB0X 2GLOA 4W1UA 1HF0A 2Y9YA 4JX5A 3HOVJ 3FK7A 5M3FJ 1PUFB 1LFUP 3L1PA 1JTXA 1HLVA 1ZKGA 4M3EA 2ID3A 3CQZJ 1T56A 1E3OC 5FLMJ 4GFBA 4A3LJ 3WHBA 5F08A 1IUFA 1IGNA 3I4NJ 5M5XJ 1XG1A 2E2JJ 1FIPA 4J19A 1B8IB 5EZGA 3WHCA 5F27A 4XRSG 1K61A 3G1OA 1GDTA 5IP6A 1JTYA 3BR5A 2JWTA 2R92J 5C4JJ 2EZHA 1TWGJ 4FE7A 1JKPC 3LSGA 2XPUA 4M3BA 1MBGA 4DZJA 1JKOC 2HOTA 5J1UA 1TC3C 1U8BA 1IDZA 2L0KA 1RESA 3S1RJ 3VPRA 2VKVA 1MBEA 2XPWA 1JUSA 3PM1A 4BKXA 4I76A 2M9HA 3HB9A 3S14J 1MH4A 5E3MA 3IH4A 2K9SA 2K9NA 4AYBN 1FTZA 5C3EJ 2XGDA 3H3VK 2DMNA 2HOAA 2LD5A 1OFCX 1Z0XA 1QRYA 1LFBA 2VUMJ 2EZKA 3F0CA 4L5EA 3HOXJ 4BY7J 3B6AA 2COBA 4A69C 1I3QJ 3GBGA 1POGA 3JRGA 2DTZA 4HNVA 1ZR4A 3FISA 2MSYA 3BG5A 1ETXA 1XC5A 2WV1A 2EZIA 5C4XJ 3A01A 3OSGA 4FE4A 1OCPA 1CQTA 2QF7A 3PO2J 2CQQA 1Z77A 1ETKA 3IV5A 5M3MJ 2M2EA 3BT9A 5EZHA 5JLWA 3S17J 4A3MJ 2HXOA 5JLXA 1ZTRA 2Y2ZA 1H88C 1WH7A 1BJZA 3HOZJ 4D7MA 3HM5A 1ZQ3P 4A3CJ 2LR8A 1LE8A 2DA1A 2FD5A 1RKWA 1I50J 1K83J 1DU0A 3MVPA 1ZGWA 4AUXA 1BA5A 2W48A 4FCYA 4XK4A 2L7MP 4EEFG 4NDLA 3GTJJ 5F0CA 1B72A 1A6IA 2VI6A 2R0QC 3RKQA 4A3BJ 2YUSA 4JP0A 5F04A 1YRNB 4M3DA 1AKHA 2AO9A 2K9QA 3S2DJ 3IH2A 2MGQA 2Y31A 4W97A 1ETYA 3JRHA 3OSFA 3BR6A 4DYRA 3LSRA 3Q0VA 4RBOA 3HEFA 2G0EA 2ECBA 2L7FP 2CU7A 2LVSA 5DTDA 4MLOA 2DMTA 1D5YA 1VI0A 4JX6A 1HDPA 1OJLA 3ZOBA 1APLC 2JN6A 3LOCA 1FJLA 2MW8A 1ENHA 1RPWA 2JMWA 3BR2A 3NARA 2ME6A 5K7ZA 4XRMA 3M3YJ 2Y30A 3E7LA 1ETWA 3I4MJ 4M6VA 5IP7J 5M5WJ 3UKGA 1F43A 1GUUA 2E1OA 4D5FA 3M4OJ 1IV6A 2XGCA 2KT0A 3QPLA 2CUEA 1ETOA 3ZQCA 1HCRA 2NVTJ 3GTLJ 3ZQGA 3S2HJ 4XICA 1VFCA 2M8GX 3S16J 1FTTA 3ZQIA 1P7JA 3K2AA 1VNDA 4B1RA 2O8KA 3JRIA 2M34A 4JYKA 4IHWA 2VKEA 2HXIA 2EBIA 3S15J 1S7EA 4C3IJ 3GTPJ 2DN0A 4QTRA 2HOSA 2IEKA 4XIDA 3JRAA 4B3AA 2R5YA 1WGXA 3PO3J 2DJNA 3BTLA 2JA7J 5M5YJ 1U9NA 3FIWA 3LSPA 1Q1VA 1H8AC 2XB5A 4X1EA 1ZK8A 2IAIA 2EQRA 5J1RA 3IH3A 1FIAA 2Y0SN 2OPTA 5DS9A 4D7NA 5IOZA 1O4XA 3BG9A 1JKRC 1TWAJ 4FTHA 5E3LA 2EH3A 3Q3SA 1UG2A 3G1MA 1XS9A 2K40A 4IHYA 3JRDA 5J3LA 1BL0A 1RKTA 2JK3A 2ME0A 2XGEA 1I6HJ 5EYRA 4JX4A 1X2NA 4V2GA 4QIWN 2ELKA 4QSHA 2Y9ZA 5EEAA 4XRSA 2LKXA 1F36A 2HI3A 5FKKA 2ZB9A 2XPVA 2QCOA 1TWHJ 3FKIJ 4M3GA 4A3GJ 4MO7A 4DZPA 2ID6A 1TWCJ 2DA6A 3JRBA 1W0TA 3JRFA 2IBDA 3A01B 1IG7A 2NVXJ 4UUTA 2N8GA 1RETA 3ZQHA 3ZQFA 2HYJA 2NVQJ 2NVYJ 1VF9A 2DA3A 1G2HA 2NOGA 1MBJA 3HKZN 1QVUA 2XSDC 2DA5A 2DA2A 4AC0A 5FKOA 2KDZA 2JA6J 5IPAA 1X2MA 3G1LA 3S1MJ 3TP3A 2CUFA 3FK6A 1SANA 5GP9A 5BNGA 1NK3P 4BBSJ 2TRTA 1LE8B 1UHSA 3DCFA 3HBLA 3LSJA 4CYCA 1NTCA
chains in the Genus database with same CATH superfamily
5BQTA 4LGWA 3KZYA 3FMSA 2VKHA 4B3XA 2DT5A 1KQ8A 4N9HA 5H6QA 3BQZA 3TOAA 3GTOJ 1V55H 2A68F 1G59A 2O7OA 1WJAA 3GWZA 5F0FA 1T39A 2V1DA 3GZNB 2W7NA 3N4MA 3QPSA 1TT5B 3Q0WA 5EG0A 4UB8C 2LBFB 4A93J 5HS8A 4UUSA 1BOAA 2QBYB 3ABUA 1TNTA 3ML6A 4LLLA 3GX4X 2PJRB 3HGYA 2HKOA 2R7FA 1HSJA 3CJTB 3R60A 1PP7U 1IDYA 3OIOA 2EV6A 3RYRA 3MKZA 1BW6A 2VASA 4UVAA 4KT6A 4Y3OA 1A35A 5ILUA 1ZELA 4KITB 2ISYA 4UV9A 4BGDA 3S3OA 1JGSA 4BXXJ 2CW0F 3OYNA 1BOBA 1RI7A 3FXQA 3CF5F 1ZYRF 5FLXK 1MH3A 1QVTA 1IN6A 1TWFJ 3KP4A 4I99C 1F1ZA 4E7IA 1DP7P 5FJ8J 3O8HA 3TDUC 1FYKA 3N05A 1XGSA 4HV6A 3HG9A 3S1QJ 5EDNA 2NXNB 4GYIA 2FU4A 4XLCA 2O0YA 1G3TA 3BTCA 4II2A 4RM2A 4NB5A 1UZCA 3OS2A 3DEWA 3CUQC 3HOSA 4RGRA 3IP4B 3OYEA 3E5UA 3GTQJ 4DW6A 1V5FA 4BQNA 1KONA 3HSFA 3M7GA 1FMWA 1AHDP 5ICCA 3F22A 2R93J 5FLVA 2JUCA 3NQOA 2X6OA 1V5GA 4F3QA 3GF2A 1QO0D 2M0CA 3WTSC 2KRFA 1XSDA 4LK0F 3KIOA 2KPMA 4EATA 4F52A 3MZYA 4JOMA 5JI6A 2PFBA 2L7ZA 3ZN1A 1LEAA 3LAPA 1Z05A 2DA7A 1ZRCA 2CV1A 4I01A 1VQ6I 2R7TA 5E8GA 2R7UA 2XHKA 4EMSA 1D1CA 4S0HB 1X58A 3BCAA 5HLTA 2IJLA 3BR1A 4P9FA 1WJ5A 4IL6C 1EH8A 4FX0A 1U78A 5FFZA 1XSVA 2DT7B 3GTKJ 1DGRM 1F5TA 4MTDA 4OMYA 4A3FJ 3HOUJ 5AIQA 2A69F 4D9JA 5FLXZ 2CQ7A 3TEDA 4KICA 2HS5A 2AS5F 3CC4I 2J5PA 5ICEA 2OF7A 1IZ1A 5F6FA 3TQNA 1GVJA 5CVRA 4GCVA 3IL2A 1V3FA 5HOOA 2BVLA 4QWQA 3OY9A 5DM6F 5DCMB 3UR3C 1GV5A 2ZXIA 1WZ2A 1Y1VJ 5ILSA 4CGZA 3IRRA 1YRNA 3BZKA 3K10A 1EF4A 4DYCA 3OIPA 5HDGA 3K6GA 1K7AA 2IT0A 3S32A 3GTGJ 5D6EA 3EYIA 4E6KG 3SJMA 4IHVA 2FBKA 2ZMEA 1GT0C 2H94A 4IQJA 3K1NA 1JJ6C 4HG2A 1P4WA 1VQOI 2R7ZJ 1ETVA 3DP7A 4I02A 4DYQA 2DBBA 1O57A 2NS8A 4ASNA 1W0UA 1OCTC 3H9JA 4IHSA 3A0BC 3PNTA 4M74A 1X3WB 2CFOA 1VQ4I 3DF8A 4D5CA 3Q0UA 2VLAA 3DPLC 2IGNA 4XL9A 5LHGA 2B9SA 3TO7A 4B4CA 4BAYA 3I5UA 3O8GA 2E2IJ 1CF7B 4HF2A 1Y1WJ 3DV8A 5KHDA 3BPVA 2QA4I 3VODA 4EJWA 2HQ5A 1BJAA 1WPKA 5HODA 2OV7A 2XAGA 3CD6I 1R5GA 2W84A 2J5OA 4BACA 1NK2P 2RN7A 3WTXC 4YRVA 4JX5A 1Z7LA 4P1WA 5M3FJ 5L3BA 4M9ZA 1JTXA 1XN7A 4PDKA 1HLVA 2IW5A 2ID3A 1DPUA 4KT5C 2V9VA 2GOMA 1BIBA 4NUBA 3GLLA 1BC7C 1K6YA 3OL4A 3V7CA 3WHBA 1P4XA 4PGGA 4ZC3A 3E6MA 2X1EA 2PMZA 4J19A 5EZGA 1K61A 4XRSG 2CUZA 4G6QA 4U0WA 4EGYA 1JTYA 1X1PA 3BR5A 2JWTA 2R92J 3HRMA 2QWWA 1TWGJ 3E6DA 1FP1D 2XAQA 1YX3A 2HOTA 1S6LA 1W7PB 3FX3A 1RESA 4OINF 1OYIA 3I55I 3S1RJ 2M87A 1JUSA 4BKXA 2M9HA 3HB9A 4U87A 1IXCA 2F5CA 4RAYA 1SMTA 3BC8A 1FYMA 1OFCX 3QRFF 1MZBA 3U9GA 4XMYA 3RJPA 3L2CA 2VQGA 3VYRB 1GLNA 1BC8C 2VUMJ 2EZKA 4L5EA 4BY7J 1I3QJ 1PVEA 3VOEA 1KU7A 3F8MA 1FBSA 3REOA 1ULYA 3JRGA 3MKWB 2R7DA 3FXJA 2NOJB 3BG5A 2WV1A 4NC6A 2EZIA 4M9SA 3HTSB 2LY2A 2ZJRF 1KU2A 4P9UA 4FE4A 2P7CB 1CQTA 2EWNA 2CV0A 4DOZA 4HSRA 3O2PE 1R5HA 4E7HA 1ETKA 1ZRFA 1ZGAA 1N75A 4QPQA 4B44A 3SDBA 1FOXA 1D1AA 1B1BA 1HW5A 2W25A 3DQVC 3KZZA 3VYUB 3J7YJ 3S17J 2F5DA 2V9KA 2K7LA 4A3MJ 3D5SC 1W36C 1X4PA 5EJCA 3TMOA 3QU6A 3HOZJ 4AYBA 4F7ZA 1ZQ3P 4IJAA 2LR8A 3ECHA 2YSRA 2CFXA 1LE8A 1RKWA 4LJZF 4CDGA 1I50J 4NC7A 3ESWB 1ZGWA 1D3YA 4FCYA 3ZGKA 3Q9VA 3PUFA 1BN5A 1U5TB 1A6QA 2F4IA 2BBYA 5F0CA 2XIGA 1VQ9I 1A6IA 2COMA 2TDXA 3IC7A 3CCQI 4QLCU 4M3DA 3HRSA 2F6CA 2IGMA 4Y15A 4XLNF 3S2DJ 4UB6C 2QUFA 2MGQA 2XASA 2F5FA 2Y31A 1OLTA 5HDKA 4L9JA 1OYWA 3JRHA 2CQKA 2ETHA 2JTVA 1IN5A 2LBFA 2ECBA 2LVSA 3PFIA 2QBYA 2OCEA 3G2BA 5LLQA 3I53A 1FSEA 1ZN2A 2LMDA 5D4SA 2PJRA 4WX9A 3PSFA 3ZOBA 3ZMDA 4BJTA 2EIMH 2MW8A 4HA8A 2NVUB 5LBQA 5K7ZA 5K1YA 2JQ7A 1WRJA 2DPUA 2UXNA 2D45A 4M9XA 1GUUA 1W7PD 2M3AA 3QPLA 3MFKA 1I6XA 1O3SA 2XF6A 5E1ZB 2IA0A 2CGPA 2NVTJ 3KX2A 4XICA 1VFCA 3TGNA 2GXBA 3S16J 1WJDA 3ZQIA 1Y6IA 1YW8A 2RGVA 4ZZLA 4EJVA 1FP2A 2QLZA 2O8XA 3MZ8A 4RAZA 3QOEA 3F72A 3U2RA 4HNUA 3WTTC 3CO7C 2QSHX 2VKEA 2HXIA 3S15J 1S7EA 3CLQA 3DBRB 4C3IJ 4MHGA 2HOSA 4M72A 4BEHB 4UVBA 3CCRI 4N9IA 5FD6A 1IXSB 2HTJA 3PO3J 5JVTA 4E7KA 4XLFA 3FIWA 1FX7A 2R7QA 3A4CA 5BS6A 1WJEA 1Q1VA 3CUOA 4E7JA 1Z1DA 2OA4A 2LDUA 3GFJA 2IAIA 4HSTA 2X51A 4Z6YA 1S9HA 5J1RA 5EEGA 1EA3A 3LFKA 1KQ9A 4RAGA 5TISC 4A2UA 1EJ9A 5L3FA 2Y0SN 1TLHB 2VB6A 3CCVI 1O4XA 2LF7A 4PSWA 2KP6A 3M9AA 5E18F 4FTHA 1QGPA 3PNVA 3Q3SA 1WQ2A 3JTGA 1FOYA 3JRDA 4Y17A 3ZMTA 2OD5A 1RKTA 2JK3A 2MD5A 2R7RA 4PJJA 1FLIA 4HX7A 1TBXA 4JX4A 4MEXF 2RQPA 3CDHA 2BHZA 1ACIA 3R0JA 3V7SA 4CXFA 1WJFA 2NNNA 2XPVA 2QCOA 3ZXSA 1TWHJ 1P9QC 5DCMA 3BJ6A 2Y69H 3K9TA 3C2GA 4MO7A 4DZPA 2JT1A 1GHCA 2DFHA 1W0TA 4II3A 4BJ6C 2JVHA 3DEUA 1IG7A 3A01B 2OC6A 5ERIA 4P55A 2BY3A 3QP6A 1BBYA 1MMNA 1R6RA 3OYKA 5L3GA 1KU9A 1XMAA 1RETA 3ZQFA 3SEZA 2NVYJ 4FQGA 4G94A 1VF9A 2NOGA 3A2KA 1SAUA 3IKVA 4AC0A 2KDZA 5IPAA 4ZH4F 1X2MA 2HZTA 5L3CA 4G9YA 3G1LA 4YIFA 3TP3A 5KVRA 2X6XA 3M8EA 3OYAA 5J40A 1SANA 1M1EB 2VBYA 1JHFA 5CPRB 3PUBA 3GUDA 1UHSA 4XKCA 2XVCA 1DQUA 1E2XA 2IA2A 1JI8A 4I09A 1O3QA 1XSXA 1QU3A 2CJJA 1XX5A 1UFMA 3AL0C 3N97A 2XRLA 1X1BA 1RIOH 9ANTA 5FRMA 1A36A 1G3SA 4PZJA 2DU9A 5E3OA 1YX5A 4ZYDA 3I59A 1T08B 4KN4X 2PLYA 3OR1C 1CF7A 4A3KJ 2EA4A 3BG7A 2LTPA 3RQIA 5LGUA 2DQRA 2VT3A 1LEBA 1KQ0A 3V42A 4B48A 3HKZA 2V4JC 2DLLA 3JR9A 3G4SI 3QPHA 4HW0A 3EQLF 3E3VA 2LLKA 3HOYJ 1QPIA 1OKRA 1X3UA 3A1YA 2E5ZA 3LSKA 1P92A 3KP2A 2GAUA 3CCMI 4M3FA 2D1HA 3O3KA 5F64A 2OQRA 1T6SA 2W1OA 3W6VA 1WJCA 4MTEA 2M5WA 2DOEA 4BL0B 2AQFA 2JVGA 1XMKA 3LMMA 3S1NJ 2M0MA 5CVVA 2P8TA 3IAS2 1MNMC 1L3LA 4L9TA 4CO8A 4NHJA 1N78A 2CH0A 2PBIA 1G3WA 2EA2A 1D8JA 2LY9A 2BXYA 5J1YA 4AM3A 2E34A 2KIUA 3HPGA 2EV0A 2KFDA 3CCUI 1NH3A 3EUHA 4BHPA 3KP5A 2Z33A 1ZLJA 2LP0A 2W57A 1WI9A 1MBFA 5A2QK 3PL8A 3OYGA 2XRNA 2YU9J 5JHFA 1BI3A 2QZ8A 2ISZA 4LIUA 5E8IA 4ZDPA 5DEQA 2KJBA 2E2HJ 1IJWC 2JJ7A 1WCMJ 4A12A 2FQ4A 3KCCA 3CUQB 2V6EA 4G7OF 3J7AY 3DTIA 3MWMA 2VQLA 2E7XA 1YJWI 2JZYA 1KGSA 5IOYA 5FO5A 5F1JA 2V79A 4LG0B 2BY1A 2MG4A 2Q2EB 3MAJA 4KIFA 5LGNA 3F8FA 4OAYA 3J81K 1CGPA 4A6DA 3EUAA 2VQCA 3WTZA 3NRVA 5FKMA 5IP9J 3RZDJ 2JA8J 1XD7A 2TCTA 5JHUA 2H1LA 