4BC5A

Crystal structure of human d-xylulokinase in complex with inhibitor 5- deoxy-5-fluoro-d-xylulose
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
524
structure length
524
Chain Sequence
RRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLTVTSPVLMWVQALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLRLHQQLQDCFSISDCPVWMDSSTTAQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIYQQNPEAYSHTERISLVSSFAASLFLGSYSPIDYSDGSGMNLLQIQDKVWSQACLGACAPHLEEKLSPPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGDNPASLAGMRLEEGDIAVSLGTSDTLFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSKALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDVEVRALIEGQFMAKRIHAEGLGYRVMSKTKILATGGASHNREILQVLADVFDAPVYVIDTANSACVGSAYRAFHGLAGGTDVPFSEVVKLAPNPRLAATPSPGASQVYEALLPQYAKLEQRILSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XYLULOSE KINASE
publication title Structure and Function of Human Xylulokinase, an Enzyme with Important Roles in Carbohydrate Metabolism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 180
structure length 524
sequence length 524
chains with identical sequence B, C
ec nomenclature ec 2.7.1.17: Xylulokinase.
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00370 FGGY_N FGGY family of carbohydrate kinases, N-terminal domain
A PF02782 FGGY_C FGGY family of carbohydrate kinases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bc5A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bc5A01
2ZWHA 4EHTA 5I9EB 3WXIA 4FWNA 1RGIA 3LM9A 3VF2A 2VCPA 3VESA 4WQ4A 4YDUA 5JICA 3J8AA 4CBWA 5FPEA 1GLFO 3WXJA 2UYTA 2YCHA 2E2NA 5KPRA 2NZTA 4PL8A 3GL1A 4CZEA 2E1YA 2CGLA 3VGLA 5EX5A 3WUHA 2P9SB 2IVOA 4B1ZA 4IXCA 3SJHA 4RWTA 3VF6A 4FSVA 3U9ZA 4IZ9A 3BF3A 2HOEA 4F9OA 1T6DA 3CJ7A 3R9PA 4CZMA 4B1XB 1DGKN 1T6CA 2YJEA 3RSEA 4BRGA 3U8XA 1V4TA 2FLOA 4QS8A 3IFRA 3U9DA 4IJNA 3AY9A 5FPDA 3I8BA 3AAQA 3CHWA 1J6ZA 2D4WA 5AZIA 3VERA 3D2EB 4WQ5A 3DXKB 1BDGA 3CI5A 2E1ZA 4FOEA 1ATRA 3MDQA 2P9KB 1YAGA 1YXQA 2FSJA 4I6MA 3QMLA 4BRKA 4H0TB 3EZWA 4CD1A 3HTVA 3EKUA 3ZEUA 3G25A 3HM8A 2D0PA 3UE5A 2A40A 1JCFA 4PKGA 5JLHA 5F1XA 2CH6A 3S41A 2GWKA 1NGDA 3WXKA 2BTFA 5KQDA 3ULEB 4BG8A 2P9NA 2Q36A 3HZ6A 3QBWA 1NGEA 4BRQA 3LM2A 3CIPA 5AQFA 2QWPA 3IMXA 4BRAA 3R8EA 5AQNA 2Q2RA 1GLBG 1HKGA 5AZJA 3MN6A 3TU5A 2A6AA 3MCPA 2E2PA 2HF4A 3A5OC 4FPAA 3AAPA 1E4GT 2W41A 3C0BA 3O5BA 4JHDB 4BRFA 5EY4A 4BR5A 1T44A 3EO3A 4ISFA 4H0PA 3ZX0A 1QQNA 1NGJA 5JMVA 1XUPO 4H5NA 3QDKA 1U2VB 2E8AA 2IVPA 2P9PA 4EAHD 3KZBA 3JXUA 4H0YB 3CJBA 2CGJA 3QICA 2P9IA 1MA9B 1NLVA 4CZFA 3KHYA 4CBUA 1NGCA 2P9LA 3VETA 1KAXA 2CH5A 3H6EA 5BPMA 2ITMA 1TYQA 1XC3A 1XQSC 4BC3A 4ISEA 1S22A 1NWKA 3LDNA 2IVNA 1NGFA 5ADXH 3C7NB 2D1KA 3DWLA 5AFUH 4CJ7A 4K43A 3UKRA 5KQ8A 4AM7A 1RDWX 2WUSA 2QW9A 5BRDA 1SZ2A 3ZX3A 3BEXA 3GOIA 3O4WA 3WXLA 3LL3A 1EQYA 4FWKA 3H1VX 3IUCA 3A0IX 3EN9A 3R6MA 1KAYA 4XEIA 2AA4A 4A62A 1NM1A 4DQ8A 5AQYA 3UKUB 3A8YA 5E26A 1GLLO 1JCGA 5AQQA 4O8KA 3VENA 5AQLA 3A5LC 4ISGA 2GEMA 5TKYA 4A2AA 1Z05A 1ZC6A 2J4RA 3BUZB 4BVPA 5AQZA 3GG4A 3HSCA 4DHYA 2QWMA 4H5TA 4MLEA 4FO0A 2V7ZA 2QXLA 3FZLA 4DB3A 1QZ5A 3CJ1A 3SMSA 1TUYA 1KAZA 4BRNA 5LJWA 5F2RA 3DXMB 2YHXA 3QB0A 4QS7A 1GLDG 1SQKA 3D2EA 3HBTA 1BG3A 2ASPA 3SLCA 3CQXA 1DEJA 1K8KA 2YJFA 3M6GA 4B9QA 3U4LA 4LC9B 2ZGZA 3VEOA 5BRFA 2EWSA 3IDHA 1R59O 2FSNA 5ADXA 3O08A 3VOVA 5AFUA 2QWNA 3GDQA 1NGAA 1IJJA 4BRCA 5AQPA 5CE3A 2E88A 5AQMA 3O80A 1GLAG 1TUUA 3ULEA 3B8AX 3JS6A 4FWRA 2Q1NA 1LOTB 2PAVA 1BA1A 5AQRA 4CI6A 3O6WA 4M7XA 2P9UB 3WEEA 4CBXA 4IJAA 3KVGA 3HI0A 3ID8A 1U6ZA 3MMVA 3H1QA 1BOTO 3QFUA 1KXPA 3FR0A 2A3ZA 3MN7A 4JHDA 3VF4A 3FGUA 4H5WA 2ZGYA 4K25A 1LCUA 5AQKA 1WUAA 2QWQA 5BPNA 4JD2B 1HX1A 5FPNA 1BU6O 4HWIA 3O8MA 4MO4A 1BWFO 4BRLA 3ZETB 2DPNA 4BVOA 4CD3A 1WOQA 4FWOA 5AQOA 2HF3A 4EHUA 1U2VA 3W3DA 3O1WA 3EKSA 1G99A 1ATSA 3SMPA 2CGKA 2HMPA 5BN9A 2NRHA 4BRIA 3QBXA 4CZJA 1MWKA 4CZLA 1QZ6A 5AZJB 3FZFA 4WQ4C 3A5MC 3BP8A 4YDUC 5EOYA 1HUXA 2YI1A 5AQSA 2QM1A 2YHYA 4BR4A 4BRPA 4MO5A 2A5XA 3L4IA 2Q0RA 1ZBSA 3VGKA 2F9WA 1QQOA 2ASOA 3ZX2A 1NGGA 2GTDA 1ZXOA 3LDLA 3M1FA 4IWVA 3FFKB 5AQWA 2P9PB 3EL2A 4DCHA 3VEYA 1YUWA 2QWRA 5LJVA 4M63C 3VEZA 1MDUB 3W0LA 4B1WB 3DJCA 4XH5A 5EVZA 2H3GX 3ATVA 2P9IB 3P4IA 4L3QA 1MWMA 2FF6A 5BREA 5KPZA 4BR9A 2E2QA 4B1VA 3D2FB 2P9LB 4JAXA 4FWSA 4BGAA 4BRDA 4BG9A 4FPBA 4WQ5C 3FZKA 2A42A 2P9SA 3L0QA 3CJ9A 3H46O 1P8ZA 1GLCG 5AR0A 4BQLA 4BC5A 2VYPA 4CZGA 1S3XA 2FF3B 4FWLA 1QHAA 1HJOA 4FWPA 1OKJA 3CERA 3FLCO 3DXMA 3BF1A 4RCHA 4J8FA 4CZKA 2A41A 4Z94A 2BUPA 1NBWA 2PBDA 4AM6A 4BR0A 3D7EO 4BREA 1C0FA 4H5RA 4QS9A 2YHWA 1YVNA 3ENHA 2I7PA 3DXKA 2FXUA 3SK3A 4BR2A 3MK6A 1SAZA 2E20A 4FWQA 3WT0A 2AP1A 3GE1A 3VEWA 4B1YB 5E84A 2P9KA 5ELZA 4C23A 4XH1A 2QWOA 2V52B 2I7NA 1V4SA 1Y64A 2GUPA 3FZMA 4HTLA 4WYBA 3CQYA 4H0OA 1ATNA 3WQUA 5B8HA 3OHRA 3VGMA 5BR9A 1C0GA 4Y0WA 3RSEB 2E2OA 4M7YA 1D4XA 3ENOA 2VWBA 4O5FA 4H0VB 2P9UA 4JN4A 1X9JA 3QFPA 4RTFD 4BQZA 3LDOA 2ASMA 1HKBA 3F9MA 1X3MA 4A61A 5AZIB 2GELA 1K8KB 3L6QA 5AQTA 5F0XA 4EFHA 3UB5A 2GWJA 2QWLA 5BPLA 4JD2A 2F9TA 2W40A 3VPZA 3CJCA 1BO5O 4I6MB 3H3NO 4FWMA 3ZETA 3DAWA 3MN9A 1BUPA 3CETA 1IG8A 1NGIA 2Q0UA 5EXWA 3ZEUB 3A5NC 2ZF5O 1NGBA 4BROA 4BC2A 4BC4A 3FE1A 4CZIA 4K42A 3VEXA 3WEEB 3CJAA 2IIRA 2P9NB 2OANA 4XH4A 4EIAA 5KPTA 3FZHA 1DKGD 1Q18A 1HKCA 3LDPA 4K41A 2NLXA 4JNEA 4NO7A 4BGBA 4GNIA 5JLFA 2V7YA 1GLEG 1HPMA 1E4FT 4GY2B 3C7NA 4B1UB 4PL7A 5AQGA 4BR7A 5BN8A 3AARA 4FL9A 4BRHA 1NGHA 4FOIA 1JCEA 4H5VA 2Q97A 1HLUA 3ATUA 4PKHA 5AQUA 5FPMA 5AQIA 5AQXA 1ESVA 3H3OB 4CZHA 3M3ZA 1QQMA 2KHOA 3VEVA 1RFQA 4PKIA 5AQJA 5BRHA 3O1BA 3D2FA 4H0XB 3UKUA 4MLHA 4H03B 4IO8A 4KBOA 4E1JA 3GBTA 1NMDA 3I33A 3MN5A 2D0OA 5LY3A 2FSKA 3H45C 4BRMA 1TYQB 5AQVA 1X3NA 1CZAN 3WQTA 2V51B 1BA0A 5AQHA 1Z6RA 3LDQA 1H1VA 4A2BA 2Q31A 1GLJO 4NB4A 3UKRB 3TPQA
chains in the Genus database with same CATH superfamily
4OLAA 2ZWHA 4CJWA 2BANA 3WXIA 4DV2K 1YJNN 1RGIA 3BDPA 2VWKA 2VCPA 1RT2A 3DLRA 1HRHA 1KFDA 4DWIA 1QVGM 2YCHA 2E2NA 3RRHA 1RTDA 3GL1A 3G4SN 2E1YA 4AHUA 3VGLA 1S5JA 5D3GA 2OTLN 2IVOA 4FJLA 2GV9A 3BZKA 4IZ9A 4F9OA 3AA5X 4B1XB 1T6CA 2YJEA 3KLEA 4BRGA 1U04A 2FLOA 1BCOA 3IFRA 3U9DA 4IJNA 1S72N 1SL1A 4NYNA 3NMUA 1OH7A 4YOXA 3OYEA 3VA3A 3NE6A 2W6LA 2G8WA 2JWLA 3MDQA 3LP0A 3HOSA 1XMQK 1UOCA 3MCAB 4AHTA 4I6MA 3I0SA 4CHYA 4ICLA 4NCGA 3O9UA 5SZTA 4KH4A 3ZEUA 3G25A 3T7ZA 1JCFA 3NVMA 1UWBA 1NGDA 2E6MA 1L3VA 4Y1CA 2BTFA 4C8MA 2GX9A 4BG8A 2Q36A 4BDZA 4NCBA 3QBWA 4BRQA 1U45A 4KB1A 4B3TK 2RF2A 4CJ5A 5AQNA 2Q2RA 2ZJPL 1HKGA 2B5JA 1U49A 2E2PA 3T1AA 1VQPN 1DTQA 2HF4A 1K73O 2W41A 2YNHA 1IKXA 3I0RA 3ITHA 5EY4A 2DFHA 3OY9A 2QI2A 1KFSA 5KI6A 3PLAA 2RKIA 3V81A 4MDBA 3EO3A 4ISFA 1R0AA 1B92A 3U6FA 1CLQA 3QDKA 2HHHK 4B3MK 2E8AA 2IVPA 4EAHD 2HBMA 4O0JA 3CJBA 4B9TA 3RTVA 4JKAA 4OKJA 4LF5K 3VQ8A 1NGCA 1YF5L 2O4IA 1J54A 2VQFK 4E7LA 4LFAK 4DFJA 4E3SA 4IEEA 4F8RA 2Z1GA 1XQSC 3PX4A 5ADXH 1NGFA 1A5WA 4CJ7A 1RTJA 1WAJA 2QW9A 3BEXA 3LL3A 1LWFA 4GKKK 3A0IX 1L3SA 4A62A 1L3UA 2X6SA 3NCIA 1YTAA 1RDAA 3AO5A 4GMJB 1GOAA 3NF9A 1JCGA 2O8FB 4O8KA 2Z1JA 3CF5L 1T8EA 4GV9A 4CJEA 1Z05A 4FM1A 4BVPA 5MLCQ 3HSCA 1VHXA 2QWMA 4MLEA 4FO0A 4BY9C 2V7ZA 2QXLA 3FZLA 4IO9L 4CIGA 3CJ1A 3TR8A 1S1VA 4B9NA 5LJWA 3PSIA 2O8EB 1S1WA 2GBZA 2UUAK 1SQKA 3ZSOA 3L2WA 5C25A 1CXQA 1EP4A 4EZ6A 1K8KA 3M6GA 4B9QA 2P5OA 2X74A 3U4LA 5BRFA 2EWSA 3IDHA 4M3RA 2HNYA 3K9JA 5AFUA 4CEOA 4O0IA 4BRCA 4DTUA 2FBTA 3G71N 4O5BA 2KTQA 2AJQA 3O80A 1SKRA 4CEQA 4DU3A 3BZCA 3LDSA 3AVKA 3F5TA 1BA1A 5AQRA 3AO4A 2P9UB 2ITGA 4LY7A 4NCAA 1S9EA 1BOTO 1D9FA 3ZSXA 3KKSA 4DMNA 3FGUA 1B9DA 2ZGYA 3CCSN 4C8NA 1WUAA 1VQLN 1E3MA 4MQ3A 3LWLA 3CPWM 3ZSQA 2ZQBA 4CEBA 1IKYA 1C0UA 4BRLA 4BVOA 4DTRA 1DTTA 4KI6A 3RMAA 1NKCA 1JKHA 1T7PA 1ATSA 3SMPA 2CGKA 4I7FA 1BIUA 2HMPA 4YOTA 3RWUA 3NHGA 3P83D 5DM7L 3HSTB 3S3MA 2NRZA 4YNQA 2IS3A 1TL1A 1YJWN 3FZFA 4WQ4C 3A5MC 1FXXA 1K6YA 4BDPA 2YI1A 