4BCOB

Structure of cdk2 in complex with cyclin a and a 2-amino-4-heteroaryl- pyrimidine inhibitor
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
258
structure length
258
Chain Sequence
b'VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 2
publication title Comparative Structural and Functional Studies of 4-(Thiazol- 5-Yl)-2-(Phenylamino)Pyrimidine-5-Carbonitrile Cdk9 Inhibitors Suggest the Basis for Isotype Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle
total genus 98
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4bcoB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4bcoB02
4EOJB 1GUXB 5IDPB 4TTHA 4EONB 3G33B 4KRCB 4BCFB 1D3UB 4YOZA 4F70B 3H4CA 4OGRB 2CCHB 2IW8B 4EC9B 4BCHB 2CJMB 3QHRB 2C5XB 1O9KB 1JSTB 2X1NB 1QMZB 4F7LB 2R7GA 2WIPB 5EFQB 4CFXB 3BHUB 3MI9B 1UNLD 2PK2A 1FVVB 1KXUA 4CRLB 2BKZB 3DDQB 2JGZB 3O0GD 1AISB 4CFWB 4I3ZB 4F7NB 1W98B 2F2CA 1TFBA 2I53A 3MY5B 1UNGD 1PKDB 3DDPB 1H1QB 4YOSA 1H24B 3BLHB 2PK9B 3MIAB 2UZLB 1VYWB 4EOPB 2C4GB 4ELLA 5CYIB 2IW9B 4EOOB 2UZEB 3LQ5B 1OKWB 3POMA 2UZBB 1GH6B 2CCIB 3TNIB 4F6WB 3EIDB 1BU2A 1JSUB 5ICPB 4EOLB 3K7AM 4ELJA 3BHTB 1URCB 1OIYB 1OL2B 4EOKB 5CEIB 1VOLA 1GY3B 2WIHB 4EOSB 4FX3B 1OL1B 1P5EB 3EOCB 5BNJB 4EOQB 1VINA 1H1RB 2BPMB 2W9FA 1AD6A 4F6UB 2C6TB 4BCIB 4BCKB 1N4MA 3MY1B 4EC8B 5HBEB 4II5B 1FINB 2C5VB 4IMYB 5LQFB 4BCQD 1H25B 2WEVB 2PMIB 2IVXA 2V22B 4BCPB 2C5NB 5HBHB 2W96A 3F5XB 4CFUD 4EOIB 4ROCA 1H4LD 2WFYB 3BHVB 3TN8B 1OKVB 1JKWA 3DOGB 3TNWB 2UZDB 3RGFB 1OGUB 1OIUB 4KRDB 4BCOB 5I5ZB 1OI9B 3EJ1B 2IW6B 2W2HA 4CFVB 4F7JB 4CXAB 4EOMB 4RODA 1F5QB 1H1SB 4F6SB 4F7SB 1C9BA 2W99A 2G9XB 4BCJB 1O9KA 5L2WB 5LMKB 1H28B 2I40B 1H26B 4G6LB 3M03A 1XO2A 4YC3B 5HNBB 2W9ZA 2EUFA 4UN0A 4ROEA 2PHGA 2WMAB 4OR5B 4BCMD 3QHWB 2WPAB 2B9RA 2WHBB 4CFNB 4BCGB 4CFMB 4BCND 5HVYB 1G3NC 2C5OB 5HQ0B 1ZP2A 5IF1B 1H1PB 4NSTB 2WXVB 5FGKB 2UUEB 1GUXA 3BLRB 4Y72B 1E9HB 1JOWA 3TNHB 4BCQB 4EORB 4BCMB 1UNHD 5IDNB 1H27B 4YOOA 4CFUB 5HBJB 2QDJA 5ACBA 4BCNB 2WMBB 3BLQB
chains in the Genus database with same CATH superfamily