2XC7A 1HKTA 3OYHA 2ZXHA 2ZBKA 1T33A 2O61A 3CMMA 4HF0A 2LG4A 1LDDA 3LA7A 3LWFA 4M6YA 4CZCA 3CMEI 4A0XA 1IXRC 2G9WA 2WV0A 5IT9K 3BJOA 2DQLA 1T8IA 1S7AA 2UXXA 2FUG2 4CYDA 4UHTA 1TQMA 4E7LA 3F8NA 1HQCA 1DPRA 5BPDA 1PYVA 2M30A 1MSFC 2L4MA 3D1NI 4IRGA 5LHIA 1QA6A 4LB5A 2BXZA 3AG3H 1YI2I 3BTJA 3MKYB 2RAEA 5LEJA 2QKMB 1X1DA 2FOWA 4RB2C 5LFAA 4KA4A 1B9MA 3BTIA 2BGCA 3T5XA 4C3JJ 2IGKA 4XORA 5IYBJ 1B59A 2P6TA 2V7FA 2RDPA 2DA4A 2UUZA 5A2QZ 3SQNA 2VXZA 3AAFA 1J75A 1HBXG 3TDZC 5DV5A 3BP8A 2KISA 1JT6A 3ZQLA 3SDGA 2FX0A 5FROA 1TQPA 3TO9A 1QZZA 3CJNA 3FBIB 3W2AA 3JTHA 3HRTA 2X1CA 4Y7NJ 5K5RA 2AXLA 4YIRX 4XNFA 3H0GJ 4G6TB 1JGGA 4E7SA 3FHZA 3DKYA 1YIOA 1YG2A 4XOPA 4NQWB 2Q8KA 1MBHA 1RUOA 2QQ9A 3TP0A 3GVAA 2VJIA 2FQ3A 3VYSB 4HZFA 2UWMA 4Y52J 3ULQB 1UELB 2JSCA 2OUMA 2ZMEC 2RQQA 2VPRA 3LA2A 4RLQA 1P7IA 3X2QH 3OV8A 2EFOA 3CJQB 1YW9A 4BNCA 3KETA 2PMZN 2M4GA 5E1WA 1SFXA 5IT9Z 1JE8A 1SD4A 3T8RA 4RB3C 4ZJZA 5DD4A 3DTKA 1DDNA 4G8XA 4EM2A 5FB2A 1HDDC 1XDSA 1NHAA 1J5YA 3SFIA 1MSEC 4ENJA 1TNSA 4KMFA 4C2UA 3JREA 1HXDA 2HPIA 5EGOB 1I5ZA 3K7AJ 3B02A 1YFHA 4GRIA 2R5ZB 3S2WA 2ECCA 3OYJA 4W1UA 3CLOA 3ZP5A 1PP8F 4HDVA 4LB6B 1FT9A 2FNPA 1PUFB 3ZMVA 1VTNC 1UB9A 1R5ID 1ZKGA 4M3EA 1IW7F 3I58A 2XF5A 3D5RC 3RKXA 2PN6A 2IA1A 1E3OC 3RPUD 2RVCA 5J4YA 3F3XA 5F08A 2HDWA 5M5XJ 1BI2A 2MC4A 3SEQA 1FIPA 1B8IB 3WHCA 5F27A 1TW3A 4XLPF 2R4GA 3FBNB 3G1OA 1GDTA 2K9LA 2P0WA 1S29A 1WJBA 3CMAI 1R1UA 4EM1A 2MLKA 3EPZA 1Z7UA 2KRHA 1EH7A 1TC3C 2MH9A 3VPRA 1KYZA 2NRAC 2RC4A 1X1CA 3R0AA 1LUJB 3H9GA 1SFEA 3HPHA 4P5OA 2ZJ2A 1YIJI 1EV7A 3DEEA 2K9SA 4AYBN 5C3EJ 4XKVA 2XGDA 3H3VK 2Z5UA 3FXUA 5TRDA 1R00A 3I9V2 1Z0XA 3K4CA 1LFBA 2EILH 4BYYA 3H9QA 3F0CA 1E0EA 2V6CA 2COBA 4WXDA 1MJAA 4EVIA 3L2WA 5HVQC 1QQIA 1XGMA 1HC8A 3WGGA 2MSYA 1BI1A 1KZHA 4HAMA 1MKMA 3QWLA 2K3FA 3A01A 3FWEA 3T0YA 2CQQA 2OZUA 2GXGA 2KKOA 2IS2A 2M2EA 3K70C 5EZHA 3K1PA 2QQBA 3AG2H 1NG7A 5JR3A 2VC1A 2E5NA 2Q1ZB 1XGOA 2Y2ZA 1H88C 1WH7A 3E0JB 3OYDA 2EFNA 1B4AA 1QHHD 3HM5A 2K5CA 3KLNA 3WU2C 2HEOA 3DBLB 4FT8A 2WADA 1DP3A 2ELJA 2RNJA 3CF2A 2FD5A 2EFWA 1LQ1A 1WHUA 1WWXA 3QOPA 4BQQA 1K83J 1L0OC 4BUPA 3CCLI 2P5LC 4EQQA 1XDUA 3EETA 2HFHA 4HPQA 4XK4A 1Z3YA 4EEFG 4NDLA 3GTJJ 3BOQA 3ABLH 4KIGA 2KIFA 1LJ9A 2ESHA 1OPCA 4JP0A 4OAZA 4CCJA 3E6CC 1E3PA 3E5QA 1UCRA 2AO9A 4IXAA 2K9QA 4AD9A 1BM9A 2DFFA 3ZR8X 2P5KA 4N4NB 1K78B 3BR6A 3TBIA 3PQKA 4RBOA 2L7FP 4BH9A 2CU7A 1YLFA 3S3NA 4CHUA 2HNHA 2DMTA 4MLOA 3M1CA 3K4LA 1N77A 1VI0A 5E20A 3LOCA 1FJLA 5L3DA 1USTA 3BROA 2BW3B 3VYTB 1IV8A 4HNTA 2KHMA 4HBLA 4UVCA 4IOAF 2VE8A 1FY7A 2ZXWH 2F5EA 3UKGA 3FF5A 4OMZA 1F43A 1H0MA 1WFXA 2K4BA 1R1VA 5DCFA 5AONA 4D5FA 1AA7A 2DFEA 3COAC 1Z9CA 4BE1A 2KT0A 2VN2A 4ENNA 4LLGF 3HZJA 3KP6A 1IRFA 4AWXB 1Y8QB 3GTLJ 3S2HJ 2LOOA 4FASD 4JK1X 3V8JA 4BS9A 2M8GX 2V26A 3PQJA 2EPFA 3G73A 1LFPA 2F48A 1YYVA 5H20A 3W6JB 3QYFA 4B1RA 1HW1A 2L9SA 1SEUA 4CCKA 2QM3A 3I3LA 3I64A 2M34A 2DO7A 1FPQA 2D2WA 4JYKA 3QAHA 4IHWA 4XLEA 3VEPA 3DFGA 4F55A 2YX7A 2JUGA 1OYYA 2GA1A 4L5JA 3CUQA 3OIQA 3JRAA 1YTYA 5D5VB 1TT0A 2W85A 4B3AA 4N4OB 1R71A 1WGXA 3BZ6A 2NAZA 1LPQA 4OIPF 3GYHX 4OU0A 4LG0A 1STZA 5H6RA 4RGXA 4ENMA 3FM3A 1B9NA 1SC7A 1H8AC 2K02A 4X1EA 1ZK8A 4PCQA 3CDIA 2DFIA 2MYSA 5HS9A 2DW4A 4E4HA 3DTEA 1ON2A 4WCGA 4BXFA 1VQKI 1FIAA 3BZCA 3DU6A 4AIDA 1ZAOA 2OPTA 5DS9A 4D7NA 3I4PA 3DWLE 3VDXA 1JKRC 3NEUA 5K5QA 3JSOA 4YFNF 1IRGA 5E3LA 4KN7X 5E79C 1W36D 4X0GA 3BCBA 2GQQA 2K40A 4IHYA 2PG4A 3MZHA 4L0YB 1QNTA 4GDFA 2DK8A 2MABA 1I6HJ 1UHMA 3KEQA 4V2GA 4QIWN 2FSWA 2PX9A 5CVJA 2FMLA 4XKBA 2LKXA 3RKYA 5FKKA 4CCOA 3SXYA 2Y48A 4S05A 4Y13A 1HKQA 3HSEA 4PJ0C 2PMUA 1O7LA 2FBHA 3JRBA 2MFZA 2IBDA 1ON1A 3I56I 2L7KA 3ZRGA 3HRUA 3SZTA 3ZQHA 2HYJA 4RMNA 3SYTA 5KNLA 3HKZN 3U1DA 1QVUA 3WE2A 2DA2A 1BR1A 4XKWA 2EFQA 4BQOA 3MQ0A 1UJ8A 1Y8RB 2VXDA 3CP2A 5GP9A 1NK3P 1ZHFA 1AOYA 1MMSA 3MCZA 2KLOA 1J0RA 3H5NA 3DBHB 3DCFA 3LSJA 3GXOA 5ED4A 2O6GE 4KJZA 1MDMB 2F5VA 2W82A 2NYXA 3T1BA 3HOWJ 3RYPA 4YFKF 3Q5FA 1U3EM 1D1BA 4BBRJ 4ON0A 1I39A 4EM0B 4G12A 3OOUA 1X4OA 5AIPA 3IKTA 1AKHB 1LDJA 1ETQA 1J9IA 3F8BA 1FMVA 4D1QA 4A3JJ 1MBKA 4MQVA 1JT0A 3IWFA 2R7OA 2DXIA 4D0PA 2B7EA 5J8FA 5D5WB 4HQEA 3WU1B 1I1GA 1U0JA 1ZG3A 4PJMA 3ASOH 2WC2A 3WGHA 4ESJA 1H89C 3IHUA 4L5IA 1PUFA 1GVDA 1VQLI 1IRZA 2E19A 1R58A 3FXKA 3LNQA 4HDUA 4I6ZA 1Y56A 2BY0A 1VQNI 4A3EJ 1S72I 3QU3A 5EG0B 5HLIA 5ICFA 2BEOA 5L3EA 3L9FA 3ASNH 2STWA 4C3HJ 3ZMSA 3TW7A 4L18B 2I8DA 3M1EA 2BV6A 2QSFX 2A5YB 1JJ8C 2EB7A 1QPMA 2I5UA 4RDUA 1LB2A 3A02A 2X6WA 1XMXA 5C44J 3BQYA 1MMAA 2QGUA 2IGOA 3L00A 2R7XA 1I27A 2FJ1A 2ZO4A 1WSUA 2KL4A 2HKXA 4DNCA 2D5VA 4E7ZA 1HOMA 4MFDA 1JUMA 3EUHC 4MFEA 3GMEA 2FBIA 1ODDA 5E17F 3IAM2 4MNUA 4EV0A 1WH5A 3HXLA 1UAAA 3B73A 3CMYA 1BIAA 3UNGC 2OCCH 2GM4A 4A0ZA 4V2FA 2CQXA 3RQ4A 2AHQA 3VWBA 2DOFA 3KYLA 3HYIA 3ZQ7A 2PEXA 4GO1A 4CH7A 1JHHA 1BR2A 2HDDA 3DPTA 3MMYB 1FNNA 3LSIA 5HNFA 2EINH 2HQRA 3K69A 2KDOA 2JA2A 3S3MA 4IEJA 1ORKA 3WG9A 3ZMZA 4X6AJ 1ZG5A 4I98B 3I0TA 4PK4A 5FGMA 2A61A 3IRQA 5K7FA 2EZLA 4HYEA 2M45A 2PJPA 4HLYA 1U2WA 1U9OA 2VBWA 4RGSA 2GA2A 3VFZA 1ITYA 4LFUA 2CRGA 1SFOJ 3KP3A 2LSOA 3NWTA 4DQ2A 2MA3A 4DGWB 2VPLA 3KPHA 1JKQC 3E5XA 2VKDA 3QQAA 4AIJA 2DMUA 1RR7A 5CLSA 3TW6A 2UV1A 1OCCH 2NS7A 2BVMA 4FISA 5LRSA 4EGZA 3HDDA 1K78A 2EIKH 2E71A 2V1XA 2CW7A 5F0HA 5JFRA 1WKMA 1YS6A 2KZGA 2Q0OA 1LDKB 2YS9A 2DDAA 1HSTA 4PJLA 3G6EI 5IYDJ 3BG6A 3KLOA 4EJOA 1UHWA 5K5OA 3MKLA 3AG1H 2WY7Q 1R9TJ 5H2FC 3K4MA 5K7HA 2BW3A 1B6AA 3HUGB 2VIXA 3NWSA 1V54H 3Q9SA 4CYCB 1A04A 3ECOA 2PMHA 4AVZA 1H9TA 2DPDA 1QHGA 1GXPA 2JRMA 4MIMA 2WTEA 2RNGA 3JCUC 5EEHA 1R23A 4LOCA 4UY8I 1OMIA 2OAZA 4L9VA 4Q48A 3WG7H 2GBYA 1D5VA 2DK5A 2HGCA 3OYFA 2M4KA 2KRCA 1SD5A 1ZH5A 2NNYA 5BOXA 4C2MJ 1TL8A 2F4OB 2P5VA 4IHTA 2B63J 3TOBA 4Y4RA 1AU7A 2XB0X 2LREA 3WU0A 2ELHA 3K1MA 2FXAA 2K86A 2WAQA 2FRHA 3MD2A 4OIOF 3HOVJ 1Z67A 4ESBA 1Z21A 1IN8A 2ZKZA 1ZGJA 3E6BA 4U88A 1KYWA 4G7ZF 3J7AO 1S8NA 1J59A 3DKWA 2FA5A 1MJ9A 1W7PA 3ELKA 4A3LJ 4CUGA 3L2RA 2CSOA 1IUFA 5HLGA 1IGNA 1LVAA 3QPTA 1TTYA 1XG1A 2E2JJ 2ADUA 3HSRA 3LSHA 2WB1A 2P7VB 1G3YA 4XLHA 2EIJH 2EZHA 4R8HA 1JKPC 3PJRA 3LSGA 2VBXA 2XPUA 3LA3A 4IOCF 2GOXB 2L0KA 3A0HC 2VKVA 1MBEA 2Z2SB 3C1DA 3PM1A 4HV5A 4I76A 3ZCOA 2EFPA 2RREA 4KYWA 4HOBA 2CWEA 4C30A 2G7HA 5E3MA 1KU3A 1T0FA 1FTZA 4KUMA 3VSLA 3K4NA 2DMNA 2HOAA 2MBFA 2HWVA 2L01A 5HLHA 3F21A 2DYSH 5LHHA 2DT6A 5DYMA 3BLYA 5D5UB 2A6EF 2IS1A 3M07A 4XOTA 1OR7A 3B6AA 3EYYA 4H4KC 4IVNA 5TJJA 3GBGA 2HTSA 1POGA 1J09A 3FKJA 3WGIA 3F8CA 4DJAA 2CV2A 2DTZA 2NS0A 4HNVA 1SMYF 1ETXA 1XC5A 1T98A 2QENA 3J80K 3G71I 2YPRA 4H0EA 5C4XJ 2GXAA 2VE9A 2XDVA 2L54A 2OJED 3OSGA 3CESA 1OCPA 5GADJ 3PO2J 1RZ4A 3SHFA 1Z77A 4O5VA 4J00A 4XN3A 3I54A 4BDYA 2VBZA 3SFZA 1U5TA 3CCEI 4A0YA 4LLNA 2HXOA 4N0BA 3V4GA 2V9PA 2STTA 4D7MA 4EJTA 4B09A 1ERDA 4BJ5C 2XF7A 5CVUA 3DLLF 4A3CJ 2LKPA 1ZREA 5BMZA 2QQAA 5J6XA 3L2UA 2JPBA 3P9KA 3JSPA 2LF8A 3MVPA 4YG2F 2E60A 4HLXA 1BA5A 4XRFA 5DM7F 2E1MC 1MDMA 1R22A 1QBJA 4L0ZB 2L7MP 1YE9A 4KNYA 2HR3A 2VI6A 3LFUA 4IRHA 4A3BJ 5F04A 3DU5A 4B47A 2IXSA 4PGHA 3J81Z 1AKHA 5LEKA 4UV8A 2R7SA 1SVLA 3ABKH 4F91B 3C18A 5KK1A 1XCBA 3OSFA 2WWYA 2GIVA 3WTWC 4A5NA 3PFYA 5IY5H 1JXSA 3R61A 1FBUA 2DJIA 1S3JA 3ERMA 2FOKA 5IT3A 1USSA 1D0ZA 1HDPA 1OJLA 3HTUA 4RAFA 3FXOA 1APLC 2L9NA 1SFUA 3FZVA 5J47A 4ETSA 3J80Z 5CVIA 2DOAA 4XLAA 2JMWA 3BR2A 1X3ZB 2MH2A 2Y30A 1ETWA 1MGTA 5M5WJ 2DODA 3LSMA 2QKLB 5B3SH 4YEJA 2VOPA 1R4MB 3SZGA 1QZYA 1I1SA 2E1OA 1T2KA 3GZ5A 2XGCA 4YIIA 4BEHA 4Z2YA 3ZQCA 4R1HA 3WTYC 2KIQA 1MW7A 3ABTA 4CA0A 3H3UA 1RC9A 1P7JA 2G7UA 3K2AA 2KZVA 3VB2A 1VNDA 4FHTA 2W24A 3BJAA 4PJNA 3JRIA 2IS4A 1SFKA 2EBIA 4A6EA 1PDNC 2DN0A 3BY6A 5GTHC 2IEKA 4O3MA 2XKPA 1G4DA 1XCVA 5CQGA 3FMRA 5GTIC 4DIQA 3BTLA 2LKSA 2H8WA 4ZYGA 3R6SA 4LIVA 3ZQQA 4ZTFA 3L09A 2BYVE 5D4RA 2XV4S 2E36A 1XGNA 3L2VA 3IUOA 4RB1A 3D5LA 4EJUA 2FMYA 3OL3A 2H6BA 1V4RA 2XAHA 2M8EA 3O6BB 1N25A 3OYIA 4F92B 2X4HA 2XAUA 3H1CA 3IH3A 2R7VA 1SD6A 1MNEA 4LMYA 1R7JA 3E97A 2PQ8A 3RTRA 5IOZA 3K70D 1U6GA 3BG9A 3ZMUA 4PFPA 3RPQA 1DUXC 4KMUX 1LKXA 1ZLKA 4RGUA 2DYRH 2A05A 2BZTA 3F6VA 3TL4X 1UG2A 2CW8A 1XS9A 1P2FA 2W4SA 5KAIC 2DI3A 4BHCA 3BWGA 1BL0A 3PIOF 2XUBA 5EYRA 3KFWX 3WE3A 1X2NA 2ELKA 1IF1A 3F6OA 4G6DA 2HU9A 4LK1F 2OTLI 2Y9ZA 2VONA 4XRSA 2E7WA 2A5WA 2ZB9A 5FFXA 3P7NA 4A5MA 1Z3XA 3C7JA 3GO5A 3T8TA 3U21A 1T38A 5CQEA 2ID6A 1HKSA 1TWCJ 2DA6A 4MQ9F 3R4KA 2FE3A 2LC2A 2PI0A 2ZCWA 2NVXJ 1J7KA 