2YNFA 3JYTA 4BRPA 3OYMA 3QEIA 2QKBA 1VQ5N 2A5XA 3L4IA 3BGRA 1RCHA 1ZBSA 3VGKA 2F9WA 4IG3A 2ASOA 3ZX2A 3AVMA 3P1GA 1KD1O 3P39A 3VQDA 4W5QA 1ZXOA 4IWVA 2ZJRL 3FFKB 2P9PB 3SCXA 3EL2A 4JKCA 2P5GA 4WE1A 1VQKN 3F9KA 3W0LA 4B1WB 4DQQA 5EVZA 1OH5A 3NBPA 3OYGA 2P9IB 3VQCA 4L3QA 4CEDA 3D45A 1IG9A 5BREA 1Z26A 4QOZB 4BR9A 2P9LB 4GV3A 4JAXA 3CYMA 2KFZA 3FZKA 2A42A 3L0QA 4IG0A 3TI0A 4K8XA 3H46O 1P8ZA 3O3FA 1LAVA 3EE9A 4M45A 5K14A 1S6QA 4CZGA 1I39A 1S3XA 4CE9A 2FF3B 1QHAA 1HJOA 3A2FA 4FWPA 4KHNA 3LALA 3DXMA 3BF1A 4RCHA 4DUYK 3PO5A 2HHXA 4KAZA 2NRTA 3MEDA 2F96A 2HNDA 1RNHA 1YVNA 3ENHA 2FXUA 4I9LA 2QEXN 1SAZA 4FLVA 2IOCA 2AP1A 1WSFA 2P1JA 4FLUA 1NJXA 1TKZA 3ZSYA 4UQGA 5LMNK 1Q8IA 3K0SA 2V52B 5FDLA 1VQ8N 4AQYK 3IS9A 4WYBA 3QNOA 3CQYA 4H0OA 1ATNA 4CVNE 2DTUA 5B8HA 3THYA 2IC3A 3D0PA 4M7YA 1O1WA 1FW6A 4ZTFA 4M3XA 1SV5A 4DFKA 3PY8A 3H08A 1Q82O 3HVTA 1X3MA 4CIFA 5F0XA 3UB5A 4U7BA 5BPLA 4LF8K 4CGDA 1C1BA 1BCMA 2W40A 3HL8A 4ILGB 4I6MB 3ZETA 3DAWA 2UUCK 3MN9A 3CETA 1NGIA 5EU7A 4F4KA 5JVHL 5EXWA 3ZEUB 2X6NA 3TANA 4JKBA 1QSYA 3C6AA 3QINA 2ZF5O 3MEEA 1ZBFA 3FE1A 5BR8K 3VEXA 3WEEB 2F8SA 4IFYA 4EIAA 4N47A 2F7TA 3C6HA 4ELUA 1B9FA 1DKGD 3O9TA 4X62K 2Z1IA 4HTUA 4LF7K 1C1AA 3ISNC 3HJFA 1E4FT 1FKOA 2QA4N 2HBKA 3LP1A 4GY2B 3V9WA 1Q81O 3ZT4A 2OA8A 3DRSA 3V9SA 1KVAA 1ASWA 3NF8A 4H5VA 1HLUA 3WNHA 4XIUA 3OBYA 4JRQA 4DV0K 3TAPA 5AQUA 5FPMA 2VG5A 5C42A 1EWQA 3OYFA 2QTDA 3TSQA 1QQMA 3SAFA 4PKIA 4AHCA 4DTPA 4Z4IA 3D2FA 5M1PA 3J7ZO 4GKJK 4YY3K 5CYQA 4J2EA 4DR3K 3NH0A 4CF2A 3V9UA 4IO8A 3CC4N 2O8FA 3SUPA 3OW2M 3EY1A 2ZD1A 5HOOA 1WB9A 1NMDA 1VSDA 3ULDA 3SBGA 3MX2A 5AQVA 5GAGP 2EX3A 1CZAN 1Z25A 3WQTA 3B6PA 3M8QA 3AA4A 4YOYA 1ZBHA 3LDQA 1IBMK 4A5AA 3CMEN 1NNEA 3OYHA 1IBKK 4IOAL 3PIPL 4FWNA 2G8VA 3LM9A 2O8EA 3VESA 4YFUA 1IV0A 2IGIA 4WQ4A 4YOUA 3OYAA 4A5BA 4DR6K 1GLFO 2UYTA 4B9MA 4V19S 1TK0A 1TVRA 2Q3SA 2CGLA 1WAFA 3LWMA 4L8RB 4B1ZA 2BE2A 4RWTA 2DFFA 4FVUA 1QE1A 4RW9A 2HOEA 3CCQN 2HHUA 3NGYA 4JV5K 4CJRA 1TKTA 4J2AA 3AY9A 2PYLA 4UY8O 5CYMA 3ZT0A 5E41A 3QNNA 3O4NA 4DS4A 3T1HK 3RMCA 3M8PA 3CI5A 1ATRA 1NK0A 1CXUA 1YAGA 3QIOA 2OPRA 1YXQA 3THWB 4DSIA 3HPGA 3QMLA 4BRKA 5KRTA 2KQ2A 4H0TB 3EZWA 3EKUA 3AVLA 3HM8A 3M5RA 1W2BM 4PKGA 5JLHA 4LH5A 3S41A 2GWKA 4DLEA 4JYAK 4CK3A 5CZ2A 2P9NA 4DS5A 3LM2A 3IMXA 4BRAA 3RMBA 3CCJN 2KZZA 4ID5A 5CHIA 2PZSA 3MN6A 3MCPA 3EEQA 4FPAA 1E4GT 4QAGA 4BRFA 2HNZA 1QSSA 4CJQA 3MXJA 2VWJA 4BR5A 1TAUA 3O4QA 4DUZK 2OYQA 4JI0K 1WSIA 1NGJA 1W0HA 3NH2A 4B3SK 4M42A 2P9PA 3SI6A 2JWKA 2P9IA 1MA9B 3OA9A 3VQQA 5J1EA 4CBUA 2P9LA 2CH5A 4N76A 3CCEN 4BE0A 5GIPA 5JS1A 3L3UA 1TYQA 3QERA 1XC3A 4ISEA 3AVFA 3DI6A 1OH8A 2D1KA 5AFUH 4AM7A 4ILHA 2WUSA 4KH5A 5BRDA 3ZX3A 3O4WA 3WXLA 1EQYA 4CF9A 3ZLJA 2ZE2A 3DMJA 1NK4A 1K8AO 1VK0A 2AA4A 1QVFM 3L2UA 3OYIA 2LSNA 5AQYA 4DV5K 5DMRA 4DKWA 5E26A 1RT1A 2G8UA 1RDDA 3QIPA 5TKYA 4K8ZA 1ZC6A 3BUZB 4MFBA 5AQZA 1XWLA 3DRPA 3DOLA 5HRNA 2E5LK 3CQ8A 4DSFA 2UXBK 2YNIA 4IKFA 1VQMN 4BRNA 3DXMB 3LPUA 1YITN 2YHXA 4M3UA 1HNWK 1GLDG 3D2EA 1ZBUA 3VQ9A 4JS5A 3LZIA 4H4OA 1BG3A 3C6TA 3SLCA 2KFNA 4B9VA 3KLGA 4FW1A 4X64K 2YJFA 4IFEA 4LC9B 4HUGA 3VEOA 1D8YA 1KTQA 4KHPK 4E1NA 1W97L 3GDQA 1YJ9N 1IJJA 3SJJA 3T69A 3KLHA 1TK8A 5AQPA 4CFBA 5CE3A 3ZSRA 4FJJA 1X1PA 1IH7A 4BE1A 4WFBL 3JS6A 2WOMA 4U67L 3E66A 3THYB 4EZ9A 1LOTB 1N6QA 3WEEA 4IJAA 3KVGA 3WNEA 3MMVA 3E1YA 3FR0A 3MN7A 4JHDA 1SL0A 4EP4A 3I55N 1NK6A 1N32K 4HWIA 5C10A 3ZETB 2DPNA 1NK9A 3P5JA 2HF3A 4RW6A 1U2VA 3W3DA 4EHUA 3CFRA 1BL3A 1YHQN 1TGOA 4IFVA 3K2PA 5BN9A 4OO1J 4CGIA 3QBXA 4H4MA 5IWAK 4AHVA 2NRXA 3UIQA 4R5PA 1JJ2M 4YOWA 3TAEA 2PYJA 4FCYA 1HMVA 4C8LA 3CXCM 2YX6A 3SPYA 1EO1A 2KLAA 1NGGA 2QK9A 3MWTA 3AVNA 1CZ9A 1YVUA 4TSXA 3NVKA 1BISA 1RBRA 4O8UA 4KREA 4FK4A 3OYNA 1YUWA 1FJGK 1MDUB 4XH5A 3SQ2A 3OTOK 3TWHA 3P4IA 4O55A 3NH1A 2E2QA 4B1VA 3D2FB 4JLHA 4B08A 1RT5A 4FWSA 3U3YA 4BRDA 5M1QA 4BG9A 3TTDA 3CJ9A 3KD5E 4RW8A 5FLXO 3TTCA 2KKZA 3V9XA 5AR0A 4BQLA 5KTQA 3LAKA 4ILJA 3CC7N 1VSJA 3WNGA 2W6KA 1TV6A 1OKJA 3OYJA 4JK9A 2BUPA 4KH6A 3E01A 1NBWA 2PBDA 4AM6A 3D7EO 4BREA 3ZCMA 4CGHA 2YKMA 4OPHA 2ZJQL 1C0TA 2I7PA 3R1XA 3V9ZA 1T03A 3OVNA 2XY7A 3THWA 3SYZA 4XH1A 5C24A 2HMIA 2I7NA 4O4GA 1ASUA 3AO2A 3FZMA 3D6RA 4FJMA 2VG7A 4E89A 4AILC 4FJNA 3OHRA 1C0GA 4FJGA 1ZBIA 3LP2A 4JI6K 2VG6A 1QQCA 3QFPA 4RTFD 3I56N 4HUFA 4KHUA 2OZSA 5FROA 4A61A 3O9RA 3KLFA 2IDOA 2GELA 2XY5A 3L6QA 4EFHA 3AVJA 2F9TA 3CJCA 5HROA 1OH6A 2HB5A 2HHSA 3H3NO 3P31A 2DY4A 1NK8A 3DLKA 5J2NA 4CHOA 2G8HA 1NGBA 4BROA 4AF1A 3VTIA 4KHSA 1NJYA 4BC4A 4E7HA 2P9NB 5KPTA 3DOKA 2E6LA 1Q18A 2X78A 4CHQA 1HKCA 4K41A 2UUBK 4C1NI 1HJRA 2ZM6K 4NO7A 4RW7A 3CFPA 3J7AP 5J2PA 4DR7K 5AQGA 1WSJA 4BR7A 3QEPA 5A2QO 1WBBA 1X9WA 3EZ5A 4F2RA 5AQIA 4LD0A 4A59A 1ESVA 1IKVA 2A1SA 3ASMA 3PIOL 4OPAA 2Y1JA 4DQRA 2O8CB 3DLEA 2ATQA 4H0XB 3PO4A 1HYSA 1D9DA 5DM6L 3GBTA 3I33A 3MN5A 1EX4A 1TYQB 1D5AA 1NK7A 3IRXA 1Z6RA 4CHNA 5FRMA 4NB4A 1W7AA 5HL7L 5CY4A 4M3TA 1RBSA 1VQ7N 1S6PA 3S3NA 5JICA 3J8AA 4CBWA 4Q0BA 3WXJA 3VQ6A 5KPRA 2NZTA 1RT4A 4CZEA 3K5OA 4JKGA 4YHHK 3WUHA 4DFMA 4LSNA 4IXCA 2JLEA 3SJHA 3MEGA 3J7YP 3VF6A 4PQUA 1LAWA 3BF3A 1T6DA 3CJ7A 4CZMA 3TSUA 1QHTA 1DGKN 3KKRA 3QLHA 4OGCA 3U8XA 1V4TA 3G6EN 1DLOA 1TKDA 5FPDA 4IBNA 2E4LA 1T05A 1QS4A 3I8BA 3AAQA 3CHWA 3R3LA 3KK7A 3CCRN 4JKHA 3TABA 3VERA 1RDBA 3QEWA 3KWIA 1LWCA 3D2EB 2VGMA 1BDGA 4GV6A 1ILYA 4FOEA 1S1TA 1QSLA 3G0ZA 5M1NA 5GAEP 1Q7YO 4CJ4A 2FBXA 4W5TA 2D0PA 3VA0A 1JXEA 4FLTA 2G8KA 5F1XA 3QO9A 4AH9A 3WXKA 5KQDA 3MECA 3K57A 2O4GA 2HHTA 3HZ6A 1NGEA 3SUNA 3CIPA 1J5EK 4NYFA 2NRWA 1WSEA 1GLBG 3O3HA 4M3ZA 1N33K 3TU5A 2A6AA 2GUIA 3A5OC 3AAPA 1N8RO 3C0BA 1HNIA 3CC2N 4JHDB 2UXDK 3SQ1A 3PUFA 4HCBA 1ITGA 4JKEA 3N4QA 1I3AA 1KRPA 2XHBA 1RBVA 3DRRA 4H0PA 3ZX0A 3KJVA 4LFCK 1XUPO 3NF6A 3SUOA 1U2VB 3CCUN 4DR5K 3KZBA 4H0YB 3QICA 2CGJA 1NLVA 1KVBA 3KHYA 2HBJA 3NGZA 4Y1DA 4CJKA 1HYVA 1WSGA 5BPMA 3SV4A 4PWDA 5GIOA 4Q5VA 4BC3A 5C2FA 1UAXA 3LDNA 4GW6A 1A5VA 1GOBA 3C7NB 5HRPA 3UKRA 5KQ8A 4CK1A 1RDWX 4IOXA 3TAMA 5H1SQ 3TAGA 4E0DA 3GOIA 4DTJA 1ZYQA 3AGKA 4FWKA 3IUCA 3R6MA 4XEIA 4FK2A 3TAFA 1NM1A 5FRNA 2BDPA 4DTXA 4DQ8A 3A8YA 1GLLO 3VENA 5AQLA 3A5LC 4ISGA 4JKDA 4A2AA 3CG7A 2J4RA 3SPZA 4FJIA 4JRPA 4DHYA 2OPSA 2F4VK 4CF8A 1P90A 4DV7K 4DB3A 5HRSA 3AV9A 4KHWA 1TUYA 1KAZA 4JI2K 1LWEA 3SBTA 2BH1A 2A1RA 3CQXA 3DLGA 1DEJA 3SQ0A 4DTNA 3SZ2A 2ZGZA 5C12A 5T7BA 1EWRA 3ZYYX 1R59O 2FSNA 3VOVA 2QWNA 4CEZA 2BGGA 1VRUA 3AVCA 1VSFA 5TKWA 4PHTX 1SL2A 4GVEA 2E88A 5AQMA 1NG9A 3ULEA 1W9HA 4B8CA 4LF9K 3HOTA 3AGRA 3E9LA 4CI6A 3O6WA 3ZSZA 4K0KK 3ID8A 4BE2A 3KD1E 3H1QA 3LPTA 1KXPA 4FZXC 5J2QA 1WLJA 4K25A 1LCUA 4HUEA 2O8DA 5AQKA 2QWQA 5BPNA 3VTHA 4KTZA 5FPNA 4B9SA 2NRVA 4MO4A 3O8MA 4CGJA 2YHAA 2B6AA 3DLLL 3VQ4A 4CD3A 2FC0A 1RDCA 3RVCA 5KRSA 4FK0A 3O1WA 3EKSA 1YIJN 1G99A 2WONA 1SKSA 1FKPA 3DYAA 2R7YA 4WF9L 4CW7B 2NRRA 4CZJA 4CZLA 2HW3A 3QEXA 2WBNA 4DF4A 2O8CA 4FLXA 1QZ6A 5AZJB 5C2DA 3BP8A 4YDUC 2D0BA 1O13A 4BR4A 4LF6K 4MO5A 3V1QA 4N56A 1UA0A 4OPKA 3L4QA 3DM2A 1YT3A 4CEEA 3ZSWA 4Z4CA 4E7JA 1JLGA 5CZ1A 2GTDA 1SS6A 4I2PA 3M1FA 3U3GA 2G8FA 4HVJA 4OGEA 4DCHA 3VEYA 1LV5A 3ZT2A 5LJVA 4M63C 2XY6A 2H3GX 4G1QA 1VSIA 1BQNA 2FF6A 4H8KA 4E1MA 1VQ6N 1Q9XA 1HQUA 4J2DA 1BIZA 3SV3A 2OPPA 4FPBA 4WQ5C 3DLBA 4G9ZA 2G8IA 5JS2A 3OJUA 4FW2A 1RTHA 1GLCG 4DU1A 4BC5A 2VYPA 3V6DA 3THVA 3P38A 3CERA 4J8FA 4CZKA 4JEPA 2A41A 3AA2A 4Z94A 4I9QA 4YOVA 3PV8A 4CJ3A 1C0FA 4H5RA 1KSPA 4QS9A 2YHWA 1NJZA 3LZJA 3ID6A 3NFAA 1RTIA 3SK3A 3MK6A 3T19A 2E20A 3CM5A 4FWQA 3DLHA 3GE1A 4B1YB 5E84A 4JKGB 3L2VA 3BY5A 2QWOA 4DTSA 1NJWA 1K9MO 1HQEA 4DU4A 2XY8A 3OS0A 3ZT1A 1LW0A 3L2QA 5KGWA 3WQUA 2HSTA 3VGMA 5BR9A 1Q86O 2OZMA 2DFEA 2E2OA 4DSLA 4DR1K 3ENOA 2VWBA 4H0VB 4JN4A 1RT6A 4BQZA 4Z4GA 4NLBA 3LDOA 2UXCK 5HP1A 3OJSA 4Z0UA 4O44A 5AQTA 4FZYA 4Z4FA 2WFBA 3OYKA 4JD2A 4IEIA 1M90O 2O8BB 3ZSVA 3VPZA 1EKEA 1RT3A 1S1UA 4FWMA 3MAQA 1NOZA 2YV0X 4JK8A 2OCEA 3KLIA 1SUQA 4W5OA 3RRGA 