4BBSH

Structure of an initially transcribing rna polymerase ii-tfiib complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
134
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 22
structure length 134
sequence length 145
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4bbsH00
2E2HH 2EIFA 3GD7A 2QA4A 1VQKA 4LF5Q 3GTGH 4R4QA 2GVAA 4IJLA 4P75A 3GDEA 4RMFA 1K3RA 1YVCA 4YHHQ 1EIFA 2HHHQ 4A3LG 1OTCA 4KLKA 1QVFA 1HZCA 4IFDG 2R6GA 4KHZA 3CMAA 3S14H 2ID0A 2VY3A 2ZTCA 5GQOA 1EWIA 1R9TH 4A3FG 3E9IA 3S15H 3HOWH 4DR3Q 3CC2A 2UXBQ 3F2DA 2Q2IA 1HNZL 4LF7L 3CXCA 4DV4Q 2R7DA 4JBMA 1YJNA 1RL2A 2OQ0A 4DR5L 3S1RH 4OX9L 5JJKA 4GKJL 4GLAC 3IRBA 5JJLA 3CD6A 3PUWA 3S1NH 1VQMA 4APVA 4IO9A 2ZM6Q 1BKBA 4LF5L 1I6HH 2A1AA 1C7YA 3HOVH 3TREA 5IP7G 4YHHL 4NXMQ 2HHHL 1VQ5A 3GTLH 2VS1A 4JI8Q 2JA7G 4DR6Q 5FJ8H 4OO1I 3L2PA 5FLMH 2HIVA 4YCVA 5IYBH 1N9WA 3MEFA 4GOPA 4JYAQ 4IFDJ 1PVOA 2UU9Q 2GN5A 4DR3L 1L1OB 2UXBL 1PA6A 1HH2P 2NN6I 1YZ6A 4JI5L 2K50A 3PUZA 4DV4L 1KXLA 2KHIA 1VQLA 1L0WA 3JAMc 1H95A 5EAYA 1GD7A 2JE6I 2JEBI 3F8TA 4BY1H 2Y0SE 3OYYA 1SLJA 4LFAQ 1VQ7A 3HOZG 4A3DG 1KC8C 4IPCA 2UUCQ 4A3BH 2UUBQ 3TQYA 1N32Q 2F3IA 2JJQA 3DM3A 2DUDA 4JCVE 4PZ6A 4NXML 4DUYQ 2PQAA 4BXXG 4X66Q 1EYGA 3STBD 4JI8L 2WAQE 4DR6L 1L1OA 4JV5Q 3RLFA 1IZ6A 1KRSA 4L5RC 1VQEA 1TWHH 2K5NA 2YV5A 3GTPH 3CW2C 4PZ8A 4YWMA 3CC7A 1N34Q 4JYAL 4A3LH 4JI6Q 4QY7A 1QVGA 2UU9L 3I4NG 5JJIA 1CKMA 1YEZA 3OTOL 1HZ9A 1SE8A 4P74A 1XNRQ 1VQAA 4A3FH 1P8LA 3ZJYC 2E5LQ 1RIPA 4A3MH 2IT1A 1BBUA 4B3SL 1OXSC 2NVTH 4A3GH 4DR1Q 1CKNA 4LFAL 2ZJQA 4NPSA 2UUCL 2NZHA 4EX5A 1PV4A 3KJPA 3PO2G 3AFPA 2UUBL 1G291 3E0EA 4O2DA 3J81c 1X3GA 3HOWG 4QQBX 2VQFQ 4LF8Q 1N32L 3NEMA 4DUYL 4AQYL 1M1KC 4X66L 2VNUD 1U5KA 1TWCH 1AE2A 1C9OA 1YHBA 3FP9A 4YCWA 5GAGC 4H02A 3T1YQ 1IBML 4JV5L 5ELOA 1Q12A 1VQBA 1VQOA 2CQOA 1GKHA 2YTVA 2CWPA 1PH3A 5IP7H 3G4SA 4LWCA 4POFA 1FL0A 1N34L 2E8GA 3W1BA 3T1HQ 1IXRA 1UWVA 4JI6L 1WCMH 3BU2A 4B3RQ 1EQQA 3AFQA 1HNXQ 4JOIA 1XNRL 1YITA 5FLXc 1U0LA 3BZKA 2E5LL 2UXCQ 4A3CG 3J81j 1OXTA 2VW9A 4JI3Q 4DR1L 4HJ9A 4LUZA 5IYBG 3FKIH 2OCEA 4PG3A 3GTOH 1CSQA 3PUVA 4GNXB 2K52A 3PCOB 2VQFL 4LF8L 1CKOA 1SMXA 5M3FH 1PH9A 2Q2TA 1XTDA 3HOZH 4GKKQ 2UXCL 3T1YL 4A3DH 1Y14B 1XPUA 2KHJA 3F2BA 4TQUS 1LTLA 2OQKA 4LUVA 3PO3H 3CCVA 1HNZQ 1JB7A 4BXXH 1EUJA 2CWAA 5H1SE 1E24A 1A62A 3T1HL 1N8RC 1I5FA 1UEBA 1S72A 4DV1Q 3PIOA 4MZ9A 2JA9A 2AWNA 3RR5A 3UDIA 1ASZA 2MNAA 4B3RL 1HNXL 1HNWQ 1Q8KA 1EIYB 1E22A 3ULLA 3G6EA 4GNXA 1PHJA 4JI0Q 4A3IH 4JI3L 4RG1A 3HFZB 3RZOH 2LXJA 1Q1BA 3GTMH 3L0OA 1PH1A 1WJJA 4GN4B 2ASBA 1UE7A 3K7UC 1VQNA 1UE5A 4X62Q 5LMNW 1SFOH 1NTGA 1V1QA 2R93G 4GKKL 3UDXA 1LUZA 1K0RA 1I94Q 3PO2H 1Q86C 2MO1A 4A3MG 1WI5A 1Y1VH 4A3GG 4JI5Q 3M4QA 1EOVA 4UP8A 1XPRA 2NVXH 3AEVA 1K73C 3HOYG 2R92G 4R1JA 2F4VQ 4DV1L 4YWLA 2D0OA 3S16H 3H15A 1XMQQ 1KL9A 1HNWL 3I4MH 3HOXG 1IL2A 3UDGA 2L15A 4GS3A 2NVQH 2IX0A 2WB1E 3EN2A 4JI0L 5IWAQ 1YBYA 2B63H 4GN3B 2CCZA 3NENA 4WJ3M 1WFQA 4BBSG 3PUYA 5IT9c 1PH6A 4DKAC 4DV6Q 3CAMA 1IBLQ 4HIMA 5C4JH 2ZJRA 3PIPA 4LF4Q 2I0QA 3UE0A 4A3CH 1V43A 3ER0A 1WCMG 4X62L 4DNIA 1MKHA 2DGYA 3STBC 4C3JH 5GADC 3ULPA 1QZGA 1YNXA 1I94L 2I5HA 1VQ6A 2E2JH 3PF4A 4K0KQ 1XNQQ 1VQFA 1HR0W 1HZBA 3M9BA 3OTOQ 3F2CA 5IY0A 3OW2A 3KF6B 1KHIA 2CFMA 1A8VA 3CCJA 5IYCH 4GOPC 2F4VL 3FKIG 3KFUA 3M4PA 1YI2A 5IP9G 1VQ9A 2JA6G 2ZTDA 1B70B 1SN8A 1YHAA 1XMQL 1FJGQ 5GAHC 2JEAI 3CCQA 1E3PA 1A63A 5M3FG 4B3SQ 2H5XA 3TS2A 4L5QA 1JMCA 4AYBG 3FHWA 5IWAL 2ALYB 4UP7A 3U4VA 2BA1A 3Q8DA 2HIXA 3D0FA 3J80i 3PO3G 3PF5A 1UE1A 4MTNA 3G71A 3CMEA 4DV6L 4AQYQ 1IBLL 4A3EH 2E2IH 4A3KG 4LF4L 5J3BA 1GM5A 1W2BA 4HIDA 1EQRA 5M5XH 1A0IA 1EFWA 1OXUA 4DAYB 1HJPA 1KRTA 1K8GA 3LGJA 4OXPA 4QJFA 1VQ8A 4K0KL 4DV5Q 2RHSB 1PH7A 5C44G 4C3IH 1TWFH 2XGTA 1E1TA 4JC0A 4A3IG 1XNQL 3K80C 2R7ZH 3HOUG 4C3HH 4DR7Q 2R93H 3GTJH 2Z6KC 1Y1WG 1JJGA 4NXNQ 2PI2A 1IBKQ 2K4KA 5C0XG 3ERSX 4QGUA 4X64L 2UXDQ 2VZAA 1FJGL 1G6PA 1Z47A 1UE6A 1YJWA 4AH6A 2VQEQ 3U58A 2IHFA 2R92H 3HOYH 4HJ5A 4ME3A 1GO3E 2HQLA 3J7A5 5IE8A 1SROA 1PH2A 1Y1VG 2YTYA 5HY6A 3HOXH 4IFDI 3CQZH 3KDFB 1LYLA 1AH9A 1LM0A 2KCMA 3UDFA 2ES2A 1VQGA 4KHPQ 1QVCA 2JK8A 2N8NA 4BBSH 4DV7Q 4QL5A 3I4MG 1B7YB 4DV5L 4JBKA 1MJCA 4A3JG 2WFWA 2B63G 3GTKH 1VQIA 4DR7L 4AIMA 4OWWB 4HJ7A 3JAMi 5K36G 3CPFA 4L5TA 2IX1A 3I55A 4NXNL 1VQCA 4LF9Q 4R4CA 1IBKL 3RN5A 2UXDL 4XIGS 3H3VI 1MIUA 3DLLA 1NY4A 3U4ZA 3CCEA 1PH4A 2LSSA 2VUMH 4JOIC 2VQEL 3S2DH 2RCNA 3A5UA 3W1GA 5C0XJ 4OO1G 3K0XA 2AWOA 3RLOA 5IP9H 4HIKA 2JA6H 4B3MQ 1G51A 1CSPA 3S1QH 4LW1A 2VL6A 2OWOA 4LFBQ 3VDYA 2JA5H 4X6AH 1SRUA 1V9PA 3TS0A 4AYBE 5IYCG 2NN6G 4KHPL 1XJVA 4JI7Q 4DV7L 4B3TQ 2N78A 4X65Q 1JT8A 3EIVA 4O0AA 3HKZG 4A3KH 4IPHA 4BA1I 2YTXA 3F1ZA 1T9HA 4BY7G 2NZOA 4LF9L 4A3EG 4POGA 2PNHA 1FVIA 2PMZE 1PYSB 3L7ZC 1X65A 5C44H 3HOUH 3S17H 4A76A 3GO5A 3CCSA 4YCUA 1PFSA 4GNXC 1Y1WH 4LUOA 1N33Q 5C3EG 3M3YH 2V1CC 5LMUQ 4P71A 2QEXA 4OONA 4R4TA 4B3ML 4DR4Q 2BA0A 2R7ZG 4A93H 4LFBL 1QUQB 1SR3A 4DV3Q 4WJ4A 2Y0SG 2B3GA 2JA8G 3PV0A 4JBJA 4DV0Q 4JI7L 1DGSA 3AYHB 4B3TL 4X65L 1BBWA 1WOCA 1E1OA 1YHQA 1X56A 2ATWA 3CPWA 1PH8A 1NMGA 2YYZA 3A5ZB 4UY8C 3M4OH 2EQSA 5LMNQ 2EXDA 5C0XI 3KJOA 1X54A 4DK3C 4DPGA 2D0PA 4JBWA 2UUAQ 3J80c 3I2ZA 4DK6C 4A3JH 5M3MG 1QUQA 4JI1Q 1VQ4A 1N33L 2Z0SA 3I56A 2KCTA 5LMUL 4NB3A 1VQHA 2MO0A 4P72A 5JEAG 4BA2I 4DR4L 3E9HA 2R7FA 2YU9H 3BJUA 3HKSA 4DV3L 5GAEC 3TEHB 1QZHA 3CC4A 1N36Q 1VQJA 2AMCB 4DV0L 2A8VA 4GOPB 2N3SA 4DV2Q 2VUMG 1X6OA 2KENA 3JC66 3KYHC 2BH8A 1K83H 1I3QH 2CKZB 4PZ7A 2K5VA 1VQPA 1YIJA 4X64Q 5AJ3Q 2B29A 3CF5A 5LMNL 3CCUA 1KD1C 2F52A 2JA5G 3HKZE 1X3FA 3I4OA 3M85A 2OTLA 2UUAL 2HT1A 3RLNA 4A4IA 4GLXA 4JI1L 1HR0Q 3GTQH 1NE3A 1BVSA 3RZDH 2A19A 4BY7H 2RHQB 1X3EA 3NBHB 4JI4Q 2BH2A 2IHEA 4JG2A 4YY3Q 2PQAB 1I50H 1KAWA 3K8AA 2Q2UA 1J6QA 2AHOB 1O7IA 2MQHA 3KF6A 4DUZQ 3I7FA 2ZTEA 3D31A 5C4XG 3KLWA 1X55A 5C3EH 1M90C 4HJAA 4P73A 1L1OC 5JEAJ 1N36L 4IOAA 5GROA 3EBEA 1S3OA 1WYDA 4DV2L 3W5OA 1NBWA 3SGIA 4BBRH 5IYDH 3H0GG 1Q1EA 4LNQA 4MNOA 2XTIA 4JI2Q 3RNUA 2JA8H 3ULJA 3G48A 2K75A 4ALPA 2ZM6L 5AJ3L 4GN5A 4QIWE 4DR2Q 4A93G 4UP9A 4OWXB 2WP8J 2I5MX 2JQOA 1J5EQ 1OXXK 1TXYA 1CKNB 3RN2A 3PGZA 1HR0L 4OWTB 1Q82C 4IPGA 1Z9FA 4JI4L 1K8AC 3U50C 4YY3L 2AKWB 1Q7YC 2Z6KA 3KOJA 1YJ9A 4L5SA 5M3MH 1W3SA 4DUZL 4IJHA 4UPAA 4PMWA 3MXNB 3K7AH 1C0AA 1D8LA 1NMFA 3CCMA 4LFCQ 1VS0A 5BR8Q 3CCLA 4LF6Q 4DAMA 4JI2L 4HIOA 4KI0A 3S2HH 1Q81C 3S24A 4DR2L 4C2MH 3UE1A 3KDFA 1VCIA 3PUXA 4FDBA 1J5EL 2I5LX 2MFIA 3H3VH 3ICEA 4GLVB 4A75A 1E7ZA 2OTJA 2Q2HA 5M5YH 1X9NA 1OXVA 2KBNA 4TVAB 2GVBA 1D7QA 2N49A 2RF4A 2WB1G 2JA7H 1XMOQ 3S1MH 1NJIC 3HOVG 1JE5A 1GVPA 5HGQA 1XPOA 4LFCL 4R4IA 1PH5A 5BR8L 2K14A 3J7ZC 4R4OA 2NVYH 4LF6L 3CP0A 1IBMQ 1L2FA 5FJ8G 2FXQA 5C4XH 1PYBA 5FLMG 1B8AA 4YWKA 2QGQA 1KIXA 1JJ2A 1ASYA 1VQDA 1CUKA 1HZAA 1S40A 3A74A 3K81C 4Y52H 1MJEA 3H0GH 5E7NA 3NELA 2K5HA 5ELNA 3PSIA 1P16A 1TWGH 5M5WH 3A0JA 3J81i 2ZJPA 4IOCA 1K9MC 3KF8B 3TRZA 1JJCB 3BZCA 3WWVA 1KQSA 3B6YA 4EQ5A 4BBRG 2D62A 5IYDG 4BY1G 4IPDA 4LF7Q 3M7NA 1IYJB 4A3BG 2PI2E 2IY5B 1TWAH 1XMOL 4J15A 3CCRA 1FGUA 2C35B 4DR5Q 4OX9Q 3AQQA 4GKJQ 1AE3A 2LXKA 4XTCS 5DLQE 4Y7NH 4HJ8A 1Q46A 2WAQG 3I4NH
chains in the Genus database with same CATH superfamily
2E2HH 2EIFA 2R61A 2GVAA 4XDXA 3KF8A 2HHHQ 1EIFA 2M00A 1KLGD 4KLKA 3KLRA 4IFDG 1HZCA 1HTPA 1H9SB 1IW7D 5ELCA 1C8CA 3VR5A 3CC2A 4LF7L 4NW2A 2N88A 3FVQA 1YJNA 2JA6B 5EBDA 1C4QA 1JC7A 3IRBA 4U68A 5JJLA 4CBVA 4APVA 1BKBA 3GV6A 2A1AA 3HOVH 2EY2A 3TREA 1VQ5A 1K8OA 3U9SA 4X3SA 3TZDA 1JCKB 1U4LA 3MEFA 4GOPA 1PVOA 5C44B 2UU9Q 2GN5A 4DR3L 1L1OB 2PMZB 3S9WA 1GUOA 2NN6I 1IHZA 3A8KE 5ELEA 1H95A 1WTWA 2JE6I 2E76C 1PTOD 2F0OA 4C1NK 2Y0SE 3OYYA 1SLJA 1VQ7A 4IPCA 1N32Q 1GHJA 3DM3A 2JJQA 2F0GA 4PZ6A 2F0IA 2NVXB 4NXML 4BXXG 4KY5A 2WAQE 1L1OA 1IZ6A 2K03A 5I9PA 1ZEQX 2YV5A 2ICEC 4U673 1N34Q 5CV9A 2F0FA 5JJIA 1CKMA 1YEZA 3R8BA 1HZ9A 2CHBD 4P74A 2J0TD 3Q24A 2FINB 4A3GH 4DR1Q 1HXYD 1CKNA 4EX5A 1S5BD 2K5WA 4FXGC 2KECA 2DY8A 2E2JB 3I70A 2VQFQ 3NEMA 3PIP3 2Z9HA 2VNUD 1AE2A 1C9OA 3IFDA 1WTXA 2O5IC 1Q12A 2CQOA 2YTVA 1LACA 3MXNA 5IP7H 3HRZC 4LWCA 2NB0A 3HKZB 2L0CA 3T1HQ 4JI6L 1QG7A 4DNRB 3BU2A 2KVMA 4MTKA 4B3RQ 4FYDA 1PRTC 2E2IB 1HTLD 1YITA 4A3EB 1DOLA 1LT3D 2E5LL 2SNSA 1CQVA 3J81j 1XYIA 4A3CG 1Z6HA 2OCEA 4GNXB 1SNMA 3TBIB 2KQ3A 2R93B 1PH9A 2UXCL 3T1YL 1BOSA 4A3DH 1V8QA 3F2BA 1LTLA 2OQKA 1CTMA 3SK5A 2CWAA 5H1SE 1E24A 1UEBA 1TY2A 4MZ9A 1HNWQ 1EIYB 3VYUA 4GNXA 5A2QE 1X3QA 4PMCA 4JI3L 1B9NA 3HFZB 1LT6D 1PH1A 1WJJA 2SDFA 1UE7A 4RGMA 4HAEA 1V1QA 4GKKL 1K0RA 5D3DA 1ENCA 1I4HA 5IGCA 4RA8A 1Y1VH 4A3GG 4R1JA 1VMCA 2D0OA 3S16H 5I4DA 3H15A 3SK6A 4GS3A 1Q3LA 2RBMA 5IWAQ 5EBCA 3I91A 3BG3A 4GN3B 4RFBA 1A3VA 3AMUA 4BBSG 1PH6A 2RDHA 2OF1A 3PIPA 2SOBA 3WDNA 4XXEA 3UE0A 4LF4Q 3ULPA 4C3JH 1VQ6A 3HZXA 4N8FA 3SVMA 1VQFA 3T56B 3M9BA 4OHJA 3KF6B 1A8VA 5IYCH 2F4VL 3KFUA 1TU2B 3M4PA 4CDFC 1YI2A 1B70B 1SN8A 3DUZA 2JEAI 4A93B 1E3PA 5JPMC 4NKLA 4AYBG 3NPPA 2BA1A 1EQTA 3PF5A 4MTNA 1IBLL 1EYAA 4R8IA 4A3KG 5J3BA 2F0UA 5IGGA 1W2BA 1L0XB 2E2HB 3ITPA 5CV6A 1SJHD 4DAYB 1KDCA 3LGJA 4K0KL 4BS9A 1E1TA 2R7ZH 1JJGA 3FMCA 1IBKQ 3ERSX 2YU9B 1Z47A 2R92H 2IHFA 3W2DA 2PCFB 4K14A 2B2WA 1GO3E 4DAYA 1W6KA 2HQLA 1SROA 2L11A 1Y1VG 5HY6A 4IFDI 3CQZH 4N9PA 3BVGA 1IKLA 1LM0A 1VQGA 5FOBB 4FO2A 4DV7Q 1CA6A 5J22A 4DV5L 4FF3A 1MJCA 1VQIA 4AIMA 