4UUTA 2M7BA 4C9YA 1TP4A 4KISA 1IRXA 4UNOA 1RRJA 1H9GA 4KIBA 2DA3A 3RCOA 1MBJA 3FXLA 1FYLA 3HC7A 2ZFWA 4CICA 2HYGD 1W1WE 2XSDC 2QSGX 4Q4ZF 3OS0A 1XPXA 4LG3A 3S1MJ 2R7WA 5BPIA 2CUFA 2DTRA 5BNGA 1YITI 4FETA 4PFOA 4BBSJ 3G3ZA 1PUEE 3HHHA 4S04A 3L7WA 4U0VA 5B66C 5KAFC 3HUGA 2ZNZA 4CYCA 1O3TA 4I2OA 4UUVA 1RNLA 1T95A 4GXOA 1B72B 1MIJA 5GPAA 1FC3A 2DMPA 3HIFA 4CCNA 2WAFA 5B1AH 4A3DJ 4I0BA 1VQMI 3GTMJ 1ZR2A 4ZYEA 3OWTA 1YHQI 1LVKA 3OR2C 4GYGA 5HDNA 2V1NA 1XTAA 2E1NA 3FXMA 2LY1A 4V19K 3C2BA 3MEXA 2X6YA 1WVRA 3BG3A 4RS8A 2H09A 3BDDA 2HVSA 1GV2A 1QZEA 5FKLA 2VJ5A 5LD2C 2ESNA 3GFMA 3CCJI 4QPOA 1ZARA 3I59B 5CKTA 3J7ZI 2CQNA 4NBQA 2IRFG 1MD0A 2EK5A 3JRCA 4PSXA 1G8XA 4ZTJA 5FKNA 3GLXA 3LQRA 4ABZA 1JUPA 4M71A 2LFBA 2H1KA 1OCZH 3OYBA 2VJ4A 5J8CA 2P81A 4ZYAA 1TZLA 3EUKL 4OOIA 2FNAA 3HGGA 3CP8A 2FEZA 3LQQA 3F23A 1IC8A 3K4JA 2Q2EA 5D8LB 2A3SA 1OCOH 1FEXA 2K85A 2L9RA 3W2VA 4MGRA 4XM3A 1BW5A 3I71A 3CCYA 2EJRA 3RPUA 4U7DA 3JW4A 4I7HA 4Y33A 4ZZDA 3FHNA 4ANJA 4L9NA 1FBQA 3FDYA 2H8RA 2O9LA 4B43A 1IN4A 2R5YB 3K4BA 2HQNA 1VQ5I 2VOOA 2KJCA 2LH9A 2OZ6A 2WA0A 1K4TA 1A31A 3FMQA 1EH6A 2M1BA 3KEYA 2ACJA 3BR3A 5IYCJ 1C0WA 1MJBA 4FX4A 2V1UA 2HYFA 2R3SA 5D8KB 3B6CA 4BU2A 4XQFA 3HJEA 3W6KB 3W2WA 3GZ6A 2ZFUA 2Z1DA 3CDLA 3LL7A 4ZDLA 3H5RA 3ZPLA 1DU6A 2VC0A 1WI3A 1KA8A 2X9DA 1HA8A 1P4AA 2IS6A 4XN0A 3KP7A 4GGGA 4U0YA 3QYBA 1SVMA 3PNYA 1RR8C 1IUYA 3CO6C 2XGXA 5D6FA 2H6CA 5F1RA 5B5EC 2OU2A 3BR0A 4HEA2 1BR4A 3GEZA 4BE0A 2LYCA 4WWCA 2Y75A 3LAJA 4IHXA 3ONQA 2JA5J 4NQWA 1IN7A 4BY1J 1GXQA 5FD5A 2ZJQF 1MMDA 4HF1A 3GFIA 1OQYA 1YW7A 3H36A 1X19A 3V8KA 2WY8Q 5HNHA 2E1CA 2KIMA 2MC3A 3AKZA 3KZIC 5GAHJ 4IRIA 3A03A 4IKFA 4CCLA 5EF6A 4BE2A 2X48A 3H5AA 2B0LA 4IPAA 1VQ8I 2Z9OA 2WAQN 3AG4H 1R1TA 5E3NA 2AXTC 2I10A 2LK2A 3MN2A 4HQMA 4KFCA 2FF4A 3EDPA 3M8JA 1A5JA 1UMQA 3CTAA 1F4KA 3M8FA 4ESFA 3AL0B 2ZJPF 2L3DA 1REPC 4XSZF 5EGOA 4A3IJ 1Y0NA 4IF4A 2F4MB 4LD5A 3IWZA 2R5ZA 2E35A 1V5EA 5LGTA 1BI0A 2JSPA 5DUKA 1Q1HA 2YR2A 2WB1N 3ERED 1X1AA 2AQEA 4OIRF 3RZOJ 2DMQA 1K4SA 4AVPA 5LRRA 2Y0MA 2HQAA 3U1KA 4UUSB 4DBQA 3H92A 5GPCA 1B8IA 4OIQF 2MLGA 3NAUA 2CUJA 2GLOA 1HF0A 2Y9YA 1VZ0A 1RUNA 3FK7A 2C6YA 1PJRA 1LFUP 2JRTA 1W5SA 1OCRH 3L1PA 3DKXA 3ISPA 1I3AA 3CQZJ 4IZZA 1G6NA 2VT2A 1VQ7I 1T56A 2F2EA 3QYEA 4K2EA 1D0YA 5FLMJ 4GFBA 2A6TA 2Z3YA 2WBMA 2KMUA 4HX8A 3OMYA 3I4NJ 4XR6A 4CZZA 4NNJA 4R79A 6PAXA 2GZWA 5D5XB 4XSXF 5IP6A 3P5JA 5C4JJ 2OBPA 2K27A 3GFLA 2OTJI 3TKYA 4FE7A 3OS1A 4M3BA 1MBGA 4DZJA 1JKOC 5J1UA 3OYLA 2LNBA 1U8BA 4NC8A 1IDZA 4HX4A 2IPQX 2XPWA 2P6SA 3K4KA 4M73A 5E1XA 3S14J 1MH4A 4WK8F 3OYCA 2HVQA 4RM3A 4M6XA 2W00A 3IH4A 2K9NA 1YO5C 4J01A 4B8XA 2VJJA 2LD5A 1W5TA 3RDIA 1QRYA 3P9IA 1T0FC 2XAFA 3C2HA 3HOXJ 4A69C 3H0DA 2DAOA 2ZNYA 2RKHA 4G7HF 4P96A 1ZR4A 3FISA 4PUSA 4TV7A 2HOEA 1OR7C 2YX4A 3D0SA 4AU7A 1FZPB 5CJ9A 3OOPA 3E1SA 2KQRA 4IQ4A 1O7FA 3BPXA 5GAGJ 1Z6TA 2BHYA 5DDGA 2QF7A 4ZYHA 2O5RA 2ZC2A 4DBRA 5M3MJ 2LRDA 3IV5A 3BT9A 5JLWA 5J4VA 5TGTA 2L4AA 1OISA 2QYOA 1AWCA 2P4WA 5JLXA 1ZTRA 2WAEA 1BJZA 3RI4A 4RA2A 2UZKA 3KYDB 1U5TC 1SD7A 2ICWG 3K0LA 2A07F 2DA1A 3ZN0A 3GW2A 1FOWA 2XSJC 4AIHA 1DU0A 2Z16A 5GAEJ 1W4MA 3FM5A 4AUXA 2W48A 4BDZA 2CMPA 1F9NA 3C3WA 2OQGA 4BHBA 1B72A 1VQPI 2M7AA 2R0QC 2QVOA 2Z99A 3DLAA 4YELA 2YUSA 3JAMK 3OYMA 3CZ6A 3RKQA 1YRNB 4RLFA 3K2ZA 1YJ9I 2ZXJA 4CSWA 3CCSI 2E1MB 3IH2A 1NG6A 4F93B 4W97A 3GCMA 1ETYA 2L5QA 3TO6A 4DYRA 4KDPA 3WTVC 3V7RA 4C2TA 2A6HF 3LSRA 3Q0VA 3HEFA 2G0EA 5ILVA 1YJNI 5DTDA 1D5YA 2ZMEB 3HOTA 3PIPF 4JX6A 1IO2A 3RIRA 2VODA 4IX7A 2BY2A 4UXNA 2JN6A 1HW2A 4AIKA 1S7OA 2BE5F 1ENHA 4YFXF 3DXJF 1U8RA 1RPWA 2DCEA 2EV5A 3NARA 2ME6A 3QP5A 4XRMA 1Z91A 1DGWY 3QODA 3M3YJ 3E7LA 3L2QA 3I4MJ 4M6VA 5IP7J 4JBAA 5DD8A 2D1VA 1TQIA 1K79A 3M4OJ 1IV6A 1LNWA 1EKEA 3ABMH 1ZRDA 2CUEA 1ETOA 1HCRA 3H3ZA 3KYCB 4ITVA 3ZQGA 1FWZA 2X1DA 1ONVA 1UG0A 1K6OA 1O3RA 1FTTA 5ICGA 2QEXI 3RSNA 2HVRA 1E17A 3CJRB 1P6RA 1IAWA 2RV8A 2O8KA 1YOVB 1D8KA 4XONA 2VQHA 2H27A 3HL2A 1TW2A 5JVGF 3GTPJ 4WXCA 4QTRA 2JPCA 3CC7I 1W5CC 3JAMZ 4XIDA 4ZDOA 3S93A 2XROA 2R5YA 2IP2A 2DJNA 2JA7J 5M5YJ 2O03A 1U9NA 1YS7A 4BXUA 3LSPA 5DUIA 3RKWA 2CG4A 1MNDA 2ZSHB 2DDBA 2XB5A 3LSTA 2K4JA 3W3CA 1XB4A 1Z6RA 4ENKA 2EQRA 4BQAA 4I0AA 4RB0A 5KCMA 2GIZA 3DPUA 4MEYF 3S8PA 2QQ8A 1R4NB 5CYVA 2O3FA 4U7BA 1TWAJ 1ZG1A 4LITA 3AFHA 1D0XA 3ROUA 2CS3A 2EH3A 3V8LA 3G1MA 4OWRB 1FOKA 4WXHA 1S5LC 2HPMA 2BOLA 5B1BH 5J3LA 3PSIA 1R36A 2ME0A 3SZPA 2XGEA 4CCMA 1FSHA 4O6JA 1R49A 4QSHA 5EEAA 1SAXA 2L2OA 2YU3A 3WTUC 1F36A 3HHGA 2HI3A 2ZSIB 4Q47A 5HS7A 1Y39A 2MD0A 3FKIJ 4M3GA 4A3GJ 1J2XA 1YQAA 2X85A 3WODF 4E70A 2GWRA 3JRFA 1Y0UA 1SVOA 4HRIA 4XBFA 2CYYA 2N8GA 1MMGA 2Y0SA 2NVQJ 2L02A 2X0LA 3FXRA 1G2HA 3VSKA 2HDCA 4JQFA 2K3PA 3H35A 2DA5A 5FRNA 5FKOA 2L9VA 2JA6J 3KE2A 2IVMA 3F9KA 2HZDA 3P9CA 2CO5A 4IO9F 2VL8A 1E3HA 2K9MA 3FK6A 3CC2I 2XKOA 2TRTA 1LE8B 2XAJA 4Q5SF 3HBLA 4WF2A 1NTCA 3KEOA
chains in the Genus database with same CATH topology
3HOWJ 1B72B 2CJJA 4BBRJ 5GPAA 2DMPA 4G12A 2XRLA 3OOUA 4A3DJ 3BQZA 9ANTA 3GTMJ 1AKHB 1ZR2A 3GTOJ 1ETQA 5E3OA 2O7OA 4A3JJ 1MBKA 5F0FA 1JT0A 4A3KJ 3QPSA 2LTPA 3Q0WA 5EG0A 3RQIA 4A93J 3C2BA 3JR9A 4UUSA 3BG3A 2LLKA 3HOYJ 1QPIA 3HGYA 1H89C 1GV2A 4M3FA 1IDYA 5FKLA 3OIOA 1PUFA 1GVDA 3W6VA 1IRZA 1BW6A 2E19A 3LNQA 3S1NJ 4I6ZA 4BXXJ 4A3EJ 5EG0B 3JRCA 1MNMC 1MH3A 1QVTA 1TWFJ 5FKNA 5FJ8J 3O8HA 4ABZA 1JUPA 2LY9A 2LFBA 2H1KA 4C3HJ 5J1YA 3TW7A 3S1QJ 2P81A 5EDNA 1JJ8C 3HGGA 4RDUA 2LP0A 3BTCA 3A02A 1IC8A 1MBFA 3BQYA 5C44J 3DEWA 2FJ1A 1FEXA 2YU9J 2D5VA 3GTQJ 1HOMA 2L9RA 4MFDA 1JUMA 4MFEA 4DW6A 1BW5A 3CCYA 1AHDP 1IJWC 2JJ7A 1WCMJ 2E2HJ 2FQ4A 2H8RA 2O9LA 2R93J 1WH5A 5FLVA 2R5YB 2X6OA 3CMYA 5IOYA 2M0CA 5F1JA 2MG4A 2GM4A 4V2FA 3BR3A 2CQXA 2L7ZA 5IYCJ 2AHQA 5FKMA 5IP9J 2DA7A 3RZDJ 2JA8J 2TCTA 3B6CA 1T33A 2HDDA 4S0HB 1X58A 3BR1A 3CDLA 4IEJA 1ORKA 1U78A 1DU6A 1WI3A 4X6AJ 2X9DA 3GTKJ 4A3FJ 3HOUJ 1MSFC 3D1NI 5K7FA 2EZLA 3BTJA 3TEDA 1U9OA 2RAEA 1ITYA 2CRGA 1SFOJ 2OF7A 3BR0A 3BTIA 4C3JJ 5IYBJ 4IHXA 1JKQC 2DA4A 1GV5A 3QQAA 2JA5J 2DMUA 1Y1VJ 4BY1J 1RR7A 1YRNA 3TW6A 1EF4A 4DYCA 2NS7A 1JT6A 4FISA 3ZQLA 3SDGA 2FX0A 3HDDA 4Y7NJ 3A03A 3GTGJ 3H0GJ 1JGGA 3SJMA 5F0HA 5EF6A 4IHVA 2X48A 2YS9A 1GT0C 1MBHA 2WAQN 5IYDJ 3TP0A 5E3NA 1JJ6C 4Y52J 3MN2A 2I10A 2LK2A 3MKLA 1A5JA 2R7ZJ 1ETVA 1UMQA 1R9TJ 4DYQA 5K7HA 2VPRA 4CYCB 2NS8A 1P7IA 1W0UA 1OCTC 5EGOA 4A3IJ 2R5ZA 2PMZN 4MIMA 4LOCA 2WB1N 2GBYA 3RZOJ 4D5CA 3Q0UA 2DMQA 1HDDC 2E2IJ 4B4CA 3O8GA 1Y1WJ 3SFIA 1MSEC 2HQ5A 4C2MJ 1WPKA 5HODA 5EGOB 4UUSB 3JREA 3K7AJ 5GPCA 1NK2P 1B8IA 2B63J 2R5ZB 3NAUA 1AU7A 2ECCA 2XB0X 2GLOA 4W1UA 1HF0A 2Y9YA 4JX5A 3HOVJ 3FK7A 5M3FJ 1PUFB 1LFUP 3L1PA 1JTXA 1HLVA 1ZKGA 4M3EA 2ID3A 3CQZJ 1T56A 1E3OC 5FLMJ 4GFBA 4A3LJ 3WHBA 5F08A 1IUFA 1IGNA 3I4NJ 5M5XJ 1XG1A 2E2JJ 1FIPA 4J19A 1B8IB 5EZGA 3WHCA 5F27A 4XRSG 1K61A 3G1OA 1GDTA 5IP6A 1JTYA 3BR5A 2JWTA 2R92J 5C4JJ 2EZHA 1TWGJ 4FE7A 1JKPC 3LSGA 2XPUA 4M3BA 1MBGA 4DZJA 1JKOC 2HOTA 5J1UA 1TC3C 1U8BA 1IDZA 2L0KA 1RESA 3S1RJ 3VPRA 2VKVA 1MBEA 2XPWA 1JUSA 3PM1A 4BKXA 4I76A 2M9HA 3HB9A 3S14J 1MH4A 5E3MA 3IH4A 2K9SA 2K9NA 4AYBN 1FTZA 5C3EJ 2XGDA 3H3VK 2DMNA 2HOAA 2LD5A 1OFCX 1Z0XA 1QRYA 1LFBA 2VUMJ 2EZKA 3F0CA 4L5EA 3HOXJ 4BY7J 3B6AA 2COBA 4A69C 1I3QJ 3GBGA 1POGA 3JRGA 2DTZA 4HNVA 1ZR4A 3FISA 2MSYA 3BG5A 1ETXA 1XC5A 2WV1A 2EZIA 5C4XJ 3A01A 3OSGA 4FE4A 1OCPA 1CQTA 2QF7A 3PO2J 2CQQA 1Z77A 1ETKA 3IV5A 5M3MJ 2M2EA 3BT9A 5EZHA 5JLWA 3S17J 4A3MJ 2HXOA 5JLXA 1ZTRA 2Y2ZA 1H88C 1WH7A 1BJZA 3HOZJ 4D7MA 3HM5A 1ZQ3P 4A3CJ 2LR8A 1LE8A 2DA1A 2FD5A 1RKWA 1I50J 1K83J 1DU0A 3MVPA 1ZGWA 4AUXA 1BA5A 2W48A 4FCYA 4XK4A 2L7MP 4EEFG 4NDLA 3GTJJ 5F0CA 1B72A 1A6IA 2VI6A 2R0QC 3RKQA 4A3BJ 2YUSA 4JP0A 5F04A 1YRNB 4M3DA 1AKHA 2AO9A 2K9QA 3S2DJ 3IH2A 2MGQA 2Y31A 4W97A 1ETYA 3JRHA 3OSFA 3BR6A 4DYRA 3LSRA 3Q0VA 4RBOA 3HEFA 2G0EA 2ECBA 2L7FP 2CU7A 2LVSA 5DTDA 4MLOA 2DMTA 1D5YA 1VI0A 4JX6A 1HDPA 1OJLA 3ZOBA 1APLC 2JN6A 3LOCA 1FJLA 2MW8A 1ENHA 1RPWA 2JMWA 3BR2A 3NARA 2ME6A 5K7ZA 4XRMA 3M3YJ 2Y30A 3E7LA 1ETWA 3I4MJ 4M6VA 5IP7J 5M5WJ 3UKGA 1F43A 1GUUA 2E1OA 4D5FA 3M4OJ 1IV6A 2XGCA 2KT0A 3QPLA 2CUEA 1ETOA 3ZQCA 1HCRA 2NVTJ 3GTLJ 3ZQGA 3S2HJ 4XICA 1VFCA 2M8GX 3S16J 1FTTA 3ZQIA 1P7JA 3K2AA 1VNDA 4B1RA 2O8KA 3JRIA 2M34A 4JYKA 4IHWA 2VKEA 2HXIA 2EBIA 3S15J 1S7EA 4C3IJ 3GTPJ 2DN0A 4QTRA 2HOSA 2IEKA 4XIDA 3JRAA 4B3AA 2R5YA 1WGXA 3PO3J 2DJNA 3BTLA 2JA7J 5M5YJ 1U9NA 3FIWA 3LSPA 1Q1VA 1H8AC 2XB5A 