4BCSA

Crystal structure of an avidin mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
123
structure length
123
Chain Sequence
b'KCSLTGKWTDDLGSNMTIGAVNSRGEFTGTYITAVADNPGNITLSPLLGIQHKRASQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDISDDWIATRVGINIFTRQRTQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHIMERIC AVIDIN
publication title A Novel Chimeric Avidin with Increased Thermal Stability Using DNA Shuffling.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Biotin-binding protein
total genus 27
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 4bcsA00
2OF9A 5K67A 2FHLA 1AVEA 1RXKA 4GGRA 1SLDB 2RTEB 1SWUA 1VWQB 1I9HA 1VYOA 1VWHB 1PTSA 3PK2A 1SLEB 2RTGB 2G5LA 2AVIA 2UYWA 4I60A 1SLFB 1VWFB 1KL5A 1Y52X 2Y3FA 4GJSA 1DF8A 5IRWA 1SWHA 2IZDB 2RTHB 1MOYA 1HY2A 1NC9A 2GH7A 3SZHA 1RXHA 3VHMA 2IZGB 4JNJA 4BX7B 4CPFA 4BX5B 1HXZA 1WBIA 2RTNB 1AVDA 1VWCB 1SWGA 1SWOA 2C4IA 1KL3A 2RTOB 3VHIA 2C1QA 2JGSA 1RSTB 2Y32A 1SWFA 5IRUA 2A8GA 2BC3A 3RE6A 1VWJB 3SZJA 1N7YA 4GDAA 1VWAB 1SWSA 1LELA 2IZBA 2RTIB 2RTKA 3WYQA 1SWBA 3RE5A 1RSUB 2RTPB 1HXLA 1VWOB 1VWLB 2Y3EA 2IZKA 2RTCB 3RDMA 3T2WA 2RTMA 3RDSA 3SZIA 2RTFB 1SWKA 4Z2PA 3EW2A 2RTRB 2IZJA 1SWNA 1STRB 1SWCA 1SRHA 1SWTA 4DNEA 1MEPA 1VWNB 1VWEB 5B5FA 1VWDB 2RTJA 1IJ8A 1LDOA 5L3YA 1VWKB 3X00A 2ZSCA 4BBOA 3WZPA 4Z6JA 4BX6A 4CPIA 4OKAA 5CSEA 4CPHA 1LCZA 4YVBA 1SRIA 1VWMB 4GGTA 2OF8A 4Z28A 1SWLA 3MM0A 5B5GA 2IZIA 1VWBB 4Y59A 1VWPB 4JHQA 4IRWA 4Y5DA 3RDOA 1KFFA 2IZAA 1NDJA 4BCSA 2RTQB 4Z2VA 2IZLB 1N9MA 2WPUA 2RTBB 5CHKA 1SRGA 3VGWA 1NBXA 4GGZA 1VWGB 1SWRA 3WYPA 4GD9A 3RY2A 4GJVA 1SRJA 2OFBA 1RXJA 4BJ8A 3RDUA 1SWPA 1LUQA 1N43A 2MF6A 1RAVA 1SWEA 3WZNA 4BX6B 1HQQA 1Y55X 2UZ2A 4CPHB 1SREA 1LDQA 1MK5A 2OFAA 3RDQA 5JD2A 3VHHA 5K68A 4Z2OA 2FHNX 2A5CA 1SWAA 3EW1A 1STPA 3FDCA 3MG5A 2RTLA 3RY1A 1VWIB 1SWQA 1MM9A 2IZCB 3WZOA 1LCVA 3T2XA 1NQNA 3T6FA 4BX7A 1SWJA 2A5BA 4BX5A 4JO6A 4EKVA 4Z27A 2IZFB 1N4JA 1SRFA 1LCWA 2RTDB 3RDXA 1KL4A 1Y53X 2C1SA 1VWRB 1STSB 4U46A 2CAMA 2IZHB 5F2BA 2QCBA 4CPEA 5IRAA 1SWDA 2RTAA 3T6LA 1NQMA 2F01A 1N9YA 1SLGB 2IZEB 3WZQA
chains in the Genus database with same CATH superfamily
2GTLN 2MO5A 3Q6LA 1LIBA 3ZW1B 3JQOA 4WFVA 4ARHA 2L9CA 2WWPA 4RUNA 2P8GA 3CR6A 2WUTA 1U17A 1EPBA 1E02A 5F6BA 5IO7A 1E06A 1SLEB 2G5LA 2UYWA 1NP4A 5LJGA 1JYDA 1KL5A 1SMPI 2QO5A 1AVGI 1QFVA 4TJZA 1DF8A 2QOMA 3STNA 4CDDA 1HY2A 3ZUOA 1HMTA 2FR3A 4IB7A 3F6ZB 4GK9A 5HAEA 4BX5B 1WBIA 2BSZA 2RTNB 1AVDA 3NP1A 2WEWA 4GDZA 4Y0PA 1TOWA 4YKOA 4LKPA 1SWGA 1KL3A 3ELZA 5F1EA 1PBOA 1A57A 3FLLA 1EIIA 2QO6A 4MEEA 3HWEA 4ZJ0A 2BC3A 1U0XA 4GRJA 5LJHA 2LFOA 1H91A 4YCHA 2OVAA 3ELXA 4C5PA 4QYPA 2RTKA 2NNQA 2IZBA 4GETA 3WYQA 4GZVA 4HPBA 3EC5A 3P6GA 4PJ2A 5EPQA 3KFFA 1RBPA 1IKJA 1QQSA 2RTPB 3U0DA 3MVFA 3TGBA 2FLJA 2WQAE 4NV7A 4YGHA 4AZRA 2OFRX 3WJGA 1AB0A 1VWOB 2Y3EA 3RKGA 1L6MA 3SZIA 1OBPA 1GT3A 1D2UA 2WR6A 1BSQA 1KXOA 5DG4A 5B3MO 2OY5O 4YFRA 1SWKA 2FGSA 2BS5A 3EW2A 3FR5A 4FQBB 2IZJA 1SWCA 4KT5A 2AT5X 3FIDA 1I04A 1HBPA 2HMBA 4O9SA 4INNA 4U8UO 5F58A 4K19A 1E00A 1G85A 3K3LA 3OBLA 2Z4IA 2RQ0A 1FENA 1FTPA 5DPQA 4ZH6A 3TZSA 3PPTA 3QKGA 5HA1A 1EALA 3LTWA 1VWKB 2ZSCA 4YFPA 3WZPA 3OJYC 4M6SA 3WJFA 2KW1A 4FBVA 4EFGA 5CE4A 1LCZA 2X32A 1SRIA 1GX8A 5D47A 2OF8A 1HMSA 3APVA 3CQRA 5HZ9A 2A13A 1LIFA 2QMIA 3MM0A 1JJXA 5B5GA 2DJGA 1W5RA 2PY1A 4L3RA 4Y59A 