4OWWB 1AN8A 3RZDB 4BY7B 1F9RA 4L5TA 3I55A 2IX1A 4R4CA 1LTGD 3RN5A 3C2PA 1I50B 1BQQT 3CCEA 1NY4A 3S2DH 4JOIC 5BN3A 1DD2A 3EQLC 1EYCA 1U9RA 5LL6S 4CHTB 5CV7A 4TRDA 5E4XA 3DWQA 3J7AF 2O5JC 1SRUA 3TS0A 1ZYRC 5IYCG 4KHPL 2EE1A 4IUQA 3UI2A 2H4OA 3NE5B 2F0KA 2HDLA 4BA1I 4ILWA 3NP8A 3F1ZA 4X3UA 5FKAC 1LTID 1CHPD 1TIID 3CRKC 3JAML 2PNHA 2A74C 1FVIA 3HOUH 3S17H 2XNAC 4YCUA 1PFSA 4JVZA 3M3YH 5LMUQ 4R4TA 5D65A 2R7ZG 1PFMA 1SR3A 2B2UA 3Q22A 1SYFA 4DV3Q 3OMCA 2D9UA 2JA8G 3SE0A 3AYHB 4B3TL 1STBA 3PQIA 4KN4C 4X65L 1BBWA 4CDDC 3A5ZB 3J7YW 1K0SA 2L55A 3KJOA 2MHVA 4JBWA 2UUAQ 3J80c 3I2ZA 4A3JH 2JA7B 5K36H 1BUVT 3NWSA 2ZXRA 4O42A 4P72A 2IJ0A 4KHVA 3J81L 4DN4M 1BNZA 3H91A 4KJNA 1MI2A 5CR3A 2G9DA 5DM73 2L5TA 2ICIA 1EU4A 2NN6H 2QF7A 1I3QH 1VQPA 2B29A 5LMNL 1QE6A 2F52A 1X3FA 3I4OA 5IIFA 4KY6A 5FLXL 1WD0A 4GLXA 1TWAB 5CBAE 2RHQB 1X3EA 2IHEA 1JWSD 1KAWA 1J6QA 2AHOB 3I4NB 5CGKA 4QUFA 4DUZQ 3D31A 2EY6A 5C4XG 4HJAA 1BCPD 1V1PB 1E2VA 5JPNC 3SGIA 1Q1EA 2G5DA 3ERQA 3RNUA 4JI2Q 1FNVA 2K75A 3G48A 5AJ3L 3FDTA 4QIWE 3QOLA 3SEBA 2WP8J 2K7VA 4K5XA 3PMFA 1OXXK 4DFAA 1TXYA 5I6WA 1PZKD 5EPLA 4JI4L 3NBIA 1ESFA 1V1PA 4YY3L 1Q7YC 1G8ZD 5I6YA 5M3MH 1I6HB 4IJHA 3T16A 4HSPA 3V2TA 4PMWA 1D8LA 4KTAA 4K5WA 4LFCQ 2FMMA 4QF4A 4LF6Q 1WTPA 4DAMA 1TY0A 1Q81C 3S24A 3VR3A 3KDFA 4FDBA 3H3VH 2MFIA 1LT5D 4A75A 3NXWA 3QOJA 2Z1CA 3TP6A 1NJIC 1JE5A 1BDOA 4OIKA 1GUGA 3ZYYX 1ZXTA 4L6TB 2CVRA 4DAPA 5BR8L 4CJ0B 3J7ZC 1B1ZA 2K5DA 1IBMQ 2EYOA 1A3UA 2FXQA 3EVQA 4PV1C 3V96A 5FLMG 4YWKA 3A7LA 3K5LA 1Z7TA 1HZAA 3K81C 2KCNA 3NQIA 1CM9A 3VA5A 2K5HA 1TWGH 1H9RA 3J81i 1F2MA 5K5PA 1YNJD 1F77A 2HDMA 3D4RA 4IPDA 2RCFA 1PRTD 2P5ZX 3SK8A 5IGFA 1OO9B 4DR5Q 1ML0D 4OX9Q 1AE3A 2K32A 2QW7A 2EXZA 5DLQE 3E0JA 4EVOA 2WAQG 2QA4A 4LF5Q 3M7GA 4KK7A 4P75A 4YHHQ 2B2VC 2MPMA 1QVFA 1EY9A 4KHZA 4XQQA 1VDZA 3S14H 1SDFA 3K5OA 5GQOA 1EWHA 1EWIA 2WINB 5DEHA 4K2KA 3S15H 4I7ZC 3HOWH 2UXBQ 4H44C 4WFN3 2M9VA 4M1UB 2JYOA 2R7DA 3O13A 2IX3A 1JOQA 2OQ0A 3K59A 3G6JB 4GLAC 3E3XA 3KBGA 2ZM6Q 2FFKB 1BR9A 1EQVA 2CH4W 3GTLH 4LAAA 3LX0A 4JI8Q 3L2PA 4YCVA 4F88A 1N9WA 3GV3A 5A2QL 1X3PA 4A3IB 1BO0A 4ZUJA 4DV4L 2KHIA 1VQLA 1RDPD 2BDNA 3PIO3 2E74C 1EY6A 4BY1H 1SFOB 3D6WA 1B50A 3HOZG 2UUCQ 4A3BH 2EPBA 2F3IA 1F9QA 1LABA 1TVXA 4XT3B 3KUPA 4X66Q 1EYGA 1D5XC 4DR6L 3RLFA 2EDGA 2EYPA 1VQEA 1TWHH 2NUCA 4EQPA 2K5NA 4RWSC 1AFPA 4RAUC 4YWMA 3CC7A 4JYAL 1QVGA 4IFDH 2PQEA 1SBBB 4V190 4G7HC 3KK7A 3Q6SA 1XNRQ 4G7ZC 5C4JB 2NTTA 1P8LA 4S3SA 1GHKA 4A3MH 1BBUA 1ILQA 2FMCA 3EROA 4LFAL 1CQFA 2NZHA 1PV4A 3KJPA 2UUBL 4F7XA 3ND8A 3HOWG 2B2YC 4QQBX 2NBFA 3K5MA 4LF8Q 2BE5C 4DUYL 2KOLA 1KNEA 1TWCH 3FP9A 4YCWA 4JV5L 1SE2A 5ELOA 3MHBA 3G4SA 4B9WA 3MXUA 2E8GA 3C1EA 2RDGA 3W1BA 1IXRA 5KNCA 1WCMH 1PTOF 3N52A 1EQQA 3AFQA 5J1ZA 2ENBA 2XRQD 1OXTA 1I4PA 4HJ9A 4E6IA 1NR2A 3FKIH 3GTOH 1CSQA 2EJFC 3PUVA 2K52A 3PCOB 3NK9A 4ABNA 4K8IA 2F0EA 5M3FH 2F0VA 5KNDA 4QMGA 3VR6A 1Y14B 1WD1A 1XPUA 1O7ZA 4TQUS 2RA4A 4LUVA 3PO3H 3CCVA 4BXXH 1JB7A 2X6LA 3HOYB 1S72A 3PIOA 2JA9A 3DWPA 2KA7A 1HNXL 4ZCKA 2AQ3B 4MHEA 1B3AA 1PHJA 4JI0Q 5D3IB 5LHY1 3Q0AA 4RG1A 3RZOH 2HQEA 3GTMH 4R8NA 1ZYRD 2NYZD 1AP0A 3NSWA 3WOFA 3GTKB 1VQNA 1I4RA 1UE5A 5LMNW 2R93G 1LUZA 2F0SA 2X6GA 4IZ8A 2MO1A 3BZDB 2F3VA 4A3MG 1WI5A 3N6RA 4JI5Q 4EQOA 2VUMB 4I7AA 4K5VA 1JOKA 2SEBD 4DV1L 1XMQQ 1KL9A 3I4MH 1BCPC 1WTVA 3UDGA 2NVQH 2IX0A 1YBYA 1H9SA 3E5SA 2B63H 3AU7A 1W6JA 2PZTA 5IT9c 4DK1A 2ZJRA 2I0QA 4A3CH 3MC0B 3ER0A 1WCMG 4X62L 3I8ZA 2Q8TA 1NUCA 2C9OA 5I2XA 3STBC 5FO9B 5GADC 3LWUA 4FXKC 1I94L 2I5HA 3PF4A 1XNQQ 1HZBA 3OTOQ 3F2CA 2CFMA 3CCJA 1LLRD 1Y1WB 3QG1A 3FKIG 5IP9G 1FJGQ 1A63A 5KRUA 5M3FG 2H5XA 2B8FA 2VB2X 4ZAIA 5DM63 2WKDA 3TS2A 3FHWA 2ALYB 1SJED 3I73A 4FF1A 3D0FA 4CDEC 1DM0B 3PO3G 1UE1A 1EWCA 4ZKCB 3G71A 1K28A 4DV6L 4AQYQ 4KY7A 4UAIA 1AZPA 1EFWA 1B9MA 1DYQA 1KRTA 2A68C 4RGTA 1VQ8A 1PH7A 4C3IH 2GA4B 4DR7Q 4C3HH 1NSNS 3DEOA 2Z6KC 5CC4A 3GTJH 1SYGA 3A54A 4NXNQ 2K4KA 2PNRC 2VQEQ 1GUSA 1HUNA 1CZWA 5IE8A 2CW0C 3BDLA 1I4QA 1Q8IA 3DEPA 2PYKA 1QVCA 4BBSH 3I4MG 5IOCA 3DWAA 1YNJC 3GTLB 1NAPA 3GTQB 2B63G 2L12A 1SNOA 4HJ7A 1VQCA 1U4PA 5JJZA 2UXDL 4XIGS 3H3VI 1MIUA 3VA7A 3RUZA 4NP5A 3NTIA 1PH4A 2KEEA 1QILA 1F9PA 5C3EB 1JB3A 3W1GA 5C0XJ 2AWOA 3S1QH 4BBRB 3VDYA 2JA5H 4BY1B 2DN8A 4J6HA 1HHVA 4A3BB 1XJVA 4F87A 4LK1C 1NR4A 2IW3A 2N78A 2KJXA 1ENFA 2A73B 4CKBA 1JT8A 4O0AA 4Z9CB 3R2TA 4HMIA 4A3KH 4IPHA 2YTXA 5G3LF 1JE4A 4BY7G 2NZOA 4RCOA 4LF9L 1EY4A 2PMZE 4ZRZA 3K58A 3CCSA 1QNUA 3K7AB 3U9OA 4B3ML 4C3IG 4DR4Q 2BA0A 4LFBL 4C3HG 2PZUA 2TMPA 2B3GA 3PV0A 3S2HB 4JBJA 4JI7L 4HN7A 3QJYA 3SR1A 2WV6D 1WOCA 1X56A 3CPWA 4F8MA 1S5FD 1BCPB 1IKMA 1K8MA 1NMGA 5M5YB 4UY8C 5JAVA 5FO8B 5C0XI 4JK1C 4FNFA 2O4XA 1EY5A 2EY5A 4JI1Q 1N33L 3I56A 4DAVA 3R2IA 2HCCA 4BA2I 1JWMD 1HCZA 1ICWA 5AFWA 2EYLA 4HR7B 4M8AA 2M2LA 4DV0L 2AMCB 2ZXPA 2A8VA 1RTOA 2A5HA 1C48A 1X6OA 2KENA 1EY8A 1T5XD 3JC66 3KYHC 2RDFA 1K83H 2IWHA 2K5VA 1VMPA 1KD1C 1B53A 2JA5G 3HKZE 1XX8A 2OTLA 4RHRA 4A4IA 1XWEA 4OL7A 1NE3A 1SYEA 2BOSA 3J7AV 1R4PB 2PQAB 3K8AA 2MQHA 3KF6A 3KLWA 1X55A 1M90C 1MHWC 5JEAJ 1N36L 5GROA 3EBEA 1S3OA 1WYDA 4DV2L 3W5OA 5HURA 3H0GG 1ESRA 2JA8H 2OXPA 4ALPA 2KUMA 2ZM6L 4DR2Q 4OWXB 4WRDA 1EYDA 2MP1A 1J5EQ 3RN2A 1HR0L 4FF4A 1G2TA 4OWTB 3U50C 2Z6KA 4CJ1B 4FVMA 4L5SA 2WB1B 3HOVB 5EPKA 3HEJA 1FNUA 3VYRA 1C0AA 1NMFA 1PRTB 3VYTA 5C4HA 3CCMA 1UNSA 5ISRA 4KI0A 3L3OC 3KLSA 4C2MH 3NTKA 3C3LA 3NWTA 3ICEA 5JVH3 1LTRD 2Z4IA 4CJ2C 3P75A 2QDBA 1HA5A 4TVAB 1PTOH 5FO7B 2N49A 2RF4A 4RGOS 3S1MH 1QB5D 1XPOA 4G4KA 1PH5A 2NVYH 1L2FA 5FJ8G 3I4LA 4JPBW 5C4XH 2BE5D 4IUVA 4K2LA 2F0LA 2ZJPA 3PSIA 5M5WH 1K9MC 1J8IA 2G9HD 3WWVA 5DNFA 4EQ5A 2D62A 4A3GB 4WJWA 4LF7Q 4H7BA 3G7LA 2R3ZA 1QJOA 2IY5B 1XMOL 4J1MA 1FGUA 5L37A 3AQQA 1E2ZA 2LXKA 4OEMB 4Y7NH 4HJ8A 5CYUA 3GTGH 4R4QA 4IJLA 3MFYA 4RMFA 3OWFA 1YVCA 4A3LG 1MSHA 1OTCA 2JN4A 2R6GA 3TZUA 5IODA 3A8JE 1I4XA 2ID0A 2VY3A 2ZTCA 3SXHA 1DONA 3D6CA 1R9TH 4A3FG 3E9IA 4DR3Q 5EGTA 3AB9A 3F2DA 1BBXC 1EEFD 2Q2IA 1STNA 2KEDA 3K0YA 4ULLA 1STEA 3MXGA 3C46A 2RVLA 3S1RH 5JJKA 4GKJL 1EZ6A 3S1NH 1VQMA 4IO9A 4AYBB 2EVBA 4A3DB 2F1MA 1C7YA 2EJGC 4DXGA 5NUCA 4NXMQ 2HHHL 4NMZA 5FLMH 4TKOB 2HIVA 3LNNA 5IYBH 4L8JA 4K6LA 2A69C 3BVZA 3DXJC 1EIHA 1QCBD 4JI5L 2K50A 1KXLA 3CRLC 2XVSA 1L0WA 1SYBA 3JAMc 5EAYA 1GD7A 2JEBI 3VR4A 1PYWD 1Y69U 3FPPA 4HCEA 1SYCA 1PDQA 4DK0A 2DUDA 1Y1VB 4JCVE 3MZ5A 3STBD 1HQMC 3D4DA 3GP7A 3S16B 5EPJA 1T5EA 3GTPH 4PZ8A 1D2BA 3BYTB 2AQ1B 4JI6Q 2F4IA 4QY7A 2UU9L 2EYFA 4G7OC 3OTOL 1B2TA 3K6OA 1B3QA 1RODA 1ZKOA 1CA5A 2CQAA 4OIJA 4DGZA 4DA2A 2E5LQ 1OXSC 2V4DA 2NVTH 2ZJQA 4C3JB 3A8IE 3PO2G 1N32L 3J81c 2PW5A 1ILPA 3IAYA 4EQNA 1LTAD 4AQYL 1M1KC 1U5KA 2UXCQ 4CDCC 2A68D 5GAGC 3T1YQ 1JR0D 2CWPA 2CH4A 2F03A 2DNEA 4POFA 1N34L 2L4NA 1UWVA 4ME5A 1RCVD 3CU7A 2RQXA 1CK1A 2SNMA 2QCPX 4JOIA 5FLXc 3BZKA 1EOTA 2VW9A 4JI3Q 2H1EA 4DR1L 1E0BA 2CW0D 4LUZA 5IYBG 1A6XA 4PG3A 2VQFL 2XWJB 1DXMA 1CKOA 1IYUA 2DJFC 2R7ZB 1GJXA 5IGDA 2B2TC 3HOZH 4GKKQ 1TT2A 2JA8B 2ZXOA 5LL6X 3ONAB 1HNZQ 1EUJA 2R92B 3T1HL 4CKCA 1N8RC 1HQRD 5ELBA 5C5MA 3SHLA 3Q23A 2AWNA 1ASZA 4B3RL 3KBXA 2MNAA 1G6ZA 1Q8KA 3CQZB 3OWEB 1E22A 3GQBA 3G6EA 2NWGA 2LXJA 4H0LC 2K1BA 4K6DA 3L0OA 5C0XH 4GN4B 2ASBA 1S5DD 3K7UC 2WKCA 4HTHA 4LMQD 5C5LA 3RD4A 1Q86C 2AUJD 1XTCD 3S2DB 3M4QA 1EOVA 1O78A 3ND9A 4UP8A 2NVXH 4Q0FA 1K73C 3HOYG 1CHQD 3CKIB 3OSOA 2F4VQ 3QB3A 3IL8A 2BCOA 2DY7A 1G2SA 4HMJA 2EJMA 1D1IA 3H3VC 1AEXA 1HA6A 1EIGA 1HNWL 4ZYSA 3HOXG 4QCLA 1IL2A 5KGUA 2L15A 2CCZA 2WACA 1WFQA 1E2WA 3T51B 4DKAC 2XIWA 3CAMA 1IBLQ 4HIMA 3OHXC 2PPBC 1V43A 4DNIA 1MKHA 4H13C 1G6PA 1YNXA 4K0KQ 2E2JH 1HR0W 3HOUB 3S17B 3NHHA 1IYVA 3OW2A 1D5MC 3H09A 4GOPC 3M3YB 3J80E 1VQ9A 2JA6G 1Y8NB 1YHAA 3CCQA 4B3SQ 1JMCA 2RSOA 3FEWX 5IWAL 2N55A 2IPKD 5T1IA 2E2IH 4A3EH 1STAA 4LF4L 1ET6A 1GM5A 1EQRA 5M5XH 3A55A 3A7AB 1HJPA 5EJWA 1STGA 2AUKA 4QJFA 5ELFA 4DV5Q 2RHSB 1PXUA 1II3A 5C44G 1TWFH 2X69A 2XGTA 1XXGA 4JC0A 5EKLA 3K80C 4A3JB 2R93H 2EY1A 1Y1WG 3QR8A 3P1HA 4XT1B 2PI2A 5C0XG 4QGUA 2PZWA 1R9TB 2VZAA 1UE6A 3HGBA 2F0DA 1YJWA 4AH6A 1SSOA 5D14A 3TP7A 2Z6BA 3J7A5 2YTYA 1MSGA 1LYLA 3JAME 2KCMA 4ZUIA 1I3QB 4KHPQ 4QL5A 3WOEA 1QOHA 4JBKA 3DHQA 1G91A 1A15A 4L63B 3MWYW 3TSSA 3BS1A 1IBKL 1KAAA 1YNNC 3DLLA 3U4ZA 2LSSA 5E1FA 3A5UA 4OO1G 3K0XA 2F0HA 5IP9H 4HIKA 1G51A 1CSPA 4LW1A 2VL6A 2OWOA 2L1BA 1ENAA 4X6AH 1V9PA 2Y0SB 4IUTA 4ODGA 4N8X1 4DV7L 4B3TQ 4X65Q 3EIVA 3HKZG 2LS01 1KLUD 3D3RA 2WAQB 1AW7A 4A3EG 3L7ZC 1PYSB 1X65A 5M3MB 4IN3A 1TS3A 1LO5D 3W3AA 2QDLA 4GNXC 1L0YB 1TR5A 2QKIC 4LUOA 5C3EG 2V1CC 4A93H 1QUQB 4R9WA 2NVTB 5EKKA 1UAPA 5C3WA 5FLXE 3MXPA 1FYCA 1DGSA 3T53B 1F2ZA 1YHQA 1E1OA 1PH8A 5A35A 2B2VA 3M4OH 2EQSA 5LMNQ 1X54A 2D0PA 4PMBA 4BWGB 4DK6C 3HP3A 5COYA 1QUQA 1VQ4A 2KCTA 1H9KA 5LMUL 1VQHA 4NDXA 1U4MA 2MO0A 3HG9A 5JEAG 2B39A 2C5CA 3MEHA 2YU9H 3HKSA 2B8GA 4DV3L 5GAEC 3TEHB 2J4XA 3CC4A 2F0PA 3D8GA 4GOPB 1ET9A 2N3SA 1K3BC 1NNXA 2Q8IB 1TWGB 2BH8A 3HOZB 5CV4A 1O7YA 1YIJA 4X64Q 5AJ3Q 3CF5A 2LFNA 3M85A 2UUAL 1M8AA 4BY7H 3RZDH 3K57A 4JI4Q 2BH2A 4JG2A 4YY3Q 1I50H 1O7IA 2F0QA 2ZTEA 3OMGA 2O2LD 3MAQA 3SDZA 2EYMA 4IOAA 1NBWA 5IYDH 3S14B 4LNQA 4MNOA 4GN5A 3S15B 3HOWB 4A93G 1EEID 2E2DC 4UP9A 1NCVA 2I5MX 2MUYA 2JQOA 1CKNB 4X3TA 1GXDC 2A69D 4IPGA 3BYYB 2XRSD 2AKWB 2OEOA 2B2WC 3KOJA 1YJ9A 1W3SA 3HS0C 4DUZL 5CBEE 5E3FA 4B08A 2WIIB 3MXNB 