4BCND

Structure of cdk2 in complex with cyclin a and a 2-amino-4-heteroaryl- pyrimidine inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
255
structure length
255
Chain Sequence
b'DYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLLDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 2
publication title Comparative Structural and Functional Studies of 4-(Thiazol- 5-Yl)-2-(Phenylamino)Pyrimidine-5-Carbonitrile Cdk9 Inhibitors Suggest the Basis for Isotype Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle
total genus 99
structure length 255
sequence length 255
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00134 Cyclin_N Cyclin, N-terminal domain
D PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4bcnD01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4bcnD02
1H1QB 5IDPB 2C5OB 1PKDB 3QHRB 3BHTB 4CFNB 1VINA 1G3NC 4BCOB 4FX3B 4F7SB 3TN8B 5IDNB 2EUFA 4BCKB 1FVVB 1GH6B 2CJMB 3TNWB 3F5XB 5LMKB 2IW9B 1H24B 3MI9B 1O9KB 1H28B 1OIYB 4Y72B 4EOMB 4II5B 1VOLA 3TNIB 3POMA 3BLHB 2BPMB 5HVYB 4CXAB 1E9HB 4EOIB 5BNJB 4YOOA 5CYIB 2PK9B 4ELLA 4I3ZB 2IVXA 2I53A 3EJ1B 4YC3B 4RODA 1P5EB 2CCIB 2C5NB 4F7NB 2C6TB 1C9BA 4OR5B 1FINB 1JSTB 4EC9B 1URCB 1H27B 3MIAB 5L2WB 4F6UB 5IF1B 2JGZB 2F2CA 2PK2A 4EOLB 4CFUB 1OI9B 2UZLB 1XO2A 4BCPB 4EOKB 2PHGA 3MY5B 1OIUB 3DOGB 1D3UB 2W2HA 3EOCB 4EOJB 4F6WB 5CEIB 2UZEB 3EIDB 3RGFB 4BCND 5ICPB 5HNBB 4F7JB 4UN0A 1QMZB 2WEVB 5I5ZB 2C5VB 4BCMB 1H1SB 4OGRB 1AD6A 3M03A 4KRDB 5FGKB 4G6LB 4BCIB 3H4CA 1JKWA 1UNGD 4BCFB 1OL1B 3BHUB 5EFQB 5LQFB 1W98B 4F7LB 2W99A 4KRCB 3DDPB 4EOQB 2C5XB 2UUEB 2WFYB 3DDQB 2UZBB 5HBHB 1OL2B 2PMIB 4IMYB 1AISB 1GY3B 4BCGB 2W96A 3MY1B 1JSUB 4TTHA 3BLRB 1KXUA 3TNHB 4YOSA 4BCJB 4EORB 1JOWA 4CFXB 2WMBB 4EC8B 1OKWB 1UNHD 2R7GA 4CFVB 1GUXA 1ZP2A 2W9ZA 4ROCA 4YOZA 2UZDB 1H25B 5HBEB 2BKZB 2C4GB 2WHBB 4BCQB 2B9RA 2W9FA 1OGUB 4BCHB 4CRLB 4EOSB 2G9XB 4BCMD 2I40B 4EOOB 4ROEA 4F6SB 4EOPB 2CCHB 4NSTB 3BHVB 1H1RB 4F70B 1H26B 1F5QB 1O9KA 4CFWB 1H4LD 4CFUD 4ELJA 3BLQB 3K7AM 1VYWB 5HBJB 1BU2A 3LQ5B 2WMAB 2WIPB 1H1PB 2WXVB 2IW6B 2WIHB 1N4MA 4EONB 2WPAB 3O0GD 2V22B 5HQ0B 4BCNB 5ACBA 1TFBA 1OKVB 2QDJA 4BCQD 3QHWB 4CFMB 2X1NB 1GUXB 3G33B 1UNLD 2IW8B
chains in the Genus database with same CATH superfamily