1K24A 4JHQA 4Y5DA 1A2DA 1SXYA 4YFQA 2IZAA 3SOTA 4BCSA 3VG4A 2LBAA 4GUZA 4NP1A 2IZLB 2KTDA 2LB6A 1KQWA 2WPUA 3EBWA 4CDCA 4Z2VA 1NGLA 2FKJA 4QAEA 5LJDA 3C77X 4MIRA 4U3QA 3P24A 1DZJA 3FR4A 4GD9A 2OVSA 3S5VA 3WYPA 2Q4NA 3G7XA 1AELA 3NQ3A 1LUQA 4YGZA 1HMRA 1DFVA 2EU7X 1PEEA 1OEKA 3ZQ3A 2AT0X 3WZNA 2UZ2A 5LJBA 5EDCA 4A8ZA 3RDQA 4CPHB 3CBCA 4Z2OA 5B11O 1IKEA 1T8VA 1CBQA 1BRPA 1SXXA 1SWQA 4ZR2A 3WZOA 3SAOA 2L67A 4AZMA 1NQNA 3SLTA 5FQ8E 2AH7X 3D4RA 1VYFA 1BEBA 1ACDA 1KT6A 2LBVA 2X8SA 4NNSA 3I17A 4BX7A 4QZTA 4ZGFA 1SRFA 3UEWA 3V8UA 5FFHA 3RDXA 1S2PA 1KOIA 1Y53X 1CJ5A 5D45A 3LV4A 2HZQA 5JR8A 2OL8O 5IRAA 3WJEA 1NQMA 4DQ3A 4GE1A 1JV4A 2IZEB 1EXSA 4N7CA 3FMZA 4ORXA 5F7GA 3WZQA 1W6FA 5K67A 5LKEA 2GTLM 4O4XA 1AVEA 4O4UA 4BVMA 3FELA 1TVQA 4YDAA 4IBAA 5EDBA 2RD7C 3WBGA 1VYOA 3EM0A 1PTSA 4FBRA 4I60A 4ID2A 3ZW0B 4OS3A 4ORUA 5IRWA 1ZNDA 2A2GA 3D95A 5H9NA 3SZHA 1RXHA 3B2LA 3NPOA 5HZQA 4U8UM 5LJKA 2JU7A 2X55A 5FQ7E 2KT4B 2I5VO 2OY1O 2RTOB 3BLGA 3PDFA 4IB9A 2GJ5A 3QQ2A 3VHIA 3D9WA 4GH7A 2FS6A 2OFMX 2HLVA 1MX8A 3KQ0A 4I9RA 1DZPA 3SLOA 4ODDA 1EIOA 1SWFA 2K62A 2OL7A 2A8GA 3PP6A 4O3WA 2OYBO 3DTQA 1JBHA 4LKTA 4YKMA 2F73A 3B2KA 4HPAA 4OMXA 4GDAA 4AZPA 1G74A 1LIDA 2X8TA 1KQXA 1I06A 1LELA 2BT9A 3F9DA 3LHNA 2BHVA 4HWMA 2K23A 1LNMA 1RSUB 5LJEA 3ZI8A 1YWAA 3FA9A 4NLJA 5EEEA 1A18A 4A1YA 1HQPA 1LFOA 4BOEA 1ERBA 3T2WA 5C0NA 4YDBA 3TF6A 4MVKA 1E5PA 1QWDA 3SLJA 5H9KA 2RTFB 3VG3A 4KC8A 4Z2PA 3S26A 3PQSA 4ORRA 4QQ1A 2FKGA 4D6BA 1SWNA 4GNYA 1STRB 1SWTA 4DNEA 3NQ9A 1MEPA 3UEUA 4EEJA 1Y0GA 3BS2A 1VWDB 1GT5A 2FS7A 1O1VA 2Q9SA 1BBPA 5L3YA 1YWBA 3PEDA 3MX7A 1BWYA 4BX6A 4CPIA 2QOSC 3P6CA 5CSEA 5D4AA 4NLIA 2YG2A 3PH6A 2L68A 4O4OA 4O49A 1VWMB 3PECA 5IO6A 1EW3A 2A3FX 2CZTA 2GTLO 3FENA 4KH8A 1HN2A 4D6AA 5L8OA 1VWPB 5FQ6E 2W2AA 4IRWA 1ICNA 4OS0A 2HKDA 3WVMA 3D96A 1DF3A 2A0AA 1KFFA 4R0BA 3VG7A 2RTQB 3BRNA 3PQUA 2R74A 3S60A 1BSOA 1BRQA 1N9MA 1XKIA 4IAXA 1SRGA 4U9CA 5CHKA 3APWA 1NBXA 1OBUA 5BYPA 1VWGB 2IFBA 1SXUA 1EUOA 3VG5A 1SRJA 2OFBA 5HZ5A 4BJ8A 3RDUA 2MF6A 3WJBA 1RAVA 3D97A 2FT9A 4BQUA 2CM9A 5HTEA 1X8UA 2RA6A 3FEKA 1SWEA 2L5PA 1KT4A 3KFHA 1Y55X 1OBQA 3EBKA 2VFCA 2AKQA 5BVTA 3HTYA 4QRLA 2N93A 4IMNA 4TQ2A 1IW2A 3FDCA 1KT3A 2AT3X 2JMBA 3MG5A 4Y0QA 1JJUA 1MM9A 4YH0A 1GXAA 4WFUA 3T2XA 2CZUA 1W4TA 4I3DA 3FA6A 2CM4A 3KFGA 2E4JA 5KICA 1X8PA 2JOZA 5LJCA 5L8NA 4Z27A 2IZFB 1N4JA 1EI5A 3RWXA 1KL4A 5D8JA 2C1SA 5F2BA 1GX3A 2CAMA 1I78A 5BVSA 1NP1A 1SWDA 2Q39A 2OVEA 3S5XA 3T6LA 2F01A 1N9YA 3CKFA 3HOLA 1SLGB 2CBSA 2RTJA 1T0VA 4O3XB 4TKJA 4DQ4A 2OF9A 4DCBA 4IMOA 3I0AA 4IAWA 1RXKA 2ACOA 4QGXA 5B10O 3EMMA 1QY0A 2G79A 1JMXA 2RTEB 1FDQA 1SWUA 1SY2A 4UU2A 3PK2A 2MJIA 2RTGB 3EYCA 1SLFB 1VWFB 1B4MA 1Y52X 2Y3FA 3FYFA 2O62A 1SWHA 2IZDB 2RTHB 1MOYA 2X34A 2GH7A 1NC9A 3BY0A 3P6DA 3RBYA 3VHMA 2X4MA 5B29A 2IZGB 4ORWA 3APXA 4BX7B 1BM5A 3U9PC 1EQDA 1HXZA 2F09A 4COTA 4YBPA 1P6PA 2C4IA 4O4SA 3C76X 3NADA 2C1QA 2HYSA 2X45A 3FW4A 2ZAIA 3OE3A 3VU1A 5HCDC 4GU8A 3Q34A 3ZZVA 2X56A 1WUBA 5IO5A 1LKEA 3KZAA 1S44A 1X8QA 2PI3O 3RE6A 3UEVA 4AZNA 3FA8A 1N7YA 3SZJA 1PMPA 4HFOA 3VG2A 5KHPA 1CBSA 1OEEA 1SWBA 3RE5A 4CV7A 1CBIA 3B2JA 1HXLA 1AQBA 1O8VA 1ZNKA 1Z24A 2X46A 4RUUA 1VWLB 2CBRA 3BU1A 4GNWA 2QO4A 2WSJA 3AEHA 1N0SA 2RTMA 1UYOX 5AJCA 5H9LA 2MM3A 4YMYA 1BLRA 5EZ2A 1X8OA 2X8FA 1KZXA 1JJJA 2R73A 4MVEA 2OY8A 5B27A 3VE2A 3NX1A 3AKNA 4M7MA 4QNIA 