1NU0A 2FBYA 1HNZK 4FJ9A 1XNRK 3F73A 3S3OA 2WTUA 4CJLA 5GAHP 3EE8A 4BC2A 1VSHA 2RN2A 3HM9A 5C0YA 4K42A 2HHVA 2IIRA 2OANA 4XH4A 4CJVA 3FZHA 3LAMA 3O9SA 3NAEA 3LDPA 3VQEA 2NLXA 4FM2A 3THXA 4JNEA 5HLFA 4FLWA 4BGBA 4GNIA 1GLEG 3NF7A 4FLZA 4FLYA 4LH4A 4OKEA 3C7NA 4PL7A 4OLBA 1X9SA 4HHTA 3AARA 4FOIA 1JCEA 4X66K 2Q97A 2I5JA 1JXBA 4PKHA 2XRIA 3M3ZA 5J2MA 2KHOA 3VEVA 3K5NA 4DTOA 5BRHA 1VQON 3RR7A 5GADP 4ELVA 4CEAA 1BQMA 1XHXA 3ZT3A 4X65K 3AVIA 4MLHA 4H03B 3IKMA 1NKBA 4KBOA 4KTWA 2D0CA 5JVGL 5LY3A 3CPEA 4WFAL 2Z1HA 4DV6K 5LMUK 3JAMO 1BA0A 1JLQA 5AQHA 3HP9A 1H1VA 4A2BA 4M3YA 2Q31A 1UA1A 5HRRA 3VQPA 3UKRB 3TPQA 4CEFA 2UU9K 4CF1A 4EHTA 5I9EB 1VQ4N 3T1YK 3VF2A 4YDUA 1TK5A 4DG1A 1J5OA 5FPEA 4DR4K 3K58A 3HRGA 4PL8A 3M8SA 4KHQA 5EX5A 2P9SB 4FSVA 3U9ZA 1JLAA 1BHLA 1BI4B 1VSEA 3VMFB 4DV1K 3OYCA 4LSLA 3R9PA 2RPIA 3CFOA 4AHRA 3CMAN 3RSEA 1BGXT 4DV3K 4QS8A 1C6VA 2NNWA 3CCVN 3L2RA 4DSJA 1J6ZA 2D4WA 5AZIA 4WQ5A 3DXKB 4CESA 1VSMA 3V1OA 3S9HA 2E1ZA 4IDHA 3AVHA 2P9KB 1N34K 4FJXA 3L3VA 3TSPA 2D5RA 2FSJA 3CM6A 4CD1A 4CFAA 3HTVA 2NUBA 3UE5A 2A40A 1C0MA 2CH6A 4W5RA 3SNNA 1KC8O 3AA3A 2HBLA 4KRFA 1IBLK 3L8BA 4M3WA 1M1KO 2RE2A 4JI4K 3ULEB 1L3TA 5AQFA 2QWPA 3QESA 4OX9K 4BDYA 3R8EA 3TTFA 1X9MA 4F3OA 4KHYA 5AZJA 1N36K 5KGXA 4JI1K 3O5BA 1HYZA 4PUOA 3CCMN 2O8DB 3EYZA 2OTJN 3E9OA 3MXIA 1T44A 2HVHA 1QQNA 4CERA 5JMVA 4H5NA 4FM0A 4FZZA 1KVCA 4F2SA 2OPQA 4CJUA 2IAJA 3JXUA 4HCCA 4DR2K 5CR4A 1JLCA 4PA1A 5AJ3K 3V1RA 3VN5A 3T3FA 4KPYA 4CZFA 3VETA 4CGFA 1KAXA 1J9AA 4C1NK 3H6EA 4JI7K 2ITMA 3F2KA 1WBDA 4FJ5A 1LW2A 1NWKA 1S22A 4Z4HA 4ZTJA 2IVNA 1REVA 3DWLA 1NKEA 4K43A 1HR0K 3OYBA 3FFIA 1N5YA 1SZ2A 1F21A 1G15A 3MWPA 1RBTA 3H1VX 1XHZA 3EN9A 1KAYA 4DTMA 3C95A 4BWJA 3IAYA 1JLEA 3UKUB 4M41A 5AQQA 5GINA 3KK3A 2GEMA 3AO1A 4EP5A 4J2BA 2PFUA 1GOCA 3GG4A 3M8RA 4CJFA 1KLNA 4H5TA 3WXMB 1QZ5A 3SMSA 4A57A 4RG8A 4NXNK 5F2RA 4W5NA 4CIEA 2RHKA 3WNFA 3QB0A 4QS7A 1RILA 4B3RK 4OPJA 3HBTA 4ID1A 2ASPA 3QEVA 4FXDA 3ENBA 1HNVA 1QTMA 1HPZA 1WN7A 3SAGA 4ZHRA 2O8BA 2F8TA 5ADXA 4FJHA 3O08A 3LP3A 5LL6Z 5I3UA 4FJKA 1NGAA 4JKFA 1U48A 2ETJA 5HBMA 1A5XA 2B4JA 4LF4K 3CCLN 1TL3A 1GLAG 4FYDA 1TUUA 4FJ8A 3PX6A 3B8AX 3HPOA 1Y97A 4FWRA 2Q1NA 1FK9A 3B6OA 2PAVA 4E7IA 4M7XA 3G10A 4CBXA 3HI0A 4CJSA 1U6ZA 1ASVA 3QFUA 1HNXK 3TAQA 2A3ZA 4WCEL 3VF4A 2W42A 3O9QA 4H5WA 3OYLA 4DSEA 1OVQA 1WSHA 4JD2B 1DT9A 1HX1A 3OS2A 4NXMK 1BU6O 5IT9O 1BWFO 1WOQA 4FWOA 5AQOA 3J81O 2P51A 2JGUA 4CCHA 1XI1A 4JI8K 3HK2A 3RMDA 2NRHA 4BRIA 3NDKA 1MWKA 1NJIO 4PY5A 2EHGA 3K5MA 2YHBA 5DK5A 4KKOA 5EOYA 1XNQK 1HUXA 1JLFA 4E7KA 2HHWA 5AQSA 4F3TA 1NMNA 3HP6A 2QM1A 2YHYA 3TARA 4B9UA 1JL1A 3KWGA 2Q0RA 3N4PA 2Y1IA 3THXB 1U47A 1RT7A 4JI3K 1QQOA 4ELTA 4IOCL 2HVIA 2KZMA 3J80O 3C6UA 3Q7BA 4KFBA 3LDLA 1IO2A 4Z4EA 1TAQA 1YI2N 5AQWA 4KTQA 4LFBK 3OBWA 3NGIA 2QWRA 3VQ5A 1JLBA 4R79A 3SQ4A 1J53A 3VEZA 3DJCA 4RW4A 3AO3A 3ATVA 3C65A 1MWMA 3AVAA 5KPZA 1VQ9N 5M1OA 4DSKA 4BGAA 5C15A 1SKWA 2YNGA 2P9SA 4CF0A 1BI4A 4I2QA 4C8KA 4KO0A 4FWLA 1WNSA 4KB0A 3IG1A 1VAZA 3FLCO 3OS1A 5M1KA 4CHPA 4OJRA 1T3VA 4CFCA 3ALYA 4BR0A 3K5LA 2FBVA 3HVRA 4DF8A 3KTQA 3CD6N 4BACA 4WFNL 3DXKA 4BR2A 3K59A 3WT0A 1VRTA 1U4BA 3VEWA 1KQSM 3AVGA 2P9KA 5ELZA 3QETA 4C23A 4N41A 3HXMA 4CK2A 4GVMA 1XMOK 1V4SA 2PY5A 3HYFA 1Y64A 2GUPA 1VSKA 4HTLA 1I94K 1ZBLA 3RR8A 3KK1A 3E9PA 3MX5A 3JSMA 3V4IA 2D0AA 4OVLA 4AHSA 4CJPA 3SAHA 4FJ7A 4Y0WA 3RSEB 1S9GA 1D4XA 4DQSA 4O5FA 2P9UA 3VQ7A 1X9JA 4QCLA 4OKKA 4E19A 2XO7A 2ASMA 1HKBA 3F9MA 3MXMA 5AZIB 4KI4A 4B3OA 4DLGA 5I42A 1K8KB 3PX0A 2GWJA 2QWLA 3O3GA 3Q7CA 2KW4A 1RBUA 1BO5O 4DQIA 1OVYA 1TKXA 1BUPA 1C1CA 1IG8A 2Q0UA 4DFPA 3OYDA 1JL2A 1EETA 3A5NC 4YORA 1MU2A 4CHZA 4CECA 1L5UA 1VQNN 4CZIA 3HT3A 3PSFA 4KV8A 1VSLA 3CJAA 2QXFA 3AVBA 4CGGA 4JI5K 4BWMA 4C8OA 4DQPA 4FVMA 2QKKA 1XC9A 2WC9A 5JLFA 4N5SA 2V7YA 1HPMA 5SWMA 1KLMA 3C94A 4B1UB 1NK5A 1Q9YA 5BN8A 2YKNA 4B8AB 4FL9A 4BRHA 1NGHA 4JS4A 3VQBA 3HO1A 3ATUA 3KK2A 4NLCA 5AQXA 1KCFA 3H3OB 2VQEK 4B9LA 4CZHA 3K9KA 3HPHA 4MDAA 1EXQA 1RFQA 4CFDA 5M1FA 5AQJA 2VGNA 3O1BA 4DV4K 1CZBA 4IDKA 1YTUA 3UKUA 4JK7A 4E1JA 1S1XA 4CJTA 1NOYA 2D0OA 2FSKA 3H45C 3LANA 4BRMA 1RDUA 1X3NA 2V51B 3SUQA 3KIOA 1IKWA 1GLJO 2HHQA 3VQAA 3I8DA
chains in the Genus database with same CATH topology
2ZWHA 4EHTA 4IOAL 5I9EB 3WXIA 3PIPL 1YJNN 4FWNA 1VQ7N 1VQ4N 1RGIA 3LM9A 3VF2A 2VCPA 3VESA 4WQ4A 4YDUA 5JICA 3J8AA 4YOUA 4CBWA 5FPEA 4A5BA 1GLFO 3WXJA 1QVGM 2UYTA 2YCHA 2E2NA 5KPRA 2NZTA 3HRGA 4PL8A 3GL1A 4CZEA 3G4SN 2E1YA 4JKGA 2CGLA 3VGLA 5EX5A 3WUHA 2P9SB 2OTLN 2IVOA 4B1ZA 4IXCA 3SJHA 4RWTA 3VF6A 4FSVA 3U9ZA 4FVUA 4IZ9A 3VMFB 3BF3A 2HOEA 4F9OA 1T6DA 3CJ7A 3CCQN 3R9PA 4CZMA 4B1XB 3TSUA 1DGKN 1T6CA 2YJEA 3CMAN 3RSEA 4BRGA 3U8XA 1V4TA 2FLOA 3G6EN 4QS8A 3IFRA 3U9DA 4IJNA 3AY9A 5FPDA 1S72N 3NMUA 2NNWA 3CCVN 4YOXA 3I8BA 3AAQA 3CHWA 3R3LA 4UY8O 3KK7A 3CCRN 1J6ZA 2D4WA 4JKHA 5AZIA 3VERA 3KWIA 3D2EB 4WQ5A 3DXKB 2VGMA 1BDGA 4GV6A 2JWLA 3CI5A 2E1ZA 4FOEA 1ILYA 1ATRA 4IDHA 3MDQA 5M1NA 3HOSA 2P9KB 1YAGA 5GAEP 3TSPA 3MCAB 1YXQA 1Q7YO 2FSJA 4I6MA 3QMLA 4BRKA 4H0TB 3EZWA 4CD1A 3O9UA 4KH4A 3HTVA 3EKUA 3ZEUA 3G25A 3HM8A 2D0PA 3M5RA 3T7ZA 2A40A 1JCFA 4PKGA 3UE5A 3NVMA 5JLHA 1W2BM 5F1XA 2CH6A 1KC8O 3S41A 2GWKA 2HBLA 1NGDA 3WXKA 2BTFA 5KQDA 1M1KO 2GX9A 2RE2A 3ULEB 4BG8A 2P9NA 2Q36A 3HZ6A 3QBWA 1NGEA 4BRQA 3LM2A 3CIPA 5AQFA 2QWPA 3IMXA 2NRWA 4BRAA 3R8EA 3CCJN 3TTFA 5AQNA 2Q2RA 2ZJPL 1GLBG 1HKGA 5AZJA 5CHIA 3MN6A 3TU5A 2A6AA 3MCPA 2E2PA 1VQPN 2HF4A 3A5OC 4FPAA 3AAPA 1E4GT 1K73O 2W41A 1N8RO 3C0BA 3CC2N 3O5BA 4JHDB 4BRFA 3CCMN 5EY4A 4JKEA 2QI2A 3N4QA 2OTJN 3E9OA 3PLAA 4BR5A 1T44A 4MDBA 3EO3A 4ISFA 4H0PA 3ZX0A 1QQNA 1NGJA 5JMVA 1XUPO 4H5NA 3QDKA 1U2VB 2E8AA 3CCUN 2IVPA 2P9PA 4EAHD 3KZBA 2HBMA 3JXUA 4H0YB 3CJBA 2CGJA 3QICA 5CR4A 2JWKA 4JKAA 2P9IA 1MA9B 1NLVA 3OA9A 4CZFA 3KHYA 4CBUA 2HBJA 1NGCA 2P9LA 1YF5L 3VETA 1KAXA 2CH5A 4C1NK 3H6EA 5BPMA 3CCEN 5GIPA 5GIOA 4IEEA 1TYQA 2ITMA 3F2KA 1XC3A 1XQSC 4BC3A 5C2FA 4ISEA 1S22A 1NWKA 3LDNA 2IVNA 1NGFA 5ADXH 3PIOL 3C7NB 2D1KA 3DWLA 5AFUH 4CJ7A 4K43A 3UKRA 5KQ8A 4AM7A 1RDWX 4IOXA 2WUSA 4ILHA 2QW9A 4KH5A 5BRDA 1SZ2A 3ZX3A 5H1SQ 3BEXA 3GOIA 3O4WA 3WXLA 3LL3A 1EQYA 3MWPA 3AGKA 4FWKA 3H1VX 3IUCA 3A0IX 3EN9A 3R6MA 1KAYA 4XEIA 2AA4A 1K8AO 1QVFM 4A62A 1NM1A 4DQ8A 5AQYA 3UKUB 3A8YA 4DKWA 5E26A 1GLLO 1JCGA 5AQQA 4O8KA 3VENA 3CF5L 5AQLA 3A5LC 4ISGA 4GV9A 5GINA 4JKDA 2GEMA 5TKYA 4A2AA 1Z05A 1ZC6A 2J4RA 3BUZB 2PFUA 4BVPA 5MLCQ 5AQZA 3GG4A 3HSCA 4DHYA 2QWMA 4H5TA 4MLEA 3WXMB 4FO0A 4BY9C 2V7ZA 2QXLA 3FZLA 1P90A 4IO9L 4DB3A 1QZ5A 3CJ1A 3SMSA 1VQMN 1TUYA 4A57A 1KAZA 4BRNA 5LJWA 5F2RA 3DXMB 1YITN 3SBTA 2RHKA 2YHXA 3QB0A 4QS7A 1GLDG 1SQKA 3D2EA 2BH1A 3HBTA 1BG3A 2ASPA 3SLCA 3CQXA 3ENBA 1DEJA 1K8KA 2YJFA 3M6GA 4B9QA 3SAGA 3U4LA 4IFEA 2ZGZA 4LC9B 5C12A 3VEOA 5BRFA 2EWSA 3IDHA 3ZYYX 1R59O 2FSNA 3K9JA 5ADXA 3O08A 3VOVA 1W97L 2QWNA 3GDQA 5AFUA 1NGAA 1IJJA 1YJ9N 4BRCA 3T69A 1VQON 4JKFA 5TKWA 4PHTX 4GVEA 5AQPA 5CE3A 2E88A 5AQMA 3G71N 3O80A 3CCLN 1GLAG 1TUUA 4WFBL 3ULEA 3B8AX 3JS6A 4FWRA 2Q1NA 4U67L 3E66A 3HOTA 1LOTB 2PAVA 3AGRA 3E9LA 3F5TA 1BA1A 5AQRA 4CI6A 3O6WA 4M7XA 2P9UB 3WEEA 4CBXA 4IJAA 3KVGA 3HI0A 3ID8A 1U6ZA 3MMVA 3E1YA 3H1QA 1BOTO 3QFUA 1KXPA 3FR0A 2A3ZA 3MN7A 4JHDA 3VF4A 4WCEL 3O9QA 3FGUA 4H5WA 2ZGYA 4K25A 3I55N 1LCUA 3CCSN 5AQKA 1WUAA 2QWQA 5BPNA 1VQLN 4JD2B 1DT9A 1HX1A 3VTHA 5FPNA 1BU6O 2NRVA 3CPWM 4HWIA 3O8MA 4MO4A 5C10A 1BWFO 4BRLA 3ZETB 3DLLL 2DPNA 4BVOA 4CD3A 1WOQA 4FWOA 5AQOA 2HF3A 3RVCA 1U2VA 3W3DA 4EHUA 3O1WA 3EKSA 1YHQN 1YIJN 1G99A 1ATSA 3SMPA 2CGKA 2HMPA 5BN9A 4YOTA 4OO1J 4WF9L 2NRRA 2NRHA 4BRIA 3QBXA 4CZJA 5DM7L 1MWKA 4CZLA 1NJIO 2NRZA 2WBNA 2NRXA 1YJWN 1QZ6A 5AZJB 3FZFA 4WQ4C 5C2DA 3A5MC 3BP8A 4YDUC 5EOYA 1HUXA 2YI1A 1O13A 1JJ2M 5AQSA 4YOWA 2QM1A 2YHYA 4BR4A 4BRPA 1VQ5N 4MO5A 2A5XA 3KWGA 2Q0RA 2YX6A 3L4QA 3L4IA 3N4PA 3CXCM 1ZBSA 3VGKA 2F9WA 1EO1A 2KLAA 1QQOA 2ASOA 3ZX2A 1NGGA 4IOCL 