4BC5A

Crystal structure of human d-xylulokinase in complex with inhibitor 5- deoxy-5-fluoro-d-xylulose
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
524
structure length
524
Chain Sequence
RRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLTVTSPVLMWVQALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLRLHQQLQDCFSISDCPVWMDSSTTAQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIYQQNPEAYSHTERISLVSSFAASLFLGSYSPIDYSDGSGMNLLQIQDKVWSQACLGACAPHLEEKLSPPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGDNPASLAGMRLEEGDIAVSLGTSDTLFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSKALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDVEVRALIEGQFMAKRIHAEGLGYRVMSKTKILATGGASHNREILQVLADVFDAPVYVIDTANSACVGSAYRAFHGLAGGTDVPFSEVVKLAPNPRLAATPSPGASQVYEALLPQYAKLEQRILSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XYLULOSE KINASE
publication title Structure and Function of Human Xylulokinase, an Enzyme with Important Roles in Carbohydrate Metabolism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 180
structure length 524
sequence length 524
chains with identical sequence B, C
ec nomenclature ec 2.7.1.17: Xylulokinase.
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00370 FGGY_N FGGY family of carbohydrate kinases, N-terminal domain
A PF02782 FGGY_C FGGY family of carbohydrate kinases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bc5A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bc5A01
1J6ZA 1SZ2A 4FO0A 2D0OA 4FWLA 3ZEUA 4BRHA 4H5RA 2AA4A 4BRPA 3MN5A 2FSJA 2FSKA 3MN7A 5AZJA 1X3NA 2GTDA 4WQ5A 1KAXA 4KBOA 2P9KA 3UKUA 5BREA 3ENOA 1BG3A 3BEXA 3WXJA 3ZX3A 3EKSA 4FPBA 3DXMB 3LDPA 3O1BA 1HKGA 2P9NA 5AQWA 3H6EA 5BPNA 4QS9A 4BG9A 3P4IA 3GG4A 4JD2B 4EHTA 3WUHA 2A5XA 1ATNA 1K8KA 4BRAA 5JLFA 3VGMA 3HI0A 1YVNA 1NGJA 4L3QA 2GWJA 5FPDA 2IVNA 2J4RA 3TPQA 4BGAA 3RSEA 4CBWA 3DXKB 1XUPO 5KQ8A 3WQTA 2E1ZA 4IWVA 1T6CA 2Q36A 2D0PA 3MK6A 1TYQB 3M6GA 5AQYA 3FGUA 2HMPA 2A3ZA 3UE5A 3AY9A 2V7YA 3D2EB 3M1FA 4BRKA 1GLAG 4DCHA 2P9UA 2FLOA 3AAQA 3FFKB 3BF3A 1RFQA 3CIPA 3OHRA 5BRDA 4BREA 1WOQA 2FF6A 3CJ1A 4CZHA 3R8EA 4BG8A 1YAGA 4H5VA 3BF1A 4B1XB 2FF3B 3U8XA 3VERA 3A5LC 2YHWA 4XH4A 3O5BA 1D4XA 4YDUA 3LDNA 2ZGZA 1RGIA 2HOEA 1C0GA 2DPNA 3C7NA 4HWIA 5EY4A 3BP8A 4BRGA 2QW9A 4DHYA 3O80A 1ZXOA 5AQMA 4BR0A 2E2QA 2YJEA 2EWSA 5E26A 3VESA 3VF4A 5AQTA 3ZEUB 1GLDG 4CZFA 4QS7A 5ADXA 1P8ZA 4XH5A 3ZX2A 5AZJB 3I33A 4K43A 5KPZA 5I9EB 3O4WA 2P9KB 3UKUB 3CQXA 4B1WB 2BUPA 3BUZB 3WEEA 3KZBA 1T6DA 2VCPA 3HTVA 3H3OB 2VWBA 3MDQA 4BR4A 4PKHA 1SAZA 3EN9A 4JN4A 5BPMA 2F9TA 4F9OA 2P9NB 4NB4A 2YI1A 5FPNA 3ATUA 2P9LA 1HLUA 2AP1A 1DKGD 1NBWA 3TU5A 1IG8A 3FLCO 3QFUA 4BRFA 2V52B 5EOYA 1K8KB 4CD3A 1ZBSA 2E2NA 3QICA 3VOVA 4CZJA 4MO4A 2FXUA 3RSEB 3FZHA 4J8FA 4FWMA 1WUAA 1TUUA 2IVOA 1IJJA 2QXLA 3M3ZA 3A5NC 3JS6A 5AQVA 3HZ6A 1R59O 3AARA 1BU6O 5ADXH 3EO3A 3QFPA 4B1VA 2QM1A 4IO8A 2P9UB 4CZEA 3I8BA 2QWQA 5LJWA 3H3NO 4ISEA 3VGKA 4CZKA 4BRNA 5AFUH 2YHYA 3VEOA 4CI6A 1Z05A 2V7ZA 3GE1A 5EVZA 1E4FT 4IXCA 3SMPA 2Q31A 3C7NB 5F2RA 3ULEA 1GLLO 1ATSA 2I7PA 4BRCA 4E1JA 5AQQA 2NRHA 4BRQA 1ESVA 1BDGA 5AQXA 1LCUA 4BC2A 3ENHA 3LDLA 3VEWA 5BR9A 3LM9A 5AQIA 3U4LA 1X9JA 1BA1A 3ZX0A 4XEIA 2YCHA 4K41A 1U2VA 2Q1NA 4GY2B 2H3GX 4JNEA 4CZMA 4PKIA 1HJOA 3FZLA 3CJ7A 1C0FA 3WEEB 3WXIA 4O8KA 3WXKA 5AQLA 3R6MA 1V4TA 4CBUA 4EAHD 1NGIA 3CJAA 2P9IA 4PL8A 1KAZA 2ZF5O 1NLVA 5AQNA 4Y0WA 4ISFA 3H46O 3QBWA 4FPAA 5KPRA 3FE1A 3ZETB 2P9LB 4BGBA 1Z6RA 3SMSA 2CGJA 3KVGA 1LOTB 5EX5A 4IJNA 1HKCA 3QDKA 2P9PB 1GLEG 3IDHA 4MLEA 1MWMA 4BR7A 3B8AX 3LDQA 3LM2A 1GLFO 4Z94A 2Q97A 3VF6A 4K25A 2NLXA 5AQOA 3EZWA 4GNIA 1MWKA 1XQSC 4H0XB 3O08A 3MCPA 2ASOA 4FWPA 4FWOA 5EXWA 4BRMA 1S22A 4H5WA 4B1YB 2D4WA 3SK3A 3A5OC 5AQUA 4AM6A 3O8MA 2Q2RA 3FZMA 3VPZA 1KAYA 4IZ9A 1NGAA 1QQMA 4XH1A 4WQ4C 4H0VB 1NGGA 2CGLA 4BRIA 3QB0A 2Q0UA 3GOIA 1HUXA 1DGKN 5B8HA 4A2AA 3U9ZA 2HF4A 3ULEB 3D2FA 1HKBA 3IFRA 1NGCA 5JMVA 2QWOA 4PL7A 3ZETA 3VEZA 3FZKA 2I7NA 4BVPA 3DJCA 2IVPA 2P9PA 1V4SA 1DEJA 1U2VB 2CGKA 5LJVA 2A6AA 4CZGA 2P9SA 3JXUA 3WQUA 4H0YB 3VENA 4H5NA 1HX1A 4BQLA 5AQPA 3CHWA 3J8AA 5AQFA 4FOEA 1GLCG 2QWPA 4FOIA 2P9IB 4QS8A 4DQ8A 1H1VA 4FWRA 3U9DA 3HBTA 4HTLA 4WYBA 3CI5A 1Q18A 5BPLA 3L0QA 4MO5A 1NGHA 4A62A 2VYPA 5ELZA 3H1QA 5AR0A 3QBXA 2FSNA 3CETA 3R9PA 2QWRA 5F1XA 4EHUA 3CQYA 2E1YA 1BWFO 3VF2A 3WXLA 2UYTA 3A5MC 3WT0A 3LDOA 4BVOA 2CH6A 5AQSA 2E20A 2PAVA 5TKYA 3H45C 4WQ5C 2GELA 5JICA 1NGFA 1S3XA 5AQKA 4FWNA 3CJ9A 3W3DA 1NMDA 4RCHA 1KXPA 5AQGA 1OKJA 5AQHA 3SLCA 3C0BA 3W0LA 5KQDA 1JCEA 4FL9A 3AAPA 5BRFA 1YUWA 3ATVA 4CJ7A 2HF3A 4M7XA 2YJFA 2ZGYA 4EFHA 5FPMA 5FPEA 4RTFD 4FWSA 4M7YA 5AQRA 4BR9A 3HM8A 1QQOA 4H0PA 5AZIA 5LY3A 4CZLA 1T44A 4H03B 1QQNA 2D1KA 3D2FB 1XC3A 4FWQA 4BRDA 4FWKA 3SJHA 1NM1A 5CE3A 2A41A 2PBDA 1EQYA 3H1VX 4MLHA 2E2OA 3UKRA 1U6ZA 2GWKA 4I6MA 4H0OA 1GLBG 5AQJA 4NO7A 4JAXA 1BOTO 1RDWX 5BN8A 4JHDA 2WUSA 4H5TA 5AQZA 2GUPA 3F9MA 1Y64A 4BRLA 3GDQA 4RWTA 2P9SB 3MN9A 1E4GT 5F0XA 1ATRA 4M63C 2QWMA 5KPTA 3IUCA 3UB5A 3EKUA 4YDUC 2QWNA 1BO5O 1YXQA 1JCGA 4BC4A 4O5FA 2ZWHA 3VETA 1SQKA 2E88A 3MN6A 3DXMA 1QHAA 3L6QA 4BQZA 2V51B 3DAWA 2NZTA 3O6WA 4A2BA 4A61A 1HPMA 3A0IX 1TUYA 2E8AA 4WQ4A 1NGDA 3CJBA 2ASMA 4BROA 4JD2A 2W41A 3O1WA 1QZ5A 5JLHA 4FSVA 4K42A 3MMVA 3GL1A 3S41A 3L4IA 2ITMA 2CH5A 3GBTA 4B1UB 1GLJO 3FR0A 1QZ6A 3VEVA 5BN9A 2Q0RA 4BR5A 1G99A 4BC3A 3DXKA 2GEMA 3KHYA 3HSCA 3FZFA 2YHXA 4CD1A 3CERA 2BTFA 1NWKA 2W40A 1TYQA 4EIAA 1MDUB 1MA9B 2A42A 1X3MA 4CZIA 5AFUA 3VGLA 4IJAA 4BR2A 2KHOA 3D2EA 3G25A 4DB3A 4BC5A 3EL2A 2A40A 1NGEA 4AM7A 3D7EO 3LL3A 2IIRA 3CJCA 5AZIB 1JCFA 1NGBA 2F9WA 3IMXA 2ASPA 2E2PA 1BUPA 4H0TB 3QMLA 3VEXA 3ID8A 3VEYA 4B1ZA 4CBXA 3DWLA 4ISGA 4C23A 2OANA 5BRHA 3UKRB 4I6MB 5E84A 1CZAN 3A8YA 2QWLA 4PKGA 4B9QA 1BA0A 4JHDB 1ZC6A 4LC9B
chains in the Genus database with same CATH superfamily
1J6ZA 1HNXK 3OYHA 4FWLA 3MN5A 5HRPA 1IKYA 3R3LA 4CEFA 3L2VA 4WQ5A 4KBOA 2P9KA 5LMUK 4YOYA 1FJGK 3ENOA 5GAGP 5HRSA 4CJVA 3CMAN 2B4JA 3NH2A 2KZMA 1HKGA 3MWPA 4CF2A 3NGIA 2YX6A 4QCLA 1QTMA 2D0BA 1UAXA 3O9UA 3PY8A 4B08A 4BRAA 2R7YA 3DMJA 1RDDA 4H4OA 2IVNA 3ZSYA 1CZBA 4X66K 2D5RA 5FROA 1BL3A 3WQTA 1T6CA 2Q36A 3DLRA 2JWLA 3M6GA 2X6SA 3UE5A 3QEWA 3HJFA 4CJ3A 4JI1K 1GLAG 2P9UA 3AAQA 3A2FA 3CIPA 4FK2A 5JVGL 1U4BA 2FF6A 3CJ1A 3G0ZA 2XRIA 4BG8A 4CZHA 1XMQK 3O9RA 1Q81O 3VERA 2YHWA 1C1AA 3TSUA 3EYZA 1C0GA 4HWIA 3BP8A 2HHQA 4BRGA 4DHYA 5M1NA 4LF5K 4JYAK 3SAHA 3NF8A 3TTDA 1YF5L 3V9SA 2HHVA 2E2QA 3RR7A 4KB1A 1R0AA 4LF6K 1N34K 4K0KK 3VF4A 4KPYA 4B3OA 3CCQN 3M8RA 3O3FA 4FW2A 3ZX2A 5AZJB 3T1AA 5KPZA 1RT2A 3OYJA 1X9MA 1VSJA 2ZJQL 5CZ2A 3UKUB 3PIOL 4B1WB 2RHKA 1RT3A 2BUPA 1BHLA 3HTVA 2UXBK 4BR4A 4FK0A 1VQMN 4PKHA 3OJUA 3EN9A 2WBNA 2P9NB 1KSPA 4E7IA 4CJTA 4Y1DA 4DSLA 4DSJA 2P9LA 3P38A 1HLUA 4FM0A 1NBWA 3KTQA 4IEEA 3ID6A 1IG8A 3QFUA 5CZ1A 4ILJA 1K8KB 2DFEA 5M1PA 4NCBA 4GVMA 1ZBSA 3VOVA 4EZ9A 4WF9L 1IKWA 4AH9A 1WBBA 3THXA 4ELUA 1WUAA 4M45A 3LANA 2Z1HA 3A5NC 2ATQA 5C10A 4GV3A 4AHCA 2PYLA 4OPJA 1R59O 4CHYA 4B1VA 2NRTA 4DS5A 4IKFA 5DMRA 2YHAA 3H3NO 4DQSA 1QHTA 4ISEA 4CERA 3VGKA 4CZKA 3NGYA 5AFUH 1M1KO 3VQPA 3JSMA 3E1YA 3GE1A 3AA2A 3C7NB 1WSHA 4O0IA 2I7PA 4CEQA 2B6AA 4DMNA 4E1JA 1HR0K 4AF1A 1OH7A 4A5BA 4YORA 4BRQA 1BDGA 4OKEA 5DK5A 2O8BB 3LDLA 1JLEA 3FFIA 1IBLK 1X9JA 3DYAA 1BA1A 3NE6A 2YCHA 2HHHK 3CD6N 1YT3A 4DU4A 1KVBA 2G8UA 3L2RA 3CMEN 3WEEB 1NKCA 3QNNA 1BISA 2BGGA 3R6MA 4CBUA 1W2BM 1YTAA 1KAZA 2ZF5O 5HLFA 4B9SA 5AQNA 3RRHA 1RDBA 4Y0WA 2D0AA 1W0HA 4R5PA 1UA1A 2G8KA 4JKFA 3T7ZA 3ZT3A 3THYA 3ZETB 3SQ2A 3ZSXA 4JKAA 3TAMA 1IV0A 3CCEN 2E6MA 4M3UA 5M1OA 3C65A 2P9PB 1GLEG 4BWJA 4MLEA 4FM1A 1VQPN 3LDQA 3K5NA 2P5GA 1ITGA 3LM2A 4AHTA 2KW4A 3KLGA 2NLXA 4N76A 4CHOA 1EETA 2I5JA 4GNIA 4H0XB 1K6YA 3O08A 5EXWA 5T7BA 5GIPA 4H5WA 4B1YB 1ZBIA 2D4WA 3ZYYX 4HCBA 5AQUA 4RW7A 4CIGA 4GKJK 2Q2RA 1KCFA 4IZ9A 5I3UA 