1GKAA 1TXLA 3WJDA 1ERXA 1DZKA 1LIEA 1A3YA 2FTBA 3RSWA 1O1UA 1D3SA 1YUPA 2I5ZO 4TLJA 1GM6A 1JZUA 4A60A 1B0OA 3CQNA 4ES7A 1YWDA 3FEPA 4BBOA 3JSQA 1PM1X 1MDCA 4OKAA 1IFCA 2WEXA 1MUPA 4TNNA 5KIDA 1ADLA 2OL6O 1VYGA 3CWKA 4GGTA 3HOEA 1QY1A 4B55A 3BX7A 2G78A 1B56A 1ZNHA 4NNTA 2R56A 2XKLA 2IZIA 1VWBB 5HBSA 1DZMA 1JMZA 3NX2A 3P6FA 1B8EA 4ALOA 1OPAA 4CSBA 1TOUA 1NDJA 5BVQA 1E2TA 3IFBA 4MISA 3WOVA 4EDEA 3TGCA 2RTBB 3VGWA 1YP6A 3RY2A 4I9SA 2BLGA 2KD2A 1OSPO 4ZHDA 1OEJA 1UYNX 1YWCA 3HK1A 3NBXX 1FELA 3ZW1A 1SA8A 4BX6B 4ZHCA 4Y0SA 4EXZA 1LPJA 3O19A 4JGLA 1I05A 1LDQA 1MK5A 2OFAA 5D48A 1QFTA 2A5CA 4YBUA 3EW1A 4IB6A 2RTLA 3RY1A 3AKMA 2IZCB 4AZOA 4ZHGA 4U8UN 4XMGA 3NR3A 1X71A 3FR2A 5EEDA 3T6FA 4CK4A 1GT1A 1KT7A 1T68X 3VE1A 2A5BA 4OS8A 4BX5A 1PBYA 4JO6A 1U18A 3FIQA 3GAQA 1LCWA 4XMEA 1FEMA 1ZNEA 2GC9A 2RTDB 1RLBE 1SXWA 1HBQA 2DJFA 2NP1A 4U46A 1QY2A 4Y0RA 1VWRB 2OY7A 1ZRYA 3RZYA 3F8AA 3C78X 4QZUA 5HA0A 3B2HA 3KVNA 2Q2MA 4MVLA 4I3CA 3CBSA 2DM5A 5B2AO 5HZ8A 2FHLA 4OELA 2AL0X 2MHDA 4CDFA 2RN4A 4GGRA 1SLDB 4OEMA 3VG6A 1VWQB 1I9HA 5HWZA 1VWHB 3KFIA 4ORSA 4HPDA 5L8IA 2AVIA 2Z4HA 2OZQA 4HPCA 4GJSA 4ML7B 1QG5A 4ON1A 1FJ1E 4NYRA 1ZNLA 4LQZA 4I95A 2VDFA 4JNJA 4LZUA 3UEXA 4CPFA 1IIUA 4I6SA 4L1NA 4UU3A 5HZ6A 3AUMO 2JW1A 3GE2A 1VWCB 3U03A 1SWOA 4O3ZA 4QYNA 3VPJE 3HWFA 2AT6X 2M4LA 2AMMX 2JGSA 4EQAC 1KT5A 4TKHA 2FWVA 3STMX 1RSTB 2Y32A 3BU9A 3P6HA 5IRUA 1Y9TA 2QM9A 4KC7A 5HCEC 1ALBA 2BS6A 2XSTA 1VWJB 4N7DA 3HPEA 1BJ7A 1VWAB 1SWSA 2RTIB 2ASNX 1SY0A 2AT8X 3APUA 1GT4A 2JU8A 2HNXA 2YMSA 3STKA 3JS1A 1EPAA 1X89A 2ALLX 4IABA 1I4UA 1UZ2X 3P02A 4IB8A 1S7DA 4GKCA 2IZKA 2RTCB 3RDMA 4AW8A 3RDSA 3H3IA 4I3BA 4OMWA 5LKFA 5F6ZA 3FA7A 4AYHA 4QGVA 3DSZA 2HZRA 2W2FA 2RTRB 4ZFXA 5HCCC 1R0UA 2GTFX 4ZHHA 1G7NA 1SRHA 3PH5A 1JQPA 3ZWEA 3ZW2A 2OVDA 1VWNB 3BX8A 3FW5A 1CRBA 1VWEB 1X8NA 4YGGA 5IXGA 1DV9A 5B5FA 3CKGA 2KTSA 2MWHA 3HWDA 4O3YA 4WHIA 4YCEA 4ZGUA 1K3BA 3MBTA 1IJ8A 1LDOA 2FR2A 1ICMA 3X00A 1MVGA 3N91A 3WXQA 4LZVA 3P6EA 4Z6JA 1KGLA 1JIWI 4KIIA 3BDRA 5H8TA 1MX7A 3ZUIA 4AZQA 4CPHA 4YVBA 1Y9LA 2LA7A 2ZAGA 1BSYA 4Z28A 2Q2PA 1SWLA 1ML7A 4A1HA 1XCAA 4MVIA 1DC9A 2G8CO 3CMPA 1SY1A 5AQ6A 4BGFA 1FE3A 5FAZA 1QABE 3T1DA 4ZHFA 3RDOA 4CDEA 4FBOA 4ORYA 1CBRA 1YP7A 3O22A 5K06A 2JN3A 4KCAA 4NW4A 4ZCBA 2ANSA 3WJCA 3O2YA 1GKAB 1VPRA 4GGZA 5FENA 1LICA 2G7BA 1SWRA 3L4RA 4XMHA 3TGAA 4GJVA 1RXJA 3NQKA 4TKBA 5AEOA 1SWPA 1N43A 4QGWA 3UAQA 3IA8A 4NYQA 1HQQA 2RCTA 2A2UA 4PSQA 1SREA 1SY3A 3VHHA 5JD2A 4ZH9A 2LKKA 5K68A 2FHNX 1SWAA 4WBKA 2POAA 1STPA 3ZW0A 1VWIB 1IFBA 2VFBA 3E3CA 4ALBA 2WQ9A 1LF7A 1LCVA 2NNDA 1TW4A 2ACPX 5H9AA 1YIVA 3BSZE 4FGIB 1SWJA 3OD9A 4XMFA 4XMCA 1ZNGA 1KZWA 5AJBA 4EKVA 2NNEA 2RCQA 2FRSA 1G5WA 4NV8A 1UREA 5CYBA 2AF5A 1GGLA 1STSB 2IZHB 2QCBA 4XMDA 4CPEA 1OPBA 2RTAA 3B2IA 5HTDA 2W2BA 2JU3A 1GX9A 1JYJA 3HWGA
chains in the Genus database with same CATH topology
