4BCZA

Monomeric human cu,zn superoxide dismutase, loops iv and vii deleted, apo form.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
110
structure length
110
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHGAGGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKAGAGAGSRLASGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Global Structural Motions from the Strain of a Single Hydrogen Bond.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
total genus 23
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4bczA00
5CU9A 1OZUA 3GZPA 2WZ6A 2AEOA 1TO4A 2E46A 1IBFA 1OEZW 1SOSA 4OJAA 1DO5A 1OZTG 4MCMA 5KBMA 1UXMA 3HOGA 2GBTA 2JCWA 2E47A 1HL5A 2AF2A 1E9PA 4A7GA 2AQSA 2WYTA 2ZOWA 3GZQA 1DSWA 1IBDA 1SXSA 3ECVA 1F18A 2C9VA 1SPDA 2APSA 3CQQA 1EQWA 1OAJA 3T5WA 4A7TA 2WWOA 4L05A 1N19A 1OALA 2Z7YA 1EJ8A 1SXNA 1TO5A 3GTVA 4BCZA 1SXZA 3S0PA 3LTVA 3MKGA 3KBEA 3KM2A 1XTLA 1FUNA 1ESOA 1PU0A 1CBJA 2K4WA 1Q0EA 1HL4A 1B4LA 1F1AA 3MNDA 1AZVA 2VR7A 4A7SA 1SXBA 2GBUA 4U4IA 1IBHA 1RK7A 4FF9A 3SODB 1BA9A 2V0AA 2AQPA 3QQDB 2ZKWA 2Z7ZA 1JCVA 1Z9PA 1E9QB 4A7UA 3RE0A 5KBKA 1L3NA 1YAIA 2GBVA 2XJKA 1PZSA 2Z7UA 1B4TA 1BZOA 2Z7WA 1SDAB 3KH4A 2WWNA 1JK9B 1YAZA 3CE1A 3L9EA 2WKOA 3K91A 3QQDA 2WYZA 2WZ0A 1COBA 4BCYA 4BD4A 1KMGA 1CB4A 1E9OA 2C9UA 1E9QA 1QUPA 1S4IA 2AQNA 2VR8A 4N3UA 1F1GA 4A7QA 3GZOA 3H2PA 4MCNA 1IB5A 2LU5A 2AQTA 2R27A 1XTMA 4OH2A 1U3NA 2AQQA 2Q2LA 4A7VA 3CQPA 1IBBA 3F7LA 3PU7A 1E9OB 2ZKYA 1SXAA 2C9SA 3ECWA 4B3EA 2AQRA 1Z9NA 1F1DA 3KBFA 2VR6A 3KM1A 1UXLA 3KH3A 2JLPA 1MFMA 1SDYA 3L9YA 4A7GF 1YSOA 5KBLA 1SXCA 2WKOF 1XSOA 2ZKXA 4N3TA 3F7KA 2WZ5A 3ECUA 2NNXA 2SODB 3H2QA 1N18A 1JK9A 3HFFA 3HW7A 1PTZA 3GQFA 1P1VA 2XJLA 1E9PB 1SRDA 3GTTA
chains in the Genus database with same CATH superfamily
2B8OT 1CGTA 1XIWA 2AEOA 3V7AG 1DBAL 5D7JB 2QPDB 2FZ3B 2GHWB 2ZYHA 3TJEL 5I1JL 4H4NA 1NMCC 1VAHA 4ZUTA 4G6AC 1IM3D 4BA8A 4TSCL 4IRSC 4QHUB 1FFRA 1SOKA 4GQPH 4WK0B 3VXUD 5H35A 3AMKA 3T3ME 3QG7H 4MDJB 5DHYA 4F7MA 3KBHE 3IVKB 3IT8D 3UDWA 1KTBA 1PAZA 3TURA 3HUJE 4ERSH 5HJBA 1OAJA 1MI5A 3EH5B 5I6PA 3X1GA 1IKNC 4WDIB 4BZ2A 2ADFL 4G7YL 2VWEC 1VFAB 1SXNA 3IKCA 2EO1A 3VYOA 4NQDA 3VWKA 5EZIH 3LB6C 3ZIMA 5CZRA 2JKJA 3GSOA 4KNQA 2I9LA 4NHCH 1CBJA 3D4GA 4AIXA 2XTJE 3BVNA 2OMUB 1E5ZA 2H2SC 2Q2EB 4X5XA 3SY0A 3X1EA 3MV11 4MJID 3QXWA 2DQHH 1OHQA 1P5VB 2DM4A 3OR6B 5HYFA 3SCMA 2ICWI 3IU3A 3QEUB 1YMHA 5I71C 1U93B 5SWSA 1FAIL 5KBKA 1U95B 1NFIB 2ZXQA 4PRIA 3QIWD 4PRNB 1OWWA 1KIUA 4KJPD 1BEXA 1G9MC 5T3XE 4FYSA 3WGVB 1A7PL 1UD5A 1ZANL 3AROA 2EYRA 2FSDA 2GABA 1VENA 3MBEB 3BLPX 4XP4L 4W6WB 1ZLVK 3ZDYE 2NY5C 1P1ZA 5TJWK 4LPVA 2Z4QB 2Q8AH 4ELKA 5CIPH 4N3UA 3RBGA 2VDKL 4IOSA 4YMPA 2C1OB 4DW2L 3H2PA 4PW3A 4KK6D 4KI5C 1EMTL 2AQTA 5FW8A 3I3EA 1O6SB 4DO4A 3F65A 2ZX8A 1WO2A 4JPVL 4WV1C 4M1DH 1J48A 2IH3A 3IAPA 3MXWH 3CWGA 4GAGH 4K73A 4E41A 3M1OA 1FZOA 5F7MC 1MJ7H 3NCXA 4MMZA 1A4JA 1UXLA 3D85B 3ZLQC 4AZ8A 3DHPA 5LB1A 2WP3T 1R3LB 1AP2A 4XZ4A 1QLFB 5DFWH 2O6FA 3QJUB 4R7NB 5JW4N 3HS0A 1NCJA 4WSJA 2UZXA 3TF7C 3H9SD 4EKJA 2CO1A 5ESQB 4RQQB 5JZ7C 2V2TA 4DN4H 2E5EA 1T7ZA 1CICD 1F6LL 2HKFL 4I3SL 3TBBA 4ZUVB 2OLDA 2DMGA 5LXVA 4AL8L 4LIQH 2PW1B 1WT5A 1YYMH 5GJTH 5T1KD 4CSZA 3QZWA 5D4IA 1IFGA 4XMLL 1MJJA 3C6EA 2WXHA 1EFXB 3NIDB 3P11L 4YHYB 3DWTA 4BM7A 2BOCB 3M1BB 1PVHA 4X6DA 4YN3A 3WTWA 3ILEA 4YL9A 3GRWH 3ARZA 2X4RA 4K8RL 3TBYB 4KRMB 4FFYH 5HBBA 4KK5D 4UIKH 1S7SA 3JWNH 2GI7A 2JJSA 3QJXA 4P23D 3IE4A 5GGTA 3UG5A 3F5WA 3R18A 2AJZA 4TTGA 1HQ4A 5CLWA 5IVNA 3GS7A 2Z8SA 1ZPUA 4JFUA 2OYKA 1FHGA 4Z3GA 2OL3A 2WOBA 3V9EA 2WWOA 4PY8J 4BH8B 3U4BH 1JZIA 2RTTA 4PJ5D 2VO5A 1KNOA 4XN9A 3UGXA 3LKNB 3C6LA 4YNYB 2PPAA 4NUMA 3S5ZA 2RCSL 2AJYH 2FYYB 3FSOA 5KYUA 3ESUF 1F4YL 2I07B 5E4AA 2F58H 4MD0A 4CMHB 3RTQB 1M71B 3V6BR 3JTTB 4RLDA 4FQXB 3DBXA 1Q0EA 2VXQL 5BVPH 2PO6B 1PFCA 4WW2C 2ESVE 4LSTL 1XBRA 1A1NB 1NAKL 2WO3B 3HMXH 4NPYA 4MDIB 1CF8H 2VMCA 4KVCL 3LIZH 2DQMA 2VXTH 3KXFD 5C0BE 4ZUTB 4POUB 3RHWF 2WK2A 3F6JA 4A7UA 4A2LA 5IFAH 2VXSL 3WU1A 1I8LA 4X8JB 4HKJA 3K6DA 4KHXL 2R0LH 4AEIL 5BUAA 3W81A 4AQ8C 2PWFA 4H8WL 4LNVA 4M6OH 3U7YH 3TP4A 2WVSA 1B90A 4DKAA 4NX0A 5DRNB 5GJSH 3VCLB 5SWZD 4BUQA 3I50H 3U1SL 1MQKH 3MODL 2PCXA 3RAJL 1IB5A 5DD6B 5FYJD 1NGWA 2IGFL 3EZJB 4U1NB 1OCCB 3EGSA 2EDMA 4KI1A 4LOFA 4RGMB 4X0KB 3TIDA 4Z7QB 5DVNA 4HWZB 2Z4QA 4OGXL 1W0VA 3ARFA 4ZSOE 2VL5A 3H9HB 3WENA 2P24A 4PJ8A 4F3FA 1P5VA 1GOGA 1D7DA 1NCCL 2DYPB 3HN3A 4QYOA 4RMVA 5HD8C 2ZUTA 3QXDB 1EXUA 2UY7B 1SN2A 3MA9L 1MIEH 3QYNA 3DI3B 1SDYA 3CDCA 3PAUA 5FGRA 5SWSB 4JO4H 5KVDH 2VC2H 2K45A 2YQGA 3VFPA 2G3ZA 4IOIB 1H5BA 1SVZA 3I6KB 2N0MA 4NS0A 2V7NB 3T9WA 3TESA 1GMIA 3HKZA 3KVDD 3BPCB 4R7XA 3UP6A 3ZE0E 5JMOC 3T2OA 5LLIC 1N4XL 2OJ1A 1XSKA 5C6WH 2LVEA 4GOSA 3PQYA 1KGXA 4I18B 4YPGB 5AW8B 3AB0C 5C0BA 4ALAC 1OAUH 3B83A 2LAAA 3FUMA 4YUEL 3HRZC 4CN4A 1QAWA 1MJ8H 2XQYK 2GK2A 5DFTA 1HIMH 2XSKA 3KLDA 3POCA 5F6IB 2XACC 5CJBA 1WBYB 1QRNA 1ADQH 4PB9L 4PRIE 2W1NA 3MACL 3IFOA 3F00A 4RGNC 1TTFA 4OM1L 4NQXB 3ZE2B 4KKZA 5SWZE 3PCYA 5CXPA 2WQ8A 4XNQB 1J9CT 1HSAA 2YD6A 1H3VA 