4BBSH

Structure of an initially transcribing rna polymerase ii-tfiib complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
134
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 22
structure length 134
sequence length 145
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4bbsH00
1YHBA 3F2CA 3J80i 2N49A 2YTVA 2JK8A 3M9BA 4JI7Q 4L5RC 4LF7Q 1E7ZA 1PYBA 3WWVA 1EIYB 1YJ9A 1FGUA 2R92G 1WOCA 2DGYA 3S16H 1XMOL 1EIFA 2LXJA 1S72A 2ZTCA 3MXNB 1E1TA 1Q1EA 4GKJQ 1X65A 2KHIA 2PQAA 4L5TA 4JI2L 4DV1L 2BH2A 1OTCA 2I0QA 1J5EQ 3HOXG 4A4IA 5FJ8H 3TEHB 1PHJA 2R7ZH 4P75A 1VQFA 1X55A 3M3YH 4LFBQ 2CFMA 4XTCS 1BBWA 1HNXQ 4JI4L 1XNRL 1AE3A 1EQQA 4DR4Q 3AQQA 2PMZE 4OONA 1X54A 1GKHA 4PZ7A 4UP7A 4DV3L 1VQOA 1VQMA 2NZHA 4JV5Q 5JEAJ 3J7ZC 4LNQA 4LF9L 4GOPB 2L15A 2AKWB 1SROA 4YWMA 2I5LX 5LMNW 4HJ7A 4AQYL 1VCIA 4A3KG 3BJUA 4J15A 3GTGH 4MTNA 5J3BA 2B3GA 4HJ9A 5HGQA 4QL5A 3OTOQ 4IJLA 1PFSA 4B3SL 3H0GH 4GN3B 4GOPC 2OWOA 1QVCA 1GM5A 2JEAI 3S2HH 4A3LH 1I3QH 4JI5Q 4JI5L 2YYZA 4DV4L 3UDIA 3CCLA 4UPAA 4OWWB 1KRTA 1I50H 3HKZE 3A0JA 4OX9L 4DR4L 2VL6A 4JI4Q 2GN5A 2YTXA 1XNRQ 4OWTB 3L0OA 5GROA 3HKSA 1OXUA 1SE8A 1IBKL 3PF4A 3KF6B 2NN6G 2Q2UA 2NVQH 2IX0A 3B6YA 4GLVB 4DR2Q 2NVXH 1J6QA 1Y14B 4BA1I 5IY0A 4JBJA 1PH4A 4JI8Q 2ZM6Q 5GADC 1E22A 1V43A 2OCEA 3KJPA 3TS2A 4GKJL 2UU9Q 2OQKA 4KLKA 1VQ8A 5GAGC 2UUCQ 4P72A 3GTPH 2K5VA 3E0EA 4MNOA 1KD1C 1IBMQ 2HQLA 5IE8A 2VNUD 4Y52H 3CCSA 4GN4B 1E3PA 1K9MC 4BXXG 2RHSB 1EYGA 4DUZQ 2B63H 4JI1L 4JI2Q 2NVYH 3CMAA 1G51A 1MJEA 5FLXc 1Z47A 3K7AH 4BBRG 3HOWH 3S1NH 3GTQH 2C35B 5M3MH 4DNIA 4AH6A 3J81i 2K52A 2WB1E 3GTJH 1VQ6A 2ATWA 4ME3A 3AFPA 2LXKA 1T9HA 4NXNL 4DV5Q 2ID0A 3CCVA 4X65L 2EQSA 4GLAC 5M5XH 1JB7A 1I5FA 4H02A 3G71A 4DV6L 3T1HL 1VQAA 2VQEQ 4JI0L 2R92H 4FDBA 3OW2A 2VQFL 4DUZL 2Z6KC 4YWLA 2I5HA 3PCOB 4GS3A 1U5KA 4QJFA 3GDEA 4HIDA 3S1QH 2JJQA 3HOWG 3PUVA 4DV4Q 1KHIA 4A3DG 1X9NA 2D0OA 3CC7A 3STBC 1Y1WH 3NELA 4A3IH 2JA7H 3HOVH 1X3EA 1TXYA 2PQAB 4NB3A 1K8GA 4BY7G 4A76A 1HZCA 1NE3A 2JA8H 3RZDH 3CCQA 4IFDJ 1VQLA 2K14A 3RNUA 1KL9A 1MJCA 2H5XA 4JOIA 2IHEA 5C4JH 3RN2A 2UUCL 4BY1H 3I55A 1K8AC 3CAMA 1RIPA 1JJCB 3H15A 5IWAL 1SR3A 2YU9H 1IBKQ 3GTLH 5LMNL 3KDFA 5C0XG 1KXLA 1HH2P 1N34Q 1PH1A 4JI3L 1I94Q 4DR2L 3PV0A 1PV4A 4TQUS 5HY6A 1N33Q 2CWAA 4X66Q 1VQ5A 3K7UC 3UE1A 4BY7H 4IOAA 1PH8A 3I2ZA 5C0XI 1L1OC 3CCEA 1Q86C 4DR1L 2QEXA 1HNZQ 3S15H 5ELOA 1G291 4DK3C 1VQ7A 3HOXH 1Y1VG 4GNXC 4R4IA 4A3MG 4PZ8A 2NVTH 3CF5A 4AQYQ 5C44H 4QY7A 1XNQQ 3M4QA 3G4SA 3PUWA 2WFWA 5LMUL 3HOUH 3M7NA 4BBSG 4A3CH 4JBWA 4B3RQ 1AH9A 3TRZA 4DV2L 3OTOL 1OXSC 1L1OB 4DV0L 2VY3A 4P74A 1LM0A 3Q8DA 1HZAA 1VQDA 1VQIA 3TQYA 3PF5A 1EQRA 3D0FA 1X3FA 2HIXA 1PH3A 4JI6Q 2N3SA 1VS0A 4B3RL 2ALYB 3JC66 3CCUA 2HT1A 4YHHL 2JA7G 3HOVG 3A5ZB 1XMQL 2XTIA 1KIXA 3DLLA 1Q8KA 2ZJPA 2IT1A 2QGQA 2A1AA 5IP7G 4DUYL 2VUMG 3S1RH 2FXQA 3OYYA 1QZGA 3KOJA 5H1SE 2WAQG 4IPHA 5E7NA 4DAYB 5FJ8G 1EFWA 4LF8L 1N9WA 2R7ZG 3A5UA 3NENA 1UEBA 1HR0Q 2CWPA 1N33L 1OXTA 5DLQE 1GD7A 4DV1Q 4P71A 2MO1A 1TWAH 1HR0W 1WYDA 4JCVE 4GOPA 4P73A 2K4KA 1VQGA 4YY3Q 2N8NA 1LUZA 1WI5A 4PZ6A 2ZTDA 4B3TQ 5IWAQ 1N8RC 1HNXL 4L5SA 1CKMA 1K0RA 3ULJA 1VQNA 3CC4A 2Y0SE 1NBWA 2NZOA 3PSIA 2N78A 1Q1BA 3EIVA 2MFIA 4XIGS 3GD7A 5IYCG 2JA5G 1N32Q 4IPCA 4A3EH 4A3GH 1JJGA 2ZJQA 4DV6Q 3T1HQ 1N36L 4LF6L 2UXBQ 4QGUA 4A93H 1NMGA 1DGSA 1YEZA 2DUDA 4PG3A 3W1GA 4IO9A 3K8AA 1OXXK 1CKNB 4LF4L 2GVBA 5FLMH 2UXDQ 4DAMA 1MKHA 3ULLA 2IX1A 2AHOB 1WCMH 1FVIA 1YJWA 1JJ2A 4LF5Q 2HIVA 5IP9H 1YI2A 3KF6A 1QVGA 1JMCA 3CCRA 4X6AH 4O2DA 1A62A 4RMFA 5M3MG 2UUAQ 3EN2A 1M1KC 2OTJA 4PMWA 3GTKH 4DR7L 2Y0SG 1SMXA 2R6GA 3K80C 4DR5Q 2UXDL 4A93G 4A3EG 1H95A 1CKNA 1TWFH 2UXCL 4JYAL 2K50A 2F4VL 1Z9FA 1N36Q 2E5LL 5ELNA 1E24A 4TVAB 2I5MX 3STBD 1XPRA 4LW1A 1JE5A 4KI0A 2F3IA 3E9HA 3H0GG 4NPSA 2R7DA 1I6HH 1S3OA 4B3ML 2AWNA 4R1JA 4JG2A 4A3KH 2GVAA 1S40A 3ULPA 1YIJA 5C4XH 5IYDG 4GNXA 1XPUA 4A3BG 4WJ4A 1CSPA 1WFQA 1BBUA 3CPFA 3KLWA 4LF8Q 2UUBL 4UY8C 1HZ9A 1O7IA 2YTYA 4DR6Q 4GLXA 3I4OA 1B8AA 2K75A 3AYHB 1VQJA 1BVSA 4LFCL 4BA2I 3ER0A 4AYBG 2CKZB 1KC8C 1QZHA 4QIWE 1NMFA 5GAHC 5IP7H 2VUMH 4A3GG 4DR3Q 1UE1A 4EX5A 2D62A 4L5QA 3DM3A 3AFQA 5C3EH 2Q2IA 2ZTEA 2E8GA 2UUBQ 3BZKA 4C3HH 4JBMA 1WJJA 4DV7Q 4DR3L 2JA9A 3CQZH 2D0PA 3IRBA 5C0XJ 1VQ9A 3I56A 2VW9A 3I4NH 4IPDA 4QQBX 4UP8A 4LFAQ 3F2DA 3ZJYC 1A8VA 3RR5A 4DPGA 3K81C 1GO3E 3NEMA 3D31A 1PA6A 2HHHL 4DR6L 4B3SQ 4LFAL 4JV5L 3A74A 5IYBH 4A3CG 5IT9c 3LGJA 1KQSA 5C44G 4BBSH 1CKOA 4DV0Q 1K3RA 1SN8A 1X6OA 3NBHB 1CUKA 2IHFA 1P16A 2EIFA 1QVFA 1PVOA 2KHJA 4JYAQ 4WJ3M 4DV7L 4HIMA 1Q81C 3T1YL 4O0AA 5M5YH 3JAMc 4DR7Q 4DV3Q 3J81c 2JA6G 4OO1G 2F52A 3G6EA 4ALPA 3J80c 2KCTA 3RZOH 4NXML 2HHHQ 1V9PA 1VQ4A 4LWCA 2UXCQ 4YCVA 1KRSA 1B7YB 3GO5A 5IP9G 4AYBE 5IYBG 4C2MH 4X64Q 2CCZA 4K0KL 1LYLA 2RCNA 4IPGA 3K0XA 4R4CA 3S1MH 1P8LA 3PIOA 3CMEA 1M90C 1TWCH 2OQ0A 1PH7A 1EUJA 4LUOA 5AJ3L 1R9TH 3HOUG 4R4TA 3TREA 4B3MQ 1MIUA 2E2JH 1OXVA 2MO0A 1IXRA 2BA1A 2PI2E 2JA6H 5JJKA 2RF4A 3U58A 4LUVA 4A3IG 1G6PA 1YZ6A 4HJAA 4A75A 1HNZL 3FKIH 2K5NA 1VQKA 1FJGQ 2VQEL 3KDFB 5GAEC 1YHAA 2PI2A 1TWHH 1D7QA 5BR8Q 5BR8L 4A3BH 3AEVA 2A8VA 2UUAL 1QUQB 5C4XG 1KAWA 4HIOA 5IYDH 3E9IA 5JJIA 2E2HH 1EOVA 2UU9L 1FJGL 3PO3G 1IL2A 5FLMG 1AE2A 2JEBI 3W5OA 2BH8A 2RHQB 3U50C 1Y1VH 2OTLA 2VS1A 4DV5L 1HZBA 1TWGH 2R93G 1XJVA 3ERSX 3PUXA 2Q2TA 4OXPA 1C9OA 4IOCA 1VQPA 4RG1A 5C3EG 1HR0L 3ICEA 4IFDG 1NTGA 3UDXA 4BXXH 1V1QA 5M3FG 3SGIA 3VDYA 2B63G 4C3IH 5EAYA 4Y7NH 3HOZG 2WAQE 2E2IH 4JI1Q 3TS0A 2VZAA 2R93H 4DUYQ 1W2BA 4LUZA 2QA4A 1XMQQ 1L1OA 4GN5A 1E1OA 1GVPA 4JI8L 2ZM6L 2YV5A 3M85A 1RL2A 2LSSA 2WB1G 1B70B 5AJ3Q 2BA0A 1UE7A 3J81j 2Z0SA 4LF7L 4KHPQ 3UDFA 3BU2A 4POFA 4NXMQ 3I4MG 3KFUA 3FP9A 2MQHA 1LTLA 5JEAG 3HKZG 1FL0A 3HFZB 1L2FA 4YCWA 4X64L 4K0KQ 2AWOA 4DR1Q 2CQOA 3M4PA 1VQEA 3I7FA 4IJHA 5LMUQ 2KENA 3HOZH 4POGA 1Q46A 3RLNA 3RLOA 4KHZA 1Y1WG 1IYJB 3RN5A 4LFCQ 1I94L 4A3DH 3PGZA 3HOYH 3PUZA 1YNXA 3PIPA 4HJ5A 1IBLQ 1HNWQ 1UE5A 5M5WH 1K73C 3CCMA 1IBML 1C0AA 2Q2HA 4C3JH 4HIKA 4DV2Q 4YCUA 3U4VA 4JI3Q 1UE6A 1XPOA 4BY1G 1HNWL 2EXDA 4LF9Q 1XNQL 3U4ZA 1XTDA 1IBLL 4JBKA 1PH6A 1SLJA 4GNXB 2NN6I 3T1YQ 3W1BA 4BBRH 3HOYG 2ZJRA 2IY5B 1VQBA 3G48A 4MZ9A 1C7YA 3CD6A 1A0IA 2PNHA 3FKIG 4JOIC 4X66L 1W3SA 3CXCA 4JC0A 1X3GA 5IYCH 4HJ8A 1SRUA 2JA5H 1EWIA 1PH5A 1YITA 4JI6L 1A63A 4EQ5A 1CSQA 1YBYA 2B29A 1N34L 1K83H 3EBEA 3CCJA 3M4OH 1HJPA 1L0WA 1VQHA 1D8LA 2R7FA 3UE0A 2A19A 4X65Q 1UWVA 5LMNQ 1Q7YC 3S2DH 2Z6KA 4DK6C 2ASBA 3PO3H 2KCMA 1IZ6A 3CC2A 1J5EL 3KJOA 3F1ZA 3JAMi 3F2BA 3S24A 1PH2A 2ES2A 4JI7L 2K5HA 3H3VH 3J7A5 5K36G 1Q12A 1VQCA 1SFOH 3GTOH 3I4NG 1Q82C 1JT8A 3BZCA 3F8TA 3L2PA 4LF6Q 2KBNA 2WP8J 4KHPL 2UXBL 4R4OA 4OWXB 4AIMA 4A3JG 2JQOA 1XMOQ 5JJLA 1PYSB 1N32L 4A3FG 1NY4A 4DR5L 2JE6I 3GTMH 5GQOA 4YWKA 5M3FH 3UDGA 4IFDI 3L7ZC 4GKKL 3RLFA 4B3TL 1YVCA 4A3JH 3PO2G 3CP0A 4A3FH 2MNAA 4GKKQ 1NJIC 4LF5L 4LFBL 1YHQA 3CPWA 4X62L 1ASYA 2V1CC 4R4QA 3I4MH 3FHWA 4X62Q 1WCMG 1BKBA 3CW2C 3H3VI 1PH9A 4APVA 4DKAC 2E5LQ 3KYHC 2XGTA 1QUQA 4NXNQ 3MEFA 2F4VQ 3S14H 2JA8G 1X56A 4LF4Q 4OX9Q 1ASZA 4A3MH 3PO2H 3PUYA 1YJNA 2AMCB 4YHHQ 3S17H 2VQFQ 4UP9A 1U0LA 3KF8B 4OO1I 4A3LG 4JI0Q 4YY3L
chains in the Genus database with same CATH superfamily
3F2CA 2N49A 2YTVA 1E7ZA 3J7YW 2R92G 4I7ZC 2SOBA 3VR3A 1EIFA 1PFMA 2VUMB 3MXNB 1Q1EA 1PFNA 1U4RA 3VR6A 1E0BA 2PQAA 3NWSA 4JI2L 4DV1L 3IFDA 4C3HB 1J5EQ 3HOXG 3EA6A 4A4IA 5FJ8H 4ILWA 1GHKA 1VQFA 3SK8A 1X55A 5JPNC 4XTCS 1HNXQ 1M8AA 4JI4L 1LV9A 4OONA 4DV3L 1GKHA 1VQOA 3N52A 4JV5Q 1SNPA 4LF9L 4J1MA 1RJTA 1IKLA 5LL6X 1SROA 4YWMA 1WCMB 1TS3A 4HJ7A 4AQYL 4IUVA 3BJUA 2AUKA 5KGUA 2Z9HA 4DAPA 4PNYA 1BCPB 1C4QA 3H0GH 4GN3B 3S2HH 4A3FB 4QUFA 4UPAA 4OWWB 2I46A 5ELDA 4G7ZC 5GROA 3VR4A 5D3IB 1IBKL 2Q2UA 4DK1A 2Q8RE 1Y14B 3I72A 3J81E 4G7OC 3MEHA 4QUCA 4GKJL 4K2LA 1DONA 3MC0B 4KLKA 4FVMA 2UUCQ 3SXHA 3GTPH 3E0EA 4Y52H 2O4XA 2RCFA 3HOVB 3CCSA 4GN4B 3Q23A 2B63H 4OIJA 2NVYH 5CYUA 1STEA 3AMUA 1RD9D 3K7AH 3U9SA 4BBRG 3GTQH 1STAA 4AH6A 2K52A 2OEOA 4ME3A 4JPBW 1JB7A 1B53A 3G71A 4U68A 1STHA 1K0SA 5E4XA 4ZYSA 4YWLA 1E2WA 1U5KA 4QJFA 1SNOA 3PUVA 1X9NA 2E2HB 2D0OA 1Y1WH 4A3IH 3S2HB 3ND8A 1CZGA 2KUMA 1WTRA 1EY5A 2QILA 4MTKA 3RNUA 4JOIA 2ZXPA 3I55A 3H15A 5IWAL 5T1GA 2YU9H 3KDFA 4S3SA 3IFTA 3K5MA 1DYQA 5ELFA 4V0BA 1PV4A 4HN7A 4BY7H 2OF1A 3I2ZA 5C0XI 1G91A 1Q86C 3S15H 4KY5A 3VR5A 2QEXA 1G291 2AQ2B 5EKLA 4GNXC 1GUSA 4R4IA 1XNQQ 3M4QA 3PUWA 2WFWA 3M7NA 1HFNA 1AH9A 2E74C 4DV2L 1OXSC 1STGA 4DV0L 2VY3A 4P74A 2K03A 1VQDA 1I3QB 5I9PA 1AFPA 1EQRA 3D0FA 3NSWA 5ISRA 4FF3A 1X3QA 5CV4A 5KNDA 2HD3A 1SJHD 2R92B 3JC66 2F3VA 2QDBA 2ICEC 3A5ZB 2VUMG 3TP8A 4DUYL 5IP7G 3S1RH 1YNJD 1QZGA 3KOJA 4DAYB 5E7NA 1EFWA 1N9WA 3NENA 2KECA 1UEBA 1HR0Q 1ICFB 2CWPA 5DLQE 1GD7A 3KLSA 2MO1A 1TWAH 4GOPA 2K4KA 1EY8A 1LUZA 1FNVA 2Y0SE 3BYTB 3PSIA 2N78A 4CDCC 1Q1BA 5EGTA 4XIGS 3GD7A 3I4MB 4E6IA 2JA5G 1N32Q 4IPCA 2ZJQA 3AB9A 4LF6L 4BY7B 4HTHA 4QGUA 1DGSA 2DUDA 4DNTB 4F87A 2MUYA 1ILQA 1OXXK 1Q8IA 2KJXA 5FLMH 1D6EC 1YJWA 2IX1A 1EIGA 2FINB 2HIVA 5KYIA 1JMCA 4X6AH 4O2DA 2EDGA 5COYA 2UUAQ 3SVMA 3EN2A 1G2TA 3OHXC 1EWCA 2CH4A 4PMWA 1SE3A 5I4DA 1SMXA 2R6GA 4R8NA 4A93G 4A3EG 1LTTD 4HR7B 2EYMA 4K14A 3T13A 4KY7A 2LS01 5EPJA 2F4VL 1PMRA 1U9RA 1E24A 3STBD 2I5MX 1XPRA 1G8ZD 1EEFD 1VMCA 3H09A 2R7DA 1MD2D 4AYBB 4G57A 4EQNA 2VB3X 4XQNA 2Z4HA 4XYQA 