2OF9A 5K67A 2FHLA 1AVEA 1RXKA 4GGRA 1SLDB 2RTEB 1SWUA 1VWQB 1I9HA 1VYOA 1VWHB 1PTSA 3PK2A 1SLEB 2RTGB 2G5LA 2AVIA 2UYWA 4I60A 1SLFB 1VWFB 1KL5A 1Y52X 2Y3FA 4GJSA 1DF8A 5IRWA 1SWHA 2IZDB 2RTHB 1MOYA 1HY2A 1NC9A 2GH7A 3SZHA 1RXHA 3VHMA 2IZGB 4JNJA 4BX7B 4CPFA 4BX5B 1HXZA 1WBIA 2RTNB 1AVDA 1VWCB 1SWGA 1SWOA 2C4IA 1KL3A 2RTOB 3VHIA 2C1QA 2JGSA 1RSTB 2Y32A 1SWFA 5IRUA 2A8GA 2BC3A 3RE6A 1VWJB 3SZJA 1N7YA 4GDAA 1VWAB 1SWSA 1LELA 2IZBA 2RTIB 2RTKA 3WYQA 1SWBA 3RE5A 1RSUB 2RTPB 1HXLA 1VWOB 1VWLB 2Y3EA 2IZKA 2RTCB 3RDMA 3T2WA 2RTMA 3RDSA 3SZIA 2RTFB 1SWKA 4Z2PA 3EW2A 2RTRB 2IZJA 1SWNA 1STRB 1SWCA 1SRHA 1SWTA 4DNEA 1MEPA 1VWNB 1VWEB 5B5FA 1VWDB 2RTJA 1IJ8A 1LDOA 5L3YA 1VWKB 3X00A 2ZSCA 4BBOA 3WZPA 4Z6JA 4BX6A 4CPIA 4OKAA 5CSEA 4CPHA 1LCZA 4YVBA 1SRIA 1VWMB 4GGTA 2OF8A 4Z28A 1SWLA 3MM0A 5B5GA 2IZIA 1VWBB 4Y59A 1VWPB 4JHQA 4IRWA 4Y5DA 3RDOA 1KFFA 2IZAA 1NDJA 4BCSA 2RTQB 4Z2VA 2IZLB 1N9MA 2WPUA 2RTBB 5CHKA 1SRGA 3VGWA 1NBXA 4GGZA 1VWGB 1SWRA 3WYPA 4GD9A 3RY2A 4GJVA 1SRJA 2OFBA 1RXJA 4BJ8A 3RDUA 1SWPA 1LUQA 1N43A 2MF6A 1RAVA 1SWEA 3WZNA 4BX6B 1HQQA 1Y55X 2UZ2A 4CPHB 1SREA 1LDQA 1MK5A 2OFAA 3RDQA 5JD2A 3VHHA 5K68A 4Z2OA 2FHNX 2A5CA 1SWAA 3EW1A 1STPA 3FDCA 3MG5A 2RTLA 3RY1A 1VWIB 1SWQA 1MM9A 2IZCB 3WZOA 1LCVA 3T2XA 1NQNA 3T6FA 4BX7A 1SWJA 2A5BA 4BX5A 4JO6A 4EKVA 4Z27A 2IZFB 1N4JA 1SRFA 1LCWA 2RTDB 3RDXA 1KL4A 1Y53X 2C1SA 1VWRB 1STSB 4U46A 2CAMA 2IZHB 5F2BA 2QCBA 4CPEA 5IRAA 1SWDA 2RTAA 3T6LA 1NQMA 2F01A 1N9YA 1SLGB 2IZEB 3WZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OF9 A;  5K67 A;  2FHL A;  1AVE A;  1RXK A;  4GGR A;  1SLD B;  2RTE B;  1SWU A;  1VWQ B;  1I9H A;  1VYO A;  1VWH B;  1PTS A;  3PK2 A;  1SLE B;  2RTG B;  2G5L A;  2AVI A;  2UYW A;  4I60 A;  1SLF B;  1VWF B;  1KL5 A;  1Y52 X;  2Y3F A;  4GJS A;  1DF8 A;  5IRW A;  1SWH A;  2IZD B;  2RTH B;  1MOY A;  1HY2 A;  1NC9 A;  2GH7 A;  3SZH A;  1RXH A;  3VHM A;  2IZG B;  4JNJ A;  4BX7 B;  4CPF A;  4BX5 B;  1HXZ A;  1WBI A;  2RTN B;  1AVD A;  1VWC B;  1SWG A;  1SWO A;  2C4I A;  1KL3 A;  2RTO B;  3VHI A;  2C1Q A;  2JGS A;  1RST B;  2Y32 A;  1SWF A;  5IRU A;  2A8G A;  2BC3 A;  3RE6 A;  1VWJ B;  3SZJ A;  1N7Y A;  4GDA A;  1VWA B;  1SWS A;  1LEL A;  2IZB A;  2RTI B;  2RTK A;  3WYQ A;  1SWB A;  3RE5 A;  1RSU B;  2RTP B;  1HXL A;  1VWO B;  1VWL B;  2Y3E A;  2IZK A;  2RTC B;  3RDM A;  3T2W A;  2RTM A;  3RDS A;  3SZI A;  2RTF B;  1SWK A;  4Z2P A;  3EW2 A;  2RTR B;  2IZJ A;  1SWN A;  1STR B;  1SWC A;  1SRH A;  1SWT A;  4DNE A;  1MEP A;  1VWN B;  1VWE B;  5B5F A;  1VWD B;  2RTJ A;  1IJ8 A;  1LDO A;  5L3Y A;  1VWK B;  3X00 A;  2ZSC A;  4BBO A;  3WZP A;  4Z6J A;  4BX6 A;  4CPI A;  4OKA A;  5CSE A;  4CPH A;  1LCZ A;  4YVB A;  1SRI A;  1VWM B;  4GGT A;  2OF8 A;  4Z28 A;  1SWL A;  3MM0 A;  5B5G A;  2IZI A;  1VWB B;  4Y59 A;  1VWP B;  4JHQ A;  4IRW A;  4Y5D A;  3RDO A;  1KFF A;  2IZA A;  1NDJ A;  4BCS A;  2RTQ B;  4Z2V A;  2IZL B;  1N9M A;  2WPU A;  2RTB B;  5CHK A;  1SRG A;  3VGW A;  1NBX A;  4GGZ A;  1VWG B;  1SWR A;  3WYP A;  4GD9 A;  3RY2 A;  4GJV A;  1SRJ A;  2OFB A;  1RXJ A;  4BJ8 A;  3RDU A;  1SWP A;  1LUQ A;  1N43 A;  2MF6 A;  1RAV A;  1SWE A;  3WZN A;  4BX6 B;  1HQQ A;  1Y55 X;  2UZ2 A;  4CPH B;  1SRE A;  1LDQ A;  1MK5 A;  2OFA A;  3RDQ A;  5JD2 A;  3VHH A;  5K68 A;  4Z2O A;  2FHN X;  2A5C A;  1SWA A;  3EW1 A;  1STP A;  3FDC A;  3MG5 A;  2RTL A;  3RY1 A;  1VWI B;  1SWQ A;  1MM9 A;  2IZC B;  3WZO A;  1LCV A;  3T2X A;  1NQN A;  3T6F A;  4BX7 A;  1SWJ A;  2A5B A;  4BX5 A;  4JO6 A;  4EKV A;  4Z27 A;  2IZF B;  1N4J A;  1SRF A;  1LCW A;  2RTD B;  3RDX A;  1KL4 A;  1Y53 X;  2C1S A;  1VWR B;  1STS B;  4U46 A;  2CAM A;  2IZH B;  5F2B A;  2QCB A;  4CPE A;  5IRA A;  1SWD A;  2RTA A;  3T6L A;  1NQM A;  2F01 A;  1N9Y A;  1SLG B;  2IZE B;  3WZQ A; 
#chains in the Genus database with same CATH topology