3BW9A 2MTPA 4GW4B 4MJIA 4FFZA 4WEMB 3WCYA 2ZNXA 1GYCA 2X4OB 4L05A 3SCMD 2JLLA 1J8KA 5I6KA 1YNKH 2VRQA 2XIIA 3IJ8A 3N91A 5SWSD 2Z91B 2WYIA 43C9B 4RMTA 5ESQA 4BE5A 5DMKB 2VUKA 4JO3L 3BSGA 3W39A 1JXKA 4K7PL 2WM0A 4OJEH 4B9YA 2DWEA 5EU6E 4F37K 4X99B 1KDJA 4B5EA 5LXGH 1WZMA 4BKLB 4C47A 4U0QB 4D8PB 4PJGB 2R0WH 1IV8A 3GJFK 1PKOA 3UBXA 4XC3H 1AKJA 4EUPA 1DLFL 1EAOA 2D3NA 3SPHA 1T7VA 3T4AC 2UY6A 4M6MH 3CPUA 3PJSA 4P8QA 1WA0X 4ZUWB 2YWYA 3T65B 4GXVL 4MMZC 2AAVA 2H32B 3FFCE 2O4EA 5FM5M 3J27A 1B0GA 2ZYIA 2EDKA 1CFNA 3JV4A 4WWPA 3LRMA 4E41D 4QJ4B 1XGPA 4BD4A 4X4ME 3DX4A 1WE5A 4NN5C 1QP1A 4JFEB 4ZFZA 4QO1B 5FKPA 1CG9B 5KYXA 4Z8FL 1U9KA 2GTZB 2XQYA 4NWTH 2O5ZH 4JQIA 1JBJA 1A7RL 1LM8V 5DT1L 1TQWA 5DRNA 3O2DL 5B4MC 4UM8B 1SXAA 4QHMB 1THCA 4JCMA 3VU1A 2FO8A 2X2HA 2GJPA 1F02I 2BNQB 3VG0L 3X1NA 4DKFL 1OF0A 3LPWA 5LCVA 5T5FA 4Y16B 3U0PA 2P80D 2B08A 4FQ1L 3S8WA 4TUKL 5JHMA 3UABA 3GRGA 5KVGL 2WAQA 1VACA 2L7JA 4FTVE 1HNYA 3MXVH 4JDVB 1D3CA 2NXZD 3L3HA 2G9KA 1WFOA 5CZKA 3BVVA 1BYOA 1GYWA 3AABA 4MYWB 4NO3B 1CDBA 3DKHA 2X9ZA 1BVNT 3ZE1E 5A16A 4PB0H 4TNWK 4R2GC 2XU9A 2X4PB 3STBA 2FLBT 4WW2A 4XCEB 1Q9LA 2YPVA 5DO2C 3T0EB 1DN0A 1F8TH 4X9YA 4GFTB 3RA7L 3FB7B 4FNQA 5IFAL 3IJYA 3QA3B 5C0AA 2KZKA 3EYFB 3AFLA 3QUXC 5CLZA 3CQQA 3V6ZB 3BUQA 1DBJL 2VDLB 2EABA 3ETBF 4O00A 2O5XH 1CFSA 2NY4B 4ANWA 1ZEAL 5FECB 2WLIB 2BY2A 3HE7A 3NIDF 4JPKL 5K1JA 3ULVE 4IBZA 1S5IL 2FVNA 3KEHA 2EECA 2LHAA 3S4SA 1RHFA 3W5NA 1CIDA 1IC1A 3N44F 3TCXA 2AI0L 3MRCA 3T0EE 3VWJD 4ECNA 4PLJD 4LCWE 3GSUB 4ODTL 3RWDB 5C0BB 1SUHA 2CE6A 2V2WA 1FAIH 1VFBB 2MPVA 3FB6B 2J56A 3SODB 1U3HA 3RI5F 3JV0A 2GVYA 4NGHL 3QFGA 5ALCL 3I3DA 3NFSH 3BO8A 3K0WA 3ZTNL 1TSRA 3WHE1 3IU4L 5DK2A 1TTUA 4AVIA 1VJSA 4HCGA 5DRWA 4L0YA 1HK6A 1T2XA 3EF7A 3QPQC 5FYLE 1IC0A 1PY9A 5AKSA 5FV1L 3JXAA 2IH9A 2VISA 5AVQB 2ZWKA 3FH7A 3G6JE 1BXUA 2PXYD 3CN3A 2JMRA 1KN4L 4JB9L 3H9ZA 3CXDL 3GZOA 5A2KH 1V05A 5TFSH 3OKDA 4JG1H 4IMKA 1EXUB 1I3VA 2UY7A 5KJ7E 1LXMA 2PO6D 3GUTB 2AQ3A 2DQDH 5L2JA 3GTNA 5AVVB 3CCHB 4FI7A 3HRZA 5BMFH 5B1BB 4HG4J 5CJ8A 1FVEA 1DYZA 4CBPA 2ZKMX 3WMPA 2X44D 3A6BH 5C08A 1JWSA 2YC1A 3TJEH 1FZKA 2Q5BA 3A0OA 3IBOA 3K6IA 2ZAGA 2WN3A 2C3HA 1X7TA 1I3RB 3ZL4L 1D2PA 3DXAD 4ODSH 1KTJA 3TXAA 5A1AA 4ODHH 4QAWA 3BC9A 1S7RB 2H2SD 2K0RA 1TCMA 1I7RA 2PTUA 3D3VE 2MCPL 1CE6B 2WNGA 2A6JB 1YDPB 5J8OA 5DQJB 1P1VA 1URLA 2F68X 3BN9D 3OGCB 1CG9A 3QE5A 4XPAL 3CUPB 5I18H 3AREA 1X5JA 4JY5L 1OPOA 3D30A 3WBDA 4HS3B 3C2AH 1QO3B 2YGOA 2CKBA 5FGBA 3F64A 3MBWA 1BOYA 5IMOB 1DCEA 1D6VL 4JS7A 2R1WB 4KJQD 1SHXA 4N1CA 4QHLA 6CGTA 4X9FA 1DVYA 1ZVSA 2DH3A 4R5TA 4NZRH 1UT2A 3V6FA 3VH8A 2RALA 5TDNA 5JIMA 3UBXI 3VXOA 3KPRB 5EZLA 4AGMA 5T5NF 1RZKH 2OCCB 4NOBA 2VLLB 1BGXH 3B2VH 4L3ED 3V6OE 1FE8H 4KK6C 1X7QA 4QNPE 2YD4A 1RZ7H 4R3SA 4WNSA 2KHAA 4LHUA 3ULSB 4EF3A 1I9EA 1M56B 3ZKQD 3FOMB 4ZW5A 5FOJA 3PP4L 3MBED 3QXVA 4JHBA 1ZV5A 3U7WL 5FOBB 1TQVA 2ZUUA 4RA3A 4XCFL 4QWWC 5IGXL 1GJWA 5IIEA 3U6RB 4XVOA 3FTSA 3BQUA 1WAAA 3DIFA 1QQDB 3CZFB 1AIFB 1DJHA 1UC6A 2QKSA 3FT4B 2UY6B 5E9DD 5IMKA 2RQEA 3KM2A 2HJKA 1QATA 1E3XA 1T2JA 1WVZA 2VTFA 4FQCH 3L3IA 5L4FA 3FO1A 1QHOA 4LKXB 2ED8A 4OLWL 1D5IL 5J11B 1TJHL 4BDVA 3MTXA 3WN5A 2J57A 3GMPB 3LMJL 3HMWH 5ADOL 4OLXL 1PD0A 3FS9A 4HWEL 2ZXDA 1IGCL 4QGYA 4GSUA 1KLGB 1X5IA 5KS9B 4MDJA 3IE9A 3FQ1A 1F8TL 4PI0A 4PW4A 5CF3A 4H5SA 2NCMA 4OT1L 2IXQA 5DRZB 2Z35A 3UMNA 2Y0SA 1PSKL 3U1QA 1CFSB 2R4SL 3DVFA 5TE6H 1I1FA 3TU6A 4OCRH 4CSPA 4FFWC 2P80A 3AITA 1Z9SB 3K5RA 4YS4A 3KBPA 2W81C 2PF6A 3LCYA 2Z93B 3DX9B 4Y4KC 3RZCA 2I9LB 4FTVB 1RZQA 2NSMA 1FSKB 4N0CD 1T20B 2GTWB 2IDUA 1SYSB 4FXKA 3IWUA 2UWEE 4LVOC 2B0SL 1FL5B 3PGDA 4RISL 4ZAKD 1EDYA 1O6SA 1QFOA 4XOEA 5LNGA 1QA9A 3B1TA 4Z5RA 2BIPA 4OCSL 2V8MA 2ZKXA 3GSXB 4NNYA 5KVFE 3K74B 5IQOA 1IEAB 4XPBL 4MNGE 2EXYD 2SODB 3ARBA 1GGBL 2A6DB 4OFPA 4O02H 5EO1B 1LMIA 3VXTA 4AYDC 4K23H 4QR7A 1E6JH 3KL5A 1I82A 1QMUA 3GBEA 4EZJA 3OKDB 2YAHA 3ZYIA 1NSNH 4J1UA 1XR9B 2YMTA 3ETSA 3WSQH 1Q9WA 4GG8B 1QFWI 1N26A 2ITDB 3T0XA 5A2BA 2B7DT 4PWIA 4NB7A 2WXIA 1FPTH 5H2BB 5LGHH 2ICCA 4EEEA 3OKOA 2LFEA 4LXFA 5JDJA 4G7VH 5GZND 3MUY1 3FQXB 4K8RD 1U3HC 3GZQA 4QY8B 1HJCA 3PUCA 4HKBB 5FW7A 2V5TA 1UH3A 1VF5C 4JFXB 1CLYL 1J12A 1ORSB 2FQDA 1UXWA 5EOTB 3UYRL 5E1QA 3WTXA 5GISL 2Y23A 4X6FB 2Z92A 1PG7W 1IBGL 2CR3A 1OW0A 4ZUSA 3UAJC 1ACYH 1FO0L 3FAXA 2PPFA 4UIMA 3X13A 1DJXA 5E8EA 2YQ2A 4NO5B 3VFNB 3ETBJ 2O5YH 2VDOH 4IMKC 1TKWB 2EDTA 1JF1A 5DUBA 3RIKA 4D0DB 4ORGB 3DMMC 3IDIB 4M4RB 1A0QH 5HYQB 2GI0A 1KENH 1ONQA 2B59B 3INUH 4HSCX 4N22A 1AE6L 2Q7YA 4F5CA 4WEBH 4NC1C 5JORA 5CO1A 3ZE1B 4GAJH 4RMBA 3C87A 3L3IB 1Y18A 5IQ7L 4HOWA 4DEWA 3GBNH 4BFIA 2NXYD 3P4OA 4IU3A 1QR1A 4KKBD 4UQIM 5HHOE 3BVUA 3VAEA 4ZMNA 5C08D 4HJJL 4JHUA 2X28A 3P0VH 3TBWA 4E41B 3S88L 4QYAA 2DYPD 4ODXA 5HDBF 4P07A 2ZUXA 3WUZA 4G9DB 1X9UA 2W38A 2EVIA 5FDWB 3ZE0B 1EEUA 1Q38A 3ZHKA 5L88L 2FIKB 4OH2A 3BZEB 5IHUL 1OB0A 2DDQL 3GSNB 5D1ZI 3NGBC 5HHNB 4PRHB 1UCTA 1GGBH 1WCQA 1XR8A 1SJEA 4EDWL 3OJVC 2NCEA 3THMH 5CP3H 3VQMA 4UV4L 3T09A 3S3JA 3UIYA 2NPLX 3KNBB 4GIOA 5AKRA 3R19A 2PTTA 1MFMA 3KYOB 2R9HC 