1PKDB 3BHTB 2DD5B 4OB2B 4FX3B 3A8GB 1FVVB 1GH6B 4HL4A 2D0QB 2DMEA 2IW9B 1H24B 1O9KB 3X20B 1E9HB 3QYHB 4YC3B 1P5EB 2CCIB 4ZGDB 4OB0B 1ENWA 1URCB 2UZLB 1XO2A 4BCPB 3MY5B 4MFEA 1TD6A 5HNBB 2C5VB 1AD6A 4KRDB 5DQVA 4G6LB 3H4CA 4BCFB 2ZPEB 1UGSB 3QXEB 3VKHA 2UUEB 3B57A 1JSUB 4TTHA 3BLRB 4EORB 4YOSA 3TNHB 2ZCFB 4CFXB 1UNHD 1ZP2A 4ROCA 2UZDB 4ZGEB 2G9XB 2QGSA 3QZ9B 3PO3S 4F6SB 2CCHB 4FM4B 4CFUD 3BLQB 5HBJB 1BU2A 3LQ5B 2QF7A 2WIHB 4M6VA 2WPAB 5HQ0B 1TFBA 4CFMB 2G77A 2QDJA 3QHWB 2IN3A 1UNLD 1H1QB 2C5OB 2DXBB 1G3NC 5IDNB 3TW7A 2EUFA 3F5XB 4LOCA 4Y72B 1E7PA 5CYIB 4ELLA 4I3ZB 2IVXA 2I53A 3EJ1B 2ZPBB 4EC9B 3MIAB 4AKHA 5IF1B 2JGZB 2ZPIB 2PK2A 2CZ0B 2PHGA 4EOJB 4F6WB 5CEIB 2UZEB 3EIDB 3A8LB 2CZ7B 4UN0A 2WEVB 4BCMB 2ZZDB 4OGRB 2CZ1B 5FGKB 4JX5A 1OL1B 5LQFB 1W98B 3DDPB 2PJQA 3X26B 2WFYB 4AI6A 5HBHB 1OL2B 4IMYB 3MY1B 2KMGA 4BCJB 1QLBA 2WMBB 4EC8B 1OKWB 1GUXA 4YOZA 1H25B 2C4GB 4CRLB 2B9RA 4BCHB 4BCMD 4ROEA 4EOPB 3BHVB 4F70B 2CYZB 3BG3A 1UGRB 2WIPB 2WJ9A 2WXVB 2IW6B 2BS2A 1N4MA 4EONB 4QSHA 4BCNB 3DTOA 1UGQB 1GUXB 5IDPB 3A8MB 2QQ8A 2CZ6B 4F7SB 4JX4A 4BCKB 2CJMB 3TNWB 5LMKB 4EOMB 3TNIB 3VYGB 3BLHB 2LW4A 5HVYB 4CXAB 4HNVA 2PK9B 2ZPFB 4RODA 5DQWA 3HHTB 4OR5B 1H27B 5L2WB 4F6UB 2F2CA 2DXCB 2QDYB 3X28B 1V29B 2ZPGB 3EOCB 4BY7X 3RGFB 4OB1B 3QWLA 4ZGJB 3KHIA 4OB3B 1FKMA 5EJCA 2DPPB 3BHUB 5EFQB 4KRCB 4EOQB 2C5XB 3DDQB 4JX6A 1AISB 1GY3B 4CFVB 2R7GA 2W9ZA 2WHBB 3VYHB 4BCQB 4EOSB 1OGUB 4Z6YA 3BG5A 4NSTB 1H1RB 4HNTA 4BY1X 1H26B 1F5QB 4ELJA 3K7AM 2WMAB 1H1PB 3HB9A 3TW6A 3HZJA 4BCQD 3X25B 2QFZA 4F7LB 3DJBA 3X24B 3QHRB 4CFNB 1VINA 4BCOB 3TN8B 3HO8A 1IREB 3MI9B 1H28B 1OIYB 4II5B 2AHJB 1VOLA 3POMA 4AKGA 2DD4B 2BPMB 5BNJB 4EOIB 3WVDB 4YOOA 2C5NB 3A8HB 4F7NB 3BG9A 2C6TB 1C9BA 3A8OB 1FINB 1JSTB 4HNUA 4EOLB 4CFUB 1OI9B 4BBRM 1AHJB 4EOKB 4HLQA 2BS3A 1OIUB 3DOGB 1D3UB 2W2HA 4BCND 5ICPB 4F7JB 1QMZB 5IHYA 5I5ZB 3GTMS 1H1SB 2ZPHB 3M03A 3QYEA 4BCIB 1JKWA 1UNGD 2W99A 4NC6A 1UGPB 3WVEB 2BS4A 4MIMA 2UZBB 2PMIB 4MFDA 4BCGB 2W96A 1KXUA 1JOWA 3QZ5B 5HBEB 2BKZB 2KR6A 2W9FA 3QYBA 4EOOB 2I40B 3QYGB 3NDQA 4AKIA 4BBSM 1O9KA 4CFWB 1H4LD 1VYWB 3O0GD 4BXXX 2V22B 3DL1A 5ACBA 3HBLA 3VKGA 1OKVB 2X1NB 3G33B 2IW8B
chains in the Genus database with same CATH topology