4PY5A 4H0VB 1NGGA 1NK5A 3QEIA 2Q0UA 3TTFA 1GOCA 1L3VA 1WLJA 1YJ9N 2HF4A 2O4IA 1VQ7N 3D2FA 1HKBA 1NGCA 3NF9A 4MDBA 4HUFA 1OVQA 1RBSA 3VEZA 3HP9A 3FZKA 2WTUA 2I7NA 4OO1J 4C1NK 1QQCA 2AJQA 4JRPA 2O8DA 1S9GA 4HCCA 1HX1A 4FLUA 3DRPA 4FJ8A 1M90O 4LF7K 3KK7A 4CJUA 1YHQN 1H1VA 3PLAA 3HL8A 3HBTA 1KFDA 4A57A 3CI5A 3B6PA 4FLXA 4JEPA 5ELZA 1C0UA 1B92A 5GADP 1IBMK 3QINA 2RE2A 3AVJA 4DKWA 2E1YA 4FZXC 5J2QA 3QESA 2O4GA 3CYMA 2NRWA 3LDOA 2UUAK 2G8WA 2OPRA 2E20A 2PAVA 1KQSM 3H45C 4JS5A 1NJZA 3E9PA 1QE1A 4E1MA 5C2DA 3E01A 1NGFA 1QSSA 3W3DA 3ZT4A 4B8AB 4CIFA 1NMDA 5DM6L 4JKEA 4CJ4A 1OKJA 3LAMA 5AQHA 3C0BA 1IG9A 5KQDA 1TKXA 4KTWA 2HF3A 4M7XA 2YJFA 3I8DA 4EFHA 3U6FA 5FPMA 2KKZA 3EY1A 4M3XA 4RTFD 3CFOA 1Q9YA 3J7YP 1YITN 4M3ZA 4CZLA 1CXQA 3P1GA 1T44A 4G1QA 5GAEP 3V9UA 4FWKA 2FBVA 3H1VX 5C25A 4CJSA 2JGUA 4MLHA 4CGHA 1U6ZA 2GWKA 5KRTA 1VRTA 3P39A 1RDWX 4OJRA 5JS1A 2GUPA 3F9MA 4FJXA 3T1YK 3LALA 3IUCA 4AILC 2UU9K 2QWNA 5LL6Z 2YNGA 1D8YA 3M8SA 3VETA 1X9SA 2KZZA 5C12A 4N5SA 4YY3K 3DAWA 2HVHA 2NZTA 4UQGA 4Q0BA 4DQRA 4KHNA 2HHXA 4RW9A 4A61A 5CHIA 2QA4N 4JKDA 1CXUA 1HPMA 3K9KA 4BROA 3Q7CA 4K8ZA 3MXIA 5JLHA 4DQIA 3KKSA 3GL1A 1C0MA 2ITMA 2O8FA 2CH5A 3TWHA 1NK0A 4JKBA 2HNYA 3AO2A 2GEMA 3KHYA 1JLCA 3OS0A 1RT7A 2BTFA 1NWKA 1TYQA 4EIAA 4JK8A 4KI6A 4OGEA 4CZIA 1KVAA 4YFUA 4M3TA 3G25A 4BC5A 4IFEA 4I9QA 2F4VK 1XHXA 2FBTA 2A40A 1NGEA 2KQ2A 1NMNA 4CESA 4IO9L 1NGBA 3AVKA 3V1RA 3VQBA 1RDAA 3IMXA 2ASPA 5D3GA 1BUPA 2NRRA 1VQ4N 3DLKA 4ISGA 1SKWA 2JWKA 2QI2A 2OANA 3QNOA 4I6MB 3AO5A 1S6QA 1VQ8N 4N47A 3QO9A 1N33K 2X78A 3CCMN 4PKGA 4JK9A 4AHRA 3G6EN 4FO0A 4HUGA 3D45A 4BRPA 1SS6A 2FSKA 3MN7A 2GTDA 1JXEA 3PSIA 5BREA 3OYCA 4IG0A 4XIUA 1VRUA 1EXQA 2HMIA 3MX2A 4W5OA 3OYKA 3MECA 3PUFA 1T03A 1HQEA 1ASVA 3MXJA 5AQWA 2NUBA 1X1PA 4CK1A 1S1XA 3U3GA 3C6HA 4DU3A 4QAGA 3P4IA 4JD2B 4EHTA 3WUHA 3TANA 2A5XA 5H1SQ 3BGRA 1ATNA 2GX9A 1IKXA 4CJRA 3HI0A 3KD1E 1I3AA 1NGJA 4L3QA 5FPDA 4UY8O 2ZE2A 4WE1A 1I94K 2J4RA 5KTQA 2QTDA 4Z0UA 1FKOA 5KQ8A 2Y1IA 2HBJA 3F5TA 2HMPA 3THWA 2A3ZA 3ITHA 4DFJA 3D2EB 2NRZA 3AA3A 4BRKA 3FFKB 2FLOA 3QIPA 3SUPA 4BREA 4R79A 3OYBA 3QIOA 3ZT1A 1YAGA 4IEIA 4B1XB 4XH4A 4FJKA 4YDUA 3PO5A 1JL2A 1RGIA 3WNHA 2DPNA 5IT9O 5EY4A 3DLBA 2JLEA 3O80A 4KH6A 4DR2K 1ZXOA 1EO1A 4DG1A 2EWSA 1JLBA 3VESA 3EE9A 5AQTA 3ZEUB 1GLDG 3K58A 5J2MA 5ADXA 2XO7A 3KIOA 4CJFA 4OKJA 4DR5K 4O0JA 3OYEA 3NDKA 1F21A 3CQXA 3TAEA 3LPUA 3KZBA 2VCPA 4IDKA 1Q9XA 4B3RK 1U49A 3MDQA 5CY4A 4M41A 4JN4A 4CVNE 4F9OA 3VQ9A 2FBXA 3SQ4A 5HOOA 1L3TA 5JS2A 2X6NA 3CM6A 4CK3A 4OPKA 1DKGD 3NF6A 3FLCO 2V52B 4WFAL 4CD3A 3V9WA 3L2QA 1I39A 3QICA 4IBNA 4CZJA 3RSEB 3EEQA 5J2PA 1BI4B 4J8FA 4FWMA 1VSLA 3AO4A 3VN5A 2IVOA 4PHTX 2Q3SA 3DRSA 3JS6A 5J2NA 4RW8A 1QVFM 1WN7A 3OVNA 3OYLA 3QEPA 1J54A 3AARA 1A5XA 4KV8A 4I9LA 3O3GA 4C8NA 5ADXH 3NF7A 5CYMA 3D6RA 2XHBA 3CCVN 4CF1A 5E41A 5TKWA 4BE1A 2HSTA 5CR4A 3THVA 1Z05A 3ZSVA 1E4FT 4JI6K 1TAQA 4CFDA 4DV3K 4C8KA 3IRXA 1ESVA 5AQXA 1LCUA 3PO4A 1NOZA 4IG3A 1HMVA 1REVA 3LM9A 4O5BA 4DTSA 4K41A 3K2PA 1U2VA 2Q1NA 4GY2B 4FVUA 4PKIA 1HJOA 3HK2A 2O8CA 4DV5K 3CJ7A 3R1XA 3WXIA 4O8KA 3U3YA 5AQLA 2E5LK 1ILYA 2UXDK 3Q7BA 4CJ5A 4DR7K 4E7JA 3P5JA 1XHZA 4Z4GA 4ISFA 3H46O 5KPRA 4CE9A 3FE1A 3VTIA 3NH1A 3WNGA 4JK7A 3KK2A 1LOTB 5EX5A 4IJNA 1MWMA 3SQ1A 1EWQA 3I0SA 4L8RB 4ZHRA 3VF6A 4K25A 5AQOA 3AO3A 5SZTA 1XQSC 1Q82O 4JKGB 3SJJA 4KKOA 2IS3A 3OYDA 4AM6A 3O8MA 3AGRA 3VPZA 4B9VA 1KAYA 3HYFA 4YOWA 2F8TA 1NGAA 4XH1A 3ENBA 4C8OA 3CG7A 3AVCA 2W42A 1JJ2M 4HVJA 2CGLA 4BRIA 1RT4A 4LH4A 3MEDA 1YJWN 1RBTA 3GOIA 4DV1K 1Z26A 1HUXA 5MLCQ 1DGKN 1RTJA 3C94A 4ZTFA 3U9ZA 3ULEB 1GOBA 4YOXA 4CCHA 2BH1A 4CJKA 3IFRA 2QWOA 4PL7A 1HNIA 1C0TA 4RG8A 3SUOA 4JI3K 4DF4A 3I56N 2VGMA 1HYVA 1FKPA 2HNDA 4OLBA 2A6AA 3HPHA 2P9SA 4JRQA 1DLOA 3VENA 3QLHA 2QKKA 5AQPA 1RDCA 3J8AA 3O9SA 4BE0A 2HW3A 2E6LA 2P9IB 4FZYA 4QS8A 4M3YA 4DQ8A 1ZYQA 1S72N 4MO5A 2QKBA 3NH0A 2QWRA 5F1XA 2HHTA 1JLGA 3WXLA 3AV9A 3VQ6A 1KC8O 4V19S 2CH6A 4IOCL 5M1QA 3O9QA 5AQSA 1XNRK 3V1QA 4W5RA 1Q86O 4CHNA 5AQKA 1NJWA 3CJ9A 4B3TK 3LP1A 4OLAA 4DV0K 4J2DA 1KXPA 3O4QA 1JCEA 4FL9A 5BRFA 2Z1GA 4LF9K 1YUWA 1NOYA 4CJ7A 1D9DA 3LP3A 3VMFB 5FPEA 1OVYA 4F2SA 3UIQA 4M7YA 2F7TA 1NK9A 2ETJA 4H0PA 5AZIA 5LY3A 4FW1A 4PA1A 1KVCA 5GINA 4Z4IA 4H03B 3P31A 3T1HK 1QQNA 4JI2K 1Q8IA 1XC3A 2O8EB 4AHSA 3NVMA 2PBDA 4FJ9A 1EQYA 2VG6A 3CXCM 2E2OA 3UKRA 5AQJA 3TI0A 1BOTO 5AQZA 4CJEA 3SYZA 1Y64A 4BRLA 4RWTA 5DM7L 3MN9A 1JLQA 1NJXA 5F0XA 1IH7A 4Q5VA 4M63C 1E3MA 2QWMA 2WC9A 1K8AO 3G4SN 1IKVA 3MX5A 5HRNA 4BC4A 4O5FA 2ZWHA 4MDAA 3OA9A 4N41A 1SQKA 2NNWA 3WNFA 1KLNA 2E88A 3MN6A 4B9MA 4CEEA 4LY7A 4CF0A 3SCXA 3EE8A 2G8IA 3A0IX 4JI7K 4LSNA 2E8AA 1NGDA 3CJBA 4X64K 1NJYA 4YOVA 2W41A 1QZ5A 1HYSA 3OYNA 2VG5A 1VSFA 3GBTA 4B1UB 4J2EA 1RDUA 4BR5A 3G10A 1S6PA 2YHXA 3CERA 4X65K 4DR4K 4FJNA 4JS4A 2A42A 1S1UA 5J1EA 4W5QA 2W6LA 4NLBA 4DB3A 4AM7A 3D7EO 3S3NA 1EWRA 4DR3K 3KJVA 2IIRA 3PIPL 1RTIA 1BQNA 4FLTA 2F9WA 1P90A 1VQLN 3KLEA 3OYIA 3VEYA 3DWLA 4CHQA 1LW0A 4CEBA 1DTTA 3RMBA 2EX3A 3SBTA 4E0DA 3S9HA 5BRHA 3TARA 2IAJA 3C95A 1CZAN 1JXBA 4KHSA 2QWLA 4FXDA 1BA0A 4JHDB 1ZC6A 4LC9B 2HHSA 1SZ2A 4LF4K 3ZCMA 4BRHA 4FYDA 4H5RA 3RMAA 4CEZA 3LWMA 4B9NA 5AZJA 3V9XA 1X3NA 1KAXA 1A5WA 3BZCA 3UKUA 3LZJA 1YJNN 3PX4A 1BG3A 1C6VA 4ID5A 3WXJA 4TSXA 3ZSRA 1VSDA 4FPBA 3OS1A 3DXMB 4K8XA 3HOTA 2P9NA 4W5NA 3H6EA 4CGDA 1ZBLA 2UUBK 2YKMA 3GG4A 1RT6A 4NCGA 1K8KA 5JLFA 1YVUA 4M3WA 4F3TA 3ASMA 2UXCK 4PQUA 2GWJA 3N4PA 4CBWA 2DTUA 4E7KA 3DXKB 1XUPO 3PX0A 2HHWA 4CIEA 2F8SA 2D0PA 3FGUA 1WSFA 4FLZA 3HT3A 3AY9A 3NVKA 2V7YA 4CFAA 3KD5E 2UUCK 2P5OA 3VQQA 4KAZA 4G9ZA 1BCOA 1RFQA 1TL1A 5BRDA 1WOQA 1UOCA 4YOTA 3R8EA 4C8MA 3HM9A 1BGXT 2HBMA 3BF1A 2FF3B 4OPHA 3O5BA 1D4XA 2RN2A 3AA4A 3LDNA 1NKEA 2ZGZA 2HOEA 3C7NA 3D0PA 4ELVA 1N5YA 2QW9A 1J5OA 5C42A 3TAQA 5AQMA 4BR0A 2O8BA 3C6AA 1SKSA 2YJEA 5E26A 2P51A 2ZJRL 1VQON 1G15A 1K9MO 2P1JA 1B9FA 4CZFA 3RMCA 4QS7A 4CJWA 1P8ZA 2HBLA 3I33A 4CGIA 3IAYA 3O4WA 2P9KB 3JYTA 3BUZB 3LPTA 2GV9A 1WSEA 3WEEA 1T6DA 3H3OB 4IFYA 5JVHL 4DSFA 3SAFA 1WAJA 2X74A 1L3SA 2PFUA 5BPMA 4KHUA 2F9TA 4DLEA 3OYAA 2ZQBA 3KWGA 3BZKA 3TSPA 4ZTJA 5HP1A 3KKRA 2AP1A 1XC9A 3K59A 3VQ4A 4BRFA 5EOYA 1WSGA 3PV8A 1JLAA 4DF8A 4GKKK 3C6TA 1NK7A 3QEXA 1RT1A 5GAHP 4NYFA 4CF9A 5AQVA 3V4IA 3DLLL 2OZMA 3CCSN 4IOAL 3CCJN 4DUYK 4LF8K 3IKMA 1VHXA 3HZ6A 3EO3A 3QFPA 2P9UB 3K57A 3ZSQA 1EKEA 1U48A 1B9DA 5LJWA 4JKHA 3AVFA 5SWMA 2HNZA 4FVMA 3M8QA 1SL0A 2YHYA 4DTRA 4HUEA 4CGFA 4KHPK 3RMDA 1NNEA 3SMPA 3P83D 5F2RA 1GLLO 1ATSA 4DTXA 4DTPA 4BRCA 1TK8A 1NK6A 4KI4A 1HNVA 3ENHA 3TAGA 2KFNA 3VEWA 1DTQA 5KGWA 2Y1JA 3CPEA 1U04A 1XNQK 2A1SA 1CLQA 5AQIA 3U4LA 4BDYA 3KWIA 1LAWA 1VQ6N 2H3GX 4O55A 4CK2A 4DV6K 2A1RA 3AVBA 3FZLA 4BACA 1SL1A 3L2WA 4DR1K 1C0FA 3BY5A 1HNZK 4FZZA 5HBMA 3QETA 3WXKA 1TK5A 1V4TA 1NGIA 3CJAA 4CFBA 4PL8A 1GOAA 3VQEA 4YOUA 4DFPA 1NLVA 2ZJPL 1LAVA 4AHVA 1DT9A 3QBWA 4CF8A 5M1KA 3VTHA 2P9LB 4BGBA 1SKRA 4CECA 2CGJA 3KVGA 1WSJA 3VQAA 1HKCA 3QDKA 1QVGM 2YV0X 3IDHA 3V9ZA 1NKBA 4BR7A 1LWCA 3DLHA 4CGJA 4Z94A 2Q97A 3EZWA 4M42A 3PSFA 3THXB 4PWDA 1MWKA 5LMNK 3MCPA 2ASOA 3TSQA 2OYQA 3J7ZO 4FK4A 2OTJN 4BRMA 1YIJN 1S22A 2VQEK 3CF5L 3NFAA 3A5OC 5HRRA 4CEDA 1ZBFA 1S1VA 4WQ4C 2RPIA 1LW2A 3SZ2A 4IDHA 4OX9K 3SAGA 3CCUN 3QB0A 3K5MA 5FDLA 2BE2A 1HNWK 5B8HA 4A2AA 3QEVA 5JMVA 4OVLA 4FLYA 4B3MK 4DWIA 1S9EA 1XI1A 3TABA 4BVPA 3DJCA 2ZM6K 1VSEA 2CGKA 5LJVA 4X62K 4DFMA 1LV5A 2RF2A 3JXUA 3WQUA 2WFBA 4H0YB 3L3VA 3AGKA 4H5NA 1T8EA 4BQLA 2VWKA 5AQFA 4FOEA 4FOIA 3AVLA 2OA8A 1Q18A 4NYNA 3L0QA 5BPLA 3JAMO 1NGHA 4HHTA 3T69A 4A62A 3H1QA 5AR0A 5C0YA 2FBYA 2FSNA 3THYB 2YNHA 3CETA 1JL1A 4DUZK 4EHUA 3CQYA 4DV2K 2QK9A 3VF2A 2UYTA 3A5MC 1BIUA 1O1WA 3VQDA 4BDZA 5TKYA 4WQ5C 2XY5A 4FJ5A 2PYJA 5HL7L 3HSTB 3LZIA 4RCHA 5AQGA 1N36K 3W0LA 1QS4A 3AAPA 4A59A 2GUIA 2G8FA 3ATVA 3DM2A 3LDSA 3M5RA 3TTCA 3K5OA 4FWSA 5AQRA 3HM8A 1QQOA 4IFVA 4BE2A 2XY7A 1OH6A 4W5TA 4KREA 