 2GTL N;  2MO5 A;  3Q6L A;  1LIB A;  3ZW1 B;  3JQO A;  4WFV A;  4ARH A;  2L9C A;  2WWP A;  4RUN A;  2P8G A;  3CR6 A;  2WUT A;  1U17 A;  1EPB A;  1E02 A;  5F6B A;  5IO7 A;  1E06 A;  1SLE B;  2G5L A;  2UYW A;  1NP4 A;  5LJG A;  1JYD A;  1KL5 A;  1SMP I;  2QO5 A;  1AVG I;  1QFV A;  4TJZ A;  1DF8 A;  2QOM A;  3STN A;  4CDD A;  1HY2 A;  3ZUO A;  1HMT A;  2FR3 A;  4IB7 A;  3F6Z B;  4GK9 A;  5HAE A;  4BX5 B;  1WBI A;  2BSZ A;  2RTN B;  1AVD A;  3NP1 A;  2WEW A;  4GDZ A;  4Y0P A;  1TOW A;  4YKO A;  4LKP A;  1SWG A;  1KL3 A;  3ELZ A;  5F1E A;  1PBO A;  1A57 A;  3FLL A;  1EII A;  2QO6 A;  4MEE A;  3HWE A;  4ZJ0 A;  2BC3 A;  1U0X A;  4GRJ A;  5LJH A;  2LFO A;  1H91 A;  4YCH A;  2OVA A;  3ELX A;  4C5P A;  4QYP A;  2RTK A;  2NNQ A;  2IZB A;  4GET A;  3WYQ A;  4GZV A;  4HPB A;  3EC5 A;  3P6G A;  4PJ2 A;  5EPQ A;  3KFF A;  1RBP A;  1IKJ A;  1QQS A;  2RTP B;  3U0D A;  3MVF A;  3TGB A;  2FLJ A;  2WQA E;  4NV7 A;  4YGH A;  4AZR A;  2OFR X;  3WJG A;  1AB0 A;  1VWO B;  2Y3E A;  3RKG A;  1L6M A;  3SZI A;  1OBP A;  1GT3 A;  1D2U A;  2WR6 A;  1BSQ A;  1KXO A;  5DG4 A;  5B3M O;  2OY5 O;  4YFR A;  1SWK A;  2FGS A;  2BS5 A;  3EW2 A;  3FR5 A;  4FQB B;  2IZJ A;  1SWC A;  4KT5 A;  2AT5 X;  3FID A;  1I04 A;  1HBP A;  2HMB A;  4O9S A;  4INN A;  4U8U O;  5F58 A;  4K19 A;  1E00 A;  1G85 A;  3K3L A;  3OBL A;  2Z4I A;  2RQ0 A;  1FEN A;  1FTP A;  5DPQ A;  4ZH6 A;  3TZS A;  3PPT A;  3QKG A;  5HA1 A;  1EAL A;  3LTW A;  1VWK B;  2ZSC A;  4YFP A;  3WZP A;  3OJY C;  4M6S A;  3WJF A;  2KW1 A;  4FBV A;  4EFG A;  5CE4 A;  1LCZ A;  2X32 A;  1SRI A;  1GX8 A;  5D47 A;  2OF8 A;  1HMS A;  3APV A;  3CQR A;  5HZ9 A;  2A13 A;  1LIF A;  2QMI A;  3MM0 A;  1JJX A;  5B5G A;  2DJG A;  1W5R A;  2PY1 A;  4L3R A;  4Y59 A;  1K24 A;  4JHQ A;  4Y5D A;  1A2D A;  1SXY A;  4YFQ A;  2IZA A;  3SOT A;  4BCS A;  3VG4 A;  2LBA A;  4GUZ A;  4NP1 A;  2IZL B;  2KTD A;  2LB6 A;  1KQW A;  2WPU A;  3EBW A;  4CDC A;  4Z2V A;  1NGL A;  2FKJ A;  4QAE A;  5LJD A;  3C77 X;  4MIR A;  4U3Q A;  3P24 A;  1DZJ A;  3FR4 A;  4GD9 A;  2OVS A;  3S5V A;  3WYP A;  2Q4N A;  3G7X A;  1AEL A;  3NQ3 A;  1LUQ A;  4YGZ A;  1HMR A;  1DFV A;  2EU7 X;  1PEE A;  1OEK A;  3ZQ3 A;  2AT0 X;  3WZN A;  2UZ2 A;  5LJB A;  5EDC A;  4A8Z A;  3RDQ A;  4CPH B;  3CBC A;  4Z2O A;  5B11 O;  1IKE A;  1T8V A;  1CBQ A;  1BRP A;  1SXX A;  1SWQ A;  4ZR2 A;  3WZO A;  3SAO A;  2L67 A;  4AZM A;  1NQN A;  3SLT A;  5FQ8 E;  2AH7 X;  3D4R A;  1VYF A;  1BEB A;  1ACD A;  1KT6 A;  2LBV A;  2X8S A;  4NNS A;  3I17 A;  4BX7 A;  4QZT A;  4ZGF A;  1SRF A;  3UEW A;  3V8U A;  5FFH A;  3RDX A;  1S2P A;  1KOI A;  1Y53 X;  1CJ5 A;  5D45 A;  3LV4 A;  2HZQ A;  5JR8 A;  2OL8 O;  5IRA A;  3WJE A;  1NQM A;  4DQ3 A;  4GE1 A;  1JV4 A;  2IZE B;  1EXS A;  4N7C A;  3FMZ A;  4ORX A;  5F7G A;  3WZQ A;  1W6F A;  5K67 A;  5LKE A;  2GTL M;  4O4X A;  1AVE A;  4O4U A;  4BVM A;  3FEL A;  1TVQ A;  4YDA A;  4IBA A;  5EDB A;  2RD7 C;  3WBG A;  1VYO A;  3EM0 A;  1PTS A;  4FBR A;  4I60 A;  4ID2 A;  3ZW0 B;  4OS3 A;  4ORU A;  5IRW A;  1ZND A;  2A2G A;  3D95 A;  5H9N A;  3SZH A;  1RXH A;  3B2L A;  3NPO A;  5HZQ A;  4U8U M;  5LJK A;  2JU7 A;  2X55 A;  5FQ7 E;  2KT4 B;  2I5V O;  2OY1 O;  2RTO B;  3BLG A;  3PDF A;  4IB9 A;  2GJ5 A;  3QQ2 A;  3VHI A;  3D9W A;  4GH7 A;  2FS6 A;  2OFM