4X1EA 1ZK8A 2IAIA 2EQRA 5J1RA 3IH3A 1FIAA 2Y0SN 2OPTA 5DS9A 4D7NA 5IOZA 1O4XA 3BG9A 1JKRC 1TWAJ 4FTHA 5E3LA 2EH3A 3Q3SA 1UG2A 3G1MA 1XS9A 2K40A 4IHYA 3JRDA 5J3LA 1BL0A 1RKTA 2JK3A 2ME0A 2XGEA 1I6HJ 5EYRA 4JX4A 1X2NA 4V2GA 4QIWN 2ELKA 4QSHA 2Y9ZA 5EEAA 4XRSA 2LKXA 1F36A 2HI3A 5FKKA 2ZB9A 2XPVA 2QCOA 1TWHJ 3FKIJ 4M3GA 4A3GJ 4MO7A 4DZPA 2ID6A 1TWCJ 2DA6A 3JRBA 1W0TA 3JRFA 2IBDA 3A01B 1IG7A 2NVXJ 4UUTA 2N8GA 1RETA 3ZQHA 3ZQFA 2HYJA 2NVQJ 2NVYJ 1VF9A 2DA3A 1G2HA 2NOGA 1MBJA 3HKZN 1QVUA 2XSDC 2DA5A 2DA2A 4AC0A 5FKOA 2KDZA 2JA6J 5IPAA 1X2MA 3G1LA 3S1MJ 3TP3A 2CUFA 3FK6A 1SANA 5GP9A 5BNGA 1NK3P 4BBSJ 2TRTA 1LE8B 1UHSA 3DCFA 3HBLA 3LSJA 4CYCA 1NTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOW J;  1B72 B;  2CJJ A;  4BBR J;  5GPA A;  2DMP A;  4G12 A;  2XRL A;  3OOU A;  4A3D J;  3BQZ A;  9ANT A;  3GTM J;  1AKH B;  1ZR2 A;  3GTO J;  1ETQ A;  5E3O A;  2O7O A;  4A3J J;  1MBK A;  5F0F A;  1JT0 A;  4A3K J;  3QPS A;  2LTP A;  3Q0W A;  5EG0 A;  3RQI A;  4A93 J;  3C2B A;  3JR9 A;  4UUS A;  3BG3 A;  2LLK A;  3HOY J;  1QPI A;  3HGY A;  1H89 C;  1GV2 A;  4M3F A;  1IDY A;  5FKL A;  3OIO A;  1PUF A;  1GVD A;  3W6V A;  1IRZ A;  1BW6 A;  2E19 A;  3LNQ A;  3S1N J;  4I6Z A;  4BXX J;  4A3E J;  5EG0 B;  3JRC A;  1MNM C;  1MH3 A;  1QVT A;  1TWF J;  5FKN A;  5FJ8 J;  3O8H A;  4ABZ A;  1JUP A;  2LY9 A;  2LFB A;  2H1K A;  4C3H J;  5J1Y A;  3TW7 A;  3S1Q J;  2P81 A;  5EDN A;  1JJ8 C;  3HGG A;  4RDU A;  2LP0 A;  3BTC A;  3A02 A;  1IC8 A;  1MBF A;  3BQY A;  5C44 J;  3DEW A;  2FJ1 A;  1FEX A;  2YU9 J;  2D5V A;  3GTQ J;  1HOM A;  2L9R A;  4MFD A;  1JUM A;  4MFE A;  4DW6 A;  1BW5 A;  3CCY A;  1AHD P;  1IJW C;  2JJ7 A;  1WCM J;  2E2H J;  2FQ4 A;  2H8R A;  2O9L A;  2R93 J;  1WH5 A;  5FLV A;  2R5Y B;  2X6O A;  3CMY A;  5IOY A;  2M0C A;  5F1J A;  2MG4 A;  2GM4 A;  4V2F A;  3BR3 A;  2CQX A;  2L7Z A;  5IYC J;  2AHQ A;  5FKM A;  5IP9 J;  2DA7 A;  3RZD J;  2JA8 J;  2TCT A;  3B6C A;  1T33 A;  2HDD A;  4S0H B;  1X58 A;  3BR1 A;  3CDL A;  4IEJ A;  1ORK A;  1U78 A;  1DU6 A;  1WI3 A;  4X6A J;  2X9D A;  3GTK J;  4A3F J;  3HOU J;  1MSF C;  3D1N I;  5K7F A;  2EZL A;  3BTJ A;  3TED A;  1U9O A;  2RAE A;  1ITY A;  2CRG A;  1SFO J;  2OF7 A;  3BR0 A;  3BTI A;  4C3J J;  5IYB J;  4IHX A;  1JKQ C;  2DA4 A;  1GV5 A;  3QQA A;  2JA5 J;  2DMU A;  1Y1V J;  4BY1 J;  1RR7 A;  1YRN A;  3TW6 A;  1EF4 A;  4DYC A;  2NS7 A;  1JT6 A;  4FIS A;  3ZQL A;  3SDG A;  2FX0 A;  3HDD A;  4Y7N J;  3A03 A;  3GTG J;  3H0G J;  1JGG A;  3SJM A;  5F0H A;  5EF6 A;  4IHV A;  2X48 A;  2YS9 A;  1GT0 C;  1MBH A;  2WAQ N;  5IYD J;  3TP0 A;  5E3N A;  1JJ6 C;  4Y52 J;  3MN2 A;  2I10 A;  2LK2 A;  3MKL A;  1A5J A;  2R7Z J;  1ETV A;  1UMQ A;  1R9T J;  4DYQ A;  5K7H A;  2VPR A;  4CYC B;  2NS8 A;  1P7I A;  1W0U A;  1OCT C;  5EGO A;  4A3I J;  2R5Z A;  2PMZ N;  4MIM A;  4LOC A;  2WB1 N;  2GBY A;  3RZO J;  4D5C A;  3Q0U A;  2DMQ A;  1HDD C;  2E2I J;  4B4C A;  3O8G A;  1Y1W J;  3SFI A;  1MSE C;  2HQ5 A;  4C2M J;  1WPK A;  5HOD A;  5EGO B;  4UUS B;  3JRE A;  3K7A J;  5GPC A;  1NK2 P;  1B8I A;  2B63 J;  2R5Z B;  3NAU A;  1AU7 A;  2ECC A;  2XB0 X;  2GLO A;  4W1U A;  1HF0 A;  2Y9Y A;  4JX5 A;  3HOV J;  3FK7 A;  5M3F J;  1PUF B;  1LFU P;  3L1P A;  1JTX A;  1HLV A;  1ZKG A;  4M3E A;  2ID3 A;  3CQZ J;  1T56 A;  1E3O C;  5FLM J;  4GFB A;  4A3L J;  3WHB A;  5F08 A;  1IUF A;  1IGN A;  3I4N J;  5M5X J;  1XG1 A;  2E2J J;  1FIP A;  4J19 A;  1B8I B;  5EZG A;  3WHC A;  5F27 A;  4XRS G;  1K61 A;  3G1O A;  1GDT A;  5IP6 A;  1JTY A;  3BR5 A;  2JWT A;  2R92 J;  5C4J J;  2EZH A;  1TWG J;  4FE7 A;  1JKP C;  3LSG A;  2XPU A;  4M3B A;  1MBG A;  4DZJ A;  1JKO C;  2HOT A;  5J1U A;  1TC3 C;  1U8B A;  1IDZ A;  2L0K A;  1RES A;  3S1R J;  3VPR A;  2VKV A;  1MBE A;  2XPW A;  1JUS A;  3PM1 A;  4BKX A;  4I76 A;  2M9H A;  3HB9 A;  3S14 J;  1MH4 A;  5E3M A;  3IH4 A;  2K9S A;  2K9N A;  4AYB N;  1FTZ A;  5C3E J;  2XGD A;  3H3V K;  2DMN A;  2HOA A;  2LD5 A;  1OFC X;  1Z0X A;  1QRY A;  1LFB A;  2VUM J;  2EZK A;  3F0C A;  4L5E A;  3HOX J;  4BY7 J;  3B6A A;  2COB A;  4A69 C;  1I3Q J;  3GBG A;  1POG A;  3JRG A;  2DTZ A;  4HNV A;  1ZR4 A;  3FIS A;  2MSY A;  3BG5 A;  1ETX A;  1XC5 A;  2WV1 A;  2EZI A;  5C4X J;  3A01 A;  3OSG A;  4FE4 A;  1OCP A;  1CQT A;  2QF7 A;  3PO2 J;  2CQQ A;  1Z77 A;  1ETK A;  3IV5 A;  5M3M J;  2M2E A;  3BT9 A;  5EZH A;  5JLW A;  3S17 J;  4A3M J;  2HXO A;  5JLX A;  1ZTR A;  2Y2Z A;  1H88 C;  1WH7 A;  1BJZ A;  3HOZ J;  4D7M A;  3HM5 A;  1ZQ3 P;  4A3C J;  2LR8 A;  1LE8 A;  2DA1 A;  2FD5 A;  1RKW A;  1I50 J;  1K83 J;  1DU0 A;  3MVP A;  1ZGW A;  4AUX A;  1BA5 A;  2W48 A;  4FCY A;  4XK4 A;  2L7M P;  4EEF G;  4NDL A;  3GTJ J;  5F0C A;  1B72 A;  1A6I A;  2VI6 A;  2R0Q C;  3RKQ A;  4A3B J;  2YUS A;  4JP0 A;  5F04 A;  1YRN B;  4M3D A;  1AKH A;  2AO9 A;  2K9Q A;  3S2D J;  3IH2 A;  2MGQ A;  2Y31 A;  4W97 A;  1ETY A;  3JRH A;  3OSF A;  3BR6 A;  4DYR A;  3LSR A;  3Q0V A;  4RBO A;  3HEF A;  2G0E A;  2ECB A;  2L7F P;  2CU7 A;  2LVS A;  5DTD A;  4MLO A;  2DMT A;  1D5Y A;  1VI0 A;  4JX6 A;  1HDP A;  1OJL A;  3ZOB A;  1APL C;  2JN6 A;  3LOC A;  1FJL A;  2MW8 A;  1ENH A;  1RPW A;  2JMW A;  3BR2 A;  3NAR A;  2ME6 A;  5K7Z A;  4XRM A;  3M3Y J;  2Y30 A;  3E7L A;  1ETW A;  3I4M J;  4M6V A;  5IP7 J;  5M5W J;  3UKG A;  1F43 A;  1GUU A;  2E1O A;  4D5F A;  3M4O J;  1IV6 A;  2XGC A;  2KT0 A;  3QPL A;  2CUE A;  1ETO A;  3ZQC A;  1HCR A;  2NVT J;  3GTL J;  3ZQG A;  3S2H J;  4XIC A;  1VFC A;  2M8G X;  3S16 J;  1FTT A;  3ZQI A;  1P7J A;  3K2A A;  1VND A;  4B1R A;  2O8K A;  3JRI A;  2M34 A;  4JYK A;  4IHW A;  2VKE A;  2HXI A;  2EBI A;  3S15 J;  1S7E A;  4C3I J;  3GTP J;  2DN0 A;  4QTR A;  2HOS A;  2IEK A;  4XID A;  3JRA A;  4B3A A;  2R5Y A;  1WGX A;  3PO3 J;  2DJN A;  3BTL A;  2JA7 J;  5M5Y J;  1U9N A;  3FIW A;  3LSP A;  1Q1V A;  1H8A C;  2XB5 A;  4X1E A;  1ZK8 A;  2IAI A;  2EQR A;  5J1R A;  3IH3 A;  1FIA A;  2Y0S N;  2OPT A;  5DS9 A;  4D7N A;  5IOZ A;  1O4X A;  3BG9 A;  1JKR C;  1TWA J;  4FTH A;  5E3L A;  2EH3 A;  3Q3S A;  1UG2 A;  3G1M A;  1XS9 A;  2K40 A;  4IHY A;  3JRD A;  5J3L A;  1BL0 A;  1RKT A;  2JK3 A;  2ME0 A;  2XGE A;  1I6H J;  5EYR A;  4JX4 A;  1X2N A;  4V2G A;  4QIW N;  2ELK A;  4QSH A;  2Y9Z A;  5EEA A;  4XRS A;  2LKX A;  1F36 A;  2HI3 A;  5FKK A;  2ZB9 A;  2XPV A;  2QCO A;  1TWH J;  3FKI J;  4M3G A;  4A3G J;  4MO7 A;  4DZP A;  2ID6 A;  1TWC J;  2DA6 A;  3JRB A;  1W0T A;  3JRF A;  2IBD A;  3A01 B;  1IG7 A;  2NVX J;  4UUT A;  2N8G A;  1RET A;  3ZQH A;  3ZQF A;  2HYJ A;  2NVQ J;  2NVY J;  1VF9 A;  2DA3 A;  1G2H A;  2NOG A;  1MBJ A;  3HKZ N;  1QVU A;  2XSD C;  2DA5 A;  2DA2 A;  4AC0 A;  5FKO A;  2KDZ A;  2JA6 J;  5IPA A;  1X2M A;  3G1L A;  3S1M J;  3TP3 A;  2CUF A;  3FK6 A;  1SAN A;  5GP9 A;  5BNG A;  1NK3 P;  4BBS J;  2TRT A;  1LE8 B;  1UHS A;  3DCF A;  3HBL A;  3LSJ A;  4CYC A;  1NTC A; 
#chains in the Genus database with same CATH topology
 5BQT A;  4LGW A;  3KZY A;  3FMS A;  2VKH A;  4B3X A;  2DT5 A;  1KQ8 A;  4N9H A;  5H6Q A;  3BQZ A;  3TOA A;  3GTO J;  1V55 H;  2A68 F;  1G59 A;  2O7O A;  1WJA A;  3GWZ A;  5F0F A;  1T39 A;  2V1D A;  3GZN B;  2W7N A;  3N4M A;  3QPS A;  1TT5 B;  3Q0W A;  5EG0 A;  4UB8 C;  2LBF B;  4A93 J;  5HS8 A;  4UUS A;  1BOA A;  2QBY B;  3ABU A;  1TNT A;  3ML6 A;  4LLL A;  3GX4 X;  2PJR B;  3HGY A;  2HKO A;  2R7F A;  1HSJ A;  3CJT B;  3R60 A;  1PP7 U;  1IDY A;  3OIO A;  2EV6 A;  3RYR A;  3MKZ A;  1BW6 A;  2VAS A;  4UVA A;  4KT6 A;  4Y3O A;  1A35 A;  5ILU A;  1ZEL A;  4KIT B;  2ISY A;  4UV9 A;  4BGD A;  3S3O A;  1JGS A;  4BXX J;  2CW0 F;  3OYN A;  1BOB A;  1RI7 A;  3FXQ A;  3CF5 F;  1ZYR F;  5FLX K;  1MH3 A;  1QVT A;  1IN6 A;  1TWF J;  3KP4 A;  4I99 C;  1F1Z A;  4E7I A;  1DP7 P;  5FJ8 J;  3O8H A;  3TDU C;  1FYK A;  3N05 A;  1XGS A;  4HV6 A;  3HG9 A;  3S1Q J;  5EDN A;  2NXN B;  4GYI A;  2FU4 A;  4XLC A;  2O0Y A;  1G3T A;  3BTC A;  4II2 A;  4RM2 A;  4NB5 A;  1UZC A;  3OS2 A;  3DEW A;  3CUQ C;  3HOS A;  4RGR A;  3IP4 B;  3OYE A;  3E5U A;  3GTQ J;  4DW6 A;  1V5F A;  4BQN A;  1KON A;  3HSF A;  3M7G A;  1FMW A;  1AHD P;  5ICC A;  3F22 A;  2R93 J;  5FLV A;  2JUC A;  3NQO A;  2X6O A;  1V5G A;  4F3Q A;  3GF2 A;  1QO0 D;  2M0C A;  3WTS C;  2KRF A;  1XSD A;  4LK0 F;  3KIO A;  2KPM A;  4EAT A;  4F52 A;  3MZY A;  4JOM