1TV6A 3D2FB 4FWQA 5K14A 4BRDA 5CE3A 2YKNA 4DTMA 1T05A 1T3VA 4ILHA 2G8HA 2OZSA 1FK9A 1FXXA 4I6MA 3WXMB 3SBGA 4H0OA 4LFCK 4NO7A 3L8BA 5BN8A 4H5TA 1N32K 1W97L 3J7AP 2O8DB 3AVHA 3T3FA 4F3OA 2HBKA 5KPTA 1FW6A 2HVIA 4AQYK 2Z1JA 3EKUA 3AO1A 1CZ9A 1U47A 3NMUA 5IWAK 1QHAA 3L6QA 4BQZA 3NCIA 3J81O 4CGGA 3ZT0A 3N4QA 4ICLA 3NAEA 1VSIA 2ASMA 4JD2A 4FJ7A 4FSVA 2DY4A 3S41A 4YHHK 1EX4A 4EP5A 3CM5A 4FJLA 3VEVA 5BN9A 4FJGA 4BC3A 3K9JA 4CD1A 3K0SA 1MA9B 4I7FA 5BR8K 3WNEA 5AFUA 1NU0A 3VGLA 1Q7YO 1QSLA 2KTQA 2KHOA 1SUQA 3D2EA 3ZSWA 3EL2A 3RTVA 1HJRA 1SV5A 1XWLA 3T19A 4OPAA 3ZSZA 1WBDA 2OCEA 4H0TB 3VEXA 3KLHA 3LWLA 4NXNK 3ID8A 4B1ZA 4CBXA 1VSKA 3CC7N 1RT5A 3VQ8A 4C23A 1RBVA 2IDOA 1RBUA 5E84A 4WFBL 4B9QA 1KRPA 4U7BA 5I42A 4Z4FA 2D0OA 3ZEUA 2AA4A 3ZT2A 5AJ3K 5KRSA 3K5LA 2FSJA 2QXFA 4A5AA 3SV3A 3HP6A 2D0CA 4EP4A 5EU7A 3PX6A 3BEXA 3ZX3A 1S1WA 3AVNA 3EKSA 3TR8A 2KFZA 4GW6A 3LDPA 4ID1A 3LP2A 3O1BA 1ASUA 3H08A 3ZSOA 5BPNA 1UA0A 3NBPA 3TAPA 4QS9A 4BG9A 1KFSA 1BCMA 1YI2N 1HRHA 2O8FB 3VGMA 1YVNA 3OW2M 3TPQA 4BGAA 3RSEA 1BI4A 4RW4A 2IC3A 2E1ZA 4IWVA 3MK6A 1TYQB 2W6KA 2BDPA 1KTQA 5AQYA 4E7LA 3QERA 1L3UA 1TVRA 4WFNL 3AVMA 4E19A 3M1FA 3HPGA 2DFHA 4DCHA 4FLWA 1MU2A 3BF3A 4DTOA 3OHRA 4AHUA 3HVTA 2NRXA 4O44A 4Y1CA 4EZ6A 2BANA 3EZ5A 4H5VA 3ZLJA 1T7PA 3U8XA 3A5LC 2OPPA 4E3SA 4PUOA 1TKZA 3DLEA 4DTNA 3F73A 1U45A 1RBRA 1K73O 2VG7A 1ASWA 3AA5X 3O4NA 4NXMK 4O8UA 4B9TA 3E9OA 4JI5K 4KHYA 2EHGA 3CPWM 4JI0K 1VQKN 4B9UA 4JKCA 1J53A 3F2KA 3MAQA 4KB0A 4H4MA 4XH5A 4FM2A 5FRNA 4K43A 5I9EB 4C8LA 2VWBA 4KRFA 1SAZA 1TL3A 1VQNN 1LWEA 4KHWA 2ITGA 1WNSA 4NB4A 4NCAA 2KLAA 2YI1A 5FPNA 3ATUA 1ZBUA 1NJIO 3TU5A 3CCRN 1RILA 1N8RO 4GV9A 2OTLN 2E2NA 3MCAB 2QEXN 4MO4A 2FXUA 1ZBHA 3FZHA 1TUUA 1IJJA 2QXLA 3M3ZA 4JKGA 1VQ5N 3I0RA 3THWB 4CEOA 5CYQA 2GBZA 4CJPA 4FJHA 1BU6O 1IO2A 2QM1A 4IO8A 3OJSA 4KTQA 1N6QA 2NRVA 4CZEA 3I8BA 2QWQA 1LWFA 3SPYA 1O13A 4BRNA 3CFRA 3ULDA 3VEOA 4CI6A 3MWTA 1HQUA 2V7ZA 5EVZA 4IXCA 3CC4N 2Q31A 2HB5A 3ULEA 3HRGA 2G8VA 5AQQA 2NRHA 3M8PA 2IOCA 1VSHA 1W9HA 1TAUA 4BC2A 4KH4A 1WAFA 5BR9A 4DSKA 1HYZA 3ZX0A 4XEIA 3HVRA 2YHBA 1XMOK 4N56A 4JNEA 4LFBK 4CZMA 1W7AA 3BDPA 4H8KA 2IGIA 4CEAA 3NGZA 1X9WA 3C6UA 2WONA 3AVAA 3ISNC 3KK1A 3VA3A 2F96A 4EAHD 3DRRA 3OYFA 2P9IA 4YNQA 1RTDA 4J2AA 2XY6A 4ILGB 1C1BA 1TKTA 4FPAA 2YNFA 4ELTA 1VQ9N 3L4QA 3CFPA 3S3MA 1Z6RA 3SMSA 4M3RA 4DV4K 2WOMA 3SQ0A 1TKDA 3E66A 3G71N 3B8AX 1Z25A 1GLFO 3HPOA 4LD0A 2PZSA 3CC2N 4FWOA 4FWPA 3SI6A 3IS9A 4FCYA 4NLCA 2OPQA 3SPZA 3B6OA 3SK3A 4C1NI 3FZMA 3OS2A 1EP4A 1A5VA 3DLGA 4GV6A 1QQMA 5KI6A 3I55N 4E7HA 1JKHA 1WB9A 1J5EK 3CCLN 1HPZA 3HOSA 3TAFA 4B8CA 3VQCA 4HTUA 4B9LA 2O8EA 4KFBA 1SL2A 3MEEA 3E9LA 3DI6A 3ZETA 3J80O 2ZD1A 2IVPA 3IG1A 2P9PA 4FJJA 1V4SA 1KD1O 1DEJA 1U2VB 2VWJA 4DFKA 4CZGA 3NHGA 3SNNA 2Z1IA 4BY9C 3VA0A 2O8CB 3AVIA 4F2RA 4LFAK 3DOKA 1S5JA 4JLHA 3CHWA 4WCEL 4BWMA 3KK3A 1GLCG 2QWPA 1BIZA 4CHPA 4CFCA 3DOLA 4CHZA 5FLXO 1OH8A 4LSLA 3VQ5A 4DTUA 4FWRA 3U9DA 4HTLA 3L3UA 3OY9A 4WYBA 5A2QO 2VYPA 3QBXA 3LP0A 1TGOA 4CW7B 3R9PA 4KTZA 4Z4EA 4MQ3A 4FJIA 4I2QA 1BWFO 3KLIA 4GVEA 1NK4A 3WT0A 2HHUA 4BVOA 1J9AA 4GMJB 3RRGA 4DSIA 3SUQA 1QSYA 2GELA 5JICA 3SUNA 3ALYA 5FRMA 4CJLA 4E1NA 3V6DA 1S3XA 4FWNA 4Z4CA 1TK0A 4BDPA 2PY5A 3V1OA 3SLCA 4DR6K 1D9FA 5C2FA 1BQMA 3O3HA 2ZGYA 1IBKK 3V81A 4LH5A 5M1FA 3HXMA 3AVGA 1C1CA 4IOXA 4BR9A 2OPSA 4FLVA 1D5AA 3HO1A 3SV4A 3LAKA 3L2UA 4DV7K 2D1KA 4QOZB 4KHQA 3SJHA 1NM1A 2A41A 3F9KA 1UWBA 1KLMA 1S1TA 3MXMA 3O9TA 1GLBG 4I2PA 1JLFA 4JAXA 4JHDA 2WUSA 1YTUA 2E4LA 3VQ7A 3GDQA 2P9SB 4MFBA 1E4GT 1RNHA 1ATRA 3CQ8A 3OBWA 2FC0A 2XY8A 3UB5A 1VAZA 4DU1A 2RKIA 4DSEA 4YDUC 1BO5O 1YXQA 1JCGA 3OTOK 3OYMA 4DTJA 1NK8A 3MEGA 2VQFK 3RR8A 4B3SK 3DXMA 4KH5A 2V51B 5GIOA 1RTHA 3O6WA 4A2BA 4JI8K 4E89A 4F8RA 1TUYA 2VGNA 4WQ4A 2DFFA 5KGXA 3RWUA 1L5UA 3O1WA 4K42A 3MMVA 3L4IA 4CJQA 2LSNA 4DQQA 1GLJO 3FR0A 1QZ6A 5C24A 5HROA 2Q0RA 1G99A 3DXKA 4DS4A 2B5JA 3FZFA 3HSCA 1VSMA 3OYGA 4FJMA 3S3OA 2W40A 4U67L 4OKKA 1MDUB 4O4GA 4KO0A 4F4KA 1X3MA 4IJAA 4BR2A 1Y97A 4JV5K 3LL3A 3RVCA 2YNIA 3CJCA 5AZIB 1RCHA 1JCFA 4RW6A 4DLGA 5C15A 4Z4HA 2E2PA 1NG9A 4J2BA 3QMLA 4DQPA 1VK0A 3OBYA 1OH5A 4OGCA 3KLFA 3UKRB 4JI4K 1WSIA 3A8YA
chains in the Genus database with same CATH topology
3G6EN 1J6ZA 1SZ2A 4FO0A 2D0OA 4FWLA 3ZEUA 4BRHA 4H5RA 2AA4A 4BRPA 3MN5A 1SS6A 2FSJA 2FSKA 4A5AA 3MN7A 3R3LA 5AZJA 1X3NA 2GTDA 4WQ5A 1KAXA 4KBOA 2P9KA 3UKUA 5BREA 1YJNN 3MX2A 4YOYA 3ENOA 1BG3A 5GAGP 3BEXA 3WXJA 3ZX3A 3EKSA 4FPBA 3DXMB 3LDPA 3CMAN 3HOTA 3O1BA 1HKGA 2P9NA 3MWPA 5AQWA 3H6EA 5BPNA 2YX6A 3C6HA 4QS9A 4BG9A 3P4IA 3GG4A 4JD2B 4EHTA 3WUHA 3O9UA 2A5XA 1YI2N 5H1SQ 1ATNA 1K8KA 2GX9A 4BRAA 5JLFA 3VGMA 3HI0A 1YVNA 1NGJA 4L3QA 2GWJA 3N4PA 5FPDA 3OW2M 2IVNA 4UY8O 2J4RA 3TPQA 4BGAA 3RSEA 2QTDA 4CBWA 3DXKB 1XUPO 5KQ8A 3WQTA 2E1ZA 4IWVA 1T6CA 2Q36A 2D0PA 3MK6A 1TYQB 2JWLA 3M6GA 2HBJA 3F5TA 3FGUA 5AQYA 2HMPA 2A3ZA 3UE5A 4WFNL 3AY9A 3NVKA 2V7YA 3D2EB 2NRZA 3M1FA 4BRKA 1GLAG 4DCHA 2P9UA 2FLOA 3AAQA 3FFKB 3BF3A 4G9ZA 1RFQA 3CIPA 3OHRA 5BRDA 4BREA 1WOQA 4R79A 5JVGL 2FF6A 2NRXA 3CJ1A 4YOTA 3R8EA 4BG8A 4CZHA 3O9RA 1YAGA 4IEIA 2HBMA 3BF1A 4H5VA 2FF3B 4B1XB 3U8XA 1Q81O 3VERA 3A5LC 4OPHA 2YHWA 4XH4A 3O5BA 1D4XA 4YDUA 3LDNA 2ZGZA 3TSUA 1RGIA 2HOEA 1C0GA 2DPNA 3C7NA 4HWIA 5EY4A 3BP8A 4BRGA 1K73O 2QW9A 4DHYA 5M1NA 3O80A 4KH6A 4O8UA 3SAHA 1ZXOA 3E9OA 5AQMA 3TTDA 4BR0A 1YF5L 1EO1A 2E2QA 3C6AA 2YJEA 2EWSA 5E26A 3CPWM 1VQKN 2ZJRL 3VESA 1VQON 1K9MO 3VF4A 3EE9A 4JKCA 5AQTA 3ZEUB 1GLDG 3F2KA 4CZFA 4QS7A 3CCQN 5ADXA 1P8ZA 2HBLA 4XH5A 3ZX2A 5AZJB 3I33A 4K43A 5KPZA 5I9EB 3O4WA 2P9KB 2ZJQL 3UKUB 3CQXA 4B1WB 2RHKA 3PIOL 2BUPA 3BUZB 3WEEA 3KZBA 1T6DA 2VCPA 3HTVA 3H3OB 2VWBA 3MDQA 4BR4A 5JVHL 1VQMN 3SAFA 4PKHA 1SAZA 3EN9A 1VQNN 2PFUA 4JN4A 2WBNA 5BPMA 2F9TA 4F9OA 2P9NB 4NB4A 3KWGA 2KLAA 2YI1A 5FPNA 3TSPA 3ATUA 5HOOA 2P9LA 3P38A 1HLUA 2AP1A 1NJIO 1DKGD 1NBWA 3TU5A 4IEEA 3ID6A 1IG8A 3FLCO 3QFUA 4ILJA 2V52B 4BRFA 3CCRN 4WFAL 5EOYA 1K8KB 4CD3A 1N8RO 5M1PA 4GV9A 1ZBSA 2OTLN 2E2NA 3MCAB 3QICA 3VOVA 2QEXN 4WF9L 4CZJA 4MO4A 2FXUA 3RSEB 3FZHA 4J8FA 4FWMA 1WUAA 1TUUA 5GAHP 2IVOA 1IJJA 2QXLA 3M3ZA 3A5NC 4PHTX 5C10A 3JS6A 4JKGA 1VQ5N 4GV3A 5AQVA 3DLLL 1QVFM 3CCSN 4IOAL 3CCJN 3IKMA 3HZ6A 1R59O 3AARA 1BU6O 5ADXH 3EO3A 3QFPA 4B1VA 2QM1A 4IO8A 2P9UB 2NRTA 2NRVA 3D6RA 3CCVN 4CZEA 5TKWA 3I8BA 2QWQA 5LJWA 3H3NO 4JKHA 1O13A 2HSTA 4ISEA 3VGKA 4CZKA 4BRNA 5AFUH 2YHYA 5CR4A 1M1KO 3VEOA 3E1YA 4CI6A 3MWTA 1Z05A 2V7ZA 3GE1A 5EVZA 1E4FT 4IXCA 3SMPA 3CC4N 2Q31A 3C7NB 5F2RA 3ULEA 3HRGA 1GLLO 1ATSA 2I7PA 4BRCA 4E1JA 5AQQA 2NRHA 4AF1A 4A5BA 4YORA 4BRQA 1ESVA 1BDGA 5AQXA 1LCUA 4BC2A 3ENHA 4KH4A 3LDLA 3VEWA 3CPEA 5BR9A 3LM9A 5AQIA 3U4LA 1X9JA 1BA1A 3ZX0A 4XEIA 2YCHA 4K41A 1U2VA 2Q1NA 3CD6N 3KWIA 4GY2B 1VQ6N 2H3GX 4JNEA 4FVUA 4CZMA 4PKIA 1HJOA 3FZLA 3CMEN 3CJ7A 3R1XA 1C0FA 3WEEB 3WXIA 4O8KA 3WXKA 5AQLA 3R6MA 1V4TA 4CBUA 4EAHD 1NGIA 3CJAA 2P9IA 4PL8A 1W2BM 1KAZA 2ZF5O 4YOUA 1ILYA 1NLVA 2ZJPL 3Q7BA 5AQNA 1DT9A 4Y0WA 4ILGB 4ISFA 3H46O 3QBWA 4JKFA 3T7ZA 4FPAA 5KPRA 5M1KA 3FE1A 3VTIA 1VQ9N 3L4QA 3ZETB 3VTHA 2P9LB 4BGBA 1Z6RA 3SMSA 4JKAA 2CGJA 4JK7A 3KVGA 1LOTB 3CCEN 5EX5A 4IJNA 5M1OA 1HKCA 3QDKA 1QVGM 3C65A 2P9PB 1GLEG 3IDHA 4MLEA 1MWMA 3E66A 4BR7A 1VQPN 3G71N 3B8AX 3LDQA 3LM2A 1GLFO 4Z94A 2Q97A 3VF6A 4K25A 2NLXA 5AQOA 3EZWA 4GNIA 3CC2N 1MWKA 1XQSC 4H0XB 3O08A 3MCPA 2ASOA 4FWPA 4FWOA 3TSQA 4JKGB 1Q82O 3J7ZO 5EXWA 5GIPA 2OTJN 4BRMA 1YIJN 1S22A 4H5WA 4NLCA 4B1YB 3CF5L 2D4WA 3SK3A 3ZYYX 3A5OC 5AQUA 4AM6A 3O8MA 4C1NI 2Q2RA 3FZMA 3AGRA 3VPZA 1KAYA 4YOWA 4GV6A 4IZ9A 1NGAA 1QQMA 4XH1A 3ENBA 4WQ4C 4H0VB 1NGGA 1JJ2M 4IDHA 3I55N 2CGLA 3SAGA 4BRIA 3CCUN 3QB0A 3CCLN 2Q0UA 3TTFA 3HOSA 1YJWN 3GOIA 1HUXA 5MLCQ 1DGKN 5B8HA 4A2AA 3U9ZA 2HF4A 3ULEB 1YJ9N 4YOXA 1VQ7N 3D2FA 2BH1A 1HKBA 3IFRA 1NGCA 5JMVA 2QWOA 3E9LA 4MDBA 3ZETA 4PL7A 3VEZA 3FZKA 2I7NA 4BVPA 4OO1J 3DJCA 2IVPA 3I56N 