1H1QB 5IDPB 2C5OB 1PKDB 3QHRB 3BHTB 4CFNB 1VINA 1G3NC 4BCOB 4FX3B 4F7SB 3TN8B 5IDNB 2EUFA 4BCKB 1FVVB 1GH6B 2CJMB 3TNWB 3F5XB 5LMKB 2IW9B 1H24B 3MI9B 1O9KB 1H28B 1OIYB 4Y72B 4EOMB 4II5B 1VOLA 3TNIB 3POMA 3BLHB 2BPMB 5HVYB 4CXAB 1E9HB 4EOIB 5BNJB 4YOOA 5CYIB 2PK9B 4ELLA 4I3ZB 2IVXA 2I53A 3EJ1B 4YC3B 4RODA 1P5EB 2CCIB 2C5NB 4F7NB 2C6TB 1C9BA 4OR5B 1FINB 1JSTB 4EC9B 1URCB 1H27B 3MIAB 5L2WB 4F6UB 5IF1B 2JGZB 2F2CA 2PK2A 4EOLB 4CFUB 1OI9B 2UZLB 1XO2A 4BCPB 4EOKB 2PHGA 3MY5B 1OIUB 3DOGB 1D3UB 2W2HA 3EOCB 4EOJB 4F6WB 5CEIB 2UZEB 3EIDB 3RGFB 4BCND 5ICPB 5HNBB 4F7JB 4UN0A 1QMZB 2WEVB 5I5ZB 2C5VB 4BCMB 1H1SB 4OGRB 1AD6A 3M03A 4KRDB 5FGKB 4G6LB 4BCIB 3H4CA 1JKWA 1UNGD 4BCFB 1OL1B 3BHUB 5EFQB 5LQFB 1W98B 4F7LB 2W99A 4KRCB 3DDPB 4EOQB 2C5XB 2UUEB 2WFYB 3DDQB 2UZBB 5HBHB 1OL2B 2PMIB 4IMYB 1AISB 1GY3B 4BCGB 2W96A 3MY1B 1JSUB 4TTHA 3BLRB 1KXUA 3TNHB 4YOSA 4BCJB 4EORB 1JOWA 4CFXB 2WMBB 4EC8B 1OKWB 1UNHD 2R7GA 4CFVB 1GUXA 1ZP2A 2W9ZA 4ROCA 4YOZA 2UZDB 1H25B 5HBEB 2BKZB 2C4GB 2WHBB 4BCQB 2B9RA 2W9FA 1OGUB 4BCHB 4CRLB 4EOSB 2G9XB 4BCMD 2I40B 4EOOB 4ROEA 4F6SB 4EOPB 2CCHB 4NSTB 3BHVB 1H1RB 4F70B 1H26B 1F5QB 1O9KA 4CFWB 1H4LD 4CFUD 4ELJA 3BLQB 3K7AM 1VYWB 5HBJB 1BU2A 3LQ5B 2WMAB 2WIPB 1H1PB 2WXVB 2IW6B 2WIHB 1N4MA 4EONB 2WPAB 3O0GD 2V22B 5HQ0B 4BCNB 5ACBA 1TFBA 1OKVB 2QDJA 4BCQD 3QHWB 4CFMB 2X1NB 1GUXB 3G33B 1UNLD 2IW8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H1Q B;  5IDP B;  2C5O B;  1PKD B;  3QHR B;  3BHT B;  4CFN B;  1VIN A;  1G3N C;  4BCO B;  4FX3 B;  4F7S B;  3TN8 B;  5IDN B;  2EUF A;  4BCK B;  1FVV B;  1GH6 B;  2CJM B;  3TNW B;  3F5X B;  5LMK B;  2IW9 B;  1H24 B;  3MI9 B;  1O9K B;  1H28 B;  1OIY B;  4Y72 B;  4EOM B;  4II5 B;  1VOL A;  3TNI B;  3POM A;  3BLH B;  2BPM B;  5HVY B;  4CXA B;  1E9H B;  4EOI B;  5BNJ B;  4YOO A;  5CYI B;  2PK9 B;  4ELL A;  4I3Z B;  2IVX A;  2I53 A;  3EJ1 B;  4YC3 B;  4ROD A;  1P5E B;  2CCI B;  2C5N B;  4F7N B;  2C6T B;  1C9B A;  4OR5 B;  1FIN B;  1JST B;  4EC9 B;  1URC B;  1H27 B;  3MIA B;  5L2W B;  4F6U B;  5IF1 B;  2JGZ B;  2F2C A;  2PK2 A;  4EOL B;  4CFU B;  1OI9 B;  2UZL B;  1XO2 A;  4BCP B;  4EOK B;  2PHG A;  3MY5 B;  1OIU B;  3DOG B;  1D3U B;  2W2H A;  3EOC B;  4EOJ B;  4F6W B;  5CEI