3Q7BA 3MWTA 3P39A 1KD1O 2GTDA 1SS6A 1ZXOA 3LDLA 3M1FA 4IWVA 2ZJRL 3NVKA 4O8UA 1YI2N 3FFKB 5AQWA 2P9PB 3EL2A 4JKCA 4DCHA 3OBWA 1YUWA 3VEYA 2QWRA 1VQKN 4R79A 5LJVA 4M63C 3VEZA 1MDUB 3W0LA 4B1WB 3DJCA 4XH5A 5EVZA 2H3GX 3ATVA 2P9IB 3C65A 3P4IA 4L3QA 1MWMA 2FF6A 5BREA 5KPZA 1VQ9N 4BR9A 2E2QA 5M1OA 3D2FB 4B1VA 1VQ6N 2P9LB 4GV3A 4JAXA 4FWSA 4BGAA 4BRDA 5C15A 5M1QA 4BG9A 4FPBA 4WQ5C 3FZKA 2A42A 2P9SA 3L0QA 3CJ9A 3TTDA 4G9ZA 3H46O 1P8ZA 3TTCA 1GLCG 2KKZA 3EE9A 5AR0A 4BQLA 4BC5A 2VYPA 4ILJA 4CZGA 1S3XA 2FF3B 4FWLA 3CC7N 1QHAA 1HJOA 4FWPA 1OKJA 3P38A 3CERA 1VAZA 3FLCO 3DXMA 3BF1A 4RCHA 5M1KA 4J8FA 4CZKA 4JEPA 2A41A 4JK9A 4Z94A 1T3VA 2BUPA 4KH6A 1NBWA 2PBDA 4AM6A 4YOVA 4BR0A 3D7EO 2NRTA 4BREA 1C0FA 4H5RA 4QS9A 2YHWA 4OPHA 2ZJQL 3CD6N 1YVNA 3ENHA 4WFNL 2I7PA 3ID6A 3DXKA 2FXUA 3SK3A 4BR2A 2QEXN 3MK6A 1SAZA 2E20A 4FWQA 3WT0A 2AP1A 3GE1A 3R1XA 3VEWA 4B1YB 1KQSM 5E84A 2P9KA 5ELZA 4JKGB 4C23A 4XH1A 2QWOA 2V52B 1K9MO 2I7NA 1VQ8N 1V4SA 1Y64A 2GUPA 3FZMA 4HTLA 4WYBA 3D6RA 3E9PA 3MX5A 3CQYA 4H0OA 1ATNA 3WQUA 5B8HA 2HSTA 3OHRA 3VGMA 5BR9A 3SAHA 1Q86O 1C0GA 4Y0WA 3RSEB 2E2OA 4M7YA 1D4XA 3ENOA 2VWBA 4O5FA 4H0VB 2P9UA 4JN4A 1X9JA 3QFPA 4RTFD 4NLBA 4BQZA 1Q82O 3LDOA 3I56N 2ASMA 1HKBA 3F9MA 1X3MA 4A61A 3O9RA 5AZIB 2GELA 1K8KB 3L6QA 5AQTA 5F0XA 4EFHA 3UB5A 2WFBA 4U7BA 2GWJA 2QWLA 5BPLA 4JD2A 4IEIA 1M90O 2F9TA 3Q7CA 2W40A 3VPZA 3CJCA 4ILGB 1BO5O 4I6MB 3H3NO 4FWMA 1OVYA 3ZETA 3DAWA 4JK8A 3MN9A 1BUPA 3P31A 3CETA 1IG8A 1NGIA 2Q0UA 5JVHL 5EXWA 3ZEUB 4JKBA 3C6AA 3A5NC 4YORA 2ZF5O 5GAHP 1NGBA 3EE8A 4BROA 1VQNN 4BC2A 4AF1A 3VTIA 4BC4A 3FE1A 4CZIA 5C0YA 4K42A 3VEXA 3WEEB 3CJAA 2IIRA 2P9NB 2OANA 4XH4A 4EIAA 5KPTA 2F7TA 3C6HA 3FZHA 3O9SA 1DKGD 1Q18A 3O9TA 1HKCA 3LDPA 4K41A 2NLXA 4C1NI 4JNEA 4NO7A 4BGBA 2WC9A 4GNIA 5JLFA 2V7YA 1GLEG 1HPMA 1E4FT 2QA4N 2HBKA 4GY2B 1Q81O 3C7NA 4B1UB 4PL7A 5AQGA 4BR7A 5BN8A 3AARA 4FL9A 4BRHA 1NGHA 4FOIA 1JCEA 4H5VA 2Q97A 1HLUA 3ATUA 3OBYA 4PKHA 5AQUA 5FPMA 5AQIA 4NLCA 5AQXA 4A59A 1ESVA 3H3OB 4CZHA 3K9KA 2QTDA 3M3ZA 1QQMA 4MDAA 3TSQA 2KHOA 3VEVA 3SAFA 1RFQA 4PKIA 4OPAA 2VGNA 3O1BA 3D2FA 5AQJA 5M1PA 5BRHA 5M1FA 4H0XB 5GADP 3J7ZO 3UKUA 4MLHA 4H03B 4JK7A 3IKMA 4IO8A 4KBOA 5DM6L 3CC4N 4E1JA 3OW2M 3GBTA 5HOOA 1NMDA 3I33A 5JVGL 3MN5A 2D0OA 3SBGA 5LY3A 3CPEA 2FSKA 3H45C 3MX2A 4BRMA 4WFAL 1TYQB 1RDUA 5AQVA 5GAGP 1X3NA 1CZAN 3WQTA 2V51B 1BA0A 5AQHA 4YOYA 1Z6RA 3LDQA 1H1VA 4A2BA 2Q31A 1GLJO 4NB4A 4A5AA 3CMEN 5HL7L 3UKRB 3TPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZWH A;  4EHT A;  5I9E B;  3WXI A;  4FWN A;  1RGI A;  3LM9 A;  3VF2 A;  2VCP A;  3VES A;  4WQ4 A;  4YDU A;  5JIC A;  3J8A A;  4CBW A;  5FPE A;  1GLF O;  3WXJ A;  2UYT A;  2YCH A;  2E2N A;  5KPR A;  2NZT A;  4PL8 A;  3GL1 A;  4CZE A;  2E1Y A;  2CGL A;  3VGL A;  5EX5 A;  3WUH A;  2P9S B;  2IVO A;  4B1Z A;  4IXC A;  3SJH A;  4RWT A;  3VF6 A;  4FSV A;  3U9Z A;  4IZ9 A;  3BF3 A;  2HOE A;  4F9O A;  1T6D A;  3CJ7 A;  3R9P A;  4CZM A;  4B1X B;  1DGK N;  1T6C A;  2YJE A;  3RSE A;  4BRG A;  3U8X A;  1V4T A;  2FLO A;  4QS8 A;  3IFR A;  3U9D A;  4IJN A;  3AY9 A;  5FPD A;  3I8B A;  3AAQ A;  3CHW A;  1J6Z A;  2D4W A;  5AZI A;  3VER A;  3D2E B;  4WQ5 A;  3DXK B;  1BDG A;  3CI5 A;  2E1Z A;  4FOE A;  1ATR A;  3MDQ A;  2P9K B;  1YAG A;  1YXQ A;  2FSJ A;  4I6M A;  3QML A;  4BRK A;  4H0T B;  3EZW A;  4CD1 A;  3HTV A;  3EKU A;  3ZEU A;  3G25 A;  3HM8 A;  2D0P A;  3UE5 A;  2A40 A;  1JCF A;  4PKG A;  5JLH A;  5F1X A;  2CH6 A;  3S41 A;  2GWK A;  1NGD A;  3WXK A;  2BTF A;  5KQD A;  3ULE B;  4BG8 A;  2P9N A;  2Q36 A;  3HZ6 A;  3QBW A;  1NGE A;  4BRQ A;  3LM2 A;  3CIP A;  5AQF A;  2QWP A;  3IMX A;  4BRA A;  3R8E A;  5AQN A;  2Q2R A;  1GLB G;  1HKG A;  5AZJ A;  3MN6 A;  3TU5 A;  2A6A A;  3MCP A;  2E2P A;  2HF4 A;  3A5O C;  4FPA A;  3AAP A;  1E4G T;  2W41 A;  3C0B A;  3O5B A;  4JHD B;  4BRF A;  5EY4 A;  4BR5 A;  1T44 A;  3EO3 A;  4ISF A;  4H0P A;  3ZX0 A;  1QQN A;  1NGJ A;  5JMV A;  1XUP O;  4H5N A;  3QDK A;  1U2V B;  2E8A A;  2IVP A;  2P9P A;  4EAH D;  3KZB A;  3JXU A;  4H0Y B;  3CJB A;  2CGJ A;  3QIC A;  2P9I A;  1MA9 B;  1NLV A;  4CZF A;  3KHY A;  4CBU A;  1NGC A;  2P9L A;  3VET A;  1KAX A;  2CH5 A;  3H6E A;  5BPM A;  2ITM A;  1TYQ A;  1XC3 A;  1XQS C;  4BC3 A;  4ISE A;  1S22 A;  1NWK A;  3LDN A;  2IVN A;  1NGF A;  5ADX H;  3C7N B;  2D1K A;  3DWL A;  5AFU H;  4CJ7 A;  4K43 A;  3UKR A;  5KQ8 A;  4AM7 A;  1RDW X;  2WUS A;  2QW9 A;  5BRD A;  1SZ2 A;  3ZX3 A;  3BEX A;  3GOI A;  3O4W A;  3WXL A;  3LL3 A;  1EQY A;  4FWK A;  3H1V X;  3IUC A;  3A0I X;  3EN9 A;  3R6M A;  1KAY A;  4XEI A;  2AA4 A;  4A62 A;  1NM1 A;  4DQ8 A;  5AQY A;  3UKU B;  3A8Y A;  5E26 A;  1GLL O;  1JCG A;  5AQQ A;  4O8K A;  3VEN A;  5AQL A;  3A5L C;  4ISG A;  2GEM A;  5TKY A;  4A2A A;  1Z05 A;  1ZC6 A;  2J4R A;  3BUZ B;  4BVP A;  5AQZ A;  3GG4 A;  3HSC A;  4DHY A;  2QWM A;  4H5T A;  4MLE A;  4FO0 A;  2V7Z A;  2QXL A;  3FZL A;  4DB3 A;  1QZ5 A;  3CJ1 A;  3SMS A;  1TUY A;  1KAZ A;  4BRN A;  5LJW A;  5F2R A;  3DXM B;  2YHX A;  3QB0 A;  4QS7 A;  1GLD G;  1SQK A;  3D2E A;  3HBT A;  1BG3 A;  2ASP A;  3SLC A;  3CQX A;  1DEJ A;  1K8K A;  2YJF A;  3M6G A;  4B9Q A;  3U4L A;  4LC9 B;  2ZGZ A;  3VEO A;  5BRF A;  2EWS A;  3IDH A;  1R59 O;  2FSN A;  5ADX A;  3O08 A;  3VOV A;  5AFU A;  2QWN A;  3GDQ A;  1NGA A;  1IJJ A;  4BRC A;  5AQP A;  5CE3 A;  2E88 A;  5AQM A;  3O80 A;  1GLA G;  1TUU A;  3ULE A;  3B8A X;  3JS6 A;  4FWR A;  2Q1N A;  1LOT B;  2PAV A;  1BA1 A;  5AQR A;  4CI6 A;  3O6W A;  4M7X A;  2P9U B;  3WEE A;  4CBX A;  4IJA A;  3KVG A;  3HI0 A;  3ID8 A;  1U6Z A;  3MMV A;  3H1Q A;  1BOT O;  3QFU A;  1KXP A;  3FR0 A;  2A3Z A;  3MN7 A;  4JHD A;  3VF4 A;  3FGU A;  4H5W A;  2ZGY A;  4K25 A;  1LCU A;  5AQK A;  1WUA A;  2QWQ A;  5BPN A;  4JD2 B;  1HX1 A;  5FPN A;  1BU6 O;  4HWI A;  3O8M A;  4MO4 A;  1BWF O;  4BRL A;  3ZET B;  2DPN A;  4BVO A;  4CD3 A;  1WOQ A;  4FWO A;  5AQO A;  2HF3 A;  4EHU A;  1U2V A;  3W3D A;  3O1W A;  3EKS A;  1G99 A;  1ATS A;  3SMP A;  2CGK A;  2HMP A;  5BN9 A;  2NRH A;  4BRI A;  3QBX A;  4CZJ A;  1MWK A;  4CZL A;  1QZ6 A;  5AZJ B;  3FZF A;  4WQ4 C;  3A5M C;  3BP8 A;  4YDU C;  5EOY A;  1HUX A;  2YI1 A;  5AQS A;  2QM1 A;  2YHY A;  4BR4 A;  4BRP A;  4MO5 A;  2A5X A;  3L4I A;  2Q0R A;  1ZBS A;  3VGK A;  2F9W A;  1QQO A;  2ASO A;  3ZX2 A;  1NGG A;  2GTD A;  1ZXO A;  3LDL A;  3M1F A;  4IWV A;  3FFK B;  5AQW A;  2P9P B;  3EL2 A;  4DCH A;  3VEY A;  1YUW A;  2QWR A;  5LJV A;  4M63 C;  3VEZ A;  1MDU B;  3W0L A;  4B1W B;  3DJC A;  4XH5 A;  5EVZ A;  2H3G X;  3ATV A;  2P9I B;  3P4I A;  4L3Q A;  1MWM A;  2FF6 A;  5BRE A;  5KPZ A;  4BR9 A;  2E2Q A;  4B1V A;  3D2F B;  2P9L B;  4JAX A;  4FWS A;  4BGA A;  4BRD A;  4BG9 A;  4FPB A;  4WQ5 C;  3FZK A;  2A42 A;  2P9S A;  3L0Q A;  3CJ9 A;  3H46 O;  1P8Z A;  1GLC G;  5AR0 A;  4BQL A;  4BC5 A;  2VYP A;  4CZG A;  1S3X A;  2FF3 B;  4FWL A;  1QHA A;  1HJO A;  4FWP A;  1OKJ A;  3CER A;  3FLC O;  3DXM A;  3BF1 A;  4RCH A;  4J8F A;  4CZK A;  2A41 A;  4Z94 A;  2BUP A;  1NBW A;  2PBD A;  4AM6 A;  4BR0 A;  3D7E O;  4BRE A;  1C0F A;  4H5R A;  4QS9 A;  2YHW A;  1YVN A;  3ENH A;  2I7P A;  3DXK A;  2FXU A;  3SK3 A;  4BR2 A;  3MK6 A;  1SAZ A;  2E20 A;  4FWQ A;  3WT0 A;  2AP1 A;  3GE1 A;  3VEW A;  4B1Y B;  5E84 A;  2P9K A;  5ELZ A;  4C23 A;  4XH1 A;  2QWO A;  2V52 B;  2I7N A;  1V4S A;  1Y64 A;  2GUP A;  3FZM A;  4HTL A;  4WYB A;  3CQY A;  4H0O A;  1ATN A;  3WQU A;  5B8H A;  3OHR A;  3VGM A;  5BR9 A;  1C0G A;  4Y0W A;  3RSE B;  2E2O A;  4M7Y A;  1D4X A;  3ENO A;  2VWB A;  4O5F A;  4H0V B;  2P9U A;  4JN4 A;  1X9J A;  3QFP A;  4RTF D;  4BQZ A;  3LDO A;  2ASM A;  1HKB A;  3F9M A;  1X3M A;  4A61 A;  5AZI B;  2GEL A;  1K8K B;  3L6Q A;  5AQT A;  5F0X A;  4EFH A;  3UB5 A;  2GWJ A;  2QWL A;  5BPL A;  4JD2 A;  2F9T A;  2W40 A;  3VPZ A;  3CJC A;  1BO5 O;  4I6M B;  3H3N O;  4FWM A;  3ZET A;  3DAW A;  3MN9 A;  1BUP A;  3CET A;  1IG8 A;  1NGI A;  2Q0U A;  5EXW A;  3ZEU B;  3A5N C;  2ZF5 O;  1NGB A;  4BRO A;  4BC2 A;  4BC4 A;  3FE1 A;  4CZI A;  4K42 A;  3VEX A;  3WEE B;  3CJA A;  2IIR A;  2P9N B;  2OAN A;  4XH4 A;  4EIA A;  5KPT A;  3FZH A;  1DKG D;  1Q18 A;  1HKC A;  3LDP A;  4K41 A;  2NLX A;  4JNE A;  4NO7 A;  4BGB A;  4GNI A;  5JLF A;  2V7Y A;  1GLE G;  1HPM A;  1E4F T;  4GY2 B;  3C7N A;  4B1U B;  4PL7 A;  5AQG A;  4BR7 A;  5BN8 A;  3AAR A;  4FL9 A;  4BRH A;  1NGH A;  4FOI A;  1JCE A;  4H5V A;  2Q97 A;  1HLU A;  3ATU A;  4PKH A;  5AQU A;  5FPM A;  5AQI A;  5AQX A;  1ESV A;  3H3O B;  4CZH A;  3M3Z A;  1QQM A;  2KHO A;  3VEV A;  1RFQ A;  4PKI A;  5AQJ A;  5BRH A;  3O1B A;  3D2F A;  4H0X B;  3UKU A;  4MLH A;  4H03 B;  4IO8 A;  4KBO A;  4E1J A;  3GBT A;  1NMD A;  3I33 A;  3MN5 A;  2D0O A;  5LY3 A;  2FSK A;  3H45 C;  4BRM A;  1TYQ B;  5AQV A;  1X3N A;  1CZA N;  3WQT A;  2V51 B;  1BA0 A;  5AQH A;  1Z6R A;  3LDQ A;  1H1V A;  4A2B A;  2Q31 A;  1GLJ O;  4NB4 A;  3UKR B;  3TPQ A; 