1PFNA 5BR8Q 1RTNA 3CCLA 4I65A 1CT1D 4IALA 2B2YA 2F3WA 4JI2L 3IFTA 1WTQA 1BF4A 4CGYB 1SAPA 2I5LX 1F9SA 2OTJA 1X9NA 2KBNA 3A56A 1D7QA 1LT4D 5I9OA 4FP5D 2WB1G 2JA7H 3EJIA 3MVVA 5KYLA 3HOVG 4ZK9B 5HGQA 2J7ZA 4LFCL 5C4ZA 4RKLA 4LF6L 3CP0A 5M5XB 5C3XA 1PYBA 1TWHB 1ASYA 1CUKA 1S40A 3I90A 1TWFB 4Y52H 3H0GH 5E7NA 3NELA 5ELNA 4IOCA 2PO4A 3TRZA 3P20A 1JJCB 3NQTA 1KQSA 1FR3A 3B6YA 5IYDG 4A3MB 3OW7A 4WORA 4DXFA 3KLSX 4DNTB 1TWAH 2MGSA 2B2UC 3CCRA 4OGQC 5BN5A 1RD9D 2I07B 3QWNA 1TWCB 2KCCA 4FXDA 1D6EC 1Q46A 1IBML 3I4NH 1VQKA 3GD7A 4HEDA 5F2DA 2A6HC 3GDEA 1K3RA 1FD7D 1A2UA 3TDQA 2PW7A 1CI3M 5FK9C 1WCMB 5KEEA 1DCZA 1KTKA 3CMAA 2HCIA 4EGVA 4XQNA 1PFBA 1HNZL 3CXCA 4DV4Q 4KV6A 2RSNA 3FKIB 1LV9A 4JBMA 3GTOB 1RL2A 1B44D 1TKWB 3I3CA 4DR5L 4OX9L 4KKUA 5M3FB 5BN4A 3CD6A 3PUWA 1JICA 5KIXA 4LF5L 3M4YA 5CV5A 1MGSA 3TMEA 1AZQA 1I6HH 1DZ1A 3PO3B 1IL8A 5IP7G 4KKSA 4YHHL 2VS1A 2JA7G 4DR6Q 5FJ8H 4MIUA 4OO1I 1GUWA 1TS2A 4HCSA 5KNBA 2JSOA 3FRPB 4RHSA 4JYAQ 4IFDJ 4KN7C 2UXBL 1PA6A 3RZOB 1HH2P 3H94A 1YZ6A 1SMYC 3PUZA 3GTMB 1HRJA 2RKSA 4QUCA 3F8TA 3QO2A 2K05A 2F0NA 1B4OA 4V0BA 2A6EC 5CV8A 5IT9E 3VYSA 4LFAQ 1PZJD 4UDUC 1D5ZC 1KC8C 4A3DG 2UUBQ 3TQYA 4DUYQ 2PQAA 3VR2A 4JI8L 5HGTA 1U4RA 4JV5Q 1KRSA 4L5RC 3URYA 3M4OB 3I4MB 3CW2C 4RH6A 3BVMA 4A3LH 2NVQB 3I4NG 2B63B 1SE8A 1VQAA 1BXTA 5G3LD 3TN2A 4A3FH 3ZJYC 1RIPA 2IT1A 4B3SL 4NPSA 2UUCL 3AFPA 1G291 1EY0A 2TSSA 3E0EA 1X3GA 4O2DA 2QEJC 4X66L 3J80L 1YHBA 4H02A 2LKVA 1VQBA 1VQOA 1GKHA 1PH3A 2D5DA 1KDAA 2XN9C 1FL0A 1SNQA 1BCPF 4UHVA 2HD3A 4PQXA 4HSVA 1S5ED 1HNXQ 1XNRL 1Q90A 1U0LA 4N9TA 4B9XA 1MBYA 1GUNA 4Q5VA 1KABA 4C3JG 5M9OA 3X3MA 4C3IB 4LF8L 3SK4A 1KNAA 1SMXA 4C3HB 2Q2TA 3GTJB 1XTDA 4G57A 4J8QA 2I46A 1J9OA 2KHJA 1IW7C 3LWEA 4QIWB 5J39A 1STHA 1RKNA 3T4AC 1A62A 1I5FA 1YNND 4DV1Q 1I6VC 3RR5A 3UDIA 1RJTA 2VXWA 1DOMA 3ULLA 2JXMB 4XQJA 4A3IH 4BBSB 1DOKA 1Q1BA 2K01A 2Z8LA 1SNDA 5TSSA 4X62Q 1SFOH 1NTGA 1WTRA 3UDXA 1KDBA 1I94Q 3PO2H 3OIPA 1XPRA 3AEVA 2R92G 1RF2D 1TS4A 4YWLA 1QNKA 3S1QB 4P2CB 2JA5B 3BDOA 1JORA 2WB1E 3EN2A 3I72A 4JI0L 5EKIA 1PTOC 5I2YA 3NENA 4WJ3M 3MA2B 3PUYA 4DV6Q 4A3KB 5C4JH 4ZLTF 4IUUA 2E75C 2DGYA 1PRTF 1QZGA 4ZKBB 1Y8OB 2XWBB 5IY0A 3H0GB 4RGNA 1KHIA 1A2TA 4DU9A 2F0TA 2ZTDA 1XMQL 1JWUD 5GAHC 2ZT9C 4IURA 4L5QA 4UP7A 3U4VA 2D2CC 3Q8DA 1CZGA 2HIXA 3J80i 3CMEA 1CFMA 5IGBA 4HIDA 1A0IA 2K04A 1OXUA 2XSCA 1SE4A 1K8GA 4OXPA 3QIAA 1XNQL 4A3IG 1A3TA 3HOUG 4IQZA 2Q8RE 1HFNA 5C6AA 3TP8A 2UXDQ 4X3KA 4X64L 1FJGL 4TSSA 3L9AX 3U58A 4C56C 3HOYH 4GZYC 4HJ5A 2LMCB 4ME3A 3MFGA 1PH2A 3HOXH 3KDFB 2K33A 4JW0A 1AH9A 1WTHA 1K83B 4KJOA 3UDFA 2ES2A 2JK8A 2N8NA 1SXTA 1D1KA 4CKEA 1B7YB 4A3JG 3GTKH 2WFWA 2F0MA 4DR7L 2DNCA 3EFXD 2VB3X 3JAMi 5K36G 3CPFA 3F2UA 4NXNL 5JVG3 4LF9Q 2K5QA 4RCNA 3X3NA 2VUMH 2QILA 2VQEL 4YIJA 2RCNA 1JQYD 4LJZC 3RLOA 2JA6H 4B3MQ 4LFBQ 3H6MA 1GOZA 1RHPA 4AYBE 1R4QB 1EZ8A 2NN6G 1HUMA 4JI7Q 2HUGA 1PZID 1F2LA 1T9HA 5IGEA 3E6ZX 4POGA 2IL8A 5C44H 3K5NA 4A76A 3GO5A 3IKJA 3NTHA 1N33Q 2F0JA 1Y1WH 4P71A 2QEXA 4OONA 4A3FB 1QWYA 4C1NI 3C1FA 4WJ4A 2Y0SG 1EY7A 2K6AA 3OIQA 2DJGC 3DMUA 4DV0Q 1V1OA 1EL0A 1S5CD 4C2MB 1ICFB 4RKBA 1JOOA 3T13A 5DAUA 2ATWA 2F0WA 2YYZA 5CORA 2EXDA 1PTOB 4DK3C 4K8JA 4DPGA 4ID6A 5M3MG 3S1MB 1UEAB 2Z0SA 4FF2A 1TQOA 5E4WC 4NB3A 2AQ2B 4DR4L 3E9HA 2R7FA 2NVYB 1FNWA 1LTSD 3BJUA 1MD2D 2EOTA 5C4XB 1PMRA 1QZHA 4OO1H 1N36Q 1VQJA 4DV2Q 1EFID 2VUMG 1PLFA 4IUNA 1ONLA 2A6HD 1UUPA 5M5WB 2CKZB 4PZ7A 4KMUC 3CCUA 2HT1A 3RLNA 3GTQH 4JI1L 1HR0Q 1SNCA 1BVSA 2A19A 1TS5A 3NBHB 4Y7NB 2Q2UA 1I4GA 3I7FA 3GTGB 3NUCA 5C3EH 4P73A 1L1OC 5ELDA 4MN3A 2NTSA 2BDOA 4BBRH 3CHBD 4XYQA 4KKTA 2XTIA 3EA6A 1H9JA 3ULJA 3PO2B 3NBHA 1LTTD 1DJRD 3PGZA 2KHSA 3R93A 1Q82C 3S1RB 1M4VA 1Z9FA 1SMYD 1K8AC 2FJ2A 3S1NB 2LY7A 1LTBD 2A6ED 2L9HA 4UPAA 1H9MA 3K7AH 5JEAH 2FHTA 2MJ8A 1VS0A 1EU3A 1HFGA 4QB4A 2EZVA 4KD4A 4HIOA 3S2HH 2K28A 1GUTA 4DR2L 3OPOA 3UE1A 1VCIA 3PUXA 1J5EL 2Z4HA 5KYIA 4GLVB 1VF5C 1HPCA 1E7ZA 5JOBA 2Q2HA 5M5YH 4PNYA 1WVLA 1OXVA 4IUPA 5IT9L 2EYHA 2GVBA 4ZQ3A 1XMOQ 2NZ1D 4KD3A 1GVPA 5T1GA 2OT2A 4R4IA 2K14A 4DF7A 4R4OA 3J81E 1F2YA 4OELB 3P7JA 3V05A 1O80A 1SE3A 1JJ2A 1B8AA 2QGQA 5CMDA 1WTOA 3DM1A 1KIXA 1VQDA 2B2TA 3FPUB 3GTPB 1FGBD 3A74A 1Y8PB 1MJEA 1P16A 3A0JA 4XYOA 3KF8B 2EYJA 3BZCA 3D4WA 4BBRG 1VF7A 4BY1G 3TP5A 1SYDA 3M7NA 5EQ0A 1IYJB 4A3BG 2PI2E 4J15A 2JP1A 3OOCA 1X32A 1S4ZA 2C35B 3BDCA 3MTSA 4GKJQ 3HOXB 1STYA 1SEBD 4XTCS 3R3OA 3RMHA 1O7LA 1SNPA 4O1NA
chains in the Genus database with same CATH topology
2E2HH 2EIFA 3GD7A 2QA4A 1VQKA 4LF5Q 3GTGH 4R4QA 2GVAA 4IJLA 4P75A 3GDEA 4RMFA 1K3RA 1YVCA 4YHHQ 1EIFA 2HHHQ 4A3LG 1OTCA 4KLKA 1QVFA 1HZCA 4IFDG 2R6GA 4KHZA 3CMAA 3S14H 2ID0A 2VY3A 2ZTCA 5GQOA 1EWIA 1R9TH 4A3FG 3E9IA 3S15H 3HOWH 4DR3Q 3CC2A 2UXBQ 3F2DA 2Q2IA 1HNZL 4LF7L 3CXCA 4DV4Q 2R7DA 4JBMA 1YJNA 1RL2A 2OQ0A 4DR5L 3S1RH 4OX9L 5JJKA 4GKJL 4GLAC 3IRBA 5JJLA 3CD6A 3PUWA 3S1NH 1VQMA 4APVA 4IO9A 2ZM6Q 1BKBA 4LF5L 1I6HH 2A1AA 1C7YA 3HOVH 3TREA 5IP7G 4YHHL 4NXMQ 2HHHL 1VQ5A 3GTLH 2VS1A 4JI8Q 2JA7G 4DR6Q 5FJ8H 4OO1I 3L2PA 5FLMH 2HIVA 4YCVA 5IYBH 1N9WA 3MEFA 4GOPA 4JYAQ 4IFDJ 1PVOA 2UU9Q 2GN5A 4DR3L 1L1OB 2UXBL 1PA6A 1HH2P 2NN6I 1YZ6A 4JI5L 2K50A 3PUZA 4DV4L 1KXLA 2KHIA 1VQLA 1L0WA 3JAMc 1H95A 5EAYA 1GD7A 2JE6I 2JEBI 3F8TA 4BY1H 2Y0SE 3OYYA 1SLJA 4LFAQ 1VQ7A 3HOZG 4A3DG 1KC8C 4IPCA 2UUCQ 4A3BH 2UUBQ 3TQYA 1N32Q 2F3IA 2JJQA 3DM3A 2DUDA 4JCVE 4PZ6A 4NXML 4DUYQ 2PQAA 4BXXG 4X66Q 1EYGA 3STBD 4JI8L 2WAQE 4DR6L 1L1OA 4JV5Q 3RLFA 1IZ6A 1KRSA 4L5RC 1VQEA 1TWHH 2K5NA 2YV5A 3GTPH 3CW2C 4PZ8A 4YWMA 3CC7A 1N34Q 4JYAL 4A3LH 4JI6Q 4QY7A 1QVGA 2UU9L 3I4NG 5JJIA 1CKMA 1YEZA 3OTOL 1HZ9A 1SE8A 4P74A 1XNRQ 1VQAA 4A3FH 1P8LA 3ZJYC 2E5LQ 1RIPA 4A3MH 2IT1A 1BBUA 4B3SL 1OXSC 2NVTH 4A3GH 4DR1Q 1CKNA 4LFAL 2ZJQA 4NPSA 2UUCL 2NZHA 4EX5A 1PV4A 3KJPA 3PO2G 3AFPA 2UUBL 1G291 3E0EA 4O2DA 3J81c 1X3GA 3HOWG 4QQBX 2VQFQ 4LF8Q 1N32L 3NEMA 4DUYL 4AQYL 1M1KC 4X66L 2VNUD 1U5KA 1TWCH 1AE2A 1C9OA 1YHBA 3FP9A 4YCWA 5GAGC 4H02A 3T1YQ 1IBML 4JV5L 5ELOA 1Q12A 1VQBA 1VQOA 2CQOA 1GKHA 2YTVA 2CWPA 1PH3A 5IP7H 3G4SA 4LWCA 4POFA 1FL0A 1N34L 2E8GA 3W1BA 3T1HQ 1IXRA 1UWVA 4JI6L 1WCMH 3BU2A 4B3RQ 1EQQA 3AFQA 1HNXQ 4JOIA 1XNRL 1YITA 5FLXc 1U0LA 3BZKA 2E5LL 2UXCQ 4A3CG 3J81j 1OXTA 2VW9A 4JI3Q 4DR1L 4HJ9A 4LUZA 5IYBG 3FKIH 2OCEA 4PG3A 3GTOH 1CSQA 3PUVA 4GNXB 2K52A 3PCOB 2VQFL 4LF8L 1CKOA 1SMXA 5M3FH 1PH9A 2Q2TA 1XTDA 3HOZH 4GKKQ 2UXCL 3T1YL 4A3DH 1Y14B 1XPUA 2KHJA 3F2BA 4TQUS 1LTLA 2OQKA 4LUVA 3PO3H 3CCVA 1HNZQ 1JB7A 4BXXH 1EUJA 2CWAA 5H1SE 1E24A 1A62A 3T1HL 1N8RC 1I5FA 1UEBA 1S72A 4DV1Q 3PIOA 4MZ9A 2JA9A 2AWNA 3RR5A 3UDIA 1ASZA 2MNAA 4B3RL 1HNXL 1HNWQ 1Q8KA 1EIYB 1E22A 3ULLA 3G6EA 4GNXA 1PHJA 4JI0Q 4A3IH 4JI3L 4RG1A 3HFZB 3RZOH 2LXJA 1Q1BA 3GTMH 3L0OA 1PH1A 1WJJA 4GN4B 2ASBA 1UE7A 3K7UC 1VQNA 1UE5A 4X62Q 5LMNW 1SFOH 1NTGA 1V1QA 2R93G 4GKKL 3UDXA 1LUZA 1K0RA 1I94Q 3PO2H 1Q86C 2MO1A 4A3MG 1WI5A 1Y1VH 4A3GG 4JI5Q 3M4QA 1EOVA 4UP8A 1XPRA 2NVXH 3AEVA 1K73C 3HOYG 2R92G 4R1JA 2F4VQ 4DV1L 4YWLA 2D0OA 3S16H 3H15A 1XMQQ 1KL9A 1HNWL 3I4MH 3HOXG 1IL2A 3UDGA 2L15A 4GS3A 2NVQH 2IX0A 2WB1E 3EN2A 4JI0L 5IWAQ 1YBYA 2B63H 4GN3B 2CCZA 3NENA 4WJ3M 1WFQA 4BBSG 3PUYA 5IT9c 1PH6A 4DKAC 4DV6Q 3CAMA 1IBLQ 4HIMA 5C4JH 2ZJRA 3PIPA 4LF4Q 2I0QA 3UE0A 4A3CH 1V43A 3ER0A 1WCMG 4X62L 4DNIA 1MKHA 2DGYA 3STBC 4C3JH 5GADC 3ULPA 1QZGA 1YNXA 1I94L 2I5HA 1VQ6A 2E2JH 3PF4A 4K0KQ 1XNQQ 1VQFA 1HR0W 1HZBA 3M9BA 3OTOQ 3F2CA 5IY0A 3OW2A 3KF6B 1KHIA 2CFMA 1A8VA 3CCJA 5IYCH 4GOPC 2F4VL 3FKIG 3KFUA 3M4PA 1YI2A 5IP9G 1VQ9A 2JA6G 2ZTDA 1B70B 1SN8A 1YHAA 1XMQL 1FJGQ 5GAHC 2JEAI 3CCQA 1E3PA 1A63A 5M3FG 4B3SQ 2H5XA 3TS2A 4L5QA 1JMCA 4AYBG 3FHWA 5IWAL 2ALYB 4UP7A 3U4VA 2BA1A 3Q8DA 2HIXA 3D0FA 3J80i 3PO3G 3PF5A 1UE1A 4MTNA 3G71A 3CMEA 4DV6L 4AQYQ 1IBLL 4A3EH 2E2IH 4A3KG 4LF4L 5J3BA 1GM5A 1W2BA 4HIDA 1EQRA 5M5XH 1A0IA 1EFWA 1OXUA 4DAYB 1HJPA 1KRTA 1K8GA 3LGJA 4OXPA 4QJFA 1VQ8A 4K0KL 4DV5Q 2RHSB 1PH7A 5C44G 4C3IH 1TWFH 2XGTA 1E1TA 4JC0A 4A3IG 1XNQL 3K80C 2R7ZH 3HOUG 4C3HH 4DR7Q 2R93H 3GTJH 2Z6KC 1Y1WG 1JJGA 4NXNQ 2PI2A 1IBKQ 2K4KA 5C0XG 3ERSX 4QGUA 4X64L 2UXDQ 2VZAA 1FJGL 1G6PA 1Z47A 1UE6A 1YJWA 4AH6A 2VQEQ 3U58A 2IHFA 2R92H 3HOYH 4HJ5A 4ME3A 1GO3E 2HQLA 3J7A5 5IE8A 1SROA 1PH2A 1Y1VG 2YTYA 5HY6A 3HOXH 4IFDI 3CQZH 3KDFB 1LYLA 1AH9A 1LM0A 2KCMA 3UDFA 2ES2A 1VQGA 4KHPQ 1QVCA 2JK8A 2N8NA 4BBSH 4DV7Q 4QL5A 3I4MG 1B7YB 4DV5L 4JBKA 1MJCA 4A3JG 2WFWA 2B63G 3GTKH 1VQIA 4DR7L 4AIMA 4OWWB 4HJ7A 3JAMi 5K36G 3CPFA 4L5TA 2IX1A 3I55A 4NXNL 1VQCA 4LF9Q 4R4CA 1IBKL 3RN5A 2UXDL 4XIGS 3H3VI 1MIUA 3DLLA 1NY4A 3U4ZA 3CCEA 1PH4A 2LSSA 2VUMH 4JOIC 2VQEL 3S2DH 2RCNA 3A5UA 3W1GA 5C0XJ 4OO1G 3K0XA 2AWOA 3RLOA 5IP9H 4HIKA 2JA6H 4B3MQ 1G51A 1CSPA 3S1QH 4LW1A 2VL6A 2OWOA 4LFBQ 3VDYA 2JA5H 4X6AH 1SRUA 1V9PA 3TS0A 4AYBE 5IYCG 2NN6G 4KHPL 1XJVA 4JI7Q 4DV7L 4B3TQ 2N78A 4X65Q 1JT8A 3EIVA 4O0AA 3HKZG 4A3KH 4IPHA 4BA1I 2YTXA 3F1ZA 1T9HA 4BY7G 2NZOA 4LF9L 4A3EG 4POGA 2PNHA 1FVIA 2PMZE 1PYSB 3L7ZC 1X65A 5C44H 3HOUH 3S17H 4A76A 3GO5A 3CCSA 4YCUA 1PFSA 4GNXC 1Y1WH 4LUOA 1N33Q 5C3EG 3M3YH 2V1CC 5LMUQ 4P71A 2QEXA 4OONA 4R4TA 4B3ML 4DR4Q 2BA0A 2R7ZG 4A93H 4LFBL 1QUQB 1SR3A 4DV3Q 4WJ4A 2Y0SG 2B3GA 2JA8G 3PV0A 4JBJA 4DV0Q 4JI7L 1DGSA 3AYHB 4B3TL 4X65L 1BBWA 1WOCA 1E1OA 1YHQA 1X56A 2ATWA 3CPWA 1PH8A 1NMGA 2YYZA 3A5ZB 4UY8C 