1MW0A 1UFUA 3QNXB 4P5SA 3E38A 3OAUL 4PFEA 2EICA 4KY2A 1PX3A 1ZA6B 1R33A 1CGUA 4F8TA 4MA7L 5BRZD 5GGSB 2YA0A 3HI5L 2Y3AA 4O2CB 5HI5C 1JZHA 4P2QE 5I19H 2CRYA 1MHEA 3QZOA 3TVMC 1D6EB 1T5XB 4WSGA 3KS0J 5CHNA 3PV7A 1SM3L 1JTPA 1XF5B 5EA0L 1TJIL 4FQJL 2HJLA 2NY6D 4HIIB 3MLYH 4QRRE 4RWYH 5HHVL 3WO4B 3EYVB 5E9DA 4G9FB 2GUOB 4PUBH 1SXSA 1NGQL 2OJEA 3FU9A 2QELA 3DO3A 4MD0B 3IXAB 4OZGE 4N0YL 4EI6B 1JVLA 1TU2A 3D6GA 4HK0A 4XN8A 2DL9A 5FAAA 4DWHA 1PEZA 4N2EA 4MCYA 4N86A 1YYCA 1AFVH 4P2OC 1V55B 4LARH 3PWPB 4JDTL 4KU1A 2WBJC 1E8WA 3MRHA 4RCAA 4UYPA 4K9EL 4ZODA 5EU7E 5TK2A 4LP8A 4NOFA 4OB5H 1T0MA 3KBEA 1RZ8B 5F1NA 2FBJL 5HYJB 4AITA 3BWUC 3HZVA 4C4KT 5FUOL 3WY3A 5A2IH 4HKJB 1FFOB 2ICWA 2V17H 2F58L 2WXMA 4HFWB 4BQ8A 4BXSV 1J5IA 4KKQA 4WKZA 2JNZA 1E28B 2VKXA 3L3GB 4H1LG 1BA9A 3VD2A 5JHDB 1G6RA 1OTSD 2LLGA 3WUWB 5K9KA 5FO7A 1BZDA 4EN2A 1CN4A 4NO5A 3R7RA 5I1CH 5LJYH 1L7TL 3OPZH 3RLSA 4QGTA 2OXGB 2NY5H 1UWFA 4P3CL 4KMTL 4DVRL 1CR9L 3BWSA 1JPEA 5JIIA 3Q0HA 3FQRB 4O02A 4PTTA 2YGVA 1F5WA 1OV8A 2NW2B 3D87B 4NKQB 3ZO0A 1UXWB 2BINA 2NOYA 4UOW1 2VR4A 4Z7UB 2NUTB 1RIVH 3OAZH 2AQNA 4ZMQA 5AD0A 4ZAKA 4MS8C 3VWKC 2E27H 1OCZB 1A21A 2AXFB 2A9NL 3GK8H 3ZT5A 2IG2H 3TCTA 1FP5A 3L1EA 3W39B 4NQEE 4M6NL 1SDDA 4FMKA 1ZLUH 2OI9B 2AGJH 2G5RA 4EE2A 3G5ZA 2XPYA 4JO1H 1C5CH 4FI6A 3ZDXF 4TN9A 4XNAA 1CLCA 4JFQB 4OLYL 1A6VL 3CX2A 4HWBH 4PBVC 3PAVA 2OK0L 1AY1L 1QFWM 5AUMB 5GS0D 2BVEA 3GSNA 4APQC 1NDMB 4PLJC 5F7DA 1FV1A 1ZVYA 3NZ8A 3QUZC 4K2UL 2CCLA 4F8LA 1G4MA 3VSTA 1FC2D 4MNQA 3WNOA 3HE6C 3KPNB 4A04A 5E24E 4MMXC 3KEDA 1KTCA 1WISA 4PWJA 4JPIB 4LOEA 4D94A 1UM4L 5DFAA 4NIKB 1AR2A 4OJAA 2AJSL 4R83A 1ADWA 5DMIH 1BEYH 2OK0H 2VLKB 1DEEB 2W9LA 3ZR5A 2P44B 2ZD0A 4D3CL 1KTRL 3F62A 5CKAA 1KYUA 4F7TB 3W11C 3O2WH 1R5WB 3ARDB 1KGJA 1MZYA 1RUAH 3NAAL 3Q5TA 1TZHA 1ZANH 4XP4H 4Z7VF 4C57C 4ZMVA 2X2JA 2IOMA 3KNBA 2OYMA 1X5GA 8FABB 2DI8A 5K1NA 3C9NB 4P3CH 1LGVA 4NGHH 3Q3GB 4M93B 1EJ6A 1NWPA 4NO0A 1UEMA 2GSMB 4XVTL 4JZJA 1TVBA 1KTDA 2HPTA 2EDLA 2Y7OA 4XMTA 1HCVA 1CLVA 4J3OG 3CH1A 1Z3GH 3MFGB 4X6EB 5FGSA 4DETA 3DYPA 2AXGA 3EO1B 3GDCA 1U4EA 1WV7T 2ADIA 3DVGB 5I0VA 1HEHC 5I1HL 1ZA3A 2H32A 1AR1C 1AGCB 5LUMA 4TSAH 5KBPA 2G4GA 3VI3E 4OF7A 4NDMB 1EO7A 4XNZB 2OSWA 1C12B 1RZKC 2O6PA 2MJWA 5DQDL 3WTUA 4GQRA 1L6PA 2V3FA 4WI5A 2XWCA 1J9SA 5BV7C 3MRCB 3ZYJA 5F3BA 1PNCA 3PJNA 3VXNA 2H4EA 3UG4A 3FB6A 5GGQH 3DYMA 3L5JA 5A6IA 3QUYA 1T0NA 4I0CC 1CYWA 4PRHA 4GJTB 5MEPA 4YZFE 3F3HA 3CFDA 3BOVA 1NL0L 1N8ZA 1TNMA 3IN0A 1ZVHA 3VXPB 1KTLA 1AOZA 2OR8A 4GI9A 2JCCB 4HC1A 3V4VL 4K55A 3SDCA 4Z7AA 2NW2A 2XVKA 4PGZA 1M42A 2BCMA 4I77H 2ZUYA 2DV6A 3RB7A 1J8HB 3QDHA 5LWYL 2EZ0D 4DUVA 4NRZB 3E9TA 5FM5O 3MRKA 1R3KA 4OLVH 1JUFA 5JHDA 4HLZH 3QXAA 2A9NH 2BVQB 2ZPKL 3PAZA 4PGCA 2G75A 2H5UA 3EOBA 1N0XL 3OAUH 4M29A 2QKIB 3D0AA 2D9QB 4K7FB 1CD9B 1S7WA 1FO0B 4RGMC 1T2QH 3LN5B 1QLRB 4RNRA 3MU3A 3O45A 2AEPH 3MJ7B 4J4PD 3TTYA 1JK8B 4HBCL 2YRZA 2BSBA 1KJ3H 5E0QA 4EDWH 2QADB 3AWEA 3MUGB 1C8QA 1S7TA 4JHWL 4MA7H 2VNCA 5F71A 1Q72L 3CDYA 2VDQB 2H3NA 3NJHA 1A9EA 1CCZA 5F7DB 4W70A 3PDDA 4OD2B 4XO4A 3LEYL 2OL3L 4EI6A 4IRSB 2OMWA 5BZDA 3GSVA 4ANUA 2ZOOA 4M7KH 1L9PA 4XVJH 2IVFC 4YSUA 2V2TB 1XH3B 3IMVA 4HETA 2L04A 4HJGB 4LMQE 4GO9A 4FGMA 3C5SB 4MASA 3W1ZA 4B0MB 2B14A 2X89A 1FNEB 2V7HA 1BVZA 2FHCA 1PLGL 2XYBA 5ES4B 1W0WB 2G5UA 2XCMC 4FKKA 4NQVB 2GB2A 4G6AD 3HPLB 3JV6B 4AYBA 2JF1A 2F61A 2J20A 4F37F 1G7HB 1NTDA 3ZL2A 1K3ZA 2X4QA 3FQNB 1JRHI 1UXSA 5JR1H 3RPBA 4MD5B 1JPST 4JO2L 1HYRC 3S0PA 3UEZA 1ROWA 4DNLA 2AJVH 2X05A 3J2PA 4WY7L 1CIUA 1FVCA 1KT2B 4Q4EA 4W1TA 3VGBA 1RQ5A 3ESMA 1TVBB 3TEUA 3SOBH 5JYLA 4JAMB 1DTUA 1XAUA 1HC1A 4F8PA 2Z65C 1EJOH 4XMXA 1XZWA 1HTYA 3VXSB 2VDPH 1IAMA 2XJKA 1QBMH 4LGRB 5I23A 1JPFB 2O5YL 2YSSB 3M17A 4NNPL 1H9VA 2PPCA 2XI9A 2ZTBA 4L4TA 2D7OA 1HXMA 4M6AA 5CINL 2HX7A 3WL9A 5IMMA 2IO5A 4GW1B 2C9UA 2VQ1A 1WA1X 4JRYB 3T1FB 3W37A 4EOWL 2VKWA 5FKAB 3CD4A 3CK0L 4NQCA 4JM2F 2DQJH 2F9BT 5E8NB 3U0WH 2WUBH 2B1AL 1NC4B 3WHXB 2WD0A 3DVGA 1FN4B 4CDGC 4AEEA 2X41A 1S8DA 4NKIL 4I3RH 1QYGH 3N85L 1TTAA 3VSUA 4HQQH 4JFED 3WN5B 1LILA 3S8FB 3MJ9A 3CSFA 5D7SH 4GT0A 3F85A 4ISVA 1TQCB 4JE0A 4AK2A 1BP3B 4K71B 5DEFB 5FWRA 3WTTA 3F7YA 2WLMA 1AI1H 1GAFL 2FO4B 2YPLB 3ML9A 4KVNH 4N6QA 2D2CC 4MAYB 5LG1A 1BZ7A 1W8EA 3GUFA 3FPYA 5TE4L 3B5GA 3PWPE 4O51A 3WEXB 4DP2X 5AVUB 2BP0A 1F00I 1RU9L 3QJZA 3ZXAC 4XWGL 4P0DA 4ZPVB 2CBTA 3QO1B 5C0IB 3T2LA 3SE4C 5DEZA 4C83A 4WWKA 1NWOA 4P23C 5CJOH 1UH4A 2PCPB 2QLYA 3RVWD 1LYQA 3ZY7A 2BS9A 1RHHA 5ENWA 1EA9C 3HZ3A 2AF2A 1OAZL 4ZSOB 1BG9A 1QI5A 2OFQA 1DSWA 4BHUA 2QVTA 5T1MA 2HRPL 4FYRA 1W8OA 1D9KB 4IRZA 1J8HD 4E42A 2P5EA 1F3JA 5DQ9A 4KVCH 3DROB 3N43F 3NSCA 1NIFA 1I4FB 1FNAA 5DJ8B 5AW3B 3GSXA 5MEQA 5FFLA 5JYMA 4NP4H 4ZMLA 2NQCA 3FRPA 5DHXB 4J28A 4LAQL 4C55A 3LS5H 5AYTA 2LAGB 3HZYB 2ERJC 4P46D 1ESOA 3HJ0A 2V37A 2RCSH 5K5YA 3H9SE 5JMRA 2ZAHA 2RMNA 5HGDA 3II3A 4QLWA 3FU5A 3KS0H 2X4QB 1NBZB 2DLFH 2Y9RT 2YJQA 4LO9A 4V2CB 1NBVL 3DTXA 3CFQA 4IU2B 3RX7A 1D5ZB 4UDUB 3BZFB 1T5WA 3TZVA 4ZRGA 3SDCD 4JQXC 3ZTJG 1I8IB 2O72A 3MLWL 3QUXA 1QSED 3GI9H 5K9JL 