#chains in the Genus database with same CATH topology
 4OLA A;  2ZWH A;  4CJW A;  2BAN A;  3WXI A;  4DV2 K;  1YJN N;  1RGI A;  3BDP A;  2VWK A;  2VCP A;  1RT2 A;  3DLR A;  1HRH A;  1KFD A;  4DWI A;  1QVG M;  2YCH A;  2E2N A;  3RRH A;  1RTD A;  3GL1 A;  3G4S N;  2E1Y A;  4AHU A;  3VGL A;  1S5J A;  5D3G A;  2OTL N;  2IVO A;  4FJL A;  2GV9 A;  3BZK A;  4IZ9 A;  4F9O A;  3AA5 X;  4B1X B;  1T6C A;  2YJE A;  3KLE A;  4BRG A;  1U04 A;  2FLO A;  1BCO A;  3IFR A;  3U9D A;  4IJN A;  1S72 N;  1SL1 A;  4NYN A;  3NMU A;  1OH7 A;  4YOX A;  3OYE A;  3VA3 A;  3NE6 A;  2W6L A;  2G8W A;  2JWL A;  3MDQ A;  3LP0 A;  3HOS A;  1XMQ K;  1UOC A;  3MCA B;  4AHT A;  4I6M A;  3I0S A;  4CHY A;  4ICL A;  4NCG A;  3O9U A;  5SZT A;  4KH4 A;  3ZEU A;  3G25 A;  3T7Z A;  1JCF A;  3NVM A;  1UWB A;  1NGD A;  2E6M A;  1L3V A;  4Y1C A;  2BTF A;  4C8M A;  2GX9 A;  4BG8 A;  2Q36 A;  4BDZ A;  4NCB A;  3QBW A;  4BRQ A;  1U45 A;  4KB1 A;  4B3T K;  2RF2 A;  4CJ5 A;  5AQN A;  2Q2R A;  2ZJP L;  1HKG A;  2B5J A;  1U49 A;  2E2P A;  3T1A A;  1VQP N;  1DTQ A;  2HF4 A;  1K73 O;  2W41 A;  2YNH A;  1IKX A;  3I0R A;  3ITH A;  5EY4 A;  2DFH A;  3OY9 A;  2QI2 A;  1KFS A;  5KI6 A;  3PLA A;  2RKI A;  3V81 A;  4MDB A;  3EO3 A;  4ISF A;  1R0A A;  1B92 A;  3U6F A;  1CLQ A;  3QDK A;  2HHH K;  4B3M K;  2E8A A;  2IVP A;  4EAH D;  2HBM A;  4O0J A;  3CJB A;  4B9T A;  3RTV A;  4JKA A;  4OKJ A;  4LF5 K;  3VQ8 A;  1NGC A;  1YF5 L;  2O4I A;  1J54 A;  2VQF K;  4E7L A;  4LFA K;  4DFJ A;  4E3S A;  4IEE A;  4F8R A;  2Z1G A;  1XQS C;  3PX4 A;  5ADX H;  1NGF A;  1A5W A;  4CJ7 A;  1RTJ A;  1WAJ A;  2QW9 A;  3BEX A;  3LL3 A;  1LWF A;  4GKK K;  3A0I X;  1L3S A;  4A62 A;  1L3U A;  2X6S A;  3NCI A;  1YTA A;  1RDA A;  3AO5 A;  4GMJ B;  1GOA A;  3NF9 A;  1JCG A;  2O8F B;  4O8K A;  2Z1J A;  3CF5 L;  1T8E A;  4GV9 A;  4CJE A;  1Z05 A;  4FM1 A;  4BVP A;  5MLC Q;  3HSC A;  1VHX A;  2QWM A;  4MLE A;  4FO0 A;  4BY9 C;  2V7Z A;  2QXL A;  3FZL A;  4IO9 L;  4CIG A;  3CJ1 A;  3TR8 A;  1S1V A;  4B9N A;  5LJW A;  3PSI A;  2O8E B;  1S1W A;  2GBZ A;  2UUA K;  1SQK A;  3ZSO A;  3L2W A;  5C25 A;  1CXQ A;  1EP4 A;  4EZ6 A;  1K8K A;  3M6G A;  4B9Q A;  2P5O A;  2X74 A;  3U4L A;  5BRF A;  2EWS A;  3IDH A;  4M3R A;  2HNY A;  3K9J A;  5AFU A;  4CEO A;  4O0I A;  4BRC A;  4DTU A;  2FBT A;  3G71 N;  4O5B A;  2KTQ A;  2AJQ A;  3O80 A;  1SKR A;  4CEQ A;  4DU3 A;  3BZC A;  3LDS A;  3AVK A;  3F5T A;  1BA1 A;  5AQR A;  3AO4 A;  2P9U B;  2ITG A;  4LY7 A;  4NCA A;  1S9E A;  1BOT O;  1D9F A;  3ZSX A;  3KKS A;  4DMN A;  3FGU A;  1B9D A;  2ZGY A;  3CCS N;  4C8N A;  1WUA A;  1VQL N;  1E3M A;  4MQ3 A;  3LWL A;  3CPW M;  3ZSQ A;  2ZQB A;  4CEB A;  1IKY A;  1C0U A;  4BRL A;  4BVO A;  4DTR A;  1DTT A;  4KI6 A;  3RMA A;  1NKC A;  1JKH A;  1T7P A;  1ATS A;  3SMP A;  2CGK A;  4I7F A;  1BIU A;  2HMP A;  4YOT A;  3RWU A;  3NHG A;  3P83 D;  5DM7 L;  3HST B;  3S3M A;  2NRZ A;  4YNQ A;  2IS3 A;  1TL1 A;  1YJW N;  3FZF A;  4WQ4 C;  3A5M C;  1FXX A;  1K6Y A;  4BDP A;  2YI1 A;  2YNF A;  3JYT A;  4BRP A;  3OYM A;  3QEI A;  2QKB A;  1VQ5 N;  2A5X A;  3L4I A;  3BGR A;  1RCH A;  1ZBS A;  3VGK A;  2F9W A;  4IG3 A;  2ASO A;  3ZX2 A;  3AVM A;  3P1G A;  1KD1 O;  3P39 A;  3VQD A;  4W5Q A;  1ZXO A;  4IWV A;  2ZJR L;  3FFK B;  2P9P B;  3SCX A;  3EL2 A;  4JKC A;  2P5G A;  4WE1 A;  1VQK N;  3F9K A;  3W0L A;  4B1W B;  4DQQ A;  5EVZ A;  1OH5 A;  3NBP A;  3OYG A;  2P9I B;  3VQC A;  4L3Q A;  4CED A;  3D45 A;  1IG9 A;  5BRE A;  1Z26 A;  4QOZ B;  4BR9 A;  2P9L B;  4GV3 A;  4JAX A;  3CYM A;  2KFZ A;  3FZK A;  2A42 A;  3L0Q A;  4IG0 A;  3TI0 A;  4K8X A;  3H46 O;  1P8Z A;  3O3F A;  1LAV A;  3EE9 A;  4M45 A;  5K14 A;  1S6Q A;  4CZG A;  1I39 A;  1S3X A;  4CE9 A;  2FF3 B;  1QHA A;  1HJO A;  3A2F A;  4FWP A;  4KHN A;  3LAL A;  3DXM A;  3BF1 A;  4RCH A;  4DUY K;  3PO5 A;  2HHX A;  4KAZ A;  2NRT A;  3MED A;  2F96 A;  2HND A;  1RNH A;  1YVN A;  3ENH A;  2FXU A;  4I9L A;  2QEX N;  1SAZ A;  4FLV A;  2IOC A;  2AP1 A;  1WSF A;  2P1J A;  4FLU A;  1NJX A;  1TKZ A;  3ZSY A;  4UQG A;  5LMN K;  1Q8I A;  3K0S A;  2V52 B;  5FDL A;  1VQ8 N;  4AQY K;  3IS9 A;  4WYB A;  3QNO A;  3CQY A;  4H0O A;  1ATN A;  4CVN E;  2DTU A;  5B8H A;  3THY A;  2IC3 A;  3D0P A;  4M7Y A;  1O1W A;  1FW6 A;  4ZTF A;  4M3X A;  1SV5 A;  4DFK A;  3PY8 A;  3H08 A;  1Q82 O;  3HVT A;  1X3M A;  4CIF A;  5F0X A;  3UB5 A;  4U7B A;  5BPL A;  4LF8 K;  4CGD A;  1C1B A;  1BCM A;  2W40 A;  3HL8 A;  4ILG B;  4I6M B;  3ZET A;  3DAW A;  2UUC K;  3MN9 A;  3CET A;  1NGI A;  5EU7 A;  4F4K A;  5JVH L;  5EXW A;  3ZEU B;  2X6N A;  3TAN A;  4JKB A;  1QSY A;  3C6A A;  3QIN A;  2ZF5 O;  3MEE A;  1ZBF A;  3FE1 A;  5BR8 K;  3VEX A;  3WEE B;  2F8S A;  4IFY A;  4EIA A;  4N47 A;  2F7T A;  3C6H A;  4ELU A;  1B9F A;  1DKG D;  3O9T A;  4X62 K;  2Z1I A;  4HTU A;  4LF7 K;  1C1A A;  3ISN C;  3HJF A;  1E4F T;  1FKO A;  2QA4 N;  2HBK A;  3LP1 A;  4GY2 B;  3V9W A;  1Q81 O;  3ZT4 A;  2OA8 A;  3DRS A;  3V9S A;  1KVA A;  1ASW A;  3NF8 A;  4H5V A;  1HLU A;  3WNH A;  4XIU A;  3OBY A;  4JRQ A;  4DV0 K;  3TAP A;  5AQU A;  5FPM A;  2VG5 A;  5C42 A;  1EWQ A;  3OYF A;  2QTD A;  3TSQ A;  1QQM A;  3SAF A;  4PKI A;  4AHC A;  4DTP A;  4Z4I A;  3D2F A;  5M1P A;  3J7Z O;  4GKJ K;  4YY3 K;  5CYQ A;  4J2E A;  4DR3 K;  3NH0 A;  4CF2 A;  3V9U A;  4IO8 A;  3CC4 N;  2O8F A;  3SUP A;  3OW2 M;  3EY1 A;  2ZD1 A;  5HOO A;  1WB9 A;  1NMD A;  1VSD A;  3ULD A;  3SBG A;  3MX2 A;  5AQV A;  5GAG P;  2EX3 A;  1CZA N;  1Z25 A;  3WQT A;  3B6P A;  3M8Q A;  3AA4 A;  4YOY A;  1ZBH A;  3LDQ A;  1IBM K;  4A5A A;  3CME N;  1NNE A;  3OYH A;  1IBK K;  4IOA L;  3PIP L;  4FWN A;  2G8V A;  3LM9 A;  2O8E A;  3VES A;  4YFU A;  1IV0 A;  2IGI A;  4WQ4 A;  4YOU A;  3OYA A;  4A5B A;  4DR6 K;  1GLF O;  2UYT A;  4B9M A;  4V19 S;  1TK0 A;  1TVR A;  2Q3S A;  2CGL A;  1WAF A;  3LWM A;  4L8R B;  4B1Z A;  2BE2 A;  4RWT A;  2DFF A;  4FVU A;  1QE1 A;  4RW9 A;  2HOE A;  3CCQ N;  2HHU A;  3NGY A;  4JV5 K;  4CJR A;  1TKT A;  4J2A A;  3AY9 A;  2PYL A;  4UY8 O;  5CYM A;  3ZT0 A;  5E41 A;  3QNN A;  3O4N A;  4DS4 A;  3T1H K;  3RMC A;  3M8P A;  3CI5 A;  1ATR A;  1NK0 A;  1CXU A;  1YAG A;  3QIO A;  2OPR A;  1YXQ A;  3THW B;  4DSI A;  3HPG A;  3QML A;  4BRK A;  5KRT A;  2KQ2 A;  4H0T B;  3EZW A;  3EKU A;  3AVL A;  3HM8 A;  3M5R A;  1W2B M;  4PKG A;  5JLH A;  4LH5 A;  3S41 A;  2GWK A;  4DLE A;  4JYA K;  4CK3 A;  5CZ2 A;  2P9N A;  4DS5 A;  3LM2 A;  3IMX A;  4BRA A;  3RMB A;  3CCJ N;  2KZZ A;  4ID5 A;  5CHI A;  2PZS A;  3MN6 A;  3MCP A;  3EEQ A;  4FPA A;  1E4G T;  4QAG A;  4BRF A;  2HNZ A;  1QSS A;  4CJQ A;  3MXJ A;  2VWJ A;  4BR5 A;  1TAU A;  3O4Q A;  4DUZ K;  2OYQ A;  4JI0 K;  1WSI A;  1NGJ A;  1W0H A;  3NH2 A;  4B3S K;  