3M4OH 2EQSA 5LMNQ 2EXDA 5C0XI 3KJOA 1X54A 4DK3C 4DPGA 2D0PA 4JBWA 2UUAQ 3J80c 3I2ZA 4DK6C 4A3JH 5M3MG 1QUQA 4JI1Q 1VQ4A 1N33L 2Z0SA 3I56A 2KCTA 5LMUL 4NB3A 1VQHA 2MO0A 4P72A 5JEAG 4BA2I 4DR4L 3E9HA 2R7FA 2YU9H 3BJUA 3HKSA 4DV3L 5GAEC 3TEHB 1QZHA 3CC4A 1N36Q 1VQJA 2AMCB 4DV0L 2A8VA 4GOPB 2N3SA 4DV2Q 2VUMG 1X6OA 2KENA 3JC66 3KYHC 2BH8A 1K83H 1I3QH 2CKZB 4PZ7A 2K5VA 1VQPA 1YIJA 4X64Q 5AJ3Q 2B29A 3CF5A 5LMNL 3CCUA 1KD1C 2F52A 2JA5G 3HKZE 1X3FA 3I4OA 3M85A 2OTLA 2UUAL 2HT1A 3RLNA 4A4IA 4GLXA 4JI1L 1HR0Q 3GTQH 1NE3A 1BVSA 3RZDH 2A19A 4BY7H 2RHQB 1X3EA 3NBHB 4JI4Q 2BH2A 2IHEA 4JG2A 4YY3Q 2PQAB 1I50H 1KAWA 3K8AA 2Q2UA 1J6QA 2AHOB 1O7IA 2MQHA 3KF6A 4DUZQ 3I7FA 2ZTEA 3D31A 5C4XG 3KLWA 1X55A 5C3EH 1M90C 4HJAA 4P73A 1L1OC 5JEAJ 1N36L 4IOAA 5GROA 3EBEA 1S3OA 1WYDA 4DV2L 3W5OA 1NBWA 3SGIA 4BBRH 5IYDH 3H0GG 1Q1EA 4LNQA 4MNOA 2XTIA 4JI2Q 3RNUA 2JA8H 3ULJA 3G48A 2K75A 4ALPA 2ZM6L 5AJ3L 4GN5A 4QIWE 4DR2Q 4A93G 4UP9A 4OWXB 2WP8J 2I5MX 2JQOA 1J5EQ 1OXXK 1TXYA 1CKNB 3RN2A 3PGZA 1HR0L 4OWTB 1Q82C 4IPGA 1Z9FA 4JI4L 1K8AC 3U50C 4YY3L 2AKWB 1Q7YC 2Z6KA 3KOJA 1YJ9A 4L5SA 5M3MH 1W3SA 4DUZL 4IJHA 4UPAA 4PMWA 3MXNB 3K7AH 1C0AA 1D8LA 1NMFA 3CCMA 4LFCQ 1VS0A 5BR8Q 3CCLA 4LF6Q 4DAMA 4JI2L 4HIOA 4KI0A 3S2HH 1Q81C 3S24A 4DR2L 4C2MH 3UE1A 3KDFA 1VCIA 3PUXA 4FDBA 1J5EL 2I5LX 2MFIA 3H3VH 3ICEA 4GLVB 4A75A 1E7ZA 2OTJA 2Q2HA 5M5YH 1X9NA 1OXVA 2KBNA 4TVAB 2GVBA 1D7QA 2N49A 2RF4A 2WB1G 2JA7H 1XMOQ 3S1MH 1NJIC 3HOVG 1JE5A 1GVPA 5HGQA 1XPOA 4LFCL 4R4IA 1PH5A 5BR8L 2K14A 3J7ZC 4R4OA 2NVYH 4LF6L 3CP0A 1IBMQ 1L2FA 5FJ8G 2FXQA 5C4XH 1PYBA 5FLMG 1B8AA 4YWKA 2QGQA 1KIXA 1JJ2A 1ASYA 1VQDA 1CUKA 1HZAA 1S40A 3A74A 3K81C 4Y52H 1MJEA 3H0GH 5E7NA 3NELA 2K5HA 5ELNA 3PSIA 1P16A 1TWGH 5M5WH 3A0JA 3J81i 2ZJPA 4IOCA 1K9MC 3KF8B 3TRZA 1JJCB 3BZCA 3WWVA 1KQSA 3B6YA 4EQ5A 4BBRG 2D62A 5IYDG 4BY1G 4IPDA 4LF7Q 3M7NA 1IYJB 4A3BG 2PI2E 2IY5B 1TWAH 1XMOL 4J15A 3CCRA 1FGUA 2C35B 4DR5Q 4OX9Q 3AQQA 4GKJQ 1AE3A 2LXKA 4XTCS 5DLQE 4Y7NH 4HJ8A 1Q46A 2WAQG 3I4NH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2H H;  2EIF A;  3GD7 A;  2QA4 A;  1VQK A;  4LF5 Q;  3GTG H;  4R4Q A;  2GVA A;  4IJL A;  4P75 A;  3GDE A;  4RMF A;  1K3R A;  1YVC A;  4YHH Q;  1EIF A;  2HHH Q;  4A3L G;  1OTC A;  4KLK A;  1QVF A;  1HZC A;  4IFD G;  2R6G A;  4KHZ A;  3CMA A;  3S14 H;  2ID0 A;  2VY3 A;  2ZTC A;  5GQO A;  1EWI A;  1R9T H;  4A3F G;  3E9I A;  3S15 H;  3HOW H;  4DR3 Q;  3CC2 A;  2UXB Q;  3F2D A;  2Q2I A;  1HNZ L;  4LF7 L;  3CXC A;  4DV4 Q;  2R7D A;  4JBM A;  1YJN A;  1RL2 A;  2OQ0 A;  4DR5 L;  3S1R H;  4OX9 L;  5JJK A;  4GKJ L;  4GLA C;  3IRB A;  5JJL A;  3CD6 A;  3PUW A;  3S1N H;  1VQM A;  4APV A;  4IO9 A;  2ZM6 Q;  1BKB A;  4LF5 L;  1I6H H;  2A1A A;  1C7Y A;  3HOV H;  3TRE A;  5IP7 G;  4YHH L;  4NXM Q;  2HHH L;  1VQ5 A;  3GTL H;  2VS1 A;  4JI8 Q;  2JA7 G;  4DR6 Q;  5FJ8 H;  4OO1 I;  3L2P A;  5FLM H;  2HIV A;  4YCV A;  5IYB H;  1N9W A;  3MEF A;  4GOP A;  4JYA Q;  4IFD J;  1PVO A;  2UU9 Q;  2GN5 A;  4DR3 L;  1L1O B;  2UXB L;  1PA6 A;  1HH2 P;  2NN6 I;  1YZ6 A;  4JI5 L;  2K50 A;  3PUZ A;  4DV4 L;  1KXL A;  2KHI A;  1VQL A;  1L0W A;  3JAM c;  1H95 A;  5EAY A;  1GD7 A;  2JE6 I;  2JEB I;  3F8T A;  4BY1 H;  2Y0S E;  3OYY A;  1SLJ A;  4LFA Q;  1VQ7 A;  3HOZ G;  4A3D G;  1KC8 C;  4IPC A;  2UUC Q;  4A3B H;  2UUB Q;  3TQY A;  1N32 Q;  2F3I A;  2JJQ A;  3DM3 A;  2DUD A;  4JCV E;  4PZ6 A;  4NXM L;  4DUY Q;  2PQA A;  4BXX G;  4X66 Q;  1EYG A;  3STB D;  4JI8 L;  2WAQ E;  4DR6 L;  1L1O A;  4JV5 Q;  3RLF A;  1IZ6 A;  1KRS A;  4L5R C;  1VQE A;  1TWH H;  2K5N A;  2YV5 A;  3GTP H;  3CW2 C;  4PZ8 A;  4YWM A;  3CC7 A;  1N34 Q;  4JYA L;  4A3L H;  4JI6 Q;  4QY7 A;  1QVG A;  2UU9 L;  3I4N G;  5JJI A;  1CKM A;  1YEZ A;  3OTO L;  1HZ9 A;  1SE8 A;  4P74 A;  1XNR Q;  1VQA A;  4A3F H;  1P8L A;  3ZJY C;  2E5L Q;  1RIP A;  4A3M H;  2IT1 A;  1BBU A;  4B3S L;  1OXS C;  2NVT H;  4A3G H;  4DR1 Q;  1CKN A;  4LFA L;  2ZJQ A;  4NPS A;  2UUC L;  2NZH A;  4EX5 A;  1PV4 A;  3KJP A;  3PO2 G;  3AFP A;  2UUB L;  1G29 1;  3E0E A;  4O2D A;  3J81 c;  1X3G A;  3HOW G;  4QQB X;  2VQF Q;  4LF8 Q;  1N32 L;  3NEM A;  4DUY L;  4AQY L;  1M1K C;  4X66 L;  2VNU D;  1U5K A;  1TWC H;  1AE2 A;  1C9O A;  1YHB A;  3FP9 A;  4YCW A;  5GAG C;  4H02 A;  3T1Y Q;  1IBM L;  4JV5 L;  5ELO A;  1Q12 A;  1VQB A;  1VQO A;  2CQO A;  1GKH A;  2YTV A;  2CWP A;  1PH3 A;  5IP7 H;  3G4S A;  4LWC A;  4POF A;  1FL0 A;  1N34 L;  2E8G A;  3W1B A;  3T1H Q;  1IXR A;  1UWV A;  4JI6 L;  1WCM H;  3BU2 A;  4B3R Q;  1EQQ A;  3AFQ A;  1HNX Q;  4JOI A;  1XNR L;  1YIT A;  5FLX c;  1U0L A;  3BZK A;  2E5L L;  2UXC Q;  4A3C G;  3J81 j;  1OXT A;  2VW9 A;  4JI3 Q;  4DR1 L;  4HJ9 A;  4LUZ A;  5IYB G;  3FKI H;  2OCE A;  4PG3 A;  3GTO H;  1CSQ A;  3PUV A;  4GNX B;  2K52 A;  3PCO B;  2VQF L;  4LF8 L;  1CKO A;  1SMX A;  5M3F H;  1PH9 A;  2Q2T A;  1XTD A;  3HOZ H;  4GKK Q;  2UXC L;  3T1Y L;  4A3D H;  1Y14 B;  1XPU A;  2KHJ A;  3F2B A;  4TQU S;  1LTL A;  2OQK A;  4LUV A;  3PO3 H;  3CCV A;  1HNZ Q;  1JB7 A;  4BXX H;  1EUJ A;  2CWA A;  5H1S E;  1E24 A;  1A62 A;  3T1H L;  1N8R C;  1I5F A;  1UEB A;  1S72 A;  4DV1 Q;  3PIO A;  4MZ9 A;  2JA9 A;  2AWN A;  3RR5 A;  3UDI A;  1ASZ A;  2MNA A;  4B3R L;  1HNX L;  1HNW Q;  1Q8K A;  1EIY B;  1E22 A;  3ULL A;  3G6E A;  4GNX A;  1PHJ A;  4JI0 Q;  4A3I H;  4JI3 L;  4RG1 A;  3HFZ B;  3RZO H;  2LXJ A;  1Q1B A;  3GTM H;  3L0O A;  1PH1 A;  1WJJ A;  4GN4 B;  2ASB A;  1UE7 A;  3K7U C;  1VQN A;  1UE5 A;  4X62 Q;  5LMN W;  1SFO H;  1NTG A;  1V1Q A;  2R93 G;  4GKK L;  3UDX A;  1LUZ A;  1K0R A;  1I94 Q;  3PO2 H;  1Q86 C;  2MO1 A;  4A3M G;  1WI5 A;  1Y1V H;  4A3G G;  4JI5 Q;  3M4Q A;  1EOV A;  4UP8 A;  1XPR A;  2NVX H;  3AEV A;  1K73 C;  3HOY G;  2R92 G;  4R1J A;  2F4V Q;  4DV1 L;  4YWL A;  2D0O A;  3S16 H;  3H15 A;  1XMQ Q;  1KL9 A;  1HNW L;  3I4M H;  3HOX G;  1IL2 A;  3UDG A;  2L15 A;  4GS3 A;  2NVQ H;  2IX0 A;  2WB1 E;  3EN2 A;  4JI0 L;  5IWA Q;  1YBY A;  2B63 H;  4GN3 B;  2CCZ A;  3NEN A;  4WJ3 M;  1WFQ A;  4BBS G;  3PUY A;  5IT9 c;  1PH6 A;  4DKA C;  4DV6 Q;  3CAM A;  1IBL Q;  4HIM A;  5C4J H;  2ZJR A;  3PIP A;  4LF4 Q;  2I0Q A;  3UE0 A;  4A3C H;  1V43 A;  3ER0 A;  1WCM G;  4X62 L;  4DNI A;  1MKH A;  2DGY A;  3STB C;  4C3J H;  5GAD C;  3ULP A;  1QZG A;  1YNX A;  1I94 L;  2I5H A;  1VQ6 A;  2E2J H;  3PF4 A;  4K0K Q;  1XNQ Q;  1VQF A;  1HR0 W;  1HZB A;  3M9B A;  3OTO Q;  3F2C A;  5IY0 A;  3OW2 A;  3KF6 B;  1KHI A;  2CFM A;  1A8V A;  3CCJ A;  5IYC H;  4GOP C;  2F4V L;  3FKI G;  3KFU A;  3M4P A;  1YI2 A;  5IP9 G;  1VQ9 A;  2JA6 G;  2ZTD A;  1B70 B;  1SN8 A;  1YHA A;  1XMQ L;  1FJG Q;  5GAH C;  2JEA I;  3CCQ A;  1E3P A;  1A63 A;  5M3F G;  4B3S Q;  2H5X A;  3TS2 A;  4L5Q A;  1JMC A;  4AYB G;  3FHW A;  5IWA L;  2ALY B;  4UP7 A;  3U4V A;  2BA1 A;  3Q8D A;  2HIX A;  3D0F A;  3J80 i;  3PO3 G;  3PF5 A;  1UE1 A;  4MTN A;  3G71 A;  3CME A;  4DV6 L;  4AQY Q;  1IBL L;  4A3E H;  2E2I H;  4A3K G;  4LF4 L;  5J3B A;  1GM5 A;  1W2B A;  4HID A;  1EQR A;  5M5X H;  1A0I A;  1EFW A;  1OXU A;  4DAY B;  1HJP A;  1KRT A;  1K8G A;  3LGJ A;  4OXP A;  4QJF A;  1VQ8 A;  4K0K L;  4DV5 Q;  2RHS B;  1PH7 A;  5C44 G;  4C3I H;  1TWF H;  2XGT A;  1E1T A;  4JC0 A;  4A3I G;  1XNQ L;  3K80 C;  2R7Z H;  3HOU G;  4C3H H;  4DR7 Q;  2R93 H;  3GTJ H;  2Z6K C;  1Y1W G;  1JJG A;  4NXN Q;  2PI2 A;  1IBK Q;  2K4K A;  5C0X G;  3ERS X;  4QGU A;  4X64 L;  2UXD Q;  2VZA A;  1FJG L;  1G6P A;  1Z47 A;  1UE6 A;  1YJW A;  4AH6 A;  2VQE Q;  3U58 A;  2IHF A;  2R92 H;  3HOY H;  4HJ5 A;  4ME3 A;  1GO3 E;  2HQL A;  3J7A 5;  5IE8 A;  1SRO A;  1PH2 A;  1Y1V G;  2YTY A;  5HY6 A;  3HOX H;  4IFD I;  3CQZ H;  3KDF B;  1LYL A;  1AH9 A;  1LM0 A;  2KCM A;  3UDF A;  2ES2 A;  1VQG A;  4KHP Q;  1QVC A;  2JK8 A;  2N8N A;  4BBS H;  4DV7 Q;  4QL5 A;  3I4M G;  1B7Y B;  4DV5 L;  4JBK A;  1MJC A;  4A3J G;  2WFW A;  2B63 G;  3GTK H;  1VQI A;  4DR7 L;  4AIM A;  4OWW B;  4HJ7 A;  3JAM i;  5K36 G;  3CPF A;  4L5T A;  2IX1 A;  3I55 A;  4NXN L;  1VQC A;  4LF9 Q;  4R4C A;  1IBK L;  3RN5 A;  2UXD L;  4XIG S;  3H3V I;  1MIU A;  3DLL A;  1NY4 A;  3U4Z A;  3CCE A;  1PH4 A;  2LSS A;  2VUM H;  4JOI C;  2VQE L;  3S2D H;  2RCN A;  3A5U A;  3W1G A;  5C0X J;  4OO1 G;  3K0X A;  2AWO A;  3RLO A;  5IP9 H;  4HIK A;  2JA6 H;  4B3M Q;  1G51 A;  1CSP A;  3S1Q H;  4LW1 A;  2VL6 A;  2OWO A;  4LFB Q;  3VDY A;  2JA5 H;  4X6A H;  1SRU A;  1V9P A;  3TS0 A;  4AYB E;  5IYC G;  2NN6 G;  4KHP L;  1XJV A;  4JI7 Q;  4DV7 L;  4B3T Q;  2N78 A;  4X65 Q;  1JT8 A;  3EIV A;  4O0A A;  3HKZ G;  4A3K H;  4IPH A;  4BA1 I;  2YTX A;  3F1Z A;  1T9H A;  4BY7 G;  2NZO A;  4LF9 L;  4A3E G;  4POG A;  2PNH A;  1FVI A;  2PMZ E;  1PYS B;  3L7Z C;  1X65 A;  5C44 H;  3HOU H;  3S17 H;  4A76 A;  3GO5 A;  3CCS A;  4YCU A;  1PFS A;  4GNX C;  1Y1W H;  4LUO A;  1N33 Q;  5C3E G;  3M3Y H;  2V1C C;  5LMU Q;  4P71 A;  2QEX A;  4OON A;  4R4T A;  4B3M L;  4DR4 Q;  2BA0 A;  2R7Z G;  4A93 H;  4LFB L;  1QUQ B;  1SR3 A;  4DV3 Q;  4WJ4 A;  2Y0S G;  2B3G A;  2JA8 G;  3PV0 A;  4JBJ A;  4DV0 Q;  4JI7 L;  1DGS A;  3AYH B;  4B3T L;  4X65 L;  1BBW A;  1WOC A;  1E1O A;  1YHQ A;  1X56 A;  2ATW A;  3CPW A;  1PH8 A;  1NMG A;  2YYZ A;  3A5Z B;  4UY8 C;  3M4O H;  2EQS A;  