4M48L 5HY9A 3GXIA 3UJTL 3T8XA 4YX2L 2L8AA 5EEZA 2R15A 4XNQA 5LKNA 4HV8B 2G9HA 3L81A 3JVFC 1MRFH 3MOBL 1LWHA 4ZUSB 3UH8A 5T5FL 4B50A 1AGDB 5EO0B 4IBUA 2XLLA 3AY2A 4XP1H 2DTMH 1MJUL 1S7QB 3X3GL 1U8NA 2WVUA 1IBYA 3RIFF 4BFJA 1FE8L 3MCLL 5FWQA 3TC9A 1DDTA 1UHVA 3P9MB 5AW7B 3ATBA 3IDNA 3MJ7A 5DC4B 3ZUCA 4G6FB 3O8XA 3HI6L 2VM3A 2BLFA 2J8UB 5CP7A 2WYHA 3UCRA 3UJJL 3VXSA 2BX5A 4JL2A 3SKNA 1F86A 2P5PA 1BQ5A 1JDCA 2IMMA 1RK0B 1OE1A 4L23A 4P9HH 1IGIL 2O26U 3WFBH 3P3YA 2FJSA 1G9NL 3BE1L 3MV8B 3GMQB 3ABMB 3FFOA 2ID5A 4HIQA 1PTZA 2QVKA 2RFXB 5E2TH 1ZAGA 2O6EA 4PJBF 3GZPA 2WZ6A 2EYSA 4JG1L 4JG5A 1X5XA 4P2CG 5EOCJ 4ELMA 2IGTA 2W0LA 2VN3A 2UX7A 4X7TA 2DI7A 2MQ0A 3FU7A 3WNKA 3HPLA 3S2AA 4KTEL 4A1RA 4Z7VA 4NZFA 4PJDE 4MCZA 4ZMWA 4F2FA 1MCBA 2JH2A 3D0LB 5EC1A 5IQMA 1MXGA 4AYFA 5C0FB 3MCLH 4QXGL 2CIKB 1C7SA 3UC0L 2ZG1A 3H3BC 4XP1L 4N1EA 4OFQA 2R69L 2YAQA 1U8CA 5EZOL 2GKIA 1DZ0A 3K7UA 4WTXA 2CLVB 1HEZA 1ND0A 1AQMA 1IZJA 2BP8B 1U2CA 4UM9D 3PDOA 2BMKA 2WOYA 5ACZB 3HA0A 4RGND 3DK0A 1RK1B 3VFGL 5B3SB 5KTEL 4OM0H 3AT0A 3LTVA 1JNLH 5AZ2H 1FUNA 4OCNC 3QFJE 4IK6A 3Q1EA 3SE3C 5F97E 4HK0B 1LE9A 3SKMA 3KJ4B 2V8LA 4KTEH 5GZOD 1Z1WA 5BVJA 4J5VA 3VMOA 1CK0L 1D6VH 5BZWB 3HE6D 2H6PA 1FRGH 5GS2D 4KWUA 3WG7B 5BXFA 2MKLC 4ENEC 2CNYA 1UWGL 4YSTA 3SYOA 5DMGD 1X6NA 2CBMA 2F19H 4OZ4A 4JW3A 4J8RB 4Y1AA 4NBZB 2F15A 2OR9L 5JQIB 1PX8A 4N90D 1G9NH 2BSTB 3DX3A 3UZVA 4WNQA 3GNML 3BQUC 4JVPA 1T3FB 2OM5A 3QQ4A 1NZRA 5GRUH 1YYLL 4B9CA 2A83B 2Z64C 2ZAIA 5CFHA 2KYIA 3B9EA 2KLSA 2Y7LA 2FL5B 5DZOA 1B3JA 1FFTB 2JELH 4Y9GA 3TM6A 5ISZD 2DQGL 1F2QA 1UM5H 3CQPA 1UUSA 3RPKA 2NUTA 5AD0B 1M05B 1DJZA 4R4NC 4JFFE 3RWDA 3SDYH 2OS7A 4Y8DC 3MRMA 5JUEL 3V5KB 4TUJA 5GSVA 1E6OL 2CDEA 2HG0A 1NANH 1R3HA 3F5WB 3FO2B 3FTXA 5CGTA 3WXWH 5C8JB 1YSOA 4HHAA 3I6GB 1AGBB 5FC9A 5IEKA 4FXLA 1BXVA 5CGMA 1XSOA 5IQ9B 4L18A 2BIMA 3JBG7 4MJ4A 2NQDA 3MNMA 4OCXL 5I5RA 1SLWA 3D08A 1BQRA 3O8XB 1K6QL 1HS6A 2JK5B 5CIPB 1ZSDB 2UWEA 2IQ9H 4FE9A 5FA3B 3ABZA 1OZUA 2P5ED 3DHJA 2MKWA 4H26B 4J12A 4Y9BA 4BZ2H 4NKOA 4GMSL 5DJZA 1AO7D 4I13B 3C08L 4FXKC 3QA3A 2E9WA 3MYJA 4G7QB 5T33L 4KH2A 1ITBB 1GOHA 1XH0A 2ALWA 4N2HA 2VXQA 3BP7B 2AI0H 2D73A 2YHGA 3HB3D 3KVQA 4MJ5A 4DGVL 4ZUVA 1U8MB 1IBDA 3E7JA 1A6WL 1CGSL 1FGVL 1GC1C 2OXHB 3KE0A 4P46A 3QP3A 3ARTA 3SGEI 5FO8A 1R17A 3TIEA 3GMLB 1IIIA 4C4UA 1KXHA 4GIAA 2CAKA 1RZPA 4PH8A 2R4RL 2J72A 3C75A 4L5FL 3BVWA 3HUJF 1K9TA 2HTLC 4ODUB 5DO2D 3V55A 1Q0YL 5C09D 3KVPA 1R5WA 3ULUE 5CN3A 3WS3A 4ZOBA 3TZVD 1CE6A 2WXFA 5IMLB 3KGUA 4UDUA 2GJ6D 4GP5B 4Z3EA 2BVOA 3HG1A 4Y8AA 2N0KA 3F7PC 1BZ9B 2A9BA 4XBMA 2ED6A 3BGMB 5MENA 4J4PC 4PJ8B 2VE6B 1RK1A 5IBUB 1CE1L 1TZAA 3WFEH 4K5LA 4F2EA 1YEJH 3CVIH 1LE9B 2EDQA 2PXYC 3RU8L 1INQB 1O7VA 2IANA 2KLTA 4K3EL 2CIKA 3N44B 3C60A 3JWNE 1A1NA 5D9SB 1TTCA 4XPHL 5HDQL 1P7HL 2Z8RA 1YAZA 1TDQA 5KVGH 2B4CC 2CLVA 1QUPA 1TJGL 2BSEA 3IB4A 4H2CA 4MQ7A 5EFIB 3WHE0 3A6CH 3QIUA 5G4OA 5IW6A 1R34A 1DQLH 2A74B 2HVKB 3OJMB 2Y69B 3DV4A 3FB5B 3MV9D 3P3RA 4HUWB 5I8EA 5E4EB 1HVXA 4NFCA 2WWKT 2Y7MA 5DFVD 4M5TA 3BIAX 3H53A 5T1KB 1NAMA 5BQDA 1DLHA 3QQ4B 4YSCA 4AV4A 4LPWA 1ES0A 5D4JA 3S2CA 1BYPA 3MGOA 1BFOB 1JERA 2K6YA 5AKTA 5IG7A 1F1DA 1RPKA 2GK0B 4CU8A 2PO6C 4HEME 1CD1A 2PN5A 3O6FD 4NAJA 1UACH 4JPIA 4NI3A 2HVJA 5CEYA 1SMOA 5ICZA 1CI5A 3BVTA 5HHQA 2ZXBA 4ZI8A 4PJ5B 1F4WL 3UO1L 2BWIA 2CGYA 2YD9A 4OFVA 5DU7A 1QTPA 3GTTA 1JV5A 3QIWC 4I0PA 4J6IA 2Z4TA 3MUJA 4ZFGH 1SEQL 4N8CH 4OGYL 4ZW8A 2Z3FA 1FWXA 3ILDA 1DLFH 1F90H 3O4OB 5DD6A 1TJGH 3LH8A 3S7GA 1DBMH 4ANXA 1HSBA 1KPUA 4UM9A 3CC5B 3D7PA 4JCWA 3TBCA 1NINA 3TO4C 1JZ6A 1RAMA 2DKSA 2DIAA 5GGVL 5KVEE 3KD4A 4UZGA 3NUKA 3OHXC 3AADB 3E8UL 5BS0E 5I6OA 3VGHA 4JY6A 3ENEA 4KJQC 2CDEB 5GZOA 4QRRD 3NJGA 3DRQB 3TNNB 3E6HA 1XF4A 1CLOL 2DPKA 5GS2H 2R56L 1IKOP 1KCVH 1HCYA 2K9FB 3HUJB 2YD8A 3IKKA 4LLWA 5T1LB 5DVMA 5GJSL 5C3IA 5EO1A 4HD9A 2X53A 2FIRT 3EYOB 5CAYB 3AXHA 4Z7WA 5BXFB 4TVUA 5E00A 2VXQH 3RWEB 5K69A 4C59B 4X4YA 2OZ4L 3CPLA 2AC0A 4PSRA 2VR7A 1KYDA 5D1QA 3KPSD 3V4VA 4FZEL 2BNQA 4PWGA 4PMFA 3VYNA 7CGTA 3FU3A 4JFSA 1TYEB 4G9FD 5ICUA 1DZBA 4Q6IA 4P59L 3AZUA 5IVOA 2EH7L 2K3TA 4LPCA 2C4XA 2BIQA 3MRBA 4H25A 3QW9A 3INOA 4GPVA 5F9WB 4ZFOB 1KCSL 3PIQB 1NFAA 2FX7H 3GYRA 2KT6A 2WY3B 1EZLA 4XVTH 3C08H 4KJYB 4X5LA 5E1AB 3RDTB 1J5HA 3CN4A 1A4KA 1QFHA 5FUCE 1LNUB 3T08A 1KB5H 4PJFE 4WHYH 1JHKL 2VT0A 3WY2A 3F7LA 4LLAA 2FGWH 2P8MA 1J1XH 4O4YL 2LQRA 3KPRE 2J55A 2W0FA 5F9WC 2B3IA 2I5YL 1RJCA 2C9XA 3BHBB 5E6RB 5HGAB 4G6KH 4F7MB 1OP9A 4YO0B 5IBLD 2D31A 3MOQA 4M43L 1NCHA 4N0CC 4XE5B 5JORB 1IGTB 3VMNA 4Q2ZA 3KPQB 1K8IA 3LNGA 2DIBA 3G04B 4AJWA 2CA4A 2GJJA 4E0RA 3IK2A 3IJEA 5KZCB 1IQWH 4MA8H 5DJZB 3MGOB 1U3ZA 4U6XA 3SDYL 5LAXA 1NGZB 3ZBMA 2VXSH 4G71B 3T1FA 4Q8BA 1YQ2A 2VXTL 3R4RA 2HVKA 2X70B 3MHZA 2FO4A 1BFVH 2FIKA 2Q0ZX 4GB9A 4LVHB 3TBSA 1JD7A 1XR8B 1C5CL 4OU3A 5AW0B 5I1HH 3VRLF 2E76C 1URIA 5D93C 3BAEH 5CZVH 2VDNL 1ZGLP 3NCWA 4P9HC 5C2UB 1MRCL 3QEQB 1ED3A 3DRTA 4UT9L 2I27N 3GK8L 5G4MA 4K8RC 5I26A 4ZW3A 2GIMA 1RUKH 4Y4FB 5AW2B 4LSPL 4PJFA 3MJ9L 2CO7B 1MVUB 1FAKT 5DYOB 3RWFA 1S9WA 1JYWA 1ZHLA 