4M42 A;  2P9P A;  3SI6 A;  2JWK A;  2P9I A;  1MA9 B;  3OA9 A;  3VQQ A;  5J1E A;  4CBU A;  2P9L A;  2CH5 A;  4N76 A;  3CCE N;  4BE0 A;  5GIP A;  5JS1 A;  3L3U A;  1TYQ A;  3QER A;  1XC3 A;  4ISE A;  3AVF A;  3DI6 A;  1OH8 A;  2D1K A;  5AFU H;  4AM7 A;  4ILH A;  2WUS A;  4KH5 A;  5BRD A;  3ZX3 A;  3O4W A;  3WXL A;  1EQY A;  4CF9 A;  3ZLJ A;  2ZE2 A;  3DMJ A;  1NK4 A;  1K8A O;  1VK0 A;  2AA4 A;  1QVF M;  3L2U A;  3OYI A;  2LSN A;  5AQY A;  4DV5 K;  5DMR A;  4DKW A;  5E26 A;  1RT1 A;  2G8U A;  1RDD A;  3QIP A;  5TKY A;  4K8Z A;  1ZC6 A;  3BUZ B;  4MFB A;  5AQZ A;  1XWL A;  3DRP A;  3DOL A;  5HRN A;  2E5L K;  3CQ8 A;  4DSF A;  2UXB K;  2YNI A;  4IKF A;  1VQM N;  4BRN A;  3DXM B;  3LPU A;  1YIT N;  2YHX A;  4M3U A;  1HNW K;  1GLD G;  3D2E A;  1ZBU A;  3VQ9 A;  4JS5 A;  3LZI A;  4H4O A;  1BG3 A;  3C6T A;  3SLC A;  2KFN A;  4B9V A;  3KLG A;  4FW1 A;  4X64 K;  2YJF A;  4IFE A;  4LC9 B;  4HUG A;  3VEO A;  1D8Y A;  1KTQ A;  4KHP K;  4E1N A;  1W97 L;  3GDQ A;  1YJ9 N;  1IJJ A;  3SJJ A;  3T69 A;  3KLH A;  1TK8 A;  5AQP A;  4CFB A;  5CE3 A;  3ZSR A;  4FJJ A;  1X1P A;  1IH7 A;  4BE1 A;  4WFB L;  3JS6 A;  2WOM A;  4U67 L;  3E66 A;  3THY B;  4EZ9 A;  1LOT B;  1N6Q A;  3WEE A;  4IJA A;  3KVG A;  3WNE A;  3MMV A;  3E1Y A;  3FR0 A;  3MN7 A;  4JHD A;  1SL0 A;  4EP4 A;  3I55 N;  1NK6 A;  1N32 K;  4HWI A;  5C10 A;  3ZET B;  2DPN A;  1NK9 A;  3P5J A;  2HF3 A;  4RW6 A;  1U2V A;  3W3D A;  4EHU A;  3CFR A;  1BL3 A;  1YHQ N;  1TGO A;  4IFV A;  3K2P A;  5BN9 A;  4OO1 J;  4CGI A;  3QBX A;  4H4M A;  5IWA K;  4AHV A;  2NRX A;  3UIQ A;  4R5P A;  1JJ2 M;  4YOW A;  3TAE A;  2PYJ A;  4FCY A;  1HMV A;  4C8L A;  3CXC M;  2YX6 A;  3SPY A;  1EO1 A;  2KLA A;  1NGG A;  2QK9 A;  3MWT A;  3AVN A;  1CZ9 A;  1YVU A;  4TSX A;  3NVK A;  1BIS A;  1RBR A;  4O8U A;  4KRE A;  4FK4 A;  3OYN A;  1YUW A;  1FJG K;  1MDU B;  4XH5 A;  3SQ2 A;  3OTO K;  3TWH A;  3P4I A;  4O55 A;  3NH1 A;  2E2Q A;  4B1V A;  3D2F B;  4JLH A;  4B08 A;  1RT5 A;  4FWS A;  3U3Y A;  4BRD A;  5M1Q A;  4BG9 A;  3TTD A;  3CJ9 A;  3KD5 E;  4RW8 A;  5FLX O;  3TTC A;  2KKZ A;  3V9X A;  5AR0 A;  4BQL A;  5KTQ A;  3LAK A;  4ILJ A;  3CC7 N;  1VSJ A;  3WNG A;  2W6K A;  1TV6 A;  1OKJ A;  3OYJ A;  4JK9 A;  2BUP A;  4KH6 A;  3E01 A;  1NBW A;  2PBD A;  4AM6 A;  3D7E O;  4BRE A;  3ZCM A;  4CGH A;  2YKM A;  4OPH A;  2ZJQ L;  1C0T A;  2I7P A;  3R1X A;  3V9Z A;  1T03 A;  3OVN A;  2XY7 A;  3THW A;  3SYZ A;  4XH1 A;  5C24 A;  2HMI A;  2I7N A;  4O4G A;  1ASU A;  3AO2 A;  3FZM A;  3D6R A;  4FJM A;  2VG7 A;  4E89 A;  4AIL C;  4FJN A;  3OHR A;  1C0G A;  4FJG A;  1ZBI A;  3LP2 A;  4JI6 K;  2VG6 A;  1QQC A;  3QFP A;  4RTF D;  3I56 N;  4HUF A;  4KHU A;  2OZS A;  5FRO A;  4A61 A;  3O9R A;  3KLF A;  2IDO A;  2GEL A;  2XY5 A;  3L6Q A;  4EFH A;  3AVJ A;  2F9T A;  3CJC A;  5HRO A;  1OH6 A;  2HB5 A;  2HHS A;  3H3N O;  3P31 A;  2DY4 A;  1NK8 A;  3DLK A;  5J2N A;  4CHO A;  2G8H A;  1NGB A;  4BRO A;  4AF1 A;  3VTI A;  4KHS A;  1NJY A;  4BC4 A;  4E7H A;  2P9N B;  5KPT A;  3DOK A;  2E6L A;  1Q18 A;  2X78 A;  4CHQ A;  1HKC A;  4K41 A;  2UUB K;  4C1N I;  1HJR A;  2ZM6 K;  4NO7 A;  4RW7 A;  3CFP A;  3J7A P;  5J2P A;  4DR7 K;  5AQG A;  1WSJ A;  4BR7 A;  3QEP A;  5A2Q O;  1WBB A;  1X9W A;  3EZ5 A;  4F2R A;  5AQI A;  4LD0 A;  4A59 A;  1ESV A;  1IKV A;  2A1S A;  3ASM A;  3PIO L;  4OPA A;  2Y1J A;  4DQR A;  2O8C B;  3DLE A;  2ATQ A;  4H0X B;  3PO4 A;  1HYS A;  1D9D A;  5DM6 L;  3GBT A;  3I33 A;  3MN5 A;  1EX4 A;  1TYQ B;  1D5A A;  1NK7 A;  3IRX A;  1Z6R A;  4CHN A;  5FRM A;  4NB4 A;  1W7A A;  5HL7 L;  5CY4 A;  4M3T A;  1RBS A;  1VQ7 N;  1S6P A;  3S3N A;  5JIC A;  3J8A A;  4CBW A;  4Q0B A;  3WXJ A;  3VQ6 A;  5KPR A;  2NZT A;  1RT4 A;  4CZE A;  3K5O A;  4JKG A;  4YHH K;  3WUH A;  4DFM A;  4LSN A;  4IXC A;  2JLE A;  3SJH A;  3MEG A;  3J7Y P;  3VF6 A;  4PQU A;  1LAW A;  3BF3 A;  1T6D A;  3CJ7 A;  4CZM A;  3TSU A;  1QHT A;  1DGK N;  3KKR A;  3QLH A;  4OGC A;  3U8X A;  1V4T A;  3G6E N;  1DLO A;  1TKD A;  5FPD A;  4IBN A;  2E4L A;  1T05 A;  1QS4 A;  3I8B A;  3AAQ A;  3CHW A;  3R3L A;  3KK7 A;  3CCR N;  4JKH A;  3TAB A;  3VER A;  1RDB A;  3QEW A;  3KWI A;  1LWC A;  3D2E B;  2VGM A;  1BDG A;  4GV6 A;  1ILY A;  4FOE A;  1S1T A;  1QSL A;  3G0Z A;  5M1N A;  5GAE P;  1Q7Y O;  4CJ4 A;  2FBX A;  4W5T A;  2D0P A;  3VA0 A;  1JXE A;  4FLT A;  2G8K A;  5F1X A;  3QO9 A;  4AH9 A;  3WXK A;  5KQD A;  3MEC A;  3K57 A;  2O4G A;  2HHT A;  3HZ6 A;  1NGE A;  3SUN A;  3CIP A;  1J5E K;  4NYF A;  2NRW A;  1WSE A;  1GLB G;  3O3H A;  4M3Z A;  1N33 K;  3TU5 A;  2A6A A;  2GUI A;  3A5O C;  3AAP A;  1N8R O;  3C0B A;  1HNI A;  3CC2 N;  4JHD B;  2UXD K;  3SQ1 A;  3PUF A;  4HCB A;  1ITG A;  4JKE A;  3N4Q A;  1I3A A;  1KRP A;  2XHB A;  1RBV A;  3DRR A;  4H0P A;  3ZX0 A;  3KJV A;  4LFC K;  1XUP O;  3NF6 A;  3SUO A;  1U2V B;  3CCU N;  4DR5 K;  3KZB A;  4H0Y B;  3QIC A;  2CGJ A;  1NLV A;  1KVB A;  3KHY A;  2HBJ A;  3NGZ A;  4Y1D A;  4CJK A;  1HYV A;  1WSG A;  5BPM A;  3SV4 A;  4PWD A;  5GIO A;  4Q5V A;  4BC3 A;  5C2F A;  1UAX A;  3LDN A;  4GW6 A;  1A5V A;  1GOB A;  3C7N B;  5HRP A;  3UKR A;  5KQ8 A;  4CK1 A;  1RDW X;  4IOX A;  3TAM A;  5H1S Q;  3TAG A;  4E0D A;  3GOI A;  4DTJ A;  1ZYQ A;  3AGK A;  4FWK A;  3IUC A;  3R6M A;  4XEI A;  4FK2 A;  3TAF A;  1NM1 A;  5FRN A;  2BDP A;  4DTX A;  4DQ8 A;  3A8Y A;  1GLL O;  3VEN A;  5AQL A;  3A5L C;  4ISG A;  4JKD A;  4A2A A;  3CG7 A;  2J4R A;  3SPZ A;  4FJI A;  4JRP A;  4DHY A;  2OPS A;  2F4V K;  4CF8 A;  1P90 A;  4DV7 K;  4DB3 A;  5HRS A;  3AV9 A;  4KHW A;  1TUY A;  1KAZ A;  4JI2 K;  1LWE A;  3SBT A;  2BH1 A;  2A1R A;  3CQX A;  3DLG A;  1DEJ A;  3SQ0 A;  4DTN A;  3SZ2 A;  2ZGZ A;  5C12 A;  5T7B A;  1EWR A;  3ZYY X;  1R59 O;  2FSN A;  3VOV A;  2QWN A;  4CEZ A;  2BGG A;  1VRU A;  3AVC A;  1VSF A;  5TKW A;  4PHT X;  1SL2 A;  4GVE A;  2E88 A;  5AQM A;  1NG9 A;  3ULE A;  1W9H A;  4B8C A;  4LF9 K;  3HOT A;  3AGR A;  3E9L A;  4CI6 A;  3O6W A;  3ZSZ A;  4K0K K;  3ID8 A;  4BE2 A;  3KD1 E;  3H1Q A;  3LPT A;  1KXP A;  4FZX C;  5J2Q A;  1WLJ A;  4K25 A;  1LCU A;  4HUE A;  2O8D A;  5AQK A;  2QWQ A;  5BPN A;  3VTH A;  4KTZ A;  5FPN A;  4B9S A;  2NRV A;  4MO4 A;  3O8M A;  4CGJ A;  2YHA A;  2B6A A;  3DLL L;  3VQ4 A;  4CD3 A;  2FC0 A;  1RDC A;  3RVC A;  5KRS A;  4FK0 A;  3O1W A;  3EKS A;  1YIJ N;  1G99 A;  2WON A;  1SKS A;  1FKP A;  3DYA A;  2R7Y A;  4WF9 L;  4CW7 B;  2NRR A;  4CZJ A;  4CZL A;  2HW3 A;  3QEX A;  2WBN A;  4DF4 A;  2O8C A;  4FLX A;  1QZ6 A;  5AZJ B;  5C2D A;  3BP8 A;  4YDU C;  2D0B A;  1O13 A;  4BR4 A;  4LF6 K;  4MO5 A;  3V1Q A;  4N56 A;  1UA0 A;  4OPK A;  3L4Q A;  3DM2 A;  1YT3 A;  4CEE A;  3ZSW A;  4Z4C A;  4E7J A;  1JLG A;  5CZ1 A;  2GTD A;  1SS6 A;  4I2P A;  3M1F A;  3U3G A;  2G8F A;  4HVJ A;  4OGE A;  4DCH A;  3VEY A;  1LV5 A;  3ZT2 A;  5LJV A;  4M63 C;  2XY6 A;  2H3G X;  4G1Q A;  1VSI A;  1BQN A;  2FF6 A;  4H8K A;  4E1M A;  1VQ6 N;  1Q9X A;  1HQU A;  4J2D A;  1BIZ A;  3SV3 A;  2OPP A;  4FPB A;  4WQ5 C;  3DLB A;  4G9Z A;  2G8I A;  5JS2 A;  3OJU A;  4FW2 A;  1RTH A;  1GLC G;  4DU1 A;  4BC5 A;  2VYP A;  3V6D A;  3THV A;  3P38 A;  3CER A;  4J8F A;  4CZK A;  4JEP A;  2A41 A;  3AA2 A;  4Z94 A;  4I9Q A;  4YOV A;  3PV8 A;  4CJ3 A;  1C0F A;  4H5R A;  1KSP A;  4QS9 A;  2YHW A;  1NJZ A;  3LZJ A;  3ID6 A;  3NFA A;  1RTI A;  3SK3 A;  3MK6 A;  3T19 A;  2E20 A;  3CM5 A;  4FWQ A;  3DLH A;  3GE1 A;  4B1Y B;  5E84 A;  4JKG B;  3L2V A;  3BY5 A;  2QWO A;  4DTS A;  1NJW A;  1K9M O;  1HQE A;  4DU4 A;  2XY8 A;  3OS0 A;  3ZT1 A;  1LW0 A;  3L2Q A;  5KGW A;  3WQU A;  2HST A;  3VGM A;  5BR9 A;  1Q86 O;  2OZM A;  2DFE A;  2E2O A;  4DSL A;  4DR1 K;  3ENO A;  2VWB A;  4H0V B;  4JN4 A;  1RT6 A;  4BQZ A;  4Z4G A;  4NLB A;  3LDO A;  2UXC K;  5HP1 A;  3OJS A;  4Z0U A;  4O44 A;  5AQT A;  4FZY A;  4Z4F