4BBSH

Structure of an initially transcribing rna polymerase ii-tfiib complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
134
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 22
structure length 134
sequence length 145
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4bbsH00
3FP9A 4ME3A 1AH9A 1XMQL 1ASZA 4B3SQ 4BXXG 4IFDG 5IT9c 1SLJA 3A74A 3D0FA 3MEFA 1VQMA 3KJOA 4NXML 1IBMQ 3ULLA 5M3MG 2MNAA 4LF9L 2LXKA 2D0OA 4C3JH 1Y1VH 1X6OA 2AWOA 2GVAA 1PH4A 1YJNA 2ES2A 1VQDA 2DUDA 4JI7Q 1X54A 1A0IA 2B3GA 1YI2A 2BA1A 4DR7Q 5IY0A 4POFA 1N32Q 2UXBL 1N34L 2YTVA 5C4JH 4DV4Q 4GNXA 1GVPA 1IBLQ 3HOUG 2XTIA 3EBEA 4A75A 5IYBH 1GD7A 1CKMA 4BBRH 5LMNQ 2JA5G 3K8AA 2OTLA 3L7ZC 3GTKH 2OQKA 1HH2P 2R7FA 1KRTA 5GADC 4QJFA 4P72A 1VQ8A 3S1QH 3CCEA 4RG1A 4K0KQ 4WJ4A 4A3LH 5ELNA 1CSPA 3S2DH 2K14A 1Q1BA 2GVBA 3CC4A 3M3YH 4BY7H 1CKNB 2JEAI 3CP0A 1MKHA 1VQJA 3GTGH 4B3RQ 3IRBA 4OWTB 2UUAL 1E3PA 1S40A 1NMFA 4JI0Q 2NVQH 2I0QA 3NENA 4OONA 2RHQB 1V1QA 4DR3Q 1XNQL 3HOVH 4A3EH 4GKKL 3RZDH 4YY3L 1K8AC 1XMOL 3OTOL 4X65Q 4DV5Q 1LTLA 4YHHQ 1XNQQ 1J6QA 2KCMA 4DV0L 1L1OB 3CPFA 4R4TA 4PZ6A 1X3GA 5HGQA 1QZGA 3BU2A 2OTJA 1VQ4A 3GTQH 4DK3C 2WFWA 3KF8B 4R4QA 2VQFQ 1EUJA 3HOWH 1JE5A 4DNIA 4B3TL 3UDGA 3CCSA 2KHJA 1Q8KA 3E9IA 4GNXB 4JBJA 4A3FG 1VQGA 4X6AH 2N78A 1PVOA 1Q12A 3I4NH 1KQSA 4JI6L 3W1GA 2PI2A 4HJ9A 3CXCA 1N36L 1HNZQ 3TRZA 1H95A 3RN5A 2R92G 4OWWB 5JJLA 1Z9FA 1JT8A 4DPGA 5C44G 4JI0L 2NZHA 1IBKL 3RZOH 4QL5A 4OWXB 1E7ZA 4ALPA 2N3SA 3AEVA 4A3JG 1WI5A 4JOIC 1XNRL 1AE3A 4A3IH 1YBYA 2HT1A 1B70B 4GOPC 2I5LX 3OTOQ 4DV5L 1PH5A 1IL2A 2UXCQ 1PYSB 1E24A 4YWKA 3I4MG 4IJLA 1XMQQ 4LW1A 4B3SL 1HNWQ 1GM5A 4DV6Q 1X56A 2YYZA 1QVFA 4DKAC 1PH2A 2MO1A 4JI1Q 1S72A 4LF6Q 4JV5Q 4LF7L 4YCUA 5BR8L 3S16H 1NMGA 2IHEA 4R4CA 1QVGA 1WJJA 3GTLH 4QIWE 4YWMA 2UU9Q 3HOYH 1I5FA 1JMCA 2ALYB 4AQYL 1L1OA 3GO5A 2EXDA 3H3VH 1BKBA 4JCVE 3A5UA 1G6PA 1VQCA 1IBKQ 5J3BA 2YU9H 4AQYQ 2WAQG 1E22A 3PO2H 3PCOB 4IO9A 3KDFB 2VQEL 1EQRA 3FKIH 1NY4A 1HZAA 1X3FA 1LUZA 4GKJL 1LM0A 1IYJB 2ATWA 1K83H 2UXDL 2VUMH 4DV7Q 2R7ZH 3KOJA 4A3FH 2XGTA 3A0JA 1QZHA 1HR0Q 4JI3Q 4LFBQ 1OTCA 1U0LA 2CQOA 2N8NA 1M1KC 1CKNA 2E2HH 1WFQA 5FLMG 1EOVA 3UE0A 5FJ8G 2I5MX 3HFZB 1PH6A 1WCMG 4LF8Q 4LFCQ 3PO3G 2IHFA 2ZTCA 1I50H 4BY1G 3NEMA 1IXRA 4C3HH 5HY6A 5AJ3Q 2Q2TA 4OO1G 1KXLA 2JA7H 2A19A 4A3BH 1KRSA 3CPWA 4A3EG 3HOVG 4HJ5A 2JA7G 4IFDI 1FJGL 2K4KA 3M4OH 2WB1G 4BY1H 3BJUA 3CCJA 4DUYQ 4JBWA 4PZ7A 4QY7A 1A62A 3PUZA 4JI2L 3HOXH 5FLMH 1VQLA 2OWOA 1NJIC 2BH2A 2Z6KA 4DR1L 3PGZA 5IYDG 2UUCL 5IWAL 1XTDA 3D31A 3UE1A 2JEBI 4A3LG 4LUOA 3WWVA 1O7IA 2RCNA 3EN2A 1N9WA 4DV3L 5GQOA 2R6GA 4UP9A 1XPRA 3CW2C 1T9HA 2Q2UA 3DLLA 2UU9L 1M90C 2AKWB 4POGA 4MNOA 2VUMG 1VS0A 4JI5L 1VQ6A 3UDFA 1I3QH 3HOUH 3S15H 3PUXA 5M5XH 5K36G 3RLFA 2NVXH 2ASBA 2AHOB 1WOCA 1B7YB 3PIOA 3CMEA 4A93H 2PMZE 1HNXL 2R93H 4XIGS 2ZJPA 4A3GH 1PH7A 1UE7A 4O2DA 1EYGA 1KL9A 4TVAB 2V1CC 3NBHB 1K0RA 1VQOA 3U4VA 4IPCA 1Q81C 4JV5L 1D7QA 3GD7A 3U58A 1K73C 2ZTEA 1P16A 3PF5A 4DR2L 1N33L 4DV7L 3SGIA 1VQKA 3S2HH 3HOZG 3HOZH 1FL0A 4NXMQ 4GNXC 4BXXH 2NVYH 1UEBA 3CQZH 3HKZE 2OCEA 4LF9Q 4JBMA 3GDEA 4HIKA 3K81C 1Q82C 4AYBG 1FGUA 2NN6G 4B3MQ 3T1HL 4A3GG 4BBSG 2YTYA 4B3RL 2R93G 1YHBA 4X66Q 3S24A 3PSIA 4IOCA 4A3JH 2K5HA 5IP7H 3AFPA 1PH9A 4A93G 3KDFA 2VNUD 5LMNL 4GOPB 2Y0SE 1FJGQ 4Y52H 3ULJA 1PH3A 4A3DG 3ULPA 3TREA 3JAMi 3KF6B 1KIXA 1CKOA 3PV0A 3ER0A 4GLAC 3UDXA 4LUZA 2VZAA 3F2CA 4DR5Q 3S17H 3F8TA 3OW2A 4PG3A 4LNQA 3HOWG 3LGJA 4DV3Q 3K80C 2JA6H 2F4VQ 1SFOH 3AYHB 4AIMA 1SMXA 1HR0W 4DV1Q 3J80i 4YWLA 4HIDA 1BBUA 1VQNA 3H3VI 1R9TH 4DR3L 2JA8G 1VQ9A 1W2BA 3KYHC 3ICEA 2F4VL 4GLVB 2HHHQ 3GTMH 1QVCA 4A3BG 2CKZB 1Z47A 4L5TA 4MZ9A 1XJVA 4JI4Q 1KC8C 4GS3A 1WCMH 1L2FA 1SR3A 1E1TA 1YIJA 3PO3H 4KLKA 3T1YQ 2KCTA 2MO0A 3G4SA 3H15A 1VQFA 3KF6A 1GKHA 2HIVA 3U4ZA 4LUVA 1J5EQ 1EQQA 4R1JA 1PHJA 4DR6L 3K7UC 1Q7YC 3W1BA 4UP7A 3S1RH 3T1YL 1B8AA 2HQLA 1JJCB 1TWFH 3RNUA 4GOPA 1A63A 4UPAA 4XTCS 2E8GA 2WP8J 5BR8Q 4NXNL 4DR6Q 1C9OA 2F52A 1YZ6A 4JC0A 3MXNB 2VW9A 4A3DH 2UXBQ 5IYBG 3FKIG 3BZKA 1SRUA 1OXXK 3ERSX 5ELOA 2D62A 4OX9L 4P74A 3PO2G 2D0PA 2UUBL 4C2MH 2Y0SG 4DUZQ 4QGUA 3RLNA 4BBSH 4LF4Q 4EX5A 2AWNA 3CAMA 4JI8Q 1Y1VG 4DR7L 1TWGH 2QA4A 4DV2L 2N49A 5DLQE 3ZJYC 1YJWA 5M3MH 4MTNA 1OXUA 4IPHA 5E7NA 4TQUS 1IZ6A 3F1ZA 2Z0SA 5C0XJ 1CUKA 3TQYA 2CCZA 1OXVA 2EIFA 1S3OA 5GROA 1VQPA 1YEZA 1P8LA 2K75A 4DK6C 3I4MH 4JI3L 1UE6A 3G48A 1HR0L 1Q1EA 4IOAA 4LFBL 1CSQA 2IX0A 1VQHA 1TXYA 4A3IG 3GTOH 1G51A 4PMWA 1MIUA 1QUQB 3CCUA 1XNRQ 1XPUA 4DUZL 5C3EG 5C44H 4DAYB 1A8VA 4P73A 4UP8A 4YCVA 3J81j 4JI4L 3J7A5 1X9NA 3EIVA 4DR5L 1X65A 3PUWA 5C0XG 2CWAA 5IE8A 4DV6L 2YTXA 3E9HA 1TWAH 1TWHH 1VQ5A 4GN5A 1N36Q 1J5EL 3M85A 1V43A 3H0GG 1QUQA 5IP9H 4DV1L 2JK8A 5IYDH 2R7DA 3GTJH 1PFSA 1MJEA 2I5HA 4P75A 4A3MH 3HOXG 4B3TQ 1HZCA 4L5RC 1NTGA 4LF5L 4LWCA 3J7ZC 2B63G 4NPSA 4BA1I 5LMUL 3AQQA 4HIMA 1VQEA 4JI5Q 2NVTH 1XPOA 1HNZL 3AFQA 1K8GA 2MFIA 3I4OA 5JJIA 3NELA 3KLWA 3L0OA 3J81i 4DV4L 1I94Q 4RMFA 1IBLL 2MQHA 4LFAQ 1GO3E 5FJ8H 4LF6L 1X55A 4UY8C 2KHIA 2K5VA 1YJ9A 4APVA 5IWAQ 4X62Q 2OQ0A 4GN4B 3W5OA 3STBD 2UXCL 1NE3A 2AMCB 1HZBA 4HIOA 2PQAB 2VY3A 3GTPH 2R7ZG 3KFUA 5M5YH 4K0KL 1PA6A 4HJAA 4HJ7A 3S1NH 4DR4Q 4IJHA 2ZJRA 3CF5A 1I6HH 4JI1L 2VS1A 4OX9Q 4LF7Q 2UUBQ 1U5KA 5AJ3L 4JBKA 5LMUQ 2BA0A 3RR5A 3STBC 1W3SA 4L5QA 1KAWA 3JAMc 3RN2A 1RL2A 3F2DA 2ID0A 4A3KH 3Q8DA 2QEXA 1LYLA 3TS0A 2E2JH 3M4PA 3CD6A 2WAQE 3KJPA 4DUYL 3CMAA 1VQBA 1ASYA 1XMOQ 1AE2A 3M7NA 4R4OA 4C3IH 1TWCH 2A8VA 4BA2I 5JJKA 1BVSA 5EAYA 1HNWL 2YV5A 1X3EA 3UDIA 4EQ5A 4X62L 1EIYB 2UUCQ 4GN3B 1YHAA 5IP9G 4X64Q 3HOYG 2PI2E 1VQAA 1UE5A 3H0GH 5H1SE 1YITA 4GKJQ 4KHPQ 3PUYA 2PQAA 4R4IA 4OXPA 1YNXA 4A4IA 1MJCA 1N8RC 3CC2A 2QGQA 1SE8A 4KHPL 4PZ8A 2Q2HA 4A3CH 1RIPA 3DM3A 5C3EH 5M3FH 5IYCG 4LF5Q 2IY5B 5C4XG 2IX1A 1Y14B 3PIPA 2JQOA 2CFMA 4H02A 3TEHB 3S14H 2L15A 3I7FA 1YVCA 4DV0Q 1SN8A 3FHWA 4Y7NH 1E1OA 5M3FG 5C4XH 1D8LA 2CWPA 2LXJA 1I94L 3I56A 2R92H 1UE1A 3JC66 2VL6A 3M4QA 2BH8A 2VQFL 2UXDQ 2NZOA 2C35B 4A76A 3I4NG 1N33Q 2H5XA 1PV4A 3F2BA 4JI6Q 1K3RA 3HKZG 3A5ZB 3U50C 2EQSA 2JA9A 4IPGA 3CCVA 1JB7A 2PNHA 4OO1I 5C0XI 2JJQA 3K0XA 4AYBE 1VCIA 4JG2A 1JJ2A 1VQ7A 2HIXA 2RHSB 3M9BA 1PH1A 4NB3A 3CCLA 4LFCL 3CCMA 4B3ML 2E5LQ 3S1MH 4A3KG 3I55A 1C7YA 2E2IH 4KI0A 4LFAL 3G6EA 2ZM6Q 2KBNA 1PYBA 2VQEQ 1N32L 2WB1E 1N34Q 1FVIA 1L1OC 2IT1A 4IPDA 2Q2IA 4BY7G 3J80c 1L0WA 3G71A 2Z6KC 3CCQA 4QQBX 4GKKQ 4DV2Q 4GLXA 1Y1WG 3VDYA 3BZCA 5M5WH 4DR4L 3J81c 4KHZA 1Y1WH 1IBML 1NBWA 1VQIA 2DGYA 2NN6I 4L5SA 4NXNQ 3CCRA 1HJPA 2FXQA 4J15A 4X66L 1YHQA 3RLOA 2F3IA 4DAMA 1JJGA 4BBRG 2JA5H 1G291 1KHIA 2GN5A 1BBWA 4LF8L 3L2PA 3CC7A 2E5LL 2ZJQA 2UUAQ 2ZTDA 3PUVA 2JE6I 2K5NA 2ZM6L 4JI8L 5LMNW 2JA8H 2KENA 1EIFA 2B63H 2A1AA 3E0EA 5JEAG 4YY3Q 4X64L 4A3MG 2K50A 1PH8A 2JA6G 1SROA 1OXSC 2B29A 1EFWA 2K52A 4AH6A 4DR1Q 1HZ9A 4HJ8A 3I2ZA 4DR2Q 1Q86C 1Q46A 1KD1C 4JYAL 1V9PA 3B6YA 1OXTA 1K9MC 5GAEC 4IFDJ 1DGSA 3PF4A 4JYAQ 4JI7L 5GAHC 3K7AH 4O0AA 4YCWA 5FLXc 3T1HQ 1C0AA 2RF4A 4P71A 5JEAJ 5IP7G 4JOIA 4X65L 4JI2Q 4LF4L 1UWVA 5IYCH 4YHHL 1WYDA 1HNXQ 4FDBA 4A3CG 3HKSA 3TS2A 3OYYA 4WJ3M 2HHHL 2LSSA 1EWIA 5GAGC
chains in the Genus database with same CATH superfamily
3FP9A 4A3JB 1QNUA 1ASZA 3D0FA 4NMZA 2MNAA 2LMCB 2LXKA 2D0OA 3K5NA 2NVYB 4RWSC 2GVAA 2ES2A 1YJNA 1JOKA 1X54A 2BA1A 4DR7Q 4KD4A 3E0JA 4POFA 4CJ1B 5K36H 3T13A 1HFNA 4F8MA 2FMMA 1IBLQ 3GV6A 1GD7A 2WINB 3GTKH 4IUVA 4J1MA 1IL8A 1T5EA 3S1QH 3CCEA 2B2TA 5E4XA 4K0KQ 1PTOF 2GVBA 3CC4A 3M3YH 4QCLA 1VQJA 4OWTB 3SK8A 1EQVA 1E3PA 3T16A 1NMFA 5EKKA 3T51B 2D5DA 2I0QA 4DR3Q 1V1OA 2E2DC 1V1PB 5FLXE 4DFAA 1K8AC 4DV5Q 3QB3A 3ITPA 4YHHQ 2KCMA 1L1OB 4J8QA 3HOWH 4R4QA 1EUJA 4B3TL 4DNIA 1T5XD 2JA7B 2L9HA 2KHJA 1Q8KA 4X6AH 2N78A 1Q12A 1KQSA 2PPBC 2R92G 1B53A 2JN4A 3I90A 4C3JB 1SE4A 1JT8A 4DPGA 3HOZB 2WKCA 4DXGA 3RZOH 2FINB 3AEVA 1PYWD 4JOIC 4JVZA 1B70B 4YWKA 3LWEA 3I70A 1Y8PB 2ZT9C 1PH2A 4JI1Q 1S72A 4JV5Q 1SXTA 4ME5A 4LF7L 3BYYB 4R4CA 1QVGA 4QIWE 2I46A 2MUYA 2EYFA 3NP8A 2XN9C 4C3IG 3H3VH 2FMCA 1IYVA 4JCVE 3K5OA 3GTPB 3SK5A 2A6EC 3KDFB 2VQEL 4QF4A 2DNEA 2KEDA 2UXDL 2R7ZH 4KY5A 1IW7C 2F0IA 4OHJA 5CR3A 1SYBA 2E2HH 2E2HB 1WFQA 3UE0A 4K2KA 2NTTA 3PO3G 1PTOB 1EY4A 1I50H 1KRSA 1BR9A 4IFDI 2B2YC 5M5WB 1FJGL 2WB1G 4BY1H 5ISRA 3CCJA 3JAME 4PZ7A 1BCPB 1K83B 3HOXH 2OWOA 5IYDG 3HOVB 1BXTA 3UE1A 1O7IA 1HHVA 2VUMG 1MSHA 4K8JA 2PZTA 1HA5A 3QO2A 4H44C 3CHBD 3PUXA 5K36G 3RLFA 2NVXH 3PIOA 1B7YB 2PMZE 1EYGA 1K0RA 1MI2A 3U4VA 3GD7A 3W2DA 4R9WA 1N33L 5EPJA 3HOZG 4HAEA 1FL0A 5EKIA 1I4HA 1PZJD 5C3WA 3NPPA 4HIKA 1Q82C 3HRZC 5J22A 4AYBG 3NTHA 1SNOA 4B3MQ 2K5QA 4F7XA 2KOLA 2YTYA 3H0GB 5HURA 2R93G 4QMGA 3AFPA 4ILWA 3KDFA 4OEMB 1EQTA 3NTKA 2VNUD 4GOPB 1TWCB 1HA6A 3HG9A 1DOLA 4XQQA 2B2VC 4C3IB 4IZ8A 1BOSA 1CKOA 4Q5VA 5ELEA 1DD2A 3F8TA 3HOWG 4DV3Q 2L12A 4AIMA 1HR0W 4HIDA 5M5YB 1STHA 4M1UB 1W2BA 2F3VA 2HHHQ 5IGEA 2EYMA 5JVG3 1Z47A 4L5TA 4MZ9A 4C3HG 3AB9A 1KC8C 2L1BA 5ELBA 1SR3A 2HDLA 4KLKA 3NHHA 3G4SA 2A73B 3KF6A 1STNA 2F0HA 5CBEE 1EQQA 3K7UC 4DN4M 2NVTB 1B8AA 2PO4A 2HQLA 1D5MC 5LHY1 2WP8J 1C9OA 3MXNB 2VW9A 4IURA 1KDCA 1Y1VB 5IYBG 1O78A 1SRUA 1GUSA 2D62A 1SNQA 4C2MH 1EYAA 4OIJA 3EA6A 1IW7D 4BBSH 3S2HB 2AWNA 4KMUC 1K28A 4QB4A 4ZKCB 4MTNA 5J39A 3P20A 1SNCA 2Z0SA 3IFDA 4RKBA 5KYLA 1ILPA 1G2TA 1S3OA 2K01A 1P8LA 4LFBL 