2VGMA 2P9PA 1V4SA 4C1NK 1KD1O 1DEJA 1U2VB 2CGKA 5LJVA 2A6AA 4CZGA 2P9SA 3JXUA 3WQUA 2WFBA 4H0YB 3VENA 4BY9C 3AGKA 4H5NA 1HX1A 4BQLA 5AQPA 4WCEL 3CHWA 3J8AA 5AQFA 4FOEA 1GLCG 3O9SA 2QWPA 4FOIA 1M90O 2P9IB 3KK7A 4QS8A 4DQ8A 1YHQN 1H1VA 3PLAA 4FWRA 3U9DA 3HBTA 4HTLA 4WYBA 1S72N 4A57A 3CI5A 1Q18A 5BPLA 3L0QA 4MO5A 1NGHA 3T69A 2VYPA 4JEPA 3H1QA 5ELZA 3QBXA 5AR0A 4A62A 5C0YA 2FSNA 3CETA 5GADP 3R9PA 2QWRA 2RE2A 5F1XA 4DKWA 3CQYA 4EHUA 2E1YA 1BWFO 3VF2A 3WXLA 2UYTA 3A5MC 4GVEA 3WT0A 2NRWA 3LDOA 4BVOA 1KC8O 2CH6A 4IOCL 5M1QA 3O9QA 5AQSA 2E20A 2PAVA 1KQSM 5TKYA 3H45C 4WQ5C 2GELA 5JICA 3E9PA 5C2DA 1Q86O 1NGFA 1S3XA 5AQKA 4FWNA 3CJ9A 3W3DA 5HL7L 1NMDA 4RCHA 5DM6L 1KXPA 4JKEA 5AQGA 1OKJA 5AQHA 3SLCA 3C0BA 3W0LA 5KQDA 1JCEA 4FL9A 3AAPA 5BRFA 4A59A 5C2FA 1YUWA 3ATVA 4CJ7A 2HF3A 3M5RA 2YJFA 2ZGYA 4M7XA 5M1FA 3VMFB 4EFHA 5FPMA 2KKZA 5FPEA 1OVYA 3TTCA 4RTFD 4FWSA 4M7YA 2F7TA 5AQRA 4IOXA 4BR9A 1YITN 3HM8A 1QQOA 4H0PA 5AZIA 5LY3A 4CZLA 1T44A 5GAEP 5GINA 4H03B 3P31A 1QQNA 2D1KA 3D2FB 1XC3A 4FWQA 4BRDA 4FWKA 3SJHA 1NM1A 5CE3A 2A41A 3NVMA 2PBDA 1EQYA 3H1VX 1T3VA 4ILHA 4MLHA 2E2OA 3CXCM 3UKRA 1U6ZA 2GWKA 4I6MA 3WXMB 3SBGA 3O9TA 1GLBG 4H0OA 4NO7A 5AQJA 4JAXA 3P39A 1BOTO 1RDWX 5BN8A 4JHDA 2WUSA 4H5TA 5AQZA 2GUPA 3F9MA 1Y64A 4BRLA 3GDQA 1W97L 4RWTA 5DM7L 2P9SB 3MN9A 1E4GT 5F0XA 1ATRA 2HBKA 3OBWA 4M63C 2QWMA 5KPTA 3IUCA 2WC9A 1K8AO 3UB5A 1VAZA 3G4SN 3EKUA 4YDUC 2QWNA 3MX5A 1BO5O 1YXQA 1JCGA 4BC4A 4O5FA 2ZWHA 4MDAA 3OA9A 3VETA 1SQKA 5C12A 3NMUA 2NNWA 2E88A 3MN6A 3DXMA 1QHAA 3L6QA 4BQZA 4KH5A 2V51B 3DAWA 5GIOA 2NZTA 3O6WA 3N4QA 4A2BA 3EE8A 4A61A 5CHIA 2QA4N 4JKDA 3K9KA 1HPMA 3A0IX 1TUYA 2E8AA 2VGNA 1NGDA 3CJBA 2ASMA 4WQ4A 3Q7CA 4BROA 4JD2A 4YOVA 2W41A 3O1WA 1QZ5A 5JLHA 4FSVA 4K42A 3MMVA 3GL1A 3S41A 3L4IA 2ITMA 2CH5A 3GBTA 4B1UB 1GLJO 3FR0A 1QZ6A 4JKBA 3VEVA 5BN9A 1RDUA 2Q0RA 4BR5A 1G99A 4BC3A 3DXKA 2GEMA 3KHYA 3HSCA 3FZFA 2YHXA 3K9JA 4CD1A 3CERA 2BTFA 1NWKA 2W40A 1TYQA 4EIAA 4U67L 1MDUB 4JK8A 1MA9B 2A42A 1X3MA 4CZIA 5AFUA 3VGLA 4IJAA 1Q7YO 4BR2A 2KHOA 3D2EA 4NLBA 3G25A 4DB3A 4BC5A 4IFEA 3EL2A 2A40A 1NGEA 4AM7A 3D7EO 3LL3A 4OPAA 3RVCA 2IIRA 3CJCA 5AZIB 3PIPL 4U7BA 4IO9L 1JCFA 1NGBA 5C15A 2F9WA 1P90A 1VQLN 3IMXA 2ASPA 2E2PA 1BUPA 4H0TB 2NRRA 3QMLA 3VEXA 3ID8A 3VEYA 4B1ZA 4CBXA 1VQ4N 3DWLA 3CC7N 4ISGA 3OBYA 2JWKA 2QI2A 3SBTA 4C23A 2OANA 5BRHA 3UKRB 4I6MB 1VQ8N 5E84A 1CZAN 3A8YA 3CCMN 2QWLA 4PKGA 4B9QA 4WFBL 4JK9A 1BA0A 4JHDB 1ZC6A 4LC9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6Z A;  1SZ2 A;  4FO0 A;  2D0O A;  4FWL A;  3ZEU A;  4BRH A;  4H5R A;  2AA4 A;  4BRP A;  3MN5 A;  2FSJ A;  2FSK A;  3MN7 A;  5AZJ A;  1X3N A;  2GTD A;  4WQ5 A;  1KAX A;  4KBO A;  2P9K A;  3UKU A;  5BRE A;  3ENO A;  1BG3 A;  3BEX A;  3WXJ A;  3ZX3 A;  3EKS A;  4FPB A;  3DXM B;  3LDP A;  3O1B A;  1HKG A;  2P9N A;  5AQW A;  3H6E A;  5BPN A;  4QS9 A;  4BG9 A;  3P4I A;  3GG4 A;  4JD2 B;  4EHT A;  3WUH A;  2A5X A;  1ATN A;  1K8K A;  4BRA A;  5JLF A;  3VGM A;  3HI0 A;  1YVN A;  1NGJ A;  4L3Q A;  2GWJ A;  5FPD A;  2IVN A;  2J4R A;  3TPQ A;  4BGA A;  3RSE A;  4CBW A;  3DXK B;  1XUP O;  5KQ8 A;  3WQT A;  2E1Z A;  4IWV A;  1T6C A;  2Q36 A;  2D0P A;  3MK6 A;  1TYQ B;  3M6G A;  5AQY A;  3FGU A;  2HMP A;  2A3Z A;  3UE5 A;  3AY9 A;  2V7Y A;  3D2E B;  3M1F A;  4BRK A;  1GLA G;  4DCH A;  2P9U A;  2FLO A;  3AAQ A;  3FFK B;  3BF3 A;  1RFQ A;  3CIP A;  3OHR A;  5BRD A;  4BRE A;  1WOQ A;  2FF6 A;  3CJ1 A;  4CZH A;  3R8E A;  4BG8 A;  1YAG A;  4H5V A;  3BF1 A;  4B1X B;  2FF3 B;  3U8X A;  3VER A;  3A5L C;  2YHW A;  4XH4 A;  3O5B A;  1D4X A;  4YDU A;  3LDN A;  2ZGZ A;  1RGI A;  2HOE A;  1C0G A;  2DPN A;  3C7N A;  4HWI A;  5EY4 A;  3BP8 A;  4BRG A;  2QW9 A;  4DHY A;  3O80 A;  1ZXO A;  5AQM A;  4BR0 A;  2E2Q A;  2YJE A;  2EWS A;  5E26 A;  3VES A;  3VF4 A;  5AQT A;  3ZEU B;  1GLD G;  4CZF A;  4QS7 A;  5ADX A;  1P8Z A;  4XH5 A;  3ZX2 A;  5AZJ B;  3I33 A;  4K43 A;  5KPZ A;  5I9E B;  3O4W A;  2P9K B;  3UKU B;  3CQX A;  4B1W B;  2BUP A;  3BUZ B;  3WEE A;  3KZB A;  1T6D A;  2VCP A;  3HTV A;  3H3O B;  2VWB A;  3MDQ A;  4BR4 A;  4PKH A;  1SAZ A;  3EN9 A;  4JN4 A;  5BPM A;  2F9T A;  4F9O A;  2P9N B;  4NB4 A;  2YI1 A;  5FPN A;  3ATU A;  2P9L A;  1HLU A;  2AP1 A;  1DKG D;  1NBW A;  3TU5 A;  1IG8 A;  3FLC O;  3QFU A;  4BRF A;  2V52 B;  5EOY A;  1K8K B;  4CD3 A;  1ZBS A;  2E2N A;  3QIC A;  3VOV A;  4CZJ A;  4MO4 A;  2FXU A;  3RSE B;  3FZH A;  4J8F A;  4FWM A;  1WUA A;  1TUU A;  2IVO A;  1IJJ A;  2QXL A;  3M3Z A;  3A5N C;  3JS6 A;  5AQV A;  3HZ6 A;  1R59 O;  3AAR A;  1BU6 O;  5ADX H;  3EO3 A;  3QFP A;  4B1V A;  2QM1 A;  4IO8 A;  2P9U B;  4CZE A;  3I8B A;  2QWQ A;  5LJW A;  3H3N O;  4ISE A;  3VGK A;  4CZK A;  4BRN A;  5AFU H;  2YHY A;  3VEO A;  4CI6 A;  1Z05 A;  2V7Z A;  3GE1 A;  5EVZ A;  1E4F T;  4IXC A;  3SMP A;  2Q31 A;  3C7N B;  5F2R A;  3ULE A;  1GLL O;  1ATS A;  2I7P A;  4BRC A;  4E1J A;  5AQQ A;  2NRH A;  4BRQ A;  1ESV A;  1BDG A;  5AQX A;  1LCU A;  4BC2 A;  3ENH A;  3LDL A;  3VEW A;  5BR9 A;  3LM9 A;  5AQI A;  3U4L A;  1X9J A;  1BA1 A;  3ZX0 A;  4XEI A;  2YCH A;  4K41 A;  1U2V A;  2Q1N A;  4GY2 B;  2H3G X;  4JNE A;  4CZM A;  4PKI A;  1HJO A;  3FZL A;  3CJ7 A;  1C0F A;  3WEE B;  3WXI A;  4O8K A;  3WXK A;  5AQL A;  3R6M A;  1V4T A;  4CBU A;  4EAH D;  1NGI A;  3CJA A;  2P9I A;  4PL8 A;  1KAZ A;  2ZF5 O;  1NLV A;  5AQN A;  4Y0W A;  4ISF A;  3H46 O;  3QBW A;  4FPA A;  5KPR A;  3FE1 A;  3ZET B;  2P9L B;  4BGB A;  1Z6R A;  3SMS A;  2CGJ A;  3KVG A;  1LOT B;  5EX5 A;  4IJN A;  1HKC A;  3QDK A;  2P9P B;  1GLE G;  3IDH A;  4MLE A;  1MWM A;  4BR7 A;  3B8A X;  3LDQ A;  3LM2 A;  1GLF O;  4Z94 A;  2Q97 A;  3VF6 A;  4K25 A;  2NLX A;  5AQO A;  3EZW A;  4GNI A;  1MWK A;  1XQS C;  4H0X B;  3O08 A;  3MCP A;  2ASO A;  4FWP A;  4FWO A;  5EXW A;  4BRM A;  1S22 A;  4H5W A;  4B1Y B;  2D4W A;  3SK3 A;  3A5O C;  5AQU A;  4AM6 A;  3O8M A;  2Q2R A;  3FZM A;  3VPZ A;  1KAY A;  4IZ9 A;  1NGA A;  1QQM A;  4XH1 A;  4WQ4 C;  4H0V B;  1NGG A;  2CGL A;  4BRI A;  3QB0 A;  2Q0U A;  3GOI A;  1HUX A;  1DGK N;  5B8H A;  4A2A A;  3U9Z A;  2HF4 A;  3ULE B;  3D2F A;  1HKB A;  3IFR A;  1NGC A;  5JMV A;  2QWO A;  4PL7 A;  3ZET A;  3VEZ A;  3FZK A;  2I7N A;  4BVP A;  3DJC A;  2IVP A;  2P9P A;  1V4S A;  1DEJ A;  1U2V B;  2CGK A;  5LJV A;  2A6A A;  4CZG A;  2P9S A;  3JXU A;  3WQU A;  4H0Y B;  3VEN A;  4H5N A;  1HX1 A;  4BQL A;  5AQP A;  3CHW A;  3J8A A;  5AQF A;  4FOE A;  1GLC G;  2QWP A;  4FOI A;  2P9I B;  4QS8 A;  4DQ8 A;  1H1V A;  4FWR A;  3U9D A;  3HBT A;  4HTL A;  4WYB A;  3CI5 A;  1Q18 A;  5BPL A;  3L0Q A;  4MO5 A;  1NGH A;  4A62 A;  2VYP A;  5ELZ A;  3H1Q A;  5AR0 A;  3QBX A;  2FSN A;  3CET A;  3R9P A;  2QWR A;  5F1X A;  4EHU A;  3CQY A;  2E1Y A;  1BWF O;  3VF2 A;  3WXL A;  2UYT A;  3A5M C;  3WT0 A;  3LDO A;  4BVO A;  2CH6 A;  5AQS A;  2E20 A;  2PAV A;  5TKY A;  3H45 C;  4WQ5 C;  2GEL A;  5JIC A;  1NGF A;  1S3X A;  5AQK A;  4FWN A;  3CJ9 A;  3W3D A;  1NMD A;  4RCH A;  1KXP A;  5AQG A;  1OKJ A;  5AQH A;  3SLC A;  3C0B A;  3W0L A;  5KQD A;  1JCE A;  4FL9 A;  3AAP A;  5BRF A;  1YUW A;  3ATV A;  4CJ7 A;  2HF3 A;  4M7X A;  2YJF A;  2ZGY A;  4EFH A;  5FPM A;  5FPE A;  4RTF D;  4FWS A;  4M7Y A;  5AQR A;  4BR9 A;  3HM8 A;  1QQO A;  4H0P A;  5AZI A;  5LY3 A;  4CZL A;  1T44 A;  4H03 B;  1QQN A;  2D1K A;  3D2F B;  1XC3 A;  4FWQ A;  4BRD A;  4FWK A;  3SJH A;  1NM1 A;  5CE3 A;  2A41 A;  2PBD A;  1EQY A;  3H1V X;  4MLH A;  2E2O A;  3UKR A;  1U6Z A;  2GWK A;  4I6M A;  4H0O A;  1GLB G;  5AQJ A;  4NO7 A;  4JAX A;  1BOT O;  1RDW X;  5BN8 A;  4JHD A;  2WUS A;  4H5T A;  5AQZ A;  2GUP A;  3F9M A;  1Y64 A;  4BRL A;  3GDQ A;  4RWT A;  2P9S B;  3MN9 A;  1E4G T;  5F0X A;  1ATR A;  4M63 C;  2QWM A;  5KPT A;  3IUC A;  3UB5 A;  3EKU A;  4YDU C;  2QWN A;  1BO5 O;  1YXQ A;  1JCG A;  4BC4 A;  4O5F A;  2ZWH A;  3VET A;  1SQK A;  2E88 A;  3MN6 A;  3DXM A;  1QHA A;  3L6Q A;  4BQZ A;  2V51 B;  3DAW A;  2NZT A;  3O6W A;  4A2B A;  4A61 A;  1HPM A;  3A0I X;  1TUY A;  2E8A A;  4WQ4 A;  1NGD A;  3CJB A;  2ASM A;  4BRO A;  4JD2 A;  2W41 A;  3O1W A;  1QZ5 A;  5JLH A;  4FSV A;  4K42 A;  3MMV A;  3GL1 A;  3S41 A;  3L4I A;  2ITM A;  2CH5 A;  3GBT A;  4B1U B;  1GLJ O;  3FR0 A;  1QZ6 A;  3VEV A;  5BN9 A;  2Q0R A;  4BR5 A;  1G99 A;  4BC3 A;  3DXK A;  2GEM A;  3KHY A;  3HSC A;  3FZF A;  2YHX A;  4CD1 A;  3CER A;  2BTF A;  1NWK A;  2W40 A;  1TYQ A;  4EIA A;  1MDU B;  1MA9 B;  2A42 A;  1X3M A;  4CZI A;  5AFU A;  3VGL A;  4IJA A;  4BR2 A;  2KHO A;  3D2E A;  3G25 A;  4DB3 A;  4BC5 A;  3EL2 A;  2A40 A;  1NGE A;  4AM7 A;  3D7E O;  3LL3 A;  2IIR A;  3CJC A;  5AZI B;  1JCF A;  1NGB A;  2F9W A;  3IMX A;  2ASP A;  2E2P A;  1BUP A;  4H0T B;  3QML A;  3VEX A;  3ID8 A;  3VEY A;  4B1Z A;  4CBX A;  3DWL A;  4ISG A;  4C23 A;  2OAN A;  5BRH A;  3UKR B;  4I6M B;  5E84 A;  1CZA N;  3A8Y A;  2QWL A;  4PKG A;  4B9Q A;  1BA0 A;  4JHD B;  1ZC6 A;  4LC9 B; 