A;  2WFB A;  3OYK A;  4JD2 A;  4IEI A;  1M90 O;  2O8B B;  3ZSV A;  3VPZ A;  1EKE A;  1RT3 A;  1S1U A;  4FWM A;  3MAQ A;  1NOZ A;  2YV0 X;  4JK8 A;  2OCE A;  3KLI A;  1SUQ A;  4W5O A;  3RRG A;  1NU0 A;  2FBY A;  1HNZ K;  4FJ9 A;  1XNR K;  3F73 A;  3S3O A;  2WTU A;  4CJL A;  5GAH P;  3EE8 A;  4BC2 A;  1VSH A;  2RN2 A;  3HM9 A;  5C0Y A;  4K42 A;  2HHV A;  2IIR A;  2OAN A;  4XH4 A;  4CJV A;  3FZH A;  3LAM A;  3O9S A;  3NAE A;  3LDP A;  3VQE A;  2NLX A;  4FM2 A;  3THX A;  4JNE A;  5HLF A;  4FLW A;  4BGB A;  4GNI A;  1GLE G;  3NF7 A;  4FLZ A;  4FLY A;  4LH4 A;  4OKE A;  3C7N A;  4PL7 A;  4OLB A;  1X9S A;  4HHT A;  3AAR A;  4FOI A;  1JCE A;  4X66 K;  2Q97 A;  2I5J A;  1JXB A;  4PKH A;  2XRI A;  3M3Z A;  5J2M A;  2KHO A;  3VEV A;  3K5N A;  4DTO A;  5BRH A;  1VQO N;  3RR7 A;  5GAD P;  4ELV A;  4CEA A;  1BQM A;  1XHX A;  3ZT3 A;  4X65 K;  3AVI A;  4MLH A;  4H03 B;  3IKM A;  1NKB A;  4KBO A;  4KTW A;  2D0C A;  5JVG L;  5LY3 A;  3CPE A;  4WFA L;  2Z1H A;  4DV6 K;  5LMU K;  3JAM O;  1BA0 A;  1JLQ A;  5AQH A;  3HP9 A;  1H1V A;  4A2B A;  4M3Y A;  2Q31 A;  1UA1 A;  5HRR A;  3VQP A;  3UKR B;  3TPQ A;  4CEF A;  2UU9 K;  4CF1 A;  4EHT A;  5I9E B;  1VQ4 N;  3T1Y K;  3VF2 A;  4YDU A;  1TK5 A;  4DG1 A;  1J5O A;  5FPE A;  4DR4 K;  3K58 A;  3HRG A;  4PL8 A;  3M8S A;  4KHQ A;  5EX5 A;  2P9S B;  4FSV A;  3U9Z A;  1JLA A;  1BHL A;  1BI4 B;  1VSE A;  3VMF B;  4DV1 K;  3OYC A;  4LSL A;  3R9P A;  2RPI A;  3CFO A;  4AHR A;  3CMA N;  3RSE A;  1BGX T;  4DV3 K;  4QS8 A;  1C6V A;  2NNW A;  3CCV N;  3L2R A;  4DSJ A;  1J6Z A;  2D4W A;  5AZI A;  4WQ5 A;  3DXK B;  4CES A;  1VSM A;  3V1O A;  3S9H A;  2E1Z A;  4IDH A;  3AVH A;  2P9K B;  1N34 K;  4FJX A;  3L3V A;  3TSP A;  2D5R A;  2FSJ A;  3CM6 A;  4CD1 A;  4CFA A;  3HTV A;  2NUB A;  3UE5 A;  2A40 A;  1C0M A;  2CH6 A;  4W5R A;  3SNN A;  1KC8 O;  3AA3 A;  2HBL A;  4KRF A;  1IBL K;  3L8B A;  4M3W A;  1M1K O;  2RE2 A;  4JI4 K;  3ULE B;  1L3T A;  5AQF A;  2QWP A;  3QES A;  4OX9 K;  4BDY A;  3R8E A;  3TTF A;  1X9M A;  4F3O A;  4KHY A;  5AZJ A;  1N36 K;  5KGX A;  4JI1 K;  3O5B A;  1HYZ A;  4PUO A;  3CCM N;  2O8D B;  3EYZ A;  2OTJ N;  3E9O A;  3MXI A;  1T44 A;  2HVH A;  1QQN A;  4CER A;  5JMV A;  4H5N A;  4FM0 A;  4FZZ A;  1KVC A;  4F2S A;  2OPQ A;  4CJU A;  2IAJ A;  3JXU A;  4HCC A;  4DR2 K;  5CR4 A;  1JLC A;  4PA1 A;  5AJ3 K;  3V1R A;  3VN5 A;  3T3F A;  4KPY A;  4CZF A;  3VET A;  4CGF A;  1KAX A;  1J9A A;  4C1N K;  3H6E A;  4JI7 K;  2ITM A;  3F2K A;  1WBD A;  4FJ5 A;  1LW2 A;  1NWK A;  1S22 A;  4Z4H A;  4ZTJ A;  2IVN A;  1REV A;  3DWL A;  1NKE A;  4K43 A;  1HR0 K;  3OYB A;  3FFI A;  1N5Y A;  1SZ2 A;  1F21 A;  1G15 A;  3MWP A;  1RBT A;  3H1V X;  1XHZ A;  3EN9 A;  1KAY A;  4DTM A;  3C95 A;  4BWJ A;  3IAY A;  1JLE A;  3UKU B;  4M41 A;  5AQQ A;  5GIN A;  3KK3 A;  2GEM A;  3AO1 A;  4EP5 A;  4J2B A;  2PFU A;  1GOC A;  3GG4 A;  3M8R A;  4CJF A;  1KLN A;  4H5T A;  3WXM B;  1QZ5 A;  3SMS A;  4A57 A;  4RG8 A;  4NXN K;  5F2R A;  4W5N A;  4CIE A;  2RHK A;  3WNF A;  3QB0 A;  4QS7 A;  1RIL A;  4B3R K;  4OPJ A;  3HBT A;  4ID1 A;  2ASP A;  3QEV A;  4FXD A;  3ENB A;  1HNV A;  1QTM A;  1HPZ A;  1WN7 A;  3SAG A;  4ZHR A;  2O8B A;  2F8T A;  5ADX A;  4FJH A;  3O08 A;  3LP3 A;  5LL6 Z;  5I3U A;  4FJK A;  1NGA A;  4JKF A;  1U48 A;  2ETJ A;  5HBM A;  1A5X A;  2B4J A;  4LF4 K;  3CCL N;  1TL3 A;  1GLA G;  4FYD A;  1TUU A;  4FJ8 A;  3PX6 A;  3B8A X;  3HPO A;  1Y97 A;  4FWR A;  2Q1N A;  1FK9 A;  3B6O A;  2PAV A;  4E7I A;  4M7X A;  3G10 A;  4CBX A;  3HI0 A;  4CJS A;  1U6Z A;  1ASV A;  3QFU A;  1HNX K;  3TAQ A;  2A3Z A;  4WCE L;  3VF4 A;  2W42 A;  3O9Q A;  4H5W A;  3OYL A;  4DSE A;  1OVQ A;  1WSH A;  4JD2 B;  1DT9 A;  1HX1 A;  3OS2 A;  4NXM K;  1BU6 O;  5IT9 O;  1BWF O;  1WOQ A;  4FWO A;  5AQO A;  3J81 O;  2P51 A;  2JGU A;  4CCH A;  1XI1 A;  4JI8 K;  3HK2 A;  3RMD A;  2NRH A;  4BRI A;  3NDK A;  1MWK A;  1NJI O;  4PY5 A;  2EHG A;  3K5M A;  2YHB A;  5DK5 A;  4KKO A;  5EOY A;  1XNQ K;  1HUX A;  1JLF A;  4E7K A;  2HHW A;  5AQS A;  4F3T A;  1NMN A;  3HP6 A;  2QM1 A;  2YHY A;  3TAR A;  4B9U A;  1JL1 A;  3KWG A;  2Q0R A;  3N4P A;  2Y1I A;  3THX B;  1U47 A;  1RT7 A;  4JI3 K;  1QQO A;  4ELT A;  4IOC L;  2HVI A;  2KZM A;  3J80 O;  3C6U A;  3Q7B A;  4KFB A;  3LDL A;  1IO2 A;  4Z4E A;  1TAQ A;  1YI2 N;  5AQW A;  4KTQ A;  4LFB K;  3OBW A;  3NGI A;  2QWR A;  3VQ5 A;  1JLB A;  4R79 A;  3SQ4 A;  1J53 A;  3VEZ A;  3DJC A;  4RW4 A;  3AO3 A;  3ATV A;  3C65 A;  1MWM A;  3AVA A;  5KPZ A;  1VQ9 N;  5M1O A;  4DSK A;  4BGA A;  5C15 A;  1SKW A;  2YNG A;  2P9S A;  4CF0 A;  1BI4 A;  4I2Q A;  4C8K A;  4KO0 A;  4FWL A;  1WNS A;  4KB0 A;  3IG1 A;  1VAZ A;  3FLC O;  3OS1 A;  5M1K A;  4CHP A;  4OJR A;  1T3V A;  4CFC A;  3ALY A;  4BR0 A;  3K5L A;  2FBV A;  3HVR A;  4DF8 A;  3KTQ A;  3CD6 N;  4BAC A;  4WFN L;  3DXK A;  4BR2 A;  3K59 A;  3WT0 A;  1VRT A;  1U4B A;  3VEW A;  1KQS M;  3AVG A;  2P9K A;  5ELZ A;  3QET A;  4C23 A;  4N41 A;  3HXM A;  4CK2 A;  4GVM A;  1XMO K;  1V4S A;  2PY5 A;  3HYF A;  1Y64 A;  2GUP A;  1VSK A;  4HTL A;  1I94 K;  1ZBL A;  3RR8 A;  3KK1 A;  3E9P A;  3MX5 A;  3JSM A;  3V4I A;  2D0A A;  4OVL A;  4AHS A;  4CJP A;  3SAH A;  4FJ7 A;  4Y0W A;  3RSE B;  1S9G A;  1D4X A;  4DQS A;  4O5F A;  2P9U A;  3VQ7 A;  1X9J A;  4QCL A;  4OKK A;  4E19 A;  2XO7 A;  2ASM A;  1HKB A;  3F9M A;  3MXM A;  5AZI B;  4KI4 A;  4B3O A;  4DLG A;  5I42 A;  1K8K B;  3PX0 A;  2GWJ A;  2QWL A;  3O3G A;  3Q7C A;  2KW4 A;  1RBU A;  1BO5 O;  4DQI A;  1OVY A;  1TKX A;  1BUP A;  1C1C A;  1IG8 A;  2Q0U A;  4DFP A;  3OYD A;  1JL2 A;  1EET A;  3A5N C;  4YOR A;  1MU2 A;  4CHZ A;  4CEC A;  1L5U A;  1VQN N;  4CZI A;  3HT3 A;  3PSF A;  4KV8 A;  1VSL A;  3CJA A;  2QXF A;  3AVB A;  4CGG A;  4JI5 K;  4BWM A;  4C8O A;  4DQP A;  4FVM A;  2QKK A;  1XC9 A;  2WC9 A;  5JLF A;  4N5S A;  2V7Y A;  1HPM A;  5SWM A;  1KLM A;  3C94 A;  4B1U B;  1NK5 A;  1Q9Y A;  5BN8 A;  2YKN A;  4B8A B;  4FL9 A;  4BRH A;  1NGH A;  4JS4 A;  3VQB A;  3HO1 A;  3ATU A;  3KK2 A;  4NLC A;  5AQX A;  1KCF A;  3H3O B;  2VQE K;  4B9L A;  4CZH A;  3K9K A;  3HPH A;  4MDA A;  1EXQ A;  1RFQ A;  4CFD A;  5M1F A;  5AQJ A;  2VGN A;  3O1B A;  4DV4 K;  1CZB A;  4IDK A;  1YTU A;  3UKU A;  4JK7 A;  4E1J A;  1S1X A;  4CJT A;  1NOY A;  2D0O A;  2FSK A;  3H45 C;  3LAN A;  4BRM A;  1RDU A;  1X3N A;  2V51 B;  3SUQ A;  3KIO A;  1IKW A;  1GLJ O;  2HHQ A;  3VQA A;  3I8D A; 
#chains in the Genus database with same CATH homology
 2ZWH A;  4EHT A;  4IOA L;  5I9E B;  3WXI A;  3PIP L;  1YJN N;  4FWN A;  1VQ7 N;  1VQ4 N;  1RGI A;  3LM9 A;  3VF2 A;  2VCP A;  3VES A;  4WQ4 A;  4YDU A;  5JIC A;  3J8A A;  4YOU A;  4CBW A;  5FPE A;  4A5B A;  1GLF O;  3WXJ A;  1QVG M;  2UYT A;  2YCH A;  2E2N A;  5KPR A;  2NZT A;  3HRG A;  4PL8 A;  3GL1 A;  4CZE A;  3G4S N;  2E1Y A;  4JKG A;  2CGL A;  3VGL A;  5EX5 A;  3WUH A;  2P9S B;  2OTL N;  2IVO A;  4B1Z A;  4IXC A;  3SJH A;  4RWT A;  3VF6 A;  4FSV A;  3U9Z A;  4FVU A;  4IZ9 A;  3VMF B;  3BF3 A;  2HOE A;  4F9O A;  1T6D A;  3CJ7 A;  3CCQ N;  3R9P A;  4CZM A;  4B1X B;  3TSU A;  1DGK N;  1T6C A;  2YJE A;  3CMA N;  3RSE A;  4BRG A;  3U8X A;  1V4T A;  2FLO A;  3G6E N;  4QS8 A;  3IFR A;  3U9D A;  4IJN A;  3AY9 A;  5FPD A;  1S72 N;  3NMU A;  2NNW A;  3CCV N;  4YOX A;  3I8B A;  3AAQ A;  3CHW A;  3R3L A;  4UY8 O;  3KK7 A;  3CCR N;  1J6Z A;  2D4W A;  4JKH A;  5AZI A;  3VER A;  3KWI A;  3D2E B;  4WQ5 A;  3DXK B;  2VGM A;  1BDG A;  4GV6 A;  2JWL A;  3CI5 A;  2E1Z A;  4FOE A;  1ILY A;  1ATR A;  4IDH A;  3MDQ A;  5M1N A;  3HOS A;  2P9K B;  1YAG A;  5GAE P;  3TSP A;  3MCA B;  1YXQ A;  1Q7Y O;  2FSJ A;  4I6M A;  3QML A;  4BRK A;  4H0T B;  3EZW A;  4CD1 A;  3O9U A;  4KH4 A;  3HTV A;  3EKU A;  3ZEU A;  3G25 A;  3HM8 A;  2D0P A;  3M5R A;  3T7Z A;  2A40 A;  1JCF A;  4PKG