B;  2UZE B;  3EID B;  3RGF B;  4BCN D;  5ICP B;  5HNB B;  4F7J B;  4UN0 A;  1QMZ B;  2WEV B;  5I5Z B;  2C5V B;  4BCM B;  1H1S B;  4OGR B;  1AD6 A;  3M03 A;  4KRD B;  5FGK B;  4G6L B;  4BCI B;  3H4C A;  1JKW A;  1UNG D;  4BCF B;  1OL1 B;  3BHU B;  5EFQ B;  5LQF B;  1W98 B;  4F7L B;  2W99 A;  4KRC B;  3DDP B;  4EOQ B;  2C5X B;  2UUE B;  2WFY B;  3DDQ B;  2UZB B;  5HBH B;  1OL2 B;  2PMI B;  4IMY B;  1AIS B;  1GY3 B;  4BCG B;  2W96 A;  3MY1 B;  1JSU B;  4TTH A;  3BLR B;  1KXU A;  3TNH B;  4YOS A;  4BCJ B;  4EOR B;  1JOW A;  4CFX B;  2WMB B;  4EC8 B;  1OKW B;  1UNH D;  2R7G A;  4CFV B;  1GUX A;  1ZP2 A;  2W9Z A;  4ROC A;  4YOZ A;  2UZD B;  1H25 B;  5HBE B;  2BKZ B;  2C4G B;  2WHB B;  4BCQ B;  2B9R A;  2W9F A;  1OGU B;  4BCH B;  4CRL B;  4EOS B;  2G9X B;  4BCM D;  2I40 B;  4EOO B;  4ROE A;  4F6S B;  4EOP B;  2CCH B;  4NST B;  3BHV B;  1H1R B;  4F70 B;  1H26 B;  1F5Q B;  1O9K A;  4CFW B;  1H4L D;  4CFU D;  4ELJ A;  3BLQ B;  3K7A M;  1VYW B;  5HBJ B;  1BU2 A;  3LQ5 B;  2WMA B;  2WIP B;  1H1P B;  2WXV B;  2IW6 B;  2WIH B;  1N4M A;  4EON B;  2WPA B;  3O0G D;  2V22 B;  5HQ0 B;  4BCN B;  5ACB A;  1TFB A;  1OKV B;  2QDJ A;  4BCQ D;  3QHW B;  4CFM B;  2X1N B;  1GUX B;  3G33 B;  1UNL D;  2IW8 B; 
#chains in the Genus database with same CATH topology
 1PKD B;  3BHT B;  2DD5 B;  4OB2 B;  4FX3 B;  3A8G B;  1FVV B;  1GH6 B;  4HL4 A;  2D0Q B;  2DME A;  2IW9 B;  1H24 B;  1O9K B;  3X20 B;  1E9H B;  3QYH B;  4YC3 B;  1P5E B;  2CCI B;  4ZGD B;  4OB0 B;  1ENW A;  1URC B;  2UZL B;  1XO2 A;  4BCP B;  3MY5 B;  4MFE A;  1TD6 A;  5HNB B;  2C5V B;  1AD6 A;  4KRD B;  5DQV A;  4G6L B;  3H4C A;  4BCF B;  2ZPE B;  1UGS B;  3QXE B;  3VKH A;  2UUE B;  3B57 A;  1JSU B;  4TTH A;  3BLR B;  4EOR B;  4YOS A;  3TNH B;  2ZCF B;  4CFX B;  1UNH D;  1ZP2 A;  4ROC A;  2UZD B;  4ZGE B;  2G9X B;  2QGS A;  3QZ9 B;  3PO3 S;  4F6S B;  2CCH B;  4FM4 B;  4CFU D;  3BLQ B;  5HBJ B;  1BU2 A;  3LQ5 B;  2QF7 A;  2WIH B;  4M6V A;  2WPA B;  5HQ0 B;  1TFB A;  4CFM B;  2G77 A;  2QDJ A;  3QHW B;  2IN3 A;  1UNL D;  1H1Q B;  2C5O B;  2DXB B;  1G3N C;  5IDN B;  3TW7 A;  2EUF A;  3F5X B;  4LOC A;  4Y72 B;  1E7P A;  5CYI B;  4ELL A;  4I3Z B;  2IVX A;  2I53 A;  3EJ1 B;  2ZPB B;  4EC9 B;  