5G3LD 5C4XH 3SK6A 5IYDG 1EEID 1EIHA 1I4QA 1Y8PB 1MBYA 4DR6Q 3I4OA 1VQJA 1BVSA 1FD7D 4JK1C 1ESRA 3LWUA 1VMPA 4EX5A 1HUMA 2D62A 3DHQA 4RHSA 5I6WA 3HS0C 1SAPA 3BZKA 4DV7Q 1Y69U 2CW0C 4DR3L 2D0PA 2IX3A 2R7ZB 3S1NB 1I4GA 3F2DA 3OMGA 1JC7A 2KHSA 2L11A 4CJ2C 4B3SQ 5FLXL 2F0VA 4A3CG 2XRQD 1EY7A 4DV0Q 1CUKA 3IKJA 1TY0A 2EIFA 2KHJA 4ID6A 2P5ZX 3S17B 1B9NA 4ME5A 4WJ3M 2RSOA 2EY6A 3KBGA 3JAMc 4DR7Q 4DV3Q 3J81c 2JA6G 1TS5A 1TWHB 3SEBA 2HHHQ 5C44B 1HQMC 2CCZA 1HQRD 4X64Q 1PZID 3U9OA 1M90C 1PRTD 3PIOA 1I6VC 3W2DA 1PH7A 4LUOA 4HSPA 4R4TA 1SJED 4B3MQ 1WTXA 2MO0A 4ZAIA 4M8AA 1FGBD 2BA1A 2K33A 2PI2E 4C3IB 2RF4A 4IZ8A 2K5NA 1VQKA 5GAEC 1YHAA 3P20A 4X3TA 1DCZA 2A8VA 4F7XA 1QUQB 1Q90A 1A3VA 3VYRA 2JXMB 3A8KE 2BH8A 2RHQB 1JICA 1LT5D 4HMJA 1TWCB 3BDLA 4B08A 5FO8B 3PUXA 1HR0L 5C3EG 3HOYB 2A6HC 3UDXA 4BXXH 3MFYA 2E2IH 1RCVD 2VZAA 3A7AB 4KV6A 1HPCA 1W2BA 2NVQB 4LUZA 4L8JA 4GN5A 3RMHA 1E1OA 2NTTA 4MIUA 1GVPA 2XSCA 1W6JA 2BA0A 2OT2A 2Z0SA 3BU2A 4NXMQ 3I4MG 1LTLA 3HKZG 1SMYC 4RH6A 4KY6A 4RA8A 4EGVA 1JE4A 3I7FA 5C3XA 1OO9B 4IJHA 4A3JB 5AFWA 4KHZA 3OWEB 1IYJB 3RN5A 4A3DH 1IBLQ 2DY7A 2PZWA 3GTJB 1HNWQ 1C8CA 1C0AA 1J8IA 2AQ3B 1K3BC 1HNWL 3U4ZA 1IBLL 2F0IA 3P7JA 1SLJA 1H9SA 1WTPA 3HOUB 3SHLA 3W1BA 1I4PA 3V05A 5T1IA 1F2ZA 3G48A 4MZ9A 3MVVA 3CD6A 4JOIC 2PNHA 4X66L 1PTOF 1EWIA 1PH5A 4FF1A 3TN2A 1CSQA 1YBYA 3EBEA 2B39A 4KJOA 4K8IA 1UWVA 1S4ZA 3PO3H 2KCMA 1CA6A 1UEAB 3F1ZA 3JAMi 5K36G 3HGBA 4HAEA 1Z6HA 5HURA 1ENFA 1Q82C 2UXBL 2WP8J 2J4XA 1PYSB 4A3FG 1NY4A 2F0SA 3RD4A 4JW0A 3GTMH 4H7BA 5GQOA 4YWKA 5M3FH 4IFDI 5M5YB 1HTLD 3RLFA 1SYCA 3K57A 4A3JH 4NKLA 4GKKQ 4LF5L 3QIAA 1ASYA 2LY7A 1AP0A 3FHWA 4KD4A 1WCMG 3VR2A 1BKBA 3I70A 4FO2A 3NBIA 3NTHA 1QUQA 4XT1B 1ASZA 2AQ1B 3NUCA 3SE0A 2AMCB 1CK1A 4RHRA 3TSSA 3KF8B 4CBVA 4A3LG 3I90A 2HUGA 4JI0Q 5CV5A 1EY6A 5DAUA 3J80i 2L5TA 2NWGA 3M9BA 4KTAA 4O42A 3WWVA 1V1OA 1YJ9A 1FGUA 1WTQA 1TQOA 1XMOL 2LXJA 5EKKA 2ZTCA 3M4YA 1R4PB 2KHIA 4L5TA 1WVLA 2MPMA 1O7YA 3TEHB 3DWQA 1Y8NB 1JWSD 4IUPA 2CFMA 1BBWA 2XWJB 3TMEA 1CQVA 1EL0A 1EQQA 4DR4Q 5D3DA 1X54A 3PIP3 2EXZA 1VQMA 2NZHA 1SNDA 4LNQA 3J7ZC 4BBRB 5BN4A 3BS1A 5IGCA 4IUNA 5LMNW 2Z8LA 1VCIA 4J15A 3GTGH 1MHWC 4IJLA 1L0YB 1PFSA 3JAME 4B3SL 4GOPC 5LL6S 3M7GA 3I3CA 1NAPA 2JEAI 2YYZA 4CDEC 4DV4L 3CCLA 2RDFA 4J6HA 3HKZE 2VL6A 1XNRQ 3HKZB 4OWTB 4XXEA 1OXUA 1SE8A 3PF4A 2NN6G 2IX0A 4GLVB 4DR2Q 2NVXH 1IKMA 3QG1A 4JBJA 5GADC 1E22A 1EYAA 2EYJA 2HQLA 2VNUD 1JR0D 1K9MC 4OHJA 2PQEA 4BXXG 3ONAB 4JI2Q 3HOWH 1MJEA 1Z47A 3WDNA 1NUCA 2C35B 5CORA 5M3MH 2E2DC 4N9TA 2ATWA 1T9HA 4XDXA 5JEAH 5CR3A 2N55A 1SMYD 3T16A 3T1HL 4JI0L 4FDBA 2VQFL 1ENAA 2F0KA 2BE5C 3S1QH 3GDEA 2F0PA 2FMMA 3STBC 3HOVH 2K32A 4NB3A 4BY7G 1K8OA 3A8JE 1HZCA 2DY8A 2FFKB 3RZDH 3EQLC 1KL9A 2H5XA 2IHEA 4BY1H 1SYBA 1A15A 2DN8A 4K6DA 3WOFA 2O5JC 1HH2P 2BDNA 1RTNA 1PH1A 2RDHA 1O7ZA 1I94Q 2EJGC 1BCPD 4A3EB 4TQUS 5KEEA 5KYLA 1VQ5A 1X32A 4CKBA 3N6RA 1L1OC 1GUWA 3CCEA 3R2IA 4DR1L 3TP7A 1FYCA 1Y1VG 3RZOB 1FR3A 4A3CH 3HOUH 3SDZA 1PTOH 3TRZA 3OTOL 4QCLA 4HSVA 5IIFA 1GUTA 2WAQB 2VB2X 3UI2A 1X3FA 1F2YA 3NHHA 1PH3A 4JI6Q 3HOWB 1SNMA 1STBA 2HT1A 1HCZA 3FEWX 2XTIA 5DM73 1KIXA 1Q8KA 5IGFA 2FXQA 4NMZA 4LF8L 2R7ZG 4ULLA 1DM0B 1N33L 1OXTA 2B2UC 3OWFA 3DEOA 1HR0W 1WTOA 5M3FB 3C3LA 1VQGA 1WI5A 2ZTDA 4DAYA 1N8RC 3K5OA 3ULJA 1VQNA 1TR5A 2CVRA 1NBWA 2NZOA 3DMUA 2HDLA 2N88A 2MFIA 4A3DB 5IYCG 2GA4B 1XX8A 4A3EH 1JJGA 3T1HQ 5JVH3 2EYHA 1NMGA 2L12A 2F0FA 2UXDQ 3BYYB 2AHOB 4LJZC 1JJ2A 1YI2A 1QVGA 3KF6A 2DNCA 2L1BA 1PTOB 4RMFA 5M3MG 3O13A 1XYIA 1B1ZA 2Y0SG 3V96A 3K80C 5FLXE 2UXDL 1TWFH 3S1MB 2UXCL 1S5ED 1EY9A 2K50A 2JN4A 1N36Q 2E5LL 3I4LA 5CV9A 2CH4W 5D65A 5ELNA 4TVAB 4N9PA 4KI0A 2F3IA 4NPSA 1ET6A 4BS9A 3X3MA 4WORA 2E2IB 4JG2A 2B2WC 1YNJC 4TSSA 3ULPA 2TSSA 4A3BG 4WJ4A 3OIPA 1CSPA 3NP8A 1HZ9A 1O7IA 1B8AA 1ESFA 3AYHB 4LFCL 3ND9A 1BF4A 2KOLA 3DWAA 2CKZB 2VUMH 3GV6A 5IP7H 4DR3Q 2FJ2A 3DM3A 2A69C 2E8GA 3TP5A 4BWGB 4K6LA 1PRTC 5BN5A 3RZDB 1HA5A 3I4NH 2VW9A 4IPDA 3ZJYC 4DN4M 4DPGA 1A3TA 2KCNA 2CHBD 3D31A 1TT2A 2HHHL 4LFAL 4JV5L 2A6ED 1DXMA 1XTCD 3LGJA 5A2QE 1KQSA 1EFID 1V8QA 1X6OA 4C1NI 1QVFA 3OPOA 1Q81C 1TWAB 1RKNA 5J1ZA 3CU7A 3T1YL 2HQEA 3H0GB 4ALPA 2XN9C 2JA8B 1ZYRD 3C1FA 1ET9A 2RKSA 1KRSA 4AYBE 4C2MH 5E4WC 1LYLA 2F3WA 2RCNA 1TWFB 3S1MH 3GTLB 2CW0D 4PQXA 1TWCH 2XIWA 1GOZA 2ZXRA 2OQ0A 3HOUG 5AJ3L 1U4PA 1PTOD 4FYDA 3TREA 1OXVA 5CBEE 5C4ZA 3ITPA 2JA6H 1F9SA 3ERQA 4LUVA 3U58A 1C48A 1LO5D 2KEEA 3FKIH 4OELB 2VQEL 3KDFB 1NR4A 2NVTB 2PI2A 3AEVA 1E2ZA 2D5DA 5C0XH 5F2DA 1LTAD 5ELEA 5JJIA 4C3JG 2G9DA 1W6KA 5FLMG 2JEBI 5LHY1 1Y1VH 2K28A 3MHBA 1HZBA 1XJVA 4OXPA 1C9OA 3ICEA 1V1QA 5M3FG 3VDYA 2B63G 5C4XB 4C3IH 5EAYA 4Y7NH 1D2BA 2R93H 2X69A 1L1OA 1RL2A 1B70B 3CHBD 3J81j 1Y1WB 3UDFA 1PFBA 4POFA 4ZKCB 3KFUA 2MQHA 5JEAG 1G2SA 3HFZB 1GJXA 1L2FA 5M9OA 1I4XA 1PTOC 4K0KQ 1K8MA 2E75C 1D1IA 5KNCA 2Z6BA 5LMUQ 2KENA 2NYZD 2HDMA 1Q46A 2PCFB 3RLNA 3RLOA 5IGDA 4LFCQ 3PGZA 3I91A 3HOYH 3D3RA 4XQJA 1UE5A 5M5WH 1K73C 3R93A 1IBML 3NQIA 4UHVA 2Q2HA 3FKIB 1AZPA 2A68C 1JOQA 2RQXA 3U4VA 4ZQ3A 4BY1G 1Q3LA 2EXDA 4LF9Q 1XNQL 4JBKA 3K5LA 1PRTB 2H1EA 4GNXB 1AEXA 3F2UA 4BBRH 2ZJRA 5ELCA 1H9RA 5HGTA 1A0IA 1O80A 4JC0A 3VYUA 5IYCH 1SRUA 1A63A 2F4IA 4K5XA 2B29A 1MSGA 1K83H 3M4OH 1L0WA 1PLFA 1VQHA 1D8LA 1S5DD 2R7FA 4X65Q 5CV7A 1LLRD 2BE5D 2Z6KA 1J5EL 3F2BA 4IUQA 1D1KA 3S24A 3H3VH 3J7A5 2K5HA 1SFOH 3GTOH 2PYKA 3I4NG 4XYOA 5JJZA 3F8TA 2KBNA 4KHPL 1EU3A 5G3LF 4AIMA 2JQOA 5JJLA 3E6ZX 3HRZC 2R93B 2B2WA 3L7ZC 4GKKL 3DWPA 1CQFA 3HOZB 4IN3A 5JAVA 3CPWA 2V1CC 3I4MH 1I4RA 4K5VA 2KQ3A 3D8GA 3NWTA 5NUCA 4XT3B 2JA8G 2B2TA 3PO2H 4YHHQ 1DOMA 1ENCA 4UP9A 3S1QB 1KABA 1RF2D 3QJYA 4J8QA 5C5LA 4RGTA 4JI7Q 5EPKA 2BOSA 1PYBA 5EBDA 2Q8IB 4UAIA 2NBFA 1S72A 2C5CA 1EQVA 4G7HC 2K5WA 1LABA 1OTCA 2I0QA 3PIO3 2MJ8A 4IURA 1R9TB 1PHJA 4FF4A 1K83B 3GTOB 4LFBQ 3K7AB 1DD2A 1XNRL 2PMZE 4PZ7A 4CHTB 3LNNA 3ZYYX 2KVMA 1TS2A 4ZKBB 4GOPB 1M4VA 2L15A 2LKVA 2I5LX 5FK9C 4WJWA 5K36H 4HJ9A 5HGQA 5IODA 1JWMD 1QVCA 3LX0A 4A3LH 2IW3A 2HCCA 3E0JA 1KLUD 1I50H 1S5BD 4IUUA 4OX9L 2JSOA 3HEJA 2GN5A 2YTXA 4B9XA 3HKSA 1TVXA 3MFGA 1QNUA 3KF6B 3NXWA 1H9MA 2JP1A 2NVQH 2SNMA 1J6QA 5IY0A 1PH4A 4JI8Q 2ZM6Q 1V43A 2OCEA 2CQAA 3GP7A 2UU9Q 2OQKA 1VQ8A 1CZWA 1IBMQ 5IE8A 3T4AC 2O5IC 1E3PA 3C1EA 1ONLA 2RHSB 1EYGA 3R3OA 4JI1L 3VYSA 2F0DA 2IPKD 2H4OA 3M4OB 4DNIA 3GTJH 2WB1E 1Y1VB 1ZXTA 1L0XB 2LXKA 4NXNL 4DV5Q 4QF4A 2ID0A 1LT3D 3CCVA 2EQSA 4GLAC 5M5XH 4H02A 4DV6L 1VQAA 2R92H 3J81L 1BXTA 4N8FA 3OW2A 3EFXD 4DUZL 3S9WA 2EE1A 4HIDA 4UDUC 4IUTA 3HOWG 4DV4Q 1VF5C 4A3DG 3CC7A 2JA7H 1KDCA 2PQAB 2ENBA 5DM63 1NE3A 3A7LA 2JA8H 3D4WA 2PO4A 1EOTA 1TWGB 4H0LC 5C4JH 3RN2A 2UUCL 4YIJA 3PMFA 1JWUD 3NPPA 3CAMA 1RIPA 1K8AC 1SR3A 3GTLH 1IBKQ 2A74C 5LMNL 4NDXA 5C0XG 3BDOA 4JI3L 4DR2L 3PV0A 1F77A 1N33Q 1B44D 4F88A 3UE1A 3GTMB 1PH8A 2DNEA 3D4RA 5DEHA 1FNWA 1VQ7A 3FVQA 3HOXH 1A2TA 1B9MA 2NVTH 2RVLA 1BR9A 5C44H 3CF5A 4AQYQ 4OL7A 2EJMA 1QWYA 5C5MA 1HZAA 1VQIA 3TQYA 2HIXA 3T53B 3G7LA 1VDZA 3MXUA 1BUVT 2NVYB 1SNCA 1VS0A 2EYPA 1EQTA 3GTQB 4ZRZA 2JA7G 5FOBB 4YHHL 4RCOA 1XMQL 3DLLA 2F1MA 2IT1A 2MP1A 1KAAA 2QGQA 3KLRA 3FPPA 3BDCA 4IPHA 3FRPB 5FJ8G 2PZUA 4LMQD 3TBIB 4U673 5CV8A 2JA5B 3DXJC 2Z1CA 1F9PA 2KEDA 1F9QA 4YY3Q 3LWEA 4PZ6A 4B3TQ 5IWAQ 4L5SA 1ZEQX 1EYCA 1K0RA 1V1PA 3FPUB 1CI3M 1NR2A 5C6AA 1U4LA 5JOBA 3IAYA 2QKIC 4DV6Q 2UXBQ 4A93H 1YEZA 3DEPA 4PG3A 1QG7A 1SE4A 3K8AA 1CKNB 4LF4L 2GVBA 3URYA 5C4HA 1HUNA 5JPMC 4DAMA 1MKHA 2PW5A 4LF5Q 1A62A 4H44C 2IJ0A 2OTJA 3GTPB 3NTKA 4DR7L 1IW7C 1H95A 1HRJA 4X3KA 4JYAL 1PRTF 1K28A 2F0TA 3CRLC 5DNFA 1Z9FA 1MI2A 1J9OA 4LW1A 3T51B 3Q6SA 4A3MB 2WKCA 3H0GG 1I6HH 1S3OA 4Y7NB 2M9VA 1QCBD 4A3KH 1S40A 2GVAA 2A5HA 2DJGC 1CHQD 1YIJA 1LT6D 1XPUA 4NP5A 4FXDA 5I9OA 2F0JA 3KLWA 4LF8Q 1F2MA 4UY8C 1KNEA 4DF7A 4GLXA 2K75A 3D6CA 5FO7B 1QILA 4AYBG 1KC8C 1QZHA 4QIWE 5K5PA 1STNA 1UE1A 3OMCA 4L5QA 1BQQT 5C3EH 4DNRB 2ZTEA 4JBMA 2JA9A 1VQ9A 4QQBX 1EY4A 4UP8A 4LFAQ 4LK1C 1A8VA 3VA7A 3K81C 1GO3E 2BDOA 2L9HA 4N8X1 1PA6A 3A74A 2PZTA 1B4OA 4BBSH 1JCKB 5C44G 4MN3A 1K3RA 2WV6D 4ABNA 4DK0A 4EQPA 2IHFA 1PYWD 3QOLA 1PVOA 2HCIA 1H9KA 4L6TB 5M5YH 4HMIA 5C3WA 4OO1G 3G6EA 3NK9A 1WTHA 2AUJD 4KKSA 3J80c 2F0MA 4NXML 2A69D 1VQ4A 4Q0FA 4LWCA 2UXCQ 1B7YB 4O1NA 5IYBG 3H6MA 4BY1B 1HXYD 2EY1A 4IPGA 3K0XA 1II3A 5KNBA 3Q22A 2F0UA 1GHJA 1JQYD 1EUJA 1R9TH 2IL8A 3S14B 2IWHA 1MIUA 2E2JH 5J39A 4A3GB 1IXRA 2B2VC 3K6OA 3EROA 4RCNA 5JJKA 1PXUA 4A3IG 1G6PA 3TDQA 1V1PB 2L55A 4WRDA 1BOSA 4XQQA 2Z4IA 1HTPA 4DXFA 5C3EB 1D7QA 2NB0A 3H91A 5BR8Q 5BR8L 2UUAL 2Q8TA 3QWNA 2WACA 2E2HH 2UU9L 2M2LA 3PO3G 1IL2A 1JB3A 3W5OA 3U50C 2OTLA 2VS1A 3QO2A 1TWGH 2R93G 4OO1I 3ERSX 3R2TA 2Q2TA 4IFDG 3QR8A 1NTGA 4DU9A 2O2LD 1EYDA 3S2DB 3OIQA 3HOZG 3TS0A 1XMQQ 1IHZA 3SK5A 4JI8L 5I6YA 2ZM6L 3M85A 1WTVA 2WB1G 1WD1A 1UE7A 1ML0D 1HHVA 1AZQA 1NSNS 2XWBB 1LT4D 4YCWA 4X64L 1B3QA 4X3UA 2AWOA 3I4NB 1VQEA 4FF2A 3MAQA 4KKTA 4POGA 1GUOA 2NTSA 1I94L 4I7AA 3PUZA 5CGKA 1YNXA 4HJ5A 3MTSA 3CCMA 3J7AF 3A56A 4C3JH 4HIKA 4DV2Q 2B2VA 4CKCA 1PH6A 4RGMA 3DM1A 3A54A 1HA6A 2NN6I 4ZUJA 1F2LA 3TZUA 2IY5B 1LTSD 1VQBA 4RKBA 3K58A 1C7YA 1S5CD 3TP6A 5CC4A 3E3XA 4HJ8A 2JA5H 4JI6L 4IQZA 4EQ5A 2A73B 4KD3A 1D5MC 3K0YA 2K5QA 3CCJA 1EU4A 4LF7Q 3UE0A 2KCCA 5LMNQ 1Q7YC 3S2DH 4DK6C 2YU9B 2ASBA 1I50B 3CC2A 3QB3A 1PH2A 2TMPA 2ES2A 3BZDB 2D2CC 