4TTHA 4EONB 3G33B 4JX4A 2ZPHB 3X25B 4F70B 2IW8B 1JSTB 1AHJB 4OB1B 2LW4A 2DD5B 2QDYB 4CRLB 2BKZB 3B57A 1UGRB 3QYHB 1W98B 1TFBA 2I53A 1H1QB 1H24B 3BLHB 2PK9B 5IHYA 1OKWB 2CCIB 4F6WB 3EIDB 5ICPB 3K7AM 3WVEB 1OIYB 4OB2B 4EOSB 4FX3B 3EOCB 4HNVA 2ZCFB 4F6UB 2C6TB 3HZJA 2C5VB 1H25B 2WEVB 2PMIB 2V22B 3BG3A 2QGSA 1QLBA 4M6VA 4MIMA 3GTMS 3RGFB 3A8MB 3DTOA 1F5QB 1H1SB 4F7SB 2D0QB 2DMEA 2G9XB 1O9KA 3QZ5B 1H28B 4HLQA 2EUFA 3QWLA 2PHGA 4OR5B 4AKHA 2B9RA 1IREB 4CFMB 3HBLA 3X20B 1UNHD 1V29B 5IDNB 4JX6A 1H27B 4BCNB 3DL1A 4KRCB 2DXCB 4BCFB 4YOZA 4OGRB 4QSHA 2DPPB 4F7LB 2DXBB 3A8HB 2PK2A 1KXUA 2ZZDB 3DDQB 3VKGA 1AISB 4CFWB 2WJ9A 2UZLB 4FM4B 2IW9B 3QZ9B 3NDQA 3A8LB 3POMA 1GH6B 1JSUB 4EOLB 1VOLA 4BBSM 2WIHB 1OL1B 1UGPB 1VINA 2W9FA 2KR6A 4BCKB 2PJQA 4EC8B 3VYGB 4BCPB 2C5NB 5HBHB 3F5XB 3BHVB 3TNWB 2UZDB 4KRDB 2ZPEB 1OI9B 4ZGDB 4F6SB 4HNTA 5EJCA 2W99A 3DJBA 2I40B 3VYHB 1XO2A 2W9ZA 4UN0A 2ZPIB 5DQVA 1TD6A 3QYEA 1G3NC 5HQ0B 1ZP2A 2UUEB 4Y72B 4EORB 4BCQB 4BCMB 4YOOA 2QDJA 4IMYB 3X26B 2WMBB 3BLQB 4EOJB 5IDPB 2ZPBB 4BCHB 4BY7X 2CJMB 3QHRB 2C5XB 1O9KB 2R7GA 2WIPB 5EFQB 4CFXB 3BHUB 1UNLD 3QXEB 3A8OB 2F2CA 4OB3B 3MY5B 3X24B 1UNGD 1PKDB 3QYGB 3DDPB 2C4GB 4ELLA 5CYIB 4EOOB 2UZEB 1ENWA 1BU2A 4LOCA 2CZ7B 4ELJA 3BHTB 1UGSB 4OB0B 2BPMB 4AI6A 2ZPGB 4BCIB 4BBRM 4ZGEB 1N4MA 3MY1B 1FINB 4BXXX 5LQFB 4BCQD 1E7PA 2W96A 4EOIB 4ROCA 1H4LD 2WFYB 2CYZB 2G77A 2CZ1B 1OIUB 4BCOB 3EJ1B 2IW6B 4CFVB 4Z6YA 4F7JB 4RODA 5DQWA 3KHIA 1H26B 2QF7A 3M03A 5HNBB 4ROEA 2AHJB 3QHWB 2WPAB 4CFNB 3TW7A 4BCND 5HVYB 2C5OB 1H1PB 4NSTB 5FGKB 1GUXA 1E9HB 2QFZA 1JOWA 1FKMA 4CFUB 5HBJB 2IN3A 2CZ0B 4JX5A 1GUXB 3HO8A 3BG9A 1D3UB 3H4CA 2CCHB 4EC9B 3HHTB 2X1NB 1QMZB 3WVDB 4HL4A 3MI9B 1FVVB 4MFDA 2QQ8A 3VKHA 2JGZB 3O0GD 4I3ZB 2BS4A 4F7NB 4YOSA 2CZ6B 3MIAB 1VYWB 4EOPB 4BY1X 3TW6A 3LQ5B 2UZBB 3TNIB 3HB9A 1URCB 4EOKB 1OL2B 5CEIB 1GY3B 1UGQB 2KMGA 2BS2A 1P5EB 4ZGJB 5BNJB 4EOQB 1H1RB 2ZPFB 1AD6A 4HNUA 2DD4B 5HBEB 4II5B 4MFEA 2IVXA 4CFUD 3TN8B 1OKVB 1JKWA 3DOGB 1OGUB 5I5ZB 2W2HA 4CXAB 4EOMB 1C9BA 4BCJB 3A8GB 5L2WB 5LMKB 4G6LB 4YC3B 4AKGA 2BS3A 2WMAB 4BCMD 2WHBB 3PO3S 3BG5A 4BCGB 4AKIA 5IF1B 2WXVB 3BLRB 3TNHB 4NC6A 3QYBA 3X28B 5ACBA
chains in the Genus database with same CATH topology