2NDFA 3ARDC 3FF7A 4FFYL 2ROXA 1DVTA 1FBIH 1DVFA 1GZHA 3E0GA 5KOVC 2YARA 4PP1C 5IOPB 2XG5A 1Y1UA 2ZUSA 5ISZE 4K3JH 2J1WA 1R4XA 2IDSA 4AL8C 4L8DA 5DMIL 5ANMB 1CFTB 3D4ZA 5ALBL 1JZGA 1MHCB 2WO2B 1JCVA 2HLAB 3OMZA 5JOPE 3QI9A 1FIEA 3E80A 4LNRA 3T6ZA 2FB4H 1UD6A 1L3NA 2X3CA 2VERN 5DI8A 4MMXB 1N6QL 1FJ1A 4HH8A 4DKTA 1UG9A 2VLJB 4LSRL 5C07B 3ULUD 5DK0A 5FUOH 2R8SH 2BNUA 2VR5A 3QG7L 4TL4A 3BZEA 1M1XA 4KJWC 5E51A 5C0ND 4ES9A 2Y06H 3DTXB 4NQSA 3WUWA 4PJEB 5J12C 2GSIA 3GSRA 3GIVB 4P5MB 1YEDA 4D9RD 1F1GA 3HG2A 1AY1H 3JTSA 4LVHC 4S1QH 4GXUN 4MCNA 2EVJA 3NGBB 2E6PA 5DGQA 1A4CA 5DJ6A 3EYOA 5HDLA 2PTTB 5JW3L 3C8KB 2WSDA 2PW2A 4B27A 5HYJA 4I0PC 1DCLA 2JTDA 5DWUH 4EQ3A 4JO1L 1E27B 3UGUA 3L4UA 4HWNA 4ZFOA 2RACA 3D0VB 3TPKA 1VFUA 4X6DB 3PF2A 4L0ZA 3U30C 3IRZA 3OKEA 1I1AA 4PP2A 3LIUA 1N9PA 4DW2H 3PWNA 3BCDA 4YIQA 3IMRA 3HLKA 1G7QB 2DD8H 4TS6A 3BQVA 5E5UB 3IDMB 5JIDA 1KFAL 2B5IB 1VDGA 2JWYA 3N1FC 2C9AA 4OCWH 5F89A 4HV8A 1P69B 4DK6A 4N1HB 1PG7L 2AJUH 1U8OB 4RGOL 2VLJD 1JYXA 1TUPA 5E5MA 1E9PB 1TT6A 3EKCA 5AYUH 4ZSOA 3OPZL 3LRLA 2QHLA 5DMGC 2R29A 3KG5A 4DPCX 2ZCKH 1JNNL 4RIRB 2WW8A 1QRKA 1MRFL 3O2VL 4G1MB 4AGQA 4YSEA 4ZMZA 1J05B 2IV8A 3GC3A 3CLEL 1OD9A 1MWOA 4M1CD 2BP5M 3PGCB 3NK4A 1F4XL 2AEIT 3PWPA 4Y19D 3E1F1 3VRJA 1E2ZA 4LBAA 4TMPA 2VLKE 4JDTH 1KPVA 2NY6C 2WXNA 4N0RA 4U1JA 5JNYB 4XT1C 1CDYA 3RYMA 1REIA 1ZVSB 4JJ5A 4XNYL 3IJEB 1MPAH 5EO9B 4ZTEA 4O58L 1E28A 5EZLB 1A3QA 3T0VA 4WI4A 4Z7QF 1YJDL 4J7RA 3W3BA 4X42A 1X7QB 5EOQL 1BBDH 3NJIA 3SDAA 4HLZG 3LN4B 3BKCL 3OLIA 3BWAA 2YXMA 1AZVA 1UKQA 4YDKH 4Y16D 3Q1SL 5DZLA 3BVXA 3MJ8B 4PAZA 4K5OA 3TH3T 3KR3L 1NFDA 1RURH 4QHLB 5D55A 1H6FA 4JLRB 4PJGE 2EC9T 4I1PA 1U8IA 2NXZC 4X98B 1U92B 2TSAA 3B3IB 1Q9KB 2F53D 4K5PA 1B4TA 1MCDA 4HAGA 3VWKD 5CSBA 2IWKA 1ZT7B 1SDAB 4D0CB 3PHSA 4TQIA 4UT6H 1OTSC 1RLBA 5DHMC 4HWBA 5JQHC 1U8HA 2ITCB 3GRBA 5HJGA 3H3KA 2OMYB 5ABAA 4KAQL 5F2FA 1BQHA 3L9RA 1KGYE 1X5AA 4JQIH 4DZ8A 1N0LA 5C0CA 1B2WH 4PJIF 2J6EL 2EXWD 1QFUH 2FQEA 3L1GA 7PAZA 3JTTA 3BT2L 3VTMA 1PDKA 2ZICA 5TDOB 3WEAA 1ORQA 4XVUC 1K5WA 1BQHG 3BSZA 4PRBB 2ZWNA 2NT0A 2H6PB 2OMVA 3AJ7A 4IOSD 3V95A 2DM7A 1H3UA 1II4E 4TRPH 1S5HA 1YUHA 2QFRA 4HWZA 2HT3C 4N2IA 5D6DA 2HJFA 1JVOA 3BZ5A 4Y0GA 1MHHA 3LPFA 2UUDH 4TQPA 4F15B 5I0XA 2GPZA 2H9GB 4H5SB 5JW4M 2VMEA 2ARJB 2DJMA 4ELDA 5GS0C 3Q6GH 4TV3A 3BT2H 2DQIL 5EU7C 1FO0A 3CVHL 1GZHC 4P5TA 3BLKA 5DUBB 4JDZB 2F5BH 4UT9A 3NTCL 3WKNA 5L7XH 1RZIB 2R2BB 2P7TA 4X9GA 2JCWA 4JX0A 3TS8A 4LCWB 3BKYH 3BEWA 3D3VD 1G7JB 2AK1L 1O7DC 2X40A 4NNPH 5CINH 3K4DA 4F7KA 3DGCR 4I1RA 3I75B 4XGZA 1KB3A 4TYUA 3P9LA 4ZX6A 1RCYA 2HX9A 4ELME 2OTUB 2VDPL 2QHRH 3N42B 1QNZH 3WIHH 2V9TA 3UYOD 3H55A 2DJSA 3OV6A 5CBEB 3LRSA 4LOUC 4Q56A 1QW9A 5D2NE 3PYCA 1ZT4B 3QULB 4PG9B 4JFOA 4HH9B 3V0GA 3MROA 5C07E 1XCQB 5J6HA 3FH8A 2D0FA 4P23A 3Q6FB 5F3BB 4MWFB 5JR1L 4FXGC 4OZFA 2F5AH 1FI8C 2QQNH 5DHEA 1X5HA 2WVTA 3BDYL 1MPAL 2Z7ZA 2N1KA 3CHOA 4TM9A 5GRWA 1WBYA 3RFRA 4OZIE 3C6LD 3U0PB 4S2SB 3FO0H 4LLDA 5HHMD 3SDAB 4UV7L 3QWOA 1BZOA 2UZPA 2XWTB 3PXJA 5MENB 2BIIA 3GGWB 4JDVA 2WN2A 1E27A 3CGTA 1LD9B 2CO6B 3QCUL 3ROOB 3AU1A 3QZBA 2HKHL 2XVGA 4ZZFA 4FNLH 1N5AA 5GHWH 3RRQA 3DJ9A 3TEZA 1BVOA 2IAMA 4L3EE 4N68A 1L9QA 1QSZA 1UA6H 4J3OF 4WKXA 5EF2A 3IDJB 2BVQA 4A7VA 5F8RC 1NCBL 2XV2A 1OCWL 3VSQA 5EU4A 4WW1B 1FYHB 2P1YA 4PYHA 5KSAA 3ORJA 4BQ9A 3D39D 1P7QB 3NVQA 3P73A 3DTDA 3Q44A 4PJEF 3FMGH 5SWZA 3FSWA 4P99A 1TTBA 1CYGA 4KNTA 3FB5A 1IL1A 4TQEH 1LL1A 4DGIL 1LO4H 3RJOA 4YZFF 1SJXA 4NZJA 1T1XB 2YA2A 4JFVA 3L48A 4N3TA 3LN9A 2P48B 1MLBA 2ZXGA 4QOKE 5I18L 3MLSL 4N24A 4Y4FC 1A3ZA 1FFPB 2DL2A 3SQOH 2EH8H 4FHBD 3V5DB 5DJ2A 1CU4H 4BWWA 1KUMA 1U8MA 2C3VB 2ED7A 3NIFE 2FR4A 1CL7H 1U30A 1OGAB 4CADA 1BMZA 3UPAA 4AYGA 5J5EA 3SDAC 1CGVA 5I16A 1OZTG 5DUPL 3QPQD 3TT1L 1NL0H 1XXDC 4WFGD 3N6YA 2WZAA 3FQUA 4YGVB 3S37L 2NW3B 5DC0A 1FDLH 1VGKA 3ALWA 1EANA 4MJJA 4WU5A 4QXTA 1JS4A 2QGCA 5AVXB 5DC9B 1ASQA 4S1RH 2PCFB 4FNSA 3UTOA 3MNZB 2E7MA 3BUBA 3LDBC 1YC8A 3B2XA 3QUZB 3LN4A 3NP4A 2YBRB 5FV2A 3REVB 2PKDA 1P5UB 2DM3A 4B60A 2R0ZL 5DZVA 2MSPA 2F1EA 5BOPA 4HIEB 1WAPA 1BZ7B 5JHLA 2VDQL 3QHZH 3IFNH 4ZQKA 4OV5A 1PJWA 2F53A 4Y4HC 2KH2B 1BZQK 2WLJA 4PVBA 4R9HA 1DJSA 3VX1A 3DA0A 2VQTA 3I9AA 4WJ5B 1PZDA 4FMFA 4LCUB 2DYSB 1QHQA 2DQUL 4LLWB 2DQTL 1IARB 2WB7A 4FF9A 4XAKE 1WFJA 1RZIA 2R2BA 4RBPH 1A7NH 3UMTA 4AZ8B 1M6OA 1MRCH 3F2LA 4FJZA 3NJVA 2JB6A 3SJVB 1YEGL 3NQIA 3QFDA 2I7SA 1HH9A 4LL1A 2VSKB 3IDXH 4KZEL 1V5JA 1NBZA 3WKML 1H6TA 4Q9RH 1FYTB 2QZ5A 3ARVA 4HS8L 1S5IH 4K3HA 3IFNL 1NAMB 4NENA 1IE4A 1PKQE 3EBIA 5MEQB 5GZNC 2X87A 1IGFH 4H13C 1HX0A 4L37B 1MAKA 2MHAB 4PRBA 4OVVA 3S36H 4D8OA 5KN5B 2PW1A 4GSQA 2GT9A 2HN7A 1ZT1B 2ZXWB 2EIDA 3EO0B 1ACXA 3MTRA 1MF2H 3P30H 4X4YB 1IAKA 4FABH 1ZWIB 4XI5C 1ZK9A 3O3BA 1AZRA 4FG4A 1A7OL 1E2VA 1MF2L 2W65B 4WK4B 3UAJD 5FM4A 1KCUL 1RL1A 4IRZH 5I8OL 4H40A 1SHWA 1UGKA 2V2XA 2YUXA 3ARGA 5L4MA 3BH9A 1KN4H 4JB9H 1T5WB 3TZVB 2FT7A 1YG9A 3ZDZB 4PGJA 5KJRH 1IM9D 1SGKA 1AQKH 3UADA 5JOFA 3X11A 1JK9A 1H15B 3D3VA 5DUML 4OFYD 4U6VL 2FGWL 4ELKB 2CO6A 3ROOA 3ARQA 4AC4A 4Q2ZB 1A7NL 