2F0NA 1UAPA 1VQCA 3DUZA 5EKIA 3C46A 3BZCA 4LF6Q 2QW7A 4R4OA 4OWXB 1XMOQ 3CKIB 4DR5L 2JE6I 3GTGB 2RBMA 2A6EC 3UDGA 5A2QL 3S15B 3J80L 1STYA 3CP0A 1NJIC 3BVGA 1YHQA 3CQZB 5EJWA 1B50A 1O78A 1BNZA 4ZUIA 3H94A 4X62Q 3CW2C 4FP5D 1PH9A 1BDOA 4APVA 3KYHC 5I2XA 2F4VQ 2MHVA 3S14H 1X56A 1IL8A 1KTKA 1SFOB 4A3MH 3V2TA 1CA5A 2G5DA 3PUYA 1B3AA 1YJNA 2PNRC 2VQFQ 1U0LA 1LACA 2NVXB 4YY3L 1YHBA 3A8IE 2JK8A 4L5RC 1EIYB 2QEJC 1WOCA 2DGYA 1WTWA 3S16H 4A3IB 3J7AV 1SSOA 1E1TA 2E76C 2PMZB 4GKJQ 2EYFA 4CKEA 1X65A 2BH2A 2LFNA 2R7ZH 3OOCA 4P75A 5ELBA 4R9WA 3M3YH 1D5ZC 1PZJD 4FXGC 3PO2B 4KKUA 1AE3A 1JORA 3PO3B 3AQQA 4RAUC 1JOKA 2B2YA 4UP7A 5JEAJ 4JVZA 2AKWB 4PV1C 5BN3A 2LMCB 2B2TC 4QIWB 4A3KG 4ZLTF 4PMBA 4MTNA 5J3BA 4CJ0B 2B3GA 4QL5A 3OTOQ 2OWOA 4KMUC 2EY2A 4KK7A 1GM5A 1I3QH 2SNSA 2QF7A 2WB1B 4JI5L 3J80E 4JI5Q 3UDIA 5IT9E 1KRTA 4K2KA 4DR4L 3A0JA 4JI4Q 1GXDC 2I07B 3L0OA 4ZCKA 4TRDA 3B6YA 1BO0A 4BA1I 2EOTA 3Q24A 1I4HA 4RGNA 3TS2A 2F03A 2B2YC 3KJPA 1GUNA 4KN4C 4IALA 5GAGC 4P72A 2F0QA 2K5VA 4MNOA 2A68D 1KD1C 2ZXOA 2JA7B 1G6ZA 1CHPD 4DUZQ 5E3FA 1X3PA 3QOJA 3NBHA 2F0LA 3KF8A 3S16B 3CMAA 1G51A 5FLXc 5C4JB 3S1NH 3I8ZA 1D5XC 3J81i 2NUCA 3HP3A 1SDFA 1VQ6A 3H3VC 4CGYB 3AFPA 4R8IA 1Z7TA 1T5EA 2D9UA 4X65L 1I5FA 1UUPA 2M00A 2VQEQ 5KIXA 2F0GA 1SBBB 4C3HG 2Z6KC 2I5HA 3PCOB 2A6HD 4GS3A 4RFBA 2JJQA 1KDAA 1KHIA 3NELA 4P2CB 3KBXA 1X3EA 1TXYA 1K8GA 5IT9L 4A76A 2B8FA 1KLGD 2X6LA 3CCQA 4IFDJ 1U4MA 1VQLA 2EYOA 2K14A 5CBAE 1MJCA 4QMGA 4WFN3 1JJCB 4K5WA 1I6HB 1KXLA 2K7VA 1TIID 1N34Q 1VF7A 2RSNA 2SDFA 2F0OA 4ODGA 5HY6A 2WINB 2WKDA 2CWAA 2R61A 4X66Q 3K7UC 4IOAA 1DZ1A 3MA2B 1HNZQ 2V4DA 1QJOA 5ELOA 3GTKB 4DXGA 4DK3C 3PQIA 4A3MG 1EZ6A 4PZ8A 1AN8A 3RUZA 4QY7A 2SEBD 3G4SA 5LMUL 4BBSG 5EBCA 2L4NA 4JBWA 4B3RQ 5I2YA 3C2PA 1ILPA 1L1OB 1LM0A 2EY5A 3Q8DA 3PF5A 4NW2A 2K04A 4RWSC 4CDFC 2N3SA 4B3RL 3KLSX 2ALYB 3CCUA 3HOVG 1IYUA 3OW7A 5EQ0A 3NQTA 2EYLA 2K05A 2K6AA 2ZJPA 2A1AA 3OYYA 5H1SE 2WAQG 2F0HA 3A5UA 2K5DA 5FKAC 3NE5B 3KK7A 4DV1Q 4P71A 1WYDA 2C9OA 4JCVE 3SK4A 1TY2A 3IL8A 4P73A 1SYEA 4RKLA 2N8NA 5KRUA 1HNXL 1TKWB 3CRKC 4DGZA 1CKMA 5IGEA 3CC4A 2B8GA 3JAML 3EIVA 4HCSA 3K5NA 1NCVA 3L3OC 4DAVA 4A3GH 4M1UB 3X3NA 1N36L 5EPLA 2XRSD 1ICWA 4B9WA 2X6GA 4OIKA 3W1GA 4IO9A 2E2JB 5M5XB 1UNSA 1O7LA 1XWEA 4KN7C 3ULLA 1WCMH 1FVIA 1PZKD 4QB4A 5IP9H 3CCRA 2NN6H 1BCPC 1M1KC 4X3SA 1MGSA 3HZXA 2EVBA 2R3ZA 3GTKH 1SNQA 4C1NK 4DR5Q 3OSOA 2QCPX 1CKNA 4L63B 3AU7A 1LTBD 4Q5VA 5CV6A 1SYFA 1TU2B 1DOLA 5M5WB 1KNAA 1JE5A 3Q0AA 1ZYRC 5M3MB 3E9HA 1JOOA 4B3ML 2AWNA 1F9RA 2Y0SB 4R1JA 4TKOB 2F0WA 4GNXA 1CTMA 1HFGA 1EZ8A 1WFQA 1BBUA 3CPFA 2UUBL 5IGGA 2YTYA 4CJ1B 1T5XD 2ZT9C 3W3AA 4BA2I 2QDLA 3MWYW 1PDQA 3I73A 3ER0A 2EZVA 4A3GG 1NMFA 5GAHC 4IFDH 1QNKA 2DJFC 4V190 1YNND 3FMCA 3AFQA 2Q2IA 2UUBQ 4A3BB 4C3HH 1CM9A 1SEBD 1WJJA 3P1HA 3IRBA 3CQZH 3MXPA 4I65A 5C0XJ 3BG3A 3I56A 2K1BA 3RR5A 1A3UA 3NEMA 2J0TD 4DR6L 1RDPD 4DA2A 3T56B 1XXGA 1TS4A 5IYBH 5IT9c 5FO9B 1BBXC 1CKOA 1SN8A 3R8BA 3NBHB 3S1RB 2J7ZA 1P16A 2PW7A 4JYAQ 4DV7L 4HIMA 4O0AA 4ZK9B 3BVZA 3D6WA 3E5SA 1H9JA 2F52A 3L9AX 2KCTA 3RZOH 4KJNA 1V9PA 1AW7A 4YCVA 5IP9G 3GO5A 3D4DA 4K0KL 1LTGD 4DFAA 3SR1A 3TZDA 4R4CA 1P8LA 3CMEA 4BBSB 2ICIA 4A93B 4OO1H 1B2TA 4MHEA 1E2VA 4K8JA 1YZ6A 4HJAA 4A75A 1HNZL 4PMCA 1DJRD 1FJGQ 3HOXB 1QOHA 1TWHH 3WOEA 2JYOA 2MGSA 4A3BH 1SXTA 5IGBA 2B63B 5C4XG 5IYDH 1KAWA 1S5FD 4HIOA 3E9IA 1EOVA 1FJGL 5L37A 1AE2A 4KHVA 1NNXA 4DV5L 2B2UA 3VYTA 4IOCA 1VQPA 1QE6A 4RG1A 2EJFC 2FHTA 5TSSA 1IW7D 3SGIA 4OEMB 5IOCA 2WAQE 4JI1Q 3KUPA 4C3JB 4DUYQ 3MZ5A 2QA4A 3MXNA 4HEDA 1RODA 1SYGA 2YV5A 2LSSA 5AJ3Q 2VXWA 4LF7L 4KHPQ 2KA7A 1CT1D 3FP9A 1A6XA 1FL0A 1BCPF 1EY0A 1YNNC 3EJIA 4DR1Q 2CQOA 3G6JB 3M4PA 1FNUA 4G4KA 3HOZH 4Z9CB 1Y1WG 2OXPA 4C2MB 1H9SB 3PIPA 2JA6B 3M3YB 4H13C 1QB5D 2EPBA 3GV3A 2RA4A 5A35A 3VA5A 1EWHA 4YCUA 2PPBC 2L0CA 4JI3Q 1UE6A 1XPOA 1A2UA 5E1FA 1XTDA 3HG9A 2G9HD 3T1YQ 1ZKOA 4C56C 3HOYG 4C3IG 1SYDA 3FKIG 4FNFA 1W3SA 4CDDC 3CXCA 1R4QB 1X3GA 4EVOA 1YITA 5D14A 2BCOA 1N34L 5CMDA 1LTID 1HJPA 2A19A 3EVQA 2FMCA 1IZ6A 2WIIB 3BVMA 3KJOA 4A3KB 3GQBA 3MXGA 4F8MA 3P75A 3A55A 4JI7L 2RDGA 1Q12A 5J22A 1WD0A 1JT8A 2K01A 3L2PA 4A3JG 1SE2A 1N32L 4OGQC 4LAAA 3NTIA 5JVG3 4GZYC 1KDBA 3FDTA 4B3TL 1YVCA 3PO2G 4A3FH 2MNAA 4LFBL 1RHPA 1CFMA 2XVSA 4X62L 1RTOA 4R4QA 4HCEA 1GUGA 2NZ1D 3H3VI 4DKAC 2XNAC 4EQOA 1LTRD 2E5LQ 2XGTA 4NXNQ 3K59A 3MEFA 4RGOS 1Y8OB 4LF4Q 4OX9Q 2F0EA 3S17H 1DOKA 4FXKC 1MSHA 1IYVA
chains in the Genus database with same CATH topology
1YHBA 3F2CA 3J80i 2N49A 2YTVA 2JK8A 3M9BA 4JI7Q 4L5RC 4LF7Q 1E7ZA 1PYBA 3WWVA 1EIYB 1YJ9A 1FGUA 2R92G 1WOCA 2DGYA 3S16H 1XMOL 1EIFA 2LXJA 1S72A 2ZTCA 3MXNB 1E1TA 1Q1EA 4GKJQ 1X65A 2KHIA 2PQAA 4L5TA 4JI2L 4DV1L 2BH2A 1OTCA 2I0QA 1J5EQ 3HOXG 4A4IA 5FJ8H 3TEHB 1PHJA 2R7ZH 4P75A 1VQFA 1X55A 3M3YH 4LFBQ 2CFMA 4XTCS 1BBWA 1HNXQ 4JI4L 1XNRL 1AE3A 1EQQA 4DR4Q 3AQQA 2PMZE 4OONA 1X54A 1GKHA 4PZ7A 4UP7A 4DV3L 1VQOA 1VQMA 2NZHA 4JV5Q 5JEAJ 3J7ZC 4LNQA 4LF9L 4GOPB 2L15A 2AKWB 1SROA 4YWMA 2I5LX 5LMNW 4HJ7A 4AQYL 1VCIA 4A3KG 3BJUA 4J15A 3GTGH 4MTNA 5J3BA 2B3GA 4HJ9A 5HGQA 4QL5A 3OTOQ 4IJLA 1PFSA 4B3SL 3H0GH 4GN3B 4GOPC 2OWOA 1QVCA 1GM5A 2JEAI 3S2HH 4A3LH 1I3QH 4JI5Q 4JI5L 2YYZA 4DV4L 3UDIA 3CCLA 4UPAA 4OWWB 1KRTA 1I50H 3HKZE 3A0JA 4OX9L 4DR4L 2VL6A 4JI4Q 2GN5A 2YTXA 1XNRQ 4OWTB 3L0OA 5GROA 3HKSA 1OXUA 1SE8A 1IBKL 3PF4A 3KF6B 2NN6G 2Q2UA 2NVQH 2IX0A 3B6YA 4GLVB 4DR2Q 2NVXH 1J6QA 1Y14B 4BA1I 5IY0A 4JBJA 1PH4A 4JI8Q 2ZM6Q 5GADC 1E22A 1V43A 2OCEA 3KJPA 3TS2A 4GKJL 2UU9Q 2OQKA 4KLKA 1VQ8A 5GAGC 2UUCQ 4P72A 3GTPH 2K5VA 3E0EA 4MNOA 1KD1C 1IBMQ 2HQLA 5IE8A 2VNUD 4Y52H 3CCSA 4GN4B 1E3PA 1K9MC 4BXXG 2RHSB 1EYGA 4DUZQ 2B63H 4JI1L 4JI2Q 2NVYH 3CMAA 1G51A 1MJEA 5FLXc 1Z47A 3K7AH 4BBRG 3HOWH 3S1NH 3GTQH 2C35B 5M3MH 4DNIA 4AH6A 3J81i 2K52A 2WB1E 3GTJH 1VQ6A 2ATWA 4ME3A 3AFPA 2LXKA 1T9HA 4NXNL 4DV5Q 2ID0A 3CCVA 4X65L 2EQSA 4GLAC 5M5XH 1JB7A 1I5FA 4H02A 3G71A 4DV6L 3T1HL 1VQAA 2VQEQ 4JI0L 2R92H 4FDBA 3OW2A 2VQFL 4DUZL 2Z6KC 4YWLA 2I5HA 3PCOB 4GS3A 1U5KA 4QJFA 3GDEA 4HIDA 3S1QH 2JJQA 3HOWG 3PUVA 4DV4Q 1KHIA 4A3DG 1X9NA 2D0OA 3CC7A 3STBC 1Y1WH 3NELA 4A3IH 2JA7H 3HOVH 1X3EA 1TXYA 2PQAB 4NB3A 1K8GA 4BY7G 4A76A 1HZCA 1NE3A 2JA8H 3RZDH 3CCQA 4IFDJ 1VQLA 2K14A 3RNUA 1KL9A 1MJCA 2H5XA 4JOIA 2IHEA 5C4JH 3RN2A 2UUCL 4BY1H 3I55A 1K8AC 3CAMA 1RIPA 1JJCB 3H15A 5IWAL 1SR3A 2YU9H 1IBKQ 3GTLH 5LMNL 3KDFA 5C0XG 1KXLA 1HH2P 1N34Q 1PH1A 4JI3L 1I94Q 4DR2L 3PV0A 1PV4A 4TQUS 5HY6A 1N33Q 2CWAA 4X66Q 1VQ5A 3K7UC 3UE1A 4BY7H 4IOAA 1PH8A 3I2ZA 5C0XI 1L1OC 3CCEA 1Q86C 4DR1L 2QEXA 1HNZQ 3S15H 5ELOA 1G291 4DK3C 1VQ7A 3HOXH 1Y1VG 4GNXC 4R4IA 4A3MG 4PZ8A 2NVTH 3CF5A 4AQYQ 5C44H 4QY7A 1XNQQ 3M4QA 3G4SA 3PUWA 2WFWA 5LMUL 3HOUH 3M7NA 4BBSG 4A3CH 4JBWA 4B3RQ 1AH9A 3TRZA 4DV2L 3OTOL 1OXSC 1L1OB 4DV0L 2VY3A 4P74A 1LM0A 3Q8DA 1HZAA 1VQDA 1VQIA 3TQYA 3PF5A 1EQRA 3D0FA 1X3FA 2HIXA 1PH3A 4JI6Q 2N3SA 1VS0A 4B3RL 2ALYB 3JC66 3CCUA 2HT1A 4YHHL 2JA7G 3HOVG 3A5ZB 1XMQL 2XTIA 1KIXA 3DLLA 1Q8KA 2ZJPA 2IT1A 2QGQA 2A1AA 5IP7G 4DUYL 2VUMG 3S1RH 2FXQA 3OYYA 1QZGA 3KOJA 5H1SE 2WAQG 4IPHA 5E7NA 4DAYB 5FJ8G 1EFWA 4LF8L 1N9WA 2R7ZG 3A5UA 3NENA 1UEBA 1HR0Q 2CWPA 1N33L 1OXTA 5DLQE 1GD7A 4DV1Q 4P71A 2MO1A 1TWAH 1HR0W 1WYDA 4JCVE 4GOPA 4P73A 2K4KA 1VQGA 4YY3Q 2N8NA 1LUZA 1WI5A 4PZ6A 2ZTDA 4B3TQ 5IWAQ 1N8RC 1HNXL 4L5SA 1CKMA 1K0RA 3ULJA 1VQNA 3CC4A 2Y0SE 1NBWA 2NZOA 3PSIA 2N78A 1Q1BA 3EIVA 2MFIA 4XIGS 3GD7A 5IYCG 2JA5G 1N32Q 4IPCA 4A3EH 4A3GH 1JJGA 2ZJQA 4DV6Q 3T1HQ 1N36L 4LF6L 2UXBQ 4QGUA 4A93H 1NMGA 1DGSA 1YEZA 2DUDA 4PG3A 3W1GA 4IO9A 3K8AA 1OXXK 1CKNB 4LF4L 2GVBA 5FLMH 2UXDQ 4DAMA 1MKHA 3ULLA 2IX1A 2AHOB 1WCMH 1FVIA 1YJWA 1JJ2A 4LF5Q 2HIVA 5IP9H 1YI2A 3KF6A 1QVGA 1JMCA 3CCRA 4X6AH 4O2DA 1A62A 4RMFA 5M3MG 2UUAQ 3EN2A 1M1KC 2OTJA 4PMWA 3GTKH 4DR7L 2Y0SG 1SMXA 2R6GA 3K80C 4DR5Q 2UXDL 4A93G 4A3EG 1H95A 1CKNA 1TWFH 2UXCL 4JYAL 2K50A 2F4VL 1Z9FA 1N36Q 2E5LL 5ELNA 1E24A 4TVAB 2I5MX 3STBD 1XPRA 4LW1A 1JE5A 4KI0A 2F3IA 3E9HA 3H0GG 4NPSA 2R7DA 1I6HH 1S3OA 4B3ML 2AWNA 4R1JA 4JG2A 4A3KH 2GVAA 1S40A 3ULPA 1YIJA 5C4XH 5IYDG 4GNXA 1XPUA 4A3BG 4WJ4A 1CSPA 1WFQA 1BBUA 3CPFA 3KLWA 4LF8Q 2UUBL 4UY8C 1HZ9A 1O7IA 2YTYA 4DR6Q 4GLXA 3I4OA 1B8AA 2K75A 3AYHB 1VQJA 1BVSA 4LFCL 4BA2I 3ER0A 4AYBG 2CKZB 1KC8C 1QZHA 4QIWE 1NMFA 5GAHC 5IP7H 2VUMH 4A3GG 4DR3Q 1UE1A 4EX5A 2D62A 4L5QA 3DM3A 3AFQA 5C3EH 2Q2IA 2ZTEA 2E8GA 2UUBQ 3BZKA 4C3HH 4JBMA 1WJJA 4DV7Q 4DR3L 2JA9A 3CQZH 2D0PA 3IRBA 5C0XJ 1VQ9A 3I56A 2VW9A 3I4NH 4IPDA 4QQBX 4UP8A 4LFAQ 3F2DA 3ZJYC 1A8VA 3RR5A 4DPGA 3K81C 1GO3E 3NEMA 3D31A 1PA6A 2HHHL 4DR6L 4B3SQ 4LFAL 4JV5L 3A74A 5IYBH 4A3CG 5IT9c 3LGJA 1KQSA 5C44G 4BBSH 1CKOA 4DV0Q 1K3RA 1SN8A 1X6OA 3NBHB 1CUKA 2IHFA 1P16A 2EIFA 1QVFA 1PVOA 2KHJA 4JYAQ 4WJ3M 4DV7L 4HIMA 1Q81C 3T1YL 4O0AA 5M5YH 3JAMc 4DR7Q 4DV3Q 3J81c 2JA6G 4OO1G 2F52A 3G6EA 4ALPA 3J80c 2KCTA 3RZOH 4NXML 2HHHQ 1V9PA 1VQ4A 4LWCA 2UXCQ 4YCVA 1KRSA 1B7YB 3GO5A 5IP9G 4AYBE 5IYBG 4C2MH 4X64Q 2CCZA 4K0KL 1LYLA 2RCNA 4IPGA 3K0XA 4R4CA 3S1MH 1P8LA 3PIOA 3CMEA 1M90C 1TWCH 2OQ0A 1PH7A 1EUJA 4LUOA 5AJ3L 1R9TH 3HOUG 4R4TA 3TREA 4B3MQ 1MIUA 2E2JH 1OXVA 2MO0A 1IXRA 2BA1A 2PI2E 2JA6H 5JJKA 2RF4A 3U58A 4LUVA 4A3IG 1G6PA 1YZ6A 4HJAA 4A75A 1HNZL 3FKIH 2K5NA 1VQKA 1FJGQ 2VQEL 3KDFB 5GAEC 1YHAA 2PI2A 1TWHH 1D7QA 5BR8Q 5BR8L 4A3BH 3AEVA 