4EOJB 1GUXB 5IDPB 4TTHA 4EONB 3G33B 4KRCB 4BCFB 1D3UB 4YOZA 4F70B 3H4CA 4OGRB 2CCHB 2IW8B 4EC9B 4BCHB 2CJMB 3QHRB 2C5XB 1O9KB 1JSTB 2X1NB 1QMZB 4F7LB 2R7GA 2WIPB 5EFQB 4CFXB 3BHUB 3MI9B 1UNLD 2PK2A 1FVVB 1KXUA 4CRLB 2BKZB 3DDQB 2JGZB 3O0GD 1AISB 4CFWB 4I3ZB 4F7NB 1W98B 2F2CA 1TFBA 2I53A 3MY5B 1UNGD 1PKDB 3DDPB 1H1QB 4YOSA 1H24B 3BLHB 2PK9B 3MIAB 2UZLB 1VYWB 4EOPB 2C4GB 4ELLA 5CYIB 2IW9B 4EOOB 2UZEB 3LQ5B 1OKWB 3POMA 2UZBB 1GH6B 2CCIB 3TNIB 4F6WB 3EIDB 1BU2A 1JSUB 5ICPB 4EOLB 3K7AM 4ELJA 3BHTB 1URCB 1OIYB 1OL2B 4EOKB 5CEIB 1VOLA 1GY3B 2WIHB 4EOSB 4FX3B 1OL1B 1P5EB 3EOCB 5BNJB 4EOQB 1VINA 1H1RB 2BPMB 2W9FA 1AD6A 4F6UB 2C6TB 4BCIB 4BCKB 1N4MA 3MY1B 4EC8B 5HBEB 4II5B 1FINB 2C5VB 4IMYB 5LQFB 4BCQD 1H25B 2WEVB 2PMIB 2IVXA 2V22B 4BCPB 2C5NB 5HBHB 2W96A 3F5XB 4CFUD 4EOIB 4ROCA 1H4LD 2WFYB 3BHVB 3TN8B 1OKVB 1JKWA 3DOGB 3TNWB 2UZDB 3RGFB 1OGUB 1OIUB 4KRDB 4BCOB 5I5ZB 1OI9B 3EJ1B 2IW6B 2W2HA 4CFVB 4F7JB 4CXAB 4EOMB 4RODA 1F5QB 1H1SB 4F6SB 4F7SB 1C9BA 2W99A 2G9XB 4BCJB 1O9KA 5L2WB 5LMKB 1H28B 2I40B 1H26B 4G6LB 3M03A 1XO2A 4YC3B 5HNBB 2W9ZA 2EUFA 4UN0A 4ROEA 2PHGA 2WMAB 4OR5B 4BCMD 3QHWB 2WPAB 2B9RA 2WHBB 4CFNB 4BCGB 4CFMB 4BCND 5HVYB 1G3NC 2C5OB 5HQ0B 1ZP2A 5IF1B 1H1PB 4NSTB 2WXVB 5FGKB 2UUEB 1GUXA 3BLRB 4Y72B 1E9HB 1JOWA 3TNHB 4BCQB 4EORB 4BCMB 1UNHD 5IDNB 1H27B 4YOOA 4CFUB 5HBJB 2QDJA 5ACBA 4BCNB 2WMBB 3BLQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EOJ B;  1GUX B;  5IDP B;  4TTH A;  4EON B;  3G33 B;  4KRC B;  4BCF B;  1D3U B;  4YOZ A;  4F70 B;  3H4C A;  4OGR B;  2CCH B;  2IW8 B;  4EC9 B;  4BCH B;  2CJM B;  3QHR B;  2C5X B;  1O9K B;  1JST B;  2X1N B;  1QMZ B;  4F7L B;  2R7G A;  2WIP B;  5EFQ B;  4CFX B;  3BHU B;  3MI9 B;  1UNL D;  2PK2 A;  1FVV B;  1KXU A;  4CRL B;  2BKZ B;  3DDQ B;  2JGZ B;  3O0G D;  1AIS B;  4CFW B;  4I3Z B;  4F7N B;  1W98 B;  2F2C A;  1TFB A;  2I53 A;  3MY5 B;  1UNG D;  1PKD B;  3DDP B;  1H1Q B;  4YOS A;  1H24 B;  3BLH B;  2PK9 B;  3MIA B;  2UZL B;  1VYW B;  4EOP B;  2C4G B;  4ELL A;  5CYI B;  2IW9 B;  4EOO B;  2UZE B;  3LQ5 B;  1OKW B;  3POM A;  2UZB B;  1GH6 B;  2CCI B;  3TNI B;  4F6W B;  3EID B;  1BU2 A;  1JSU B;  5ICP B;  4EOL B;  3K7A M;  4ELJ A;  3BHT B;  1URC B;  1OIY B;  1OL2 B;  4EOK B;  5CEI B;  1VOL A;  1GY3 B;  2WIH B;  4EOS B;  4FX3 B;  1OL1 B;  1P5E B;  3EOC B;  5BNJ B;  