#chains in the Genus database with same CATH topology
 1J6Z A;  1HNX K;  3OYH A;  4FWL A;  3MN5 A;  5HRP A;  1IKY A;  3R3L A;  4CEF A;  3L2V A;  4WQ5 A;  4KBO A;  2P9K A;  5LMU K;  4YOY A;  1FJG K;  3ENO A;  5GAG P;  5HRS A;  4CJV A;  3CMA N;  2B4J A;  3NH2 A;  2KZM A;  1HKG A;  3MWP A;  4CF2 A;  3NGI A;  2YX6 A;  4QCL A;  1QTM A;  2D0B A;  1UAX A;  3O9U A;  3PY8 A;  4B08 A;  4BRA A;  2R7Y A;  3DMJ A;  1RDD A;  4H4O A;  2IVN A;  3ZSY A;  1CZB A;  4X66 K;  2D5R A;  5FRO A;  1BL3 A;  3WQT A;  1T6C A;  2Q36 A;  3DLR A;  2JWL A;  3M6G A;  2X6S A;  3UE5 A;  3QEW A;  3HJF A;  4CJ3 A;  4JI1 K;  1GLA G;  2P9U A;  3AAQ A;  3A2F A;  3CIP A;  4FK2 A;  5JVG L;  1U4B A;  2FF6 A;  3CJ1 A;  3G0Z A;  2XRI A;  4BG8 A;  4CZH A;  1XMQ K;  3O9R A;  1Q81 O;  3VER A;  2YHW A;  1C1A A;  3TSU A;  3EYZ A;  1C0G A;  4HWI A;  3BP8 A;  2HHQ A;  4BRG A;  4DHY A;  5M1N A;  4LF5 K;  4JYA K;  3SAH A;  3NF8 A;  3TTD A;  1YF5 L;  3V9S A;  2HHV A;  2E2Q A;  3RR7 A;  4KB1 A;  1R0A A;  4LF6 K;  1N34 K;  4K0K K;  3VF4 A;  4KPY A;  4B3O A;  3CCQ N;  3M8R A;  3O3F A;  4FW2 A;  3ZX2 A;  5AZJ B;  3T1A A;  5KPZ A;  1RT2 A;  3OYJ A;  1X9M A;  1VSJ A;  2ZJQ L;  5CZ2 A;  3UKU B;  3PIO L;  4B1W B;  2RHK A;  1RT3 A;  2BUP A;  1BHL A;  3HTV A;  2UXB K;  4BR4 A;  4FK0 A;  1VQM N;  4PKH A;  3OJU A;  3EN9 A;  2WBN A;  2P9N B;  1KSP A;  4E7I A;  4CJT A;  4Y1D A;  4DSL A;  4DSJ A;  2P9L A;  3P38 A;  1HLU A;  4FM0 A;  1NBW A;  3KTQ A;  4IEE A;  3ID6 A;  1IG8 A;  3QFU A;  5CZ1 A;  4ILJ A;  1K8K B;  2DFE A;  5M1P A;  4NCB A;  4GVM A;  1ZBS A;  3VOV A;  4EZ9 A;  4WF9 L;  1IKW A;  4AH9 A;  1WBB A;  3THX A;  4ELU A;  1WUA A;  4M45 A;  3LAN A;  2Z1H A;  3A5N C;  2ATQ A;  5C10 A;  4GV3 A;  4AHC A;  2PYL A;  4OPJ A;  1R59 O;  4CHY A;  4B1V A;  2NRT A;  4DS5 A;  4IKF A;  5DMR A;  2YHA A;  3H3N O;  4DQS A;  1QHT A;  4ISE A;  4CER A;  3VGK A;  4CZK A;  3NGY A;  5AFU H;  1M1K O;  3VQP A;  3JSM A;  3E1Y A;  3GE1 A;  3AA2 A;  3C7N B;  1WSH A;  4O0I A;  2I7P A;  4CEQ A;  2B6A A;  4DMN A;  4E1J A;  1HR0 K;  4AF1 A;  1OH7 A;  4A5B A;  4YOR A;  4BRQ A;  1BDG A;  4OKE A;  5DK5 A;  2O8B B;  3LDL A;  1JLE A;  3FFI A;  1IBL K;  1X9J A;  3DYA A;  1BA1 A;  3NE6 A;  2YCH A;  2HHH K;  3CD6 N;  1YT3 A;  4DU4 A;  1KVB A;  2G8U A;  3L2R A;  3CME N;  3WEE B;  1NKC A;  3QNN A;  1BIS A;  2BGG A;  3R6M A;  4CBU A;  1W2B M;  1YTA A;  1KAZ A;  2ZF5 O;  5HLF A;  4B9S A;  5AQN A;  3RRH A;  1RDB A;  4Y0W A;  2D0A A;  1W0H A;  4R5P A;  1UA1 A;  2G8K A;  4JKF A;  3T7Z A;  3ZT3 A;  3THY A;  3ZET B;  3SQ2 A;  3ZSX A;  4JKA A;  3TAM A;  1IV0 A;  3CCE N;  2E6M A;  4M3U A;  5M1O A;  3C65 A;  2P9P B;  1GLE G;  4BWJ A;  4MLE A;  4FM1 A;  1VQP N;  3LDQ A;  3K5N A;  2P5G A;  1ITG A;  3LM2 A;  4AHT A;  2KW4 A;  3KLG A;  2NLX A;  4N76 A;  4CHO A;  1EET A;  2I5J A;  4GNI A;  4H0X B;  1K6Y A;  3O08 A;  5EXW A;  5T7B A;  5GIP A;  4H5W A;  4B1Y B;  1ZBI A;  2D4W A;  3ZYY X;  4HCB A;  5AQU A;  4RW7 A;  4CIG A;  4GKJ K;  2Q2R A;  1KCF A;  4IZ9 A;  5I3U A;  4PY5 A;  4H0V B;  1NGG A;  1NK5 A;  3QEI A;  2Q0U A;  3TTF A;  1GOC A;  1L3V A;  1WLJ A;  1YJ9 N;  2HF4 A;  2O4I A;  1VQ7 N;  3D2F A;  1HKB A;  1NGC A;  3NF9 A;  4MDB A;  4HUF A;  1OVQ A;  1RBS A;  3VEZ A;  3HP9 A;  3FZK A;  2WTU A;  2I7N A;  4OO1 J;  4C1N K;  1QQC A;  2AJQ A;  4JRP A;  2O8D A;  1S9G A;  4HCC A;  1HX1 A;  4FLU A;  3DRP A;  4FJ8 A;  1M90 O;  4LF7 K;  3KK7 A;  4CJU A;  1YHQ N;  1H1V A;  3PLA A;  3HL8 A;  3HBT A;  1KFD A;  4A57 A;  3CI5 A;  3B6P A;  4FLX A;  4JEP A;  5ELZ A;  1C0U A;  1B92 A;  5GAD P;  1IBM K;  3QIN A;  2RE2 A;  3AVJ A;  4DKW A;  2E1Y A;  4FZX C;  5J2Q A;  3QES A;  2O4G A;  3CYM A;  2NRW A;  3LDO A;  2UUA K;  2G8W A;  2OPR A;  2E20 A;  2PAV A;  1KQS M;  3H45 C;  4JS5 A;  1NJZ A;  3E9P A;  1QE1 A;  4E1M A;  5C2D A;  3E01 A;  1NGF A;  1QSS A;  3W3D A;  3ZT4 A;  4B8A B;  4CIF A;  1NMD A;  5DM6 L;  4JKE A;  4CJ4 A;  1OKJ A;  3LAM A;  5AQH A;  3C0B A;  1IG9 A;  5KQD A;  1TKX A;  4KTW A;  2HF3 A;  4M7X A;  2YJF A;  3I8D A;  4EFH A;  3U6F A;  5FPM A;  2KKZ A;  3EY1 A;  4M3X A;  4RTF D;  3CFO A;  1Q9Y A;  3J7Y P;  1YIT N;  4M3Z A;  4CZL A;  1CXQ A;  3P1G A;  1T44 A;  4G1Q A;  5GAE P;  3V9U A;  4FWK A;  2FBV A;  3H1V X;  5C25 A;  4CJS A;  2JGU A;  4MLH A;  4CGH A;  1U6Z A;  2GWK A;  5KRT A;  1VRT A;  3P39 A;  1RDW X;  4OJR A;  5JS1 A;  2GUP A;  3F9M A;  4FJX A;  3T1Y K;  3LAL A;  3IUC A;  4AIL C;  2UU9 K;  2QWN A;  5LL6 Z;  2YNG A;  1D8Y A;  3M8S A;  3VET A;  1X9S A;  2KZZ A;  5C12 A;  4N5S A;  4YY3 K;  3DAW A;  2HVH A;  2NZT A;  4UQG A;  4Q0B A;  4DQR A;  4KHN A;  2HHX A;  4RW9 A;  4A61 A;  5CHI A;  2QA4 N;  4JKD A;  1CXU A;  1HPM A;  3K9K A;  4BRO A;  3Q7C A;  4K8Z A;  3MXI A;  5JLH A;  4DQI A;  3KKS A;  3GL1 A;  1C0M A;  2ITM A;  2O8F A;  2CH5 A;  3TWH A;  1NK0 A;  4JKB A;  2HNY A;  3AO2 A;  2GEM A;  3KHY A;  1JLC A;  3OS0 A;  1RT7 A;  2BTF A;  1NWK A;  1TYQ A;  4EIA A;  4JK8 A;  4KI6 A;  4OGE A;  4CZI A;  1KVA A;  4YFU A;  4M3T A;  3G25 A;  4BC5 A;  4IFE A;  4I9Q A;  2F4V K;  1XHX A;  2FBT A;  2A40 A;  1NGE A;  2KQ2 A;  1NMN A;  4CES A;  4IO9 L;  1NGB A;  3AVK A;  3V1R A;  3VQB A;  1RDA A;  3IMX A;  2ASP A;  5D3G A;  1BUP A;  2NRR A;  1VQ4 N;  3DLK A;  4ISG A;  1SKW A;  2JWK A;  2QI2 A;  2OAN A;  3QNO A;  4I6M B;  3AO5 A;  1S6Q A;  1VQ8 N;  4N47 A;  3QO9 A;  1N33 K;  2X78 A;  3CCM N;  4PKG A;  4JK9 A;  4AHR A;  3G6E N;  4FO0 A;  4HUG A;  3D45 A;  4BRP A;  1SS6 A;  2FSK A;  3MN7 A;  2GTD A;  1JXE A;  3PSI A;  5BRE A;  3OYC A;  4IG0 A;  4XIU A;  1VRU A;  1EXQ A;  2HMI A;  3MX2 A;  4W5O A;  3OYK A;  3MEC A;  3PUF A;  1T03 A;  1HQE A;  1ASV A;  3MXJ A;  5AQW A;  2NUB A;  1X1P A;  4CK1 A;  1S1X A;  3U3G A;  3C6H A;  4DU3 A;  4QAG A;  3P4I A;  4JD2 B;  4EHT A;  3WUH A;  3TAN A;  2A5X A;  5H1S Q;  3BGR A;  1ATN A;  2GX9 A;  1IKX A;  4CJR A;  3HI0 A;  3KD1 E;  1I3A A;  1NGJ A;  4L3Q A;  5FPD A;  4UY8 O;  2ZE2 A;  4WE1 A;  1I94 K;  2J4R A;  5KTQ A;  2QTD A;  4Z0U A;  1FKO A;  5KQ8 A;  2Y1I A;  2HBJ A;  3F5T A;  2HMP A;  3THW A;  2A3Z A;  3ITH A;  4DFJ A;  3D2E B;  2NRZ A;  3AA3 A;  4BRK A;  3FFK B;  2FLO A;  3QIP A;  3SUP A;  4BRE A;  4R79 A;  3OYB A;  3QIO A;  3ZT1 A;  1YAG A;  4IEI A;  4B1X B;  4XH4 A;  4FJK A;  4YDU A;  3PO5 A;  1JL2 A;  1RGI A;  3WNH A;  2DPN A;  5IT9 O;  5EY4 A;  3DLB A;  2JLE A;  3O80 A;  4KH6 A;  4DR2 K;  1ZXO A;  1EO1 A;  4DG1 A;  2EWS A;  1JLB A;  3VES A;  3EE9 A;  5AQT A;  3ZEU B;  1GLD G;  3K58 A;  5J2M A;  5ADX A;  2XO7 A;  3KIO A;  4CJF A;  4OKJ A;  4DR5 K;  4O0J A;  3OYE A;  3NDK A;  1F21 A;  3CQX A;  3TAE A;  3LPU A;  3KZB A;  2VCP A;  4IDK A;  1Q9X A;  4B3R K;  1U49 A;  3MDQ A;  5CY4 A;  4M41 A;  4JN4 A;  4CVN E;  4F9O A;  3VQ9 