1NDMA 4WF7A 4IRJC 2CHNA 4QXVA 2E27L 1VZHA 2OMBA 2XFGB 4PQXA 1UJ3C 3ATFA 3MCYA 3ZO9A 2DQTH 4AC2A 1JD9A 1S3RA 3RKDC 2DQUH 1EVTC 3WLWD 5L2JB 5I8CB 4JY4B 1TJXA 1I4FA 4IBYA 1CICC 3BT0A 4KTDH 4UI2A 2WXGA 3G5ZB 3DJZA 2OSLB 4WO4B 1HHJB 2GITA 2Y1YA 4OSUH 1E40A 3MRRA 5IHWA 3VXNB 5FO2A 1VFOA 2H6OA 1KZYA 4Z7WB 3EF4A 1YHPA 2FSEB 3OKYA 3VJ6A 1B9KA 1MCPH 3WGUB 3BH8B 4JM4H 5MEPB 4KDVA 5GRZA 3NESA 2XWZA 3D1MC 4MCZB 4W9DC 1JGIA 3EH3B 2ERJB 4HKZA 2V17L 4ZJ9A 3HB3B 4GLRH 1KB5A 4GRLA 4R5VA 4NQCE 4S1RL 3ZDYF 4CJ0A 4PJAB 4I18C 1XH1A 2NLJA 1ECZA 2GBUA 1IC4L 5DRXB 2L7EA 3GPSA 2I60L 1IKFL 1LO3H 2Y1VA 4CILA 4OIBA 3DETC 3MX0A 1R3KB 4IKNA 3N42F 1DUYA 1KCVL 4XCNA 3QXDA 1JZJA 4OLZH 1EK3A 4IEFA 3EBGA 1RJLB 6FABH 3OG4B 4HU2A 4ADJA 5TDNB 1KBGH 3QIBC 1N70A 2G5BA 1HWWA 2Z7WA 4XBEH 1VCBC 5CLYA 5JW4R 3QZLA 2WV3A 3PWUA 1GVIA 1Z0MA 4DFIA 1FLRL 4XCCH 4NRYB 1CB4A 2QZQA 4FQ1H 1MG2C 4DZBB 1HYSD 1U3HD 4ICXA 2F7QA 2CLRA 4TQEL 3CZFA 4OAWA 3OSKA 4B53A 3B34A 3N9GH 3QDGD 5I19L 5KVEL 2YXFA 1Q9WB 5LNDA 4Y2OB 1WP6A 1U3JA 1E4JA 4Q7DA 2MTAA 3TWCL 4G6ML 1ANUA 1MLBB 2BDNH 2GW5A 2PP7A 4FFYA 4OTXH 1GZQA 3BKJL 2WBJD 1RZGA 1RZJH 3FN9A 4OR1A 2O5ZL 3M07A 1SYVB 3RL1B 3RVXD 1FNSL 3T2NL 1QZNA 3QRGH 4HGMA 4XO9A 4UTBA 2OSYA 2HP4A 2VZOA 3V0IA 1LE5B 4X5WB 3WE6B 5KW9L 3DJTA 2BNRB 4W9LC 3HC0A 4G1EA 3QIUC 3EH4B 3VXUA 3CVDA 4JKMA 1USZA 3EJYC 2C1PA 5C0RH 1FNFA 3O0LA 4HF5L 2BCKB 3RX9A 4K7FA 3JTSB 3DYOA 1BF2A 2WINA 2WLLA 2DWDA 1JK8A 2APWA 3DX9A 3RZCB 3KPLA 4CU6A 1ONQB 3VVVA 5D7LD 4L4VE 5AAWA 4DP1X 3H3PL 5F1IA 1TETH 3LZQA 2Z0BA 2ODIA 1E4KA 3BN3B 4KO5A 5IQ7H 4GAJL 2FEEL 2N56A 3QH3B 4OZFH 1YNKL 2J88L 1B2WL 2OW6A 1TCRB 2ADJB 3QJOA 4HHAB 4M03A 1KXTB 2V3DA 3CTTA 1XH3A 5E9NA 1BF8A 5F44A 4IIQA 4X6CF 2CRIA 12E8L 3GJFB 4RMSA 3BKML 4G9DA 4GH7B 4NQCB 5E8NA 1MCCA 3HVNA 2PYEB 3BSHA 4LCYB 3VA6A 1GYVA 1OAXH 3QUMA 1IFRA 2ORBH 1YEHL 2HT3D 2R0LL 2ZONA 5INCB 4AEIH 5KS9E 4HS6B 3I6SA 4U4IA 3MA7A 3VFOA 5AALA 4AM0A 1HQRB 2H7WA 3D07A 4HD5A 5EOCL 5BCAA 4KRPB 1ZHBB 2VM9A 1S9VB 1DANU 3P2TA 3OHXA 4PRAA 4E36A 3RWIB 1T3FA 3BQUD 4MX7B 1YN7B 2AHIA 3ES6A 1LP9A 3GXMA 3RWGA 1LEIB 4A38A 2Y36H 2F1AA 3FB8A 3N0PB 4PTUA 4GYBA 4D0DA 1LP9F 1UADC 2R7EA 4JAMA 3BEVA 4RDQF 2OTWA 3PDGA 4RMQA 2Y07L 2YPLD 1T04A 3G5XA 4XHJD 1NSNL 2VDPB 4N26A 1SOXA 4EN3B 5EWIH 2CBQA 2JQAA 4HT1H 3VX0A 1OTTD 4ONGH 4BFGA 2NR6A 2BERA 1I75A 4YXLL 5GSVB 3I6LE 1TZIB 2DMBA 4KY1L 4XNUH 5E2UL 1IM9A 3VGDA 4XMKL 3VFMB 1A2YB 1ZK5A 3IDYB 5LVEA 3OKMA 1U8HB 4N4YB 2ZKYA 4K23L 4YDMA 5J1SC 2I24N 2PYED 4P2OD 5JOFB 4GBXB 4A6YB 4EUPB 2J6EH 1JNHB 3ZU8A 4DPBX 5DJYA 5DZNA 1WZAA 3IWVA 4OCSH 4WFFE 4XBPA 5B4MD 5T1KA 1OP5H 3BAXA 4K5NA 3IPFA 5BRZE 3NYKA 4LSQL 4W6XB 4UZSA 1G87A 1BD2E 4U3HA 5JUEH 4OZHB 4PIBA 3WL9B 4GO6B 5DO8A 3KWUA 3L08A 5I8CA 3PL6A 8PAZA 4RRPG 5KJ4A 4JUSA 2ATKB 5JDSA 1JXGA 3KYOA 1SVBA 4MQ7B 5BS0A 1AD9B 2DQGH 4YHOL 2ENJA 4NKDB 5EUOB 2FWOB 4NRXB 3FT9A 2CDFB 4N2MA 3OG6B 5DMYA 2CKBL 1OLZA 1DJIA 2CLZB 4Z78B 1YYLH 5IV2A 4PJ5A 5C0JA 3S5LB 5HHNA 1U8PB 4M5ZL 4F33B 1QSFB 2Y2WA 3NCJL 1BCIA 3ATAA 5I75C 5F93C 5GS3A 3G6DL 3MV7A 3EDDA 1VEOA 3MXWL 4GAGL 5GS1C 1PG7X 4R2GD 2FWUA 5J06A 2WQXA 4AQ1B 5C08E 3V0EA 4AE1A 1EQWA 2VDOB 5LBVA 3HB3C 2EZ0C 5EEVA 1T1YA 2CALA 1EJ8A 1KIQB 4JEGB 4JHVA 4G8GD 5CBAB 3NCBB 4KKLC 3UL4A 4OGZA 4IEFB 4HW6A 2C1PB 3EHBB 5DQ9B 2GBAA 5EG6C 3CLEH 2BFGA 3SE8H 5T1LA 4AG4L 1Q9OB 4DHLA 1A1MB 2CUAA 1JNNH 4GKNA 3CC5A 1P1ZB 2FX9H 4HXBH 3ME0B 3QNYA 1YEWA 1HE7A 2Y2TA 4L9LB 4AL8H 2HT4D 5CP7B 5AUMA 2HH0H 2FT8A 3IRPX 3CFTA 5D1XD 1KBPA 4AIZB 2DF3A 2PWHA 1FV1B 3PXHA 3O81A 5I1GL 3I85A 2XY1A 7FABL 4XP6H 4URKA 3ARFD 1YDPA 2WYZA 4Y2OA 4L1TA 1YY8A 2ZUQB 3AS2A 3V8OA 3D39B 3UP1A 5B38A 1R0AL 4G7YH 2W07A 2NXZB 2IJ0C 1W72L 2BC4B 3AU0A 3EG9A 4UT9H 5C6PB 4O02B 4PTTB 1EEQA 1CD1B 4Y2NA 3ZW3A 1YY9D 4GRMB 3GBLA 1TENA 4IHBA 2GAZA 1E4XL 1VEMA 4Z7UA 4Z7VB 2HJFB 1FNGB 3BP4B 2WCPA 4MZRA 3FZUC 4NI6A 5DWUL 1J0JA 1K72A 1ZLSH 1EHAA 2VLLA 3I9IA 4N0UA 5AAWC 8FABA 2ZOTA 4RAVA 3OBAA 1OXYA 3RL2A 4AENB 1SUJA 4L1BA 5ANME 1MSPA 3WTYA 3WELA 3UJJH 1UD4A 1HT6A 4OBSA 1G9ML 2XG4B 1MCHA 3QNFA 3PHOB 4G70B 4LU5L 2WZ5A 1E5AA 3BHBA 5HTSA 4NAMA 2VSDA 2BRRH 3SE9L 5C6TL 4IIQC 1MFUA 3BJLA 4OZHF 1DJWA 1YQVL 2VJ0A 3IMTA 3TO4D 1ZS8B 4FLHA 4UQEA 4XCYB 3QARA 1CURA 3QHTC 1CZ8H 5E1AA 3RDTA 4P3DA 5F88B 1OARH 3QEQE 1R0AH 3UTSE 5K9QI 2X10A 2BNQE 1SLUA 4LRIC 5FPIA 4AG4H 3TBVB 5T1JA 1H3PH 1QPXA 1JRHH 4PGEA 2I25N 2DLTA 3GEFA 4TTDC 4TUOA 2YC1B 5MP6L 3QNZA 4OD3H 4XMKH 4LCYA 3HBPA 4HKXB 4GAYA 5E6IA 4LSSL 4KOCA 3NRQA 4DO6A 3FUJA 3VCLA 2Q3AA 4FQLH 1EUUA 3FOLA 2CKNA 5PAZA 2ZP8A 1JZEA 4B9GA 1EPFA 1XZ0B 3L4CA 2CMRH 3WFHB 1E7VA 4QJ3B 5F7AA 1LDPL 2QV2A 4HJUA 4XMWA 1ROCA 4QRAA 1DJGA 1E65A 4NWUH 3KYAA 3RWGB 1FL3A 1T0OA 3DO4A 4O9HL 4L8SA 4Z1PA 2VLKA 1CYXA 4WJKB 5LGJB 5E08H 2BY1A 2WLKA 2G75B 5EOCH 2BOCA 3M1BA 5FDYA 3TF4A 1SFHA 2E7LA 5I66A 3WXVH 5EU6B 3VDCA 3IYLW 3S98A 4AX3A 5MHSD 1S7SB 1GJIA 1TZIA 1AGFB 2VYRE 4A37A 5DJCB 3ZZ1A 5CD3B 2K6WA 4AY0A 4WI8A 1WYJA 4L9LA 4NM4H 3PREA 4X7FC 2NY2C 2FGZA 2J4WL 4GP4B 3DDFA 4UOZA 2VAJA 5JQ6L 4ONHA 4UU9B 3H56A 1MCWW 1CGYA 1H0DA 