A;  5JI6 A;  2PFB A;  2L7Z A;  3ZN1 A;  1LEA A;  3LAP A;  1Z05 A;  2DA7 A;  1ZRC A;  2CV1 A;  4I01 A;  1VQ6 I;  2R7T A;  5E8G A;  2R7U A;  2XHK A;  4EMS A;  1D1C A;  4S0H B;  1X58 A;  3BCA A;  5HLT A;  2IJL A;  3BR1 A;  4P9F A;  1WJ5 A;  4IL6 C;  1EH8 A;  4FX0 A;  1U78 A;  5FFZ A;  1XSV A;  2DT7 B;  3GTK J;  1DGR M;  1F5T A;  4MTD A;  4OMY A;  4A3F J;  3HOU J;  5AIQ A;  2A69 F;  4D9J A;  5FLX Z;  2CQ7 A;  3TED A;  4KIC A;  2HS5 A;  2AS5 F;  3CC4 I;  2J5P A;  5ICE A;  2OF7 A;  1IZ1 A;  5F6F A;  3TQN A;  1GVJ A;  5CVR A;  4GCV A;  3IL2 A;  1V3F A;  5HOO A;  2BVL A;  4QWQ A;  3OY9 A;  5DM6 F;  5DCM B;  3UR3 C;  1GV5 A;  2ZXI A;  1WZ2 A;  1Y1V J;  5ILS A;  4CGZ A;  3IRR A;  1YRN A;  3BZK A;  3K10 A;  1EF4 A;  4DYC A;  3OIP A;  5HDG A;  3K6G A;  1K7A A;  2IT0 A;  3S32 A;  3GTG J;  5D6E A;  3EYI A;  4E6K G;  3SJM A;  4IHV A;  2FBK A;  2ZME A;  1GT0 C;  2H94 A;  4IQJ A;  3K1N A;  1JJ6 C;  4HG2 A;  1P4W A;  1VQO I;  2R7Z J;  1ETV A;  3DP7 A;  4I02 A;  4DYQ A;  2DBB A;  1O57 A;  2NS8 A;  4ASN A;  1W0U A;  1OCT C;  3H9J A;  4IHS A;  3A0B C;  3PNT A;  4M74 A;  1X3W B;  2CFO A;  1VQ4 I;  3DF8 A;  4D5C A;  3Q0U A;  2VLA A;  3DPL C;  2IGN A;  4XL9 A;  5LHG A;  2B9S A;  3TO7 A;  4B4C A;  4BAY A;  3I5U A;  3O8G A;  2E2I J;  1CF7 B;  4HF2 A;  1Y1W J;  3DV8 A;  5KHD A;  3BPV A;  2QA4 I;  3VOD A;  4EJW A;  2HQ5 A;  1BJA A;  1WPK A;  5HOD A;  2OV7 A;  2XAG A;  3CD6 I;  1R5G A;  2W84 A;  2J5O A;  4BAC A;  1NK2 P;  2RN7 A;  3WTX C;  4YRV A;  4JX5 A;  1Z7L A;  4P1W A;  5M3F J;  5L3B A;  4M9Z A;  1JTX A;  1XN7 A;  4PDK A;  1HLV A;  2IW5 A;  2ID3 A;  1DPU A;  4KT5 C;  2V9V A;  2GOM A;  1BIB A;  4NUB A;  3GLL A;  1BC7 C;  1K6Y A;  3OL4 A;  3V7C A;  3WHB A;  1P4X A;  4PGG A;  4ZC3 A;  3E6M A;  2X1E A;  2PMZ A;  4J19 A;  5EZG A;  1K61 A;  4XRS G;  2CUZ A;  4G6Q A;  4U0W A;  4EGY A;  1JTY A;  1X1P A;  3BR5 A;  2JWT A;  2R92 J;  3HRM A;  2QWW A;  1TWG J;  3E6D A;  1FP1 D;  2XAQ A;  1YX3 A;  2HOT A;  1S6L A;  1W7P B;  3FX3 A;  1RES A;  4OIN F;  1OYI A;  3I55 I;  3S1R J;  2M87 A;  1JUS A;  4BKX A;  2M9H A;  3HB9 A;  4U87 A;  1IXC A;  2F5C A;  4RAY A;  1SMT A;  3BC8 A;  1FYM A;  1OFC X;  3QRF F;  1MZB A;  3U9G A;  4XMY A;  3RJP A;  3L2C A;  2VQG A;  3VYR B;  1GLN A;  1BC8 C;  2VUM J;  2EZK A;  4L5E A;  4BY7 J;  1I3Q J;  1PVE A;  3VOE A;  1KU7 A;  3F8M A;  1FBS A;  3REO A;  1ULY A;  3JRG A;  3MKW B;  2R7D A;  3FXJ A;  2NOJ B;  3BG5 A;  2WV1 A;  4NC6 A;  2EZI A;  4M9S A;  3HTS B;  2LY2 A;  2ZJR F;  1KU2 A;  4P9U A;  4FE4 A;  2P7C B;  1CQT A;  2EWN A;  2CV0 A;  4DOZ A;  4HSR A;  3O2P E;  1R5H A;  4E7H A;  1ETK A;  1ZRF A;  1ZGA A;  1N75 A;  4QPQ A;  4B44 A;  3SDB A;  1FOX A;  1D1A A;  1B1B A;  1HW5 A;  2W25 A;  3DQV C;  3KZZ A;  3VYU B;  3J7Y J;  3S17 J;  2F5D A;  2V9K A;  2K7L A;  4A3M J;  3D5S C;  1W36 C;  1X4P A;  5EJC A;  3TMO A;  3QU6 A;  3HOZ J;  4AYB A;  4F7Z A;  1ZQ3 P;  4IJA A;  2LR8 A;  3ECH A;  2YSR A;  2CFX A;  1LE8 A;  1RKW A;  4LJZ F;  4CDG A;  1I50 J;  4NC7 A;  3ESW B;  1ZGW A;  1D3Y A;  4FCY A;  3ZGK A;  3Q9V A;  3PUF A;  1BN5 A;  1U5T B;  1A6Q A;  2F4I A;  2BBY A;  5F0C A;  2XIG A;  1VQ9 I;  1A6I A;  2COM A;  2TDX A;  3IC7 A;  3CCQ I;  4QLC U;  4M3D A;  3HRS A;  2F6C A;  2IGM A;  4Y15 A;  4XLN F;  3S2D J;  4UB6 C;  2QUF A;  2MGQ A;  2XAS A;  2F5F A;  2Y31 A;  1OLT A;  5HDK A;  4L9J A;  1OYW A;  3JRH A;  2CQK A;  2ETH A;  2JTV A;  1IN5 A;  2LBF A;  2ECB A;  2LVS A;  3PFI A;  2QBY A;  2OCE A;  3G2B A;  5LLQ A;  3I53 A;  1FSE A;  1ZN2 A;  2LMD A;  5D4S A;  2PJR A;  4WX9 A;  3PSF A;  3ZOB A;  3ZMD A;  4BJT A;  2EIM H;  2MW8 A;  4HA8 A;  2NVU B;  5LBQ A;  5K7Z A;  5K1Y A;  2JQ7 A;  1WRJ A;  2DPU A;  2UXN A;  2D45 A;  4M9X A;  1GUU A;  1W7P D;  2M3A A;  3QPL A;  3MFK A;  1I6X A;  1O3S A;  2XF6 A;  5E1Z B;  2IA0 A;  2CGP A;  2NVT J;  3KX2 A;  4XIC A;  1VFC A;  3TGN A;  2GXB A;  3S16 J;  1WJD A;  3ZQI A;  1Y6I A;  1YW8 A;  2RGV A;  4ZZL A;  4EJV A;  1FP2 A;  2QLZ A;  2O8X A;  3MZ8 A;  4RAZ A;  3QOE A;  3F72 A;  3U2R A;  4HNU A;  3WTT C;  3CO7 C;  2QSH X;  2VKE A;  2HXI A;  3S15 J;  1S7E A;  3CLQ A;  3DBR B;  4C3I J;  4MHG A;  2HOS A;  4M72 A;  4BEH B;  4UVB A;  3CCR I;  4N9I A;  5FD6 A;  1IXS B;  2HTJ A;  3PO3 J;  5JVT A;  4E7K A;  4XLF A;  3FIW A;  1FX7 A;  2R7Q A;  3A4C A;  5BS6 A;  1WJE A;  1Q1V A;  3CUO A;  4E7J A;  1Z1D A;  2OA4 A;  2LDU A;  3GFJ A;  2IAI A;  4HST A;  2X51 A;  4Z6Y A;  1S9H A;  5J1R A;  5EEG A;  1EA3 A;  3LFK A;  1KQ9 A;  4RAG A;  5TIS C;  4A2U A;  1EJ9 A;  5L3F A;  2Y0S N;  1TLH B;  2VB6 A;  3CCV I;  1O4X A;  2LF7 A;  4PSW A;  2KP6 A;  3M9A A;  5E18 F;  4FTH A;  1QGP A;  3PNV A;  3Q3S A;  1WQ2 A;  3JTG A;  1FOY A;  3JRD A;  4Y17 A;  3ZMT A;  2OD5 A;  1RKT A;  2JK3 A;  2MD5 A;  2R7R A;  4PJJ A;  1FLI A;  4HX7 A;  1TBX A;  4JX4 A;  4MEX F;  2RQP A;  3CDH A;  2BHZ A;  1ACI A;  3R0J A;  3V7S A;  4CXF A;  1WJF A;  2NNN A;  2XPV A;  2QCO A;  3ZXS A;  1TWH J;  1P9Q C;  5DCM A;  3BJ6 A;  2Y69 H;  3K9T A;  3C2G A;  4MO7 A;  4DZP A;  2JT1 A;  1GHC A;  2DFH A;  1W0T A;  4II3 A;  4BJ6 C;  2JVH A;  3DEU A;  1IG7 A;  3A01 B;  2OC6 A;  5ERI A;  4P55 A;  2BY3 A;  3QP6 A;  1BBY A;  1MMN A;  1R6R A;  3OYK A;  5L3G A;  1KU9 A;  1XMA A;  1RET A;  3ZQF A;  3SEZ A;  2NVY J;  4FQG A;  4G94 A;  1VF9 A;  2NOG A;  3A2K A;  1SAU A;  3IKV A;  4AC0 A;  2KDZ A;  5IPA A;  4ZH4 F;  1X2M A;  2HZT A;  5L3C A;  4G9Y A;  3G1L A;  4YIF A;  3TP3 A;  5KVR A;  2X6X A;  3M8E A;  3OYA A;  5J40 A;  1SAN A;  1M1E B;  2VBY A;  1JHF A;  5CPR B;  3PUB A;  3GUD A;  1UHS A;  4XKC A;  2XVC A;  1DQU A;  1E2X A;  2IA2 A;  1JI8 A;  4I09 A;  1O3Q A;  1XSX A;  1QU3 A;  2CJJ A;  1XX5 A;  1UFM A;  3AL0 C;  3N97 A;  2XRL A;  1X1B A;  1RIO H;  9ANT A;  5FRM A;  1A36 A;  1G3S A;  4PZJ A;  2DU9 A;  5E3O A;  1YX5 A;  4ZYD A;  3I59 A;  1T08 B;  4KN4 X;  2PLY A;  3OR1 C;  1CF7 A;  4A3K J;  2EA4 A;  3BG7 A;  2LTP A;  3RQI A;  5LGU A;  2DQR A;  2VT3 A;  1LEB A;  1KQ0 A;  3V42 A;  4B48 A;  3HKZ A;  2V4J C;  2DLL A;  3JR9 A;  3G4S I;  3QPH A;  4HW0 A;  3EQL F;  3E3V A;  2LLK A;  3HOY J;  1QPI A;  1OKR A;  1X3U A;  3A1Y A;  2E5Z A;  3LSK A;  1P92 A;  3KP2 A;  2GAU A;  3CCM I;  4M3F A;  2D1H A;  3O3K A;  5F64 A;  2OQR A;  1T6S A;  2W1O A;  3W6V A;  1WJC A;  4MTE A;  2M5W A;  2DOE A;  4BL0 B;  2AQF A;  2JVG A;  1XMK A;  3LMM A;  3S1N J;  2M0M A;  5CVV A;  2P8T A;  3IAS 2;  1MNM C;  1L3L A;  4L9T A;  4CO8 A;  4NHJ A;  1N78 A;  2CH0 A;  2PBI A;  1G3W A;  2EA2 A;  1D8J A;  2LY9 A;  2BXY A;  5J1Y A;  4AM3 A;  2E34 A;  2KIU A;  3HPG A;  2EV0 A;  2KFD A;  3CCU I;  1NH3 A;  3EUH A;  4BHP A;  3KP5 A;  2Z33 A;  1ZLJ A;  2LP0 A;  2W57 A;  1WI9 A;  1MBF A;  5A2Q K;  3PL8 A;  3OYG A;  2XRN A;  2YU9 J;  5JHF A;  1BI3 A;  2QZ8 A;  2ISZ A;  4LIU A;  5E8I A;  4ZDP A;  5DEQ A;  2KJB A;  2E2H J;  1IJW C;  2JJ7 A;  1WCM J;  4A12 A;  2FQ4 A;  3KCC A;  3CUQ B;  2V6E A;  4G7O F;  3J7A Y;  3DTI A;  3MWM A;  2VQL A;  2E7X A;  1YJW I;  2JZY A;  1KGS A;  5IOY A;  5FO5 A;  5F1J A;  2V79 A;  4LG0 B;  2BY1 A;  2MG4 A;  2Q2E B;  3MAJ A;  4KIF A;  5LGN A;  3F8F A;  4OAY A;  3J81 K;  1CGP A;  4A6D A;  3EUA A;  2VQC A;  3WTZ A;  3NRV A;  5FKM A;  5IP9 J;  3RZD J;  2JA8 J;  1XD7 A;  2TCT A;  5JHU A;  2H1L A;  2XC7 A;  1HKT A;  3OYH A;  2ZXH A;  2ZBK A;  1T33 A;  2O61 A;  3CMM A;  4HF0 A;  2LG4 A;  1LDD A;  3LA7 A;  3LWF A;  4M6Y A;  4CZC A;  3CME I;  4A0X A;  1IXR C;  2G9W A;  2WV0 A;  5IT9 K;  3BJO A;  2DQL A;  1T8I A;  1S7A A;  2UXX A;  2FUG 2;  4CYD A;  4UHT A;  1TQM A;  4E7L A;  3F8N A;  1HQC A;  1DPR A;  5BPD A;  1PYV A;  2M30 A;  1MSF C;  2L4M A;  3D1N I;  4IRG A;  5LHI A;  1QA6 A;  4LB5 A;  2BXZ A;  3AG3 H;  1YI2 I;  3BTJ A;  3MKY B;  2RAE A;  5LEJ A;  2QKM B;  1X1D A;  2FOW A;  4RB2 C;  5LFA A;  4KA4 A;  1B9M A;  3BTI A;  2BGC A;  3T5X A;  4C3J J;  2IGK A;  4XOR A;  5IYB J;  1B59 A;  2P6T A;  2V7F A;  2RDP A;  2DA4 A;  2UUZ A;  5A2Q Z;  3SQN A;  2VXZ A;  3AAF A;  1J75 A;  1HBX G;  3TDZ C;  5DV5 A;  3BP8 A;  2KIS A;  1JT6 A;  3ZQL A;  3SDG A;  2FX0 A;  5FRO A;  1TQP A;  3TO9 A;  1QZZ A;  3CJN A;  3FBI B;  3W2A A;  3JTH A;  3HRT A;  2X1C A;  4Y7N J;  5K5R A;  2AXL A;  4YIR X;  4XNF A;  3H0G J;  4G6T B;  1JGG A;  4E7S A;  3FHZ A;  3DKY A;  1YIO A;  1YG2 A;  4XOP A;  4NQW B;  2Q8K A;  1MBH