5CBAE 1Q1EA 1NSNS 3K0YA 2R61A 3KLSA 3EVQA 5KYIA 1G51A 4PMWA 1QUQB 4XXEA 1I4XA 5KNBA 3HEJA 4YCVA 1A3TA 4P73A 4JI4L 5C4XB 1X65A 3PUWA 1X32A 3E9HA 4AYBB 1N36Q 2JP1A 3H0GG 4DV1L 3VA5A 3GTJH 1PFSA 2N55A 3HOXG 2F3WA 1NTGA 1U4RA 4NPSA 3M4YA 3AQQA 1XPOA 1K8GA 2MFIA 5I6YA 1IHZA 3J81i 1I94Q 3AMUA 1B44D 2MQHA 1X55A 2IW3A 4X3KA 2E76C 1UUPA 1F9RA 3FKIB 1EU4A 2AMCB 3NXWA 2MGSA 5K5PA 2A6ED 4QUCA 1HTPA 1PA6A 5C4ZA 1ZXTA 1EWHA 1I6HH 2EZVA 2RKSA 1FGBD 3TDQA 4EVOA 1HFGA 3PMFA 2BA0A 1W3SA 3RN2A 1F77A 1SNDA 4EQPA 3G7LA 2QEXA 1LTID 3V05A 2WAQE 1H9SB 3P7JA 3I4LA 3M7NA 1PDQA 5JJKA 2YV5A 2AQ2B 3R2TA 4X64Q 1XTCD 2MP1A 2PI2E 3OSOA 4GKJQ 1SMYD 3PUYA 2L55A 1CZWA 3CC2A 1MJCA 2QGQA 4KHPL 4PZ8A 2EOTA 2DJFC 2A69C 4KKUA 3I4NB 3PIPA 2JQOA 2CFMA 4MTKA 3S14H 2ICEC 2L11A 2Q8TA 1A15A 1D8LA 1LTSD 1QNKA 2Z9HA 2LXJA 3I56A 3A8KE 2R92H 3M4QA 2BH8A 4ZYSA 3ONAB 2NZOA 5C6AA 4A3GB 3VYTA 4JI6Q 3HOUB 1GUNA 1SEBD 3GTOB 1K3RA 3L3OC 2EQSA 1EY0A 4JG2A 1VQ7A 3CCLA 1CQFA 4LFCL 3OHXC 4BY7B 4HCSA 3I55A 1C7YA 2E2IH 3S2DB 4KI0A 1STAA 2ZM6Q 4ZK9B 2SNSA 1N32L 1RJTA 1FVIA 1D6EC 3G71A 3CCQA 4CKEA 2D2CC 2JA8B 5M5WH 1VF5C 2WV6D 3SXHA 4L5SA 3CCRA 4X66L 1JJGA 4BBRG 1KLUD 1BBWA 3CC7A 4IUNA 2E5LL 2ZTDA 4LAAA 2JE6I 2ZXOA 2F0OA 3FRPB 2K5NA 4RGNA 4JI8L 3HS0C 4TRDA 2KENA 2A1AA 5KNDA 4YY3Q 5KGUA 4A3MG 2ZXPA 1PH8A 2G5DA 1YNND 2K52A 1J9OA 1HZ9A 4RAUC 4CDCC 2D9UA 3B6YA 1ICFB 1SYCA 1SFOB 1BUVT 3PF4A 1X3QA 5GAHC 3K7AH 2NWGA 1C0AA 5IP7G 1RHPA 1H9MA 5L37A 2F0TA 5IYCH 4FDBA 4A3CG 3HKSA 4BWGB 3TS2A 1ZEQX 1HQRD 3VR6A 2F0FA 3A8JE 1KABA 1JQYD 3BDOA 4ME3A 1AH9A 4BXXG 1SLJA 3A74A 4C56C 1VQMA 4C2MB 1RODA 2VXWA 3ULLA 1IBMQ 1JORA 2RDHA 5IGFA 5JEAH 1VF7A 1S5BD 2B3GA 1A0IA 2UXBL 2YTVA 4CJ2C 4G7OC 3HOUG 1GVPA 2JA5G 5LMNQ 3L7ZC 2FHTA 1HH2P 2R7FA 4QJFA 2EJGC 2NVXB 3MEHA 3RZDB 2KVMA 3BVMA 4RG1A 5ELNA 2EPBA 1CSPA 3S2DH 1Q1BA 3S1MB 2BE5C 1MKHA 5FO8B 3DEPA 1S40A 3IAYA 1B4OA 2KUMA 3SVMA 3NENA 1F9PA 1V1QA 2DJGC 4G7HC 3HOVH 4A3EH 1FNVA 4YY3L 1JOQA 1LTLA 1MD2D 1J6QA 1RDPD 4R4TA 4OIKA 4PZ6A 1QZGA 1S5DD 2NB0A 3BU2A 3BVGA 2R92B 1VQ4A 4DK3C 1JE5A 3KBGA 3CCSA 1W6KA 1CHPD 3E9IA 4JBJA 3S14B 5EBDA 4JI6L 3W1GA 2PI2A 3CXCA 3RN5A 4OWWB 1O7YA 3Q0AA 1H9KA 2NZHA 1AW7A 2EE1A 1IBKL 1TS4A 1E7ZA 4ALPA 2N3SA 4CHTB 1JR0D 1WI5A 2VUMB 1XNRL 1AE3A 4A3IH 2HT1A 4O42A 2I5LX 4TKOB 4DV5L 1TS3A 1IL2A 1CK1A 2Q8RE 4JPBW 1E24A 3OW7A 3I4MG 1XMQQ 1AN8A 5IGBA 1S5CD 2YYZA 4DKAC 2KQ3A 3K7AB 1I3QB 1TKWB 1PMRA 1D1KA 5BR8L 3S16H 3HOYH 2L4NA 1JMCA 1BO0A 4AQYL 1L1OA 3GO5A 4RKLA 3MXGA 3FDTA 3A5UA 1VQCA 5J3BA 1E22A 4K5WA 3K5LA 1EQRA 1BBXC 1LUZA 4GKJL 1PFMA 4CDEC 1EFID 4A3FH 2CH4W 3G6JB 2F0DA 4DAPA 1QZHA 1OTCA 2CQOA 2EY2A 2N8NA 2PYKA 4KY6A 4GZYC 3DM1A 1EOVA 2QW7A 2JA5B 2F4IA 4LFCQ 2ZTCA 3C3LA 3NEMA 3BYTB 2JA7H 1RTOA 1IKLA 1I4RA 4KKSA 4A3BH 3CPWA 3HOVG 1Y1WB 2H4OA 3MHBA 1LACA 3M4OH 4L8JA 2K5DA 1A62A 2K28A 2KEEA 5FLMH 1OO9B 2BH2A 2Z6KA 1XTDA 3D31A 2E2IB 3A54A 3WWVA 1O7ZA 4RA8A 3EN2A 1KDBA 5E1FA 3E6ZX 5IGCA 3QJYA 2AKWB 4MNOA 2SDFA 3TSSA 1F2LA 1WTWA 4C1NK 5CV6A 1VQ6A 3D6WA 1I3QH 3S16B 3NSWA 2R3ZA 1F9QA 3CMEA 4MN3A 1HNXL 4XIGS 4LJZC 2Z4IA 1UE7A 4O2DA 3EROA 1STGA 3GTKB 1KL9A 4TVAB 2V1CC 3D4DA 4HSPA 4A3IB 4CGYB 1Q81C 2IX3A 1SDFA 3I72A 4X3TA 4XT1B 2KCNA 1GXDC 3SGIA 4ZLTF 4XYOA 2X6LA 4DV7L 1VQKA 3S2HH 1U9RA 3ERQA 4NXMQ 4BXXH 3CQZH 2O2LD 4JBMA 3GDEA 3K81C 1FGUA 2NN6G 1E2WA 5EQ0A 3WOFA 4IOCA 2K5HA 4XDXA 1GUTA 1I4PA 2Y0SE 1LTTD 3HOWB 4A3DG 3TP7A 3ULPA 1FNUA 3JAMi 5I2XA 4DR5Q 3PV0A 2VZAA 2NVQB 3OW2A 4LNQA 5FOBB 1LT4D 1NAPA 2K04A 3J80i 1BBUA 3H3VI 2CVRA 2G9DA 4DR3L 1TVXA 3S1NB 3KYHC 3M3YB 2SEBD 1QVCA 2CKZB 1XJVA 3HOXB 4QIWB 4GS3A 1WCMH 4V190 1F2ZA 2KCCA 3T1YQ 1ZKOA 3H15A 2QDLA 1VQFA 4I65A 4C1NI 1GKHA 2HIVA 2QF7A 3U4ZA 4R1JA 1PTOH 3OWFA 4XTCS 2E8GA 1STBA 4JC0A 3GTJB 1XYIA 2UXBQ 1LTRD 2BDOA 1PTOC 3FKIG 3DEOA 4OX9L 2UUBL 5A2QL 2Y0SG 3X3MA 1CA6A 2VB3X 4CKCA 1U4PA 3RLNA 4LF4Q 4EX5A 1B9MA 3CAMA 4DR7L 1TWGH 1BCPC 3ZJYC 4DV2L 5M3MH 4NP5A 3BZDB 1GOZA 1OXUA 4IPHA 3MA2B 3F1ZA 2NBFA 5C0XJ 3C1FA 4FP5D 1SBBB 2LKVA 1OXVA 2EIFA 4G57A 1SJED 2GA4B 5GROA 1VQPA 2RQXA 3FMCA 1DZ1A 1ZYRC 1CSQA 3R93A 1VQHA 4A3IG 3VYUA 2V4DA 1MIUA 1XNRQ 3A7LA 4DUZL 4FF2A 4DAYB 1A8VA 2KECA 1X9NA 4DR5L 1I4GA 3DWQA 1LABA 3CU7A 4DV6L 1VQ5A 1TWAH 1TWHH 1J5EL 4WFN3 2HUGA 4EQNA 3RZOB 1V43A 1HUMA 1QUQA 2KHSA 5T1IA 1V8QA 2R7DA 5IT9E 4B3TQ 2ZXRA 4H13C 1QWYA 4L5RC 4LF5L 1TWFB 4LWCA 3J7ZC 3K57A 2RBMA 4A3DB 1KTKA 2NVTH 1HNZL 3AFQA 2PZUA 3KLWA 1PFBA 4RMFA 4G7ZC 1NR4A 3MXPA 4LF6L 1GO3E 5FJ8H 4UY8C 3OMCA 1YJ9A 4X62Q 1WCMB 1PLFA 3DXJC 2K03A 1G6ZA 1NE3A 4DNRB 1HZBA 2F03A 5FO7B 1ENFA 2PQAB 2VY3A 3GTPH 3Q6SA 1Y69U 4E6IA 4HJAA 1JCKB 1JICA 4KJOA 4IN3A 4RGMA 4F88A 4PMCA 2PNRC 4LF7Q 2UUBQ 1U5KA 5AJ3L 5LMUQ 3RR5A 2KA7A 4L5QA 5IT9L 5C4HA 5AFWA 1FR3A 2ID0A 2EYLA 1TS5A 3M4PA 1ASYA 4C3JG 1TWCH 3PIO3 1R4QB 3FPPA 5EAYA 3ZYYX 3RD4A 1HNWL 1FYCA 3UDIA 3HOYG 2A68D 4GN3B 1YHAA 5IP9G 1X3PA 2IJ0A 3H0GH 4Y7NB 5H1SE 1YITA 2PQAA 2Y0SB 1YNXA 3T56B 5BN4A 3K58A 4A4IA 1N8RC 1SE8A 2B8GA 2Q2HA 4A3CH 1RIPA 2Q8IB 2RSNA 4LF5Q 4L6TB 4K5VA 4ULLA 1EIGA 4H02A 3TEHB 1Q90A 1E1OA 5M3FG 2OF1A 2VQFL 5I9OA 3H6MA 4A76A 2C35B 4KKTA 5A35A 1PV4A 2E2JB 1MBYA 1XX8A 3A5ZB 3U50C 3CCVA 2QEJC 1DOMA 5CGKA 2OEOA 3MTSA 5KIXA 5C0XI 1KDAA 2HIXA 3MFGA 1II3A 2I07B 3CCMA 5DM73 4A3KG 4N9TA 2MPMA 2O5IC 3IFTA 1CHQD 3BG3A 1Y8NB 4LFAL 1PYBA 1DCZA 4IUQA 5ELFA 3V2TA 3F2UA 2Q2IA 4ZRZA 3TBIB 3J80c 2Z6KC 4DV2Q 4DR4L 2M9VA 4NKLA 4KHZA 1Y1WH 1D5XC 1JC7A 1NBWA 2TMPA 4FXGC 2NN6I 1DYQA 2C9OA 4J15A 2RA4A 1YHQA 3RLOA 1JE4A 4CDFC 4DAMA 2NZ1D 1KHIA 3P75A 4LF8L 4JW0A 3SK6A 3L9AX 5FK9C 1EYDA 2ZM6L 1EIFA 2B63H 3E0EA 5C44B 2HQEA 5EBCA 1MGSA 2F0WA 2K32A 1YNJD 1SROA 2B29A 1EFWA 3CKIB 2K7VA 4HJ8A 1KD1C 5EKLA 5I4DA 4JYAL 1LLRD 4IFDH 1OXTA 2F0EA 2EJMA 3FVQA 5GAEC 5EGTA 2BE5D 3TP6A 1DGSA 4JYAQ 5I9PA 3MXNA 1A6XA 1WTOA 4MIUA 3I8ZA 3T1HQ 4P71A 4JI2Q 4LF4L 1UWVA 4YHHL 4CDDC 3GV3A 2HHHL 2OXPA 3AU7A 5GAGC 4B3SQ 5IT9c 3DWPA 4I7AA 1O80A 1DM0B 4NXML 4YIJA 5M3FB 3VR2A 1X6OA 1I6VC 1YI2A 4KK7A 5IY0A 1GHKA 4EGVA 5C4JH 4DV4Q 4GNXA 5IGDA 5NUCA 5IYBH 4BBRH 1CKMA 4RCNA 2OTLA 1PRTF 5GADC 1GUGA 2RDGA 4P72A 5M5XB 1VQ8A 4BS9A 2XSCA 2CW0D 4A3LH 3VA7A 2K14A 2F1MA 2JEAI 3U9SA 1S5FD 3GTGH 3U9OA 1WVLA 4OONA 3H91A 3J80E 1XNQL 3RZDH 2NTSA 1M8AA 1RTNA 3T4AC 4X65Q 1GHJA 3OPOA 1TT2A 1XNQQ 1VDZA 5HGQA 2OTJA 4K6LA 1X3GA 4NDXA 1BQQT 1JB3A 2F0QA 2WFWA 3KF8B 2VQFQ 1RD9D 1ESFA 3BDCA 1PVOA 3TRZA 4HJ9A 1A3UA 1N36L 1HNZQ 5JJLA 2J0TD 5C44G 4JI0L 4QL5A 4OWXB 4A3FB 1EY6A 1TWAB 1TWHB 5JPNC 3NK9A 1YBYA 2FJ2A 4GOPC 3OTOQ 1KLGD 1PH5A 4WJWA 2UXCQ 4B3SL 1HNWQ 1SYDA 3T53B 2YU9B 1QVFA 1LTGD 4DGZA 2F0UA 1B1ZA 4YCUA 1NMGA 1WJJA 2UU9Q 2LS01 2ALYB 5A2QE 4O1NA 3GTLB 3IKJA 1EYCA 1S5ED 1G6PA 2P5ZX 4N8FA 1IBKQ 2B2UC 1I4QA 2WAQG 3BVZA 1X3FA 1LM0A 1IYJB 3SEBA 1EWCA 2VUMH 4R8IA 3MXUA 3O13A 3KOJA 1LO5D 4MHEA 2XGTA 3M4OB 2F0KA 4FF3A 3A0JA 4HTHA 4LFBQ 1U0LA 4B9WA 1Z6HA 1HRJA 3HFZB 1PH6A 3RUZA 4BY1G 4OO1G 1IXRA 4C3HH 1UEAB 3S1RB 2Q2TA 2A19A 2KJXA 4HJ5A 3BJUA 4DUYQ 4JBWA 4QY7A 4JI2L 1VQLA 4DXFA 2CQAA 1NJIC 3LNNA 3VR4A 1E2ZA 3OIQA 3PGZA 2ICIA 2JEBI 4A3LG 2MHVA 3NUCA 5E4WC 1XXGA 4HEDA 2RCNA 1N9WA 4DV3L 5GQOA 1XPRA 1T9HA 3DLLA 2UU9L 5C0XH 2Z1CA 5F2DA 5IIFA 1VS0A 3EJIA 4KTAA 3UDFA 4IUPA 3S15H 2RSOA 3DUZA 4IUTA 2ASBA 2AHOB 1WOCA 2R93H 2AUJD 3K59A 2ZJPA 4A3GH 1PH7A 2B39A 3R3OA 3NBHB 4Z9CB 4JV5L 1K73C 2LY7A 3PF5A 3QWNA 1HCZA 2A5HA 4DR2L 2VB2X 3PQIA 3HOZH 3H94A 4GNXC 1F9SA 4LF9Q 2OCEA 2JXMB 4Q0FA 3D4RA 3GP7A 4XYQA 4RGTA 2A6HD 3ND9A 1KNAA 4A3GG 4BBSG 2DNCA 3T1HL 1YHBA 4X66Q 3S24A 1EOTA 3PSIA 5J1ZA 1SNPA 3BDLA 2F0MA 5LMNL 1FJGQ 4Y52H 1ONLA 1EIHA 1PH3A 2PCFB 3TREA 1AP0A 3KF6B 2N88A 4GLAC 1QE6A 3F2CA 3MC0B 2CHBD 3S17H 3Q22A 4PG3A 1EZ6A 1WTRA 2WAQB 1HPCA 3K80C 1B3AA 2JA6H 1SFOH 3AYHB 5CV8A 4ZKBB 1SMXA 4DV1Q 4YWLA 1VQNA 1STEA 3QOJA 5G3LD 1R9TH 3TP8A 2JA8G 2K1BA 5IOCA 3I73A 4GLVB 3TZDA 3GTMH 2XNAC 1KAAA 4JI4Q 4OO1H 4XQJA 3OOCA 1YIJA 3PO3H 1CTMA 4BBRB 1ET6A 2KCTA 2MO0A 3OIPA 5CORA 1VMPA 2Z8LA 4LUVA 5JOBA 1PHJA 5JVH3 1Q7YC 2EY1A 4UP7A 2X6GA 1JJCB 1TWFH 2M2LA 4HR7B 3RNUA 4A3MB 2DY7A 1VMCA 4NXNL 1YZ6A 3WDNA 1H9RA 2EYHA 3CQZB 4P74A 2D0PA 3SDZA 4DUZQ 5KEEA 2QA4A 2N49A 3PO2B 5FO9B 3R2IA 4ZUIA 5E7NA 3J7YW 4TQUS 3A56A 3NBIA 1CUKA 4RGOS 2JSOA 3M7GA 2OT2A 5KRUA 2WKDA 4DK6C 4IOAA 3G48A 1EU3A 4R8NA 4OELB 1F2YA 1TXYA 3GTOH 1HQMC 4ZUJA 1PXUA 1Z7TA 1XPUA 5C44H 1TWGB 3J7A5 3J81j 4U68A 3MVVA 5C0XG 1CM9A 5IE8A 2YTXA 2F0SA 5CV7A 3A8IE 2EY6A 4BBSB 5C3EB 1B50A 2F0PA 5FLXL 5IP9H 1TS2A 3I3CA 4A3BB 5IYDH 2TSSA 2I5HA 1HZCA 1STYA 2AUKA 2B63G 2HCCA 1WTHA 5LMUL 4HIMA 5ELDA 2IWHA 1RKNA 3A7AB 1XWEA 3EFXD 2H1EA 3I4OA 4LMQD 1AZPA 4DV4L 1IBLL 1CI3M 1PRTC 1CA5A 5IWAQ 4GN4B 3PO3B 1TR5A 5DM63 3IL8A 2R7ZG 3KFUA 4K0KL 3DWAA 5FKAC 1W6JA 1U4LA 2F0LA 4IJHA 1QJOA 4B08A 3DHQA 2HD3A 5M9OA 1WTPA 1ENAA 4PQXA 5CV4A 1RL2A 4A3KH 1CZGA 1LYLA 5D65A 3CD6A 3KJPA 4DUYL 1VQBA 3VYSA 2XWBB 2EXZA 4C3IH 3C46A 2A8VA 1BVSA 2Z4HA 3URYA 1ML0D 4EQ5A 4X62L 4DK1A 3FEWX 1VQAA 4KHPQ 2EY5A 1QILA 1GUOA 3VR3A 3J80L 4U673 4IUUA 1HUNA 2HCIA 2DN8A 5C3EH 5M3FH 2IX1A 1Y14B 3D8GA 5EPLA 5ELCA 4G4KA 3I7FA 4DV0Q 1QB5D 1SN8A 4N9PA 3CRLC 4ZAIA 5C4XH 2CWPA 1I94L 3GTQB 2VL6A 1CT1D 4FF4A 2B8FA 1N33Q 2H5XA 2EYPA 4DF7A 3HKZG 4A3KB 1BCPF 2A74C 1CFMA 4IPGA 2PNHA 5COYA 4OO1I 1VCIA 2F0VA 2RHSB 4H0LC 4ID6A 4NB3A 4K2LA 