4EOQ B;  1VIN A;  1H1R B;  2BPM B;  2W9F A;  1AD6 A;  4F6U B;  2C6T B;  4BCI B;  4BCK B;  1N4M A;  3MY1 B;  4EC8 B;  5HBE B;  4II5 B;  1FIN B;  2C5V B;  4IMY B;  5LQF B;  4BCQ D;  1H25 B;  2WEV B;  2PMI B;  2IVX A;  2V22 B;  4BCP B;  2C5N B;  5HBH B;  2W96 A;  3F5X B;  4CFU D;  4EOI B;  4ROC A;  1H4L D;  2WFY B;  3BHV B;  3TN8 B;  1OKV B;  1JKW A;  3DOG B;  3TNW B;  2UZD B;  3RGF B;  1OGU B;  1OIU B;  4KRD B;  4BCO B;  5I5Z B;  1OI9 B;  3EJ1 B;  2IW6 B;  2W2H A;  4CFV B;  4F7J B;  4CXA B;  4EOM B;  4ROD A;  1F5Q B;  1H1S B;  4F6S B;  4F7S B;  1C9B A;  2W99 A;  2G9X B;  4BCJ B;  1O9K A;  5L2W B;  5LMK B;  1H28 B;  2I40 B;  1H26 B;  4G6L B;  3M03 A;  1XO2 A;  4YC3 B;  5HNB B;  2W9Z A;  2EUF A;  4UN0 A;  4ROE A;  2PHG A;  2WMA B;  4OR5 B;  4BCM D;  3QHW B;  2WPA B;  2B9R A;  2WHB B;  4CFN B;  4BCG B;  4CFM B;  4BCN D;  5HVY B;  1G3N C;  2C5O B;  5HQ0 B;  1ZP2 A;  5IF1 B;  1H1P B;  4NST B;  2WXV B;  5FGK B;  2UUE B;  1GUX A;  3BLR B;  4Y72 B;  1E9H B;  1JOW A;  3TNH B;  4BCQ B;  4EOR B;  4BCM B;  1UNH D;  5IDN B;  1H27 B;  4YOO A;  4CFU B;  5HBJ B;  2QDJ A;  5ACB A;  4BCN B;  2WMB B;  3BLQ B; 
#chains in the Genus database with same CATH topology
 4TTH A;  4EON B;  3G33 B;  4JX4 A;  2ZPH B;  3X25 B;  4F70 B;  2IW8 B;  1JST B;  1AHJ B;  4OB1 B;  2LW4 A;  2DD5 B;  2QDY B;  4CRL B;  2BKZ B;  3B57 A;  1UGR B;  3QYH B;  1W98 B;  1TFB A;  2I53 A;  1H1Q B;  1H24 B;  3BLH B;  2PK9 B;  5IHY A;  1OKW B;  2CCI B;  4F6W B;  3EID B;  5ICP B;  3K7A M;  3WVE B;  1OIY B;  4OB2 B;  4EOS B;  4FX3 B;  3EOC B;  4HNV A;  2ZCF B;  4F6U B;  2C6T B;  3HZJ A;  2C5V B;  1H25 B;  2WEV B;  2PMI B;  2V22 B;  3BG3 A;  2QGS A;  1QLB A;  4M6V A;  4MIM A;  3GTM S;  3RGF B;  3A8M B;  3DTO A;  1F5Q B;  1H1S B;  4F7S B;  2D0Q B;  2DME A;  2G9X B;  1O9K A;  3QZ5 B;  1H28 B;  4HLQ A;  2EUF A;  3QWL A;  2PHG A;  4OR5 B;  4AKH A;  2B9R A;  1IRE B;  4CFM B;  3HBL A;  3X20 B;  1UNH D;  1V29 B;  5IDN B;  4JX6 A;  1H27 B;  4BCN B;  3DL1 A;  4KRC B;  2DXC B;  4BCF B;  4YOZ A;  4OGR B;  4QSH A;  2DPP B;  4F7L B;  2DXB B;  3A8H B;  2PK2 A;  1KXU A;  2ZZD B;  3DDQ B;  3VKG A;  1AIS B;  4CFW B;  2WJ9 A;  2UZL B;  4FM4 B;  2IW9 B;  3QZ9 B;  