5LMN Q;  2EXD A;  5C0X I;  3KJO A;  1X54 A;  4DK3 C;  4DPG A;  2D0P A;  4JBW A;  2UUA Q;  3J80 c;  3I2Z A;  4DK6 C;  4A3J H;  5M3M G;  1QUQ A;  4JI1 Q;  1VQ4 A;  1N33 L;  2Z0S A;  3I56 A;  2KCT A;  5LMU L;  4NB3 A;  1VQH A;  2MO0 A;  4P72 A;  5JEA G;  4BA2 I;  4DR4 L;  3E9H A;  2R7F A;  2YU9 H;  3BJU A;  3HKS A;  4DV3 L;  5GAE C;  3TEH B;  1QZH A;  3CC4 A;  1N36 Q;  1VQJ A;  2AMC B;  4DV0 L;  2A8V A;  4GOP B;  2N3S A;  4DV2 Q;  2VUM G;  1X6O A;  2KEN A;  3JC6 6;  3KYH C;  2BH8 A;  1K83 H;  1I3Q H;  2CKZ B;  4PZ7 A;  2K5V A;  1VQP A;  1YIJ A;  4X64 Q;  5AJ3 Q;  2B29 A;  3CF5 A;  5LMN L;  3CCU A;  1KD1 C;  2F52 A;  2JA5 G;  3HKZ E;  1X3F A;  3I4O A;  3M85 A;  2OTL A;  2UUA L;  2HT1 A;  3RLN A;  4A4I A;  4GLX A;  4JI1 L;  1HR0 Q;  3GTQ H;  1NE3 A;  1BVS A;  3RZD H;  2A19 A;  4BY7 H;  2RHQ B;  1X3E A;  3NBH B;  4JI4 Q;  2BH2 A;  2IHE A;  4JG2 A;  4YY3 Q;  2PQA B;  1I50 H;  1KAW A;  3K8A A;  2Q2U A;  1J6Q A;  2AHO B;  1O7I A;  2MQH A;  3KF6 A;  4DUZ Q;  3I7F A;  2ZTE A;  3D31 A;  5C4X G;  3KLW A;  1X55 A;  5C3E H;  1M90 C;  4HJA A;  4P73 A;  1L1O C;  5JEA J;  1N36 L;  4IOA A;  5GRO A;  3EBE A;  1S3O A;  1WYD A;  4DV2 L;  3W5O A;  1NBW A;  3SGI A;  4BBR H;  5IYD H;  3H0G G;  1Q1E A;  4LNQ A;  4MNO A;  2XTI A;  4JI2 Q;  3RNU A;  2JA8 H;  3ULJ A;  3G48 A;  2K75 A;  4ALP A;  2ZM6 L;  5AJ3 L;  4GN5 A;  4QIW E;  4DR2 Q;  4A93 G;  4UP9 A;  4OWX B;  2WP8 J;  2I5M X;  2JQO A;  1J5E Q;  1OXX K;  1TXY A;  1CKN B;  3RN2 A;  3PGZ A;  1HR0 L;  4OWT B;  1Q82 C;  4IPG A;  1Z9F A;  4JI4 L;  1K8A C;  3U50 C;  4YY3 L;  2AKW B;  1Q7Y C;  2Z6K A;  3KOJ A;  1YJ9 A;  4L5S A;  5M3M H;  1W3S A;  4DUZ L;  4IJH A;  4UPA A;  4PMW A;  3MXN B;  3K7A H;  1C0A A;  1D8L A;  1NMF A;  3CCM A;  4LFC Q;  1VS0 A;  5BR8 Q;  3CCL A;  4LF6 Q;  4DAM A;  4JI2 L;  4HIO A;  4KI0 A;  3S2H H;  1Q81 C;  3S24 A;  4DR2 L;  4C2M H;  3UE1 A;  3KDF A;  1VCI A;  3PUX A;  4FDB A;  1J5E L;  2I5L X;  2MFI A;  3H3V H;  3ICE A;  4GLV B;  4A75 A;  1E7Z A;  2OTJ A;  2Q2H A;  5M5Y H;  1X9N A;  1OXV A;  2KBN A;  4TVA B;  2GVB A;  1D7Q A;  2N49 A;  2RF4 A;  2WB1 G;  2JA7 H;  1XMO Q;  3S1M H;  1NJI C;  3HOV G;  1JE5 A;  1GVP A;  5HGQ A;  1XPO A;  4LFC L;  4R4I A;  1PH5 A;  5BR8 L;  2K14 A;  3J7Z C;  4R4O A;  2NVY H;  4LF6 L;  3CP0 A;  1IBM Q;  1L2F A;  5FJ8 G;  2FXQ A;  5C4X H;  1PYB A;  5FLM G;  1B8A A;  4YWK A;  2QGQ A;  1KIX A;  1JJ2 A;  1ASY A;  1VQD A;  1CUK A;  1HZA A;  1S40 A;  3A74 A;  3K81 C;  4Y52 H;  1MJE A;  3H0G H;  5E7N A;  3NEL A;  2K5H A;  5ELN A;  3PSI A;  1P16 A;  1TWG H;  5M5W H;  3A0J A;  3J81 i;  2ZJP A;  4IOC A;  1K9M C;  3KF8 B;  3TRZ A;  1JJC B;  3BZC A;  3WWV A;  1KQS A;  3B6Y A;  4EQ5 A;  4BBR G;  2D62 A;  5IYD G;  4BY1 G;  4IPD A;  4LF7 Q;  3M7N A;  1IYJ B;  4A3B G;  2PI2 E;  2IY5 B;  1TWA H;  1XMO L;  4J15 A;  3CCR A;  1FGU A;  2C35 B;  4DR5 Q;  4OX9 Q;  3AQQ A;  4GKJ Q;  1AE3 A;  2LXK A;  4XTC S;  5DLQ E;  4Y7N H;  4HJ8 A;  1Q46 A;  2WAQ G;  3I4N H; 
#chains in the Genus database with same CATH topology
 2E2H H;  2EIF A;  2R61 A;  2GVA A;  4XDX A;  3KF8 A;  2HHH Q;  1EIF A;  2M00 A;  1KLG D;  4KLK A;  3KLR A;  4IFD G;  1HZC A;  1HTP A;  1H9S B;  1IW7 D;  5ELC A;  1C8C A;  3VR5 A;  3CC2 A;  4LF7 L;  4NW2 A;  2N88 A;  3FVQ A;  1YJN A;  2JA6 B;  5EBD A;  1C4Q A;  1JC7 A;  3IRB A;  4U68 A;  5JJL A;  4CBV A;  4APV A;  1BKB A;  3GV6 A;  2A1A A;  3HOV H;  2EY2 A;  3TRE A;  1VQ5 A;  1K8O A;  3U9S A;  4X3S A;  3TZD A;  1JCK B;  1U4L A;  3MEF A;  4GOP A;  1PVO A;  5C44 B;  2UU9 Q;  2GN5 A;  4DR3 L;  1L1O B;  2PMZ B;  3S9W A;  1GUO A;  2NN6 I;  1IHZ A;  3A8K E;  5ELE A;  1H95 A;  1WTW A;  2JE6 I;  2E76 C;  1PTO D;  2F0O A;  4C1N K;  2Y0S E;  3OYY A;  1SLJ A;  1VQ7 A;  4IPC A;  1N32 Q;  1GHJ A;  3DM3 A;  2JJQ A;  2F0G A;  4PZ6 A;  2F0I A;  2NVX B;  4NXM L;  4BXX G;  4KY5 A;  2WAQ E;  1L1O A;  1IZ6 A;  2K03 A;  5I9P A;  1ZEQ X;  2YV5 A;  2ICE C;  4U67 3;  1N34 Q;  5CV9 A;  2F0F A;  5JJI A;  1CKM A;  1YEZ A;  3R8B A;  1HZ9 A;  2CHB D;  4P74 A;  2J0T D;  3Q24 A;  2FIN B;  4A3G H;  4DR1 Q;  1HXY D;  1CKN A;  4EX5 A;  1S5B D;  2K5W A;  4FXG C;  2KEC A;  2DY8 A;  2E2J B;  3I70 A;  2VQF Q;  3NEM A;  3PIP 3;  2Z9H A;  2VNU D;  1AE2 A;  1C9O A;  3IFD A;  1WTX A;  2O5I C;  1Q12 A;  2CQO A;  2YTV A;  1LAC A;  3MXN A;  5IP7 H;  3HRZ C;  4LWC A;  2NB0 A;  3HKZ B;  2L0C A;  3T1H Q;  4JI6 L;  1QG7 A;  4DNR B;  3BU2 A;  2KVM A;  4MTK A;  4B3R Q;  4FYD A;  1PRT C;  2E2I B;  1HTL D;  1YIT A;  4A3E B;  1DOL A;  1LT3 D;  2E5L L;  2SNS A;  1CQV A;  3J81 j;  1XYI A;  4A3C G;  1Z6H A;  2OCE A;  4GNX B;  1SNM A;  3TBI B;  2KQ3 A;  2R93 B;  1PH9 A;  2UXC L;  3T1Y L;  1BOS A;  4A3D H;  1V8Q A;  3F2B A;  1LTL A;  2OQK A;  1CTM A;  3SK5 A;  2CWA A;  5H1S E;  1E24 A;  1UEB A;  1TY2 A;  4MZ9 A;  1HNW Q;  1EIY B;  3VYU A;  4GNX A;  5A2Q E;  1X3Q A;  4PMC A;  4JI3 L;  1B9N A;  3HFZ B;  1LT6 D;  1PH1 A;  1WJJ A;  2SDF A;  1UE7 A;  4RGM A;  4HAE A;  1V1Q A;  4GKK L;  1K0R A;  5D3D A;  1ENC A;  1I4H A;  5IGC A;  4RA8 A;  1Y1V H;  4A3G G;  4R1J A;  1VMC A;  2D0O A;  3S16 H;  5I4D A;  3H15 A;  3SK6 A;  4GS3 A;  1Q3L A;  2RBM A;  5IWA Q;  5EBC A;  3I91 A;  3BG3 A;  4GN3 B;  4RFB A;  1A3V A;  3AMU A;  4BBS G;  1PH6 A;  2RDH A;  2OF1 A;  3PIP A;  2SOB A;  3WDN A;  4XXE A;  3UE0 A;  4LF4 Q;  3ULP A;  4C3J H;  1VQ6 A;  3HZX A;  4N8F A;  3SVM A;  1VQF A;  3T56 B;  3M9B A;  4OHJ A;  3KF6 B;  1A8V A;  5IYC H;  2F4V L;  3KFU A;  1TU2 B;  3M4P A;  4CDF C;  1YI2 A;  1B70 B;  1SN8 A;  3DUZ A;  2JEA I;  4A93 B;  1E3P A;  5JPM C;  4NKL A;  4AYB G;  3NPP A;  2BA1 A;  1EQT A;  3PF5 A;  4MTN A;  1IBL L;  1EYA A;  4R8I A;  4A3K G;  5J3B A;  2F0U A;  5IGG A;  1W2B A;  1L0X B;  2E2H B;  3ITP A;  5CV6 A;  1SJH D;  4DAY B;  1KDC A;  3LGJ A;  4K0K L;  4BS9 A;  1E1T A;  2R7Z H;  1JJG A;  3FMC A;  1IBK Q;  3ERS X;  2YU9 B;  1Z47 A;  2R92 H;  2IHF A;  3W2D A;  2PCF B;  4K14 A;  2B2W A;  1GO3 E;  4DAY A;  1W6K A;  2HQL A;  1SRO A;  2L11 A;  1Y1V G;  5HY6 A;  4IFD I;  3CQZ H;  4N9P A;  3BVG A;  1IKL A;  1LM0 A;  1VQG A;  5FOB B;  4FO2 A;  4DV7 Q;  1CA6 A;  5J22 A;  4DV5 L;  4FF3 A;  1MJC A;  1VQI A;  4AIM A;  4OWW B;  1AN8 A;  3RZD B;  4BY7 B;  1F9R A;  4L5T A;  3I55 A;  2IX1 A;  4R4C A;  1LTG D;  3RN5 A;  3C2P A;  1I50 B;  1BQQ T;  3CCE A;  1NY4 A;  3S2D H;  4JOI C;  5BN3 A;  1DD2 A;  3EQL C;  1EYC A;  1U9R A;  5LL6 S;  4CHT B;  5CV7 A;  4TRD A;  5E4X A;  3DWQ A;  3J7A F;  2O5J C;  1SRU A;  3TS0 A;  1ZYR C;  5IYC G;  4KHP L;  2EE1 A;  4IUQ A;  3UI2 A;  2H4O A;  3NE5 B;  2F0K A;  2HDL A;  4BA1 I;  4ILW A;  3NP8 A;  3F1Z A;  4X3U A;  5FKA C;  1LTI D;  1CHP D;  1TII D;  3CRK C;  3JAM L;  2PNH A;  2A74 C;  1FVI A;  3HOU H;  3S17 H;  2XNA C;  4YCU A;  1PFS A;  4JVZ A;  3M3Y H;  5LMU Q;  4R4T A;  5D65 A;  2R7Z G;  1PFM A;  1SR3 A;  2B2U A;  3Q22 A;  1SYF A;  4DV3 Q;  3OMC A;  2D9U A;  2JA8 G;  3SE0 A;  3AYH B;  4B3T L;  1STB A;  3PQI A;  4KN4 C;  4X65 L;  1BBW A;  4CDD C;  3A5Z B;  3J7Y W;  1K0S A;  2L55 A;  3KJO A;  2MHV A;  4JBW A;  2UUA Q;  3J80 c;  3I2Z A;  4A3J H;  2JA7 B;  5K36 H;  1BUV T;  3NWS A;  2ZXR A;  4O42 A;  4P72 A;  2IJ0 A;  4KHV A;  3J81 L;  4DN4 M;  1BNZ A;  3H91 A;  4KJN A;  1MI2 A;  5CR3 A;  2G9D A;  5DM7 3;  2L5T A;  2ICI A;  1EU4 A;  2NN6 H;  2QF7 A;  1I3Q H;  1VQP A;  2B29 A;  5LMN L;  1QE6 A;  2F52 A;  1X3F A;  3I4O A;  5IIF A;  4KY6 A;  5FLX L;  1WD0 A;  4GLX A;  1TWA B;  5CBA E;  2RHQ B;  1X3E A;  2IHE A;  1JWS D;  1KAW A;  1J6Q A;  2AHO B;  3I4N B;  5CGK A;  4QUF A;  4DUZ Q;  3D31 A;  2EY6 A;  5C4X G;  4HJA A;  1BCP D;  1V1P B;  1E2V A;  5JPN C;  3SGI A;  1Q1E A;  2G5D A;  3ERQ A;  3RNU A;  4JI2 Q;  1FNV A;  2K75 A;  3G48 A;  5AJ3 L;  3FDT A;  4QIW E;  3QOL A;  3SEB A;  2WP8 J;  2K7V A;  4K5X A;  3PMF A;  1OXX K;  4DFA A;  1TXY A;  5I6W A;  1PZK D;  5EPL A;  4JI4 L;  3NBI A;  1ESF A;  1V1P A;  4YY3 L;  1Q7Y C;  1G8Z D;  5I6Y A;  5M3M H;  1I6H B;  4IJH A;  3T16 A;  4HSP A;  3V2T A;  4PMW A;  1D8L A;  4KTA A;  4K5W A;  4LFC Q;  2FMM A;  4QF4 A;  4LF6 Q;  1WTP A;  4DAM A;  1TY0 A;  1Q81 C;  3S24 A;  3VR3 A;  3KDF A;  4FDB A;  3H3V H;  2MFI A;  1LT5 D;  4A75 A;  3NXW A;  3QOJ A;  2Z1C A;  3TP6 A;  1NJI C;  1JE5 A;  1BDO A;  4OIK A;  1GUG A;  3ZYY X;  1ZXT A;  4L6T B;  2CVR A;  4DAP A;  5BR8 L;  4CJ0 B;  3J7Z C;  1B1Z A;  2K5D A;  1IBM Q;  2EYO A;  1A3U A;  2FXQ A;  3EVQ A;  4PV1 C;  3V96 A;  5FLM G;  4YWK A;  3A7L A;  3K5L A;  1Z7T A;  1HZA A;  3K81 C;  2KCN A;  3NQI A;  1CM9 A;  3VA5 A;  2K5H A;  1TWG H;  1H9R A;  3J81 i;  1F2M A;  5K5P A;  1YNJ D;  1F77 A;  2HDM A;  3D4R A;  4IPD A;  2RCF A;  1PRT D;  2P5Z X;  3SK8 A;  5IGF A;  1OO9 B;  4DR5 Q;  1ML0 D;  4OX9 Q;  1AE3 A;  2K32 A;  2QW7 A;  2EXZ A;  5DLQ E;  3E0J A;  4EVO A;  2WAQ G;  2QA4 A;  4LF5 Q;  3M7G A;  4KK7 A;  4P75 A;  4YHH Q;  2B2V C;  2MPM A;  1QVF A;  1EY9 A;  4KHZ A;  4XQQ A;  1VDZ A;  3S14 H;  1SDF A;  3K5O A;  5GQO A;  1EWH A;  1EWI A;  2WIN B;  5DEH A;  4K2K A;  3S15 H;  4I7Z C;  3HOW H;  2UXB Q;  4H44 C;  4WFN 3;  2M9V A;  4M1U B;  2JYO A;  2R7D A;  3O13 A;  2IX3 A;  1JOQ A;  2OQ0 A;  3K59 A;  3G6J B;  4GLA C;  3E3X A;  3KBG A;  2ZM6 Q;  2FFK B;  1BR9 A;  1EQV A;  2CH4 W;  