5CC4A 1I6HB 1MHWC 3HGBA 4B3ML 1B2TA 3OMGA 3HP3A 3S1MH 5DAUA 2RCFA 3TP5A 1L0XB 3KUPA 1ICWA 1K8OA 4DK0A 1BCPD 2VQEQ 4HCEA 1N34Q 4K14A 1L0WA 2B63B 1Y1WG 1K8MA 3BZCA 3VDYA 3K6OA 1IBML 1PTOD 2NUCA 3BS1A 2DGYA 1S4ZA 1HJPA 2FXQA 1G291 3MFYA 4UAIA 3L2PA 2UUAQ 5IODA 1B9NA 5I6WA 2L0CA 3KLRA 5LMNW 1PRTB 4X64L 5EPKA 4KN4C 3P1HA 1CQVA 3KBXA 1OXSC 3TZUA 4DNTB 4AH6A 1DJRD 1Q46A 2F0JA 1K9MC 1SAPA 4IFDJ 5D3DA 4O0AA 4YCWA 1UNSA 1BNZA 1TIID 2EYJA 3UI2A 2K5WA 2RF4A 4FVMA 5JEAJ 2XRSD 2MJ8A 2PQEA 3SHLA 4WJ3M 1WTQA 1EL0A 1XMQL 4IFDG 3MEFA 4CKBA 3KJOA 5M3MG 5CMDA 4LF9L 1A2UA 3C2PA 4C3JH 1Y1VH 2AWOA 2PMZB 3N52A 2HDMA 3MWYW 4HMJA 4KV6A 1PH4A 4JI7Q 1VQDA 2DUDA 2B2UA 1JWMD 1N32Q 1GUWA 1N34L 4FYDA 4DA2A 2XTIA 3EBEA 4DAVA 1EZ8A 1FNWA 4A75A 3K8AA 1O7LA 2OQKA 3NWSA 3MAQA 1KRTA 4A3EB 4EQOA 4I7ZC 1ET9A 4K5XA 4WJ4A 1PZID 5D14A 4BY7H 1CKNB 3CP0A 4B3RQ 3IRBA 2UUAL 4JI0Q 2NVQH 4FF1A 2JA6B 1C4QA 2RHQB 4RH6A 1WTVA 1U4MA 1XMOL 3OTOL 1EY7A 2BOSA 4HMIA 4DV0L 3CPFA 3Q24A 4BY1B 3GTQH 5DNFA 4H7BA 3UDGA 1IYUA 1SNMA 4GNXB 4A3FG 1VQGA 1SSOA 3I4NH 4RCOA 4P2CB 1H95A 3PIP3 2XIWA 1Z9FA 4TSSA 2A68C 3J7AF 4A3JG 2LFNA 1SMYC 3KK7A 1DONA 4FNFA 1PYSB 4IJLA 4LW1A 1WD0A 4NW2A 1GM5A 4DV6Q 4A93B 1D2BA 1X56A 2J7ZA 2MO1A 4KHVA 4LF6Q 2IHEA 3GTLH 4YWMA 2C5CA 1NCVA 2AQ1B 1I5FA 4B9XA 1BDOA 5KNCA 1B3QA 2EXDA 1WD1A 2L5TA 1ZYRD 1BKBA 5T1GA 4CBVA 1NNXA 1F2MA 2YU9H 3Q23A 4AQYQ 1A3VA 3RMHA 3PO2H 3PCOB 3R8BA 4IO9A 4KD3A 2JYOA 3FKIH 1NY4A 1HZAA 3E5SA 4K6DA 2EYOA 1G8ZD 2AQ3B 2ATWA 1K83H 4DV7Q 2B2TC 4PV1C 1HR0Q 3FPUB 4JI3Q 1TY2A 1D5ZC 1M1KC 1CKNA 3D6CA 5C3XA 1EY5A 4K8IA 5FLMG 1I50B 5FJ8G 2I5MX 1WCMG 4LF8Q 2IHFA 3K5MA 1KXLA 1QG7A 5HY6A 5AJ3Q 5LL6X 4QUFA 4A3EG 2JA7G 3NWTA 2K4KA 2EVBA 3PUZA 1Q3LA 3J81E 1C8CA 1GJXA 1Q8IA 4DR1L 2UUCL 3GTMB 2XWJB 4N8X1 5IWAL 4LUOA 2BCOA 2WB1B 1AFPA 1R9TB 2R6GA 1KNEA 4UP9A 3SR1A 3CW2C 2Q2UA 2X69A 4POGA 4S3SA 1M90C 3QOLA 4JI5L 3HOYB 4ZCKA 2CW0C 1EEFD 2QILA 4IALA 2J4XA 4KN7C 3TN2A 3HOUH 5M5XH 4A93H 1K0SA 1ILQA 2IPKD 2B2WA 1YNJC 1VQOA 4IPCA 1D7QA 1AEXA 3U58A 5I2YA 2ZTEA 1P16A 5JJZA 1EY9A 3J7AV 3I91A 3C1EA 2NVYH 1UEBA 3HKZE 2K05A 1JWSD 2M00A 3EQLC 3NBHA 3OWEB 4B3RL 4A3JH 4A93G 1PH9A 5IP7H 5JPMC 5DEHA 1E0BA 1PFNA 2RDFA 3ULJA 1E2VA 2F0NA 2R93B 1KIXA 1PZKD 1R4PB 2RVLA 3ER0A 3UDXA 4LUZA 1L0YB 1ESRA 4DU9A 1G2SA 1SYGA 3LGJA 3H3VC 1J8IA 2F4VQ 1Y8OB 2E75C 3GTGB 4FO2A 1HTLD 1VQ9A 3ICEA 5HGTA 2F4VL 4A3BG 3S1QB 1L2FA 1E1TA 3SK4A 1LV9A 1J5EQ 4DR6L 2K6AA 2XRQD 3W1BA 4C3HB 5C4JB 1TQOA 4J6HA 4X3SA 3T1YL 3S1RH 2A6HC 4GOPA 1A63A 4UPAA 3H09A 3QIAA 5BR8Q 4DR6Q 2F52A 4L63B 4A3DH 3BZKA 3S9WA 1OXXK 2XVSA 3ERSX 5ELOA 3PO2G 1JOOA 2R7ZB 3CRKC 5TSSA 4QGUA 3NQTA 2NN6H 1LTAD 1JWUD 4RFBA 4JI8Q 1Y1VG 5IGGA 1YJWA 2PW5A 5DLQE 1NR2A 1LT5D 4LK1C 3E3XA 1IZ6A 5C5LA 4CJ0B 1RF2D 3DMUA 3TQYA 2CCZA 2O4XA 5C5MA 3S15B 3QR8A 4ABNA 1YEZA 2K75A 2QDBA 3I4MH 4JI3L 1UE6A 1HR0L 1G91A 1A2TA 2ENBA 2IX0A 3I4MB 3X3NA 1ENCA 1SE2A 5LL6S 3CCUA 5E3FA 3V96A 2PW7A 2WIIB 5C3EG 4UP8A 3EIVA 2QCPX 2CWAA 2FFKB 3SE0A 1PRTD 4GN5A 3A55A 3JAML 3M85A 1IKMA 3N6RA 2EJFC 2JK8A 1MJEA 4P75A 4A3MH 4F87A 4BA1I 1VQEA 4JI5Q 4WORA 4UHVA 4M8AA 3D3RA 5JJIA 3NELA 1SYFA 3L0OA 3KLSX 4LFAQ 2KHIA 1LT6D 2K5VA 4APVA 2OQ0A 3VR5A 1LT3D 3W5OA 3STBD 2UXCL 4HIOA 1M4VA 2WACA 3WOEA 3QG1A 3LWUA 5M5YH 4HJ7A 3S1NH 1H9SA 4DR4Q 2B2WC 2ZJRA 3CF5A 4JI1L 2VS1A 4OX9Q 3NE5B 4KY7A 4JBKA 3S17B 1WTXA 3STBC 3JAMc 1KAWA 1SJHD 3F2DA 3Q8DA 4RHRA 1QCBD 3TS0A 2E2JH 2O5JC 4UDUC 3CMAA 1XMOQ 4FXKC 4HN7A 1AE2A 4R4OA 4BA2I 4HSVA 1X3EA 1K3BC 2UUCQ 1EIYB 4GKKL 2CH4A 1UE5A 1SE3A 2A69D 4R4IA 4OXPA 2G9HD 3W3AA 3HZXA 4PNYA 3GQBA 2QKIC 4WRDA 5C4XG 3DM3A 5IYCG 2IY5B 3NQIA 2L15A 2SNMA 1YVCA 2DY8A 3FHWA 4Y7NH 4DAYA 3HKZB 5D3IB 1UE1A 3JC66 1RCVD 2UXDQ 3I4NG 1DXMA 3KF8A 4OGQC 4V0BA 3F2BA 4XQNA 3TMEA 1EEID 4FXDA 2JA9A 1JB7A 2JJQA 2SOBA 3K0XA 4AYBE 3MZ5A 1JJ2A 3M9BA 1DOKA 4KJNA 1PH1A 4XT3B 2IL8A 2E5LQ 2PZWA 3G6EA 5CV9A 5M3MB 2B2YA 2KBNA 5EJWA 1EY8A 1YNNC 4ODGA 2WB1E 1L1OC 2B2VA 2IT1A 4IPDA 2K33A 4BY7G 4QQBX 4GKKQ 4GLXA 2EDGA 3NTIA 3J81c 1VQIA 4X3UA 1BF4A 1NUCA 4NXNQ 1H9JA 2NYZD 3LX0A 5JAVA 2F3IA 2BDNA 2JA5H 3D4WA 2GN5A 1TY0A 5BN3A 2ZJQA 1SYEA 3PUVA 1QOHA 5G3LF 1V1PA 1AZQA 2JA8H 4JK1C 5JEAG 1HXYD 3ND8A 2K50A 2JA6G 1TU2B 1D1IA 1C48A 4DR2Q 4DR1Q 1LTBD 1FD7D 2F0GA 3I2ZA 1Q86C 1V9PA 1UAPA 1MSGA 4IQZA 2Z6BA 4RHSA 4JI7L 4OL7A 5FLXc 3J81L 3VYRA 4PMBA 5CV5A 4JOIA 5BN5A 4X65L 2E74C 1WYDA 1HNXQ 3OYYA 4ZQ3A 5CYUA 2LSSA 1EWIA
chains in the Genus database with same CATH topology
3FP9A 4ME3A 1AH9A 1XMQL 1ASZA 4B3SQ 4BXXG 4IFDG 5IT9c 1SLJA 3A74A 3D0FA 3MEFA 1VQMA 3KJOA 4NXML 1IBMQ 3ULLA 5M3MG 2MNAA 4LF9L 2LXKA 2D0OA 4C3JH 1Y1VH 1X6OA 2AWOA 2GVAA 1PH4A 1YJNA 2ES2A 1VQDA 2DUDA 4JI7Q 1X54A 1A0IA 2B3GA 1YI2A 2BA1A 4DR7Q 5IY0A 4POFA 1N32Q 2UXBL 1N34L 2YTVA 5C4JH 4DV4Q 4GNXA 1GVPA 1IBLQ 3HOUG 2XTIA 3EBEA 4A75A 5IYBH 1GD7A 1CKMA 4BBRH 5LMNQ 2JA5G 3K8AA 2OTLA 3L7ZC 3GTKH 2OQKA 1HH2P 2R7FA 1KRTA 5GADC 4QJFA 4P72A 1VQ8A 3S1QH 3CCEA 4RG1A 4K0KQ 4WJ4A 4A3LH 5ELNA 1CSPA 3S2DH 2K14A 1Q1BA 2GVBA 3CC4A 3M3YH 4BY7H 1CKNB 2JEAI 3CP0A 1MKHA 1VQJA 3GTGH 4B3RQ 3IRBA 4OWTB 2UUAL 1E3PA 1S40A 1NMFA 4JI0Q 2NVQH 2I0QA 3NENA 4OONA 2RHQB 1V1QA 4DR3Q 1XNQL 3HOVH 4A3EH 4GKKL 3RZDH 4YY3L 1K8AC 1XMOL 3OTOL 4X65Q 4DV5Q 1LTLA 4YHHQ 1XNQQ 1J6QA 2KCMA 4DV0L 1L1OB 3CPFA 4R4TA 4PZ6A 1X3GA 5HGQA 1QZGA 3BU2A 2OTJA 1VQ4A 3GTQH 4DK3C 2WFWA 3KF8B 4R4QA 2VQFQ 1EUJA 3HOWH 1JE5A 4DNIA 4B3TL 3UDGA 3CCSA 2KHJA 1Q8KA 3E9IA 4GNXB 4JBJA 4A3FG 1VQGA 4X6AH 2N78A 1PVOA 1Q12A 3I4NH 1KQSA 4JI6L 3W1GA 2PI2A 4HJ9A 3CXCA 1N36L 1HNZQ 3TRZA 1H95A 3RN5A 2R92G 4OWWB 5JJLA 1Z9FA 1JT8A 4DPGA 5C44G 4JI0L 2NZHA 1IBKL 3RZOH 4QL5A 4OWXB 1E7ZA 4ALPA 2N3SA 3AEVA 4A3JG 1WI5A 4JOIC 1XNRL 1AE3A 4A3IH 1YBYA 2HT1A 1B70B 4GOPC 2I5LX 3OTOQ 4DV5L 1PH5A 1IL2A 2UXCQ 1PYSB 1E24A 4YWKA 3I4MG 4IJLA 1XMQQ 4LW1A 4B3SL 1HNWQ 1GM5A 4DV6Q 1X56A 2YYZA 1QVFA 4DKAC 1PH2A 2MO1A 4JI1Q 1S72A 4LF6Q 4JV5Q 4LF7L 4YCUA 5BR8L 3S16H 1NMGA 2IHEA 4R4CA 1QVGA 1WJJA 3GTLH 4QIWE 4YWMA 2UU9Q 3HOYH 1I5FA 1JMCA 2ALYB 4AQYL 1L1OA 3GO5A 2EXDA 3H3VH 1BKBA 4JCVE 3A5UA 1G6PA 1VQCA 1IBKQ 5J3BA 2YU9H 4AQYQ 2WAQG 1E22A 3PO2H 3PCOB 4IO9A 3KDFB 2VQEL 1EQRA 3FKIH 1NY4A 1HZAA 1X3FA 1LUZA 4GKJL 1LM0A 1IYJB 2ATWA 1K83H 2UXDL 2VUMH 4DV7Q 2R7ZH 3KOJA 4A3FH 2XGTA 3A0JA 1QZHA 1HR0Q 4JI3Q 4LFBQ 1OTCA 1U0LA 2CQOA 2N8NA 1M1KC 1CKNA 2E2HH 1WFQA 5FLMG 1EOVA 3UE0A 5FJ8G 2I5MX 3HFZB 1PH6A 1WCMG 4LF8Q 4LFCQ 3PO3G 2IHFA 2ZTCA 1I50H 4BY1G 3NEMA 1IXRA 4C3HH 5HY6A 5AJ3Q 2Q2TA 4OO1G 1KXLA 2JA7H 2A19A 4A3BH 1KRSA 3CPWA 4A3EG 3HOVG 4HJ5A 2JA7G 4IFDI 1FJGL 2K4KA 3M4OH 2WB1G 4BY1H 3BJUA 3CCJA 4DUYQ 4JBWA 4PZ7A 4QY7A 1A62A 3PUZA 4JI2L 3HOXH 5FLMH 1VQLA 2OWOA 1NJIC 2BH2A 2Z6KA 4DR1L 3PGZA 5IYDG 2UUCL 5IWAL 1XTDA 3D31A 3UE1A 2JEBI 4A3LG 4LUOA 3WWVA 1O7IA 2RCNA 3EN2A 1N9WA 4DV3L 5GQOA 2R6GA 4UP9A 1XPRA 3CW2C 1T9HA 2Q2UA 3DLLA 2UU9L 1M90C 2AKWB 4POGA 4MNOA 2VUMG 1VS0A 4JI5L 1VQ6A 3UDFA 1I3QH 3HOUH 3S15H 3PUXA 5M5XH 5K36G 3RLFA 2NVXH 2ASBA 2AHOB 1WOCA 1B7YB 3PIOA 3CMEA 4A93H 2PMZE 1HNXL 2R93H 4XIGS 2ZJPA 4A3GH 1PH7A 1UE7A 4O2DA 1EYGA 1KL9A 4TVAB 2V1CC 3NBHB 1K0RA 1VQOA 3U4VA 4IPCA 1Q81C 4JV5L 1D7QA 3GD7A 3U58A 1K73C 2ZTEA 1P16A 3PF5A 4DR2L 1N33L 4DV7L 3SGIA 1VQKA 3S2HH 3HOZG 3HOZH 1FL0A 4NXMQ 4GNXC 4BXXH 2NVYH 1UEBA 3CQZH 3HKZE 2OCEA 4LF9Q 4JBMA 3GDEA 4HIKA 3K81C 1Q82C 4AYBG 1FGUA 2NN6G 4B3MQ 3T1HL 4A3GG 4BBSG 2YTYA 4B3RL 2R93G 1YHBA 4X66Q 3S24A 3PSIA 4IOCA 4A3JH 2K5HA 5IP7H 3AFPA 1PH9A 4A93G 3KDFA 2VNUD 5LMNL 4GOPB 2Y0SE 1FJGQ 4Y52H 3ULJA 1PH3A 4A3DG 3ULPA 3TREA 3JAMi 3KF6B 1KIXA 1CKOA 3PV0A 3ER0A 4GLAC 3UDXA 4LUZA 2VZAA 3F2CA 4DR5Q 3S17H 3F8TA 3OW2A 4PG3A 4LNQA 3HOWG 3LGJA 4DV3Q 3K80C 2JA6H 2F4VQ 1SFOH 3AYHB 4AIMA 1SMXA 1HR0W 4DV1Q 3J80i 4YWLA 4HIDA 1BBUA 1VQNA 3H3VI 1R9TH 4DR3L 2JA8G 1VQ9A 1W2BA 3KYHC 3ICEA 2F4VL 4GLVB 2HHHQ 3GTMH 1QVCA 4A3BG 2CKZB 1Z47A 4L5TA 4MZ9A 1XJVA 4JI4Q 1KC8C 4GS3A 1WCMH 1L2FA 1SR3A 1E1TA 1YIJA 3PO3H 4KLKA 3T1YQ 2KCTA 2MO0A 3G4SA 3H15A 1VQFA 3KF6A 1GKHA 2HIVA 3U4ZA 4LUVA 1J5EQ 1EQQA 4R1JA 1PHJA 4DR6L 3K7UC 1Q7YC 3W1BA 4UP7A 3S1RH 3T1YL 1B8AA 2HQLA 1JJCB 1TWFH 3RNUA 4GOPA 1A63A 4UPAA 4XTCS 2E8GA 2WP8J 5BR8Q 4NXNL 4DR6Q 1C9OA 2F52A 1YZ6A 4JC0A 3MXNB 2VW9A 4A3DH 2UXBQ 5IYBG 3FKIG 3BZKA 1SRUA 1OXXK 3ERSX 5ELOA 2D62A 4OX9L 4P74A 3PO2G 2D0PA 2UUBL 4C2MH 2Y0SG 4DUZQ 4QGUA 3RLNA 4BBSH 4LF4Q 4EX5A 2AWNA 3CAMA 4JI8Q 1Y1VG 4DR7L 1TWGH 2QA4A 4DV2L 2N49A 5DLQE 3ZJYC 1YJWA 5M3MH 4MTNA 1OXUA 4IPHA 5E7NA 4TQUS 1IZ6A 3F1ZA 2Z0SA 5C0XJ 1CUKA 3TQYA 2CCZA 1OXVA 2EIFA 1S3OA 5GROA 1VQPA 1YEZA 1P8LA 2K75A 4DK6C 3I4MH 4JI3L 1UE6A 3G48A 1HR0L 1Q1EA 4IOAA 4LFBL 1CSQA 2IX0A 1VQHA 1TXYA 4A3IG 3GTOH 1G51A 4PMWA 1MIUA 1QUQB 3CCUA 1XNRQ 1XPUA 4DUZL 5C3EG 5C44H 4DAYB 1A8VA 4P73A 4UP8A 4YCVA 3J81j 4JI4L 3J7A5 1X9NA 3EIVA 4DR5L 1X65A 3PUWA 5C0XG 2CWAA 5IE8A 4DV6L 2YTXA 3E9HA 1TWAH 1TWHH 1VQ5A 4GN5A 1N36Q 1J5EL 3M85A 1V43A 3H0GG 1QUQA 5IP9H 4DV1L 2JK8A 5IYDH 2R7DA 3GTJH 1PFSA 1MJEA 2I5HA 4P75A 4A3MH 3HOXG 4B3TQ 1HZCA 4L5RC 1NTGA 4LF5L 4LWCA 3J7ZC 2B63G 4NPSA 4BA1I 5LMUL 3AQQA 4HIMA 1VQEA 4JI5Q 2NVTH 1XPOA 1HNZL 3AFQA 1K8GA 2MFIA 3I4OA 5JJIA 3NELA 3KLWA 3L0OA 3J81i 4DV4L 1I94Q 4RMFA 1IBLL 2MQHA 4LFAQ 1GO3E 5FJ8H 4LF6L 1X55A 4UY8C 2KHIA 2K5VA 1YJ9A 4APVA 5IWAQ 4X62Q 2OQ0A 4GN4B 3W5OA 3STBD 2UXCL 