3MIA B;  4AKH A;  5IF1 B;  2JGZ B;  2ZPI B;  2PK2 A;  2CZ0 B;  2PHG A;  4EOJ B;  4F6W B;  5CEI B;  2UZE B;  3EID B;  3A8L B;  2CZ7 B;  4UN0 A;  2WEV B;  4BCM B;  2ZZD B;  4OGR B;  2CZ1 B;  5FGK B;  4JX5 A;  1OL1 B;  5LQF B;  1W98 B;  3DDP B;  2PJQ A;  3X26 B;  2WFY B;  4AI6 A;  5HBH B;  1OL2 B;  4IMY B;  3MY1 B;  2KMG A;  4BCJ B;  1QLB A;  2WMB B;  4EC8 B;  1OKW B;  1GUX A;  4YOZ A;  1H25 B;  2C4G B;  4CRL B;  2B9R A;  4BCH B;  4BCM D;  4ROE A;  4EOP B;  3BHV B;  4F70 B;  2CYZ B;  3BG3 A;  1UGR B;  2WIP B;  2WJ9 A;  2WXV B;  2IW6 B;  2BS2 A;  1N4M A;  4EON B;  4QSH A;  4BCN B;  3DTO A;  1UGQ B;  1GUX B;  5IDP B;  3A8M B;  2QQ8 A;  2CZ6 B;  4F7S B;  4JX4 A;  4BCK B;  2CJM B;  3TNW B;  5LMK B;  4EOM B;  3TNI B;  3VYG B;  3BLH B;  2LW4 A;  5HVY B;  4CXA B;  4HNV A;  2PK9 B;  2ZPF B;  4ROD A;  5DQW A;  3HHT B;  4OR5 B;  1H27 B;  5L2W B;  4F6U B;  2F2C A;  2DXC B;  2QDY B;  3X28 B;  1V29 B;  2ZPG B;  3EOC B;  4BY7 X;  3RGF B;  4OB1 B;  3QWL A;  4ZGJ B;  3KHI A;  4OB3 B;  1FKM A;  5EJC A;  2DPP B;  3BHU B;  5EFQ B;  4KRC B;  4EOQ B;  2C5X B;  3DDQ B;  4JX6 A;  1AIS B;  1GY3 B;  4CFV B;  2R7G A;  2W9Z A;  2WHB B;  3VYH B;  4BCQ B;  4EOS B;  1OGU B;  4Z6Y A;  3BG5 A;  4NST B;  1H1R B;  4HNT A;  4BY1 X;  1H26 B;  1F5Q B;  4ELJ A;  3K7A M;  2WMA B;  1H1P B;  3HB9 A;  3TW6 A;  3HZJ A;  4BCQ D;  3X25 B;  2QFZ A;  4F7L B;  3DJB A;  3X24 B;  3QHR B;  4CFN B;  1VIN A;  4BCO B;  3TN8 B;  3HO8 A;  1IRE B;  3MI9 B;  1H28 B;  1OIY B;  4II5 B;  2AHJ B;  1VOL A;  3POM A;  4AKG A;  2DD4 B;  2BPM B;  5BNJ B;  4EOI B;  3WVD B;  4YOO A;  2C5N B;  3A8H B;  4F7N B;  3BG9 A;  2C6T B;  1C9B A;  3A8O B;  1FIN B;  1JST B;  4HNU A;  4EOL B;  4CFU B;  1OI9 B;  4BBR M;  1AHJ B;  4EOK B;  4HLQ A;  2BS3 A;  1OIU B;  3DOG B;  1D3U B;  2W2H A;  4BCN D;  5ICP B;  4F7J B;  1QMZ B;  5IHY A;  5I5Z B;  3GTM S;  1H1S B;  2ZPH B;  3M03 A;  3QYE A;  4BCI B;  1JKW A;  1UNG D;  2W99 A;  4NC6 A;  1UGP B;  3WVE B;  2BS4 A;  4MIM A;  2UZB B;  2PMI B;  4MFD A;  4BCG B;  2W96 A;  1KXU A;  1JOW A;  3QZ5 B;  5HBE B;  2BKZ B;  2KR6 A;  2W9F A;  3QYB A;  4EOO B;  2I40 B;  3QYG B;  3NDQ A;  4AKI A;  4BBS M;  1O9K A;  4CFW B;  1H4L D;  1VYW B;  3O0G D;  4BXX X;  2V22 B;  3DL1 A;  5ACB A;  3HBL A;  3VKG A;  1OKV B;  2X1N B;  3G33 B;  2IW8 B; 