3NDQ A;  3A8L B;  3POM A;  1GH6 B;  1JSU B;  4EOL B;  1VOL A;  4BBS M;  2WIH B;  1OL1 B;  1UGP B;  1VIN A;  2W9F A;  2KR6 A;  4BCK B;  2PJQ A;  4EC8 B;  3VYG B;  4BCP B;  2C5N B;  5HBH B;  3F5X B;  3BHV B;  3TNW B;  2UZD B;  4KRD B;  2ZPE B;  1OI9 B;  4ZGD B;  4F6S B;  4HNT A;  5EJC A;  2W99 A;  3DJB A;  2I40 B;  3VYH B;  1XO2 A;  2W9Z A;  4UN0 A;  2ZPI B;  5DQV A;  1TD6 A;  3QYE A;  1G3N C;  5HQ0 B;  1ZP2 A;  2UUE B;  4Y72 B;  4EOR B;  4BCQ B;  4BCM B;  4YOO A;  2QDJ A;  4IMY B;  3X26 B;  2WMB B;  3BLQ B;  4EOJ B;  5IDP B;  2ZPB B;  4BCH B;  4BY7 X;  2CJM B;  3QHR B;  2C5X B;  1O9K B;  2R7G A;  2WIP B;  5EFQ B;  4CFX B;  3BHU B;  1UNL D;  3QXE B;  3A8O B;  2F2C A;  4OB3 B;  3MY5 B;  3X24 B;  1UNG D;  1PKD B;  3QYG B;  3DDP B;  2C4G B;  4ELL A;  5CYI B;  4EOO B;  2UZE B;  1ENW A;  1BU2 A;  4LOC A;  2CZ7 B;  4ELJ A;  3BHT B;  1UGS B;  4OB0 B;  2BPM B;  4AI6 A;  2ZPG B;  4BCI B;  4BBR M;  4ZGE B;  1N4M A;  3MY1 B;  1FIN B;  4BXX X;  5LQF B;  4BCQ D;  1E7P A;  2W96 A;  4EOI B;  4ROC A;  1H4L D;  2WFY B;  2CYZ B;  2G77 A;  2CZ1 B;  1OIU B;  4BCO B;  3EJ1 B;  2IW6 B;  4CFV B;  4Z6Y A;  4F7J B;  4ROD A;  5DQW A;  3KHI A;  1H26 B;  2QF7 A;  3M03 A;  5HNB B;  4ROE A;  2AHJ B;  3QHW B;  2WPA B;  4CFN B;  3TW7 A;  4BCN D;  5HVY B;  2C5O B;  1H1P B;  4NST B;  5FGK B;  1GUX A;  1E9H B;  2QFZ A;  1JOW A;  1FKM A;  4CFU B;  5HBJ B;  2IN3 A;  2CZ0 B;  4JX5 A;  1GUX B;  3HO8 A;  3BG9 A;  1D3U B;  3H4C A;  2CCH B;  4EC9 B;  3HHT B;  2X1N B;  1QMZ B;  3WVD B;  4HL4 A;  3MI9 B;  1FVV B;  4MFD A;  2QQ8 A;  3VKH A;  2JGZ B;  3O0G D;  4I3Z B;  2BS4 A;  4F7N B;  4YOS A;  2CZ6 B;  3MIA B;  1VYW B;  4EOP B;  4BY1 X;  3TW6 A;  3LQ5 B;  2UZB B;  3TNI B;  3HB9 A;  1URC B;  4EOK B;  1OL2 B;  5CEI B;  1GY3 B;  1UGQ B;  2KMG A;  2BS2 A;  1P5E B;  4ZGJ B;  5BNJ B;  4EOQ B;  1H1R B;  2ZPF B;  1AD6 A;  4HNU A;  2DD4 B;  5HBE B;  4II5 B;  4MFE A;  2IVX A;  4CFU D;  3TN8 B;  1OKV B;  1JKW A;  3DOG B;  1OGU B;  5I5Z B;  2W2H A;  4CXA B;  4EOM B;  1C9B A;  4BCJ B;  3A8G B;  5L2W B;  5LMK B;  4G6L B;  4YC3 B;  4AKG A;  2BS3 A;  2WMA B;  4BCM D;  2WHB B;  3PO3 S;  3BG5 A;  4BCG B;  4AKI A;  5IF1 B;  2WXV B;  3BLR B;  3TNH B;  4NC6 A;  3QYB A;  3X28 B;  5ACB A; 