2A8VA 2UUAL 1QUQB 5C4XG 1KAWA 4HIOA 5IYDH 3E9IA 5JJIA 2E2HH 1EOVA 2UU9L 1FJGL 3PO3G 1IL2A 5FLMG 1AE2A 2JEBI 3W5OA 2BH8A 2RHQB 3U50C 1Y1VH 2OTLA 2VS1A 4DV5L 1HZBA 1TWGH 2R93G 1XJVA 3ERSX 3PUXA 2Q2TA 4OXPA 1C9OA 4IOCA 1VQPA 4RG1A 5C3EG 1HR0L 3ICEA 4IFDG 1NTGA 3UDXA 4BXXH 1V1QA 5M3FG 3SGIA 3VDYA 2B63G 4C3IH 5EAYA 4Y7NH 3HOZG 2WAQE 2E2IH 4JI1Q 3TS0A 2VZAA 2R93H 4DUYQ 1W2BA 4LUZA 2QA4A 1XMQQ 1L1OA 4GN5A 1E1OA 1GVPA 4JI8L 2ZM6L 2YV5A 3M85A 1RL2A 2LSSA 2WB1G 1B70B 5AJ3Q 2BA0A 1UE7A 3J81j 2Z0SA 4LF7L 4KHPQ 3UDFA 3BU2A 4POFA 4NXMQ 3I4MG 3KFUA 3FP9A 2MQHA 1LTLA 5JEAG 3HKZG 1FL0A 3HFZB 1L2FA 4YCWA 4X64L 4K0KQ 2AWOA 4DR1Q 2CQOA 3M4PA 1VQEA 3I7FA 4IJHA 5LMUQ 2KENA 3HOZH 4POGA 1Q46A 3RLNA 3RLOA 4KHZA 1Y1WG 1IYJB 3RN5A 4LFCQ 1I94L 4A3DH 3PGZA 3HOYH 3PUZA 1YNXA 3PIPA 4HJ5A 1IBLQ 1HNWQ 1UE5A 5M5WH 1K73C 3CCMA 1IBML 1C0AA 2Q2HA 4C3JH 4HIKA 4DV2Q 4YCUA 3U4VA 4JI3Q 1UE6A 1XPOA 4BY1G 1HNWL 2EXDA 4LF9Q 1XNQL 3U4ZA 1XTDA 1IBLL 4JBKA 1PH6A 1SLJA 4GNXB 2NN6I 3T1YQ 3W1BA 4BBRH 3HOYG 2ZJRA 2IY5B 1VQBA 3G48A 4MZ9A 1C7YA 3CD6A 1A0IA 2PNHA 3FKIG 4JOIC 4X66L 1W3SA 3CXCA 4JC0A 1X3GA 5IYCH 4HJ8A 1SRUA 2JA5H 1EWIA 1PH5A 1YITA 4JI6L 1A63A 4EQ5A 1CSQA 1YBYA 2B29A 1N34L 1K83H 3EBEA 3CCJA 3M4OH 1HJPA 1L0WA 1VQHA 1D8LA 2R7FA 3UE0A 2A19A 4X65Q 1UWVA 5LMNQ 1Q7YC 3S2DH 2Z6KA 4DK6C 2ASBA 3PO3H 2KCMA 1IZ6A 3CC2A 1J5EL 3KJOA 3F1ZA 3JAMi 3F2BA 3S24A 1PH2A 2ES2A 4JI7L 2K5HA 3H3VH 3J7A5 5K36G 1Q12A 1VQCA 1SFOH 3GTOH 3I4NG 1Q82C 1JT8A 3BZCA 3F8TA 3L2PA 4LF6Q 2KBNA 2WP8J 4KHPL 2UXBL 4R4OA 4OWXB 4AIMA 4A3JG 2JQOA 1XMOQ 5JJLA 1PYSB 1N32L 4A3FG 1NY4A 4DR5L 2JE6I 3GTMH 5GQOA 4YWKA 5M3FH 3UDGA 4IFDI 3L7ZC 4GKKL 3RLFA 4B3TL 1YVCA 4A3JH 3PO2G 3CP0A 4A3FH 2MNAA 4GKKQ 1NJIC 4LF5L 4LFBL 1YHQA 3CPWA 4X62L 1ASYA 2V1CC 4R4QA 3I4MH 3FHWA 4X62Q 1WCMG 1BKBA 3CW2C 3H3VI 1PH9A 4APVA 4DKAC 2E5LQ 3KYHC 2XGTA 1QUQA 4NXNQ 3MEFA 2F4VQ 3S14H 2JA8G 1X56A 4LF4Q 4OX9Q 1ASZA 4A3MH 3PO2H 3PUYA 1YJNA 2AMCB 4YHHQ 3S17H 2VQFQ 4UP9A 1U0LA 3KF8B 4OO1I 4A3LG 4JI0Q 4YY3L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHB A;  3F2C A;  3J80 i;  2N49 A;  2YTV A;  2JK8 A;  3M9B A;  4JI7 Q;  4L5R C;  4LF7 Q;  1E7Z A;  1PYB A;  3WWV A;  1EIY B;  1YJ9 A;  1FGU A;  2R92 G;  1WOC A;  2DGY A;  3S16 H;  1XMO L;  1EIF A;  2LXJ A;  1S72 A;  2ZTC A;  3MXN B;  1E1T A;  1Q1E A;  4GKJ Q;  1X65 A;  2KHI A;  2PQA A;  4L5T A;  4JI2 L;  4DV1 L;  2BH2 A;  1OTC A;  2I0Q A;  1J5E Q;  3HOX G;  4A4I A;  5FJ8 H;  3TEH B;  1PHJ A;  2R7Z H;  4P75 A;  1VQF A;  1X55 A;  3M3Y H;  4LFB Q;  2CFM A;  4XTC S;  1BBW A;  1HNX Q;  4JI4 L;  1XNR L;  1AE3 A;  1EQQ A;  4DR4 Q;  3AQQ A;  2PMZ E;  4OON A;  1X54 A;  1GKH A;  4PZ7 A;  4UP7 A;  4DV3 L;  1VQO A;  1VQM A;  2NZH A;  4JV5 Q;  5JEA J;  3J7Z C;  4LNQ A;  4LF9 L;  4GOP B;  2L15 A;  2AKW B;  1SRO A;  4YWM A;  2I5L X;  5LMN W;  4HJ7 A;  4AQY L;  1VCI A;  4A3K G;  3BJU A;  4J15 A;  3GTG H;  4MTN A;  5J3B A;  2B3G A;  4HJ9 A;  5HGQ A;  4QL5 A;  3OTO Q;  4IJL A;  1PFS A;  4B3S L;  3H0G H;  4GN3 B;  4GOP C;  2OWO A;  1QVC A;  1GM5 A;  2JEA I;  3S2H H;  4A3L H;  1I3Q H;  4JI5 Q;  4JI5 L;  2YYZ A;  4DV4 L;  3UDI A;  3CCL A;  4UPA A;  4OWW B;  1KRT A;  1I50 H;  3HKZ E;  3A0J A;  4OX9 L;  4DR4 L;  2VL6 A;  4JI4 Q;  2GN5 A;  2YTX A;  1XNR Q;  4OWT B;  3L0O A;  5GRO A;  3HKS A;  1OXU A;  1SE8 A;  1IBK L;  3PF4 A;  3KF6 B;  2NN6 G;  2Q2U A;  2NVQ H;  2IX0 A;  3B6Y A;  4GLV B;  4DR2 Q;  2NVX H;  1J6Q A;  1Y14 B;  4BA1 I;  5IY0 A;  4JBJ A;  1PH4 A;  4JI8 Q;  2ZM6 Q;  5GAD C;  1E22 A;  1V43 A;  2OCE A;  3KJP A;  3TS2 A;  4GKJ L;  2UU9 Q;  2OQK A;  4KLK A;  1VQ8 A;  5GAG C;  2UUC Q;  4P72 A;  3GTP H;  2K5V A;  3E0E A;  4MNO A;  1KD1 C;  1IBM Q;  2HQL A;  5IE8 A;  2VNU D;  4Y52 H;  3CCS A;  4GN4 B;  1E3P A;  1K9M C;  4BXX G;  2RHS B;  1EYG A;  4DUZ Q;  2B63 H;  4JI1 L;  4JI2 Q;  2NVY H;  3CMA A;  1G51 A;  1MJE A;  5FLX c;  1Z47 A;  3K7A H;  4BBR G;  3HOW H;  3S1N H;  3GTQ H;  2C35 B;  5M3M H;  4DNI A;  4AH6 A;  3J81 i;  2K52 A;  2WB1 E;  3GTJ H;  1VQ6 A;  2ATW A;  4ME3 A;  3AFP A;  2LXK A;  1T9H A;  4NXN L;  4DV5 Q;  2ID0 A;  3CCV A;  4X65 L;  2EQS A;  4GLA C;  5M5X H;  1JB7 A;  1I5F A;  4H02 A;  3G71 A;  4DV6 L;  3T1H L;  1VQA A;  2VQE Q;  4JI0 L;  2R92 H;  4FDB A;  3OW2 A;  2VQF L;  4DUZ L;  2Z6K C;  4YWL A;  2I5H A;  3PCO B;  4GS3 A;  1U5K A;  4QJF A;  3GDE A;  4HID A;  3S1Q H;  2JJQ A;  3HOW G;  3PUV A;  4DV4 Q;  1KHI A;  4A3D G;  1X9N A;  2D0O A;  3CC7 A;  3STB C;  1Y1W H;  3NEL A;  4A3I H;  2JA7 H;  3HOV H;  1X3E A;  1TXY A;  2PQA B;  4NB3 A;  1K8G A;  4BY7 G;  4A76 A;  1HZC A;  1NE3 A;  2JA8 H;  3RZD H;  3CCQ A;  4IFD J;  1VQL A;  2K14 A;  3RNU A;  1KL9 A;  1MJC A;  2H5X A;  4JOI A;  2IHE A;  5C4J H;  3RN2 A;  2UUC L;  4BY1 H;  3I55 A;  1K8A C;  3CAM A;  1RIP A;  1JJC B;  3H15 A;  5IWA L;  1SR3 A;  2YU9 H;  1IBK Q;  3GTL H;  5LMN L;  3KDF A;  5C0X G;  1KXL A;  1HH2 P;  1N34 Q;  1PH1 A;  4JI3 L;  1I94 Q;  4DR2 L;  3PV0 A;  1PV4 A;  4TQU S;  5HY6 A;  1N33 Q;  2CWA A;  4X66 Q;  1VQ5 A;  3K7U C;  3UE1 A;  4BY7 H;  4IOA A;  1PH8 A;  3I2Z A;  5C0X I;  1L1O C;  3CCE A;  1Q86 C;  4DR1 L;  2QEX A;  1HNZ Q;  3S15 H;  5ELO A;  1G29 1;  4DK3 C;  1VQ7 A;  3HOX H;  1Y1V G;  4GNX C;  4R4I A;  4A3M G;  4PZ8 A;  2NVT H;  3CF5 A;  4AQY Q;  5C44 H;  4QY7 A;  1XNQ Q;  3M4Q A;  3G4S A;  3PUW A;  2WFW A;  5LMU L;  3HOU H;  3M7N A;  4BBS G;  4A3C H;  4JBW A;  4B3R Q;  1AH9 A;  3TRZ A;  4DV2 L;  3OTO L;  1OXS C;  1L1O B;  4DV0 L;  2VY3 A;  4P74 A;  1LM0 A;  3Q8D A;  1HZA A;  1VQD A;  1VQI A;  3TQY A;  3PF5 A;  1EQR A;  3D0F A;  1X3F A;  2HIX A;  1PH3 A;  4JI6 Q;  2N3S A;  1VS0 A;  4B3R L;  2ALY B;  3JC6 6;  3CCU A;  2HT1 A;  4YHH L;  2JA7 G;  3HOV G;  3A5Z B;  1XMQ L;  2XTI A;  1KIX A;  3DLL A;  1Q8K A;  2ZJP A;  2IT1 A;  2QGQ A;  2A1A A;  5IP7 G;  4DUY L;  2VUM G;  3S1R H;  2FXQ A;  3OYY A;  1QZG A;  3KOJ A;  5H1S E;  2WAQ G;  4IPH A;  5E7N A;  4DAY B;  5FJ8 G;  1EFW A;  4LF8 L;  1N9W A;  2R7Z G;  3A5U A;  3NEN A;  1UEB A;  1HR0 Q;  2CWP A;  1N33 L;  1OXT A;  5DLQ E;  1GD7 A;  4DV1 Q;  4P71 A;  2MO1 A;  1TWA H;  1HR0 W;  1WYD A;  4JCV E;  4GOP A;  4P73 A;  2K4K A;  1VQG A;  4YY3 Q;  2N8N A;  1LUZ A;  1WI5 A;  4PZ6 A;  2ZTD A;  4B3T Q;  5IWA Q;  1N8R C;  1HNX L;  4L5S A;  1CKM A;  1K0R A;  3ULJ A;  1VQN A;  3CC4 A;  2Y0S E;  1NBW A;  2NZO A;  3PSI A;  2N78 A;  1Q1B A;  3EIV A;  2MFI A;  4XIG S;  3GD7 A;  5IYC G;  2JA5 G;  1N32 Q;  4IPC A;  4A3E H;  4A3G H;  1JJG A;  2ZJQ A;  4DV6 Q;  3T1H Q;  1N36 L;  4LF6 L;  2UXB Q;  4QGU A;  4A93 H;  1NMG A;  1DGS A;  1YEZ A;  2DUD A;  4PG3 A;  3W1G A;  4IO9 A;  3K8A A;  1OXX K;  1CKN B;  4LF4 L;  2GVB A;  5FLM H;  2UXD Q;  4DAM A;  1MKH A;  3ULL A;  2IX1 A;  2AHO B;  1WCM H;  1FVI A;  1YJW A;  1JJ2 A;  4LF5 Q;  2HIV A;  5IP9 H;  1YI2 A;  3KF6 A;  1QVG A;  1JMC A;  3CCR A;  4X6A H;  4O2D A;  1A62 A;  4RMF A;  5M3M G;  2UUA Q;  3EN2 A;  1M1K C;  2OTJ A;  4PMW A;  3GTK H;  4DR7 L;  2Y0S G;  1SMX A;  2R6G A;  3K80 C;  4DR5 Q;  2UXD L;  4A93 G;  4A3E G;  1H95 A;  1CKN A;  1TWF H;  2UXC L;  4JYA L;  2K50 A;  2F4V L;  1Z9F A;  1N36 Q;  2E5L L;  5ELN A;  1E24 A;  4TVA B;  2I5M X;  3STB D;  1XPR A;  4LW1 A;  1JE5 A;  4KI0 A;  2F3I A;  3E9H A;  3H0G G;  4NPS A;  2R7D A;  1I6H H;  1S3O A;  4B3M L;  2AWN A;  4R1J A;  4JG2 A;  4A3K H;  2GVA A;  1S40 A;  3ULP A;  1YIJ A;  5C4X H;  5IYD G;  4GNX A;  1XPU A;  4A3B G;  4WJ4 A;  1CSP A;  1WFQ A;  1BBU A;  3CPF A;  3KLW A;  4LF8 Q;  2UUB L;  4UY8 C;  1HZ9 A;  1O7I A;  2YTY A;  4DR6 Q;  4GLX A;  3I4O A;  1B8A A;  2K75 A;  3AYH B;  1VQJ A;  1BVS A;  4LFC L;  4BA2 I;  3ER0 A;  4AYB G;  2CKZ B;  1KC8 C;  1QZH A;  4QIW E;  1NMF A;  5GAH C;  5IP7 H;  2VUM H;  4A3G G;  4DR3 Q;  1UE1 A;  4EX5 A;  2D62 A;  4L5Q A;  3DM3 A;  3AFQ A;  5C3E H;  2Q2I A;  2ZTE A;  2E8G A;  2UUB Q;  3BZK A;  4C3H H;  4JBM A;  1WJJ A;  4DV7 Q;  4DR3 L;  2JA9 A;  3CQZ H;  2D0P A;  3IRB A;  5C0X J;  1VQ9 A;  3I56 A;  2VW9 A;  3I4N H;  4IPD A;  4QQB X;  4UP8 A;  4LFA Q;  3F2D A;  3ZJY C;  1A8V A;  3RR5 A;  4DPG A;  3K81 C;  1GO3 E;  3NEM A;  3D31 A;  1PA6 A;  2HHH L;  4DR6 L;  4B3S Q;  4LFA L;  4JV5 L;  3A74 A;  5IYB H;  4A3C G;  5IT9 c;  3LGJ A;  1KQS A;  5C44 G;  4BBS H;  1CKO A;  4DV0 Q;  1K3R A;  1SN8 A;  1X6O A;  3NBH B;  1CUK A;  2IHF A;  1P16 A;  2EIF A;  1QVF A;  1PVO A;  2KHJ A;  4JYA Q;  4WJ3 M;  4DV7 L;  4HIM A;  1Q81 C;  3T1Y L;  4O0A A;  5M5Y H;  3JAM c;  4DR7 Q;  4DV3 Q;  3J81 c;  2JA6 G;  4OO1 G;  2F52 A;  3G6E A;  4ALP A;  3J80 c;  2KCT A;  3RZO H;  4NXM L;  2HHH Q;  1V9P A;  1VQ4 A;  4LWC A;  2UXC Q;  4YCV A;  1KRS A;  1B7Y B;  3GO5 A;  5IP9 G;  4AYB E;  5IYB G;  4C2M H;  4X64 Q;  2CCZ A;  4K0K L;  1LYL A;  2RCN A;  4IPG A;  3K0X A;  4R4C A;  3S1M H;  1P8L A;  3PIO A;  3CME A;  1M90 C;  1TWC H;  2OQ0 A;  1PH7 A;  1EUJ A;  4LUO A;  5AJ3 L;  1R9T H;  3HOU G;  4R4T A;  3TRE A;  4B3M Q;  1MIU A;  2E2J H;  1OXV A;  2MO0 A;  1IXR A;  2BA1 A;  2PI2 E;  2JA6 H;  5JJK A;  2RF4 A;  3U58 A;  4LUV A;  4A3I G;  1G6P A;  1YZ6 A;  4HJA A;  4A75 A;  1HNZ L;  3FKI H;  2K5N A;  1VQK A;  1FJG Q;  2VQE L;  3KDF B;  5GAE C;  1YHA A;  2PI2 A;  1TWH H;  1D7Q A;  5BR8 Q;  5BR8 L;  4A3B H;  3AEV A;  2A8V A;  2UUA L;  