1NE3A 2AMCB 1HZBA 4HIOA 2PQAB 2VY3A 3GTPH 2R7ZG 3KFUA 5M5YH 4K0KL 1PA6A 4HJAA 4HJ7A 3S1NH 4DR4Q 4IJHA 2ZJRA 3CF5A 1I6HH 4JI1L 2VS1A 4OX9Q 4LF7Q 2UUBQ 1U5KA 5AJ3L 4JBKA 5LMUQ 2BA0A 3RR5A 3STBC 1W3SA 4L5QA 1KAWA 3JAMc 3RN2A 1RL2A 3F2DA 2ID0A 4A3KH 3Q8DA 2QEXA 1LYLA 3TS0A 2E2JH 3M4PA 3CD6A 2WAQE 3KJPA 4DUYL 3CMAA 1VQBA 1ASYA 1XMOQ 1AE2A 3M7NA 4R4OA 4C3IH 1TWCH 2A8VA 4BA2I 5JJKA 1BVSA 5EAYA 1HNWL 2YV5A 1X3EA 3UDIA 4EQ5A 4X62L 1EIYB 2UUCQ 4GN3B 1YHAA 5IP9G 4X64Q 3HOYG 2PI2E 1VQAA 1UE5A 3H0GH 5H1SE 1YITA 4GKJQ 4KHPQ 3PUYA 2PQAA 4R4IA 4OXPA 1YNXA 4A4IA 1MJCA 1N8RC 3CC2A 2QGQA 1SE8A 4KHPL 4PZ8A 2Q2HA 4A3CH 1RIPA 3DM3A 5C3EH 5M3FH 5IYCG 4LF5Q 2IY5B 5C4XG 2IX1A 1Y14B 3PIPA 2JQOA 2CFMA 4H02A 3TEHB 3S14H 2L15A 3I7FA 1YVCA 4DV0Q 1SN8A 3FHWA 4Y7NH 1E1OA 5M3FG 5C4XH 1D8LA 2CWPA 2LXJA 1I94L 3I56A 2R92H 1UE1A 3JC66 2VL6A 3M4QA 2BH8A 2VQFL 2UXDQ 2NZOA 2C35B 4A76A 3I4NG 1N33Q 2H5XA 1PV4A 3F2BA 4JI6Q 1K3RA 3HKZG 3A5ZB 3U50C 2EQSA 2JA9A 4IPGA 3CCVA 1JB7A 2PNHA 4OO1I 5C0XI 2JJQA 3K0XA 4AYBE 1VCIA 4JG2A 1JJ2A 1VQ7A 2HIXA 2RHSB 3M9BA 1PH1A 4NB3A 3CCLA 4LFCL 3CCMA 4B3ML 2E5LQ 3S1MH 4A3KG 3I55A 1C7YA 2E2IH 4KI0A 4LFAL 3G6EA 2ZM6Q 2KBNA 1PYBA 2VQEQ 1N32L 2WB1E 1N34Q 1FVIA 1L1OC 2IT1A 4IPDA 2Q2IA 4BY7G 3J80c 1L0WA 3G71A 2Z6KC 3CCQA 4QQBX 4GKKQ 4DV2Q 4GLXA 1Y1WG 3VDYA 3BZCA 5M5WH 4DR4L 3J81c 4KHZA 1Y1WH 1IBML 1NBWA 1VQIA 2DGYA 2NN6I 4L5SA 4NXNQ 3CCRA 1HJPA 2FXQA 4J15A 4X66L 1YHQA 3RLOA 2F3IA 4DAMA 1JJGA 4BBRG 2JA5H 1G291 1KHIA 2GN5A 1BBWA 4LF8L 3L2PA 3CC7A 2E5LL 2ZJQA 2UUAQ 2ZTDA 3PUVA 2JE6I 2K5NA 2ZM6L 4JI8L 5LMNW 2JA8H 2KENA 1EIFA 2B63H 2A1AA 3E0EA 5JEAG 4YY3Q 4X64L 4A3MG 2K50A 1PH8A 2JA6G 1SROA 1OXSC 2B29A 1EFWA 2K52A 4AH6A 4DR1Q 1HZ9A 4HJ8A 3I2ZA 4DR2Q 1Q86C 1Q46A 1KD1C 4JYAL 1V9PA 3B6YA 1OXTA 1K9MC 5GAEC 4IFDJ 1DGSA 3PF4A 4JYAQ 4JI7L 5GAHC 3K7AH 4O0AA 4YCWA 5FLXc 3T1HQ 1C0AA 2RF4A 4P71A 5JEAJ 5IP7G 4JOIA 4X65L 4JI2Q 4LF4L 1UWVA 5IYCH 4YHHL 1WYDA 1HNXQ 4FDBA 4A3CG 3HKSA 3TS2A 3OYYA 4WJ3M 2HHHL 2LSSA 1EWIA 5GAGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FP9 A;  4ME3 A;  1AH9 A;  1XMQ L;  1ASZ A;  4B3S Q;  4BXX G;  4IFD G;  5IT9 c;  1SLJ A;  3A74 A;  3D0F A;  3MEF A;  1VQM A;  3KJO A;  4NXM L;  1IBM Q;  3ULL A;  5M3M G;  2MNA A;  4LF9 L;  2LXK A;  2D0O A;  4C3J H;  1Y1V H;  1X6O A;  2AWO A;  2GVA A;  1PH4 A;  1YJN A;  2ES2 A;  1VQD A;  2DUD A;  4JI7 Q;  1X54 A;  1A0I A;  2B3G A;  1YI2 A;  2BA1 A;  4DR7 Q;  5IY0 A;  4POF A;  1N32 Q;  2UXB L;  1N34 L;  2YTV A;  5C4J H;  4DV4 Q;  4GNX A;  1GVP A;  1IBL Q;  3HOU G;  2XTI A;  3EBE A;  4A75 A;  5IYB H;  1GD7 A;  1CKM A;  4BBR H;  5LMN Q;  2JA5 G;  3K8A A;  2OTL A;  3L7Z C;  3GTK H;  2OQK A;  1HH2 P;  2R7F A;  1KRT A;  5GAD C;  4QJF A;  4P72 A;  1VQ8 A;  3S1Q H;  3CCE A;  4RG1 A;  4K0K Q;  4WJ4 A;  4A3L H;  5ELN A;  1CSP A;  3S2D H;  2K14 A;  1Q1B A;  2GVB A;  3CC4 A;  3M3Y H;  4BY7 H;  1CKN B;  2JEA I;  3CP0 A;  1MKH A;  1VQJ A;  3GTG H;  4B3R Q;  3IRB A;  4OWT B;  2UUA L;  1E3P A;  1S40 A;  1NMF A;  4JI0 Q;  2NVQ H;  2I0Q A;  3NEN A;  4OON A;  2RHQ B;  1V1Q A;  4DR3 Q;  1XNQ L;  3HOV H;  4A3E H;  4GKK L;  3RZD H;  4YY3 L;  1K8A C;  1XMO L;  3OTO L;  4X65 Q;  4DV5 Q;  1LTL A;  4YHH Q;  1XNQ Q;  1J6Q A;  2KCM A;  4DV0 L;  1L1O B;  3CPF A;  4R4T A;  4PZ6 A;  1X3G A;  5HGQ A;  1QZG A;  3BU2 A;  2OTJ A;  1VQ4 A;  3GTQ H;  4DK3 C;  2WFW A;  3KF8 B;  4R4Q A;  2VQF Q;  1EUJ A;  3HOW H;  1JE5 A;  4DNI A;  4B3T L;  3UDG A;  3CCS A;  2KHJ A;  1Q8K A;  3E9I A;  4GNX B;  4JBJ A;  4A3F G;  1VQG A;  4X6A H;  2N78 A;  1PVO A;  1Q12 A;  3I4N H;  1KQS A;  4JI6 L;  3W1G A;  2PI2 A;  4HJ9 A;  3CXC A;  1N36 L;  1HNZ Q;  3TRZ A;  1H95 A;  3RN5 A;  2R92 G;  4OWW B;  5JJL A;  1Z9F A;  1JT8 A;  4DPG A;  5C44 G;  4JI0 L;  2NZH A;  1IBK L;  3RZO H;  4QL5 A;  4OWX B;  1E7Z A;  4ALP A;  2N3S A;  3AEV A;  4A3J G;  1WI5 A;  4JOI C;  1XNR L;  1AE3 A;  4A3I H;  1YBY A;  2HT1 A;  1B70 B;  4GOP C;  2I5L X;  3OTO Q;  4DV5 L;  1PH5 A;  1IL2 A;  2UXC Q;  1PYS B;  1E24 A;  4YWK A;  3I4M G;  4IJL A;  1XMQ Q;  4LW1 A;  4B3S L;  1HNW Q;  1GM5 A;  4DV6 Q;  1X56 A;  2YYZ A;  1QVF A;  4DKA C;  1PH2 A;  2MO1 A;  4JI1 Q;  1S72 A;  4LF6 Q;  4JV5 Q;  4LF7 L;  4YCU A;  5BR8 L;  3S16 H;  1NMG A;  2IHE A;  4R4C A;  1QVG A;  1WJJ A;  3GTL H;  4QIW E;  4YWM A;  2UU9 Q;  3HOY H;  1I5F A;  1JMC A;  2ALY B;  4AQY L;  1L1O A;  3GO5 A;  2EXD A;  3H3V H;  1BKB A;  4JCV E;  3A5U A;  1G6P A;  1VQC A;  1IBK Q;  5J3B A;  2YU9 H;  4AQY Q;  2WAQ G;  1E22 A;  3PO2 H;  3PCO B;  4IO9 A;  3KDF B;  2VQE L;  1EQR A;  3FKI H;  1NY4 A;  1HZA A;  1X3F A;  1LUZ A;  4GKJ L;  1LM0 A;  1IYJ B;  2ATW A;  1K83 H;  2UXD L;  2VUM H;  4DV7 Q;  2R7Z H;  3KOJ A;  4A3F H;  2XGT A;  3A0J A;  1QZH A;  1HR0 Q;  4JI3 Q;  4LFB Q;  1OTC A;  1U0L A;  2CQO A;  2N8N A;  1M1K C;  1CKN A;  2E2H H;  1WFQ A;  5FLM G;  1EOV A;  3UE0 A;  5FJ8 G;  2I5M X;  3HFZ B;  1PH6 A;  1WCM G;  4LF8 Q;  4LFC Q;  3PO3 G;  2IHF A;  2ZTC A;  1I50 H;  4BY1 G;  3NEM A;  1IXR A;  4C3H H;  5HY6 A;  5AJ3 Q;  2Q2T A;  4OO1 G;  1KXL A;  2JA7 H;  2A19 A;  4A3B H;  1KRS A;  3CPW A;  4A3E G;  3HOV G;  4HJ5 A;  2JA7 G;  4IFD I;  1FJG L;  2K4K A;  3M4O H;  2WB1 G;  4BY1 H;  3BJU A;  3CCJ A;  4DUY Q;  4JBW A;  4PZ7 A;  4QY7 A;  1A62 A;  3PUZ A;  4JI2 L;  3HOX H;  5FLM H;  1VQL A;  2OWO A;  1NJI C;  2BH2 A;  2Z6K A;  4DR1 L;  3PGZ A;  5IYD G;  2UUC L;  5IWA L;  1XTD A;  3D31 A;  3UE1 A;  2JEB I;  4A3L G;  4LUO A;  3WWV A;  1O7I A;  2RCN A;  3EN2 A;  1N9W A;  4DV3 L;  5GQO A;  2R6G A;  4UP9 A;  1XPR A;  3CW2 C;  1T9H A;  2Q2U A;  3DLL A;  2UU9 L;  1M90 C;  2AKW B;  4POG A;  4MNO A;  2VUM G;  1VS0 A;  4JI5 L;  1VQ6 A;  3UDF A;  1I3Q H;  3HOU H;  3S15 H;  3PUX A;  5M5X H;  5K36 G;  3RLF A;  2NVX H;  2ASB A;  2AHO B;  1WOC A;  1B7Y B;  3PIO A;  3CME A;  4A93 H;  2PMZ E;  1HNX L;  2R93 H;  4XIG S;  2ZJP A;  4A3G H;  1PH7 A;  1UE7 A;  4O2D A;  1EYG A;  1KL9 A;  4TVA B;  2V1C C;  3NBH B;  1K0R A;  1VQO A;  3U4V A;  4IPC A;  1Q81 C;  4JV5 L;  1D7Q A;  3GD7 A;  3U58 A;  1K73 C;  2ZTE A;  1P16 A;  3PF5 A;  4DR2 L;  1N33 L;  4DV7 L;  3SGI A;  1VQK A;  3S2H H;  3HOZ G;  3HOZ H;  1FL0 A;  4NXM Q;  4GNX C;  4BXX H;  2NVY H;  1UEB A;  3CQZ H;  3HKZ E;  2OCE A;  4LF9 Q;  4JBM A;  3GDE A;  4HIK A;  3K81 C;  1Q82 C;  4AYB G;  1FGU A;  2NN6 G;  4B3M Q;  3T1H L;  4A3G G;  4BBS G;  2YTY A;  4B3R L;  2R93 G;  1YHB A;  4X66 Q;  3S24 A;  3PSI A;  4IOC A;  4A3J H;  2K5H A;  5IP7 H;  3AFP A;  1PH9 A;  4A93 G;  3KDF A;  2VNU D;  5LMN L;  4GOP B;  2Y0S E;  1FJG Q;  4Y52 H;  3ULJ A;  1PH3 A;  4A3D G;  3ULP A;  3TRE A;  3JAM i;  3KF6 B;  1KIX A;  1CKO A;  3PV0 A;  3ER0 A;  4GLA C;  3UDX A;  4LUZ A;  2VZA A;  3F2C A;  4DR5 Q;  3S17 H;  3F8T A;  3OW2 A;  4PG3 A;  4LNQ A;  3HOW G;  3LGJ A;  4DV3 Q;  3K80 C;  2JA6 H;  2F4V Q;  1SFO H;  3AYH B;  4AIM A;  1SMX A;  1HR0 W;  4DV1 Q;  3J80 i;  4YWL A;  4HID A;  1BBU A;  1VQN A;  3H3V I;  1R9T H;  4DR3 L;  2JA8 G;  1VQ9 A;  1W2B A;  3KYH C;  3ICE A;  2F4V L;  4GLV B;  2HHH Q;  3GTM H;  1QVC A;  4A3B G;  2CKZ B;  1Z47 A;  4L5T A;  4MZ9 A;  1XJV A;  4JI4 Q;  1KC8 C;  4GS3 A;  1WCM H;  1L2F A;  1SR3 A;  1E1T A;  1YIJ A;  3PO3 H;  4KLK A;  3T1Y Q;  2KCT A;  2MO0 A;  3G4S A;  3H15 A;  1VQF A;  3KF6 A;  1GKH A;  2HIV A;  3U4Z A;  4LUV A;  1J5E Q;  1EQQ A;  4R1J A;  1PHJ A;  4DR6 L;  3K7U C;  1Q7Y C;  3W1B A;  4UP7 A;  3S1R H;  3T1Y L;  1B8A A;  2HQL A;  1JJC B;  1TWF H;  3RNU A;  4GOP A;  1A63 A;  4UPA A;  4XTC S;  2E8G A;  2WP8 J;  5BR8 Q;  4NXN L;  4DR6 Q;  1C9O A;  2F52 A;  1YZ6 A;  4JC0 A;  3MXN B;  2VW9 A;  4A3D H;  2UXB Q;  5IYB G;  3FKI G;  3BZK A;  1SRU A;  1OXX K;  3ERS X;  5ELO A;  2D62 A;  4OX9 L;  4P74 A;  3PO2 G;  2D0P A;  2UUB L;  4C2M H;  2Y0S G;  4DUZ Q;  4QGU A;  3RLN A;  4BBS H;  4LF4 Q;  4EX5 A;  2AWN A;  3CAM A;  4JI8 Q;  1Y1V G;  4DR7 L;  1TWG H;  2QA4 A;  4DV2 L;  2N49 A;  5DLQ E;  3ZJY C;  1YJW A;  5M3M H;  4MTN A;  1OXU A;  4IPH A;  5E7N A;  4TQU S;  1IZ6 A;  3F1Z A;  2Z0S A;  5C0X J;  1CUK A;  3TQY A;  2CCZ A;  1OXV A;  2EIF A;  1S3O A;  5GRO A;  1VQP A;  1YEZ A;  1P8L A;  2K75 A;  4DK6 C;  3I4M H;  4JI3 L;  1UE6 A;  3G48 A;  1HR0 L;  1Q1E A;  4IOA A;  4LFB L;  1CSQ A;  2IX0 A;  1VQH A;  1TXY A;  4A3I G;  3GTO H;  1G51 A;  4PMW A;  1MIU A;  1QUQ B;  3CCU A;  1XNR Q;  1XPU A;  4DUZ L;  5C3E G;  5C44 H;  4DAY B;  1A8V A;  4P73 A;  4UP8 A;  4YCV A;  3J81 j;  4JI4 L;  3J7A 5;  1X9N A;  3EIV A;  4DR5 L;  1X65 A;  3PUW A;  5C0X G;  2CWA A;  5IE8 A;  4DV6 L;  2YTX A;  3E9H A;  1TWA H;  1TWH H;  1VQ5 A;  4GN5 A;  1N36 Q;  1J5E L;  3M85 A;  1V43 A;  3H0G G;  1QUQ A;  5IP9 H;  4DV1 L;  2JK8 A;  5IYD H;  2R7D A;  3GTJ H;  1PFS A;  1MJE A;  2I5H A;  4P75 A;  4A3M H;  3HOX G;  4B3T Q;  1HZC A;  4L5R C;  1NTG A;  4LF5 L;  4LWC A;  3J7Z C;  2B63 G;  4NPS A;  4BA1 I;  5LMU L;  3AQQ A;  4HIM A;  1VQE A;  4JI5 Q;  2NVT H;  1XPO A;  1HNZ L;  3AFQ A;  1K8G A;  2MFI A;  3I4O A;  5JJI A;  3NEL A;  3KLW A;  3L0O A;  3J81 i;  4DV4 L;  1I94 Q;  4RMF A;  1IBL L;  2MQH A;  4LFA Q;  1GO3 E;  5FJ8 H;  4LF6 L;  1X55 A;  4UY8 C;  2KHI A;  2K5V A;  1YJ9 A;  4APV A;  5IWA Q;  4X62 Q;  2OQ0 A;  4GN4 B;  3W5O A;  3STB D;  2UXC L;  1NE3 A;  2AMC B;  