3IGUA 3M45A 2LGNA 1A64A 1X5YA 5C70A 1MWAL 4KX8A 4ETQB 1WZLA 4JRLA 3Q13A 5DZAA 2JKNA 4PJIE 1E30A 4UTAA 4YDIL 3CNKA 1AAJA 1I8KA 3KPRD 4NM8H 3BD4A 4GEJA 4W93A 2H1XA 2XA8H 3Q5YA 2E0PA 5IT2H 4HT1L 1BQUA 3LKOA 3S5YA 1DEDA 3D0VA 2VLRA 4FHJA 3EH2A 1UKTA 1WGVA 5I16B 4B7IA 4M9PA 3ZTEA 4UNUA 2JB5L 3IGFA 2EDHA 4V33A 1I8MA 4J3XA 1QSEB 1Q1JL 3AB0B 4AENA 2NX5B 3S37X 3GJEA 5FFGA 1G7LA 1G7QA 3JWNG 1DANT 2W0KA 3KLQA 3DX8B 1W6WA 2M83A 2JKIS 4NWTL 2FUQA 4Z8FH 5B1AB 1DP0A 2IH1A 3HS8A 2HMID 5DA0B 2A5UA 1JYVA 5GS1B 4G8GA 3H9HA 2ZWZA 1MOEA 5INDB 4MJ2A 4U0RC 4QRRB 1IEHA 2YIHA 3K72A 2PUQT 3LZRA 2F74B 2QR0B 3AM8A 4N8VB 2FJGB 1UUNA 4L8BA 1JF5A 2J5LC 4OGAD 1DVFB 5DURD 3HR5B 4U1KA 5ICXB 5BV7H 2P5WB 3PJLA 2K1MA 4YIQB 2QKIA 2J1YA 1U8KB 1IAIL 4PGEB 3DUUB 5ICYA 4JRFA 1ZGLB 5AVYB 4AUJA 4FMVA 2A6DA 3VXTB 2ORBL 4K7PH 3BWUF 3OJ2C 4R26L 2X0VA 3JZ7A 2HB0A 1J5OH 1S7TB 5DJ0B 1SMDA 4XCYA 4JO2H 4K3EH 4X4XB 2VL4A 4WSKA 3OXRB 1HESA 4OD2A 5F7EH 2DWYA 1RK7A 4H8QA 2FEJA 2GSGA 4JUTA 2XXGA 3TYFA 2HFFA 3ARWA 1TFHA 3HZKA 1PLGH 4OM1H 5I5MA 5C0RL 2NX5E 4R0LA 3MQIA 5DJXA 5IFHL 3LH9A 3SGKC 1BZ9A 4IKKA 1WC7B 2EKSB 4XWOC 3SKOB 2EIMB 3UZQA 5DD1L 3BP5A 4CKQA 2RB8A 1KC5L 4PREA 2EIZB 3WEXA 2X4OA 2WBJB 4JFWA 1H8SA 2DEWX 4E9YA 1Q9KA 3UG3A 1LQSR 3OKNB 1JI1A 2WJ5A 5E03A 1U6AH 1NMBL 3GXFA 4LHQB 5IB2B 2ZUWA 4MSWB 4LMQI 1QKZL 4WW2B 2CO3A 4ILDA 2Y6TE 2WCSA 1KGIA 4LRIA 3MFFB 2H1PH 3DECA 4L2YA 3CFEA 4KTDL 4AJ0A 1MREH 5D7HA 3KBFA 5KSBB 3BX7C 5I2IB 1JZ4A 5KZCD 3ABKB 1BLIA 5L9DH 3GSNL 3E6FA 3MA9H 5IB4A 2Z31B 3EBHA 1F4AA 4KQ3H 3F05A 4UQAA 5CD3A 2YAOA 4Y5VB 1JPTL 5LWYH 4LVOB 4XCEA 5KG9A 3SDDD 3FYIB 4JFHD 3D25A 5E4IA 5JHDD 1DQKA 2J12B 5ICZB 5JQ6H 5FB8B 1YEJL 5FF6B 3DXAB 4TOYL 5TPWH 3TVMB 1EIBA 2MNWA 4MDRA 2I60H 2KKQA 4IU2A 5JPNB 2AK4E 5E99L 4JRXD 1MI5B 1R3JA 4PWFA 4I5BB 1ZTXH 3QPXL 3V0DA 4GKOA 2EE0A 3QZWG 1I8IA 3QUXB 3AUVA 1S78C 2FLRT 1QUNA 2E7LC 2NY4C 4OQ1A 2TRHA 4PSPA 1Q0YH 2P7TB 5J11C 6TAAA 1JXFA 3MV8D 4KMLB 1WJ3A 1X9RA 1BOGA 4O2FB 5FGCB 3B43A 1GIGH 2IFFL 4MAUL 2P49B 2VH5L 4YFDB 5ETUB 4HU8A 1FH5L 1U8IB 3QHFH 5T5NG 1M1SA 4E42B 3WKMH 3KWWA 5I6MA 2P8PB 4G5AA 1YMMB 2F6AA 3RJQB 1GCYA 2H32H 4N5EC 5AQ0A 3PP3K 3QPKA 3F84A 3U36B 5A6MA 1A22B 4LASL 4PJXA 1QSVA 5I74B 2NRDA 3QDJE 3DO7A 1P2CB 3STZA 3L5WB 1XFPA 4NRYA 4RH4A 1MCPL 3V0VA 2XN1A 5J56B 3B7YA 4Y16C 4U6VH 3QJQB 4DZ8B 3O4LE 4OZFB 2JIXB 2XQYG 5IJBC 2JTYA 2HCZX 4JVUA 2EXWC 2ICEA 1COBA 3DBSA 3K8LA 4Y4HA 5BJTB 2AV1A 4HHGA 2R0KH 5LQBH 5J1AB 4ONFL 4RMUA 4FULA 4MBOA 4NQDB 4GXUM 3WTVA 1NUNB 3RWEA 3VXQA 3NDYE 2AXWA 3EGXA 5B1KA 3VXRE 3WNPA 4AQZA 5KYNA 3RNQA 1MI5E 4UDTB 3K2KA 1IUZA 4OJYA 1S9XB 3FU6A 1EEYA 1KYOK 3Q2VA 4IKJA 2X4RB 2ZIDA 1PEWA 5C0AE 5AL0A 4XTRD 3K71A 3GBDA 1A65A 4EIZC 3ULSA 2RGSA 3AM8C 1NCWH 4HJTA 2CJ3A 3R4DA 3OSVA 4QCIB 4UQ2B 5JXEA 1GJUA 3MFFA 3X14A 3BUPA 1KCKA 4XAWL 5B1JA 4F80A 5JW5B 2D31B 5GXBB 4ZO8A 1N2RB 2VDML 2YEQA 1ZA3B 3O6KL 1A9BA 3P4NA 3I02A 1T1XA 3S36L 5I76B 3OKNA 4ABUA 3TWYA 2VXVH 4WI3A 3V7MA 5DHVH 1IBFA 1WA2X 2A6KA 3GXNA 5HDBB 2VIRA 4GKSA 3M88A 4OY9A 1M9SA 2WXPA 2FRGP 3EFFB 5J6SA 1LWRA 1U8KA 3E2HB 3MDJA 3SPJA 2IFGA 2CCVA 4XRCB 4V11A 4B9JA 4O5LH 5KSAB 4Q6KA 2ENSA 3GM0A 4PGBB 2YAPA 2AQ1A 1ZHNB 4J8RA 4Y1AB 4UILH 4WO0A 3LYRA 1ZT4A 2BSRB 1UM6H 4TULL 3UOAB 3FSVA 3IJSB 5FA4B 3L3OA 1N59B 4LSDA 4OW6A 4E9LA 1YNLH 1Y7VA 4XZUB 5ITBL 4HCRA 4RZCA 3FT0A 4G6FD 5KAQF 5EZOH 1OCOB 4NAQA 2EEBA 1ZIAA 5EIQA 4LAJH 2NY2B 3MOBH 3QAZB 3B2DC 1QEWB 2YD0A 2AXHA 1KYAA 1MXDA 3Q8AA 3UBFA 1QUNB 3LNHA 3CVHB 4ZS6D 3SE8L 3TYFB 4AWJC 4I89A 4HULB 1ZLVH 2J7LA 1LP9E 2QQLL 3G08A 2QGDA 2YN5A 4QTHA 1QSFE 3W9EA 2FWOA 2XWJA 4NRXA 4WHTB 2EIKB 3HPJB 3MUZ1 4UV7H 2J6EA 2X4NB 5HGHB 4LPTA 2DYPA 3O9WC 4D7BA 4NUJB 1EDHA 1OAKH 3LV3A 5DTFB 4F7TA 4XMPL 3IMUA 2GBVA 3L2NA 2EH8L 3SKMB 3VGAC 1L9OA 5T3XD 1U4FA 5L2KA 4NQEA 4PJXB 3W9DB 4AVJA 5GRJH 2PR4H 4P9HL 5HXMA 5D1ZC 1SM3H 1HEZB 1ND0B 3C5ZC 4NP4L 3RWJB 4GRLC 4U1MA 3H6AA 4TTDD 4AIZA 3HI6H 3U4EB 4RX4A 1ZHLB 5FHBH 3T0BA 4DEPC 1IBZA 2C9PA 3RTQA 5KAQG 3US0A 1GS7A 4JKPH 4OZGF 4P4KD 1RUML 2JV6A 3OZ9H 5DDHB 5BRZA 3TJPA 1I9JL 4FQ2H 2ITFA 4D9LL 3X3GH 1JMZA 5DYFA 1CPUA 2VR9A 5HHXL 3SDDA 5I6XC 3JWDL 1N64L 5A2AA 1J0ZA 2JVUA 3WI9A 3WJLA 4NQXA 2PWGA 2Z9TA 3H4FA 1OQXA 3FCGA 1B88A 1NBQA 2DWXA 4QHNA 3VDBA 1MFCL 4M9OA 1JGEB 5DJAA 1TYRA 4QRPB 4HMDA 2ZYRA 4U1LA 2GJZB 3SJVA 1ODUA 4MZ3A 3X3FL 3CSYB 4F92B 3CH8A 4K71C 4WNQB 5EU5A 1T0NB 3GI9L 2J25A 3OKOB 4LP4A 3WKYA 4LKCB 3BP6A 5FO9B 3OVUB 3VXPA 2HYMA 2BC4A 3O41A 4F91B 2P5EE 1IVLA 1OIOA 4HGWA 4XB8A 3AQDA 1PCXA 1M7IA 3BW9B 3LPGA 4OGQC 3BDXA 4TPRL 1BSIA 3ARFB 3MCG1 1H19A 5IB5B 3UTZB 1A14H 1R1CA 2F1BA 1EO8H 3PNWB 1MWAB 3MI6A 2Q20A 3NEOA 4LLYB 2CM6A 2YSSA 2YK1H 3M17B 2UYLB 3MO1B 5LBGA 3VTAA 4J3OC 3S48A 2WGNB 5IHZA 3NCCB 4C54A 3FO2A 4ZW6A 3NCFB 3U0WL 4E2OA 2KUTA 4Z5RB 2IWEA 5IROA 4ZTOL 1YMMA 5E9DE 4QCIA 3IDMA 4TNVF 5CCKL 2F5AL 4AGNA 1KENL 2OMYA 3INUL 3VM7A 5IM7A 1Q9OA 1PKQB 5D2LB 4U1GC 1TEFA 1KJ2H 4RDQG 2KI6A 1W8NA 3QXTA 1ZJBA 4RVBA 4W81A 4AV0A 4B6ZA 3QJTB 1LEGB 3IJSA 5FA4A 2K7QA 1ZS8A 4HYTB 3VQ2C 4P2RD 3QORD 4I1NB 5A7EA 4Y4KB 4UUJA 