1QUQ B;  5C4X G;  1KAW A;  4HIO A;  5IYD H;  3E9I A;  5JJI A;  2E2H H;  1EOV A;  2UU9 L;  1FJG L;  3PO3 G;  1IL2 A;  5FLM G;  1AE2 A;  2JEB I;  3W5O A;  2BH8 A;  2RHQ B;  3U50 C;  1Y1V H;  2OTL A;  2VS1 A;  4DV5 L;  1HZB A;  1TWG H;  2R93 G;  1XJV A;  3ERS X;  3PUX A;  2Q2T A;  4OXP A;  1C9O A;  4IOC A;  1VQP A;  4RG1 A;  5C3E G;  1HR0 L;  3ICE A;  4IFD G;  1NTG A;  3UDX A;  4BXX H;  1V1Q A;  5M3F G;  3SGI A;  3VDY A;  2B63 G;  4C3I H;  5EAY A;  4Y7N H;  3HOZ G;  2WAQ E;  2E2I H;  4JI1 Q;  3TS0 A;  2VZA A;  2R93 H;  4DUY Q;  1W2B A;  4LUZ A;  2QA4 A;  1XMQ Q;  1L1O A;  4GN5 A;  1E1O A;  1GVP A;  4JI8 L;  2ZM6 L;  2YV5 A;  3M85 A;  1RL2 A;  2LSS A;  2WB1 G;  1B70 B;  5AJ3 Q;  2BA0 A;  1UE7 A;  3J81 j;  2Z0S A;  4LF7 L;  4KHP Q;  3UDF A;  3BU2 A;  4POF A;  4NXM Q;  3I4M G;  3KFU A;  3FP9 A;  2MQH A;  1LTL A;  5JEA G;  3HKZ G;  1FL0 A;  3HFZ B;  1L2F A;  4YCW A;  4X64 L;  4K0K Q;  2AWO A;  4DR1 Q;  2CQO A;  3M4P A;  1VQE A;  3I7F A;  4IJH A;  5LMU Q;  2KEN A;  3HOZ H;  4POG A;  1Q46 A;  3RLN A;  3RLO A;  4KHZ A;  1Y1W G;  1IYJ B;  3RN5 A;  4LFC Q;  1I94 L;  4A3D H;  3PGZ A;  3HOY H;  3PUZ A;  1YNX A;  3PIP A;  4HJ5 A;  1IBL Q;  1HNW Q;  1UE5 A;  5M5W H;  1K73 C;  3CCM A;  1IBM L;  1C0A A;  2Q2H A;  4C3J H;  4HIK A;  4DV2 Q;  4YCU A;  3U4V A;  4JI3 Q;  1UE6 A;  1XPO A;  4BY1 G;  1HNW L;  2EXD A;  4LF9 Q;  1XNQ L;  3U4Z A;  1XTD A;  1IBL L;  4JBK A;  1PH6 A;  1SLJ A;  4GNX B;  2NN6 I;  3T1Y Q;  3W1B A;  4BBR H;  3HOY G;  2ZJR A;  2IY5 B;  1VQB A;  3G48 A;  4MZ9 A;  1C7Y A;  3CD6 A;  1A0I A;  2PNH A;  3FKI G;  4JOI C;  4X66 L;  1W3S A;  3CXC A;  4JC0 A;  1X3G A;  5IYC H;  4HJ8 A;  1SRU A;  2JA5 H;  1EWI A;  1PH5 A;  1YIT A;  4JI6 L;  1A63 A;  4EQ5 A;  1CSQ A;  1YBY A;  2B29 A;  1N34 L;  1K83 H;  3EBE A;  3CCJ A;  3M4O H;  1HJP A;  1L0W A;  1VQH A;  1D8L A;  2R7F A;  3UE0 A;  2A19 A;  4X65 Q;  1UWV A;  5LMN Q;  1Q7Y C;  3S2D H;  2Z6K A;  4DK6 C;  2ASB A;  3PO3 H;  2KCM A;  1IZ6 A;  3CC2 A;  1J5E L;  3KJO A;  3F1Z A;  3JAM i;  3F2B A;  3S24 A;  1PH2 A;  2ES2 A;  4JI7 L;  2K5H A;  3H3V H;  3J7A 5;  5K36 G;  1Q12 A;  1VQC A;  1SFO H;  3GTO H;  3I4N G;  1Q82 C;  1JT8 A;  3BZC A;  3F8T A;  3L2P A;  4LF6 Q;  2KBN A;  2WP8 J;  4KHP L;  2UXB L;  4R4O A;  4OWX B;  4AIM A;  4A3J G;  2JQO A;  1XMO Q;  5JJL A;  1PYS B;  1N32 L;  4A3F G;  1NY4 A;  4DR5 L;  2JE6 I;  3GTM H;  5GQO A;  4YWK A;  5M3F H;  3UDG A;  4IFD I;  3L7Z C;  4GKK L;  3RLF A;  4B3T L;  1YVC A;  4A3J H;  3PO2 G;  3CP0 A;  4A3F H;  2MNA A;  4GKK Q;  1NJI C;  4LF5 L;  4LFB L;  1YHQ A;  3CPW A;  4X62 L;  1ASY A;  2V1C C;  4R4Q A;  3I4M H;  3FHW A;  4X62 Q;  1WCM G;  1BKB A;  3CW2 C;  3H3V I;  1PH9 A;  4APV A;  4DKA C;  2E5L Q;  3KYH C;  2XGT A;  1QUQ A;  4NXN Q;  3MEF A;  2F4V Q;  3S14 H;  2JA8 G;  1X56 A;  4LF4 Q;  4OX9 Q;  1ASZ A;  4A3M H;  3PO2 H;  3PUY A;  1YJN A;  2AMC B;  4YHH Q;  3S17 H;  2VQF Q;  4UP9 A;  1U0L A;  3KF8 B;  4OO1 I;  4A3L G;  4JI0 Q;  4YY3 L; 
#chains in the Genus database with same CATH topology
 3F2C A;  2N49 A;  2YTV A;  1E7Z A;  3J7Y W;  2R92 G;  4I7Z C;  2SOB A;  3VR3 A;  1EIF A;  1PFM A;  2VUM B;  3MXN B;  1Q1E A;  1PFN A;  1U4R A;  3VR6 A;  1E0B A;  2PQA A;  3NWS A;  4JI2 L;  4DV1 L;  3IFD A;  4C3H B;  1J5E Q;  3HOX G;  3EA6 A;  4A4I A;  5FJ8 H;  4ILW A;  1GHK A;  1VQF A;  3SK8 A;  1X55 A;  5JPN C;  4XTC S;  1HNX Q;  1M8A A;  4JI4 L;  1LV9 A;  4OON A;  4DV3 L;  1GKH A;  1VQO A;  3N52 A;  4JV5 Q;  1SNP A;  4LF9 L;  4J1M A;  1RJT A;  1IKL A;  5LL6 X;  1SRO A;  4YWM A;  1WCM B;  1TS3 A;  4HJ7 A;  4AQY L;  4IUV A;  3BJU A;  2AUK A;  5KGU A;  2Z9H A;  4DAP A;  4PNY A;  1BCP B;  1C4Q A;  3H0G H;  4GN3 B;  3S2H H;  4A3F B;  4QUF A;  4UPA A;  4OWW B;  2I46 A;  5ELD A;  4G7Z C;  5GRO A;  3VR4 A;  5D3I B;  1IBK L;  2Q2U A;  4DK1 A;  2Q8R E;  1Y14 B;  3I72 A;  3J81 E;  4G7O C;  3MEH A;  4QUC A;  4GKJ L;  4K2L A;  1DON A;  3MC0 B;  4KLK A;  4FVM A;  2UUC Q;  3SXH A;  3GTP H;  3E0E A;  4Y52 H;  2O4X A;  2RCF A;  3HOV B;  3CCS A;  4GN4 B;  3Q23 A;  2B63 H;  4OIJ A;  2NVY H;  5CYU A;  1STE A;  3AMU A;  1RD9 D;  3K7A H;  3U9S A;  4BBR G;  3GTQ H;  1STA A;  4AH6 A;  2K52 A;  2OEO A;  4ME3 A;  4JPB W;  1JB7 A;  1B53 A;  3G71 A;  4U68 A;  1STH A;  1K0S A;  5E4X A;  4ZYS A;  4YWL A;  1E2W A;  1U5K A;  4QJF A;  1SNO A;  3PUV A;  1X9N A;  2E2H B;  2D0O A;  1Y1W H;  4A3I H;  3S2H B;  3ND8 A;  1CZG A;  2KUM A;  1WTR A;  1EY5 A;  2QIL A;  4MTK A;  3RNU A;  4JOI A;  2ZXP A;  3I55 A;  3H15 A;  5IWA L;  5T1G A;  2YU9 H;  3KDF A;  4S3S A;  3IFT A;  3K5M A;  1DYQ A;  5ELF A;  4V0B A;  1PV4 A;  4HN7 A;  4BY7 H;  2OF1 A;  3I2Z A;  5C0X I;  1G91 A;  1Q86 C;  3S15 H;  4KY5 A;  3VR5 A;  2QEX A;  1G29 1;  2AQ2 B;  5EKL A;  4GNX C;  1GUS A;  4R4I A;  1XNQ Q;  3M4Q A;  3PUW A;  2WFW A;  3M7N A;  1HFN A;  1AH9 A;  2E74 C;  4DV2 L;  1OXS C;  1STG A;  4DV0 L;  2VY3 A;  4P74 A;  2K03 A;  1VQD A;  1I3Q B;  5I9P A;  1AFP A;  1EQR A;  3D0F A;  3NSW A;  5ISR A;  4FF3 A;  1X3Q A;  5CV4 A;  5KND A;  2HD3 A;  1SJH D;  2R92 B;  3JC6 6;  2F3V A;  2QDB A;  2ICE C;  3A5Z B;  2VUM G;  3TP8 A;  4DUY L;  5IP7 G;  3S1R H;  1YNJ D;  1QZG A;  3KOJ A;  4DAY B;  5E7N A;  1EFW A;  1N9W A;  3NEN A;  2KEC A;  1UEB A;  1HR0 Q;  1ICF B;  2CWP A;  5DLQ E;  1GD7 A;  3KLS A;  2MO1 A;  1TWA H;  4GOP A;  2K4K A;  1EY8 A;  1LUZ A;  1FNV A;  2Y0S E;  3BYT B;  3PSI A;  2N78 A;  4CDC C;  1Q1B A;  5EGT A;  4XIG S;  3GD7 A;  3I4M B;  4E6I A;  2JA5 G;  1N32 Q;  4IPC A;  2ZJQ A;  3AB9 A;  4LF6 L;  4BY7 B;  4HTH A;  4QGU A;  1DGS A;  2DUD A;  4DNT B;  4F87 A;  2MUY A;  1ILQ A;  1OXX K;  1Q8I A;  2KJX A;  5FLM H;  1D6E C;  1YJW A;  2IX1 A;  1EIG A;  2FIN B;  2HIV A;  5KYI A;  1JMC A;  4X6A H;  4O2D A;  2EDG A;  5COY A;  2UUA Q;  3SVM A;  3EN2 A;  1G2T A;  3OHX C;  1EWC A;  2CH4 A;  4PMW A;  1SE3 A;  5I4D A;  1SMX A;  2R6G A;  4R8N A;  4A93 G;  4A3E G;  1LTT D;  4HR7 B;  2EYM A;  4K14 A;  3T13 A;  4KY7 A;  2LS0 1;  5EPJ A;  2F4V L;  1PMR A;  1U9R A;  1E24 A;  3STB D;  2I5M X;  1XPR A;  1G8Z D;  1EEF D;  1VMC A;  3H09 A;  2R7D A;  1MD2 D;  4AYB B;  4G57 A;  4EQN A;  2VB3 X;  4XQN A;  2Z4H A;  4XYQ A;  5G3L D;  5C4X H;  3SK6 A;  5IYD G;  1EEI D;  1EIH A;  1I4Q A;  1Y8P B;  1MBY A;  4DR6 Q;  3I4O A;  1VQJ A;  1BVS A;  1FD7 D;  4JK1 C;  1ESR A;  3LWU A;  1VMP A;  4EX5 A;  1HUM A;  2D62 A;  3DHQ A;  4RHS A;  5I6W A;  3HS0 C;  1SAP A;  3BZK A;  4DV7 Q;  1Y69 U;  2CW0 C;  4DR3 L;  2D0P A;  2IX3 A;  2R7Z B;  3S1N B;  1I4G A;  3F2D A;  3OMG A;  1JC7 A;  2KHS A;  2L11 A;  4CJ2 C;  4B3S Q;  5FLX L;  2F0V A;  4A3C G;  2XRQ D;  1EY7 A;  4DV0 Q;  1CUK A;  3IKJ A;  1TY0 A;  2EIF A;  2KHJ A;  4ID6 A;  2P5Z X;  3S17 B;  1B9N A;  4ME5 A;  4WJ3 M;  2RSO A;  2EY6 A;  3KBG A;  3JAM c;  4DR7 Q;  4DV3 Q;  3J81 c;  2JA6 G;  1TS5 A;  1TWH B;  3SEB A;  2HHH Q;  5C44 B;  1HQM C;  2CCZ A;  1HQR D;  4X64 Q;  1PZI D;  3U9O A;  1M90 C;  1PRT D;  3PIO A;  1I6V C;  3W2D A;  1PH7 A;  4LUO A;  4HSP A;  4R4T A;  1SJE D;  4B3M Q;  1WTX A;  2MO0 A;  4ZAI A;  4M8A A;  1FGB D;  2BA1 A;  2K33 A;  2PI2 E;  4C3I B;  2RF4 A;  4IZ8 A;  2K5N A;  1VQK A;  5GAE C;  1YHA A;  3P20 A;  4X3T A;  1DCZ A;  2A8V A;  4F7X A;  1QUQ B;  1Q90 A;  1A3V A;  3VYR A;  2JXM B;  3A8K E;  2BH8 A;  2RHQ B;  1JIC A;  1LT5 D;  4HMJ A;  1TWC B;  3BDL A;  4B08 A;  5FO8 B;  3PUX A;  1HR0 L;  5C3E G;  3HOY B;  2A6H C;  3UDX A;  4BXX H;  3MFY A;  2E2I H;  1RCV D;  2VZA A;  3A7A B;  4KV6 A;  1HPC A;  1W2B A;  2NVQ B;  4LUZ A;  4L8J A;  4GN5 A;  3RMH A;  1E1O A;  2NTT A;  4MIU A;  1GVP A;  2XSC A;  1W6J A;  2BA0 A;  2OT2 A;  2Z0S A;  3BU2 A;  4NXM Q;  3I4M G;  1LTL A;  3HKZ G;  1SMY C;  4RH6 A;  4KY6 A;  4RA8 A;  4EGV A;  1JE4 A;  3I7F A;  5C3X A;  1OO9 B;  4IJH A;  4A3J B;  5AFW A;  4KHZ A;  3OWE B;  1IYJ B;  3RN5 A;  4A3D H;  1IBL Q;  2DY7 A;  2PZW A;  3GTJ B;  1HNW Q;  1C8C A;  1C0A A;  1J8I A;  2AQ3 B;  1K3B C;  1HNW L;  3U4Z A;  1IBL L;  2F0I A;  3P7J A;  1SLJ A;  1H9S A;  1WTP A;  3HOU B;  3SHL A;  3W1B A;  1I4P A;  3V05 A;  5T1I A;  1F2Z A;  3G48 A;  4MZ9 A;  3MVV A;  3CD6 A;  4JOI C;  2PNH A;  4X66 L;  1PTO F;  1EWI A;  1PH5 A;  4FF1 A;  3TN2 A;  1CSQ A;  1YBY A;  3EBE A;  2B39 A;  4KJO A;  4K8I A;  1UWV A;  1S4Z A;  3PO3 H;  2KCM A;  1CA6 A;  1UEA B;  3F1Z A;  3JAM i;  5K36 G;  3HGB A;  4HAE A;  1Z6H A;  5HUR A;  1ENF A;  1Q82 C;  2UXB L;  2WP8 J;  2J4X A;  1PYS B;  4A3F G;  1NY4 A;  2F0S A;  3RD4 A;  4JW0 A;  3GTM H;  4H7B A;  5GQO A;  4YWK A;  5M3F H;  4IFD I;  5M5Y B;  1HTL D;  3RLF A;  1SYC A;  3K57 A;  4A3J H;  4NKL A;  4GKK Q;  4LF5 L;  3QIA A;  1ASY A;  2LY7 A;  1AP0 A;  3FHW A;  4KD4 A;  1WCM G;  3VR2 A;  1BKB A;  3I70 A;  4FO2 A;  3NBI A;  3NTH A;  1QUQ A;  4XT1 B;  1ASZ A;  2AQ1 B;  3NUC A;  3SE0 A;  2AMC B;  1CK1 A;  4RHR A;  3TSS A;  3KF8 B;  4CBV A;  4A3L G;  3I90 A;  2HUG A;  4JI0 Q;  5CV5 A;  1EY6 A;  5DAU A;  3J80 i;  2L5T A;  2NWG A;  3M9B A;  4KTA A;  4O42 A;  3WWV A;  1V1O A;  1YJ9 A;  1FGU A;  1WTQ A;  1TQO A;  1XMO L;  2LXJ A;  5EKK A;  2ZTC A;  3M4Y A;  1R4P B;  2KHI A;  4L5T A;  1WVL A;  2MPM A;  1O7Y A;  3TEH B;  3DWQ A;  1Y8N B;  1JWS D;  4IUP A;  2CFM A;  1BBW A;  2XWJ B;  3TME A;  1CQV