3GTL H;  4LAA A;  3LX0 A;  4JI8 Q;  3L2P A;  4YCV A;  4F88 A;  1N9W A;  3GV3 A;  5A2Q L;  1X3P A;  4A3I B;  1BO0 A;  4ZUJ A;  4DV4 L;  2KHI A;  1VQL A;  1RDP D;  2BDN A;  3PIO 3;  2E74 C;  1EY6 A;  4BY1 H;  1SFO B;  3D6W A;  1B50 A;  3HOZ G;  2UUC Q;  4A3B H;  2EPB A;  2F3I A;  1F9Q A;  1LAB A;  1TVX A;  4XT3 B;  3KUP A;  4X66 Q;  1EYG A;  1D5X C;  4DR6 L;  3RLF A;  2EDG A;  2EYP A;  1VQE A;  1TWH H;  2NUC A;  4EQP A;  2K5N A;  4RWS C;  1AFP A;  4RAU C;  4YWM A;  3CC7 A;  4JYA L;  1QVG A;  4IFD H;  2PQE A;  1SBB B;  4V19 0;  4G7H C;  3KK7 A;  3Q6S A;  1XNR Q;  4G7Z C;  5C4J B;  2NTT A;  1P8L A;  4S3S A;  1GHK A;  4A3M H;  1BBU A;  1ILQ A;  2FMC A;  3ERO A;  4LFA L;  1CQF A;  2NZH A;  1PV4 A;  3KJP A;  2UUB L;  4F7X A;  3ND8 A;  3HOW G;  2B2Y C;  4QQB X;  2NBF A;  3K5M A;  4LF8 Q;  2BE5 C;  4DUY L;  2KOL A;  1KNE A;  1TWC H;  3FP9 A;  4YCW A;  4JV5 L;  1SE2 A;  5ELO A;  3MHB A;  3G4S A;  4B9W A;  3MXU A;  2E8G A;  3C1E A;  2RDG A;  3W1B A;  1IXR A;  5KNC A;  1WCM H;  1PTO F;  3N52 A;  1EQQ A;  3AFQ A;  5J1Z A;  2ENB A;  2XRQ D;  1OXT A;  1I4P A;  4HJ9 A;  4E6I A;  1NR2 A;  3FKI H;  3GTO H;  1CSQ A;  2EJF C;  3PUV A;  2K52 A;  3PCO B;  3NK9 A;  4ABN A;  4K8I A;  2F0E A;  5M3F H;  2F0V A;  5KND A;  4QMG A;  3VR6 A;  1Y14 B;  1WD1 A;  1XPU A;  1O7Z A;  4TQU S;  2RA4 A;  4LUV A;  3PO3 H;  3CCV A;  4BXX H;  1JB7 A;  2X6L A;  3HOY B;  1S72 A;  3PIO A;  2JA9 A;  3DWP A;  2KA7 A;  1HNX L;  4ZCK A;  2AQ3 B;  4MHE A;  1B3A A;  1PHJ A;  4JI0 Q;  5D3I B;  5LHY 1;  3Q0A A;  4RG1 A;  3RZO H;  2HQE A;  3GTM H;  4R8N A;  1ZYR D;  2NYZ D;  1AP0 A;  3NSW A;  3WOF A;  3GTK B;  1VQN A;  1I4R A;  1UE5 A;  5LMN W;  2R93 G;  1LUZ A;  2F0S A;  2X6G A;  4IZ8 A;  2MO1 A;  3BZD B;  2F3V A;  4A3M G;  1WI5 A;  3N6R A;  4JI5 Q;  4EQO A;  2VUM B;  4I7A A;  4K5V A;  1JOK A;  2SEB D;  4DV1 L;  1XMQ Q;  1KL9 A;  3I4M H;  1BCP C;  1WTV A;  3UDG A;  2NVQ H;  2IX0 A;  1YBY A;  1H9S A;  3E5S A;  2B63 H;  3AU7 A;  1W6J A;  2PZT A;  5IT9 c;  4DK1 A;  2ZJR A;  2I0Q A;  4A3C H;  3MC0 B;  3ER0 A;  1WCM G;  4X62 L;  3I8Z A;  2Q8T A;  1NUC A;  2C9O A;  5I2X A;  3STB C;  5FO9 B;  5GAD C;  3LWU A;  4FXK C;  1I94 L;  2I5H A;  3PF4 A;  1XNQ Q;  1HZB A;  3OTO Q;  3F2C A;  2CFM A;  3CCJ A;  1LLR D;  1Y1W B;  3QG1 A;  3FKI G;  5IP9 G;  1FJG Q;  1A63 A;  5KRU A;  5M3F G;  2H5X A;  2B8F A;  2VB2 X;  4ZAI A;  5DM6 3;  2WKD A;  3TS2 A;  3FHW A;  2ALY B;  1SJE D;  3I73 A;  4FF1 A;  3D0F A;  4CDE C;  1DM0 B;  3PO3 G;  1UE1 A;  1EWC A;  4ZKC B;  3G71 A;  1K28 A;  4DV6 L;  4AQY Q;  4KY7 A;  4UAI A;  1AZP A;  1EFW A;  1B9M A;  1DYQ A;  1KRT A;  2A68 C;  4RGT A;  1VQ8 A;  1PH7 A;  4C3I H;  2GA4 B;  4DR7 Q;  4C3H H;  1NSN S;  3DEO A;  2Z6K C;  5CC4 A;  3GTJ H;  1SYG A;  3A54 A;  4NXN Q;  2K4K A;  2PNR C;  2VQE Q;  1GUS A;  1HUN A;  1CZW A;  5IE8 A;  2CW0 C;  3BDL A;  1I4Q A;  1Q8I A;  3DEP A;  2PYK A;  1QVC A;  4BBS H;  3I4M G;  5IOC A;  3DWA A;  1YNJ C;  3GTL B;  1NAP A;  3GTQ B;  2B63 G;  2L12 A;  1SNO A;  4HJ7 A;  1VQC A;  1U4P A;  5JJZ A;  2UXD L;  4XIG S;  3H3V I;  1MIU A;  3VA7 A;  3RUZ A;  4NP5 A;  3NTI A;  1PH4 A;  2KEE A;  1QIL A;  1F9P A;  5C3E B;  1JB3 A;  3W1G A;  5C0X J;  2AWO A;  3S1Q H;  4BBR B;  3VDY A;  2JA5 H;  4BY1 B;  2DN8 A;  4J6H A;  1HHV A;  4A3B B;  1XJV A;  4F87 A;  4LK1 C;  1NR4 A;  2IW3 A;  2N78 A;  2KJX A;  1ENF A;  2A73 B;  4CKB A;  1JT8 A;  4O0A A;  4Z9C B;  3R2T A;  4HMI A;  4A3K H;  4IPH A;  2YTX A;  5G3L F;  1JE4 A;  4BY7 G;  2NZO A;  4RCO A;  4LF9 L;  1EY4 A;  2PMZ E;  4ZRZ A;  3K58 A;  3CCS A;  1QNU A;  3K7A B;  3U9O A;  4B3M L;  4C3I G;  4DR4 Q;  2BA0 A;  4LFB L;  4C3H G;  2PZU A;  2TMP A;  2B3G A;  3PV0 A;  3S2H B;  4JBJ A;  4JI7 L;  4HN7 A;  3QJY A;  3SR1 A;  2WV6 D;  1WOC A;  1X56 A;  3CPW A;  4F8M A;  1S5F D;  1BCP B;  1IKM A;  1K8M A;  1NMG A;  5M5Y B;  4UY8 C;  5JAV A;  5FO8 B;  5C0X I;  4JK1 C;  4FNF A;  2O4X A;  1EY5 A;  2EY5 A;  4JI1 Q;  1N33 L;  3I56 A;  4DAV A;  3R2I A;  2HCC A;  4BA2 I;  1JWM D;  1HCZ A;  1ICW A;  5AFW A;  2EYL A;  4HR7 B;  4M8A A;  2M2L A;  4DV0 L;  2AMC B;  2ZXP A;  2A8V A;  1RTO A;  2A5H A;  1C48 A;  1X6O A;  2KEN A;  1EY8 A;  1T5X D;  3JC6 6;  3KYH C;  2RDF A;  1K83 H;  2IWH A;  2K5V A;  1VMP A;  1KD1 C;  1B53 A;  2JA5 G;  3HKZ E;  1XX8 A;  2OTL A;  4RHR A;  4A4I A;  1XWE A;  4OL7 A;  1NE3 A;  1SYE A;  2BOS A;  3J7A V;  1R4P B;  2PQA B;  3K8A A;  2MQH A;  3KF6 A;  3KLW A;  1X55 A;  1M90 C;  1MHW C;  5JEA J;  1N36 L;  5GRO A;  3EBE A;  1S3O A;  1WYD A;  4DV2 L;  3W5O A;  5HUR A;  3H0G G;  1ESR A;  2JA8 H;  2OXP A;  4ALP A;  2KUM A;  2ZM6 L;  4DR2 Q;  4OWX B;  4WRD A;  1EYD A;  2MP1 A;  1J5E Q;  3RN2 A;  1HR0 L;  4FF4 A;  1G2T A;  4OWT B;  3U50 C;  2Z6K A;  4CJ1 B;  4FVM A;  4L5S A;  2WB1 B;  3HOV B;  5EPK A;  3HEJ A;  1FNU A;  3VYR A;  1C0A A;  1NMF A;  1PRT B;  3VYT A;  5C4H A;  3CCM A;  1UNS A;  5ISR A;  4KI0 A;  3L3O C;  3KLS A;  4C2M H;  3NTK A;  3C3L A;  3NWT A;  3ICE A;  5JVH 3;  1LTR D;  2Z4I A;  4CJ2 C;  3P75 A;  2QDB A;  1HA5 A;  4TVA B;  1PTO H;  5FO7 B;  2N49 A;  2RF4 A;  4RGO S;  3S1M H;  1QB5 D;  1XPO A;  4G4K A;  1PH5 A;  2NVY H;  1L2F A;  5FJ8 G;  3I4L A;  4JPB W;  5C4X H;  2BE5 D;  4IUV A;  4K2L A;  2F0L A;  2ZJP A;  3PSI A;  5M5W H;  1K9M C;  1J8I A;  2G9H D;  3WWV A;  5DNF A;  4EQ5 A;  2D62 A;  4A3G B;  4WJW A;  4LF7 Q;  4H7B A;  3G7L A;  2R3Z A;  1QJO A;  2IY5 B;  1XMO L;  4J1M A;  1FGU A;  5L37 A;  3AQQ A;  1E2Z A;  2LXK A;  4OEM B;  4Y7N H;  4HJ8 A;  5CYU A;  3GTG H;  4R4Q A;  4IJL A;  3MFY A;  4RMF A;  3OWF A;  1YVC A;  4A3L G;  1MSH A;  1OTC A;  2JN4 A;  2R6G A;  3TZU A;  5IOD A;  3A8J E;  1I4X A;  2ID0 A;  2VY3 A;  2ZTC A;  3SXH A;  1DON A;  3D6C A;  1R9T H;  4A3F G;  3E9I A;  4DR3 Q;  5EGT A;  3AB9 A;  3F2D A;  1BBX C;  1EEF D;  2Q2I A;  1STN A;  2KED A;  3K0Y A;  4ULL A;  1STE A;  3MXG A;  3C46 A;  2RVL A;  3S1R H;  5JJK A;  4GKJ L;  1EZ6 A;  3S1N H;  1VQM A;  4IO9 A;  4AYB B;  2EVB A;  4A3D B;  2F1M A;  1C7Y A;  2EJG C;  4DXG A;  5NUC A;  4NXM Q;  2HHH L;  4NMZ A;  5FLM H;  4TKO B;  2HIV A;  3LNN A;  5IYB H;  4L8J A;  4K6L A;  2A69 C;  3BVZ A;  3DXJ C;  1EIH A;  1QCB D;  4JI5 L;  2K50 A;  1KXL A;  3CRL C;  2XVS A;  1L0W A;  1SYB A;  3JAM c;  5EAY A;  1GD7 A;  2JEB I;  3VR4 A;  1PYW D;  1Y69 U;  3FPP A;  4HCE A;  1SYC A;  1PDQ A;  4DK0 A;  2DUD A;  1Y1V B;  4JCV E;  3MZ5 A;  3STB D;  1HQM C;  3D4D A;  3GP7 A;  3S16 B;  5EPJ A;  1T5E A;  3GTP H;  4PZ8 A;  1D2B A;  3BYT B;  2AQ1 B;  4JI6 Q;  2F4I A;  4QY7 A;  2UU9 L;  2EYF A;  4G7O C;  3OTO L;  1B2T A;  3K6O A;  1B3Q A;  1ROD A;  1ZKO A;  1CA5 A;  2CQA A;  4OIJ A;  4DGZ A;  4DA2 A;  2E5L Q;  1OXS C;  2V4D A;  2NVT H;  2ZJQ A;  4C3J B;  3A8I E;  3PO2 G;  1N32 L;  3J81 c;  2PW5 A;  1ILP A;  3IAY A;  4EQN A;  1LTA D;  4AQY L;  1M1K C;  1U5K A;  2UXC Q;  4CDC C;  2A68 D;  5GAG C;  3T1Y Q;  1JR0 D;  2CWP A;  2CH4 A;  2F03 A;  2DNE A;  4POF A;  1N34 L;  2L4N A;  1UWV A;  4ME5 A;  1RCV D;  3CU7 A;  2RQX A;  1CK1 A;  2SNM A;  2QCP X;  4JOI A;  5FLX c;  3BZK A;  1EOT A;  2VW9 A;  4JI3 Q;  2H1E A;  4DR1 L;  1E0B A;  2CW0 D;  4LUZ A;  5IYB G;  1A6X A;  4PG3 A;  2VQF L;  2XWJ B;  1DXM A;  1CKO A;  1IYU A;  2DJF C;  2R7Z B;  1GJX A;  5IGD A;  2B2T C;  3HOZ H;  4GKK Q;  1TT2 A;  2JA8 B;  2ZXO A;  5LL6 X;  3ONA B;  1HNZ Q;  1EUJ A;  2R92 B;  3T1H L;  4CKC A;  1N8R C;  1HQR D;  5ELB A;  5C5M A;  3SHL A;  3Q23 A;  2AWN A;  1ASZ A;  4B3R L;  3KBX A;  2MNA A;  1G6Z A;  1Q8K A;  3CQZ B;  3OWE B;  1E22 A;  3GQB A;  3G6E A;  2NWG A;  2LXJ A;  4H0L C;  2K1B A;  4K6D A;  3L0O A;  5C0X H;  4GN4 B;  2ASB A;  1S5D D;  3K7U C;  2WKC A;  4HTH A;  4LMQ D;  5C5L A;  3RD4 A;  1Q86 C;  2AUJ D;  1XTC D;  3S2D B;  3M4Q A;  1EOV A;  1O78 A;  3ND9 A;  4UP8 A;  2NVX H;  4Q0F A;  1K73 C;  3HOY G;  1CHQ D;  3CKI B;  3OSO A;  2F4V Q;  3QB3 A;  3IL8 A;  2BCO A;  2DY7 A;  1G2S A;  4HMJ A;  2EJM A;  1D1I A;  3H3V C;  1AEX A;  1HA6 A;  1EIG A;  1HNW L;  4ZYS A;  3HOX G;  4QCL A;  1IL2 A;  5KGU A;  2L15 A;  2CCZ A;  2WAC A;  1WFQ A;  1E2W A;  3T51 B;  4DKA C;  2XIW A;  3CAM A;  1IBL Q;  4HIM A;  3OHX C;  2PPB C;  1V43 A;  4DNI A;  1MKH A;  4H13 C;  1G6P A;  1YNX A;  4K0K Q;  2E2J H;  1HR0 W;  3HOU B;  3S17 B;  3NHH A;  1IYV A;  3OW2 A;  1D5M C;  3H09 A;  4GOP C;  3M3Y B;  3J80 E;  1VQ9 A;  2JA6 G;  1Y8N B;  1YHA A;  3CCQ A;  4B3S Q;  1JMC A;  2RSO A;  3FEW X;  5IWA L;  2N55 A;  2IPK D;  5T1I A;  2E2I H;  4A3E H;  1STA A;  4LF4 L;  1ET6 A;  1GM5 A;  1EQR A;  5M5X H;  3A55 A;  3A7A B;  1HJP A;  5EJW A;  1STG A;  2AUK A;  4QJF A;  5ELF A;  4DV5 Q;  2RHS B;  1PXU A;  1II3 A;  5C44 G;  1TWF H;  2X69 A;  2XGT A;  1XXG A;  4JC0 A;  5EKL A;  3K80 C;  4A3J B;  2R93 H;  2EY1 A;  1Y1W G;  3QR8 A;  3P1H A;  4XT1 B;  2PI2 A;  5C0X G;  4QGU A;  2PZW A;  1R9T B;  2VZA A;  1UE6 A;  3HGB A;  2F0D A;  1YJW A;  4AH6 A;  1SSO A;  5D14 A;  3TP7 A;  2Z6B A;  3J7A 5;  2YTY A;  1MSG A;  1LYL A;  3JAM E;  2KCM A;  4ZUI A;  1I3Q B;  4KHP Q;  4QL5 A;  3WOE A;  1QOH A;  4JBK A;  3DHQ A;  1G91 A;  1A15 A;  4L63 B;  3MWY W;  3TSS A;  3BS1 A;  1IBK L;  1KAA A;  1YNN C;  3DLL A;  3U4Z A;  2LSS A;  5E1F A;  3A5U A;  4OO1 G;  3K0X A;  2F0H