X;  2HLV A;  1MX8 A;  3KQ0 A;  4I9R A;  1DZP A;  3SLO A;  4ODD A;  1EIO A;  1SWF A;  2K62 A;  2OL7 A;  2A8G A;  3PP6 A;  4O3W A;  2OYB O;  3DTQ A;  1JBH A;  4LKT A;  4YKM A;  2F73 A;  3B2K A;  4HPA A;  4OMX A;  4GDA A;  4AZP A;  1G74 A;  1LID A;  2X8T A;  1KQX A;  1I06 A;  1LEL A;  2BT9 A;  3F9D A;  3LHN A;  2BHV A;  4HWM A;  2K23 A;  1LNM A;  1RSU B;  5LJE A;  3ZI8 A;  1YWA A;  3FA9 A;  4NLJ A;  5EEE A;  1A18 A;  4A1Y A;  1HQP A;  1LFO A;  4BOE A;  1ERB A;  3T2W A;  5C0N A;  4YDB A;  3TF6 A;  4MVK A;  1E5P A;  1QWD A;  3SLJ A;  5H9K A;  2RTF B;  3VG3 A;  4KC8 A;  4Z2P A;  3S26 A;  3PQS A;  4ORR A;  4QQ1 A;  2FKG A;  4D6B A;  1SWN A;  4GNY A;  1STR B;  1SWT A;  4DNE A;  3NQ9 A;  1MEP A;  3UEU A;  4EEJ A;  1Y0G A;  3BS2 A;  1VWD B;  1GT5 A;  2FS7 A;  1O1V A;  2Q9S A;  1BBP A;  5L3Y A;  1YWB A;  3PED A;  3MX7 A;  1BWY A;  4BX6 A;  4CPI A;  2QOS C;  3P6C A;  5CSE A;  5D4A A;  4NLI A;  2YG2 A;  3PH6 A;  2L68 A;  4O4O A;  4O49 A;  1VWM B;  3PEC A;  5IO6 A;  1EW3 A;  2A3F X;  2CZT A;  2GTL O;  3FEN A;  4KH8 A;  1HN2 A;  4D6A A;  5L8O A;  1VWP B;  5FQ6 E;  2W2A A;  4IRW A;  1ICN A;  4OS0 A;  2HKD A;  3WVM A;  3D96 A;  1DF3 A;  2A0A A;  1KFF A;  4R0B A;  3VG7 A;  2RTQ B;  3BRN A;  3PQU A;  2R74 A;  3S60 A;  1BSO A;  1BRQ A;  1N9M A;  1XKI A;  4IAX A;  1SRG A;  4U9C A;  5CHK A;  3APW A;  1NBX A;  1OBU A;  5BYP A;  1VWG B;  2IFB A;  1SXU A;  1EUO A;  3VG5 A;  1SRJ A;  2OFB A;  5HZ5 A;  4BJ8 A;  3RDU A;  2MF6 A;  3WJB A;  1RAV A;  3D97 A;  2FT9 A;  4BQU A;  2CM9 A;  5HTE A;  1X8U A;  2RA6 A;  3FEK A;  1SWE A;  2L5P A;  1KT4 A;  3KFH A;  1Y55 X;  1OBQ A;  3EBK A;  2VFC A;  2AKQ A;  5BVT A;  3HTY A;  4QRL A;  2N93 A;  4IMN A;  4TQ2 A;  1IW2 A;  3FDC A;  1KT3 A;  2AT3 X;  2JMB A;  3MG5 A;  4Y0Q A;  1JJU A;  1MM9 A;  4YH0 A;  1GXA A;  4WFU A;  3T2X A;  2CZU A;  1W4T A;  4I3D A;  3FA6 A;  2CM4 A;  3KFG A;  2E4J A;  5KIC A;  1X8P A;  2JOZ A;  5LJC A;  5L8N A;  4Z27 A;  2IZF B;  1N4J A;  1EI5 A;  3RWX A;  1KL4 A;  5D8J A;  2C1S A;  5F2B A;  1GX3 A;  2CAM A;  1I78 A;  5BVS A;  1NP1 A;  1SWD A;  2Q39 A;  2OVE A;  3S5X A;  3T6L A;  2F01 A;  1N9Y A;  3CKF A;  3HOL A;  1SLG B;  2CBS A;  2RTJ A;  1T0V A;  4O3X B;  4TKJ A;  4DQ4 A;  2OF9 A;  4DCB A;  4IMO A;  3I0A A;  4IAW A;  1RXK A;  2ACO A;  4QGX A;  5B10 O;  3EMM A;  1QY0 A;  2G79 A;  1JMX A;  2RTE B;  1FDQ A;  1SWU A;  1SY2 A;  4UU2 A;  3PK2 A;  2MJI A;  2RTG B;  3EYC A;  1SLF B;  1VWF B;  1B4M A;  1Y52 X;  2Y3F A;  3FYF A;  2O62 A;  1SWH A;  2IZD B;  2RTH B;  1MOY A;  2X34 A;  2GH7 A;  1NC9 A;  3BY0 A;  3P6D A;  3RBY A;  3VHM A;  2X4M A;  5B29 A;  2IZG B;  4ORW A;  3APX A;  4BX7 B;  1BM5 A;  3U9P C;  1EQD A;  1HXZ A;  2F09 A;  4COT A;  4YBP A;  1P6P A;  2C4I A;  4O4S A;  3C76 X;  3NAD A;  2C1Q A;  2HYS A;  2X45 A;  3FW4 A;  2ZAI A;  3OE3 A;  3VU1 A;  5HCD C;  4GU8 A;  3Q34 A;  3ZZV A;  2X56 A;  1WUB A;  5IO5 A;  1LKE A;  3KZA A;  1S44 A;  1X8Q A;  2PI3 O;  3RE6 A;  3UEV A;  4AZN A;  3FA8 A;  1N7Y A;  3SZJ A;  1PMP A;  4HFO A;  3VG2 A;  5KHP A;  1CBS A;  1OEE A;  1SWB A;  3RE5 A;  4CV7 A;  1CBI A;  3B2J A;  1HXL A;  1AQB A;  1O8V A;  1ZNK A;  1Z24 A;  2X46 A;  4RUU A;  1VWL B;  2CBR A;  3BU1 A;  4GNW A;  2QO4 A;  2WSJ A;  3AEH A;  1N0S A;  2RTM A;  1UYO X;  5AJC A;  5H9L A;  2MM3 A;  4YMY A;  1BLR A;  5EZ2 A;  1X8O