3NCYP 1OM3H 2QSCH 1JV2B 4P3DB 2IDCA 3GKZA 4G6JH 1Z5LA 3FAWA 1SOQA 1ODAA 2E59A 3EFFA 4OIIH 4U1IA 4HJGA 3ZRCC 3TYGH 3K81A 2AV1B 5GRVK 2J88H 4TUOB 2IALA 2FUTA 1F6AB 5C3LD 5BZZA 4NZUH 3SEPA 2GT9B 5D7IF 3SDXE 4Y7OC 2B16A 4IGBA 1YNTB 1FPTL 2WANA 3IXTA 3PNRB 4QOKA 5EORH 4W9CC 5LGHL 2YXVA 4X6FA 1QNIA 1MHEB 4QRUB 5EO9A 3ILQC 3APDA 3FJTA 4ZXBC 1NC4D 5CJXC 1I53A 2W60A 4PJ9B 2Z91A 43C9A 3D09A 4B9PA 4HUCA 1Q1JH 4R7LA 1KPUB 4JDEA 1MRDH 5DSCB 3MCKB 3P9WB 1IBBA 4H20H 5IKCB 1W91A 3CFNA 3KCWA 4BKLA 5IJCC 4NPKA 2XN2A 2JKLA 3IDGA 3EH1A 2OMTA 3DC0A 4TPRH 2Q76B 5B3NA 5CILH 3ALPA 2KDYA 4IMLB 3LV3B 4YSSA 4XI5D 4GSDH 1A9BB 2JIXD 3HC2A 2AKRA 3P4NB 3QEHA 3L7EB 4YDIH 4BFRA 4HOZA 4JFYA 1H3WM 2XN9D 2OSXA 2X9XA 5AYUL 2Q8BH 2YS4A 3SDDB 1ZLWH 3PWUB 4J8QA 2BVPB 1J8RA 2NR6C 1OSZB 4WUUD 3WLWC 5BQ7A 2AEPL 3ZKMC 5AB9A 4OKVB 1E8XA 3QCTL 2BZ7A 2X7LB 3QFJA 1GGYA 4XP9H 4AYID 2WLYA 4JMNA 3U9PH 1M3IA 4ZUUA 3IVKA 1E5BA 3SPIA 4IBWA 1AMXA 4G6JL 3V4PA 4AVHA 3IETB 3Q48A 2EVHA 3PP3H 2CD0A 4B9KC 2JCCF 1INDH 3AG1B 2ATPA 4H0GA 2UWEF 2OQJB 3HAEH 5EPMA 2F08A 4GRLB 4Z7UF 3RVWC 3NN8A 3WJMB 5K59F 1S5HB 3D9AL 1VFMA 1HHIA 4YHLH 1E5CA 4DEPB 1KY6A 4N0FB 4WKZB 1X5ZA 2AJXH 2W95A 5AL8A 1FCCA 3KCPB 3MAWA 1HI6A 3IDYC 3L4ZA 1E4WL 4NC0B 1DUYB 4XCNB 3LZPA 3MLXL 3MOAL 5BO0D 5BV7B 4A55A 2ETWA 4PJDF 3CX5J 1VLXA 4W9HC 1RPQA 1G7LB 4P5TB 2J71A 2HWZL 4NQEB 4G5ZH 1QFWL 2EYRB 3ASOB 3MNVB 3MBXH 1L5GA 2E8YA 1I3RA 4YSOA 5K1VA 5GS1A 3FQTA 5ILTL 1HKLH 4YK4B 1QLFA 1KXQE 1OTUD 4TULH 4P4KA 2DLIA 3DETD 4KZ0A 2NY0C 1Z5LB 2XV0A 5IFJA 2WBWB 3VACA 4DIXA 1I7ZB 2LTQB 1AQDA 1UWXK 1OGAE 1V8HA 3BUTA 2BVYA 1N0XH 4BFEA 3K6OA 2D3VA 5C08B 1MFAH 3QZPA 1MFEL 3T71A 2EYSB 3S35X 2NZ9C 4D0BA 1QPKA 3M7FB 4WI0A 2VABB 5C7XL 1KGWA 5I82A 2NY0B 2XA3A 4G82A 1MAMH 3C60D 4PJXF 3IDUA 3MRQB 5F7HA 4YBQD 3DX2A 5A2FA 5AW1B 4NSKA 4BRVA 1G5GA 5E2VH 4XP5H 4JG9A 4KO7A 1BAFL 4MSWA 4BIKA 4AKQA 1A47A 5EUOE 2YN3A 3WNJA 3AREB 4FA7B 1HH6A 1CD8A 4U2ZA 3VI3B 3BLBA 3S6CA 2NYYD 2ARJQ 1O75A 1MVYA 3K0YA 4KTYA 1FVDA 1WBXA 4HGWB 3CMGA 4LCWD 3BMVA 1W6LA 2NYZA 1EFXA 5I75B 5DJYB 4HUXA 2X89D 1X5FA 1E42A 3EYUH 2VXUL 3T3MB 1MFBH 1Z9LA 2OX5A 4DUXA 4KXZH 1KIRB 1QRNE 1NGYA 4IKIA 1OAKL 2OULB 3LVTA 5FUZL 5E4EC 1PX4A 5C97A 4HZAA 4LLVA 3IMSA 5KBMA 3SO5A 2Y06L 2X1OA 3MREA 1YECH 4KK8D 2IADB 2YD3A 7FABH 4MYPA 1XGRA 3WD5L 2QPUA 1J1XL 5HVHC 1ZRUA 1OHZA 1ZIBA 3QORA 3FT4A 5ALCH 3ZSSA 4I0PD 3LD8B 3V6OA 2ZSVB 1CUOA 1O9WA 5IVXF 5D8JH 1XL4A 3FQUB 4UUJB 4E0RB 4UB0L 2CH8A 2CK2A 3CFDB 4A2HA 1HINH 1A7QL 3O4LD 4JFEE 4D7PA 2A6JA 1KSRA 1IT9H 4Z9KB 4YHZL 1AC6A 3RDTC 1M2VA 5DJ2B 3IJ9A 1RI8A 2R23B 4DP4X 4KMTH 1T89C 4DVRH 1W0VB 5D5MA 2VH5H 3A6OA 4KUCF 1WC7A 2EKSA 3SKOA 4BINA 4L2LA 3HBZA 1I3UA 4Z78A 1WCBA 2IXQB 2EILB 2EXTA 4ZQKB 4OV5B 2V2XB 5D7LE 1GC1H 5EUKA 1MEXH 4NQCD 1TFPA 3K2MC 2VDNH 4XHJC 1PZSA 3RA7H 1QABA 4KZDH 1P4IL 2N7SA 5EC2B 3ULVL 4C56A 4BUGA 2Q86A 3MRFB 5JA8B 3MV8E 2WWNA 1JK9B 2XTSA 4PGDB 5ESAA 5T1DL 5F6HJ 3ZPDA 1P2CA 3STZB 5HVFB 3REWA 4YJZL 3PJSB 2R39A 4PJ9C 1BFVL 1XEUA 4KUZL 1QWUA 2N01B 1PF3A 4AW4A 3QDGB 4A6YA 4A7QA 3PFUA 2VWEE 1P6AB 4K9EC 3AXLB 2R1YB 2A73A 3RGHA 3QXAB 2P28B 3SB3A 1UJTA 1YLBB 3KWWB 5B39B 2Y5TA 5F6HI 4NQSB 1KDIA 1SF5A 1EZVX 1WT5C 2YPLE 1I7ZA 2XWRA 1AC0A 4L8SC 4O4YH 1NAML 1OAYL 4GQ9H 3SYQA 5EZJB 2VMDA 4NNYB 3K1KC 5GRVL 4F20A 1JTOA 2V7NA 3G9AB 3ECBA 3RGVB 2GTZA 5BZWA 1M7DA 1RVFH 3IS0X 2OXHA 3N1GC 4H88L 4P46B 4Y89A 5ERWA 1OGSA 4NLHA 3KW7A 5JHDE 4G3YH 3EFOA 5LCVH 4ZS6C 4MB4A 2WC7A 1S2EA 1GOFA 2FX7L 4UTBH 4XN1A 5ITFB 3VXRD 3DHMA 4N20A 2H3NB 2GAZB 3QCVH 1G7IB 2JJSC 2QQKH 2A9ML 2W65A 3MZGB 1AHWB 1F2XK 1IZKA 2L3BA 3LXUX 3KLHC 4YL4A 3ABLB 5FLUA 1JHKH 1KCBA 1MKFA 3NACH 1CR9H 1U2HA 1J1OL 3A3YB 4LEXH 3PWNB 1QKZH 4M5YL 5H37H 5CUSH 3VD0A 3BSZH 3D06A 3NEEA 1A3LL 5KN5A 3GJFH 5TDPB 4AVKA 2YJLA 2IPUG 3VFRA 3FDWA 4HIJA 4ZD3H 3HZMA 1JSYA 1AKJB 5IHBA 1HHKB 4XN2A 1HHIB 2GIXA 4EDXA 3CFJB 1U92A 2WWMC 2ZOKB 3FQYA 2EE9A 2FBJH 4XE0A 1NBYA 3RBSA 5ID1B 2G5BB 4GXVH 4APXB 2KPNA 2IFFH 3PV6B 4KX7A 4PGCB 4YDVB 4NJ9H 1CFVH 3OX8A 2QPFA 1WG3A 3DUSB 5HYIA 4XC3L 4EZMA 2Q6WA 4XVUD 5EFIA 4XB3A 4XXWA 1YEKH 3D39E 4N0YH 4ORGA 3RY6C 4U1HB 3X14B 4AM0Q 7PCYA 5F89B 1SXZA 5AFAA 3NSYA 3ZQXA 4F7EB 4YGAB 5E2WL 2HTLD 3LKQA 3O6MH 1HL4A 2OYLA 4JO3H 1DLHB 1I1CA 4R26H 1OAQL 3K8KA 1WF5A 1BJ1J 2R56H 2D7MA 4CVXA 5LDSA 2A3TA 4FZ8H 4BFBD 5IG7B 4H0IA 5TPWL 1HILA 2GYSA 4GW1A 3WY4A 3WFHA 2YQBA 2G0LA 4JM2A 1KB5B 3IGKA 4PJ8C 5GSRA 4Y4HB 3QNXA 5CD5C 1U0QA 3GD1C 1OO2A 5JLZA 2Z7UA 3NH7H 4G72B 2QKIC 3CZSA 3A47A 3W2DL 4OF6A 1ADQL 4PB9H 3W0WB 1UT9A 4G1EB 4YQXL 2R2HA 4NBYB 5HHME 1K4CB 4UINL 4YDLC 3OLDA 1TQBC 4YXHL 1XGUB 3D50A 3EXJA 5IP4A 2XV6B 4KDWA 3TN0A 5IR1A 1HIML 2YSTA 4I0PB 3VXSD 3FCSA 5D1ZB 1EHKB 1NMAL 1QEWA 3EBAA 2R27A 1F11A 4L1DA 3CVHH 3QWQB 4JQVC 4ZMPA 5K9OB 2H1PL 5CM1A 1INEH 5D7EA 3TCLA 4UQ2A 1FZMA 1W2KT 4KPHL 3HPJA 3RWJA 2EUVA 4DUWA 2HG5B 1RULH 2IDQA 1EZSA 3GMMA 1BVKA 3OKKA 4PN6A 1JGVL 1TQCC 1Z9NA 2RA1A 3AWGA 1NMAH 2UXGA 3TEXA 3DX7A 4GSRA 2E3VA 4DP8X 5DFVC 3GSQB 4OCMC 3T2NH 4F2MB 3B3IA 1B3IA 3SYCA 1P4LA 5HJDA 1MCNA 1LWJA 4PPTA 1N6VA