A;  1EL0 A;  1EQQ A;  4DR4 Q;  5D3D A;  1X54 A;  3PIP 3;  2EXZ A;  1VQM A;  2NZH A;  1SND A;  4LNQ A;  3J7Z C;  4BBR B;  5BN4 A;  3BS1 A;  5IGC A;  4IUN A;  5LMN W;  2Z8L A;  1VCI A;  4J15 A;  3GTG H;  1MHW C;  4IJL A;  1L0Y B;  1PFS A;  3JAM E;  4B3S L;  4GOP C;  5LL6 S;  3M7G A;  3I3C A;  1NAP A;  2JEA I;  2YYZ A;  4CDE C;  4DV4 L;  3CCL A;  2RDF A;  4J6H A;  3HKZ E;  2VL6 A;  1XNR Q;  3HKZ B;  4OWT B;  4XXE A;  1OXU A;  1SE8 A;  3PF4 A;  2NN6 G;  2IX0 A;  4GLV B;  4DR2 Q;  2NVX H;  1IKM A;  3QG1 A;  4JBJ A;  5GAD C;  1E22 A;  1EYA A;  2EYJ A;  2HQL A;  2VNU D;  1JR0 D;  1K9M C;  4OHJ A;  2PQE A;  4BXX G;  3ONA B;  4JI2 Q;  3HOW H;  1MJE A;  1Z47 A;  3WDN A;  1NUC A;  2C35 B;  5COR A;  5M3M H;  2E2D C;  4N9T A;  2ATW A;  1T9H A;  4XDX A;  5JEA H;  5CR3 A;  2N55 A;  1SMY D;  3T16 A;  3T1H L;  4JI0 L;  4FDB A;  2VQF L;  1ENA A;  2F0K A;  2BE5 C;  3S1Q H;  3GDE A;  2F0P A;  2FMM A;  3STB C;  3HOV H;  2K32 A;  4NB3 A;  4BY7 G;  1K8O A;  3A8J E;  1HZC A;  2DY8 A;  2FFK B;  3RZD H;  3EQL C;  1KL9 A;  2H5X A;  2IHE A;  4BY1 H;  1SYB A;  1A15 A;  2DN8 A;  4K6D A;  3WOF A;  2O5J C;  1HH2 P;  2BDN A;  1RTN A;  1PH1 A;  2RDH A;  1O7Z A;  1I94 Q;  2EJG C;  1BCP D;  4A3E B;  4TQU S;  5KEE A;  5KYL A;  1VQ5 A;  1X32 A;  4CKB A;  3N6R A;  1L1O C;  1GUW A;  3CCE A;  3R2I A;  4DR1 L;  3TP7 A;  1FYC A;  1Y1V G;  3RZO B;  1FR3 A;  4A3C H;  3HOU H;  3SDZ A;  1PTO H;  3TRZ A;  3OTO L;  4QCL A;  4HSV A;  5IIF A;  1GUT A;  2WAQ B;  2VB2 X;  3UI2 A;  1X3F A;  1F2Y A;  3NHH A;  1PH3 A;  4JI6 Q;  3HOW B;  1SNM A;  1STB A;  2HT1 A;  1HCZ A;  3FEW X;  2XTI A;  5DM7 3;  1KIX A;  1Q8K A;  5IGF A;  2FXQ A;  4NMZ A;  4LF8 L;  2R7Z G;  4ULL A;  1DM0 B;  1N33 L;  1OXT A;  2B2U C;  3OWF A;  3DEO A;  1HR0 W;  1WTO A;  5M3F B;  3C3L A;  1VQG A;  1WI5 A;  2ZTD A;  4DAY A;  1N8R C;  3K5O A;  3ULJ A;  1VQN A;  1TR5 A;  2CVR A;  1NBW A;  2NZO A;  3DMU A;  2HDL A;  2N88 A;  2MFI A;  4A3D B;  5IYC G;  2GA4 B;  1XX8 A;  4A3E H;  1JJG A;  3T1H Q;  5JVH 3;  2EYH A;  1NMG A;  2L12 A;  2F0F A;  2UXD Q;  3BYY B;  2AHO B;  4LJZ C;  1JJ2 A;  1YI2 A;  1QVG A;  3KF6 A;  2DNC A;  2L1B A;  1PTO B;  4RMF A;  5M3M G;  3O13 A;  1XYI A;  1B1Z A;  2Y0S G;  3V96 A;  3K80 C;  5FLX E;  2UXD L;  1TWF H;  3S1M B;  2UXC L;  1S5E D;  1EY9 A;  2K50 A;  2JN4 A;  1N36 Q;  2E5L L;  3I4L A;  5CV9 A;  2CH4 W;  5D65 A;  5ELN A;  4TVA B;  4N9P A;  4KI0 A;  2F3I A;  4NPS A;  1ET6 A;  4BS9 A;  3X3M A;  4WOR A;  2E2I B;  4JG2 A;  2B2W C;  1YNJ C;  4TSS A;  3ULP A;  2TSS A;  4A3B G;  4WJ4 A;  3OIP A;  1CSP A;  3NP8 A;  1HZ9 A;  1O7I A;  1B8A A;  1ESF A;  3AYH B;  4LFC L;  3ND9 A;  1BF4 A;  2KOL A;  3DWA A;  2CKZ B;  2VUM H;  3GV6 A;  5IP7 H;  4DR3 Q;  2FJ2 A;  3DM3 A;  2A69 C;  2E8G A;  3TP5 A;  4BWG B;  4K6L A;  1PRT C;  5BN5 A;  3RZD B;  1HA5 A;  3I4N H;  2VW9 A;  4IPD A;  3ZJY C;  4DN4 M;  4DPG A;  1A3T A;  2KCN A;  2CHB D;  3D31 A;  1TT2 A;  2HHH L;  4LFA L;  4JV5 L;  2A6E D;  1DXM A;  1XTC D;  3LGJ A;  5A2Q E;  1KQS A;  1EFI D;  1V8Q A;  1X6O A;  4C1N I;  1QVF A;  3OPO A;  1Q81 C;  1TWA B;  1RKN A;  5J1Z A;  3CU7 A;  3T1Y L;  2HQE A;  3H0G B;  4ALP A;  2XN9 C;  2JA8 B;  1ZYR D;  3C1F A;  1ET9 A;  2RKS A;  1KRS A;  4AYB E;  4C2M H;  5E4W C;  1LYL A;  2F3W A;  2RCN A;  1TWF B;  3S1M H;  3GTL B;  2CW0 D;  4PQX A;  1TWC H;  2XIW A;  1GOZ A;  2ZXR A;  2OQ0 A;  3HOU G;  5AJ3 L;  1U4P A;  1PTO D;  4FYD A;  3TRE A;  1OXV A;  5CBE E;  5C4Z A;  3ITP A;  2JA6 H;  1F9S A;  3ERQ A;  4LUV A;  3U58 A;  1C48 A;  1LO5 D;  2KEE A;  3FKI H;  4OEL B;  2VQE L;  3KDF B;  1NR4 A;  2NVT B;  2PI2 A;  3AEV A;  1E2Z A;  2D5D A;  5C0X H;  5F2D A;  1LTA D;  5ELE A;  5JJI A;  4C3J G;  2G9D A;  1W6K A;  5FLM G;  2JEB I;  5LHY 1;  1Y1V H;  2K28 A;  3MHB A;  1HZB A;  1XJV A;  4OXP A;  1C9O A;  3ICE A;  1V1Q A;  5M3F G;  3VDY A;  2B63 G;  5C4X B;  4C3I H;  5EAY A;  4Y7N H;  1D2B A;  2R93 H;  2X69 A;  1L1O A;  1RL2 A;  1B70 B;  3CHB D;  3J81 j;  1Y1W B;  3UDF A;  1PFB A;  4POF A;  4ZKC B;  3KFU A;  2MQH A;  5JEA G;  1G2S A;  3HFZ B;  1GJX A;  1L2F A;  5M9O A;  1I4X A;  1PTO C;  4K0K Q;  1K8M A;  2E75 C;  1D1I A;  5KNC A;  2Z6B A;  5LMU Q;  2KEN A;  2NYZ D;  2HDM A;  1Q46 A;  2PCF B;  3RLN A;  3RLO A;  5IGD A;  4LFC Q;  3PGZ A;  3I91 A;  3HOY H;  3D3R A;  4XQJ A;  1UE5 A;  5M5W H;  1K73 C;  3R93 A;  1IBM L;  3NQI A;  4UHV A;  2Q2H A;  3FKI B;  1AZP A;  2A68 C;  1JOQ A;  2RQX A;  3U4V A;  4ZQ3 A;  4BY1 G;  1Q3L A;  2EXD A;  4LF9 Q;  1XNQ L;  4JBK A;  3K5L A;  1PRT B;  2H1E A;  4GNX B;  1AEX A;  3F2U A;  4BBR H;  2ZJR A;  5ELC A;  1H9R A;  5HGT A;  1A0I A;  1O80 A;  4JC0 A;  3VYU A;  5IYC H;  1SRU A;  1A63 A;  2F4I A;  4K5X A;  2B29 A;  1MSG A;  1K83 H;  3M4O H;  1L0W A;  1PLF A;  1VQH A;  1D8L A;  1S5D D;  2R7F A;  4X65 Q;  5CV7 A;  1LLR D;  2BE5 D;  2Z6K A;  1J5E L;  3F2B A;  4IUQ A;  1D1K A;  3S24 A;  3H3V H;  3J7A 5;  2K5H A;  1SFO H;  3GTO H;  2PYK A;  3I4N G;  4XYO A;  5JJZ A;  3F8T A;  2KBN A;  4KHP L;  1EU3 A;  5G3L F;  4AIM A;  2JQO A;  5JJL A;  3E6Z X;  3HRZ C;  2R93 B;  2B2W A;  3L7Z C;  4GKK L;  3DWP A;  1CQF A;  3HOZ B;  4IN3 A;  5JAV A;  3CPW A;  2V1C C;  3I4M H;  1I4R A;  4K5V A;  2KQ3 A;  3D8G A;  3NWT A;  5NUC A;  4XT3 B;  2JA8 G;  2B2T A;  3PO2 H;  4YHH Q;  1DOM A;  1ENC A;  4UP9 A;  3S1Q B;  1KAB A;  1RF2 D;  3QJY A;  4J8Q A;  5C5L A;  4RGT A;  4JI7 Q;  5EPK A;  2BOS A;  1PYB A;  5EBD A;  2Q8I B;  4UAI A;  2NBF A;  1S72 A;  2C5C A;  1EQV A;  4G7H C;  2K5W A;  1LAB A;  1OTC A;  2I0Q A;  3PIO 3;  2MJ8 A;  4IUR A;  1R9T B;  1PHJ A;  4FF4 A;  1K83 B;  3GTO B;  4LFB Q;  3K7A B;  1DD2 A;  1XNR L;  2PMZ E;  4PZ7 A;  4CHT B;  3LNN A;  3ZYY X;  2KVM A;  1TS2 A;  4ZKB B;  4GOP B;  1M4V A;  2L15 A;  2LKV A;  2I5L X;  5FK9 C;  4WJW A;  5K36 H;  4HJ9 A;  5HGQ A;  5IOD A;  1JWM D;  1QVC A;  3LX0 A;  4A3L H;  2IW3 A;  2HCC A;  3E0J A;  1KLU D;  1I50 H;  1S5B D;  4IUU A;  4OX9 L;  2JSO A;  3HEJ A;  2GN5 A;  2YTX A;  4B9X A;  3HKS A;  1TVX A;  3MFG A;  1QNU A;  3KF6 B;  3NXW A;  1H9M A;  2JP1 A;  2NVQ H;  2SNM A;  1J6Q A;  5IY0 A;  1PH4 A;  4JI8 Q;  2ZM6 Q;  1V43 A;  2OCE A;  2CQA A;  3GP7 A;  2UU9 Q;  2OQK A;  1VQ8 A;  1CZW A;  1IBM Q;  5IE8 A;  3T4A C;  2O5I C;  1E3P A;  3C1E A;  1ONL A;  2RHS B;  1EYG A;  3R3O A;  4JI1 L;  3VYS A;  2F0D A;  2IPK D;  2H4O A;  3M4O B;  4DNI A;  3GTJ H;  2WB1 E;  1Y1V B;  1ZXT A;  1L0X B;  2LXK A;  4NXN L;  4DV5 Q;  4QF4 A;  2ID0 A;  1LT3 D;  3CCV A;  2EQS A;  4GLA C;  5M5X H;  4H02 A;  4DV6 L;  1VQA A;  2R92 H;  3J81 L;  1BXT A;  4N8F A;  3OW2 A;  3EFX D;  4DUZ L;  3S9W A;  2EE1 A;  4HID A;  4UDU C;  4IUT A;  3HOW G;  4DV4 Q;  1VF5 C;  4A3D G;  3CC7 A;  2JA7 H;  1KDC A;  2PQA B;  2ENB A;  5DM6 3;  1NE3 A;  3A7L A;  2JA8 H;  3D4W A;  2PO4 A;  1EOT A;  1TWG B;  4H0L C;  5C4J H;  3RN2 A;  2UUC L;  4YIJ A;  3PMF A;  1JWU D;  3NPP A;  3CAM A;  1RIP A;  1K8A C;  1SR3 A;  3GTL H;  1IBK Q;  2A74 C;  5LMN L;  4NDX A;  5C0X G;  3BDO A;  4JI3 L;  4DR2 L;  3PV0 A;  1F77 A;  1N33 Q;  1B44 D;  4F88 A;  3UE1 A;  3GTM B;  1PH8 A;  2DNE A;  3D4R A;  5DEH A;  1FNW A;  1VQ7 A;  3FVQ A;  3HOX H;  1A2T A;  1B9M A;  2NVT H;  2RVL A;  1BR9 A;  5C44 H;  3CF5 A;  4AQY Q;  4OL7 A;  2EJM A;  1QWY A;  5C5M A;  1HZA A;  1VQI A;  3TQY A;  2HIX A;  3T53 B;  3G7L A;  1VDZ A;  3MXU A;  1BUV T;  2NVY B;  1SNC A;  1VS0 A;  2EYP A;  1EQT A;  3GTQ B;  4ZRZ A;  2JA7 G;  5FOB B;  4YHH L;  4RCO A;  1XMQ L;  3DLL A;  2F1M A;  2IT1 A;  2MP1 A;  1KAA A;  2QGQ A;  3KLR A;  3FPP A;  3BDC A;  4IPH A;  3FRP B;  5FJ8 G;  2PZU A;  4LMQ D;  3TBI B;  4U67 3;  5CV8 A;  2JA5 B;  3DXJ C;  2Z1C A;  1F9P A;  2KED A;  1F9Q A;  4YY3 Q;  3LWE A;  4PZ6 A;  4B3T Q;  5IWA Q;  4L5S A;  1ZEQ X;  1EYC A;  1K0R A;  1V1P A;  3FPU B;  1CI3 M;  1NR2 A;  5C6A A;  1U4L A;  5JOB A;  3IAY A;  2QKI C;  4DV6 Q;  2UXB Q;  4A93 H;  1YEZ A;  3DEP A;  4PG3 A;  1QG7 A;  1SE4 A;  3K8A A;  1CKN B;  4LF4 L;  2GVB A;  3URY A;  5C4H A;  1HUN A;  5JPM C;  4DAM A;  1MKH A;  2PW5 A;  4LF5 Q;  1A62 A;  4H44 C;  2IJ0 A;  2OTJ A;  3GTP B;  3NTK A;  4DR7 L;  1IW7 C;  1H95 A;  1HRJ A;  4X3K A;  4JYA L;  1PRT F;  1K28 A;  2F0T A;  3CRL C;  5DNF A;  1Z9F A;  1MI2 A;  1J9O A;  4LW1 A;  3T51 B;  3Q6S A;  4A3M B;  2WKC A;  3H0G G;  1I6H H;  1S3O A;  4Y7N B;  2M9V A;  1QCB D;  4A3K H;  1S40 A;  2GVA A;  2A5H A;  2DJG C;  1CHQ D;  1YIJ A;  1LT6 D;  1XPU A;  4NP5 A;  4FXD A;  5I9O A;  2F0J A;  3KLW A;  4LF8 Q;  1F2M A;  4UY8 C;  1KNE A;  4DF7 A;  4GLX A;  2K75 A;  3D6C A;  5FO7 B;  1QIL A;  4AYB G;  1KC8 C;  1QZH A;  4QIW E;  5K5P A;  1STN A;  1UE1 A;  3OMC A;  4L5Q A;  1BQQ T;  5C3E H;  4DNR B;  2ZTE A;  4JBM A;  2JA9 A;  1VQ9 A;  4QQB X;  1EY4 A;  4UP8 A;  4LFA Q;  4LK1 C;  1A8V A;  3VA7 A;  3K81 C;  1GO3 E;  2BDO A;  2L9H A;  4N8X 1;  1PA6 A;  3A74 A;  2PZT A;  1B4O A;  4BBS H;  1JCK B;  5C44 G;  4MN3 A;  1K3R A;  2WV6 D;  4ABN A;  4DK0 A;  4EQP A;  2IHF A;  1PYW D;  3QOL A;  1PVO A;  2HCI A;  1H9K A;  4L6T B;  5M5Y H;  4HMI A;  5C3W A;  4OO1 G;  3G6E A;  3NK9 A;  1WTH A;  2AUJ D;  4KKS A;  3J80 c;  2F0M A;  4NXM L;  2A69 D;  1VQ4 A;  4Q0F A;  4LWC A;  2UXC Q;  1B7Y B;  4O1N A;  5IYB G;  3H6M A;  4BY1 B;  1HXY