A;  1RUO A;  2QQ9 A;  3TP0 A;  3GVA A;  2VJI A;  2FQ3 A;  3VYS B;  4HZF A;  2UWM A;  4Y52 J;  3ULQ B;  1UEL B;  2JSC A;  2OUM A;  2ZME C;  2RQQ A;  2VPR A;  3LA2 A;  4RLQ A;  1P7I A;  3X2Q H;  3OV8 A;  2EFO A;  3CJQ B;  1YW9 A;  4BNC A;  3KET A;  2PMZ N;  2M4G A;  5E1W A;  1SFX A;  5IT9 Z;  1JE8 A;  1SD4 A;  3T8R A;  4RB3 C;  4ZJZ A;  5DD4 A;  3DTK A;  1DDN A;  4G8X A;  4EM2 A;  5FB2 A;  1HDD C;  1XDS A;  1NHA A;  1J5Y A;  3SFI A;  1MSE C;  4ENJ A;  1TNS A;  4KMF A;  4C2U A;  3JRE A;  1HXD A;  2HPI A;  5EGO B;  1I5Z A;  3K7A J;  3B02 A;  1YFH A;  4GRI A;  2R5Z B;  3S2W A;  2ECC A;  3OYJ A;  4W1U A;  3CLO A;  3ZP5 A;  1PP8 F;  4HDV A;  4LB6 B;  1FT9 A;  2FNP A;  1PUF B;  3ZMV A;  1VTN C;  1UB9 A;  1R5I D;  1ZKG A;  4M3E A;  1IW7 F;  3I58 A;  2XF5 A;  3D5R C;  3RKX A;  2PN6 A;  2IA1 A;  1E3O C;  3RPU D;  2RVC A;  5J4Y A;  3F3X A;  5F08 A;  2HDW A;  5M5X J;  1BI2 A;  2MC4 A;  3SEQ A;  1FIP A;  1B8I B;  3WHC A;  5F27 A;  1TW3 A;  4XLP F;  2R4G A;  3FBN B;  3G1O A;  1GDT A;  2K9L A;  2P0W A;  1S29 A;  1WJB A;  3CMA I;  1R1U A;  4EM1 A;  2MLK A;  3EPZ A;  1Z7U A;  2KRH A;  1EH7 A;  1TC3 C;  2MH9 A;  3VPR A;  1KYZ A;  2NRA C;  2RC4 A;  1X1C A;  3R0A A;  1LUJ B;  3H9G A;  1SFE A;  3HPH A;  4P5O A;  2ZJ2 A;  1YIJ I;  1EV7 A;  3DEE A;  2K9S A;  4AYB N;  5C3E J;  4XKV A;  2XGD A;  3H3V K;  2Z5U A;  3FXU A;  5TRD A;  1R00 A;  3I9V 2;  1Z0X A;  3K4C A;  1LFB A;  2EIL H;  4BYY A;  3H9Q A;  3F0C A;  1E0E A;  2V6C A;  2COB A;  4WXD A;  1MJA A;  4EVI A;  3L2W A;  5HVQ C;  1QQI A;  1XGM A;  1HC8 A;  3WGG A;  2MSY A;  1BI1 A;  1KZH A;  4HAM A;  1MKM A;  3QWL A;  2K3F A;  3A01 A;  3FWE A;  3T0Y A;  2CQQ A;  2OZU A;  2GXG A;  2KKO A;  2IS2 A;  2M2E A;  3K70 C;  5EZH A;  3K1P A;  2QQB A;  3AG2 H;  1NG7 A;  5JR3 A;  2VC1 A;  2E5N A;  2Q1Z B;  1XGO A;  2Y2Z A;  1H88 C;  1WH7 A;  3E0J B;  3OYD A;  2EFN A;  1B4A A;  1QHH D;  3HM5 A;  2K5C A;  3KLN A;  3WU2 C;  2HEO A;  3DBL B;  4FT8 A;  2WAD A;  1DP3 A;  2ELJ A;  2RNJ A;  3CF2 A;  2FD5 A;  2EFW A;  1LQ1 A;  1WHU A;  1WWX A;  3QOP A;  4BQQ A;  1K83 J;  1L0O C;  4BUP A;  3CCL I;  2P5L C;  4EQQ A;  1XDU A;  3EET A;  2HFH A;  4HPQ A;  4XK4 A;  1Z3Y A;  4EEF G;  4NDL A;  3GTJ J;  3BOQ A;  3ABL H;  4KIG A;  2KIF A;  1LJ9 A;  2ESH A;  1OPC A;  4JP0 A;  4OAZ A;  4CCJ A;  3E6C C;  1E3P A;  3E5Q A;  1UCR A;  2AO9 A;  4IXA A;  2K9Q A;  4AD9 A;  1BM9 A;  2DFF A;  3ZR8 X;  2P5K A;  4N4N B;  1K78 B;  3BR6 A;  3TBI A;  3PQK A;  4RBO A;  2L7F P;  4BH9 A;  2CU7 A;  1YLF A;  3S3N A;  4CHU A;  2HNH A;  2DMT A;  4MLO A;  3M1C A;  3K4L A;  1N77 A;  1VI0 A;  5E20 A;  3LOC A;  1FJL A;  5L3D A;  1UST A;  3BRO A;  2BW3 B;  3VYT B;  1IV8 A;  4HNT A;  2KHM A;  4HBL A;  4UVC A;  4IOA F;  2VE8 A;  1FY7 A;  2ZXW H;  2F5E A;  3UKG A;  3FF5 A;  4OMZ A;  1F43 A;  1H0M A;  1WFX A;  2K4B A;  1R1V A;  5DCF A;  5AON A;  4D5F A;  1AA7 A;  2DFE A;  3COA C;  1Z9C A;  4BE1 A;  2KT0 A;  2VN2 A;  4ENN A;  4LLG F;  3HZJ A;  3KP6 A;  1IRF A;  4AWX B;  1Y8Q B;  3GTL J;  3S2H J;  2LOO A;  4FAS D;  4JK1 X;  3V8J A;  4BS9 A;  2M8G X;  2V26 A;  3PQJ A;  2EPF A;  3G73 A;  1LFP A;  2F48 A;  1YYV A;  5H20 A;  3W6J B;  3QYF A;  4B1R A;  1HW1 A;  2L9S A;  1SEU A;  4CCK A;  2QM3 A;  3I3L A;  3I64 A;  2M34 A;  2DO7 A;  1FPQ A;  2D2W A;  4JYK A;  3QAH A;  4IHW A;  4XLE A;  3VEP A;  3DFG A;  4F55 A;  2YX7 A;  2JUG A;  1OYY A;  2GA1 A;  4L5J A;  3CUQ A;  3OIQ A;  3JRA A;  1YTY A;  5D5V B;  1TT0 A;  2W85 A;  4B3A A;  4N4O B;  1R71 A;  1WGX A;  3BZ6 A;  2NAZ A;  1LPQ A;  4OIP F;  3GYH X;  4OU0 A;  4LG0 A;  1STZ A;  5H6R A;  4RGX A;  4ENM A;  3FM3 A;  1B9N A;  1SC7 A;  1H8A C;  2K02 A;  4X1E A;  1ZK8 A;  4PCQ A;  3CDI A;  2DFI A;  2MYS A;  5HS9 A;  2DW4 A;  4E4H A;  3DTE A;  1ON2 A;  4WCG A;  4BXF A;  1VQK I;  1FIA A;  3BZC A;  3DU6 A;  4AID A;  1ZAO A;  2OPT A;  5DS9 A;  4D7N A;  3I4P A;  3DWL E;  3VDX A;  1JKR C;  3NEU A;  5K5Q A;  3JSO A;  4YFN F;  1IRG A;  5E3L A;  4KN7 X;  5E79 C;  1W36 D;  4X0G A;  3BCB A;  2GQQ A;  2K40 A;  4IHY A;  2PG4 A;  3MZH A;  4L0Y B;  1QNT A;  4GDF A;  2DK8 A;  2MAB A;  1I6H J;  1UHM A;  3KEQ A;  4V2G A;  4QIW N;  2FSW A;  2PX9 A;  5CVJ A;  2FML A;  4XKB A;  2LKX A;  3RKY A;  5FKK A;  4CCO A;  3SXY A;  2Y48 A;  4S05 A;  4Y13 A;  1HKQ A;  3HSE A;  4PJ0 C;  2PMU A;  1O7L A;  2FBH A;  3JRB A;  2MFZ A;  2IBD A;  1ON1 A;  3I56 I;  2L7K A;  3ZRG A;  3HRU A;  3SZT A;  3ZQH A;  2HYJ A;  4RMN A;  3SYT A;  5KNL A;  3HKZ N;  3U1D A;  1QVU A;  3WE2 A;  2DA2 A;  1BR1 A;  4XKW A;  2EFQ A;  4BQO A;  3MQ0 A;  1UJ8 A;  1Y8R B;  2VXD A;  3CP2 A;  5GP9 A;  1NK3 P;  1ZHF A;  1AOY A;  1MMS A;  3MCZ A;  2KLO A;  1J0R A;  3H5N A;  3DBH B;  3DCF A;  3LSJ A;  3GXO A;  5ED4 A;  2O6G E;  4KJZ A;  1MDM B;  2F5V A;  2W82 A;  2NYX A;  3T1B A;  3HOW J;  3RYP A;  4YFK F;  3Q5F A;  1U3E M;  1D1B A;  4BBR J;  4ON0 A;  1I39 A;  4EM0 B;  4G12 A;  3OOU A;  1X4O A;  5AIP A;  3IKT A;  1AKH B;  1LDJ A;  1ETQ A;  1J9I A;  3F8B A;  1FMV A;  4D1Q A;  4A3J J;  1MBK A;  4MQV A;  1JT0 A;  3IWF A;  2R7O A;  2DXI A;  4D0P A;  2B7E A;  5J8F A;  5D5W B;  4HQE A;  3WU1 B;  1I1G A;  1U0J A;  1ZG3 A;  4PJM A;  3ASO H;  2WC2 A;  3WGH A;  4ESJ A;  1H89 C;  3IHU A;  4L5I A;  1PUF A;  1GVD A;  1VQL I;  1IRZ A;  2E19 A;  1R58 A;  3FXK A;  3LNQ A;  4HDU A;  4I6Z A;  1Y56 A;  2BY0 A;  1VQN I;  4A3E J;  1S72 I;  3QU3 A;  5EG0 B;  5HLI A;  5ICF A;  2BEO A;  5L3E A;  3L9F A;  3ASN H;  2STW A;  4C3H J;  3ZMS A;  3TW7 A;  4L18 B;  2I8D A;  3M1E A;  2BV6 A;  2QSF X;  2A5Y B;  1JJ8 C;  2EB7 A;  1QPM A;  2I5U A;  4RDU A;  1LB2 A;  3A02 A;  2X6W A;  1XMX A;  5C44 J;  3BQY A;  1MMA A;  2QGU A;  2IGO A;  3L00 A;  2R7X A;  1I27 A;  2FJ1 A;  2ZO4 A;  1WSU A;  2KL4 A;  2HKX A;  4DNC A;  2D5V A;  4E7Z A;  1HOM A;  4MFD A;  1JUM A;  3EUH C;  4MFE A;  3GME A;  2FBI A;  1ODD A;  5E17 F;  3IAM 2;  4MNU A;  4EV0 A;  1WH5 A;  3HXL A;  1UAA A;  3B73 A;  3CMY A;  1BIA A;  3UNG C;  2OCC H;  2GM4 A;  4A0Z A;  4V2F A;  2CQX A;  3RQ4 A;  2AHQ A;  3VWB A;  2DOF A;  3KYL A;  3HYI A;  3ZQ7 A;  2PEX A;  4GO1 A;  4CH7 A;  1JHH A;  1BR2 A;  2HDD A;  3DPT A;  3MMY B;  1FNN A;  3LSI A;  5HNF A;  2EIN H;  2HQR A;  3K69 A;  2KDO A;  2JA2 A;  3S3M A;  4IEJ A;  1ORK A;  3WG9 A;  3ZMZ A;  4X6A J;  1ZG5 A;  4I98 B;  3I0T A;  4PK4 A;  5FGM A;  2A61 A;  3IRQ A;  5K7F A;  2EZL A;  4HYE A;  2M45 A;  2PJP A;  4HLY A;  1U2W A;  1U9O A;  2VBW A;  4RGS A;  2GA2 A;  3VFZ A;  1ITY A;  4LFU A;  2CRG A;  1SFO J;  3KP3 A;  2LSO A;  3NWT A;  4DQ2 A;  2MA3 A;  4DGW B;  2VPL A;  3KPH A;  1JKQ C;  3E5X A;  2VKD A;  3QQA A;  4AIJ A;  2DMU A;  1RR7 A;  5CLS A;  3TW6 A;  2UV1 A;  1OCC H;  2NS7 A;  2BVM A;  4FIS A;  5LRS A;  4EGZ A;  3HDD A;  1K78 A;  2EIK H;  2E71 A;  2V1X A;  2CW7 A;  5F0H A;  5JFR A;  1WKM A;  1YS6 A;  2KZG A;  2Q0O A;  1LDK B;  2YS9 A;  2DDA A;  1HST A;  4PJL A;  3G6E I;  5IYD J;  3BG6 A;  3KLO A;  4EJO A;  1UHW A;  5K5O A;  3MKL A;  3AG1 H;  2WY7 Q;  1R9T J;  5H2F C;  3K4M A;  5K7H A;  2BW3 A;  1B6A A;  3HUG B;  2VIX A;  3NWS A;  1V54 H;  3Q9S A;  4CYC B;  1A04 A;  3ECO A;  2PMH A;  4AVZ A;  1H9T A;  2DPD A;  1QHG A;  1GXP A;  2JRM A;  4MIM A;  2WTE A;  2RNG A;  3JCU C;  5EEH A;  1R23 A;  4LOC A;  4UY8 I;  1OMI A;  2OAZ A;  4L9V A;  4Q48 A;  3WG7 H;  2GBY A;  1D5V A;  2DK5 A;  2HGC A;  3OYF A;  2M4K A;  2KRC A;  1SD5 A;  1ZH5 A;  2NNY A;  5BOX A;  4C2M J;  1TL8 A;  2F4O B;  2P5V A;  4IHT A;  2B63 J;  3TOB A;  4Y4R A;  1AU7 A;  2XB0 X;  2LRE A;  3WU0 A;  2ELH A;  3K1M A;  2FXA A;  2K86 A;  2WAQ A;  2FRH A;  3MD2 A;  4OIO F;  3HOV J;  1Z67 A;  4ESB A;  1Z21 A;  1IN8 A;  2ZKZ A;  1ZGJ A;  3E6B A;  4U88 A;  1KYW A;  4G7Z F;  3J7A O;  1S8N A;  1J59 A;  3DKW A;  2FA5 A;  1MJ9 A;  1W7P A;  3ELK A;  4A3L J;  4CUG A;  3L2R A;  2CSO A;  1IUF A;  5HLG A;  1IGN A;  1LVA A;  3QPT A;  1TTY A;  1XG1 A;  2E2J J;  2ADU A;  3HSR A;  3LSH A;  2WB1 A;  2P7V B;  1G3Y A;  4XLH A;  2EIJ H;  2EZH A;  4R8H A;  1JKP C;  3PJR A;  3LSG A;  2VBX A;  2XPU A;  3LA3 A;  4IOC F;  2GOX B;  2L0K A;  3A0H C;  2VKV A;  1MBE A;  2Z2S B;  3C1D A;  3PM1 A;  4HV5 A;  4I76 A;  3ZCO A;  2EFP A;  2RRE A;  4KYW A;  4HOB A;  2CWE A;  4C30 A;  2G7H A;  5E3M A;  1KU3 A;  1T0F A;  1FTZ A;  4KUM A;  3VSL A;  3K4N A;  2DMN A;  2HOA A;  2MBF