A;  2FBX A;  3SQ4 A;  5HOO A;  1L3T A;  5JS2 A;  2X6N A;  3CM6 A;  4CK3 A;  4OPK A;  1DKG D;  3NF6 A;  3FLC O;  2V52 B;  4WFA L;  4CD3 A;  3V9W A;  3L2Q A;  1I39 A;  3QIC A;  4IBN A;  4CZJ A;  3RSE B;  3EEQ A;  5J2P A;  1BI4 B;  4J8F A;  4FWM A;  1VSL A;  3AO4 A;  3VN5 A;  2IVO A;  4PHT X;  2Q3S A;  3DRS A;  3JS6 A;  5J2N A;  4RW8 A;  1QVF M;  1WN7 A;  3OVN A;  3OYL A;  3QEP A;  1J54 A;  3AAR A;  1A5X A;  4KV8 A;  4I9L A;  3O3G A;  4C8N A;  5ADX H;  3NF7 A;  5CYM A;  3D6R A;  2XHB A;  3CCV N;  4CF1 A;  5E41 A;  5TKW A;  4BE1 A;  2HST A;  5CR4 A;  3THV A;  1Z05 A;  3ZSV A;  1E4F T;  4JI6 K;  1TAQ A;  4CFD A;  4DV3 K;  4C8K A;  3IRX A;  1ESV A;  5AQX A;  1LCU A;  3PO4 A;  1NOZ A;  4IG3 A;  1HMV A;  1REV A;  3LM9 A;  4O5B A;  4DTS A;  4K41 A;  3K2P A;  1U2V A;  2Q1N A;  4GY2 B;  4FVU A;  4PKI A;  1HJO A;  3HK2 A;  2O8C A;  4DV5 K;  3CJ7 A;  3R1X A;  3WXI A;  4O8K A;  3U3Y A;  5AQL A;  2E5L K;  1ILY A;  2UXD K;  3Q7B A;  4CJ5 A;  4DR7 K;  4E7J A;  3P5J A;  1XHZ A;  4Z4G A;  4ISF A;  3H46 O;  5KPR A;  4CE9 A;  3FE1 A;  3VTI A;  3NH1 A;  3WNG A;  4JK7 A;  3KK2 A;  1LOT B;  5EX5 A;  4IJN A;  1MWM A;  3SQ1 A;  1EWQ A;  3I0S A;  4L8R B;  4ZHR A;  3VF6 A;  4K25 A;  5AQO A;  3AO3 A;  5SZT A;  1XQS C;  1Q82 O;  4JKG B;  3SJJ A;  4KKO A;  2IS3 A;  3OYD A;  4AM6 A;  3O8M A;  3AGR A;  3VPZ A;  4B9V A;  1KAY A;  3HYF A;  4YOW A;  2F8T A;  1NGA A;  4XH1 A;  3ENB A;  4C8O A;  3CG7 A;  3AVC A;  2W42 A;  1JJ2 M;  4HVJ A;  2CGL A;  4BRI A;  1RT4 A;  4LH4 A;  3MED A;  1YJW N;  1RBT A;  3GOI A;  4DV1 K;  1Z26 A;  1HUX A;  5MLC Q;  1DGK N;  1RTJ A;  3C94 A;  4ZTF A;  3U9Z A;  3ULE B;  1GOB A;  4YOX A;  4CCH A;  2BH1 A;  4CJK A;  3IFR A;  2QWO A;  4PL7 A;  1HNI A;  1C0T A;  4RG8 A;  3SUO A;  4JI3 K;  4DF4 A;  3I56 N;  2VGM A;  1HYV A;  1FKP A;  2HND A;  4OLB A;  2A6A A;  3HPH A;  2P9S A;  4JRQ A;  1DLO A;  3VEN A;  3QLH A;  2QKK A;  5AQP A;  1RDC A;  3J8A A;  3O9S A;  4BE0 A;  2HW3 A;  2E6L A;  2P9I B;  4FZY A;  4QS8 A;  4M3Y A;  4DQ8 A;  1ZYQ A;  1S72 N;  4MO5 A;  2QKB A;  3NH0 A;  2QWR A;  5F1X A;  2HHT A;  1JLG A;  3WXL A;  3AV9 A;  3VQ6 A;  1KC8 O;  4V19 S;  2CH6 A;  4IOC L;  5M1Q A;  3O9Q A;  5AQS A;  1XNR K;  3V1Q A;  4W5R A;  1Q86 O;  4CHN A;  5AQK A;  1NJW A;  3CJ9 A;  4B3T K;  3LP1 A;  4OLA A;  4DV0 K;  4J2D A;  1KXP A;  3O4Q A;  1JCE A;  4FL9 A;  5BRF A;  2Z1G A;  4LF9 K;  1YUW A;  1NOY A;  4CJ7 A;  1D9D A;  3LP3 A;  3VMF B;  5FPE A;  1OVY A;  4F2S A;  3UIQ A;  4M7Y A;  2F7T A;  1NK9 A;  2ETJ A;  4H0P A;  5AZI A;  5LY3 A;  4FW1 A;  4PA1 A;  1KVC A;  5GIN A;  4Z4I A;  4H03 B;  3P31 A;  3T1H K;  1QQN A;  4JI2 K;  1Q8I A;  1XC3 A;  2O8E B;  4AHS A;  3NVM A;  2PBD A;  4FJ9 A;  1EQY A;  2VG6 A;  3CXC M;  2E2O A;  3UKR A;  5AQJ A;  3TI0 A;  1BOT O;  5AQZ A;  4CJE A;  3SYZ A;  1Y64 A;  4BRL A;  4RWT A;  5DM7 L;  3MN9 A;  1JLQ A;  1NJX A;  5F0X A;  1IH7 A;  4Q5V A;  4M63 C;  1E3M A;  2QWM A;  2WC9 A;  1K8A O;  3G4S N;  1IKV A;  3MX5 A;  5HRN A;  4BC4 A;  4O5F A;  2ZWH A;  4MDA A;  3OA9 A;  4N41 A;  1SQK A;  2NNW A;  3WNF A;  1KLN A;  2E88 A;  3MN6 A;  4B9M A;  4CEE A;  4LY7 A;  4CF0 A;  3SCX A;  3EE8 A;  2G8I A;  3A0I X;  4JI7 K;  4LSN A;  2E8A A;  1NGD A;  3CJB A;  4X64 K;  1NJY A;  4YOV A;  2W41 A;  1QZ5 A;  1HYS A;  3OYN A;  2VG5 A;  1VSF A;  3GBT A;  4B1U B;  4J2E A;  1RDU A;  4BR5 A;  3G10 A;  1S6P A;  2YHX A;  3CER A;  4X65 K;  4DR4 K;  4FJN A;  4JS4 A;  2A42 A;  1S1U A;  5J1E A;  4W5Q A;  2W6L A;  4NLB A;  4DB3 A;  4AM7 A;  3D7E O;  3S3N A;  1EWR A;  4DR3 K;  3KJV A;  2IIR A;  3PIP L;  1RTI A;  1BQN A;  4FLT A;  2F9W A;  1P90 A;  1VQL N;  3KLE A;  3OYI A;  3VEY A;  3DWL A;  4CHQ A;  1LW0 A;  4CEB A;  1DTT A;  3RMB A;  2EX3 A;  3SBT A;  4E0D A;  3S9H A;  5BRH A;  3TAR A;  2IAJ A;  3C95 A;  1CZA N;  1JXB A;  4KHS A;  2QWL A;  4FXD A;  1BA0 A;  4JHD B;  1ZC6 A;  4LC9 B;  2HHS A;  1SZ2 A;  4LF4 K;  3ZCM A;  4BRH A;  4FYD A;  4H5R A;  3RMA A;  4CEZ A;  3LWM A;  4B9N A;  5AZJ A;  3V9X A;  1X3N A;  1KAX A;  1A5W A;  3BZC A;  3UKU A;  3LZJ A;  1YJN N;  3PX4 A;  1BG3 A;  1C6V A;  4ID5 A;  3WXJ A;  4TSX A;  3ZSR A;  1VSD A;  4FPB A;  3OS1 A;  3DXM B;  4K8X A;  3HOT A;  2P9N A;  4W5N A;  3H6E A;  4CGD A;  1ZBL A;  2UUB K;  2YKM A;  3GG4 A;  1RT6 A;  4NCG A;  1K8K A;  5JLF A;  1YVU A;  4M3W A;  4F3T A;  3ASM A;  2UXC K;  4PQU A;  2GWJ A;  3N4P A;  4CBW A;  2DTU A;  4E7K A;  3DXK B;  1XUP O;  3PX0 A;  2HHW A;  4CIE A;  2F8S A;  2D0P A;  3FGU A;  1WSF A;  4FLZ A;  3HT3 A;  3AY9 A;  3NVK A;  2V7Y A;  4CFA A;  3KD5 E;  2UUC K;  2P5O A;  3VQQ A;  4KAZ A;  4G9Z A;  1BCO A;  1RFQ A;  1TL1 A;  5BRD A;  1WOQ A;  1UOC A;  4YOT A;  3R8E A;  4C8M A;  3HM9 A;  1BGX T;  2HBM A;  3BF1 A;  2FF3 B;  4OPH A;  3O5B A;  1D4X A;  2RN2 A;  3AA4 A;  3LDN A;  1NKE A;  2ZGZ A;  2HOE A;  3C7N A;  3D0P A;  4ELV A;  1N5Y A;  2QW9 A;  1J5O A;  5C42 A;  3TAQ A;  5AQM A;  4BR0 A;  2O8B A;  3C6A A;  1SKS A;  2YJE A;  5E26 A;  2P51 A;  2ZJR L;  1VQO N;  1G15 A;  1K9M O;  2P1J A;  1B9F A;  4CZF A;  3RMC A;  4QS7 A;  4CJW A;  1P8Z A;  2HBL A;  3I33 A;  4CGI A;  3IAY A;  3O4W A;  2P9K B;  3JYT A;  3BUZ B;  3LPT A;  2GV9 A;  1WSE A;  3WEE A;  1T6D A;  3H3O B;  4IFY A;  5JVH L;  4DSF A;  3SAF A;  1WAJ A;  2X74 A;  1L3S A;  2PFU A;  5BPM A;  4KHU A;  2F9T A;  4DLE A;  3OYA A;  2ZQB A;  3KWG A;  3BZK A;  3TSP A;  4ZTJ A;  5HP1 A;  3KKR A;  2AP1 A;  1XC9 A;  3K59 A;  3VQ4 A;  4BRF A;  5EOY A;  1WSG A;  3PV8 A;  1JLA A;  4DF8 A;  4GKK K;  3C6T A;  1NK7 A;  3QEX A;  1RT1 A;  5GAH P;  4NYF A;  4CF9 A;  5AQV A;  3V4I A;  3DLL L;  2OZM A;  3CCS N;  4IOA L;  3CCJ N;  4DUY K;  4LF8 K;  3IKM A;  1VHX A;  3HZ6 A;  3EO3 A;  3QFP A;  2P9U B;  3K57 A;  3ZSQ A;  1EKE A;  1U48 A;  1B9D A;  5LJW A;  4JKH A;  3AVF A;  5SWM A;  2HNZ A;  4FVM A;  3M8Q A;  1SL0 A;  2YHY A;  4DTR A;  4HUE A;  4CGF A;  4KHP K;  3RMD A;  1NNE A;  3SMP A;  3P83 D;  5F2R A;  1GLL O;  1ATS A;  4DTX A;  4DTP A;  4BRC A;  1TK8 A;  1NK6 A;  4KI4 A;  1HNV A;  3ENH A;  3TAG A;  2KFN A;  3VEW A;  1DTQ A;  5KGW A;  2Y1J A;  3CPE A;  1U04 A;  1XNQ K;  2A1S A;  1CLQ A;  5AQI A;  3U4L A;  4BDY A;  3KWI A;  1LAW A;  1VQ6 N;  2H3G X;  4O55 A;  4CK2 A;  4DV6 K;  2A1R A;  3AVB A;  3FZL A;  4BAC A;  1SL1 A;  3L2W A;  4DR1 K;  1C0F A;  3BY5 A;  1HNZ K;  4FZZ A;  5HBM A;  3QET A;  3WXK A;  1TK5 A;  1V4T A;  1NGI A;  3CJA A;  4CFB A;  4PL8 A;  1GOA A;  3VQE A;  4YOU A;  4DFP A;  1NLV A;  2ZJP L;  1LAV A;  4AHV A;  1DT9 A;  3QBW A;  4CF8 A;  5M1K A;  3VTH A;  2P9L B;  4BGB A;  1SKR A;  4CEC A;  2CGJ A;  3KVG A;  1WSJ A;  3VQA A;  1HKC A;  3QDK A;  1QVG M;  2YV0 X;  3IDH A;  3V9Z A;  1NKB A;  4BR7 A;  1LWC A;  3DLH A;  4CGJ A;  4Z94 A;  2Q97 A;  3EZW A;  4M42 A;  3PSF A;  3THX B;  4PWD A;  1MWK A;  5LMN K;  3MCP A;  2ASO A;  3TSQ A;  2OYQ A;  3J7Z O;  4FK4 A;  2OTJ N;  4BRM A;  1YIJ N;  1S22 A;  2VQE K;  3CF5 L;  3NFA A;  3A5O C;  5HRR A;  4CED A;  1ZBF A;  1S1V A;  4WQ4 C;  2RPI A;  1LW2 A;  3SZ2 A;  4IDH A;  4OX9 K;  3SAG A;  3CCU N;  3QB0 A;  3K5M A;  5FDL A;  2BE2 A;  1HNW K;  5B8H A;  4A2A A;  3QEV A;  5JMV A;  4OVL A;  4FLY A;  4B3M K;  4DWI A;  1S9E A;  1XI1 A;  3TAB A;  4BVP A;  3DJC A;  2ZM6 K;  1VSE A;  2CGK A;  5LJV A;  4X62 K;  4DFM A;  1LV5 A;  2RF2 A;  3JXU A;  3WQU A;  2WFB A;  4H0Y B;  3L3V A;  3AGK A;  4H5N A;  1T8E A;  4BQL A;  2VWK A;  5AQF A;  4FOE A;  4FOI A;  3AVL A;  2OA8 A;  1Q18 A;  4NYN A;  3L0Q A;  5BPL A;  3JAM O;  1NGH A;  4HHT A;  3T69 A;  4A62 A;  3H1Q A;  5AR0 A;  5C0Y A;  2FBY A;  2FSN A;  3THY B;  2YNH A;  3CET A;  1JL1 A;  4DUZ K;  4EHU A;  3CQY A;  4DV2 K;  2QK9 A;  3VF2 A;  2UYT A;  3A5M C;  1BIU A;  1O1W A;  3VQD A;  4BDZ A;  5TKY A;  4WQ5 C;  2XY5 A;  4FJ5 A;  2PYJ A;  5HL7 L;  3HST B;  3LZI A;  4RCH A;  5AQG A;  1N36 K;  3W0L