A;  2X8F A;  1KZX A;  1JJJ A;  2R73 A;  4MVE A;  2OY8 A;  5B27 A;  3VE2 A;  3NX1 A;  3AKN A;  4M7M A;  4QNI A;  1GKA A;  1TXL A;  3WJD A;  1ERX A;  1DZK A;  1LIE A;  1A3Y A;  2FTB A;  3RSW A;  1O1U A;  1D3S A;  1YUP A;  2I5Z O;  4TLJ A;  1GM6 A;  1JZU A;  4A60 A;  1B0O A;  3CQN A;  4ES7 A;  1YWD A;  3FEP A;  4BBO A;  3JSQ A;  1PM1 X;  1MDC A;  4OKA A;  1IFC A;  2WEX A;  1MUP A;  4TNN A;  5KID A;  1ADL A;  2OL6 O;  1VYG A;  3CWK A;  4GGT A;  3HOE A;  1QY1 A;  4B55 A;  3BX7 A;  2G78 A;  1B56 A;  1ZNH A;  4NNT A;  2R56 A;  2XKL A;  2IZI A;  1VWB B;  5HBS A;  1DZM A;  1JMZ A;  3NX2 A;  3P6F A;  1B8E A;  4ALO A;  1OPA A;  4CSB A;  1TOU A;  1NDJ A;  5BVQ A;  1E2T A;  3IFB A;  4MIS A;  3WOV A;  4EDE A;  3TGC A;  2RTB B;  3VGW A;  1YP6 A;  3RY2 A;  4I9S A;  2BLG A;  2KD2 A;  1OSP O;  4ZHD A;  1OEJ A;  1UYN X;  1YWC A;  3HK1 A;  3NBX X;  1FEL A;  3ZW1 A;  1SA8 A;  4BX6 B;  4ZHC A;  4Y0S A;  4EXZ A;  1LPJ A;  3O19 A;  4JGL A;  1I05 A;  1LDQ A;  1MK5 A;  2OFA A;  5D48 A;  1QFT A;  2A5C A;  4YBU A;  3EW1 A;  4IB6 A;  2RTL A;  3RY1 A;  3AKM A;  2IZC B;  4AZO A;  4ZHG A;  4U8U N;  4XMG A;  3NR3 A;  1X71 A;  3FR2 A;  5EED A;  3T6F A;  4CK4 A;  1GT1 A;  1KT7 A;  1T68 X;  3VE1 A;  2A5B A;  4OS8 A;  4BX5 A;  1PBY A;  4JO6 A;  1U18 A;  3FIQ A;  3GAQ A;  1LCW A;  4XME A;  1FEM A;  1ZNE A;  2GC9 A;  2RTD B;  1RLB E;  1SXW A;  1HBQ A;  2DJF A;  2NP1 A;  4U46 A;  1QY2 A;  4Y0R A;  1VWR B;  2OY7 A;  1ZRY A;  3RZY A;  3F8A A;  3C78 X;  4QZU A;  5HA0 A;  3B2H A;  3KVN A;  2Q2M A;  4MVL A;  4I3C A;  3CBS A;  2DM5 A;  5B2A O;  5HZ8 A;  2FHL A;  4OEL A;  2AL0 X;  2MHD A;  4CDF A;  2RN4 A;  4GGR A;  1SLD B;  4OEM A;  3VG6 A;  1VWQ B;  1I9H A;  5HWZ A;  1VWH B;  3KFI A;  4ORS A;  4HPD A;  5L8I A;  2AVI A;  2Z4H A;  2OZQ A;  4HPC A;  4GJS A;  4ML7 B;  1QG5 A;  4ON1 A;  1FJ1 E;  4NYR A;  1ZNL A;  4LQZ A;  4I95 A;  2VDF A;  4JNJ A;  4LZU A;  3UEX A;  4CPF A;  1IIU A;  4I6S A;  4L1N A;  4UU3 A;  5HZ6 A;  3AUM O;  2JW1 A;  3GE2 A;  1VWC B;  3U03 A;  1SWO A;  4O3Z A;  4QYN A;  3VPJ E;  3HWF A;  2AT6 X;  2M4L A;  2AMM X;  2JGS A;  4EQA C;  1KT5 A;  4TKH A;  2FWV A;  3STM X;  1RST B;  2Y32 A;  3BU9 A;  3P6H A;  5IRU A;  1Y9T A;  2QM9 A;  4KC7 A;  5HCE C;  1ALB A;  2BS6 A;  2XST A;  1VWJ B;  4N7D A;  3HPE A;  1BJ7 A;  1VWA B;  1SWS A;  2RTI B;  2ASN X;  1SY0 A;  2AT8 X;  3APU A;  1GT4 A;  2JU8 A;  2HNX A;  2YMS A;  3STK A;  3JS1 A;  1EPA A;  1X89 A;  2ALL X;  4IAB A;  1I4U A;  1UZ2 X;  3P02 A;  4IB8 A;  1S7D A;  4GKC A;  2IZK A;  2RTC B;  3RDM A;  4AW8 A;  3RDS A;  3H3I A;  4I3B A;  4OMW A;  5LKF A;  5F6Z A;  3FA7 A;  4AYH A;  4QGV A;  3DSZ A;  2HZR A;  2W2F A;  2RTR B;  4ZFX A;  5HCC C;  1R0U A;  2GTF X;  4ZHH A;  1G7N A;  1SRH A;  3PH5 A;  1JQP A;  3ZWE A;  3ZW2 A;  2OVD A;  1VWN B;  3BX8 A;  3FW5 A;  1CRB A;  1VWE B;  1X8N A;  4YGG A;  5IXG A;  1DV9 A;  5B5F A;  3CKG A;  2KTS A;  2MWH A;  3HWD A;  4O3Y A;  4WHI A;  4YCE A;  4ZGU A;  1K3B A;  3MBT A;  1IJ8 A;  1LDO A;  2FR2 A;  1ICM A;  3X00 A;  1MVG A;  3N91 A;  3WXQ A;  4LZV A;  3P6E A;  4Z6J A;  1KGL A;  1JIW I;  4KII A;  3BDR A;  5H8T A;  1MX7 A;  3ZUI A;  4AZQ A;  4CPH A;  4YVB A;  1Y9L A;  2LA7 A;  2ZAG A;  1BSY A;  4Z28 A;  2Q2P A;  1SWL A;  1ML7 A;  4A1H A;  1XCA A;  4MVI A;  1DC9 A;  2G8C O;  3CMP A;  1SY1 A;  5AQ6 A;  