A;  2HWV A;  2L01 A;  5HLH A;  3F21 A;  2DYS H;  5LHH A;  2DT6 A;  5DYM A;  3BLY A;  5D5U B;  2A6E F;  2IS1 A;  3M07 A;  4XOT A;  1OR7 A;  3B6A A;  3EYY A;  4H4K C;  4IVN A;  5TJJ A;  3GBG A;  2HTS A;  1POG A;  1J09 A;  3FKJ A;  3WGI A;  3F8C A;  4DJA A;  2CV2 A;  2DTZ A;  2NS0 A;  4HNV A;  1SMY F;  1ETX A;  1XC5 A;  1T98 A;  2QEN A;  3J80 K;  3G71 I;  2YPR A;  4H0E A;  5C4X J;  2GXA A;  2VE9 A;  2XDV A;  2L54 A;  2OJE D;  3OSG A;  3CES A;  1OCP A;  5GAD J;  3PO2 J;  1RZ4 A;  3SHF A;  1Z77 A;  4O5V A;  4J00 A;  4XN3 A;  3I54 A;  4BDY A;  2VBZ A;  3SFZ A;  1U5T A;  3CCE I;  4A0Y A;  4LLN A;  2HXO A;  4N0B A;  3V4G A;  2V9P A;  2STT A;  4D7M A;  4EJT A;  4B09 A;  1ERD A;  4BJ5 C;  2XF7 A;  5CVU A;  3DLL F;  4A3C J;  2LKP A;  1ZRE A;  5BMZ A;  2QQA A;  5J6X A;  3L2U A;  2JPB A;  3P9K A;  3JSP A;  2LF8 A;  3MVP A;  4YG2 F;  2E60 A;  4HLX A;  1BA5 A;  4XRF A;  5DM7 F;  2E1M C;  1MDM A;  1R22 A;  1QBJ A;  4L0Z B;  2L7M P;  1YE9 A;  4KNY A;  2HR3 A;  2VI6 A;  3LFU A;  4IRH A;  4A3B J;  5F04 A;  3DU5 A;  4B47 A;  2IXS A;  4PGH A;  3J81 Z;  1AKH A;  5LEK A;  4UV8 A;  2R7S A;  1SVL A;  3ABK H;  4F91 B;  3C18 A;  5KK1 A;  1XCB A;  3OSF A;  2WWY A;  2GIV A;  3WTW C;  4A5N A;  3PFY A;  5IY5 H;  1JXS A;  3R61 A;  1FBU A;  2DJI A;  1S3J A;  3ERM A;  2FOK A;  5IT3 A;  1USS A;  1D0Z A;  1HDP A;  1OJL A;  3HTU A;  4RAF A;  3FXO A;  1APL C;  2L9N A;  1SFU A;  3FZV A;  5J47 A;  4ETS A;  3J80 Z;  5CVI A;  2DOA A;  4XLA A;  2JMW A;  3BR2 A;  1X3Z B;  2MH2 A;  2Y30 A;  1ETW A;  1MGT A;  5M5W J;  2DOD A;  3LSM A;  2QKL B;  5B3S H;  4YEJ A;  2VOP A;  1R4M B;  3SZG A;  1QZY A;  1I1S A;  2E1O A;  1T2K A;  3GZ5 A;  2XGC A;  4YII A;  4BEH A;  4Z2Y A;  3ZQC A;  4R1H A;  3WTY C;  2KIQ A;  1MW7 A;  3ABT A;  4CA0 A;  3H3U A;  1RC9 A;  1P7J A;  2G7U A;  3K2A A;  2KZV A;  3VB2 A;  1VND A;  4FHT A;  2W24 A;  3BJA A;  4PJN A;  3JRI A;  2IS4 A;  1SFK A;  2EBI A;  4A6E A;  1PDN C;  2DN0 A;  3BY6 A;  5GTH C;  2IEK A;  4O3M A;  2XKP A;  1G4D A;  1XCV A;  5CQG A;  3FMR A;  5GTI C;  4DIQ A;  3BTL A;  2LKS A;  2H8W A;  4ZYG A;  3R6S A;  4LIV A;  3ZQQ A;  4ZTF A;  3L09 A;  2BYV E;  5D4R A;  2XV4 S;  2E36 A;  1XGN A;  3L2V A;  3IUO A;  4RB1 A;  3D5L A;  4EJU A;  2FMY A;  3OL3 A;  2H6B A;  1V4R A;  2XAH A;  2M8E A;  3O6B B;  1N25 A;  3OYI A;  4F92 B;  2X4H A;  2XAU A;  3H1C A;  3IH3 A;  2R7V A;  1SD6 A;  1MNE A;  4LMY A;  1R7J A;  3E97 A;  2PQ8 A;  3RTR A;  5IOZ A;  3K70 D;  1U6G A;  3BG9 A;  3ZMU A;  4PFP A;  3RPQ A;  1DUX C;  4KMU X;  1LKX A;  1ZLK A;  4RGU A;  2DYR H;  2A05 A;  2BZT A;  3F6V A;  3TL4 X;  1UG2 A;  2CW8 A;  1XS9 A;  1P2F A;  2W4S A;  5KAI C;  2DI3 A;  4BHC A;  3BWG A;  1BL0 A;  3PIO F;  2XUB A;  5EYR A;  3KFW X;  3WE3 A;  1X2N A;  2ELK A;  1IF1 A;  3F6O A;  4G6D A;  2HU9 A;  4LK1 F;  2OTL I;  2Y9Z A;  2VON A;  4XRS A;  2E7W A;  2A5W A;  2ZB9 A;  5FFX A;  3P7N A;  4A5M A;  1Z3X A;  3C7J A;  3GO5 A;  3T8T A;  3U21 A;  1T38 A;  5CQE A;  2ID6 A;  1HKS A;  1TWC J;  2DA6 A;  4MQ9 F;  3R4K A;  2FE3 A;  2LC2 A;  2PI0 A;  2ZCW A;  2NVX J;  1J7K A;  4UUT A;  2M7B A;  4C9Y A;  1TP4 A;  4KIS A;  1IRX A;  4UNO A;  1RRJ A;  1H9G A;  4KIB A;  2DA3 A;  3RCO A;  1MBJ A;  3FXL A;  1FYL A;  3HC7 A;  2ZFW A;  4CIC A;  2HYG D;  1W1W E;  2XSD C;  2QSG X;  4Q4Z F;  3OS0 A;  1XPX A;  4LG3 A;  3S1M J;  2R7W A;  5BPI A;  2CUF A;  2DTR A;  5BNG A;  1YIT I;  4FET A;  4PFO A;  4BBS J;  3G3Z A;  1PUE E;  3HHH A;  4S04 A;  3L7W A;  4U0V A;  5B66 C;  5KAF C;  3HUG A;  2ZNZ A;  4CYC A;  1O3T A;  4I2O A;  4UUV A;  1RNL A;  1T95 A;  4GXO A;  1B72 B;  1MIJ A;  5GPA A;  1FC3 A;  2DMP A;  3HIF A;  4CCN A;  2WAF A;  5B1A H;  4A3D J;  4I0B A;  1VQM I;  3GTM J;  1ZR2 A;  4ZYE A;  3OWT A;  1YHQ I;  1LVK A;  3OR2 C;  4GYG A;  5HDN A;  2V1N A;  1XTA A;  2E1N A;  3FXM A;  2LY1 A;  4V19 K;  3C2B A;  3MEX A;  2X6Y A;  1WVR A;  3BG3 A;  4RS8 A;  2H09 A;  3BDD A;  2HVS A;  1GV2 A;  1QZE A;  5FKL A;  2VJ5 A;  5LD2 C;  2ESN A;  3GFM A;  3CCJ I;  4QPO A;  1ZAR A;  3I59 B;  5CKT A;  3J7Z I;  2CQN A;  4NBQ A;  2IRF G;  1MD0 A;  2EK5 A;  3JRC A;  4PSX A;  1G8X A;  4ZTJ A;  5FKN A;  3GLX A;  3LQR A;  4ABZ A;  1JUP A;  4M71 A;  2LFB A;  2H1K A;  1OCZ H;  3OYB A;  2VJ4 A;  5J8C A;  2P81 A;  4ZYA A;  1TZL A;  3EUK L;  4OOI A;  2FNA A;  3HGG A;  3CP8 A;  2FEZ A;  3LQQ A;  3F23 A;  1IC8 A;  3K4J A;  2Q2E A;  5D8L B;  2A3S A;  1OCO H;  1FEX A;  2K85 A;  2L9R A;  3W2V A;  4MGR A;  4XM3 A;  1BW5 A;  3I71 A;  3CCY A;  2EJR A;  3RPU A;  4U7D A;  3JW4 A;  4I7H A;  4Y33 A;  4ZZD A;  3FHN A;  4ANJ A;  4L9N A;  1FBQ A;  3FDY A;  2H8R A;  2O9L A;  4B43 A;  1IN4 A;  2R5Y B;  3K4B A;  2HQN A;  1VQ5 I;  2VOO A;  2KJC A;  2LH9 A;  2OZ6 A;  2WA0 A;  1K4T A;  1A31 A;  3FMQ A;  1EH6 A;  2M1B A;  3KEY A;  2ACJ A;  3BR3 A;  5IYC J;  1C0W A;  1MJB A;  4FX4 A;  2V1U A;  2HYF A;  2R3S A;  5D8K B;  3B6C A;  4BU2 A;  4XQF A;  3HJE A;  3W6K B;  3W2W A;  3GZ6 A;  2ZFU A;  2Z1D A;  3CDL A;  3LL7 A;  4ZDL A;  3H5R A;  3ZPL A;  1DU6 A;  2VC0 A;  1WI3 A;  1KA8 A;  2X9D A;  1HA8 A;  1P4A A;  2IS6 A;  4XN0 A;  3KP7 A;  4GGG A;  4U0Y A;  3QYB A;  1SVM A;  3PNY A;  1RR8 C;  1IUY A;  3CO6 C;  2XGX A;  5D6F A;  2H6C A;  5F1R A;  5B5E C;  2OU2 A;  3BR0 A;  4HEA 2;  1BR4 A;  3GEZ A;  4BE0 A;  2LYC A;  4WWC A;  2Y75 A;  3LAJ A;  4IHX A;  3ONQ A;  2JA5 J;  4NQW A;  1IN7 A;  4BY1 J;  1GXQ A;  5FD5 A;  2ZJQ F;  1MMD A;  4HF1 A;  3GFI A;  1OQY A;  1YW7 A;  3H36 A;  1X19 A;  3V8K A;  2WY8 Q;  5HNH A;  2E1C A;  2KIM A;  2MC3 A;  3AKZ A;  3KZI C;  5GAH J;  4IRI A;  3A03 A;  4IKF A;  4CCL A;  5EF6 A;  4BE2 A;  2X48 A;  3H5A A;  2B0L A;  4IPA A;  1VQ8 I;  2Z9O A;  2WAQ N;  3AG4 H;  1R1T A;  5E3N A;  2AXT C;  2I10 A;  2LK2 A;  3MN2 A;  4HQM A;  4KFC A;  2FF4 A;  3EDP A;  3M8J A;  1A5J A;  1UMQ A;  3CTA A;  1F4K A;  3M8F A;  4ESF A;  3AL0 B;  2ZJP F;  2L3D A;  1REP C;  4XSZ F;  5EGO A;  4A3I J;  1Y0N A;  4IF4 A;  2F4M B;  4LD5 A;  3IWZ A;  2R5Z A;  2E35 A;  1V5E A;  5LGT A;  1BI0 A;  2JSP A;  5DUK A;  1Q1H A;  2YR2 A;  2WB1 N;  3ERE D;  1X1A A;  2AQE A;  4OIR F;  3RZO J;  2DMQ A;  1K4S A;  4AVP A;  5LRR A;  2Y0M A;  2HQA A;  3U1K A;  4UUS B;  4DBQ A;  3H92 A;  5GPC A;  1B8I A;  4OIQ F;  2MLG A;  3NAU A;  2CUJ A;  2GLO A;  1HF0 A;  2Y9Y A;  1VZ0 A;  1RUN A;  3FK7 A;  2C6Y A;  1PJR A;  1LFU P;  2JRT A;  1W5S A;  1OCR H;  3L1P A;  3DKX A;  3ISP A;  1I3A A;  3CQZ J;  4IZZ A;  1G6N A;  2VT2 A;  1VQ7 I;  1T56 A;  2F2E A;  3QYE A;  4K2E A;  1D0Y A;  5FLM J;  4GFB A;  2A6T A;  2Z3Y A;  2WBM A;  2KMU A;  4HX8 A;  3OMY A;  3I4N J;  4XR6 A;  4CZZ A;  4NNJ A;  4R79 A;  6PAX A;  2GZW A;  5D5X B;  4XSX F;  5IP6 A;  3P5J A;  5C4J J;  2OBP A;  2K27 A;  3GFL A;  2OTJ I;  3TKY A;  4FE7 A;  3OS1 A;  4M3B A;  1MBG A;  4DZJ A;  1JKO C;  5J1U A;  3OYL A;  2LNB A;  1U8B A;  4NC8 A;  1IDZ A;  4HX4 A;  2IPQ X;  2XPW A;  2P6S A;  3K4K A;  4M73 A;  5E1X A;  3S14 J;  1MH4 A;  4WK8 F;  3OYC A;  2HVQ A;  4RM3 A;  4M6X A;  2W00 A;  3IH4 A;  2K9N A;  1YO5 C;  4J01 A;  4B8X A;  2VJJ A;  2LD5 A;  1W5T A;  3RDI A;  1QRY A;  3P9I A;  1T0F C;  2XAF A;  3C2H A;  3HOX J;  4A69 C;  3H0D A;  2DAO A;  2ZNY A;  2RKH A;  4G7H F;  4P96 A;  1ZR4 A;  3FIS A;  4PUS A;  4TV7 A;  2HOE A;  1OR7 C;  2YX4 A;  3D0S A;  4AU7 A;  1FZP B;  5CJ9 A;  3OOP A;  3E1S A;  2KQR A;  4IQ4 A;  1O7F A;  3BPX A;  5GAG J;  1Z6T A;  2BHY A;  5DDG A;  2QF7 A;  4ZYH A;  2O5R A;  2ZC2 A;  4DBR A;  5M3M J;  2LRD A;  3IV5 A;  3BT9 A;  5JLW A;  5J4V A;  5TGT A;  2L4A A;  1OIS A;  2QYO A;  1AWC A;  2P4W A;  5JLX A;  1ZTR A;  2WAE A;  1BJZ A;  3RI4 A;  4RA2 A;  2UZK A;  3KYD B;  1U5T C;  1SD7 A;  2ICW G;  3K0L A;  2A07 F;  2DA1 A;  3ZN0 A;  3GW2 A;  1FOW A;  2XSJ C;  4AIH A;  1DU0 A;  2Z16 A;  5GAE J;  1W4M A;  3FM5 A;  4AUX A;  2W48 A;  4BDZ A;  2CMP A;  1F9N A;  3C3W A;  2OQG A;  4BHB A;  1B72 A;  1VQP I;  2M7A A;  2R0Q C;  2QVO A;  2Z99 A;  3DLA A;  4YEL A;  2YUS A;  3JAM K;  3OYM A;  3CZ6 A;  3RKQ A;  1YRN B;  4RLF A;  3K2Z A;  1YJ9 I;  2ZXJ A;  4CSW A;  3CCS I;  2E1M B;  3IH2 A;  1NG6 A;  4F93 B;  4W97 A;  3GCM A;  1ETY A;  2L5Q A;  3TO6 A;  4DYR A;  4KDP A;  3WTV C;  3V7R A;  4C2T A;  2A6H F;  3LSR A;  3Q0V A;  3HEF A;  2G0E A;  5ILV A;  1YJN I;  5DTD A;  1D5Y A;  2ZME B;  3HOT A;  3PIP F;  4JX6 