A;  1QS4 A;  3AAP A;  4A59 A;  2GUI A;  2G8F A;  3ATV A;  3DM2 A;  3LDS A;  3M5R A;  3TTC A;  3K5O A;  4FWS A;  5AQR A;  3HM8 A;  1QQO A;  4IFV A;  4BE2 A;  2XY7 A;  1OH6 A;  4W5T A;  4KRE A;  1TV6 A;  3D2F B;  4FWQ A;  5K14 A;  4BRD A;  5CE3 A;  2YKN A;  4DTM A;  1T05 A;  1T3V A;  4ILH A;  2G8H A;  2OZS A;  1FK9 A;  1FXX A;  4I6M A;  3WXM B;  3SBG A;  4H0O A;  4LFC K;  4NO7 A;  3L8B A;  5BN8 A;  4H5T A;  1N32 K;  1W97 L;  3J7A P;  2O8D B;  3AVH A;  3T3F A;  4F3O A;  2HBK A;  5KPT A;  1FW6 A;  2HVI A;  4AQY K;  2Z1J A;  3EKU A;  3AO1 A;  1CZ9 A;  1U47 A;  3NMU A;  5IWA K;  1QHA A;  3L6Q A;  4BQZ A;  3NCI A;  3J81 O;  4CGG A;  3ZT0 A;  3N4Q A;  4ICL A;  3NAE A;  1VSI A;  2ASM A;  4JD2 A;  4FJ7 A;  4FSV A;  2DY4 A;  3S41 A;  4YHH K;  1EX4 A;  4EP5 A;  3CM5 A;  4FJL A;  3VEV A;  5BN9 A;  4FJG A;  4BC3 A;  3K9J A;  4CD1 A;  3K0S A;  1MA9 B;  4I7F A;  5BR8 K;  3WNE A;  5AFU A;  1NU0 A;  3VGL A;  1Q7Y O;  1QSL A;  2KTQ A;  2KHO A;  1SUQ A;  3D2E A;  3ZSW A;  3EL2 A;  3RTV A;  1HJR A;  1SV5 A;  1XWL A;  3T19 A;  4OPA A;  3ZSZ A;  1WBD A;  2OCE A;  4H0T B;  3VEX A;  3KLH A;  3LWL A;  4NXN K;  3ID8 A;  4B1Z A;  4CBX A;  1VSK A;  3CC7 N;  1RT5 A;  3VQ8 A;  4C23 A;  1RBV A;  2IDO A;  1RBU A;  5E84 A;  4WFB L;  4B9Q A;  1KRP A;  4U7B A;  5I42 A;  4Z4F A;  2D0O A;  3ZEU A;  2AA4 A;  3ZT2 A;  5AJ3 K;  5KRS A;  3K5L A;  2FSJ A;  2QXF A;  4A5A A;  3SV3 A;  3HP6 A;  2D0C A;  4EP4 A;  5EU7 A;  3PX6 A;  3BEX A;  3ZX3 A;  1S1W A;  3AVN A;  3EKS A;  3TR8 A;  2KFZ A;  4GW6 A;  3LDP A;  4ID1 A;  3LP2 A;  3O1B A;  1ASU A;  3H08 A;  3ZSO A;  5BPN A;  1UA0 A;  3NBP A;  3TAP A;  4QS9 A;  4BG9 A;  1KFS A;  1BCM A;  1YI2 N;  1HRH A;  2O8F B;  3VGM A;  1YVN A;  3OW2 M;  3TPQ A;  4BGA A;  3RSE A;  1BI4 A;  4RW4 A;  2IC3 A;  2E1Z A;  4IWV A;  3MK6 A;  1TYQ B;  2W6K A;  2BDP A;  1KTQ A;  5AQY A;  4E7L A;  3QER A;  1L3U A;  1TVR A;  4WFN L;  3AVM A;  4E19 A;  3M1F A;  3HPG A;  2DFH A;  4DCH A;  4FLW A;  1MU2 A;  3BF3 A;  4DTO A;  3OHR A;  4AHU A;  3HVT A;  2NRX A;  4O44 A;  4Y1C A;  4EZ6 A;  2BAN A;  3EZ5 A;  4H5V A;  3ZLJ A;  1T7P A;  3U8X A;  3A5L C;  2OPP A;  4E3S A;  4PUO A;  1TKZ A;  3DLE A;  4DTN A;  3F73 A;  1U45 A;  1RBR A;  1K73 O;  2VG7 A;  1ASW A;  3AA5 X;  3O4N A;  4NXM K;  4O8U A;  4B9T A;  3E9O A;  4JI5 K;  4KHY A;  2EHG A;  3CPW M;  4JI0 K;  1VQK N;  4B9U A;  4JKC A;  1J53 A;  3F2K A;  3MAQ A;  4KB0 A;  4H4M A;  4XH5 A;  4FM2 A;  5FRN A;  4K43 A;  5I9E B;  4C8L A;  2VWB A;  4KRF A;  1SAZ A;  1TL3 A;  1VQN N;  1LWE A;  4KHW A;  2ITG A;  1WNS A;  4NB4 A;  4NCA A;  2KLA A;  2YI1 A;  5FPN A;  3ATU A;  1ZBU A;  1NJI O;  3TU5 A;  3CCR N;  1RIL A;  1N8R O;  4GV9 A;  2OTL N;  2E2N A;  3MCA B;  2QEX N;  4MO4 A;  2FXU A;  1ZBH A;  3FZH A;  1TUU A;  1IJJ A;  2QXL A;  3M3Z A;  4JKG A;  1VQ5 N;  3I0R A;  3THW B;  4CEO A;  5CYQ A;  2GBZ A;  4CJP A;  4FJH A;  1BU6 O;  1IO2 A;  2QM1 A;  4IO8 A;  3OJS A;  4KTQ A;  1N6Q A;  2NRV A;  4CZE A;  3I8B A;  2QWQ A;  1LWF A;  3SPY A;  1O13 A;  4BRN A;  3CFR A;  3ULD A;  3VEO A;  4CI6 A;  3MWT A;  1HQU A;  2V7Z A;  5EVZ A;  4IXC A;  3CC4 N;  2Q31 A;  2HB5 A;  3ULE A;  3HRG A;  2G8V A;  5AQQ A;  2NRH A;  3M8P A;  2IOC A;  1VSH A;  1W9H A;  1TAU A;  4BC2 A;  4KH4 A;  1WAF A;  5BR9 A;  4DSK A;  1HYZ A;  3ZX0 A;  4XEI A;  3HVR A;  2YHB A;  1XMO K;  4N56 A;  4JNE A;  4LFB K;  4CZM A;  1W7A A;  3BDP A;  4H8K A;  2IGI A;  4CEA A;  3NGZ A;  1X9W A;  3C6U A;  2WON A;  3AVA A;  3ISN C;  3KK1 A;  3VA3 A;  2F96 A;  4EAH D;  3DRR A;  3OYF A;  2P9I A;  4YNQ A;  1RTD A;  4J2A A;  2XY6 A;  4ILG B;  1C1B A;  1TKT A;  4FPA A;  2YNF A;  4ELT A;  1VQ9 N;  3L4Q A;  3CFP A;  3S3M A;  1Z6R A;  3SMS A;  4M3R A;  4DV4 K;  2WOM A;  3SQ0 A;  1TKD A;  3E66 A;  3G71 N;  3B8A X;  1Z25 A;  1GLF O;  3HPO A;  4LD0 A;  2PZS A;  3CC2 N;  4FWO A;  4FWP A;  3SI6 A;  3IS9 A;  4FCY A;  4NLC A;  2OPQ A;  3SPZ A;  3B6O A;  3SK3 A;  4C1N I;  3FZM A;  3OS2 A;  1EP4 A;  1A5V A;  3DLG A;  4GV6 A;  1QQM A;  5KI6 A;  3I55 N;  4E7H A;  1JKH A;  1WB9 A;  1J5E K;  3CCL N;  1HPZ A;  3HOS A;  3TAF A;  4B8C A;  3VQC A;  4HTU A;  4B9L A;  2O8E A;  4KFB A;  1SL2 A;  3MEE A;  3E9L A;  3DI6 A;  3ZET A;  3J80 O;  2ZD1 A;  2IVP A;  3IG1 A;  2P9P A;  4FJJ A;  1V4S A;  1KD1 O;  1DEJ A;  1U2V B;  2VWJ A;  4DFK A;  4CZG A;  3NHG A;  3SNN A;  2Z1I A;  4BY9 C;  3VA0 A;  2O8C B;  3AVI A;  4F2R A;  4LFA K;  3DOK A;  1S5J A;  4JLH A;  3CHW A;  4WCE L;  4BWM A;  3KK3 A;  1GLC G;  2QWP A;  1BIZ A;  4CHP A;  4CFC A;  3DOL A;  4CHZ A;  5FLX O;  1OH8 A;  4LSL A;  3VQ5 A;  4DTU A;  4FWR A;  3U9D A;  4HTL A;  3L3U A;  3OY9 A;  4WYB A;  5A2Q O;  2VYP A;  3QBX A;  3LP0 A;  1TGO A;  4CW7 B;  3R9P A;  4KTZ A;  4Z4E A;  4MQ3 A;  4FJI A;  4I2Q A;  1BWF O;  3KLI A;  4GVE A;  1NK4 A;  3WT0 A;  2HHU A;  4BVO A;  1J9A A;  4GMJ B;  3RRG A;  4DSI A;  3SUQ A;  1QSY A;  2GEL A;  5JIC A;  3SUN A;  3ALY A;  5FRM A;  4CJL A;  4E1N A;  3V6D A;  1S3X A;  4FWN A;  4Z4C A;  1TK0 A;  4BDP A;  2PY5 A;  3V1O A;  3SLC A;  4DR6 K;  1D9F A;  5C2F A;  1BQM A;  3O3H A;  2ZGY A;  1IBK K;  3V81 A;  4LH5 A;  5M1F A;  3HXM A;  3AVG A;  1C1C A;  4IOX A;  4BR9 A;  2OPS A;  4FLV A;  1D5A A;  3HO1 A;  3SV4 A;  3LAK A;  3L2U A;  4DV7 K;  2D1K A;  4QOZ B;  4KHQ A;  3SJH A;  1NM1 A;  2A41 A;  3F9K A;  1UWB A;  1KLM A;  1S1T A;  3MXM A;  3O9T A;  1GLB G;  4I2P A;  1JLF A;  4JAX A;  4JHD A;  2WUS A;  1YTU A;  2E4L A;  3VQ7 A;  3GDQ A;  2P9S B;  4MFB A;  1E4G T;  1RNH A;  1ATR A;  3CQ8 A;  3OBW A;  2FC0 A;  2XY8 A;  3UB5 A;  1VAZ A;  4DU1 A;  2RKI A;  4DSE A;  4YDU C;  1BO5 O;  1YXQ A;  1JCG A;  3OTO K;  3OYM A;  4DTJ A;  1NK8 A;  3MEG A;  2VQF K;  3RR8 A;  4B3S K;  3DXM A;  4KH5 A;  2V51 B;  5GIO A;  1RTH A;  3O6W A;  4A2B A;  4JI8 K;  4E89 A;  4F8R A;  1TUY A;  2VGN A;  4WQ4 A;  2DFF A;  5KGX A;  3RWU A;  1L5U A;  3O1W A;  4K42 A;  3MMV A;  3L4I A;  4CJQ A;  2LSN A;  4DQQ A;  1GLJ O;  3FR0 A;  1QZ6 A;  5C24 A;  5HRO A;  2Q0R A;  1G99 A;  3DXK A;  4DS4 A;  2B5J A;  3FZF A;  3HSC A;  1VSM A;  3OYG A;  4FJM A;  3S3O A;  2W40 A;  4U67 L;  4OKK A;  1MDU B;  4O4G A;  4KO0 A;  4F4K A;  1X3M A;  4IJA A;  4BR2 A;  1Y97 A;  4JV5 K;  3LL3 A;  3RVC A;  2YNI A;  3CJC A;  5AZI B;  1RCH A;  1JCF A;  4RW6 A;  4DLG A;  5C15 A;  4Z4H A;  2E2P A;  1NG9 A;  4J2B A;  3QML A;  4DQP A;  1VK0 A;  3OBY A;  1OH5 A;  4OGC A;  3KLF A;  3UKR B;  4JI4 K;  1WSI A;  3A8Y A; 
#chains in the Genus database with same CATH homology
 3G6E N;  1J6Z A;  1SZ2 A;  4FO0 A;  2D0O A;  4FWL A;  3ZEU A;  4BRH A;  4H5R A;  2AA4 A;  4BRP A;  3MN5 A;  1SS6 A;  2FSJ A;  2FSK A;  4A5A A;  3MN7 A;  3R3L A;  5AZJ A;  1X3N A;  2GTD A;  4WQ5 A;  1KAX A;  4KBO A;  2P9K A;  3UKU A;  5BRE A;  1YJN N;  3MX2 A;  4YOY A;  3ENO A;  1BG3 A;  5GAG P;  3BEX A;  3WXJ A;  3ZX3 A;  3EKS A;  4FPB A;  3DXM B;  3LDP A;  3CMA N;  3HOT A;  3O1B A;  1HKG A;  2P9N A;  3MWP A;  5AQW A;  3H6E A;  5BPN A;  2YX6 A;  3C6H A;  4QS9 A;  4BG9 A;  3P4I A;  3GG4 A;  4JD2 B;  4EHT A;  3WUH A;  3O9U A;  2A5X A;  1YI2 N;  5H1S Q;  1ATN A;  1K8K A;  2GX9 A;  4BRA A;  5JLF A;  3VGM A;  3HI0 A;  1YVN A;  1NGJ A;  4L3Q A;  2GWJ A;  3N4P A;  5FPD A;  3OW2 M;  2IVN A;  4UY8 O;  2J4R A;  3TPQ A;  4BGA A;  3RSE A;  2QTD A;  4CBW A;  3DXK B;  1XUP O;  5KQ8 A;  3WQT A;  2E1Z A;  4IWV A;  1T6C A;  2Q36 A;  2D0P A;  3MK6 A;  1TYQ B;  2JWL A;  3M6G A;  2HBJ A;  3F5T A;  3FGU A;  5AQY A;  2HMP A;  2A3Z A;  3UE5 A;  4WFN L;  3AY9 A;  3NVK A;  2V7Y A;  3D2E B;  2NRZ A;  3M1F A;  4BRK A;  1GLA G;  4DCH A;  2P9U A;  2FLO A;  3AAQ A;  3FFK B;  3BF3 A;  4G9Z A;  1RFQ A;  3CIP A;  3OHR A;  5BRD A;  4BRE A;  1WOQ A;  4R79 A;  5JVG L;  2FF6 A;  2NRX A;  3CJ1 A;  4YOT A;  3R8E A;  4BG8 A;  4CZH A;  3O9R A;  1YAG A;  4IEI A;  2HBM A;  3BF1 A;  4H5V A;  2FF3 