1HZB A;  4HIO A;  2PQA B;  2VY3 A;  3GTP H;  2R7Z G;  3KFU A;  5M5Y H;  4K0K L;  1PA6 A;  4HJA A;  4HJ7 A;  3S1N H;  4DR4 Q;  4IJH A;  2ZJR A;  3CF5 A;  1I6H H;  4JI1 L;  2VS1 A;  4OX9 Q;  4LF7 Q;  2UUB Q;  1U5K A;  5AJ3 L;  4JBK A;  5LMU Q;  2BA0 A;  3RR5 A;  3STB C;  1W3S A;  4L5Q A;  1KAW A;  3JAM c;  3RN2 A;  1RL2 A;  3F2D A;  2ID0 A;  4A3K H;  3Q8D A;  2QEX A;  1LYL A;  3TS0 A;  2E2J H;  3M4P A;  3CD6 A;  2WAQ E;  3KJP A;  4DUY L;  3CMA A;  1VQB A;  1ASY A;  1XMO Q;  1AE2 A;  3M7N A;  4R4O A;  4C3I H;  1TWC H;  2A8V A;  4BA2 I;  5JJK A;  1BVS A;  5EAY A;  1HNW L;  2YV5 A;  1X3E A;  3UDI A;  4EQ5 A;  4X62 L;  1EIY B;  2UUC Q;  4GN3 B;  1YHA A;  5IP9 G;  4X64 Q;  3HOY G;  2PI2 E;  1VQA A;  1UE5 A;  3H0G H;  5H1S E;  1YIT A;  4GKJ Q;  4KHP Q;  3PUY A;  2PQA A;  4R4I A;  4OXP A;  1YNX A;  4A4I A;  1MJC A;  1N8R C;  3CC2 A;  2QGQ A;  1SE8 A;  4KHP L;  4PZ8 A;  2Q2H A;  4A3C H;  1RIP A;  3DM3 A;  5C3E H;  5M3F H;  5IYC G;  4LF5 Q;  2IY5 B;  5C4X G;  2IX1 A;  1Y14 B;  3PIP A;  2JQO A;  2CFM A;  4H02 A;  3TEH B;  3S14 H;  2L15 A;  3I7F A;  1YVC A;  4DV0 Q;  1SN8 A;  3FHW A;  4Y7N H;  1E1O A;  5M3F G;  5C4X H;  1D8L A;  2CWP A;  2LXJ A;  1I94 L;  3I56 A;  2R92 H;  1UE1 A;  3JC6 6;  2VL6 A;  3M4Q A;  2BH8 A;  2VQF L;  2UXD Q;  2NZO A;  2C35 B;  4A76 A;  3I4N G;  1N33 Q;  2H5X A;  1PV4 A;  3F2B A;  4JI6 Q;  1K3R A;  3HKZ G;  3A5Z B;  3U50 C;  2EQS A;  2JA9 A;  4IPG A;  3CCV A;  1JB7 A;  2PNH A;  4OO1 I;  5C0X I;  2JJQ A;  3K0X A;  4AYB E;  1VCI A;  4JG2 A;  1JJ2 A;  1VQ7 A;  2HIX A;  2RHS B;  3M9B A;  1PH1 A;  4NB3 A;  3CCL A;  4LFC L;  3CCM A;  4B3M L;  2E5L Q;  3S1M H;  4A3K G;  3I55 A;  1C7Y A;  2E2I H;  4KI0 A;  4LFA L;  3G6E A;  2ZM6 Q;  2KBN A;  1PYB A;  2VQE Q;  1N32 L;  2WB1 E;  1N34 Q;  1FVI A;  1L1O C;  2IT1 A;  4IPD A;  2Q2I A;  4BY7 G;  3J80 c;  1L0W A;  3G71 A;  2Z6K C;  3CCQ A;  4QQB X;  4GKK Q;  4DV2 Q;  4GLX A;  1Y1W G;  3VDY A;  3BZC A;  5M5W H;  4DR4 L;  3J81 c;  4KHZ A;  1Y1W H;  1IBM L;  1NBW A;  1VQI A;  2DGY A;  2NN6 I;  4L5S A;  4NXN Q;  3CCR A;  1HJP A;  2FXQ A;  4J15 A;  4X66 L;  1YHQ A;  3RLO A;  2F3I A;  4DAM A;  1JJG A;  4BBR G;  2JA5 H;  1G29 1;  1KHI A;  2GN5 A;  1BBW A;  4LF8 L;  3L2P A;  3CC7 A;  2E5L L;  2ZJQ A;  2UUA Q;  2ZTD A;  3PUV A;  2JE6 I;  2K5N A;  2ZM6 L;  4JI8 L;  5LMN W;  2JA8 H;  2KEN A;  1EIF A;  2B63 H;  2A1A A;  3E0E A;  5JEA G;  4YY3 Q;  4X64 L;  4A3M G;  2K50 A;  1PH8 A;  2JA6 G;  1SRO A;  1OXS C;  2B29 A;  1EFW A;  2K52 A;  4AH6 A;  4DR1 Q;  1HZ9 A;  4HJ8 A;  3I2Z A;  4DR2 Q;  1Q86 C;  1Q46 A;  1KD1 C;  4JYA L;  1V9P A;  3B6Y A;  1OXT A;  1K9M C;  5GAE C;  4IFD J;  1DGS A;  3PF4 A;  4JYA Q;  4JI7 L;  5GAH C;  3K7A H;  4O0A A;  4YCW A;  5FLX c;  3T1H Q;  1C0A A;  2RF4 A;  4P71 A;  5JEA J;  5IP7 G;  4JOI A;  4X65 L;  4JI2 Q;  4LF4 L;  1UWV A;  5IYC H;  4YHH L;  1WYD A;  1HNX Q;  4FDB A;  4A3C G;  3HKS A;  3TS2 A;  3OYY A;  4WJ3 M;  2HHH L;  2LSS A;  1EWI A;  5GAG C; 
#chains in the Genus database with same CATH topology
 3FP9 A;  4A3J B;  1QNU A;  1ASZ A;  3D0F A;  4NMZ A;  2MNA A;  2LMC B;  2LXK A;  2D0O A;  3K5N A;  2NVY B;  4RWS C;  2GVA A;  2ES2 A;  1YJN A;  1JOK A;  1X54 A;  2BA1 A;  4DR7 Q;  4KD4 A;  3E0J A;  4POF A;  4CJ1 B;  5K36 H;  3T13 A;  1HFN A;  4F8M A;  2FMM A;  1IBL Q;  3GV6 A;  1GD7 A;  2WIN B;  3GTK H;  4IUV A;  4J1M A;  1IL8 A;  1T5E A;  3S1Q H;  3CCE A;  2B2T A;  5E4X A;  4K0K Q;  1PTO F;  2GVB A;  3CC4 A;  3M3Y H;  4QCL A;  1VQJ A;  4OWT B;  3SK8 A;  1EQV A;  1E3P A;  3T16 A;  1NMF A;  5EKK A;  3T51 B;  2D5D A;  2I0Q A;  4DR3 Q;  1V1O A;  2E2D C;  1V1P B;  5FLX E;  4DFA A;  1K8A C;  4DV5 Q;  3QB3 A;  3ITP A;  4YHH Q;  2KCM A;  1L1O B;  4J8Q A;  3HOW H;  4R4Q A;  1EUJ A;  4B3T L;  4DNI A;  1T5X D;  2JA7 B;  2L9H A;  2KHJ A;  1Q8K A;  4X6A H;  2N78 A;  1Q12 A;  1KQS A;  2PPB C;  2R92 G;  1B53 A;  2JN4 A;  3I90 A;  4C3J B;  1SE4 A;  1JT8 A;  4DPG A;  3HOZ B;  2WKC A;  4DXG A;  3RZO H;  2FIN B;  3AEV A;  1PYW D;  4JOI C;  4JVZ A;  1B70 B;  4YWK A;  3LWE A;  3I70 A;  1Y8P B;  2ZT9 C;  1PH2 A;  4JI1 Q;  1S72 A;  4JV5 Q;  1SXT A;  4ME5 A;  4LF7 L;  3BYY B;  4R4C A;  1QVG A;  4QIW E;  2I46 A;  2MUY A;  2EYF A;  3NP8 A;  2XN9 C;  4C3I G;  3H3V H;  2FMC A;  1IYV A;  4JCV E;  3K5O A;  3GTP B;  3SK5 A;  2A6E C;  3KDF B;  2VQE L;  4QF4 A;  2DNE A;  2KED A;  2UXD L;  2R7Z H;  4KY5 A;  1IW7 C;  2F0I A;  4OHJ A;  5CR3 A;  1SYB A;  2E2H H;  2E2H B;  1WFQ A;  3UE0 A;  4K2K A;  2NTT A;  3PO3 G;  1PTO B;  1EY4 A;  1I50 H;  1KRS A;  1BR9 A;  4IFD I;  2B2Y C;  5M5W B;  1FJG L;  2WB1 G;  4BY1 H;  5ISR A;  3CCJ A;  3JAM E;  4PZ7 A;  1BCP B;  1K83 B;  3HOX H;  2OWO A;  5IYD G;  3HOV B;  1BXT A;  3UE1 A;  1O7I A;  1HHV A;  2VUM G;  1MSH A;  4K8J A;  2PZT A;  1HA5 A;  3QO2 A;  4H44 C;  3CHB D;  3PUX A;  5K36 G;  3RLF A;  2NVX H;  3PIO A;  1B7Y B;  2PMZ E;  1EYG A;  1K0R A;  1MI2 A;  3U4V A;  3GD7 A;  3W2D A;  4R9W A;  1N33 L;  5EPJ A;  3HOZ G;  4HAE A;  1FL0 A;  5EKI A;  1I4H A;  1PZJ D;  5C3W A;  3NPP A;  4HIK A;  1Q82 C;  3HRZ C;  5J22 A;  4AYB G;  3NTH A;  1SNO A;  4B3M Q;  2K5Q A;  4F7X A;  2KOL A;  2YTY A;  3H0G B;  5HUR A;  2R93 G;  4QMG A;  3AFP A;  4ILW A;  3KDF A;  4OEM B;  1EQT A;  3NTK A;  2VNU D;  4GOP B;  1TWC B;  1HA6 A;  3HG9 A;  1DOL A;  4XQQ A;  2B2V C;  4C3I B;  4IZ8 A;  1BOS A;  1CKO A;  4Q5V A;  5ELE A;  1DD2 A;  3F8T A;  3HOW G;  4DV3 Q;  2L12 A;  4AIM A;  1HR0 W;  4HID A;  5M5Y B;  1STH A;  4M1U B;  1W2B A;  2F3V A;  2HHH Q;  5IGE A;  2EYM A;  5JVG 3;  1Z47 A;  4L5T A;  4MZ9 A;  4C3H G;  3AB9 A;  1KC8 C;  2L1B A;  5ELB A;  1SR3 A;  2HDL A;  4KLK A;  3NHH A;  3G4S A;  2A73 B;  3KF6 A;  1STN A;  2F0H A;  5CBE E;  1EQQ A;  3K7U C;  4DN4 M;  2NVT B;  1B8A A;  2PO4 A;  2HQL A;  1D5M C;  5LHY 1;  2WP8 J;  1C9O A;  3MXN B;  2VW9 A;  4IUR A;  1KDC A;  1Y1V B;  5IYB G;  1O78 A;  1SRU A;  1GUS A;  2D62 A;  1SNQ A;  4C2M H;  1EYA A;  4OIJ A;  3EA6 A;  1IW7 D;  4BBS H;  3S2H B;  2AWN A;  4KMU C;  1K28 A;  4QB4 A;  4ZKC B;  4MTN A;  5J39 A;  3P20 A;  1SNC A;  2Z0S A;  3IFD A;  4RKB A;  5KYL A;  1ILP A;  1G2T A;  1S3O A;  2K01 A;  1P8L A;  4LFB L;  5CBA E;  1Q1E A;  1NSN S;  3K0Y A;  2R61 A;  3KLS A;  3EVQ A;  5KYI A;  1G51 A;  4PMW A;  1QUQ B;  4XXE A;  1I4X A;  5KNB A;  3HEJ A;  4YCV A;  1A3T A;  4P73 A;  4JI4 L;  5C4X B;  1X65 A;  3PUW A;  1X32 A;  3E9H A;  4AYB B;  1N36 Q;  2JP1 A;  3H0G G;  4DV1 L;  3VA5 A;  3GTJ H;  1PFS A;  2N55 A;  3HOX G;  2F3W A;  1NTG A;  1U4R A;  4NPS A;  3M4Y A;  3AQQ A;  1XPO A;  1K8G A;  2MFI A;  5I6Y A;  1IHZ A;  3J81 i;  1I94 Q;  3AMU A;  1B44 D;  2MQH A;  1X55 A;  2IW3 A;  4X3K A;  2E76 C;  1UUP A;  1F9R A;  3FKI B;  1EU4 A;  2AMC B;  3NXW A;  2MGS A;  5K5P A;  2A6E D;  4QUC A;  1HTP A;  1PA6 A;  5C4Z A;  1ZXT A;  1EWH A;  1I6H H;  2EZV A;  2RKS A;  1FGB D;  3TDQ A;  4EVO A;  1HFG A;  3PMF A;  2BA0 A;  1W3S A;  3RN2 A;  1F77 A;  1SND A;  4EQP A;  3G7L A;  2QEX A;  1LTI D;  3V05 A;  2WAQ E;  1H9S B;  3P7J A;  3I4L A;  3M7N A;  1PDQ A;  5JJK A;  2YV5 A;  2AQ2 B;  3R2T A;  4X64 Q;  1XTC D;  2MP1 A;  2PI2 E;  3OSO A;  4GKJ Q;  1SMY D;  3PUY A;  2L55 A;  1CZW A;  3CC2 A;  1MJC A;  2QGQ A;  4KHP L;  4PZ8 A;  2EOT A;  2DJF C;  2A69 C;  4KKU A;  3I4N B;  3PIP A;  2JQO A;  2CFM A;  4MTK A;  3S14 H;  2ICE C;  2L11 A;  2Q8T A;  1A15 A;  1D8L A;  1LTS D;  1QNK A;  2Z9H A;  2LXJ A;  3I56 A;  3A8K E;  2R92 H;  3M4Q A;  2BH8 A;  4ZYS A;  3ONA B;  2NZO A;  5C6A A;  4A3G B;  3VYT A;  4JI6 Q;  3HOU B;  1GUN A;  1SEB D;  3GTO B;  1K3R A;  3L3O C;  2EQS A;  1EY0 A;  4JG2 A;  1VQ7 A;  3CCL A;  1CQF A;  4LFC L;  3OHX C;  4BY7 B;  4HCS A;  3I55 A;  1C7Y A;  2E2I H;  3S2D B;  4KI0 A;  1STA A;  2ZM6 Q;  4ZK9 B;  2SNS A;  1N32 L;  1RJT A;  1FVI A;  1D6E C;  3G71 A;  3CCQ A;  4CKE A;  2D2C C;  2JA8 B;  5M5W H;  1VF5 C;  2WV6 D;  3SXH A;  4L5S A;  3CCR A;  4X66 L;  1JJG A;  4BBR G;  1KLU D;  1BBW A;  3CC7 A;  4IUN A;  2E5L L;  2ZTD A;  4LAA A;  2JE6 I;  2ZXO A;  2F0O A;  3FRP B;  2K5N A;  4RGN A;  4JI8 L;  3HS0 C;  4TRD A;  2KEN A;  2A1A A;  5KND A;  4YY3 Q;  5KGU A;  4A3M G;  2ZXP A;  1PH8 A;  2G5D A;  1YNN D;  2K52 A;  1J9O A;  1HZ9 A;  4RAU C;  4CDC C;  2D9U A;  3B6Y A;  1ICF B;  1SYC A;  1SFO B;  1BUV T;  3PF4 A;  1X3Q A;  5GAH C;  3K7A H;  2NWG A;  1C0A A;  5IP7 G;  1RHP A;  1H9M A;  5L37 A;  2F0T A;  5IYC H;  4FDB A;  4A3C G;  3HKS A;  4BWG B;  3TS2 A;  1ZEQ X;  1HQR D;  3VR6 A;  2F0F A;  3A8J E;  1KAB A;  1JQY D;  3BDO A;  4ME3 A;  1AH9 A;  4BXX G;  1SLJ A;  3A74 A;  4C56 C;  1VQM A;  4C2M B;  1ROD A;  2VXW A;  3ULL A;  1IBM Q;  1JOR A;  2RDH A;  5IGF A;  5JEA H;  1VF7 A;  1S5B D;  2B3G A;  1A0I A;  2UXB L;  2YTV A;  4CJ2 C;  4G7O C;  3HOU G;  1GVP A;  2JA5 G;  5LMN Q;  3L7Z C;  2FHT A;  1HH2 P;  2R7F A;  4QJF A;  2EJG C;  2NVX B;  3MEH A;  3RZD B;  2KVM A;  3BVM A;  4RG1 A;  5ELN A;  2EPB A;  1CSP A;  3S2D H;  1Q1B A;  3S1M B;  2BE5 C;  1MKH A;  5FO8 B;  3DEP A;  1S40 A;  3IAY A;  1B4O A;  2KUM A;  3SVM A;  3NEN A;  1F9P A;  1V1Q A;  2DJG C;  4G7H C;  3HOV H;  4A3E H;  1FNV A;  4YY3 L;  1JOQ A;  1LTL A;  1MD2 D;  1J6Q A;  1RDP D;  4R4T A;  4OIK A;  4PZ6 A;  1QZG A;  1S5D D;  2NB0 