A;  1IO2 A;  3RIR A;  2VOD A;  4IX7 A;  2BY2 A;  4UXN A;  2JN6 A;  1HW2 A;  4AIK A;  1S7O A;  2BE5 F;  1ENH A;  4YFX F;  3DXJ F;  1U8R A;  1RPW A;  2DCE A;  2EV5 A;  3NAR A;  2ME6 A;  3QP5 A;  4XRM A;  1Z91 A;  1DGW Y;  3QOD A;  3M3Y J;  3E7L A;  3L2Q A;  3I4M J;  4M6V A;  5IP7 J;  4JBA A;  5DD8 A;  2D1V A;  1TQI A;  1K79 A;  3M4O J;  1IV6 A;  1LNW A;  1EKE A;  3ABM H;  1ZRD A;  2CUE A;  1ETO A;  1HCR A;  3H3Z A;  3KYC B;  4ITV A;  3ZQG A;  1FWZ A;  2X1D A;  1ONV A;  1UG0 A;  1K6O A;  1O3R A;  1FTT A;  5ICG A;  2QEX I;  3RSN A;  2HVR A;  1E17 A;  3CJR B;  1P6R A;  1IAW A;  2RV8 A;  2O8K A;  1YOV B;  1D8K A;  4XON A;  2VQH A;  2H27 A;  3HL2 A;  1TW2 A;  5JVG F;  3GTP J;  4WXC A;  4QTR A;  2JPC A;  3CC7 I;  1W5C C;  3JAM Z;  4XID A;  4ZDO A;  3S93 A;  2XRO A;  2R5Y A;  2IP2 A;  2DJN A;  2JA7 J;  5M5Y J;  2O03 A;  1U9N A;  1YS7 A;  4BXU A;  3LSP A;  5DUI A;  3RKW A;  2CG4 A;  1MND A;  2ZSH B;  2DDB A;  2XB5 A;  3LST A;  2K4J A;  3W3C A;  1XB4 A;  1Z6R A;  4ENK A;  2EQR A;  4BQA A;  4I0A A;  4RB0 A;  5KCM A;  2GIZ A;  3DPU A;  4MEY F;  3S8P A;  2QQ8 A;  1R4N B;  5CYV A;  2O3F A;  4U7B A;  1TWA J;  1ZG1 A;  4LIT A;  3AFH A;  1D0X A;  3ROU A;  2CS3 A;  2EH3 A;  3V8L A;  3G1M A;  4OWR B;  1FOK A;  4WXH A;  1S5L C;  2HPM A;  2BOL A;  5B1B H;  5J3L A;  3PSI A;  1R36 A;  2ME0 A;  3SZP A;  2XGE A;  4CCM A;  1FSH A;  4O6J A;  1R49 A;  4QSH A;  5EEA A;  1SAX A;  2L2O A;  2YU3 A;  3WTU C;  1F36 A;  3HHG A;  2HI3 A;  2ZSI B;  4Q47 A;  5HS7 A;  1Y39 A;  2MD0 A;  3FKI J;  4M3G A;  4A3G J;  1J2X A;  1YQA A;  2X85 A;  3WOD F;  4E70 A;  2GWR A;  3JRF A;  1Y0U A;  1SVO A;  4HRI A;  4XBF A;  2CYY A;  2N8G A;  1MMG A;  2Y0S A;  2NVQ J;  2L02 A;  2X0L A;  3FXR A;  1G2H A;  3VSK A;  2HDC A;  4JQF A;  2K3P A;  3H35 A;  2DA5 A;  5FRN A;  5FKO A;  2L9V A;  2JA6 J;  3KE2 A;  2IVM A;  3F9K A;  2HZD A;  3P9C A;  2CO5 A;  4IO9 F;  2VL8 A;  1E3H A;  2K9M A;  3FK6 A;  3CC2 I;  2XKO A;  2TRT A;  1LE8 B;  2XAJ A;  4Q5S F;  3HBL A;  4WF2 A;  1NTC A;  3KEO A; 
#chains in the Genus database with same CATH homology
 3HOW J;  1B72 B;  2CJJ A;  4BBR J;  5GPA A;  2DMP A;  4G12 A;  2XRL A;  3OOU A;  4A3D J;  3BQZ A;  9ANT A;  3GTM J;  1AKH B;  1ZR2 A;  3GTO J;  1ETQ A;  5E3O A;  2O7O A;  4A3J J;  1MBK A;  5F0F A;  1JT0 A;  4A3K J;  3QPS A;  2LTP A;  3Q0W A;  5EG0 A;  3RQI A;  4A93 J;  3C2B A;  3JR9 A;  4UUS A;  3BG3 A;  2LLK A;  3HOY J;  1QPI A;  3HGY A;  1H89 C;  1GV2 A;  4M3F A;  1IDY A;  5FKL A;  3OIO A;  1PUF A;  1GVD A;  3W6V A;  1IRZ A;  1BW6 A;  2E19 A;  3LNQ A;  3S1N J;  4I6Z A;  4BXX J;  4A3E J;  5EG0 B;  3JRC A;  1MNM C;  1MH3 A;  1QVT A;  1TWF J;  5FKN A;  5FJ8 J;  3O8H A;  4ABZ A;  1JUP A;  2LY9 A;  2LFB A;  2H1K A;  4C3H J;  5J1Y A;  3TW7 A;  3S1Q J;  2P81 A;  5EDN A;  1JJ8 C;  3HGG A;  4RDU A;  2LP0 A;  3BTC A;  3A02 A;  1IC8 A;  1MBF A;  3BQY A;  5C44 J;  3DEW A;  2FJ1 A;  1FEX A;  2YU9 J;  2D5V A;  3GTQ J;  1HOM A;  2L9R A;  4MFD A;  1JUM A;  4MFE A;  4DW6 A;  1BW5 A;  3CCY A;  1AHD P;  1IJW C;  2JJ7 A;  1WCM J;  2E2H J;  2FQ4 A;  2H8R A;  2O9L A;  2R93 J;  1WH5 A;  5FLV A;  2R5Y B;  2X6O A;  3CMY A;  5IOY A;  2M0C A;  5F1J A;  2MG4 A;  2GM4 A;  4V2F A;  3BR3 A;  2CQX A;  2L7Z A;  5IYC J;  2AHQ A;  5FKM A;  5IP9 J;  2DA7 A;  3RZD J;  2JA8 J;  2TCT A;  3B6C A;  1T33 A;  2HDD A;  4S0H B;  1X58 A;  3BR1 A;  3CDL A;  4IEJ A;  1ORK A;  1U78 A;  1DU6 A;  1WI3 A;  4X6A J;  2X9D A;  3GTK J;  4A3F J;  3HOU J;  1MSF C;  3D1N I;  5K7F A;  2EZL A;  3BTJ A;  3TED A;  1U9O A;  2RAE A;  1ITY A;  2CRG A;  1SFO J;  2OF7 A;  3BR0 A;  3BTI A;  4C3J J;  5IYB J;  4IHX A;  1JKQ C;  2DA4 A;  1GV5 A;  3QQA A;  2JA5 J;  2DMU A;  1Y1V J;  4BY1 J;  1RR7 A;  1YRN A;  3TW6 A;  1EF4 A;  4DYC A;  2NS7 A;  1JT6 A;  4FIS A;  3ZQL A;  3SDG A;  2FX0 A;  3HDD A;  4Y7N J;  3A03 A;  3GTG J;  3H0G J;  1JGG A;  3SJM A;  5F0H A;  5EF6 A;  4IHV A;  2X48 A;  2YS9 A;  1GT0 C;  1MBH A;  2WAQ N;  5IYD J;  3TP0 A;  5E3N A;  1JJ6 C;  4Y52 J;  3MN2 A;  2I10 A;  2LK2 A;  3MKL A;  1A5J A;  2R7Z J;  1ETV A;  1UMQ A;  1R9T J;  4DYQ A;  5K7H A;  2VPR A;  4CYC B;  2NS8 A;  1P7I A;  1W0U A;  1OCT C;  5EGO A;  4A3I J;  2R5Z A;  2PMZ N;  4MIM A;  4LOC A;  2WB1 N;  2GBY A;  3RZO J;  4D5C A;  3Q0U A;  2DMQ A;  1HDD C;  2E2I J;  4B4C A;  3O8G A;  1Y1W J;  3SFI A;  1MSE C;  2HQ5 A;  4C2M J;  1WPK A;  5HOD A;  5EGO B;  4UUS B;  3JRE A;  3K7A J;  5GPC A;  1NK2 P;  1B8I A;  2B63 J;  2R5Z B;  3NAU A;  1AU7 A;  2ECC A;  2XB0 X;  2GLO A;  4W1U A;  1HF0 A;  2Y9Y A;  4JX5 A;  3HOV J;  3FK7 A;  5M3F J;  1PUF B;  1LFU P;  3L1P A;  1JTX A;  1HLV A;  1ZKG A;  4M3E A;  2ID3 A;  3CQZ J;  1T56 A;  1E3O C;  5FLM J;  4GFB A;  4A3L J;  3WHB A;  5F08 A;  1IUF A;  1IGN A;  3I4N J;  5M5X J;  1XG1 A;  2E2J J;  1FIP A;  4J19 A;  1B8I B;  5EZG A;  3WHC A;  5F27 A;  4XRS G;  1K61 A;  3G1O A;  1GDT A;  5IP6 A;  1JTY A;  3BR5 A;  2JWT A;  2R92 J;  5C4J J;  2EZH A;  1TWG J;  4FE7 A;  1JKP C;  3LSG A;  2XPU A;  4M3B A;  1MBG A;  4DZJ A;  1JKO C;  2HOT A;  5J1U A;  1TC3 C;  1U8B A;  1IDZ A;  2L0K A;  1RES A;  3S1R J;  3VPR A;  2VKV A;  1MBE A;  2XPW A;  1JUS A;  3PM1 A;  4BKX A;  4I76 A;  2M9H A;  3HB9 A;  3S14 J;  1MH4 A;  5E3M A;  3IH4 A;  2K9S A;  2K9N A;  4AYB N;  1FTZ A;  5C3E J;  2XGD A;  3H3V K;  2DMN A;  2HOA A;  2LD5 A;  1OFC X;  1Z0X A;  1QRY A;  1LFB A;  2VUM J;  2EZK A;  3F0C A;  4L5E A;  3HOX J;  4BY7 J;  3B6A A;  2COB A;  4A69 C;  1I3Q J;  3GBG A;  1POG A;  3JRG A;  2DTZ A;  4HNV A;  1ZR4 A;  3FIS A;  2MSY A;  3BG5 A;  1ETX A;  1XC5 A;  2WV1 A;  2EZI A;  5C4X J;  3A01 A;  3OSG A;  4FE4 A;  1OCP A;  1CQT A;  2QF7 A;  3PO2 J;  2CQQ A;  1Z77 A;  1ETK A;  3IV5 A;  5M3M J;  2M2E A;  3BT9 A;  5EZH A;  5JLW A;  3S17 J;  4A3M J;  2HXO A;  5JLX A;  1ZTR A;  2Y2Z A;  1H88 C;  1WH7 A;  1BJZ A;  3HOZ J;  4D7M A;  3HM5 A;  1ZQ3 P;  4A3C J;  2LR8 A;  1LE8 A;  2DA1 A;  2FD5 A;  1RKW A;  1I50 J;  1K83 J;  1DU0 A;  3MVP A;  1ZGW A;  4AUX A;  1BA5 A;  2W48 A;  4FCY A;  4XK4 A;  2L7M P;  4EEF G;  4NDL A;  3GTJ J;  5F0C A;  1B72 A;  1A6I A;  2VI6 A;  2R0Q C;  3RKQ A;  4A3B J;  2YUS A;  4JP0 A;  5F04 A;  1YRN B;  4M3D A;  1AKH A;  2AO9 A;  2K9Q A;  3S2D J;  3IH2 A;  2MGQ A;  2Y31 A;  4W97 A;  1ETY A;  3JRH A;  3OSF A;  3BR6 A;  4DYR A;  3LSR A;  3Q0V A;  4RBO A;  3HEF A;  2G0E A;  2ECB A;  2L7F P;  2CU7 A;  2LVS A;  5DTD A;  4MLO A;  2DMT A;  1D5Y A;  1VI0 A;  4JX6 A;  1HDP A;  1OJL A;  3ZOB A;  1APL C;  2JN6 A;  3LOC A;  1FJL A;  2MW8 A;  1ENH A;  1RPW A;  2JMW A;  3BR2 A;  3NAR A;  2ME6 A;  5K7Z A;  4XRM A;  3M3Y J;  2Y30 A;  3E7L A;  1ETW A;  3I4M J;  4M6V A;  5IP7 J;  5M5W J;  3UKG A;  1F43 A;  1GUU A;  2E1O A;  4D5F A;  3M4O J;  1IV6 A;  2XGC A;  2KT0 A;  3QPL A;  2CUE A;  1ETO A;  3ZQC A;  1HCR A;  2NVT J;  3GTL J;  3ZQG A;  3S2H J;  4XIC A;  1VFC A;  2M8G X;  3S16 J;  1FTT A;  3ZQI A;  1P7J A;  3K2A A;  1VND A;  4B1R A;  2O8K A;  3JRI A;  2M34 A;  4JYK A;  4IHW A;  2VKE A;  2HXI A;  2EBI A;  3S15 J;  1S7E A;  4C3I J;  3GTP J;  2DN0 A;  4QTR A;  2HOS A;  2IEK A;  4XID A;  3JRA A;  4B3A A;  2R5Y A;  1WGX A;  3PO3 J;  2DJN A;  3BTL A;  2JA7 J;  5M5Y J;  1U9N A;  3FIW A;  3LSP A;  1Q1V A;  1H8A C;  2XB5 A;  4X1E A;  1ZK8 A;  2IAI A;  2EQR A;  5J1R A;  3IH3 A;  1FIA A;  2Y0S N;  2OPT A;  5DS9 A;  4D7N A;  5IOZ A;  1O4X A;  3BG9 A;  1JKR C;  1TWA J;  4FTH A;  5E3L A;  2EH3 A;  3Q3S A;  1UG2 A;  3G1M A;  1XS9 A;  2K40 A;  4IHY A;  3JRD A;  5J3L A;  1BL0 A;  1RKT A;  2JK3 A;  2ME0 A;  2XGE A;  1I6H J;  5EYR A;  4JX4 A;  1X2N A;  4V2G A;  4QIW N;  2ELK A;  4QSH A;  2Y9Z A;  5EEA A;  4XRS A;  2LKX A;  1F36 A;  2HI3 A;  5FKK A;  2ZB9 A;  2XPV A;  2QCO A;  1TWH J;  3FKI J;  4M3G A;  4A3G J;  4MO7 A;  4DZP A;  2ID6 A;  1TWC J;  2DA6 A;  3JRB A;  1W0T A;  3JRF A;  2IBD A;  3A01 B;  1IG7 A;  2NVX J;  4UUT A;  2N8G A;  1RET A;  3ZQH A;  3ZQF A;  2HYJ A;  2NVQ J;  2NVY J;  1VF9 A;  2DA3 A;  1G2H A;  2NOG A;  1MBJ A;  3HKZ N;  1QVU A;  2XSD C;  2DA5 A;  2DA2 A;  4AC0 A;  5FKO A;  2KDZ A;  2JA6 J;  5IPA A;  1X2M A;  3G1L A;  3S1M J;  3TP3 A;  2CUF A;  3FK6 A;  1SAN A;  5GP9 A;  5BNG A;  1NK3 P;  4BBS J;  2TRT A;  1LE8 B;  1UHS A;  3DCF A;  3HBL A;  3LSJ A;  4CYC A;  1NTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...