A;  3UE5 A;  3NVM A;  5JLH A;  1W2B M;  5F1X A;  2CH6 A;  1KC8 O;  3S41 A;  2GWK A;  2HBL A;  1NGD A;  3WXK A;  2BTF A;  5KQD A;  1M1K O;  2GX9 A;  2RE2 A;  3ULE B;  4BG8 A;  2P9N A;  2Q36 A;  3HZ6 A;  3QBW A;  1NGE A;  4BRQ A;  3LM2 A;  3CIP A;  5AQF A;  2QWP A;  3IMX A;  2NRW A;  4BRA A;  3R8E A;  3CCJ N;  3TTF A;  5AQN A;  2Q2R A;  2ZJP L;  1GLB G;  1HKG A;  5AZJ A;  5CHI A;  3MN6 A;  3TU5 A;  2A6A A;  3MCP A;  2E2P A;  1VQP N;  2HF4 A;  3A5O C;  4FPA A;  3AAP A;  1E4G T;  1K73 O;  2W41 A;  1N8R O;  3C0B A;  3CC2 N;  3O5B A;  4JHD B;  4BRF A;  3CCM N;  5EY4 A;  4JKE A;  2QI2 A;  3N4Q A;  2OTJ N;  3E9O A;  3PLA A;  4BR5 A;  1T44 A;  4MDB A;  3EO3 A;  4ISF A;  4H0P A;  3ZX0 A;  1QQN A;  1NGJ A;  5JMV A;  1XUP O;  4H5N A;  3QDK A;  1U2V B;  2E8A A;  3CCU N;  2IVP A;  2P9P A;  4EAH D;  3KZB A;  2HBM A;  3JXU A;  4H0Y B;  3CJB A;  2CGJ A;  3QIC A;  5CR4 A;  2JWK A;  4JKA A;  2P9I A;  1MA9 B;  1NLV A;  3OA9 A;  4CZF A;  3KHY A;  4CBU A;  2HBJ A;  1NGC A;  2P9L A;  1YF5 L;  3VET A;  1KAX A;  2CH5 A;  4C1N K;  3H6E A;  5BPM A;  3CCE N;  5GIP A;  5GIO A;  4IEE A;  1TYQ A;  2ITM A;  3F2K A;  1XC3 A;  1XQS C;  4BC3 A;  5C2F A;  4ISE A;  1S22 A;  1NWK A;  3LDN A;  2IVN A;  1NGF A;  5ADX H;  3PIO L;  3C7N B;  2D1K A;  3DWL A;  5AFU H;  4CJ7 A;  4K43 A;  3UKR A;  5KQ8 A;  4AM7 A;  1RDW X;  4IOX A;  2WUS A;  4ILH A;  2QW9 A;  4KH5 A;  5BRD A;  1SZ2 A;  3ZX3 A;  5H1S Q;  3BEX A;  3GOI A;  3O4W A;  3WXL A;  3LL3 A;  1EQY A;  3MWP A;  3AGK A;  4FWK A;  3H1V X;  3IUC A;  3A0I X;  3EN9 A;  3R6M A;  1KAY A;  4XEI A;  2AA4 A;  1K8A O;  1QVF M;  4A62 A;  1NM1 A;  4DQ8 A;  5AQY A;  3UKU B;  3A8Y A;  4DKW A;  5E26 A;  1GLL O;  1JCG A;  5AQQ A;  4O8K A;  3VEN A;  3CF5 L;  5AQL A;  3A5L C;  4ISG A;  4GV9 A;  5GIN A;  4JKD A;  2GEM A;  5TKY A;  4A2A A;  1Z05 A;  1ZC6 A;  2J4R A;  3BUZ B;  2PFU A;  4BVP A;  5MLC Q;  5AQZ A;  3GG4 A;  3HSC A;  4DHY A;  2QWM A;  4H5T A;  4MLE A;  3WXM B;  4FO0 A;  4BY9 C;  2V7Z A;  2QXL A;  3FZL A;  1P90 A;  4IO9 L;  4DB3 A;  1QZ5 A;  3CJ1 A;  3SMS A;  1VQM N;  1TUY A;  4A57 A;  1KAZ A;  4BRN A;  5LJW A;  5F2R A;  3DXM B;  1YIT N;  3SBT A;  2RHK A;  2YHX A;  3QB0 A;  4QS7 A;  1GLD G;  1SQK A;  3D2E A;  2BH1 A;  3HBT A;  1BG3 A;  2ASP A;  3SLC A;  3CQX A;  3ENB A;  1DEJ A;  1K8K A;  2YJF A;  3M6G A;  4B9Q A;  3SAG A;  3U4L A;  4IFE A;  2ZGZ A;  4LC9 B;  5C12 A;  3VEO A;  5BRF A;  2EWS A;  3IDH A;  3ZYY X;  1R59 O;  2FSN A;  3K9J A;  5ADX A;  3O08 A;  3VOV A;  1W97 L;  2QWN A;  3GDQ A;  5AFU A;  1NGA A;  1IJJ A;  1YJ9 N;  4BRC A;  3T69 A;  1VQO N;  4JKF A;  5TKW A;  4PHT X;  4GVE A;  5AQP A;  5CE3 A;  2E88 A;  5AQM A;  3G71 N;  3O80 A;  3CCL N;  1GLA G;  1TUU A;  4WFB L;  3ULE A;  3B8A X;  3JS6 A;  4FWR A;  2Q1N A;  4U67 L;  3E66 A;  3HOT A;  1LOT B;  2PAV A;  3AGR A;  3E9L A;  3F5T A;  1BA1 A;  5AQR A;  4CI6 A;  3O6W A;  4M7X A;  2P9U B;  3WEE A;  4CBX A;  4IJA A;  3KVG A;  3HI0 A;  3ID8 A;  1U6Z A;  3MMV A;  3E1Y A;  3H1Q A;  1BOT O;  3QFU A;  1KXP A;  3FR0 A;  2A3Z A;  3MN7 A;  4JHD A;  3VF4 A;  4WCE L;  3O9Q A;  3FGU A;  4H5W A;  2ZGY A;  4K25 A;  3I55 N;  1LCU A;  3CCS N;  5AQK A;  1WUA A;  2QWQ A;  5BPN A;  1VQL N;  4JD2 B;  1DT9 A;  1HX1 A;  3VTH A;  5FPN A;  1BU6 O;  2NRV A;  3CPW M;  4HWI A;  3O8M A;  4MO4 A;  5C10 A;  1BWF O;  4BRL A;  3ZET B;  3DLL L;  2DPN A;  4BVO A;  4CD3 A;  1WOQ A;  4FWO A;  5AQO A;  2HF3 A;  3RVC A;  1U2V A;  3W3D A;  4EHU A;  3O1W A;  3EKS A;  1YHQ N;  1YIJ N;  1G99 A;  1ATS A;  3SMP A;  2CGK A;  2HMP A;  5BN9 A;  4YOT A;  4OO1 J;  4WF9 L;  2NRR A;  2NRH A;  4BRI A;  3QBX A;  4CZJ A;  5DM7 L;  1MWK A;  4CZL A;  1NJI O;  2NRZ A;  2WBN A;  2NRX A;  1YJW N;  1QZ6 A;  5AZJ B;  3FZF A;  4WQ4 C;  5C2D A;  3A5M C;  3BP8 A;  4YDU C;  5EOY A;  1HUX A;  2YI1 A;  1O13 A;  1JJ2 M;  5AQS A;  4YOW A;  2QM1 A;  2YHY A;  4BR4 A;  4BRP A;  1VQ5 N;  4MO5 A;  2A5X A;  3KWG A;  2Q0R A;  2YX6 A;  3L4Q A;  3L4I A;  3N4P A;  3CXC M;  1ZBS A;  3VGK A;  2F9W A;  1EO1 A;  2KLA A;  1QQO A;  2ASO A;  3ZX2 A;  1NGG A;  4IOC L;  3Q7B A;  3MWT A;  3P39 A;  1KD1 O;  2GTD A;  1SS6 A;  1ZXO A;  3LDL A;  3M1F A;  4IWV A;  2ZJR L;  3NVK A;  4O8U A;  1YI2 N;  3FFK B;  5AQW A;  2P9P B;  3EL2 A;  4JKC A;  4DCH A;  3OBW A;  1YUW A;  3VEY A;  2QWR A;  1VQK N;  4R79 A;  5LJV A;  4M63 C;  3VEZ A;  1MDU B;  3W0L A;  4B1W B;  3DJC A;  4XH5 A;  5EVZ A;  2H3G X;  3ATV A;  2P9I B;  3C65 A;  3P4I A;  4L3Q A;  1MWM A;  2FF6 A;  5BRE A;  5KPZ A;  1VQ9 N;  4BR9 A;  2E2Q A;  5M1O A;  3D2F B;  4B1V A;  1VQ6 N;  2P9L B;  4GV3 A;  4JAX A;  4FWS A;  4BGA A;  4BRD A;  5C15 A;  5M1Q A;  4BG9 A;  4FPB A;  4WQ5 C;  3FZK A;  2A42 A;  2P9S A;  3L0Q A;  3CJ9 A;  3TTD A;  4G9Z A;  3H46 O;  1P8Z A;  3TTC A;  1GLC G;  2KKZ A;  3EE9 A;  5AR0 A;  4BQL A;  4BC5 A;  2VYP A;  4ILJ A;  4CZG A;  1S3X A;  2FF3 B;  4FWL A;  3CC7 N;  1QHA A;  1HJO A;  4FWP A;  1OKJ A;  3P38 A;  3CER A;  1VAZ A;  3FLC O;  3DXM A;  3BF1 A;  4RCH A;  5M1K A;  4J8F A;  4CZK A;  4JEP A;  2A41 A;  4JK9 A;  4Z94 A;  1T3V A;  2BUP A;  4KH6 A;  1NBW A;  2PBD A;  4AM6 A;  4YOV A;  4BR0 A;  3D7E O;  2NRT A;  4BRE A;  1C0F A;  4H5R A;  4QS9 A;  2YHW A;  4OPH A;  2ZJQ L;  3CD6 N;  1YVN A;  3ENH A;  4WFN L;  2I7P A;  3ID6 A;  3DXK A;  2FXU A;  3SK3 A;  4BR2 A;  2QEX N;  3MK6 A;  1SAZ A;  2E20 A;  4FWQ A;  3WT0 A;  2AP1 A;  3GE1 A;  3R1X A;  3VEW A;  4B1Y B;  1KQS M;  5E84 A;  2P9K A;  5ELZ A;  4JKG B;  4C23 A;  4XH1 A;  2QWO A;  2V52 B;  1K9M O;  2I7N A;  1VQ8 N;  1V4S A;  1Y64 A;  2GUP A;  3FZM A;  4HTL A;  4WYB A;  3D6R A;  3E9P A;  3MX5 A;  3CQY A;  4H0O A;  1ATN A;  3WQU A;  5B8H A;  2HST A;  3OHR A;  3VGM A;  5BR9 A;  3SAH A;  1Q86 O;  1C0G A;  4Y0W A;  3RSE B;  2E2O A;  4M7Y A;  1D4X A;  3ENO A;  2VWB A;  4O5F A;  4H0V B;  2P9U A;  4JN4 A;  1X9J A;  3QFP A;  4RTF D;  4NLB A;  4BQZ A;  1Q82 O;  3LDO A;  3I56 N;  2ASM A;  1HKB A;  3F9M A;  1X3M A;  4A61 A;  3O9R A;  5AZI B;  2GEL A;  1K8K B;  3L6Q A;  5AQT A;  5F0X A;  4EFH A;  3UB5 A;  2WFB A;  4U7B A;  2GWJ A;  2QWL A;  5BPL A;  4JD2 A;  4IEI A;  1M90 O;  2F9T A;  3Q7C A;  2W40 A;  3VPZ A;  3CJC A;  4ILG B;  1BO5 O;  4I6M B;  3H3N O;  4FWM A;  1OVY A;  3ZET A;  3DAW A;  4JK8 A;  3MN9 A;  1BUP A;  3P31 A;  3CET A;  1IG8 A;  1NGI A;  2Q0U A;  5JVH L;  5EXW A;  3ZEU B;  4JKB A;  3C6A A;  3A5N C;  4YOR A;  2ZF5 O;  5GAH P;  1NGB A;  3EE8 A;  4BRO A;  1VQN N;  4BC2 A;  4AF1 A;  3VTI A;  4BC4 A;  3FE1 A;  4CZI A;  5C0Y A;  4K42 A;  3VEX A;  3WEE B;  3CJA A;  2IIR A;  2P9N B;  2OAN A;  4XH4 A;  4EIA A;  5KPT A;  2F7T A;  3C6H A;  3FZH A;  3O9S A;  1DKG D;  1Q18 A;  3O9T A;  1HKC A;  3LDP A;  4K41 A;  2NLX A;  4C1N I;  4JNE A;  4NO7 A;  4BGB A;  2WC9 A;  4GNI A;  5JLF A;  2V7Y A;  1GLE G;  1HPM A;  1E4F T;  2QA4 N;  2HBK A;  4GY2 B;  1Q81 O;  3C7N A;  4B1U B;  4PL7 A;  5AQG A;  4BR7 A;  5BN8 A;  3AAR A;  4FL9 A;  4BRH A;  1NGH A;  4FOI A;  1JCE A;  4H5V A;  2Q97 A;  1HLU A;  3ATU A;  3OBY A;  4PKH A;  5AQU A;  5FPM A;  5AQI A;  4NLC A;  5AQX A;  4A59 A;  1ESV A;  3H3O B;  4CZH A;  3K9K A;  2QTD A;  3M3Z A;  1QQM A;  4MDA A;  3TSQ A;  2KHO A;  3VEV A;  3SAF A;  1RFQ A;  4PKI A;  4OPA A;  2VGN A;  3O1B A;  3D2F A;  5AQJ A;  5M1P A;  5BRH A;  5M1F A;  4H0X B;  5GAD P;  3J7Z O;  3UKU A;  4MLH A;  4H03 B;  4JK7 A;  3IKM A;  4IO8 A;  4KBO A;  5DM6 L;  3CC4 N;  4E1J A;  3OW2 M;  3GBT A;  5HOO A;  1NMD A;  3I33 A;  5JVG L;  3MN5 A;  2D0O A;  3SBG A;  5LY3 A;  3CPE A;  2FSK A;  3H45 C;  3MX2 A;  4BRM A;  4WFA L;  1TYQ B;  1RDU A;  5AQV A;  5GAG P;  1X3N A;  1CZA N;  3WQT A;  2V51 B;  1BA0 A;  5AQH A;  4YOY A;  1Z6R A;  3LDQ A;  1H1V A;  4A2B A;  2Q31 A;  1GLJ O;  4NB4 A;  4A5A A;  3CME N;  5HL7 L;  3UKR B;  3TPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...