B;  4B1X B;  3U8X A;  1Q81 O;  3VER A;  3A5L C;  4OPH A;  2YHW A;  4XH4 A;  3O5B A;  1D4X A;  4YDU A;  3LDN A;  2ZGZ A;  3TSU A;  1RGI A;  2HOE A;  1C0G A;  2DPN A;  3C7N A;  4HWI A;  5EY4 A;  3BP8 A;  4BRG A;  1K73 O;  2QW9 A;  4DHY A;  5M1N A;  3O80 A;  4KH6 A;  4O8U A;  3SAH A;  1ZXO A;  3E9O A;  5AQM A;  3TTD A;  4BR0 A;  1YF5 L;  1EO1 A;  2E2Q A;  3C6A A;  2YJE A;  2EWS A;  5E26 A;  3CPW M;  1VQK N;  2ZJR L;  3VES A;  1VQO N;  1K9M O;  3VF4 A;  3EE9 A;  4JKC A;  5AQT A;  3ZEU B;  1GLD G;  3F2K A;  4CZF A;  4QS7 A;  3CCQ N;  5ADX A;  1P8Z A;  2HBL A;  4XH5 A;  3ZX2 A;  5AZJ B;  3I33 A;  4K43 A;  5KPZ A;  5I9E B;  3O4W A;  2P9K B;  2ZJQ L;  3UKU B;  3CQX A;  4B1W B;  2RHK A;  3PIO L;  2BUP A;  3BUZ B;  3WEE A;  3KZB A;  1T6D A;  2VCP A;  3HTV A;  3H3O B;  2VWB A;  3MDQ A;  4BR4 A;  5JVH L;  1VQM N;  3SAF A;  4PKH A;  1SAZ A;  3EN9 A;  1VQN N;  2PFU A;  4JN4 A;  2WBN A;  5BPM A;  2F9T A;  4F9O A;  2P9N B;  4NB4 A;  3KWG A;  2KLA A;  2YI1 A;  5FPN A;  3TSP A;  3ATU A;  5HOO A;  2P9L A;  3P38 A;  1HLU A;  2AP1 A;  1NJI O;  1DKG D;  1NBW A;  3TU5 A;  4IEE A;  3ID6 A;  1IG8 A;  3FLC O;  3QFU A;  4ILJ A;  2V52 B;  4BRF A;  3CCR N;  4WFA L;  5EOY A;  1K8K B;  4CD3 A;  1N8R O;  5M1P A;  4GV9 A;  1ZBS A;  2OTL N;  2E2N A;  3MCA B;  3QIC A;  3VOV A;  2QEX N;  4WF9 L;  4CZJ A;  4MO4 A;  2FXU A;  3RSE B;  3FZH A;  4J8F A;  4FWM A;  1WUA A;  1TUU A;  5GAH P;  2IVO A;  1IJJ A;  2QXL A;  3M3Z A;  3A5N C;  4PHT X;  5C10 A;  3JS6 A;  4JKG A;  1VQ5 N;  4GV3 A;  5AQV A;  3DLL L;  1QVF M;  3CCS N;  4IOA L;  3CCJ N;  3IKM A;  3HZ6 A;  1R59 O;  3AAR A;  1BU6 O;  5ADX H;  3EO3 A;  3QFP A;  4B1V A;  2QM1 A;  4IO8 A;  2P9U B;  2NRT A;  2NRV A;  3D6R A;  3CCV N;  4CZE A;  5TKW A;  3I8B A;  2QWQ A;  5LJW A;  3H3N O;  4JKH A;  1O13 A;  2HST A;  4ISE A;  3VGK A;  4CZK A;  4BRN A;  5AFU H;  2YHY A;  5CR4 A;  1M1K O;  3VEO A;  3E1Y A;  4CI6 A;  3MWT A;  1Z05 A;  2V7Z A;  3GE1 A;  5EVZ A;  1E4F T;  4IXC A;  3SMP A;  3CC4 N;  2Q31 A;  3C7N B;  5F2R A;  3ULE A;  3HRG A;  1GLL O;  1ATS A;  2I7P A;  4BRC A;  4E1J A;  5AQQ A;  2NRH A;  4AF1 A;  4A5B A;  4YOR A;  4BRQ A;  1ESV A;  1BDG A;  5AQX A;  1LCU A;  4BC2 A;  3ENH A;  4KH4 A;  3LDL A;  3VEW A;  3CPE A;  5BR9 A;  3LM9 A;  5AQI A;  3U4L A;  1X9J A;  1BA1 A;  3ZX0 A;  4XEI A;  2YCH A;  4K41 A;  1U2V A;  2Q1N A;  3CD6 N;  3KWI A;  4GY2 B;  1VQ6 N;  2H3G X;  4JNE A;  4FVU A;  4CZM A;  4PKI A;  1HJO A;  3FZL A;  3CME N;  3CJ7 A;  3R1X A;  1C0F A;  3WEE B;  3WXI A;  4O8K A;  3WXK A;  5AQL A;  3R6M A;  1V4T A;  4CBU A;  4EAH D;  1NGI A;  3CJA A;  2P9I A;  4PL8 A;  1W2B M;  1KAZ A;  2ZF5 O;  4YOU A;  1ILY A;  1NLV A;  2ZJP L;  3Q7B A;  5AQN A;  1DT9 A;  4Y0W A;  4ILG B;  4ISF A;  3H46 O;  3QBW A;  4JKF A;  3T7Z A;  4FPA A;  5KPR A;  5M1K A;  3FE1 A;  3VTI A;  1VQ9 N;  3L4Q A;  3ZET B;  3VTH A;  2P9L B;  4BGB A;  1Z6R A;  3SMS A;  4JKA A;  2CGJ A;  4JK7 A;  3KVG A;  1LOT B;  3CCE N;  5EX5 A;  4IJN A;  5M1O A;  1HKC A;  3QDK A;  1QVG M;  3C65 A;  2P9P B;  1GLE G;  3IDH A;  4MLE A;  1MWM A;  3E66 A;  4BR7 A;  1VQP N;  3G71 N;  3B8A X;  3LDQ A;  3LM2 A;  1GLF O;  4Z94 A;  2Q97 A;  3VF6 A;  4K25 A;  2NLX A;  5AQO A;  3EZW A;  4GNI A;  3CC2 N;  1MWK A;  1XQS C;  4H0X B;  3O08 A;  3MCP A;  2ASO A;  4FWP A;  4FWO A;  3TSQ A;  4JKG B;  1Q82 O;  3J7Z O;  5EXW A;  5GIP A;  2OTJ N;  4BRM A;  1YIJ N;  1S22 A;  4H5W A;  4NLC A;  4B1Y B;  3CF5 L;  2D4W A;  3SK3 A;  3ZYY X;  3A5O C;  5AQU A;  4AM6 A;  3O8M A;  4C1N I;  2Q2R A;  3FZM A;  3AGR A;  3VPZ A;  1KAY A;  4YOW A;  4GV6 A;  4IZ9 A;  1NGA A;  1QQM A;  4XH1 A;  3ENB A;  4WQ4 C;  4H0V B;  1NGG A;  1JJ2 M;  4IDH A;  3I55 N;  2CGL A;  3SAG A;  4BRI A;  3CCU N;  3QB0 A;  3CCL N;  2Q0U A;  3TTF A;  3HOS A;  1YJW N;  3GOI A;  1HUX A;  5MLC Q;  1DGK N;  5B8H A;  4A2A A;  3U9Z A;  2HF4 A;  3ULE B;  1YJ9 N;  4YOX A;  1VQ7 N;  3D2F A;  2BH1 A;  1HKB A;  3IFR A;  1NGC A;  5JMV A;  2QWO A;  3E9L A;  4MDB A;  3ZET A;  4PL7 A;  3VEZ A;  3FZK A;  2I7N A;  4BVP A;  4OO1 J;  3DJC A;  2IVP A;  3I56 N;  2VGM A;  2P9P A;  1V4S A;  4C1N K;  1KD1 O;  1DEJ A;  1U2V B;  2CGK A;  5LJV A;  2A6A A;  4CZG A;  2P9S A;  3JXU A;  3WQU A;  2WFB A;  4H0Y B;  3VEN A;  4BY9 C;  3AGK A;  4H5N A;  1HX1 A;  4BQL A;  5AQP A;  4WCE L;  3CHW A;  3J8A A;  5AQF A;  4FOE A;  1GLC G;  3O9S A;  2QWP A;  4FOI A;  1M90 O;  2P9I B;  3KK7 A;  4QS8 A;  4DQ8 A;  1YHQ N;  1H1V A;  3PLA A;  4FWR A;  3U9D A;  3HBT A;  4HTL A;  4WYB A;  1S72 N;  4A57 A;  3CI5 A;  1Q18 A;  5BPL A;  3L0Q A;  4MO5 A;  1NGH A;  3T69 A;  2VYP A;  4JEP A;  3H1Q A;  5ELZ A;  3QBX A;  5AR0 A;  4A62 A;  5C0Y A;  2FSN A;  3CET A;  5GAD P;  3R9P A;  2QWR A;  2RE2 A;  5F1X A;  4DKW A;  3CQY A;  4EHU A;  2E1Y A;  1BWF O;  3VF2 A;  3WXL A;  2UYT A;  3A5M C;  4GVE A;  3WT0 A;  2NRW A;  3LDO A;  4BVO A;  1KC8 O;  2CH6 A;  4IOC L;  5M1Q A;  3O9Q A;  5AQS A;  2E20 A;  2PAV A;  1KQS M;  5TKY A;  3H45 C;  4WQ5 C;  2GEL A;  5JIC A;  3E9P A;  5C2D A;  1Q86 O;  1NGF A;  1S3X A;  5AQK A;  4FWN A;  3CJ9 A;  3W3D A;  5HL7 L;  1NMD A;  4RCH A;  5DM6 L;  1KXP A;  4JKE A;  5AQG A;  1OKJ A;  5AQH A;  3SLC A;  3C0B A;  3W0L A;  5KQD A;  1JCE A;  4FL9 A;  3AAP A;  5BRF A;  4A59 A;  5C2F A;  1YUW A;  3ATV A;  4CJ7 A;  2HF3 A;  3M5R A;  2YJF A;  2ZGY A;  4M7X A;  5M1F A;  3VMF B;  4EFH A;  5FPM A;  2KKZ A;  5FPE A;  1OVY A;  3TTC A;  4RTF D;  4FWS A;  4M7Y A;  2F7T A;  5AQR A;  4IOX A;  4BR9 A;  1YIT N;  3HM8 A;  1QQO A;  4H0P A;  5AZI A;  5LY3 A;  4CZL A;  1T44 A;  5GAE P;  5GIN A;  4H03 B;  3P31 A;  1QQN A;  2D1K A;  3D2F B;  1XC3 A;  4FWQ A;  4BRD A;  4FWK A;  3SJH A;  1NM1 A;  5CE3 A;  2A41 A;  3NVM A;  2PBD A;  1EQY A;  3H1V X;  1T3V A;  4ILH A;  4MLH A;  2E2O A;  3CXC M;  3UKR A;  1U6Z A;  2GWK A;  4I6M A;  3WXM B;  3SBG A;  3O9T A;  1GLB G;  4H0O A;  4NO7 A;  5AQJ A;  4JAX A;  3P39 A;  1BOT O;  1RDW X;  5BN8 A;  4JHD A;  2WUS A;  4H5T A;  5AQZ A;  2GUP A;  3F9M A;  1Y64 A;  4BRL A;  3GDQ A;  1W97 L;  4RWT A;  5DM7 L;  2P9S B;  3MN9 A;  1E4G T;  5F0X A;  1ATR A;  2HBK A;  3OBW A;  4M63 C;  2QWM A;  5KPT A;  3IUC A;  2WC9 A;  1K8A O;  3UB5 A;  1VAZ A;  3G4S N;  3EKU A;  4YDU C;  2QWN A;  3MX5 A;  1BO5 O;  1YXQ A;  1JCG A;  4BC4 A;  4O5F A;  2ZWH A;  4MDA A;  3OA9 A;  3VET A;  1SQK A;  5C12 A;  3NMU A;  2NNW A;  2E88 A;  3MN6 A;  3DXM A;  1QHA A;  3L6Q A;  4BQZ A;  4KH5 A;  2V51 B;  3DAW A;  5GIO A;  2NZT A;  3O6W A;  3N4Q A;  4A2B A;  3EE8 A;  4A61 A;  5CHI A;  2QA4 N;  4JKD A;  3K9K A;  1HPM A;  3A0I X;  1TUY A;  2E8A A;  2VGN A;  1NGD A;  3CJB A;  2ASM A;  4WQ4 A;  3Q7C A;  4BRO A;  4JD2 A;  4YOV A;  2W41 A;  3O1W A;  1QZ5 A;  5JLH A;  4FSV A;  4K42 A;  3MMV A;  3GL1 A;  3S41 A;  3L4I A;  2ITM A;  2CH5 A;  3GBT A;  4B1U B;  1GLJ O;  3FR0 A;  1QZ6 A;  4JKB A;  3VEV A;  5BN9 A;  1RDU A;  2Q0R A;  4BR5 A;  1G99 A;  4BC3 A;  3DXK A;  2GEM A;  3KHY A;  3HSC A;  3FZF A;  2YHX A;  3K9J A;  4CD1 A;  3CER A;  2BTF A;  1NWK A;  2W40 A;  1TYQ A;  4EIA A;  4U67 L;  1MDU B;  4JK8 A;  1MA9 B;  2A42 A;  1X3M A;  4CZI A;  5AFU A;  3VGL A;  4IJA A;  1Q7Y O;  4BR2 A;  2KHO A;  3D2E A;  4NLB A;  3G25 A;  4DB3 A;  4BC5 A;  4IFE A;  3EL2 A;  2A40 A;  1NGE A;  4AM7 A;  3D7E O;  3LL3 A;  4OPA A;  3RVC A;  2IIR A;  3CJC A;  5AZI B;  3PIP L;  4U7B A;  4IO9 L;  1JCF A;  1NGB A;  5C15 A;  2F9W A;  1P90 A;  1VQL N;  3IMX A;  2ASP A;  2E2P A;  1BUP A;  4H0T B;  2NRR A;  3QML A;  3VEX A;  3ID8 A;  3VEY A;  4B1Z A;  4CBX A;  1VQ4 N;  3DWL A;  3CC7 N;  4ISG A;  3OBY A;  2JWK A;  2QI2 A;  3SBT A;  4C23 A;  2OAN A;  5BRH A;  3UKR B;  4I6M B;  1VQ8 N;  5E84 A;  1CZA N;  3A8Y A;  3CCM N;  2QWL A;  4PKG A;  4B9Q A;  4WFB L;  4JK9 A;  1BA0 A;  4JHD B;  1ZC6 A;  4LC9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...