#chains in the Genus database with same CATH homology
 4EOJ B;  1GUX B;  5IDP B;  4TTH A;  4EON B;  3G33 B;  4KRC B;  4BCF B;  1D3U B;  4YOZ A;  4F70 B;  3H4C A;  4OGR B;  2CCH B;  2IW8 B;  4EC9 B;  4BCH B;  2CJM B;  3QHR B;  2C5X B;  1O9K B;  1JST B;  2X1N B;  1QMZ B;  4F7L B;  2R7G A;  2WIP B;  5EFQ B;  4CFX B;  3BHU B;  3MI9 B;  1UNL D;  2PK2 A;  1FVV B;  1KXU A;  4CRL B;  2BKZ B;  3DDQ B;  2JGZ B;  3O0G D;  1AIS B;  4CFW B;  4I3Z B;  4F7N B;  1W98 B;  2F2C A;  1TFB A;  2I53 A;  3MY5 B;  1UNG D;  1PKD B;  3DDP B;  1H1Q B;  4YOS A;  1H24 B;  3BLH B;  2PK9 B;  3MIA B;  2UZL B;  1VYW B;  4EOP B;  2C4G B;  4ELL A;  5CYI B;  2IW9 B;  4EOO B;  2UZE B;  3LQ5 B;  1OKW B;  3POM A;  2UZB B;  1GH6 B;  2CCI B;  3TNI B;  4F6W B;  3EID B;  1BU2 A;  1JSU B;  5ICP B;  4EOL B;  3K7A M;  4ELJ A;  3BHT B;  1URC B;  1OIY B;  1OL2 B;  4EOK B;  5CEI B;  1VOL A;  1GY3 B;  2WIH B;  4EOS B;  4FX3 B;  1OL1 B;  1P5E B;  3EOC B;  5BNJ B;  4EOQ B;  1VIN A;  1H1R B;  2BPM B;  2W9F A;  1AD6 A;  4F6U B;  2C6T B;  4BCI B;  4BCK B;  1N4M A;  3MY1 B;  4EC8 B;  5HBE B;  4II5 B;  1FIN B;  2C5V B;  4IMY B;  5LQF B;  4BCQ D;  1H25 B;  2WEV B;  2PMI B;  2IVX A;  2V22 B;  4BCP B;  2C5N B;  5HBH B;  2W96 A;  3F5X B;  4CFU D;  4EOI B;  4ROC A;  1H4L D;  2WFY B;  3BHV B;  3TN8 B;  1OKV B;  1JKW A;  3DOG B;  3TNW B;  2UZD B;  3RGF B;  1OGU B;  1OIU B;  4KRD B;  4BCO B;  5I5Z B;  1OI9 B;  3EJ1 B;  2IW6 B;  2W2H A;  4CFV B;  4F7J B;  4CXA B;  4EOM B;  4ROD A;  1F5Q B;  1H1S B;  4F6S B;  4F7S B;  1C9B A;  2W99 A;  2G9X B;  4BCJ B;  1O9K A;  5L2W B;  5LMK B;  1H28 B;  2I40 B;  1H26 B;  4G6L B;  3M03 A;  1XO2 A;  4YC3 B;  5HNB B;  2W9Z A;  2EUF A;  4UN0 A;  4ROE A;  2PHG A;  2WMA B;  4OR5 B;  4BCM D;  3QHW B;  2WPA B;  2B9R A;  2WHB B;  4CFN B;  4BCG B;  4CFM B;  4BCN D;  5HVY B;  1G3N C;  2C5O B;  5HQ0 B;  1ZP2 A;  5IF1 B;  1H1P B;  4NST B;  2WXV B;  5FGK B;  2UUE B;  1GUX A;  3BLR B;  4Y72 B;  1E9H B;  1JOW A;  3TNH B;  4BCQ B;  4EOR B;  4BCM B;  1UNH D;  5IDN B;  1H27 B;  4YOO A;  4CFU B;  5HBJ B;  2QDJ A;  5ACB A;  4BCN B;  2WMB B;  3BLQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...