A;  3BU2 A;  3BVG A;  2R92 B;  1VQ4 A;  4DK3 C;  1JE5 A;  3KBG A;  3CCS A;  1W6K A;  1CHP D;  3E9I A;  4JBJ A;  3S14 B;  5EBD A;  4JI6 L;  3W1G A;  2PI2 A;  3CXC A;  3RN5 A;  4OWW B;  1O7Y A;  3Q0A A;  1H9K A;  2NZH A;  1AW7 A;  2EE1 A;  1IBK L;  1TS4 A;  1E7Z A;  4ALP A;  2N3S A;  4CHT B;  1JR0 D;  1WI5 A;  2VUM B;  1XNR L;  1AE3 A;  4A3I H;  2HT1 A;  4O42 A;  2I5L X;  4TKO B;  4DV5 L;  1TS3 A;  1IL2 A;  1CK1 A;  2Q8R E;  4JPB W;  1E24 A;  3OW7 A;  3I4M G;  1XMQ Q;  1AN8 A;  5IGB A;  1S5C D;  2YYZ A;  4DKA C;  2KQ3 A;  3K7A B;  1I3Q B;  1TKW B;  1PMR A;  1D1K A;  5BR8 L;  3S16 H;  3HOY H;  2L4N A;  1JMC A;  1BO0 A;  4AQY L;  1L1O A;  3GO5 A;  4RKL A;  3MXG A;  3FDT A;  3A5U A;  1VQC A;  5J3B A;  1E22 A;  4K5W A;  3K5L A;  1EQR A;  1BBX C;  1LUZ A;  4GKJ L;  1PFM A;  4CDE C;  1EFI D;  4A3F H;  2CH4 W;  3G6J B;  2F0D A;  4DAP A;  1QZH A;  1OTC A;  2CQO A;  2EY2 A;  2N8N A;  2PYK A;  4KY6 A;  4GZY C;  3DM1 A;  1EOV A;  2QW7 A;  2JA5 B;  2F4I A;  4LFC Q;  2ZTC A;  3C3L A;  3NEM A;  3BYT B;  2JA7 H;  1RTO A;  1IKL A;  1I4R A;  4KKS A;  4A3B H;  3CPW A;  3HOV G;  1Y1W B;  2H4O A;  3MHB A;  1LAC A;  3M4O H;  4L8J A;  2K5D A;  1A62 A;  2K28 A;  2KEE A;  5FLM H;  1OO9 B;  2BH2 A;  2Z6K A;  1XTD A;  3D31 A;  2E2I B;  3A54 A;  3WWV A;  1O7Z A;  4RA8 A;  3EN2 A;  1KDB A;  5E1F A;  3E6Z X;  5IGC A;  3QJY A;  2AKW B;  4MNO A;  2SDF A;  3TSS A;  1F2L A;  1WTW A;  4C1N K;  5CV6 A;  1VQ6 A;  3D6W A;  1I3Q H;  3S16 B;  3NSW A;  2R3Z A;  1F9Q A;  3CME A;  4MN3 A;  1HNX L;  4XIG S;  4LJZ C;  2Z4I A;  1UE7 A;  4O2D A;  3ERO A;  1STG A;  3GTK B;  1KL9 A;  4TVA B;  2V1C C;  3D4D A;  4HSP A;  4A3I B;  4CGY B;  1Q81 C;  2IX3 A;  1SDF A;  3I72 A;  4X3T A;  4XT1 B;  2KCN A;  1GXD C;  3SGI A;  4ZLT F;  4XYO A;  2X6L A;  4DV7 L;  1VQK A;  3S2H H;  1U9R A;  3ERQ A;  4NXM Q;  4BXX H;  3CQZ H;  2O2L D;  4JBM A;  3GDE A;  3K81 C;  1FGU A;  2NN6 G;  1E2W A;  5EQ0 A;  3WOF A;  4IOC A;  2K5H A;  4XDX A;  1GUT A;  1I4P A;  2Y0S E;  1LTT D;  3HOW B;  4A3D G;  3TP7 A;  3ULP A;  1FNU A;  3JAM i;  5I2X A;  4DR5 Q;  3PV0 A;  2VZA A;  2NVQ B;  3OW2 A;  4LNQ A;  5FOB B;  1LT4 D;  1NAP A;  2K04 A;  3J80 i;  1BBU A;  3H3V I;  2CVR A;  2G9D A;  4DR3 L;  1TVX A;  3S1N B;  3KYH C;  3M3Y B;  2SEB D;  1QVC A;  2CKZ B;  1XJV A;  3HOX B;  4QIW B;  4GS3 A;  1WCM H;  4V19 0;  1F2Z A;  2KCC A;  3T1Y Q;  1ZKO A;  3H15 A;  2QDL A;  1VQF A;  4I65 A;  4C1N I;  1GKH A;  2HIV A;  2QF7 A;  3U4Z A;  4R1J A;  1PTO H;  3OWF A;  4XTC S;  2E8G A;  1STB A;  4JC0 A;  3GTJ B;  1XYI A;  2UXB Q;  1LTR D;  2BDO A;  1PTO C;  3FKI G;  3DEO A;  4OX9 L;  2UUB L;  5A2Q L;  2Y0S G;  3X3M A;  1CA6 A;  2VB3 X;  4CKC A;  1U4P A;  3RLN A;  4LF4 Q;  4EX5 A;  1B9M A;  3CAM A;  4DR7 L;  1TWG H;  1BCP C;  3ZJY C;  4DV2 L;  5M3M H;  4NP5 A;  3BZD B;  1GOZ A;  1OXU A;  4IPH A;  3MA2 B;  3F1Z A;  2NBF A;  5C0X J;  3C1F A;  4FP5 D;  1SBB B;  2LKV A;  1OXV A;  2EIF A;  4G57 A;  1SJE D;  2GA4 B;  5GRO A;  1VQP A;  2RQX A;  3FMC A;  1DZ1 A;  1ZYR C;  1CSQ A;  3R93 A;  1VQH A;  4A3I G;  3VYU A;  2V4D A;  1MIU A;  1XNR Q;  3A7L A;  4DUZ L;  4FF2 A;  4DAY B;  1A8V A;  2KEC A;  1X9N A;  4DR5 L;  1I4G A;  3DWQ A;  1LAB A;  3CU7 A;  4DV6 L;  1VQ5 A;  1TWA H;  1TWH H;  1J5E L;  4WFN 3;  2HUG A;  4EQN A;  3RZO B;  1V43 A;  1HUM A;  1QUQ A;  2KHS A;  5T1I A;  1V8Q A;  2R7D A;  5IT9 E;  4B3T Q;  2ZXR A;  4H13 C;  1QWY A;  4L5R C;  4LF5 L;  1TWF B;  4LWC A;  3J7Z C;  3K57 A;  2RBM A;  4A3D B;  1KTK A;  2NVT H;  1HNZ L;  3AFQ A;  2PZU A;  3KLW A;  1PFB A;  4RMF A;  4G7Z C;  1NR4 A;  3MXP A;  4LF6 L;  1GO3 E;  5FJ8 H;  4UY8 C;  3OMC A;  1YJ9 A;  4X62 Q;  1WCM B;  1PLF A;  3DXJ C;  2K03 A;  1G6Z A;  1NE3 A;  4DNR B;  1HZB A;  2F03 A;  5FO7 B;  1ENF A;  2PQA B;  2VY3 A;  3GTP H;  3Q6S A;  1Y69 U;  4E6I A;  4HJA A;  1JCK B;  1JIC A;  4KJO A;  4IN3 A;  4RGM A;  4F88 A;  4PMC A;  2PNR C;  4LF7 Q;  2UUB Q;  1U5K A;  5AJ3 L;  5LMU Q;  3RR5 A;  2KA7 A;  4L5Q A;  5IT9 L;  5C4H A;  5AFW A;  1FR3 A;  2ID0 A;  2EYL A;  1TS5 A;  3M4P A;  1ASY A;  4C3J G;  1TWC H;  3PIO 3;  1R4Q B;  3FPP A;  5EAY A;  3ZYY X;  3RD4 A;  1HNW L;  1FYC A;  3UDI A;  3HOY G;  2A68 D;  4GN3 B;  1YHA A;  5IP9 G;  1X3P A;  2IJ0 A;  3H0G H;  4Y7N B;  5H1S E;  1YIT A;  2PQA A;  2Y0S B;  1YNX A;  3T56 B;  5BN4 A;  3K58 A;  4A4I A;  1N8R C;  1SE8 A;  2B8G A;  2Q2H A;  4A3C H;  1RIP A;  2Q8I B;  2RSN A;  4LF5 Q;  4L6T B;  4K5V A;  4ULL A;  1EIG A;  4H02 A;  3TEH B;  1Q90 A;  1E1O A;  5M3F G;  2OF1 A;  2VQF L;  5I9O A;  3H6M A;  4A76 A;  2C35 B;  4KKT A;  5A35 A;  1PV4 A;  2E2J B;  1MBY A;  1XX8 A;  3A5Z B;  3U50 C;  3CCV A;  2QEJ C;  1DOM A;  5CGK A;  2OEO A;  3MTS A;  5KIX A;  5C0X I;  1KDA A;  2HIX A;  3MFG A;  1II3 A;  2I07 B;  3CCM A;  5DM7 3;  4A3K G;  4N9T A;  2MPM A;  2O5I C;  3IFT A;  1CHQ D;  3BG3 A;  1Y8N B;  4LFA L;  1PYB A;  1DCZ A;  4IUQ A;  5ELF A;  3V2T A;  3F2U A;  2Q2I A;  4ZRZ A;  3TBI B;  3J80 c;  2Z6K C;  4DV2 Q;  4DR4 L;  2M9V A;  4NKL A;  4KHZ A;  1Y1W H;  1D5X C;  1JC7 A;  1NBW A;  2TMP A;  4FXG C;  2NN6 I;  1DYQ A;  2C9O A;  4J15 A;  2RA4 A;  1YHQ A;  3RLO A;  1JE4 A;  4CDF C;  4DAM A;  2NZ1 D;  1KHI A;  3P75 A;  4LF8 L;  4JW0 A;  3SK6 A;  3L9A X;  5FK9 C;  1EYD A;  2ZM6 L;  1EIF A;  2B63 H;  3E0E A;  5C44 B;  2HQE A;  5EBC A;  1MGS A;  2F0W A;  2K32 A;  1YNJ D;  1SRO A;  2B29 A;  1EFW A;  3CKI B;  2K7V A;  4HJ8 A;  1KD1 C;  5EKL A;  5I4D A;  4JYA L;  1LLR D;  4IFD H;  1OXT A;  2F0E A;  2EJM A;  3FVQ A;  5GAE C;  5EGT A;  2BE5 D;  3TP6 A;  1DGS A;  4JYA Q;  5I9P A;  3MXN A;  1A6X A;  1WTO A;  4MIU A;  3I8Z A;  3T1H Q;  4P71 A;  4JI2 Q;  4LF4 L;  1UWV A;  4YHH L;  4CDD C;  3GV3 A;  2HHH L;  2OXP A;  3AU7 A;  5GAG C;  4B3S Q;  5IT9 c;  3DWP A;  4I7A A;  1O80 A;  1DM0 B;  4NXM L;  4YIJ A;  5M3F B;  3VR2 A;  1X6O A;  1I6V C;  1YI2 A;  4KK7 A;  5IY0 A;  1GHK A;  4EGV A;  5C4J H;  4DV4 Q;  4GNX A;  5IGD A;  5NUC A;  5IYB H;  4BBR H;  1CKM A;  4RCN A;  2OTL A;  1PRT F;  5GAD C;  1GUG A;  2RDG A;  4P72 A;  5M5X B;  1VQ8 A;  4BS9 A;  2XSC A;  2CW0 D;  4A3L H;  3VA7 A;  2K14 A;  2F1M A;  2JEA I;  3U9S A;  1S5F D;  3GTG H;  3U9O A;  1WVL A;  4OON A;  3H91 A;  3J80 E;  1XNQ L;  3RZD H;  2NTS A;  1M8A A;  1RTN A;  3T4A C;  4X65 Q;  1GHJ A;  3OPO A;  1TT2 A;  1XNQ Q;  1VDZ A;  5HGQ A;  2OTJ A;  4K6L A;  1X3G A;  4NDX A;  1BQQ T;  1JB3 A;  2F0Q A;  2WFW A;  3KF8 B;  2VQF Q;  1RD9 D;  1ESF A;  3BDC A;  1PVO A;  3TRZ A;  4HJ9 A;  1A3U A;  1N36 L;  1HNZ Q;  5JJL A;  2J0T D;  5C44 G;  4JI0 L;  4QL5 A;  4OWX B;  4A3F B;  1EY6 A;  1TWA B;  1TWH B;  5JPN C;  3NK9 A;  1YBY A;  2FJ2 A;  4GOP C;  3OTO Q;  1KLG D;  1PH5 A;  4WJW A;  2UXC Q;  4B3S L;  1HNW Q;  1SYD A;  3T53 B;  2YU9 B;  1QVF A;  1LTG D;  4DGZ A;  2F0U A;  1B1Z A;  4YCU A;  1NMG A;  1WJJ A;  2UU9 Q;  2LS0 1;  2ALY B;  5A2Q E;  4O1N A;  3GTL B;  3IKJ A;  1EYC A;  1S5E D;  1G6P A;  2P5Z X;  4N8F A;  1IBK Q;  2B2U C;  1I4Q A;  2WAQ G;  3BVZ A;  1X3F A;  1LM0 A;  1IYJ B;  3SEB A;  1EWC A;  2VUM H;  4R8I A;  3MXU A;  3O13 A;  3KOJ A;  1LO5 D;  4MHE A;  2XGT A;  3M4O B;  2F0K A;  4FF3 A;  3A0J A;  4HTH A;  4LFB Q;  1U0L A;  4B9W A;  1Z6H A;  1HRJ A;  3HFZ B;  1PH6 A;  3RUZ A;  4BY1 G;  4OO1 G;  1IXR A;  4C3H H;  1UEA B;  3S1R B;  2Q2T A;  2A19 A;  2KJX A;  4HJ5 A;  3BJU A;  4DUY Q;  4JBW A;  4QY7 A;  4JI2 L;  1VQL A;  4DXF A;  2CQA A;  1NJI C;  3LNN A;  3VR4 A;  1E2Z A;  3OIQ A;  3PGZ A;  2ICI A;  2JEB I;  4A3L G;  2MHV A;  3NUC A;  5E4W C;  1XXG A;  4HED A;  2RCN A;  1N9W A;  4DV3 L;  5GQO A;  1XPR A;  1T9H A;  3DLL A;  2UU9 L;  5C0X H;  2Z1C A;  5F2D A;  5IIF A;  1VS0 A;  3EJI A;  4KTA A;  3UDF A;  4IUP A;  3S15 H;  2RSO A;  3DUZ A;  4IUT A;  2ASB A;  2AHO B;  1WOC A;  2R93 H;  2AUJ D;  3K59 A;  2ZJP A;  4A3G H;  1PH7 A;  2B39 A;  3R3O A;  3NBH B;  4Z9C B;  4JV5 L;  1K73 C;  2LY7 A;  3PF5 A;  3QWN A;  1HCZ A;  2A5H A;  4DR2 L;  2VB2 X;  3PQI A;  3HOZ H;  3H94 A;  4GNX C;  1F9S A;  4LF9 Q;  2OCE A;  2JXM B;  4Q0F A;  3D4R A;  3GP7 A;  4XYQ A;  4RGT A;  2A6H D;  3ND9 A;  1KNA A;  4A3G G;  4BBS G;  2DNC A;  3T1H L;  1YHB A;  4X66 Q;  3S24 A;  1EOT A;  3PSI A;  5J1Z A;  1SNP A;  3BDL A;  2F0M A;  5LMN L;  1FJG Q;  4Y52 H;  1ONL A;  1EIH A;  1PH3 A;  2PCF B;  3TRE A;  1AP0 A;  3KF6 B;  2N88 A;  4GLA C;  1QE6 A;  3F2C A;  3MC0 B;  2CHB D;  3S17 H;  3Q22 A;  4PG3 A;  1EZ6 A;  1WTR A;  2WAQ B;  1HPC A;  3K80 C;  1B3A A;  2JA6 H;  1SFO H;  3AYH B;  5CV8 A;  4ZKB B;  1SMX A;  4DV1 Q;  4YWL A;  1VQN A;  1STE A;  3QOJ A;  5G3L D;  1R9T H;  3TP8 A;  2JA8 G;  2K1B A;  5IOC A;  3I73 A;  4GLV B;  3TZD A;  3GTM H;  2XNA C;  1KAA A;  4JI4 Q;  4OO1 H;  4XQJ A;  3OOC A;  1YIJ A;  3PO3 H;  1CTM A;  4BBR B;  1ET6 A;  2KCT A;  2MO0 A;  3OIP A;  5COR A;  1VMP A;  2Z8L A;  4LUV A;  5JOB A;  1PHJ A;  5JVH 3;  1Q7Y C;  2EY1 A;  4UP7 A;  2X6G A;  1JJC B;  1TWF H;  2M2L A;  4HR7 B;  3RNU A;  4A3M B;  2DY7 A;  1VMC A;  4NXN L;  1YZ6 A;  3WDN A;  1H9R A;  2EYH A;  3CQZ B;  4P74 A;  2D0P A;  3SDZ A;  4DUZ Q;  5KEE A;  2QA4 A;  2N49 A;  3PO2 B;  5FO9 B;  3R2I A;  4ZUI A;  5E7N A;  3J7Y W;  4TQU S;  3A56 A;  3NBI A;  1CUK A;  4RGO S;  2JSO A;  3M7G A;  2OT2 A;  5KRU