#chains in the Genus database with same CATH homology
 1H1Q B;  5IDP B;  2C5O B;  1PKD B;  3QHR B;  3BHT B;  4CFN B;  1VIN A;  1G3N C;  4BCO B;  4FX3 B;  4F7S B;  3TN8 B;  5IDN B;  2EUF A;  4BCK B;  1FVV B;  1GH6 B;  2CJM B;  3TNW B;  3F5X B;  5LMK B;  2IW9 B;  1H24 B;  3MI9 B;  1O9K B;  1H28 B;  1OIY B;  4Y72 B;  4EOM B;  4II5 B;  1VOL A;  3TNI B;  3POM A;  3BLH B;  2BPM B;  5HVY B;  4CXA B;  1E9H B;  4EOI B;  5BNJ B;  4YOO A;  5CYI B;  2PK9 B;  4ELL A;  4I3Z B;  2IVX A;  2I53 A;  3EJ1 B;  4YC3 B;  4ROD A;  1P5E B;  2CCI B;  2C5N B;  4F7N B;  2C6T B;  1C9B A;  4OR5 B;  1FIN B;  1JST B;  4EC9 B;  1URC B;  1H27 B;  3MIA B;  5L2W B;  4F6U B;  5IF1 B;  2JGZ B;  2F2C A;  2PK2 A;  4EOL B;  4CFU B;  1OI9 B;  2UZL B;  1XO2 A;  4BCP B;  4EOK B;  2PHG A;  3MY5 B;  1OIU B;  3DOG B;  1D3U B;  2W2H A;  3EOC B;  4EOJ B;  4F6W B;  5CEI B;  2UZE B;  3EID B;  3RGF B;  4BCN D;  5ICP B;  5HNB B;  4F7J B;  4UN0 A;  1QMZ B;  2WEV B;  5I5Z B;  2C5V B;  4BCM B;  1H1S B;  4OGR B;  1AD6 A;  3M03 A;  4KRD B;  5FGK B;  4G6L B;  4BCI B;  3H4C A;  1JKW A;  1UNG D;  4BCF B;  1OL1 B;  3BHU B;  5EFQ B;  5LQF B;  1W98 B;  4F7L B;  2W99 A;  4KRC B;  3DDP B;  4EOQ B;  2C5X B;  2UUE B;  2WFY B;  3DDQ B;  2UZB B;  5HBH B;  1OL2 B;  2PMI B;  4IMY B;  1AIS B;  1GY3 B;  4BCG B;  2W96 A;  3MY1 B;  1JSU B;  4TTH A;  3BLR B;  1KXU A;  3TNH B;  4YOS A;  4BCJ B;  4EOR B;  1JOW A;  4CFX B;  2WMB B;  4EC8 B;  1OKW B;  1UNH D;  2R7G A;  4CFV B;  1GUX A;  1ZP2 A;  2W9Z A;  4ROC A;  4YOZ A;  2UZD B;  1H25 B;  5HBE B;  2BKZ B;  2C4G B;  2WHB B;  4BCQ B;  2B9R A;  2W9F A;  1OGU B;  4BCH B;  4CRL B;  4EOS B;  2G9X B;  4BCM D;  2I40 B;  4EOO B;  4ROE A;  4F6S B;  4EOP B;  2CCH B;  4NST B;  3BHV B;  1H1R B;  4F70 B;  1H26 B;  1F5Q B;  1O9K A;  4CFW B;  1H4L D;  4CFU D;  4ELJ A;  3BLQ B;  3K7A M;  1VYW B;  5HBJ B;  1BU2 A;  3LQ5 B;  2WMA B;  2WIP B;  1H1P B;  2WXV B;  2IW6 B;  2WIH B;  1N4M A;  4EON B;  2WPA B;  3O0G D;  2V22 B;  5HQ0 B;  4BCN B;  5ACB A;  1TFB A;  1OKV B;  2QDJ A;  4BCQ D;  3QHW B;  4CFM B;  2X1N B;  1GUX B;  3G33 B;  1UNL D;  2IW8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...