A;  5IP9 H;  4HIK A;  1G51 A;  1CSP A;  4LW1 A;  2VL6 A;  2OWO A;  2L1B A;  1ENA A;  4X6A H;  1V9P A;  2Y0S B;  4IUT A;  4ODG A;  4N8X 1;  4DV7 L;  4B3T Q;  4X65 Q;  3EIV A;  3HKZ G;  2LS0 1;  1KLU D;  3D3R A;  2WAQ B;  1AW7 A;  4A3E G;  3L7Z C;  1PYS B;  1X65 A;  5M3M B;  4IN3 A;  1TS3 A;  1LO5 D;  3W3A A;  2QDL A;  4GNX C;  1L0Y B;  1TR5 A;  2QKI C;  4LUO A;  5C3E G;  2V1C C;  4A93 H;  1QUQ B;  4R9W A;  2NVT B;  5EKK A;  1UAP A;  5C3W A;  5FLX E;  3MXP A;  1FYC A;  1DGS A;  3T53 B;  1F2Z A;  1YHQ A;  1E1O A;  1PH8 A;  5A35 A;  2B2V A;  3M4O H;  2EQS A;  5LMN Q;  1X54 A;  2D0P A;  4PMB A;  4BWG B;  4DK6 C;  3HP3 A;  5COY A;  1QUQ A;  1VQ4 A;  2KCT A;  1H9K A;  5LMU L;  1VQH A;  4NDX A;  1U4M A;  2MO0 A;  3HG9 A;  5JEA G;  2B39 A;  2C5C A;  3MEH A;  2YU9 H;  3HKS A;  2B8G A;  4DV3 L;  5GAE C;  3TEH B;  2J4X A;  3CC4 A;  2F0P A;  3D8G A;  4GOP B;  1ET9 A;  2N3S A;  1K3B C;  1NNX A;  2Q8I B;  1TWG B;  2BH8 A;  3HOZ B;  5CV4 A;  1O7Y A;  1YIJ A;  4X64 Q;  5AJ3 Q;  3CF5 A;  2LFN A;  3M85 A;  2UUA L;  1M8A A;  4BY7 H;  3RZD H;  3K57 A;  4JI4 Q;  2BH2 A;  4JG2 A;  4YY3 Q;  1I50 H;  1O7I A;  2F0Q A;  2ZTE A;  3OMG A;  2O2L D;  3MAQ A;  3SDZ A;  2EYM A;  4IOA A;  1NBW A;  5IYD H;  3S14 B;  4LNQ A;  4MNO A;  4GN5 A;  3S15 B;  3HOW B;  4A93 G;  1EEI D;  2E2D C;  4UP9 A;  1NCV A;  2I5M X;  2MUY A;  2JQO A;  1CKN B;  4X3T A;  1GXD C;  2A69 D;  4IPG A;  3BYY B;  2XRS D;  2AKW B;  2OEO A;  2B2W C;  3KOJ A;  1YJ9 A;  1W3S A;  3HS0 C;  4DUZ L;  5CBE E;  5E3F A;  4B08 A;  2WII B;  3MXN B;  1PFN A;  5BR8 Q;  1RTN A;  3CCL A;  4I65 A;  1CT1 D;  4IAL A;  2B2Y A;  2F3W A;  4JI2 L;  3IFT A;  1WTQ A;  1BF4 A;  4CGY B;  1SAP A;  2I5L X;  1F9S A;  2OTJ A;  1X9N A;  2KBN A;  3A56 A;  1D7Q A;  1LT4 D;  5I9O A;  4FP5 D;  2WB1 G;  2JA7 H;  3EJI A;  3MVV A;  5KYL A;  3HOV G;  4ZK9 B;  5HGQ A;  2J7Z A;  4LFC L;  5C4Z A;  4RKL A;  4LF6 L;  3CP0 A;  5M5X B;  5C3X A;  1PYB A;  1TWH B;  1ASY A;  1CUK A;  1S40 A;  3I90 A;  1TWF B;  4Y52 H;  3H0G H;  5E7N A;  3NEL A;  5ELN A;  4IOC A;  2PO4 A;  3TRZ A;  3P20 A;  1JJC B;  3NQT A;  1KQS A;  1FR3 A;  3B6Y A;  5IYD G;  4A3M B;  3OW7 A;  4WOR A;  4DXF A;  3KLS X;  4DNT B;  1TWA H;  2MGS A;  2B2U C;  3CCR A;  4OGQ C;  5BN5 A;  1RD9 D;  2I07 B;  3QWN A;  1TWC B;  2KCC A;  4FXD A;  1D6E C;  1Q46 A;  1IBM L;  3I4N H;  1VQK A;  3GD7 A;  4HED A;  5F2D A;  2A6H C;  3GDE A;  1K3R A;  1FD7 D;  1A2U A;  3TDQ A;  2PW7 A;  1CI3 M;  5FK9 C;  1WCM B;  5KEE A;  1DCZ A;  1KTK A;  3CMA A;  2HCI A;  4EGV A;  4XQN A;  1PFB A;  1HNZ L;  3CXC A;  4DV4 Q;  4KV6 A;  2RSN A;  3FKI B;  1LV9 A;  4JBM A;  3GTO B;  1RL2 A;  1B44 D;  1TKW B;  3I3C A;  4DR5 L;  4OX9 L;  4KKU A;  5M3F B;  5BN4 A;  3CD6 A;  3PUW A;  1JIC A;  5KIX A;  4LF5 L;  3M4Y A;  5CV5 A;  1MGS A;  3TME A;  1AZQ A;  1I6H H;  1DZ1 A;  3PO3 B;  1IL8 A;  5IP7 G;  4KKS A;  4YHH L;  2VS1 A;  2JA7 G;  4DR6 Q;  5FJ8 H;  4MIU A;  4OO1 I;  1GUW A;  1TS2 A;  4HCS A;  5KNB A;  2JSO A;  3FRP B;  4RHS A;  4JYA Q;  4IFD J;  4KN7 C;  2UXB L;  1PA6 A;  3RZO B;  1HH2 P;  3H94 A;  1YZ6 A;  1SMY C;  3PUZ A;  3GTM B;  1HRJ A;  2RKS A;  4QUC A;  3F8T A;  3QO2 A;  2K05 A;  2F0N A;  1B4O A;  4V0B A;  2A6E C;  5CV8 A;  5IT9 E;  3VYS A;  4LFA Q;  1PZJ D;  4UDU C;  1D5Z C;  1KC8 C;  4A3D G;  2UUB Q;  3TQY A;  4DUY Q;  2PQA A;  3VR2 A;  4JI8 L;  5HGT A;  1U4R A;  4JV5 Q;  1KRS A;  4L5R C;  3URY A;  3M4O B;  3I4M B;  3CW2 C;  4RH6 A;  3BVM A;  4A3L H;  2NVQ B;  3I4N G;  2B63 B;  1SE8 A;  1VQA A;  1BXT A;  5G3L D;  3TN2 A;  4A3F H;  3ZJY C;  1RIP A;  2IT1 A;  4B3S L;  4NPS A;  2UUC L;  3AFP A;  1G29 1;  1EY0 A;  2TSS A;  3E0E A;  1X3G A;  4O2D A;  2QEJ C;  4X66 L;  3J80 L;  1YHB A;  4H02 A;  2LKV A;  1VQB A;  1VQO A;  1GKH A;  1PH3 A;  2D5D A;  1KDA A;  2XN9 C;  1FL0 A;  1SNQ A;  1BCP F;  4UHV A;  2HD3 A;  4PQX A;  4HSV A;  1S5E D;  1HNX Q;  1XNR L;  1Q90 A;  1U0L A;  4N9T A;  4B9X A;  1MBY A;  1GUN A;  4Q5V A;  1KAB A;  4C3J G;  5M9O A;  3X3M A;  4C3I B;  4LF8 L;  3SK4 A;  1KNA A;  1SMX A;  4C3H B;  2Q2T A;  3GTJ B;  1XTD A;  4G57 A;  4J8Q A;  2I46 A;  1J9O A;  2KHJ A;  1IW7 C;  3LWE A;  4QIW B;  5J39 A;  1STH A;  1RKN A;  3T4A C;  1A62 A;  1I5F A;  1YNN D;  4DV1 Q;  1I6V C;  3RR5 A;  3UDI A;  1RJT A;  2VXW A;  1DOM A;  3ULL A;  2JXM B;  4XQJ A;  4A3I H;  4BBS B;  1DOK A;  1Q1B A;  2K01 A;  2Z8L A;  1SND A;  5TSS A;  4X62 Q;  1SFO H;  1NTG A;  1WTR A;  3UDX A;  1KDB A;  1I94 Q;  3PO2 H;  3OIP A;  1XPR A;  3AEV A;  2R92 G;  1RF2 D;  1TS4 A;  4YWL A;  1QNK A;  3S1Q B;  4P2C B;  2JA5 B;  3BDO A;  1JOR A;  2WB1 E;  3EN2 A;  3I72 A;  4JI0 L;  5EKI A;  1PTO C;  5I2Y A;  3NEN A;  4WJ3 M;  3MA2 B;  3PUY A;  4DV6 Q;  4A3K B;  5C4J H;  4ZLT F;  4IUU A;  2E75 C;  2DGY A;  1PRT F;  1QZG A;  4ZKB B;  1Y8O B;  2XWB B;  5IY0 A;  3H0G B;  4RGN A;  1KHI A;  1A2T A;  4DU9 A;  2F0T A;  2ZTD A;  1XMQ L;  1JWU D;  5GAH C;  2ZT9 C;  4IUR A;  4L5Q A;  4UP7 A;  3U4V A;  2D2C C;  3Q8D A;  1CZG A;  2HIX A;  3J80 i;  3CME A;  1CFM A;  5IGB A;  4HID A;  1A0I A;  2K04 A;  1OXU A;  2XSC A;  1SE4 A;  1K8G A;  4OXP A;  3QIA A;  1XNQ L;  4A3I G;  1A3T A;  3HOU G;  4IQZ A;  2Q8R E;  1HFN A;  5C6A A;  3TP8 A;  2UXD Q;  4X3K A;  4X64 L;  1FJG L;  4TSS A;  3L9A X;  3U58 A;  4C56 C;  3HOY H;  4GZY C;  4HJ5 A;  2LMC B;  4ME3 A;  3MFG A;  1PH2 A;  3HOX H;  3KDF B;  2K33 A;  4JW0 A;  1AH9 A;  1WTH A;  1K83 B;  4KJO A;  3UDF A;  2ES2 A;  2JK8 A;  2N8N A;  1SXT A;  1D1K A;  4CKE A;  1B7Y B;  4A3J G;  3GTK H;  2WFW A;  2F0M A;  4DR7 L;  2DNC A;  3EFX D;  2VB3 X;  3JAM i;  5K36 G;  3CPF A;  3F2U A;  4NXN L;  5JVG 3;  4LF9 Q;  2K5Q A;  4RCN A;  3X3N A;  2VUM H;  2QIL A;  2VQE L;  4YIJ A;  2RCN A;  1JQY D;  4LJZ C;  3RLO A;  2JA6 H;  4B3M Q;  4LFB Q;  3H6M A;  1GOZ A;  1RHP A;  4AYB E;  1R4Q B;  1EZ8 A;  2NN6 G;  1HUM A;  4JI7 Q;  2HUG A;  1PZI D;  1F2L A;  1T9H A;  5IGE A;  3E6Z X;  4POG A;  2IL8 A;  5C44 H;  3K5N A;  4A76 A;  3GO5 A;  3IKJ A;  3NTH A;  1N33 Q;  2F0J A;  1Y1W H;  4P71 A;  2QEX A;  4OON A;  4A3F B;  1QWY A;  4C1N I;  3C1F A;  4WJ4 A;  2Y0S G;  1EY7 A;  2K6A A;  3OIQ A;  2DJG C;  3DMU A;  4DV0 Q;  1V1O A;  1EL0 A;  1S5C D;  4C2M B;  1ICF B;  4RKB A;  1JOO A;  3T13 A;  5DAU A;  2ATW A;  2F0W A;  2YYZ A;  5COR A;  2EXD A;  1PTO B;  4DK3 C;  4K8J A;  4DPG A;  4ID6 A;  5M3M G;  3S1M B;  1UEA B;  2Z0S A;  4FF2 A;  1TQO A;  5E4W C;  4NB3 A;  2AQ2 B;  4DR4 L;  3E9H A;  2R7F A;  2NVY B;  1FNW A;  1LTS D;  3BJU A;  1MD2 D;  2EOT A;  5C4X B;  1PMR A;  1QZH A;  4OO1 H;  1N36 Q;  1VQJ A;  4DV2 Q;  1EFI D;  2VUM G;  1PLF A;  4IUN A;  1ONL A;  2A6H D;  1UUP A;  5M5W B;  2CKZ B;  4PZ7 A;  4KMU C;  3CCU A;  2HT1 A;  3RLN A;  3GTQ H;  4JI1 L;  1HR0 Q;  1SNC A;  1BVS A;  2A19 A;  1TS5 A;  3NBH B;  4Y7N B;  2Q2U A;  1I4G A;  3I7F A;  3GTG B;  3NUC A;  5C3E H;  4P73 A;  1L1O C;  5ELD A;  4MN3 A;  2NTS A;  2BDO A;  4BBR H;  3CHB D;  4XYQ A;  4KKT A;  2XTI A;  3EA6 A;  1H9J A;  3ULJ A;  3PO2 B;  3NBH A;  1LTT D;  1DJR D;  3PGZ A;  2KHS A;  3R93 A;  1Q82 C;  3S1R B;  1M4V A;  1Z9F A;  1SMY D;  1K8A C;  2FJ2 A;  3S1N B;  2LY7 A;  1LTB D;  2A6E D;  2L9H A;  4UPA A;  1H9M A;  3K7A H;  5JEA H;  2FHT A;  2MJ8 A;  1VS0 A;  1EU3 A;  1HFG A;  4QB4 A;  2EZV A;  4KD4 A;  4HIO A;  3S2H H;  2K28 A;  1GUT A;  4DR2 L;  3OPO A;  3UE1 A;  1VCI A;  3PUX A;  1J5E L;  2Z4H A;  5KYI A;  4GLV B;  1VF5 C;  1HPC A;  1E7Z A;  5JOB A;  2Q2H A;  5M5Y H;  4PNY A;  1WVL A;  1OXV A;  4IUP A;  5IT9 L;  2EYH A;  2GVB A;  4ZQ3 A;  1XMO Q;  2NZ1 D;  4KD3 A;  1GVP A;  5T1G A;  2OT2 A;  4R4I A;  2K14 A;  4DF7 A;  4R4O A;  3J81 E;  1F2Y A;  4OEL B;  3P7J A;  3V05 A;  1O80 A;  1SE3 A;  1JJ2 A;  1B8A A;  2QGQ A;  5CMD A;  1WTO A;  3DM1 A;  1KIX A;  1VQD A;  2B2T A;  3FPU B;  3GTP B;  1FGB D;  3A74 A;  1Y8P B;  1MJE A;  1P16 A;  3A0J A;  4XYO A;  3KF8 B;  2EYJ A;  3BZC A;  3D4W A;  4BBR G;  1VF7 A;  4BY1 G;  3TP5 A;  1SYD A;  3M7N A;  5EQ0 A;  1IYJ B;  4A3B G;  2PI2 E;  4J15 A;  2JP1 A;  3OOC A;  1X32 A;  1S4Z A;  2C35 B;  3BDC A;  3MTS A;  4GKJ Q;  3HOX B;  1STY A;  1SEB D;  4XTC S;  3R3O A;  3RMH A;  1O7L A;  1SNP A;  4O1N A; 
#chains in the Genus database with same CATH homology