A;  2WKD A;  4DK6 C;  4IOA A;  3G48 A;  1EU3 A;  4R8N A;  4OEL B;  1F2Y A;  1TXY A;  3GTO H;  1HQM C;  4ZUJ A;  1PXU A;  1Z7T A;  1XPU A;  5C44 H;  1TWG B;  3J7A 5;  3J81 j;  4U68 A;  3MVV A;  5C0X G;  1CM9 A;  5IE8 A;  2YTX A;  2F0S A;  5CV7 A;  3A8I E;  2EY6 A;  4BBS B;  5C3E B;  1B50 A;  2F0P A;  5FLX L;  5IP9 H;  1TS2 A;  3I3C A;  4A3B B;  5IYD H;  2TSS A;  2I5H A;  1HZC A;  1STY A;  2AUK A;  2B63 G;  2HCC A;  1WTH A;  5LMU L;  4HIM A;  5ELD A;  2IWH A;  1RKN A;  3A7A B;  1XWE A;  3EFX D;  2H1E A;  3I4O A;  4LMQ D;  1AZP A;  4DV4 L;  1IBL L;  1CI3 M;  1PRT C;  1CA5 A;  5IWA Q;  4GN4 B;  3PO3 B;  1TR5 A;  5DM6 3;  3IL8 A;  2R7Z G;  3KFU A;  4K0K L;  3DWA A;  5FKA C;  1W6J A;  1U4L A;  2F0L A;  4IJH A;  1QJO A;  4B08 A;  3DHQ A;  2HD3 A;  5M9O A;  1WTP A;  1ENA A;  4PQX A;  5CV4 A;  1RL2 A;  4A3K H;  1CZG A;  1LYL A;  5D65 A;  3CD6 A;  3KJP A;  4DUY L;  1VQB A;  3VYS A;  2XWB B;  2EXZ A;  4C3I H;  3C46 A;  2A8V A;  1BVS A;  2Z4H A;  3URY A;  1ML0 D;  4EQ5 A;  4X62 L;  4DK1 A;  3FEW X;  1VQA A;  4KHP Q;  2EY5 A;  1QIL A;  1GUO A;  3VR3 A;  3J80 L;  4U67 3;  4IUU A;  1HUN A;  2HCI A;  2DN8 A;  5C3E H;  5M3F H;  2IX1 A;  1Y14 B;  3D8G A;  5EPL A;  5ELC A;  4G4K A;  3I7F A;  4DV0 Q;  1QB5 D;  1SN8 A;  4N9P A;  3CRL C;  4ZAI A;  5C4X H;  2CWP A;  1I94 L;  3GTQ B;  2VL6 A;  1CT1 D;  4FF4 A;  2B8F A;  1N33 Q;  2H5X A;  2EYP A;  4DF7 A;  3HKZ G;  4A3K B;  1BCP F;  2A74 C;  1CFM A;  4IPG A;  2PNH A;  5COY A;  4OO1 I;  1VCI A;  2F0V A;  2RHS B;  4H0L C;  4ID6 A;  4NB3 A;  4K2L A;  5CC4 A;  1I6H B;  1MHW C;  3HGB A;  4B3M L;  1B2T A;  3OMG A;  3HP3 A;  3S1M H;  5DAU A;  2RCF A;  3TP5 A;  1L0X B;  3KUP A;  1ICW A;  1K8O A;  4DK0 A;  1BCP D;  2VQE Q;  4HCE A;  1N34 Q;  4K14 A;  1L0W A;  2B63 B;  1Y1W G;  1K8M A;  3BZC A;  3VDY A;  3K6O A;  1IBM L;  1PTO D;  2NUC A;  3BS1 A;  2DGY A;  1S4Z A;  1HJP A;  2FXQ A;  1G29 1;  3MFY A;  4UAI A;  3L2P A;  2UUA Q;  5IOD A;  1B9N A;  5I6W A;  2L0C A;  3KLR A;  5LMN W;  1PRT B;  4X64 L;  5EPK A;  4KN4 C;  3P1H A;  1CQV A;  3KBX A;  1OXS C;  3TZU A;  4DNT B;  4AH6 A;  1DJR D;  1Q46 A;  2F0J A;  1K9M C;  1SAP A;  4IFD J;  5D3D A;  4O0A A;  4YCW A;  1UNS A;  1BNZ A;  1TII D;  2EYJ A;  3UI2 A;  2K5W A;  2RF4 A;  4FVM A;  5JEA J;  2XRS D;  2MJ8 A;  2PQE A;  3SHL A;  4WJ3 M;  1WTQ A;  1EL0 A;  1XMQ L;  4IFD G;  3MEF A;  4CKB A;  3KJO A;  5M3M G;  5CMD A;  4LF9 L;  1A2U A;  3C2P A;  4C3J H;  1Y1V H;  2AWO A;  2PMZ B;  3N52 A;  2HDM A;  3MWY W;  4HMJ A;  4KV6 A;  1PH4 A;  4JI7 Q;  1VQD A;  2DUD A;  2B2U A;  1JWM D;  1N32 Q;  1GUW A;  1N34 L;  4FYD A;  4DA2 A;  2XTI A;  3EBE A;  4DAV A;  1EZ8 A;  1FNW A;  4A75 A;  3K8A A;  1O7L A;  2OQK A;  3NWS A;  3MAQ A;  1KRT A;  4A3E B;  4EQO A;  4I7Z C;  1ET9 A;  4K5X A;  4WJ4 A;  1PZI D;  5D14 A;  4BY7 H;  1CKN B;  3CP0 A;  4B3R Q;  3IRB A;  2UUA L;  4JI0 Q;  2NVQ H;  4FF1 A;  2JA6 B;  1C4Q A;  2RHQ B;  4RH6 A;  1WTV A;  1U4M A;  1XMO L;  3OTO L;  1EY7 A;  2BOS A;  4HMI A;  4DV0 L;  3CPF A;  3Q24 A;  4BY1 B;  3GTQ H;  5DNF A;  4H7B A;  3UDG A;  1IYU A;  1SNM A;  4GNX B;  4A3F G;  1VQG A;  1SSO A;  3I4N H;  4RCO A;  4P2C B;  1H95 A;  3PIP 3;  2XIW A;  1Z9F A;  4TSS A;  2A68 C;  3J7A F;  4A3J G;  2LFN A;  1SMY C;  3KK7 A;  1DON A;  4FNF A;  1PYS B;  4IJL A;  4LW1 A;  1WD0 A;  4NW2 A;  1GM5 A;  4DV6 Q;  4A93 B;  1D2B A;  1X56 A;  2J7Z A;  2MO1 A;  4KHV A;  4LF6 Q;  2IHE A;  3GTL H;  4YWM A;  2C5C A;  1NCV A;  2AQ1 B;  1I5F A;  4B9X A;  1BDO A;  5KNC A;  1B3Q A;  2EXD A;  1WD1 A;  2L5T A;  1ZYR D;  1BKB A;  5T1G A;  4CBV A;  1NNX A;  1F2M A;  2YU9 H;  3Q23 A;  4AQY Q;  1A3V A;  3RMH A;  3PO2 H;  3PCO B;  3R8B A;  4IO9 A;  4KD3 A;  2JYO A;  3FKI H;  1NY4 A;  1HZA A;  3E5S A;  4K6D A;  2EYO A;  1G8Z D;  2AQ3 B;  2ATW A;  1K83 H;  4DV7 Q;  2B2T C;  4PV1 C;  1HR0 Q;  3FPU B;  4JI3 Q;  1TY2 A;  1D5Z C;  1M1K C;  1CKN A;  3D6C A;  5C3X A;  1EY5 A;  4K8I A;  5FLM G;  1I50 B;  5FJ8 G;  2I5M X;  1WCM G;  4LF8 Q;  2IHF A;  3K5M A;  1KXL A;  1QG7 A;  5HY6 A;  5AJ3 Q;  5LL6 X;  4QUF A;  4A3E G;  2JA7 G;  3NWT A;  2K4K A;  2EVB A;  3PUZ A;  1Q3L A;  3J81 E;  1C8C A;  1GJX A;  1Q8I A;  4DR1 L;  2UUC L;  3GTM B;  2XWJ B;  4N8X 1;  5IWA L;  4LUO A;  2BCO A;  2WB1 B;  1AFP A;  1R9T B;  2R6G A;  1KNE A;  4UP9 A;  3SR1 A;  3CW2 C;  2Q2U A;  2X69 A;  4POG A;  4S3S A;  1M90 C;  3QOL A;  4JI5 L;  3HOY B;  4ZCK A;  2CW0 C;  1EEF D;  2QIL A;  4IAL A;  2J4X A;  4KN7 C;  3TN2 A;  3HOU H;  5M5X H;  4A93 H;  1K0S A;  1ILQ A;  2IPK D;  2B2W A;  1YNJ C;  1VQO A;  4IPC A;  1D7Q A;  1AEX A;  3U58 A;  5I2Y A;  2ZTE A;  1P16 A;  5JJZ A;  1EY9 A;  3J7A V;  3I91 A;  3C1E A;  2NVY H;  1UEB A;  3HKZ E;  2K05 A;  1JWS D;  2M00 A;  3EQL C;  3NBH A;  3OWE B;  4B3R L;  4A3J H;  4A93 G;  1PH9 A;  5IP7 H;  5JPM C;  5DEH A;  1E0B A;  1PFN A;  2RDF A;  3ULJ A;  1E2V A;  2F0N A;  2R93 B;  1KIX A;  1PZK D;  1R4P B;  2RVL A;  3ER0 A;  3UDX A;  4LUZ A;  1L0Y B;  1ESR A;  4DU9 A;  1G2S A;  1SYG A;  3LGJ A;  3H3V C;  1J8I A;  2F4V Q;  1Y8O B;  2E75 C;  3GTG B;  4FO2 A;  1HTL D;  1VQ9 A;  3ICE A;  5HGT A;  2F4V L;  4A3B G;  3S1Q B;  1L2F A;  1E1T A;  3SK4 A;  1LV9 A;  1J5E Q;  4DR6 L;  2K6A A;  2XRQ D;  3W1B A;  4C3H B;  5C4J B;  1TQO A;  4J6H A;  4X3S A;  3T1Y L;  3S1R H;  2A6H C;  4GOP A;  1A63 A;  4UPA A;  3H09 A;  3QIA A;  5BR8 Q;  4DR6 Q;  2F52 A;  4L63 B;  4A3D H;  3BZK A;  3S9W A;  1OXX K;  2XVS A;  3ERS X;  5ELO A;  3PO2 G;  1JOO A;  2R7Z B;  3CRK C;  5TSS A;  4QGU A;  3NQT A;  2NN6 H;  1LTA D;  1JWU D;  4RFB A;  4JI8 Q;  1Y1V G;  5IGG A;  1YJW A;  2PW5 A;  5DLQ E;  1NR2 A;  1LT5 D;  4LK1 C;  3E3X A;  1IZ6 A;  5C5L A;  4CJ0 B;  1RF2 D;  3DMU A;  3TQY A;  2CCZ A;  2O4X A;  5C5M A;  3S15 B;  3QR8 A;  4ABN A;  1YEZ A;  2K75 A;  2QDB A;  3I4M H;  4JI3 L;  1UE6 A;  1HR0 L;  1G91 A;  1A2T A;  2ENB A;  2IX0 A;  3I4M B;  3X3N A;  1ENC A;  1SE2 A;  5LL6 S;  3CCU A;  5E3F A;  3V96 A;  2PW7 A;  2WII B;  5C3E G;  4UP8 A;  3EIV A;  2QCP X;  2CWA A;  2FFK B;  3SE0 A;  1PRT D;  4GN5 A;  3A55 A;  3JAM L;  3M85 A;  1IKM A;  3N6R A;  2EJF C;  2JK8 A;  1MJE A;  4P75 A;  4A3M H;  4F87 A;  4BA1 I;  1VQE A;  4JI5 Q;  4WOR A;  4UHV A;  4M8A A;  3D3R A;  5JJI A;  3NEL A;  1SYF A;  3L0O A;  3KLS X;  4LFA Q;  2KHI A;  1LT6 D;  2K5V A;  4APV A;  2OQ0 A;  3VR5 A;  1LT3 D;  3W5O A;  3STB D;  2UXC L;  4HIO A;  1M4V A;  2WAC A;  3WOE A;  3QG1 A;  3LWU A;  5M5Y H;  4HJ7 A;  3S1N H;  1H9S A;  4DR4 Q;  2B2W C;  2ZJR A;  3CF5 A;  4JI1 L;  2VS1 A;  4OX9 Q;  3NE5 B;  4KY7 A;  4JBK A;  3S17 B;  1WTX A;  3STB C;  3JAM c;  1KAW A;  1SJH D;  3F2D A;  3Q8D A;  4RHR A;  1QCB D;  3TS0 A;  2E2J H;  2O5J C;  4UDU C;  3CMA A;  1XMO Q;  4FXK C;  4HN7 A;  1AE2 A;  4R4O A;  4BA2 I;  4HSV A;  1X3E A;  1K3B C;  2UUC Q;  1EIY B;  4GKK L;  2CH4 A;  1UE5 A;  1SE3 A;  2A69 D;  4R4I A;  4OXP A;  2G9H D;  3W3A A;  3HZX A;  4PNY A;  3GQB A;  2QKI C;  4WRD A;  5C4X G;  3DM3 A;  5IYC G;  2IY5 B;  3NQI A;  2L15 A;  2SNM A;  1YVC A;  2DY8 A;  3FHW A;  4Y7N H;  4DAY A;  3HKZ B;  5D3I B;  1UE1 A;  3JC6 6;  1RCV D;  2UXD Q;  3I4N G;  1DXM A;  3KF8 A;  4OGQ C;  4V0B A;  3F2B A;  4XQN A;  3TME A;  1EEI D;  4FXD A;  2JA9 A;  1JB7 A;  2JJQ A;  2SOB A;  3K0X A;  4AYB E;  3MZ5 A;  1JJ2 A;  3M9B A;  1DOK A;  4KJN A;  1PH1 A;  4XT3 B;  2IL8 A;  2E5L Q;  2PZW A;  3G6E A;  5CV9 A;  5M3M B;  2B2Y A;  2KBN A;  5EJW A;  1EY8 A;  1YNN C;  4ODG A;  2WB1 E;  1L1O C;  2B2V A;  2IT1 A;  4IPD A;  2K33 A;  4BY7 G;  4QQB X;  4GKK Q;  4GLX A;  2EDG A;  3NTI A;  3J81 c;  1VQI A;  4X3U A;  1BF4 A;  1NUC A;  4NXN Q;  1H9J A;  2NYZ D;  3LX0 A;  5JAV A;  2F3I A;  2BDN A;  2JA5 H;  3D4W A;  2GN5 A;  1TY0 A;  5BN3 A;  2ZJQ A;  1SYE A;  3PUV A;  1QOH A;  5G3L F;  1V1P A;  1AZQ A;  2JA8 H;  4JK1 C;  5JEA G;  1HXY D;  3ND8 A;  2K50 A;  2JA6 G;  1TU2 B;  1D1I A;  1C48 A;  4DR2 Q;  4DR1 Q;  1LTB D;  1FD7 D;  2F0G A;  3I2Z A;  1Q86 C;  1V9P A;  1UAP A;  1MSG A;  4IQZ A;  2Z6B A;  4RHS A;  4JI7 L;  4OL7 A;  5FLX c;  3J81 L;  3VYR A;  4PMB A;  5CV5 A;  4JOI A;  5BN5 A;  4X65 L;  2E74 C;  1WYD A;  1HNX Q;  3OYY A;  4ZQ3 A;  5CYU A;  2LSS A;  1EWI A; 
#chains in the Genus database with same CATH homology