D;  2EY1 A;  4IPG A;  3K0X A;  1II3 A;  5KNB A;  3Q22 A;  2F0U A;  1GHJ A;  1JQY D;  1EUJ A;  1R9T H;  2IL8 A;  3S14 B;  2IWH A;  1MIU A;  2E2J H;  5J39 A;  4A3G B;  1IXR A;  2B2V C;  3K6O A;  3ERO A;  4RCN A;  5JJK A;  1PXU A;  4A3I G;  1G6P A;  3TDQ A;  1V1P B;  2L55 A;  4WRD A;  1BOS A;  4XQQ A;  2Z4I A;  1HTP A;  4DXF A;  5C3E B;  1D7Q A;  2NB0 A;  3H91 A;  5BR8 Q;  5BR8 L;  2UUA L;  2Q8T A;  3QWN A;  2WAC A;  2E2H H;  2UU9 L;  2M2L A;  3PO3 G;  1IL2 A;  1JB3 A;  3W5O A;  3U50 C;  2OTL A;  2VS1 A;  3QO2 A;  1TWG H;  2R93 G;  4OO1 I;  3ERS X;  3R2T A;  2Q2T A;  4IFD G;  3QR8 A;  1NTG A;  4DU9 A;  2O2L D;  1EYD A;  3S2D B;  3OIQ A;  3HOZ G;  3TS0 A;  1XMQ Q;  1IHZ A;  3SK5 A;  4JI8 L;  5I6Y A;  2ZM6 L;  3M85 A;  1WTV A;  2WB1 G;  1WD1 A;  1UE7 A;  1ML0 D;  1HHV A;  1AZQ A;  1NSN S;  2XWB B;  1LT4 D;  4YCW A;  4X64 L;  1B3Q A;  4X3U A;  2AWO A;  3I4N B;  1VQE A;  4FF2 A;  3MAQ A;  4KKT A;  4POG A;  1GUO A;  2NTS A;  1I94 L;  4I7A A;  3PUZ A;  5CGK A;  1YNX A;  4HJ5 A;  3MTS A;  3CCM A;  3J7A F;  3A56 A;  4C3J H;  4HIK A;  4DV2 Q;  2B2V A;  4CKC A;  1PH6 A;  4RGM A;  3DM1 A;  3A54 A;  1HA6 A;  2NN6 I;  4ZUJ A;  1F2L A;  3TZU A;  2IY5 B;  1LTS D;  1VQB A;  4RKB A;  3K58 A;  1C7Y A;  1S5C D;  3TP6 A;  5CC4 A;  3E3X A;  4HJ8 A;  2JA5 H;  4JI6 L;  4IQZ A;  4EQ5 A;  2A73 B;  4KD3 A;  1D5M C;  3K0Y A;  2K5Q A;  3CCJ A;  1EU4 A;  4LF7 Q;  3UE0 A;  2KCC A;  5LMN Q;  1Q7Y C;  3S2D H;  4DK6 C;  2YU9 B;  2ASB A;  1I50 B;  3CC2 A;  3QB3 A;  1PH2 A;  2TMP A;  2ES2 A;  3BZD B;  2D2C C;  2F0N A;  1UAP A;  1VQC A;  3DUZ A;  5EKI A;  3C46 A;  3BZC A;  4LF6 Q;  2QW7 A;  4R4O A;  4OWX B;  1XMO Q;  3CKI B;  4DR5 L;  2JE6 I;  3GTG B;  2RBM A;  2A6E C;  3UDG A;  5A2Q L;  3S15 B;  3J80 L;  1STY A;  3CP0 A;  1NJI C;  3BVG A;  1YHQ A;  3CQZ B;  5EJW A;  1B50 A;  1O78 A;  1BNZ A;  4ZUI A;  3H94 A;  4X62 Q;  3CW2 C;  4FP5 D;  1PH9 A;  1BDO A;  4APV A;  3KYH C;  5I2X A;  2F4V Q;  2MHV A;  3S14 H;  1X56 A;  1IL8 A;  1KTK A;  1SFO B;  4A3M H;  3V2T A;  1CA5 A;  2G5D A;  3PUY A;  1B3A A;  1YJN A;  2PNR C;  2VQF Q;  1U0L A;  1LAC A;  2NVX B;  4YY3 L;  1YHB A;  3A8I E;  2JK8 A;  4L5R C;  1EIY B;  2QEJ C;  1WOC A;  2DGY A;  1WTW A;  3S16 H;  4A3I B;  3J7A V;  1SSO A;  1E1T A;  2E76 C;  2PMZ B;  4GKJ Q;  2EYF A;  4CKE A;  1X65 A;  2BH2 A;  2LFN A;  2R7Z H;  3OOC A;  4P75 A;  5ELB A;  4R9W A;  3M3Y H;  1D5Z C;  1PZJ D;  4FXG C;  3PO2 B;  4KKU A;  1AE3 A;  1JOR A;  3PO3 B;  3AQQ A;  4RAU C;  1JOK A;  2B2Y A;  4UP7 A;  5JEA J;  4JVZ A;  2AKW B;  4PV1 C;  5BN3 A;  2LMC B;  2B2T C;  4QIW B;  4A3K G;  4ZLT F;  4PMB A;  4MTN A;  5J3B A;  4CJ0 B;  2B3G A;  4QL5 A;  3OTO Q;  2OWO A;  4KMU C;  2EY2 A;  4KK7 A;  1GM5 A;  1I3Q H;  2SNS A;  2QF7 A;  2WB1 B;  4JI5 L;  3J80 E;  4JI5 Q;  3UDI A;  5IT9 E;  1KRT A;  4K2K A;  4DR4 L;  3A0J A;  4JI4 Q;  1GXD C;  2I07 B;  3L0O A;  4ZCK A;  4TRD A;  3B6Y A;  1BO0 A;  4BA1 I;  2EOT A;  3Q24 A;  1I4H A;  4RGN A;  3TS2 A;  2F03 A;  2B2Y C;  3KJP A;  1GUN A;  4KN4 C;  4IAL A;  5GAG C;  4P72 A;  2F0Q A;  2K5V A;  4MNO A;  2A68 D;  1KD1 C;  2ZXO A;  2JA7 B;  1G6Z A;  1CHP D;  4DUZ Q;  5E3F A;  1X3P A;  3QOJ A;  3NBH A;  2F0L A;  3KF8 A;  3S16 B;  3CMA A;  1G51 A;  5FLX c;  5C4J B;  3S1N H;  3I8Z A;  1D5X C;  3J81 i;  2NUC A;  3HP3 A;  1SDF A;  1VQ6 A;  3H3V C;  4CGY B;  3AFP A;  4R8I A;  1Z7T A;  1T5E A;  2D9U A;  4X65 L;  1I5F A;  1UUP A;  2M00 A;  2VQE Q;  5KIX A;  2F0G A;  1SBB B;  4C3H G;  2Z6K C;  2I5H A;  3PCO B;  2A6H D;  4GS3 A;  4RFB A;  2JJQ A;  1KDA A;  1KHI A;  3NEL A;  4P2C B;  3KBX A;  1X3E A;  1TXY A;  1K8G A;  5IT9 L;  4A76 A;  2B8F A;  1KLG D;  2X6L A;  3CCQ A;  4IFD J;  1U4M A;  1VQL A;  2EYO A;  2K14 A;  5CBA E;  1MJC A;  4QMG A;  4WFN 3;  1JJC B;  4K5W A;  1I6H B;  1KXL A;  2K7V A;  1TII D;  1N34 Q;  1VF7 A;  2RSN A;  2SDF A;  2F0O A;  4ODG A;  5HY6 A;  2WIN B;  2WKD A;  2CWA A;  2R61 A;  4X66 Q;  3K7U C;  4IOA A;  1DZ1 A;  3MA2 B;  1HNZ Q;  2V4D A;  1QJO A;  5ELO A;  3GTK B;  4DXG A;  4DK3 C;  3PQI A;  4A3M G;  1EZ6 A;  4PZ8 A;  1AN8 A;  3RUZ A;  4QY7 A;  2SEB D;  3G4S A;  5LMU L;  4BBS G;  5EBC A;  2L4N A;  4JBW A;  4B3R Q;  5I2Y A;  3C2P A;  1ILP A;  1L1O B;  1LM0 A;  2EY5 A;  3Q8D A;  3PF5 A;  4NW2 A;  2K04 A;  4RWS C;  4CDF C;  2N3S A;  4B3R L;  3KLS X;  2ALY B;  3CCU A;  3HOV G;  1IYU A;  3OW7 A;  5EQ0 A;  3NQT A;  2EYL A;  2K05 A;  2K6A A;  2ZJP A;  2A1A A;  3OYY A;  5H1S E;  2WAQ G;  2F0H A;  3A5U A;  2K5D A;  5FKA C;  3NE5 B;  3KK7 A;  4DV1 Q;  4P71 A;  1WYD A;  2C9O A;  4JCV E;  3SK4 A;  1TY2 A;  3IL8 A;  4P73 A;  1SYE A;  4RKL A;  2N8N A;  5KRU A;  1HNX L;  1TKW B;  3CRK C;  4DGZ A;  1CKM A;  5IGE A;  3CC4 A;  2B8G A;  3JAM L;  3EIV A;  4HCS A;  3K5N A;  1NCV A;  3L3O C;  4DAV A;  4A3G H;  4M1U B;  3X3N A;  1N36 L;  5EPL A;  2XRS D;  1ICW A;  4B9W A;  2X6G A;  4OIK A;  3W1G A;  4IO9 A;  2E2J B;  5M5X B;  1UNS A;  1O7L A;  1XWE A;  4KN7 C;  3ULL A;  1WCM H;  1FVI A;  1PZK D;  4QB4 A;  5IP9 H;  3CCR A;  2NN6 H;  1BCP C;  1M1K C;  4X3S A;  1MGS A;  3HZX A;  2EVB A;  2R3Z A;  3GTK H;  1SNQ A;  4C1N K;  4DR5 Q;  3OSO A;  2QCP X;  1CKN A;  4L63 B;  3AU7 A;  1LTB D;  4Q5V A;  5CV6 A;  1SYF A;  1TU2 B;  1DOL A;  5M5W B;  1KNA A;  1JE5 A;  3Q0A A;  1ZYR C;  5M3M B;  3E9H A;  1JOO A;  4B3M L;  2AWN A;  1F9R A;  2Y0S B;  4R1J A;  4TKO B;  2F0W A;  4GNX A;  1CTM A;  1HFG A;  1EZ8 A;  1WFQ A;  1BBU A;  3CPF A;  2UUB L;  5IGG A;  2YTY A;  4CJ1 B;  1T5X D;  2ZT9 C;  3W3A A;  4BA2 I;  2QDL A;  3MWY W;  1PDQ A;  3I73 A;  3ER0 A;  2EZV A;  4A3G G;  1NMF A;  5GAH C;  4IFD H;  1QNK A;  2DJF C;  4V19 0;  1YNN D;  3FMC A;  3AFQ A;  2Q2I A;  2UUB Q;  4A3B B;  4C3H H;  1CM9 A;  1SEB D;  1WJJ A;  3P1H A;  3IRB A;  3CQZ H;  3MXP A;  4I65 A;  5C0X J;  3BG3 A;  3I56 A;  2K1B A;  3RR5 A;  1A3U A;  3NEM A;  2J0T D;  4DR6 L;  1RDP D;  4DA2 A;  3T56 B;  1XXG A;  1TS4 A;  5IYB H;  5IT9 c;  5FO9 B;  1BBX C;  1CKO A;  1SN8 A;  3R8B A;  3NBH B;  3S1R B;  2J7Z A;  1P16 A;  2PW7 A;  4JYA Q;  4DV7 L;  4HIM A;  4O0A A;  4ZK9 B;  3BVZ A;  3D6W A;  3E5S A;  1H9J A;  2F52 A;  3L9A X;  2KCT A;  3RZO H;  4KJN A;  1V9P A;  1AW7 A;  4YCV A;  5IP9 G;  3GO5 A;  3D4D A;  4K0K L;  1LTG D;  4DFA A;  3SR1 A;  3TZD A;  4R4C A;  1P8L A;  3CME A;  4BBS B;  2ICI A;  4A93 B;  4OO1 H;  1B2T A;  4MHE A;  1E2V A;  4K8J A;  1YZ6 A;  4HJA A;  4A75 A;  1HNZ L;  4PMC A;  1DJR D;  1FJG Q;  3HOX B;  1QOH A;  1TWH H;  3WOE A;  2JYO A;  2MGS A;  4A3B H;  1SXT A;  5IGB A;  2B63 B;  5C4X G;  5IYD H;  1KAW A;  1S5F D;  4HIO A;  3E9I A;  1EOV A;  1FJG L;  5L37 A;  1AE2 A;  4KHV A;  1NNX A;  4DV5 L;  2B2U A;  3VYT A;  4IOC A;  1VQP A;  1QE6 A;  4RG1 A;  2EJF C;  2FHT A;  5TSS A;  1IW7 D;  3SGI A;  4OEM B;  5IOC A;  2WAQ E;  4JI1 Q;  3KUP A;  4C3J B;  4DUY Q;  3MZ5 A;  2QA4 A;  3MXN A;  4HED A;  1ROD A;  1SYG A;  2YV5 A;  2LSS A;  5AJ3 Q;  2VXW A;  4LF7 L;  4KHP Q;  2KA7 A;  1CT1 D;  3FP9 A;  1A6X A;  1FL0 A;  1BCP F;  1EY0 A;  1YNN C;  3EJI A;  4DR1 Q;  2CQO A;  3G6J B;  3M4P A;  1FNU A;  4G4K A;  3HOZ H;  4Z9C B;  1Y1W G;  2OXP A;  4C2M B;  1H9S B;  3PIP A;  2JA6 B;  3M3Y B;  4H13 C;  1QB5 D;  2EPB A;  3GV3 A;  2RA4 A;  5A35 A;  3VA5 A;  1EWH A;  4YCU A;  2PPB C;  2L0C A;  4JI3 Q;  1UE6 A;  1XPO A;  1A2U A;  5E1F A;  1XTD A;  3HG9 A;  2G9H D;  3T1Y Q;  1ZKO A;  4C56 C;  3HOY G;  4C3I G;  1SYD A;  3FKI G;  4FNF A;  1W3S A;  4CDD C;  3CXC A;  1R4Q B;  1X3G A;  4EVO A;  1YIT A;  5D14 A;  2BCO A;  1N34 L;  5CMD A;  1LTI D;  1HJP A;  2A19 A;  3EVQ A;  2FMC A;  1IZ6 A;  2WII B;  3BVM A;  3KJO A;  4A3K B;  3GQB A;  3MXG A;  4F8M A;  3P75 A;  3A55 A;  4JI7 L;  2RDG A;  1Q12 A;  5J22 A;  1WD0 A;  1JT8 A;  2K01 A;  3L2P A;  4A3J G;  1SE2 A;  1N32 L;  4OGQ C;  4LAA A;  3NTI A;  5JVG 3;  4GZY C;  1KDB A;  3FDT A;  4B3T L;  1YVC A;  3PO2 G;  4A3F H;  2MNA A;  4LFB L;  1RHP A;  1CFM A;  2XVS A;  4X62 L;  1RTO A;  4R4Q A;  4HCE A;  1GUG A;  2NZ1 D;  3H3V I;  4DKA C;  2XNA C;  4EQO A;  1LTR D;  2E5L Q;  2XGT A;  4NXN Q;  3K59 A;  3MEF A;  4RGO S;  1Y8O B;  4LF4 Q;  4OX9 Q;  2F0E A;  3S17 H;  1DOK A;  4FXK C;  1MSH A;  1IYV A; 
#chains in the Genus database with same CATH homology