4BGF A;  1FE3 A;  5FAZ A;  1QAB E;  3T1D A;  4ZHF A;  3RDO A;  4CDE A;  4FBO A;  4ORY A;  1CBR A;  1YP7 A;  3O22 A;  5K06 A;  2JN3 A;  4KCA A;  4NW4 A;  4ZCB A;  2ANS A;  3WJC A;  3O2Y A;  1GKA B;  1VPR A;  4GGZ A;  5FEN A;  1LIC A;  2G7B A;  1SWR A;  3L4R A;  4XMH A;  3TGA A;  4GJV A;  1RXJ A;  3NQK A;  4TKB A;  5AEO A;  1SWP A;  1N43 A;  4QGW A;  3UAQ A;  3IA8 A;  4NYQ A;  1HQQ A;  2RCT A;  2A2U A;  4PSQ A;  1SRE A;  1SY3 A;  3VHH A;  5JD2 A;  4ZH9 A;  2LKK A;  5K68 A;  2FHN X;  1SWA A;  4WBK A;  2POA A;  1STP A;  3ZW0 A;  1VWI B;  1IFB A;  2VFB A;  3E3C A;  4ALB A;  2WQ9 A;  1LF7 A;  1LCV A;  2NND A;  1TW4 A;  2ACP X;  5H9A A;  1YIV A;  3BSZ E;  4FGI B;  1SWJ A;  3OD9 A;  4XMF A;  4XMC A;  1ZNG A;  1KZW A;  5AJB A;  4EKV A;  2NNE A;  2RCQ A;  2FRS A;  1G5W A;  4NV8 A;  1URE A;  5CYB A;  2AF5 A;  1GGL A;  1STS B;  2IZH B;  2QCB A;  4XMD A;  4CPE A;  1OPB A;  2RTA A;  3B2I A;  5HTD A;  2W2B A;  2JU3 A;  1GX9 A;  1JYJ A;  3HWG A; 
#chains in the Genus database with same CATH homology
 2OF9 A;  5K67 A;  2FHL A;  1AVE A;  1RXK A;  4GGR A;  1SLD B;  2RTE B;  1SWU A;  1VWQ B;  1I9H A;  1VYO A;  1VWH B;  1PTS A;  3PK2 A;  1SLE B;  2RTG B;  2G5L A;  2AVI A;  2UYW A;  4I60 A;  1SLF B;  1VWF B;  1KL5 A;  1Y52 X;  2Y3F A;  4GJS A;  1DF8 A;  5IRW A;  1SWH A;  2IZD B;  2RTH B;  1MOY A;  1HY2 A;  1NC9 A;  2GH7 A;  3SZH A;  1RXH A;  3VHM A;  2IZG B;  4JNJ A;  4BX7 B;  4CPF A;  4BX5 B;  1HXZ A;  1WBI A;  2RTN B;  1AVD A;  1VWC B;  1SWG A;  1SWO A;  2C4I A;  1KL3 A;  2RTO B;  3VHI A;  2C1Q A;  2JGS A;  1RST B;  2Y32 A;  1SWF A;  5IRU A;  2A8G A;  2BC3 A;  3RE6 A;  1VWJ B;  3SZJ A;  1N7Y A;  4GDA A;  1VWA B;  1SWS A;  1LEL A;  2IZB A;  2RTI B;  2RTK A;  3WYQ A;  1SWB A;  3RE5 A;  1RSU B;  2RTP B;  1HXL A;  1VWO B;  1VWL B;  2Y3E A;  2IZK A;  2RTC B;  3RDM A;  3T2W A;  2RTM A;  3RDS A;  3SZI A;  2RTF B;  1SWK A;  4Z2P A;  3EW2 A;  2RTR B;  2IZJ A;  1SWN A;  1STR B;  1SWC A;  1SRH A;  1SWT A;  4DNE A;  1MEP A;  1VWN B;  1VWE B;  5B5F A;  1VWD B;  2RTJ A;  1IJ8 A;  1LDO A;  5L3Y A;  1VWK B;  3X00 A;  2ZSC A;  4BBO A;  3WZP A;  4Z6J A;  4BX6 A;  4CPI A;  4OKA A;  5CSE A;  4CPH A;  1LCZ A;  4YVB A;  1SRI A;  1VWM B;  4GGT A;  2OF8 A;  4Z28 A;  1SWL A;  3MM0 A;  5B5G A;  2IZI A;  1VWB B;  4Y59 A;  1VWP B;  4JHQ A;  4IRW A;  4Y5D A;  3RDO A;  1KFF A;  2IZA A;  1NDJ A;  4BCS A;  2RTQ B;  4Z2V A;  2IZL B;  1N9M A;  2WPU A;  2RTB B;  5CHK A;  1SRG A;  3VGW A;  1NBX A;  4GGZ A;  1VWG B;  1SWR A;  3WYP A;  4GD9 A;  3RY2 A;  4GJV A;  1SRJ A;  2OFB A;  1RXJ A;  4BJ8 A;  3RDU A;  1SWP A;  1LUQ A;  1N43 A;  2MF6 A;  1RAV A;  1SWE A;  3WZN A;  4BX6 B;  1HQQ A;  1Y55 X;  2UZ2 A;  4CPH B;  1SRE A;  1LDQ A;  1MK5 A;  2OFA A;  3RDQ A;  5JD2 A;  3VHH A;  5K68 A;  4Z2O A;  2FHN X;  2A5C A;  1SWA A;  3EW1 A;  1STP A;  3FDC A;  3MG5 A;  2RTL A;  3RY1 A;  1VWI B;  1SWQ A;  1MM9 A;  2IZC B;  3WZO A;  1LCV A;  3T2X A;  1NQN A;  3T6F A;  4BX7 A;  1SWJ A;  2A5B A;  4BX5 A;  4JO6 A;  4EKV A;  4Z27 A;  2IZF B;  1N4J A;  1SRF A;  1LCW A;  2RTD B;  3RDX A;  1KL4 A;  1Y53 X;  2C1S A;  1VWR B;  1STS B;  4U46 A;  2CAM A;  2IZH B;  5F2B A;  2QCB A;  4CPE A;  5IRA A;  1SWD A;  2RTA A;  3T6L A;  1NQM A;  2F01 A;  1N9Y A;  1SLG B;  2IZE B;  3WZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...