 3FP9 A;  4ME3 A;  1AH9 A;  1XMQ L;  1ASZ A;  4B3S Q;  4BXX G;  4IFD G;  5IT9 c;  1SLJ A;  3A74 A;  3D0F A;  3MEF A;  1VQM A;  3KJO A;  4NXM L;  1IBM Q;  3ULL A;  5M3M G;  2MNA A;  4LF9 L;  2LXK A;  2D0O A;  4C3J H;  1Y1V H;  1X6O A;  2AWO A;  2GVA A;  1PH4 A;  1YJN A;  2ES2 A;  1VQD A;  2DUD A;  4JI7 Q;  1X54 A;  1A0I A;  2B3G A;  1YI2 A;  2BA1 A;  4DR7 Q;  5IY0 A;  4POF A;  1N32 Q;  2UXB L;  1N34 L;  2YTV A;  5C4J H;  4DV4 Q;  4GNX A;  1GVP A;  1IBL Q;  3HOU G;  2XTI A;  3EBE A;  4A75 A;  5IYB H;  1GD7 A;  1CKM A;  4BBR H;  5LMN Q;  2JA5 G;  3K8A A;  2OTL A;  3L7Z C;  3GTK H;  2OQK A;  1HH2 P;  2R7F A;  1KRT A;  5GAD C;  4QJF A;  4P72 A;  1VQ8 A;  3S1Q H;  3CCE A;  4RG1 A;  4K0K Q;  4WJ4 A;  4A3L H;  5ELN A;  1CSP A;  3S2D H;  2K14 A;  1Q1B A;  2GVB A;  3CC4 A;  3M3Y H;  4BY7 H;  1CKN B;  2JEA I;  3CP0 A;  1MKH A;  1VQJ A;  3GTG H;  4B3R Q;  3IRB A;  4OWT B;  2UUA L;  1E3P A;  1S40 A;  1NMF A;  4JI0 Q;  2NVQ H;  2I0Q A;  3NEN A;  4OON A;  2RHQ B;  1V1Q A;  4DR3 Q;  1XNQ L;  3HOV H;  4A3E H;  4GKK L;  3RZD H;  4YY3 L;  1K8A C;  1XMO L;  3OTO L;  4X65 Q;  4DV5 Q;  1LTL A;  4YHH Q;  1XNQ Q;  1J6Q A;  2KCM A;  4DV0 L;  1L1O B;  3CPF A;  4R4T A;  4PZ6 A;  1X3G A;  5HGQ A;  1QZG A;  3BU2 A;  2OTJ A;  1VQ4 A;  3GTQ H;  4DK3 C;  2WFW A;  3KF8 B;  4R4Q A;  2VQF Q;  1EUJ A;  3HOW H;  1JE5 A;  4DNI A;  4B3T L;  3UDG A;  3CCS A;  2KHJ A;  1Q8K A;  3E9I A;  4GNX B;  4JBJ A;  4A3F G;  1VQG A;  4X6A H;  2N78 A;  1PVO A;  1Q12 A;  3I4N H;  1KQS A;  4JI6 L;  3W1G A;  2PI2 A;  4HJ9 A;  3CXC A;  1N36 L;  1HNZ Q;  3TRZ A;  1H95 A;  3RN5 A;  2R92 G;  4OWW B;  5JJL A;  1Z9F A;  1JT8 A;  4DPG A;  5C44 G;  4JI0 L;  2NZH A;  1IBK L;  3RZO H;  4QL5 A;  4OWX B;  1E7Z A;  4ALP A;  2N3S A;  3AEV A;  4A3J G;  1WI5 A;  4JOI C;  1XNR L;  1AE3 A;  4A3I H;  1YBY A;  2HT1 A;  1B70 B;  4GOP C;  2I5L X;  3OTO Q;  4DV5 L;  1PH5 A;  1IL2 A;  2UXC Q;  1PYS B;  1E24 A;  4YWK A;  3I4M G;  4IJL A;  1XMQ Q;  4LW1 A;  4B3S L;  1HNW Q;  1GM5 A;  4DV6 Q;  1X56 A;  2YYZ A;  1QVF A;  4DKA C;  1PH2 A;  2MO1 A;  4JI1 Q;  1S72 A;  4LF6 Q;  4JV5 Q;  4LF7 L;  4YCU A;  5BR8 L;  3S16 H;  1NMG A;  2IHE A;  4R4C A;  1QVG A;  1WJJ A;  3GTL H;  4QIW E;  4YWM A;  2UU9 Q;  3HOY H;  1I5F A;  1JMC A;  2ALY B;  4AQY L;  1L1O A;  3GO5 A;  2EXD A;  3H3V H;  1BKB A;  4JCV E;  3A5U A;  1G6P A;  1VQC A;  1IBK Q;  5J3B A;  2YU9 H;  4AQY Q;  2WAQ G;  1E22 A;  3PO2 H;  3PCO B;  4IO9 A;  3KDF B;  2VQE L;  1EQR A;  3FKI H;  1NY4 A;  1HZA A;  1X3F A;  1LUZ A;  4GKJ L;  1LM0 A;  1IYJ B;  2ATW A;  1K83 H;  2UXD L;  2VUM H;  4DV7 Q;  2R7Z H;  3KOJ A;  4A3F H;  2XGT A;  3A0J A;  1QZH A;  1HR0 Q;  4JI3 Q;  4LFB Q;  1OTC A;  1U0L A;  2CQO A;  2N8N A;  1M1K C;  1CKN A;  2E2H H;  1WFQ A;  5FLM G;  1EOV A;  3UE0 A;  5FJ8 G;  2I5M X;  3HFZ B;  1PH6 A;  1WCM G;  4LF8 Q;  4LFC Q;  3PO3 G;  2IHF A;  2ZTC A;  1I50 H;  4BY1 G;  3NEM A;  1IXR A;  4C3H H;  5HY6 A;  5AJ3 Q;  2Q2T A;  4OO1 G;  1KXL A;  2JA7 H;  2A19 A;  4A3B H;  1KRS A;  3CPW A;  4A3E G;  3HOV G;  4HJ5 A;  2JA7 G;  4IFD I;  1FJG L;  2K4K A;  3M4O H;  2WB1 G;  4BY1 H;  3BJU A;  3CCJ A;  4DUY Q;  4JBW A;  4PZ7 A;  4QY7 A;  1A62 A;  3PUZ A;  4JI2 L;  3HOX H;  5FLM H;  1VQL A;  2OWO A;  1NJI C;  2BH2 A;  2Z6K A;  4DR1 L;  3PGZ A;  5IYD G;  2UUC L;  5IWA L;  1XTD A;  3D31 A;  3UE1 A;  2JEB I;  4A3L G;  4LUO A;  3WWV A;  1O7I A;  2RCN A;  3EN2 A;  1N9W A;  4DV3 L;  5GQO A;  2R6G A;  4UP9 A;  1XPR A;  3CW2 C;  1T9H A;  2Q2U A;  3DLL A;  2UU9 L;  1M90 C;  2AKW B;  4POG A;  4MNO A;  2VUM G;  1VS0 A;  4JI5 L;  1VQ6 A;  3UDF A;  1I3Q H;  3HOU H;  3S15 H;  3PUX A;  5M5X H;  5K36 G;  3RLF A;  2NVX H;  2ASB A;  2AHO B;  1WOC A;  1B7Y B;  3PIO A;  3CME A;  4A93 H;  2PMZ E;  1HNX L;  2R93 H;  4XIG S;  2ZJP A;  4A3G H;  1PH7 A;  1UE7 A;  4O2D A;  1EYG A;  1KL9 A;  4TVA B;  2V1C C;  3NBH B;  1K0R A;  1VQO A;  3U4V A;  4IPC A;  1Q81 C;  4JV5 L;  1D7Q A;  3GD7 A;  3U58 A;  1K73 C;  2ZTE A;  1P16 A;  3PF5 A;  4DR2 L;  1N33 L;  4DV7 L;  3SGI A;  1VQK A;  3S2H H;  3HOZ G;  3HOZ H;  1FL0 A;  4NXM Q;  4GNX C;  4BXX H;  2NVY H;  1UEB A;  3CQZ H;  3HKZ E;  2OCE A;  4LF9 Q;  4JBM A;  3GDE A;  4HIK A;  3K81 C;  1Q82 C;  4AYB G;  1FGU A;  2NN6 G;  4B3M Q;  3T1H L;  4A3G G;  4BBS G;  2YTY A;  4B3R L;  2R93 G;  1YHB A;  4X66 Q;  3S24 A;  3PSI A;  4IOC A;  4A3J H;  2K5H A;  5IP7 H;  3AFP A;  1PH9 A;  4A93 G;  3KDF A;  2VNU D;  5LMN L;  4GOP B;  2Y0S E;  1FJG Q;  4Y52 H;  3ULJ A;  1PH3 A;  4A3D G;  3ULP A;  3TRE A;  3JAM i;  3KF6 B;  1KIX A;  1CKO A;  3PV0 A;  3ER0 A;  4GLA C;  3UDX A;  4LUZ A;  2VZA A;  3F2C A;  4DR5 Q;  3S17 H;  3F8T A;  3OW2 A;  4PG3 A;  4LNQ A;  3HOW G;  3LGJ A;  4DV3 Q;  3K80 C;  2JA6 H;  2F4V Q;  1SFO H;  3AYH B;  4AIM A;  1SMX A;  1HR0 W;  4DV1 Q;  3J80 i;  4YWL A;  4HID A;  1BBU A;  1VQN A;  3H3V I;  1R9T H;  4DR3 L;  2JA8 G;  1VQ9 A;  1W2B A;  3KYH C;  3ICE A;  2F4V L;  4GLV B;  2HHH Q;  3GTM H;  1QVC A;  4A3B G;  2CKZ B;  1Z47 A;  4L5T A;  4MZ9 A;  1XJV A;  4JI4 Q;  1KC8 C;  4GS3 A;  1WCM H;  1L2F A;  1SR3 A;  1E1T A;  1YIJ A;  3PO3 H;  4KLK A;  3T1Y Q;  2KCT A;  2MO0 A;  3G4S A;  3H15 A;  1VQF A;  3KF6 A;  1GKH A;  2HIV A;  3U4Z A;  4LUV A;  1J5E Q;  1EQQ A;  4R1J A;  1PHJ A;  4DR6 L;  3K7U C;  1Q7Y C;  3W1B A;  4UP7 A;  3S1R H;  3T1Y L;  1B8A A;  2HQL A;  1JJC B;  1TWF H;  3RNU A;  4GOP A;  1A63 A;  4UPA A;  4XTC S;  2E8G A;  2WP8 J;  5BR8 Q;  4NXN L;  4DR6 Q;  1C9O A;  2F52 A;  1YZ6 A;  4JC0 A;  3MXN B;  2VW9 A;  4A3D H;  2UXB Q;  5IYB G;  3FKI G;  3BZK A;  1SRU A;  1OXX K;  3ERS X;  5ELO A;  2D62 A;  4OX9 L;  4P74 A;  3PO2 G;  2D0P A;  2UUB L;  4C2M H;  2Y0S G;  4DUZ Q;  4QGU A;  3RLN A;  4BBS H;  4LF4 Q;  4EX5 A;  2AWN A;  3CAM A;  4JI8 Q;  1Y1V G;  4DR7 L;  1TWG H;  2QA4 A;  4DV2 L;  2N49 A;  5DLQ E;  3ZJY C;  1YJW A;  5M3M H;  4MTN A;  1OXU A;  4IPH A;  5E7N A;  4TQU S;  1IZ6 A;  3F1Z A;  2Z0S A;  5C0X J;  1CUK A;  3TQY A;  2CCZ A;  1OXV A;  2EIF A;  1S3O A;  5GRO A;  1VQP A;  1YEZ A;  1P8L A;  2K75 A;  4DK6 C;  3I4M H;  4JI3 L;  1UE6 A;  3G48 A;  1HR0 L;  1Q1E A;  4IOA A;  4LFB L;  1CSQ A;  2IX0 A;  1VQH A;  1TXY A;  4A3I G;  3GTO H;  1G51 A;  4PMW A;  1MIU A;  1QUQ B;  3CCU A;  1XNR Q;  1XPU A;  4DUZ L;  5C3E G;  5C44 H;  4DAY B;  1A8V A;  4P73 A;  4UP8 A;  4YCV A;  3J81 j;  4JI4 L;  3J7A 5;  1X9N A;  3EIV A;  4DR5 L;  1X65 A;  3PUW A;  5C0X G;  2CWA A;  5IE8 A;  4DV6 L;  2YTX A;  3E9H A;  1TWA H;  1TWH H;  1VQ5 A;  4GN5 A;  1N36 Q;  1J5E L;  3M85 A;  1V43 A;  3H0G G;  1QUQ A;  5IP9 H;  4DV1 L;  2JK8 A;  5IYD H;  2R7D A;  3GTJ H;  1PFS A;  1MJE A;  2I5H A;  4P75 A;  4A3M H;  3HOX G;  4B3T Q;  1HZC A;  4L5R C;  1NTG A;  4LF5 L;  4LWC A;  3J7Z C;  2B63 G;  4NPS A;  4BA1 I;  5LMU L;  3AQQ A;  4HIM A;  1VQE A;  4JI5 Q;  2NVT H;  1XPO A;  1HNZ L;  3AFQ A;  1K8G A;  2MFI A;  3I4O A;  5JJI A;  3NEL A;  3KLW A;  3L0O A;  3J81 i;  4DV4 L;  1I94 Q;  4RMF A;  1IBL L;  2MQH A;  4LFA Q;  1GO3 E;  5FJ8 H;  4LF6 L;  1X55 A;  4UY8 C;  2KHI A;  2K5V A;  1YJ9 A;  4APV A;  5IWA Q;  4X62 Q;  2OQ0 A;  4GN4 B;  3W5O A;  3STB D;  2UXC L;  1NE3 A;  2AMC B;  1HZB A;  4HIO A;  2PQA B;  2VY3 A;  3GTP H;  2R7Z G;  3KFU A;  5M5Y H;  4K0K L;  1PA6 A;  4HJA A;  4HJ7 A;  3S1N H;  4DR4 Q;  4IJH A;  2ZJR A;  3CF5 A;  1I6H H;  4JI1 L;  2VS1 A;  4OX9 Q;  4LF7 Q;  2UUB Q;  1U5K A;  5AJ3 L;  4JBK A;  5LMU Q;  2BA0 A;  3RR5 A;  3STB C;  1W3S A;  4L5Q A;  1KAW A;  3JAM c;  3RN2 A;  1RL2 A;  3F2D A;  2ID0 A;  4A3K H;  3Q8D A;  2QEX A;  1LYL A;  3TS0 A;  2E2J H;  3M4P A;  3CD6 A;  2WAQ E;  3KJP A;  4DUY L;  3CMA A;  1VQB A;  1ASY A;  1XMO Q;  1AE2 A;  3M7N A;  4R4O A;  4C3I H;  1TWC H;  2A8V A;  4BA2 I;  5JJK A;  1BVS A;  5EAY A;  1HNW L;  2YV5 A;  1X3E A;  3UDI A;  4EQ5 A;  4X62 L;  1EIY B;  2UUC Q;  4GN3 B;  1YHA A;  5IP9 G;  4X64 Q;  3HOY G;  2PI2 E;  1VQA A;  1UE5 A;  3H0G H;  5H1S E;  1YIT A;  4GKJ Q;  4KHP Q;  3PUY A;  2PQA A;  4R4I A;  4OXP A;  1YNX A;  4A4I A;  1MJC A;  1N8R C;  3CC2 A;  2QGQ A;  1SE8 A;  4KHP L;  4PZ8 A;  2Q2H A;  4A3C H;  1RIP A;  3DM3 A;  5C3E H;  5M3F H;  5IYC G;  4LF5 Q;  2IY5 B;  5C4X G;  2IX1 A;  1Y14 B;  3PIP A;  2JQO A;  2CFM A;  4H02 A;  3TEH B;  3S14 H;  2L15 A;  3I7F A;  1YVC A;  4DV0 Q;  1SN8 A;  3FHW A;  4Y7N H;  1E1O A;  5M3F G;  5C4X H;  1D8L A;  2CWP A;  2LXJ A;  1I94 L;  3I56 A;  2R92 H;  1UE1 A;  3JC6 6;  2VL6 A;  3M4Q A;  2BH8 A;  2VQF L;  2UXD Q;  2NZO A;  2C35 B;  4A76 A;  3I4N G;  1N33 Q;  2H5X A;  1PV4 A;  3F2B A;  4JI6 Q;  1K3R A;  3HKZ G;  3A5Z B;  3U50 C;  2EQS A;  2JA9 A;  4IPG A;  3CCV A;  1JB7 A;  2PNH A;  4OO1 I;  5C0X I;  2JJQ A;  3K0X A;  4AYB E;  1VCI A;  4JG2 A;  1JJ2 A;  1VQ7 A;  2HIX A;  2RHS B;  3M9B A;  1PH1 A;  4NB3 A;  3CCL A;  4LFC L;  3CCM A;  4B3M L;  2E5L Q;  3S1M H;  4A3K G;  3I55 A;  1C7Y A;  2E2I H;  4KI0 A;  4LFA L;  3G6E A;  2ZM6 Q;  2KBN A;  1PYB A;  2VQE Q;  1N32 L;  2WB1 E;  1N34 Q;  1FVI A;  1L1O C;  2IT1 A;  4IPD A;  2Q2I A;  4BY7 G;  3J80 c;  1L0W A;  3G71 A;  2Z6K C;  3CCQ A;  4QQB X;  4GKK Q;  4DV2 Q;  4GLX A;  1Y1W G;  3VDY A;  3BZC A;  5M5W H;  4DR4 L;  3J81 c;  4KHZ A;  1Y1W H;  1IBM L;  1NBW A;  1VQI A;  2DGY A;  2NN6 I;  4L5S A;  4NXN Q;  3CCR A;  1HJP A;  2FXQ A;  4J15 A;  4X66 L;  1YHQ A;  3RLO A;  2F3I A;  4DAM A;  1JJG A;  4BBR G;  2JA5 H;  1G29 1;  1KHI A;  2GN5 A;  1BBW A;  4LF8 L;  3L2P A;  3CC7 A;  2E5L L;  2ZJQ A;  2UUA Q;  2ZTD A;  3PUV A;  2JE6 I;  2K5N A;  2ZM6 L;  4JI8 L;  5LMN W;  2JA8 H;  2KEN A;  1EIF A;  2B63 H;  2A1A A;  3E0E A;  5JEA G;  4YY3 Q;  4X64 L;  4A3M G;  2K50 A;  1PH8 A;  2JA6 G;  1SRO A;  1OXS C;  2B29 A;  1EFW A;  2K52 A;  4AH6 A;  4DR1 Q;  1HZ9 A;  4HJ8 A;  3I2Z A;  4DR2 Q;  1Q86 C;  1Q46 A;  1KD1 C;  4JYA L;  1V9P A;  3B6Y A;  1OXT A;  1K9M C;  5GAE C;  4IFD J;  1DGS A;  3PF4 A;  4JYA Q;  4JI7 L;  5GAH C;  3K7A H;  4O0A A;  4YCW A;  5FLX c;  3T1H Q;  1C0A A;  2RF4 A;  4P71 A;  5JEA J;  5IP7 G;  4JOI A;  4X65 L;  4JI2 Q;  4LF4 L;  1UWV A;  5IYC H;  4YHH L;  1WYD A;  1HNX Q;  4FDB A;  4A3C G;  3HKS A;  3TS2 A;  3OYY A;  4WJ3 M;  2HHH L;  2LSS A;  1EWI A;  5GAG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...