 2E2H H;  2EIF A;  3GD7 A;  2QA4 A;  1VQK A;  4LF5 Q;  3GTG H;  4R4Q A;  2GVA A;  4IJL A;  4P75 A;  3GDE A;  4RMF A;  1K3R A;  1YVC A;  4YHH Q;  1EIF A;  2HHH Q;  4A3L G;  1OTC A;  4KLK A;  1QVF A;  1HZC A;  4IFD G;  2R6G A;  4KHZ A;  3CMA A;  3S14 H;  2ID0 A;  2VY3 A;  2ZTC A;  5GQO A;  1EWI A;  1R9T H;  4A3F G;  3E9I A;  3S15 H;  3HOW H;  4DR3 Q;  3CC2 A;  2UXB Q;  3F2D A;  2Q2I A;  1HNZ L;  4LF7 L;  3CXC A;  4DV4 Q;  2R7D A;  4JBM A;  1YJN A;  1RL2 A;  2OQ0 A;  4DR5 L;  3S1R H;  4OX9 L;  5JJK A;  4GKJ L;  4GLA C;  3IRB A;  5JJL A;  3CD6 A;  3PUW A;  3S1N H;  1VQM A;  4APV A;  4IO9 A;  2ZM6 Q;  1BKB A;  4LF5 L;  1I6H H;  2A1A A;  1C7Y A;  3HOV H;  3TRE A;  5IP7 G;  4YHH L;  4NXM Q;  2HHH L;  1VQ5 A;  3GTL H;  2VS1 A;  4JI8 Q;  2JA7 G;  4DR6 Q;  5FJ8 H;  4OO1 I;  3L2P A;  5FLM H;  2HIV A;  4YCV A;  5IYB H;  1N9W A;  3MEF A;  4GOP A;  4JYA Q;  4IFD J;  1PVO A;  2UU9 Q;  2GN5 A;  4DR3 L;  1L1O B;  2UXB L;  1PA6 A;  1HH2 P;  2NN6 I;  1YZ6 A;  4JI5 L;  2K50 A;  3PUZ A;  4DV4 L;  1KXL A;  2KHI A;  1VQL A;  1L0W A;  3JAM c;  1H95 A;  5EAY A;  1GD7 A;  2JE6 I;  2JEB I;  3F8T A;  4BY1 H;  2Y0S E;  3OYY A;  1SLJ A;  4LFA Q;  1VQ7 A;  3HOZ G;  4A3D G;  1KC8 C;  4IPC A;  2UUC Q;  4A3B H;  2UUB Q;  3TQY A;  1N32 Q;  2F3I A;  2JJQ A;  3DM3 A;  2DUD A;  4JCV E;  4PZ6 A;  4NXM L;  4DUY Q;  2PQA A;  4BXX G;  4X66 Q;  1EYG A;  3STB D;  4JI8 L;  2WAQ E;  4DR6 L;  1L1O A;  4JV5 Q;  3RLF A;  1IZ6 A;  1KRS A;  4L5R C;  1VQE A;  1TWH H;  2K5N A;  2YV5 A;  3GTP H;  3CW2 C;  4PZ8 A;  4YWM A;  3CC7 A;  1N34 Q;  4JYA L;  4A3L H;  4JI6 Q;  4QY7 A;  1QVG A;  2UU9 L;  3I4N G;  5JJI A;  1CKM A;  1YEZ A;  3OTO L;  1HZ9 A;  1SE8 A;  4P74 A;  1XNR Q;  1VQA A;  4A3F H;  1P8L A;  3ZJY C;  2E5L Q;  1RIP A;  4A3M H;  2IT1 A;  1BBU A;  4B3S L;  1OXS C;  2NVT H;  4A3G H;  4DR1 Q;  1CKN A;  4LFA L;  2ZJQ A;  4NPS A;  2UUC L;  2NZH A;  4EX5 A;  1PV4 A;  3KJP A;  3PO2 G;  3AFP A;  2UUB L;  1G29 1;  3E0E A;  4O2D A;  3J81 c;  1X3G A;  3HOW G;  4QQB X;  2VQF Q;  4LF8 Q;  1N32 L;  3NEM A;  4DUY L;  4AQY L;  1M1K C;  4X66 L;  2VNU D;  1U5K A;  1TWC H;  1AE2 A;  1C9O A;  1YHB A;  3FP9 A;  4YCW A;  5GAG C;  4H02 A;  3T1Y Q;  1IBM L;  4JV5 L;  5ELO A;  1Q12 A;  1VQB A;  1VQO A;  2CQO A;  1GKH A;  2YTV A;  2CWP A;  1PH3 A;  5IP7 H;  3G4S A;  4LWC A;  4POF A;  1FL0 A;  1N34 L;  2E8G A;  3W1B A;  3T1H Q;  1IXR A;  1UWV A;  4JI6 L;  1WCM H;  3BU2 A;  4B3R Q;  1EQQ A;  3AFQ A;  1HNX Q;  4JOI A;  1XNR L;  1YIT A;  5FLX c;  1U0L A;  3BZK A;  2E5L L;  2UXC Q;  4A3C G;  3J81 j;  1OXT A;  2VW9 A;  4JI3 Q;  4DR1 L;  4HJ9 A;  4LUZ A;  5IYB G;  3FKI H;  2OCE A;  4PG3 A;  3GTO H;  1CSQ A;  3PUV A;  4GNX B;  2K52 A;  3PCO B;  2VQF L;  4LF8 L;  1CKO A;  1SMX A;  5M3F H;  1PH9 A;  2Q2T A;  1XTD A;  3HOZ H;  4GKK Q;  2UXC L;  3T1Y L;  4A3D H;  1Y14 B;  1XPU A;  2KHJ A;  3F2B A;  4TQU S;  1LTL A;  2OQK A;  4LUV A;  3PO3 H;  3CCV A;  1HNZ Q;  1JB7 A;  4BXX H;  1EUJ A;  2CWA A;  5H1S E;  1E24 A;  1A62 A;  3T1H L;  1N8R C;  1I5F A;  1UEB A;  1S72 A;  4DV1 Q;  3PIO A;  4MZ9 A;  2JA9 A;  2AWN A;  3RR5 A;  3UDI A;  1ASZ A;  2MNA A;  4B3R L;  1HNX L;  1HNW Q;  1Q8K A;  1EIY B;  1E22 A;  3ULL A;  3G6E A;  4GNX A;  1PHJ A;  4JI0 Q;  4A3I H;  4JI3 L;  4RG1 A;  3HFZ B;  3RZO H;  2LXJ A;  1Q1B A;  3GTM H;  3L0O A;  1PH1 A;  1WJJ A;  4GN4 B;  2ASB A;  1UE7 A;  3K7U C;  1VQN A;  1UE5 A;  4X62 Q;  5LMN W;  1SFO H;  1NTG A;  1V1Q A;  2R93 G;  4GKK L;  3UDX A;  1LUZ A;  1K0R A;  1I94 Q;  3PO2 H;  1Q86 C;  2MO1 A;  4A3M G;  1WI5 A;  1Y1V H;  4A3G G;  4JI5 Q;  3M4Q A;  1EOV A;  4UP8 A;  1XPR A;  2NVX H;  3AEV A;  1K73 C;  3HOY G;  2R92 G;  4R1J A;  2F4V Q;  4DV1 L;  4YWL A;  2D0O A;  3S16 H;  3H15 A;  1XMQ Q;  1KL9 A;  1HNW L;  3I4M H;  3HOX G;  1IL2 A;  3UDG A;  2L15 A;  4GS3 A;  2NVQ H;  2IX0 A;  2WB1 E;  3EN2 A;  4JI0 L;  5IWA Q;  1YBY A;  2B63 H;  4GN3 B;  2CCZ A;  3NEN A;  4WJ3 M;  1WFQ A;  4BBS G;  3PUY A;  5IT9 c;  1PH6 A;  4DKA C;  4DV6 Q;  3CAM A;  1IBL Q;  4HIM A;  5C4J H;  2ZJR A;  3PIP A;  4LF4 Q;  2I0Q A;  3UE0 A;  4A3C H;  1V43 A;  3ER0 A;  1WCM G;  4X62 L;  4DNI A;  1MKH A;  2DGY A;  3STB C;  4C3J H;  5GAD C;  3ULP A;  1QZG A;  1YNX A;  1I94 L;  2I5H A;  1VQ6 A;  2E2J H;  3PF4 A;  4K0K Q;  1XNQ Q;  1VQF A;  1HR0 W;  1HZB A;  3M9B A;  3OTO Q;  3F2C A;  5IY0 A;  3OW2 A;  3KF6 B;  1KHI A;  2CFM A;  1A8V A;  3CCJ A;  5IYC H;  4GOP C;  2F4V L;  3FKI G;  3KFU A;  3M4P A;  1YI2 A;  5IP9 G;  1VQ9 A;  2JA6 G;  2ZTD A;  1B70 B;  1SN8 A;  1YHA A;  1XMQ L;  1FJG Q;  5GAH C;  2JEA I;  3CCQ A;  1E3P A;  1A63 A;  5M3F G;  4B3S Q;  2H5X A;  3TS2 A;  4L5Q A;  1JMC A;  4AYB G;  3FHW A;  5IWA L;  2ALY B;  4UP7 A;  3U4V A;  2BA1 A;  3Q8D A;  2HIX A;  3D0F A;  3J80 i;  3PO3 G;  3PF5 A;  1UE1 A;  4MTN A;  3G71 A;  3CME A;  4DV6 L;  4AQY Q;  1IBL L;  4A3E H;  2E2I H;  4A3K G;  4LF4 L;  5J3B A;  1GM5 A;  1W2B A;  4HID A;  1EQR A;  5M5X H;  1A0I A;  1EFW A;  1OXU A;  4DAY B;  1HJP A;  1KRT A;  1K8G A;  3LGJ A;  4OXP A;  4QJF A;  1VQ8 A;  4K0K L;  4DV5 Q;  2RHS B;  1PH7 A;  5C44 G;  4C3I H;  1TWF H;  2XGT A;  1E1T A;  4JC0 A;  4A3I G;  1XNQ L;  3K80 C;  2R7Z H;  3HOU G;  4C3H H;  4DR7 Q;  2R93 H;  3GTJ H;  2Z6K C;  1Y1W G;  1JJG A;  4NXN Q;  2PI2 A;  1IBK Q;  2K4K A;  5C0X G;  3ERS X;  4QGU A;  4X64 L;  2UXD Q;  2VZA A;  1FJG L;  1G6P A;  1Z47 A;  1UE6 A;  1YJW A;  4AH6 A;  2VQE Q;  3U58 A;  2IHF A;  2R92 H;  3HOY H;  4HJ5 A;  4ME3 A;  1GO3 E;  2HQL A;  3J7A 5;  5IE8 A;  1SRO A;  1PH2 A;  1Y1V G;  2YTY A;  5HY6 A;  3HOX H;  4IFD I;  3CQZ H;  3KDF B;  1LYL A;  1AH9 A;  1LM0 A;  2KCM A;  3UDF A;  2ES2 A;  1VQG A;  4KHP Q;  1QVC A;  2JK8 A;  2N8N A;  4BBS H;  4DV7 Q;  4QL5 A;  3I4M G;  1B7Y B;  4DV5 L;  4JBK A;  1MJC A;  4A3J G;  2WFW A;  2B63 G;  3GTK H;  1VQI A;  4DR7 L;  4AIM A;  4OWW B;  4HJ7 A;  3JAM i;  5K36 G;  3CPF A;  4L5T A;  2IX1 A;  3I55 A;  4NXN L;  1VQC A;  4LF9 Q;  4R4C A;  1IBK L;  3RN5 A;  2UXD L;  4XIG S;  3H3V I;  1MIU A;  3DLL A;  1NY4 A;  3U4Z A;  3CCE A;  1PH4 A;  2LSS A;  2VUM H;  4JOI C;  2VQE L;  3S2D H;  2RCN A;  3A5U A;  3W1G A;  5C0X J;  4OO1 G;  3K0X A;  2AWO A;  3RLO A;  5IP9 H;  4HIK A;  2JA6 H;  4B3M Q;  1G51 A;  1CSP A;  3S1Q H;  4LW1 A;  2VL6 A;  2OWO A;  4LFB Q;  3VDY A;  2JA5 H;  4X6A H;  1SRU A;  1V9P A;  3TS0 A;  4AYB E;  5IYC G;  2NN6 G;  4KHP L;  1XJV A;  4JI7 Q;  4DV7 L;  4B3T Q;  2N78 A;  4X65 Q;  1JT8 A;  3EIV A;  4O0A A;  3HKZ G;  4A3K H;  4IPH A;  4BA1 I;  2YTX A;  3F1Z A;  1T9H A;  4BY7 G;  2NZO A;  4LF9 L;  4A3E G;  4POG A;  2PNH A;  1FVI A;  2PMZ E;  1PYS B;  3L7Z C;  1X65 A;  5C44 H;  3HOU H;  3S17 H;  4A76 A;  3GO5 A;  3CCS A;  4YCU A;  1PFS A;  4GNX C;  1Y1W H;  4LUO A;  1N33 Q;  5C3E G;  3M3Y H;  2V1C C;  5LMU Q;  4P71 A;  2QEX A;  4OON A;  4R4T A;  4B3M L;  4DR4 Q;  2BA0 A;  2R7Z G;  4A93 H;  4LFB L;  1QUQ B;  1SR3 A;  4DV3 Q;  4WJ4 A;  2Y0S G;  2B3G A;  2JA8 G;  3PV0 A;  4JBJ A;  4DV0 Q;  4JI7 L;  1DGS A;  3AYH B;  4B3T L;  4X65 L;  1BBW A;  1WOC A;  1E1O A;  1YHQ A;  1X56 A;  2ATW A;  3CPW A;  1PH8 A;  1NMG A;  2YYZ A;  3A5Z B;  4UY8 C;  3M4O H;  2EQS A;  5LMN Q;  2EXD A;  5C0X I;  3KJO A;  1X54 A;  4DK3 C;  4DPG A;  2D0P A;  4JBW A;  2UUA Q;  3J80 c;  3I2Z A;  4DK6 C;  4A3J H;  5M3M G;  1QUQ A;  4JI1 Q;  1VQ4 A;  1N33 L;  2Z0S A;  3I56 A;  2KCT A;  5LMU L;  4NB3 A;  1VQH A;  2MO0 A;  4P72 A;  5JEA G;  4BA2 I;  4DR4 L;  3E9H A;  2R7F A;  2YU9 H;  3BJU A;  3HKS A;  4DV3 L;  5GAE C;  3TEH B;  1QZH A;  3CC4 A;  1N36 Q;  1VQJ A;  2AMC B;  4DV0 L;  2A8V A;  4GOP B;  2N3S A;  4DV2 Q;  2VUM G;  1X6O A;  2KEN A;  3JC6 6;  3KYH C;  2BH8 A;  1K83 H;  1I3Q H;  2CKZ B;  4PZ7 A;  2K5V A;  1VQP A;  1YIJ A;  4X64 Q;  5AJ3 Q;  2B29 A;  3CF5 A;  5LMN L;  3CCU A;  1KD1 C;  2F52 A;  2JA5 G;  3HKZ E;  1X3F A;  3I4O A;  3M85 A;  2OTL A;  2UUA L;  2HT1 A;  3RLN A;  4A4I A;  4GLX A;  4JI1 L;  1HR0 Q;  3GTQ H;  1NE3 A;  1BVS A;  3RZD H;  2A19 A;  4BY7 H;  2RHQ B;  1X3E A;  3NBH B;  4JI4 Q;  2BH2 A;  2IHE A;  4JG2 A;  4YY3 Q;  2PQA B;  1I50 H;  1KAW A;  3K8A A;  2Q2U A;  1J6Q A;  2AHO B;  1O7I A;  2MQH A;  3KF6 A;  4DUZ Q;  3I7F A;  2ZTE A;  3D31 A;  5C4X G;  3KLW A;  1X55 A;  5C3E H;  1M90 C;  4HJA A;  4P73 A;  1L1O C;  5JEA J;  1N36 L;  4IOA A;  5GRO A;  3EBE A;  1S3O A;  1WYD A;  4DV2 L;  3W5O A;  1NBW A;  3SGI A;  4BBR H;  5IYD H;  3H0G G;  1Q1E A;  4LNQ A;  4MNO A;  2XTI A;  4JI2 Q;  3RNU A;  2JA8 H;  3ULJ A;  3G48 A;  2K75 A;  4ALP A;  2ZM6 L;  5AJ3 L;  4GN5 A;  4QIW E;  4DR2 Q;  4A93 G;  4UP9 A;  4OWX B;  2WP8 J;  2I5M X;  2JQO A;  1J5E Q;  1OXX K;  1TXY A;  1CKN B;  3RN2 A;  3PGZ A;  1HR0 L;  4OWT B;  1Q82 C;  4IPG A;  1Z9F A;  4JI4 L;  1K8A C;  3U50 C;  4YY3 L;  2AKW B;  1Q7Y C;  2Z6K A;  3KOJ A;  1YJ9 A;  4L5S A;  5M3M H;  1W3S A;  4DUZ L;  4IJH A;  4UPA A;  4PMW A;  3MXN B;  3K7A H;  1C0A A;  1D8L A;  1NMF A;  3CCM A;  4LFC Q;  1VS0 A;  5BR8 Q;  3CCL A;  4LF6 Q;  4DAM A;  4JI2 L;  4HIO A;  4KI0 A;  3S2H H;  1Q81 C;  3S24 A;  4DR2 L;  4C2M H;  3UE1 A;  3KDF A;  1VCI A;  3PUX A;  4FDB A;  1J5E L;  2I5L X;  2MFI A;  3H3V H;  3ICE A;  4GLV B;  4A75 A;  1E7Z A;  2OTJ A;  2Q2H A;  5M5Y H;  1X9N A;  1OXV A;  2KBN A;  4TVA B;  2GVB A;  1D7Q A;  2N49 A;  2RF4 A;  2WB1 G;  2JA7 H;  1XMO Q;  3S1M H;  1NJI C;  3HOV G;  1JE5 A;  1GVP A;  5HGQ A;  1XPO A;  4LFC L;  4R4I A;  1PH5 A;  5BR8 L;  2K14 A;  3J7Z C;  4R4O A;  2NVY H;  4LF6 L;  3CP0 A;  1IBM Q;  1L2F A;  5FJ8 G;  2FXQ A;  5C4X H;  1PYB A;  5FLM G;  1B8A A;  4YWK A;  2QGQ A;  1KIX A;  1JJ2 A;  1ASY A;  1VQD A;  1CUK A;  1HZA A;  1S40 A;  3A74 A;  3K81 C;  4Y52 H;  1MJE A;  3H0G H;  5E7N A;  3NEL A;  2K5H A;  5ELN A;  3PSI A;  1P16 A;  1TWG H;  5M5W H;  3A0J A;  3J81 i;  2ZJP A;  4IOC A;  1K9M C;  3KF8 B;  3TRZ A;  1JJC B;  3BZC A;  3WWV A;  1KQS A;  3B6Y A;  4EQ5 A;  4BBR G;  2D62 A;  5IYD G;  4BY1 G;  4IPD A;  4LF7 Q;  3M7N A;  1IYJ B;  4A3B G;  2PI2 E;  2IY5 B;  1TWA H;  1XMO L;  4J15 A;  3CCR A;  1FGU A;  2C35 B;  4DR5 Q;  4OX9 Q;  3AQQ A;  4GKJ Q;  1AE3 A;  2LXK A;  4XTC S;  5DLQ E;  4Y7N H;  4HJ8 A;  1Q46 A;  2WAQ G;  3I4N H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...