 1YHB A;  3F2C A;  3J80 i;  2N49 A;  2YTV A;  2JK8 A;  3M9B A;  4JI7 Q;  4L5R C;  4LF7 Q;  1E7Z A;  1PYB A;  3WWV A;  1EIY B;  1YJ9 A;  1FGU A;  2R92 G;  1WOC A;  2DGY A;  3S16 H;  1XMO L;  1EIF A;  2LXJ A;  1S72 A;  2ZTC A;  3MXN B;  1E1T A;  1Q1E A;  4GKJ Q;  1X65 A;  2KHI A;  2PQA A;  4L5T A;  4JI2 L;  4DV1 L;  2BH2 A;  1OTC A;  2I0Q A;  1J5E Q;  3HOX G;  4A4I A;  5FJ8 H;  3TEH B;  1PHJ A;  2R7Z H;  4P75 A;  1VQF A;  1X55 A;  3M3Y H;  4LFB Q;  2CFM A;  4XTC S;  1BBW A;  1HNX Q;  4JI4 L;  1XNR L;  1AE3 A;  1EQQ A;  4DR4 Q;  3AQQ A;  2PMZ E;  4OON A;  1X54 A;  1GKH A;  4PZ7 A;  4UP7 A;  4DV3 L;  1VQO A;  1VQM A;  2NZH A;  4JV5 Q;  5JEA J;  3J7Z C;  4LNQ A;  4LF9 L;  4GOP B;  2L15 A;  2AKW B;  1SRO A;  4YWM A;  2I5L X;  5LMN W;  4HJ7 A;  4AQY L;  1VCI A;  4A3K G;  3BJU A;  4J15 A;  3GTG H;  4MTN A;  5J3B A;  2B3G A;  4HJ9 A;  5HGQ A;  4QL5 A;  3OTO Q;  4IJL A;  1PFS A;  4B3S L;  3H0G H;  4GN3 B;  4GOP C;  2OWO A;  1QVC A;  1GM5 A;  2JEA I;  3S2H H;  4A3L H;  1I3Q H;  4JI5 Q;  4JI5 L;  2YYZ A;  4DV4 L;  3UDI A;  3CCL A;  4UPA A;  4OWW B;  1KRT A;  1I50 H;  3HKZ E;  3A0J A;  4OX9 L;  4DR4 L;  2VL6 A;  4JI4 Q;  2GN5 A;  2YTX A;  1XNR Q;  4OWT B;  3L0O A;  5GRO A;  3HKS A;  1OXU A;  1SE8 A;  1IBK L;  3PF4 A;  3KF6 B;  2NN6 G;  2Q2U A;  2NVQ H;  2IX0 A;  3B6Y A;  4GLV B;  4DR2 Q;  2NVX H;  1J6Q A;  1Y14 B;  4BA1 I;  5IY0 A;  4JBJ A;  1PH4 A;  4JI8 Q;  2ZM6 Q;  5GAD C;  1E22 A;  1V43 A;  2OCE A;  3KJP A;  3TS2 A;  4GKJ L;  2UU9 Q;  2OQK A;  4KLK A;  1VQ8 A;  5GAG C;  2UUC Q;  4P72 A;  3GTP H;  2K5V A;  3E0E A;  4MNO A;  1KD1 C;  1IBM Q;  2HQL A;  5IE8 A;  2VNU D;  4Y52 H;  3CCS A;  4GN4 B;  1E3P A;  1K9M C;  4BXX G;  2RHS B;  1EYG A;  4DUZ Q;  2B63 H;  4JI1 L;  4JI2 Q;  2NVY H;  3CMA A;  1G51 A;  1MJE A;  5FLX c;  1Z47 A;  3K7A H;  4BBR G;  3HOW H;  3S1N H;  3GTQ H;  2C35 B;  5M3M H;  4DNI A;  4AH6 A;  3J81 i;  2K52 A;  2WB1 E;  3GTJ H;  1VQ6 A;  2ATW A;  4ME3 A;  3AFP A;  2LXK A;  1T9H A;  4NXN L;  4DV5 Q;  2ID0 A;  3CCV A;  4X65 L;  2EQS A;  4GLA C;  5M5X H;  1JB7 A;  1I5F A;  4H02 A;  3G71 A;  4DV6 L;  3T1H L;  1VQA A;  2VQE Q;  4JI0 L;  2R92 H;  4FDB A;  3OW2 A;  2VQF L;  4DUZ L;  2Z6K C;  4YWL A;  2I5H A;  3PCO B;  4GS3 A;  1U5K A;  4QJF A;  3GDE A;  4HID A;  3S1Q H;  2JJQ A;  3HOW G;  3PUV A;  4DV4 Q;  1KHI A;  4A3D G;  1X9N A;  2D0O A;  3CC7 A;  3STB C;  1Y1W H;  3NEL A;  4A3I H;  2JA7 H;  3HOV H;  1X3E A;  1TXY A;  2PQA B;  4NB3 A;  1K8G A;  4BY7 G;  4A76 A;  1HZC A;  1NE3 A;  2JA8 H;  3RZD H;  3CCQ A;  4IFD J;  1VQL A;  2K14 A;  3RNU A;  1KL9 A;  1MJC A;  2H5X A;  4JOI A;  2IHE A;  5C4J H;  3RN2 A;  2UUC L;  4BY1 H;  3I55 A;  1K8A C;  3CAM A;  1RIP A;  1JJC B;  3H15 A;  5IWA L;  1SR3 A;  2YU9 H;  1IBK Q;  3GTL H;  5LMN L;  3KDF A;  5C0X G;  1KXL A;  1HH2 P;  1N34 Q;  1PH1 A;  4JI3 L;  1I94 Q;  4DR2 L;  3PV0 A;  1PV4 A;  4TQU S;  5HY6 A;  1N33 Q;  2CWA A;  4X66 Q;  1VQ5 A;  3K7U C;  3UE1 A;  4BY7 H;  4IOA A;  1PH8 A;  3I2Z A;  5C0X I;  1L1O C;  3CCE A;  1Q86 C;  4DR1 L;  2QEX A;  1HNZ Q;  3S15 H;  5ELO A;  1G29 1;  4DK3 C;  1VQ7 A;  3HOX H;  1Y1V G;  4GNX C;  4R4I A;  4A3M G;  4PZ8 A;  2NVT H;  3CF5 A;  4AQY Q;  5C44 H;  4QY7 A;  1XNQ Q;  3M4Q A;  3G4S A;  3PUW A;  2WFW A;  5LMU L;  3HOU H;  3M7N A;  4BBS G;  4A3C H;  4JBW A;  4B3R Q;  1AH9 A;  3TRZ A;  4DV2 L;  3OTO L;  1OXS C;  1L1O B;  4DV0 L;  2VY3 A;  4P74 A;  1LM0 A;  3Q8D A;  1HZA A;  1VQD A;  1VQI A;  3TQY A;  3PF5 A;  1EQR A;  3D0F A;  1X3F A;  2HIX A;  1PH3 A;  4JI6 Q;  2N3S A;  1VS0 A;  4B3R L;  2ALY B;  3JC6 6;  3CCU A;  2HT1 A;  4YHH L;  2JA7 G;  3HOV G;  3A5Z B;  1XMQ L;  2XTI A;  1KIX A;  3DLL A;  1Q8K A;  2ZJP A;  2IT1 A;  2QGQ A;  2A1A A;  5IP7 G;  4DUY L;  2VUM G;  3S1R H;  2FXQ A;  3OYY A;  1QZG A;  3KOJ A;  5H1S E;  2WAQ G;  4IPH A;  5E7N A;  4DAY B;  5FJ8 G;  1EFW A;  4LF8 L;  1N9W A;  2R7Z G;  3A5U A;  3NEN A;  1UEB A;  1HR0 Q;  2CWP A;  1N33 L;  1OXT A;  5DLQ E;  1GD7 A;  4DV1 Q;  4P71 A;  2MO1 A;  1TWA H;  1HR0 W;  1WYD A;  4JCV E;  4GOP A;  4P73 A;  2K4K A;  1VQG A;  4YY3 Q;  2N8N A;  1LUZ A;  1WI5 A;  4PZ6 A;  2ZTD A;  4B3T Q;  5IWA Q;  1N8R C;  1HNX L;  4L5S A;  1CKM A;  1K0R A;  3ULJ A;  1VQN A;  3CC4 A;  2Y0S E;  1NBW A;  2NZO A;  3PSI A;  2N78 A;  1Q1B A;  3EIV A;  2MFI A;  4XIG S;  3GD7 A;  5IYC G;  2JA5 G;  1N32 Q;  4IPC A;  4A3E H;  4A3G H;  1JJG A;  2ZJQ A;  4DV6 Q;  3T1H Q;  1N36 L;  4LF6 L;  2UXB Q;  4QGU A;  4A93 H;  1NMG A;  1DGS A;  1YEZ A;  2DUD A;  4PG3 A;  3W1G A;  4IO9 A;  3K8A A;  1OXX K;  1CKN B;  4LF4 L;  2GVB A;  5FLM H;  2UXD Q;  4DAM A;  1MKH A;  3ULL A;  2IX1 A;  2AHO B;  1WCM H;  1FVI A;  1YJW A;  1JJ2 A;  4LF5 Q;  2HIV A;  5IP9 H;  1YI2 A;  3KF6 A;  1QVG A;  1JMC A;  3CCR A;  4X6A H;  4O2D A;  1A62 A;  4RMF A;  5M3M G;  2UUA Q;  3EN2 A;  1M1K C;  2OTJ A;  4PMW A;  3GTK H;  4DR7 L;  2Y0S G;  1SMX A;  2R6G A;  3K80 C;  4DR5 Q;  2UXD L;  4A93 G;  4A3E G;  1H95 A;  1CKN A;  1TWF H;  2UXC L;  4JYA L;  2K50 A;  2F4V L;  1Z9F A;  1N36 Q;  2E5L L;  5ELN A;  1E24 A;  4TVA B;  2I5M X;  3STB D;  1XPR A;  4LW1 A;  1JE5 A;  4KI0 A;  2F3I A;  3E9H A;  3H0G G;  4NPS A;  2R7D A;  1I6H H;  1S3O A;  4B3M L;  2AWN A;  4R1J A;  4JG2 A;  4A3K H;  2GVA A;  1S40 A;  3ULP A;  1YIJ A;  5C4X H;  5IYD G;  4GNX A;  1XPU A;  4A3B G;  4WJ4 A;  1CSP A;  1WFQ A;  1BBU A;  3CPF A;  3KLW A;  4LF8 Q;  2UUB L;  4UY8 C;  1HZ9 A;  1O7I A;  2YTY A;  4DR6 Q;  4GLX A;  3I4O A;  1B8A A;  2K75 A;  3AYH B;  1VQJ A;  1BVS A;  4LFC L;  4BA2 I;  3ER0 A;  4AYB G;  2CKZ B;  1KC8 C;  1QZH A;  4QIW E;  1NMF A;  5GAH C;  5IP7 H;  2VUM H;  4A3G G;  4DR3 Q;  1UE1 A;  4EX5 A;  2D62 A;  4L5Q A;  3DM3 A;  3AFQ A;  5C3E H;  2Q2I A;  2ZTE A;  2E8G A;  2UUB Q;  3BZK A;  4C3H H;  4JBM A;  1WJJ A;  4DV7 Q;  4DR3 L;  2JA9 A;  3CQZ H;  2D0P A;  3IRB A;  5C0X J;  1VQ9 A;  3I56 A;  2VW9 A;  3I4N H;  4IPD A;  4QQB X;  4UP8 A;  4LFA Q;  3F2D A;  3ZJY C;  1A8V A;  3RR5 A;  4DPG A;  3K81 C;  1GO3 E;  3NEM A;  3D31 A;  1PA6 A;  2HHH L;  4DR6 L;  4B3S Q;  4LFA L;  4JV5 L;  3A74 A;  5IYB H;  4A3C G;  5IT9 c;  3LGJ A;  1KQS A;  5C44 G;  4BBS H;  1CKO A;  4DV0 Q;  1K3R A;  1SN8 A;  1X6O A;  3NBH B;  1CUK A;  2IHF A;  1P16 A;  2EIF A;  1QVF A;  1PVO A;  2KHJ A;  4JYA Q;  4WJ3 M;  4DV7 L;  4HIM A;  1Q81 C;  3T1Y L;  4O0A A;  5M5Y H;  3JAM c;  4DR7 Q;  4DV3 Q;  3J81 c;  2JA6 G;  4OO1 G;  2F52 A;  3G6E A;  4ALP A;  3J80 c;  2KCT A;  3RZO H;  4NXM L;  2HHH Q;  1V9P A;  1VQ4 A;  4LWC A;  2UXC Q;  4YCV A;  1KRS A;  1B7Y B;  3GO5 A;  5IP9 G;  4AYB E;  5IYB G;  4C2M H;  4X64 Q;  2CCZ A;  4K0K L;  1LYL A;  2RCN A;  4IPG A;  3K0X A;  4R4C A;  3S1M H;  1P8L A;  3PIO A;  3CME A;  1M90 C;  1TWC H;  2OQ0 A;  1PH7 A;  1EUJ A;  4LUO A;  5AJ3 L;  1R9T H;  3HOU G;  4R4T A;  3TRE A;  4B3M Q;  1MIU A;  2E2J H;  1OXV A;  2MO0 A;  1IXR A;  2BA1 A;  2PI2 E;  2JA6 H;  5JJK A;  2RF4 A;  3U58 A;  4LUV A;  4A3I G;  1G6P A;  1YZ6 A;  4HJA A;  4A75 A;  1HNZ L;  3FKI H;  2K5N A;  1VQK A;  1FJG Q;  2VQE L;  3KDF B;  5GAE C;  1YHA A;  2PI2 A;  1TWH H;  1D7Q A;  5BR8 Q;  5BR8 L;  4A3B H;  3AEV A;  2A8V A;  2UUA L;  1QUQ B;  5C4X G;  1KAW A;  4HIO A;  5IYD H;  3E9I A;  5JJI A;  2E2H H;  1EOV A;  2UU9 L;  1FJG L;  3PO3 G;  1IL2 A;  5FLM G;  1AE2 A;  2JEB I;  3W5O A;  2BH8 A;  2RHQ B;  3U50 C;  1Y1V H;  2OTL A;  2VS1 A;  4DV5 L;  1HZB A;  1TWG H;  2R93 G;  1XJV A;  3ERS X;  3PUX A;  2Q2T A;  4OXP A;  1C9O A;  4IOC A;  1VQP A;  4RG1 A;  5C3E G;  1HR0 L;  3ICE A;  4IFD G;  1NTG A;  3UDX A;  4BXX H;  1V1Q A;  5M3F G;  3SGI A;  3VDY A;  2B63 G;  4C3I H;  5EAY A;  4Y7N H;  3HOZ G;  2WAQ E;  2E2I H;  4JI1 Q;  3TS0 A;  2VZA A;  2R93 H;  4DUY Q;  1W2B A;  4LUZ A;  2QA4 A;  1XMQ Q;  1L1O A;  4GN5 A;  1E1O A;  1GVP A;  4JI8 L;  2ZM6 L;  2YV5 A;  3M85 A;  1RL2 A;  2LSS A;  2WB1 G;  1B70 B;  5AJ3 Q;  2BA0 A;  1UE7 A;  3J81 j;  2Z0S A;  4LF7 L;  4KHP Q;  3UDF A;  3BU2 A;  4POF A;  4NXM Q;  3I4M G;  3KFU A;  3FP9 A;  2MQH A;  1LTL A;  5JEA G;  3HKZ G;  1FL0 A;  3HFZ B;  1L2F A;  4YCW A;  4X64 L;  4K0K Q;  2AWO A;  4DR1 Q;  2CQO A;  3M4P A;  1VQE A;  3I7F A;  4IJH A;  5LMU Q;  2KEN A;  3HOZ H;  4POG A;  1Q46 A;  3RLN A;  3RLO A;  4KHZ A;  1Y1W G;  1IYJ B;  3RN5 A;  4LFC Q;  1I94 L;  4A3D H;  3PGZ A;  3HOY H;  3PUZ A;  1YNX A;  3PIP A;  4HJ5 A;  1IBL Q;  1HNW Q;  1UE5 A;  5M5W H;  1K73 C;  3CCM A;  1IBM L;  1C0A A;  2Q2H A;  4C3J H;  4HIK A;  4DV2 Q;  4YCU A;  3U4V A;  4JI3 Q;  1UE6 A;  1XPO A;  4BY1 G;  1HNW L;  2EXD A;  4LF9 Q;  1XNQ L;  3U4Z A;  1XTD A;  1IBL L;  4JBK A;  1PH6 A;  1SLJ A;  4GNX B;  2NN6 I;  3T1Y Q;  3W1B A;  4BBR H;  3HOY G;  2ZJR A;  2IY5 B;  1VQB A;  3G48 A;  4MZ9 A;  1C7Y A;  3CD6 A;  1A0I A;  2PNH A;  3FKI G;  4JOI C;  4X66 L;  1W3S A;  3CXC A;  4JC0 A;  1X3G A;  5IYC H;  4HJ8 A;  1SRU A;  2JA5 H;  1EWI A;  1PH5 A;  1YIT A;  4JI6 L;  1A63 A;  4EQ5 A;  1CSQ A;  1YBY A;  2B29 A;  1N34 L;  1K83 H;  3EBE A;  3CCJ A;  3M4O H;  1HJP A;  1L0W A;  1VQH A;  1D8L A;  2R7F A;  3UE0 A;  2A19 A;  4X65 Q;  1UWV A;  5LMN Q;  1Q7Y C;  3S2D H;  2Z6K A;  4DK6 C;  2ASB A;  3PO3 H;  2KCM A;  1IZ6 A;  3CC2 A;  1J5E L;  3KJO A;  3F1Z A;  3JAM i;  3F2B A;  3S24 A;  1PH2 A;  2ES2 A;  4JI7 L;  2K5H A;  3H3V H;  3J7A 5;  5K36 G;  1Q12 A;  1VQC A;  1SFO H;  3GTO H;  3I4N G;  1Q82 C;  1JT8 A;  3BZC A;  3F8T A;  3L2P A;  4LF6 Q;  2KBN A;  2WP8 J;  4KHP L;  2UXB L;  4R4O A;  4OWX B;  4AIM A;  4A3J G;  2JQO A;  1XMO Q;  5JJL A;  1PYS B;  1N32 L;  4A3F G;  1NY4 A;  4DR5 L;  2JE6 I;  3GTM H;  5GQO A;  4YWK A;  5M3F H;  3UDG A;  4IFD I;  3L7Z C;  4GKK L;  3RLF A;  4B3T L;  1YVC A;  4A3J H;  3PO2 G;  3CP0 A;  4A3F H;  2MNA A;  4GKK Q;  1NJI C;  4LF5 L;  4LFB L;  1YHQ A;  3CPW A;  4X62 L;  1ASY A;  2V1C C;  4R4Q A;  3I4M H;  3FHW A;  4X62 Q;  1WCM G;  1BKB A;  3CW2 C;  3H3V I;  1PH9 A;  4APV A;  4DKA C;  2E5L Q;  3KYH C;  2XGT A;  1QUQ A;  4NXN Q;  3MEF A;  2F4V Q;  3S14 H;  2JA8 G;  1X56 A;  4LF4 Q;  4OX9 Q;  1ASZ A;  4A3M H;  3PO2 H;  3PUY A;  1YJN A;  2AMC B;  4YHH Q;  3S17 H;  2VQF Q;  4UP9 A;  1U0L A;  3KF8 B;  4OO1 I;  4A3L G;  4JI0 Q;  4YY3 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...