4BCZA

Monomeric human cu,zn superoxide dismutase, loops iv and vii deleted, apo form.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
110
structure length
110
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHGAGGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKAGAGAGSRLASGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Global Structural Motions from the Strain of a Single Hydrogen Bond.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 23
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4bczA00
3K91A 1SPDA 1COBA 1UXMA 3F7LA 2AQTA 3GZPA 1F1DA 1P1VA 1SXSA 4A7TA 1SXZA 2Z7WA 3GQFA 3L9YA 1BA9A 4OH2A 3T5WA 1SXBA 1OZTG 2AQRA 1Q0EA 2WKOA 2WZ5A 2ZOWA 3QQDA 1IB5A 1ESOA 2Z7ZA 3H2PA 1QUPA 3QQDB 3HOGA 5KBMA 3KM2A 1TO4A 2E46A 4N3TA 2WYTA 1SOSA 1CBJA 2VR7A 3RE0A 1F1GA 1JCVA 3KBEA 1B4LA 3MKGA 3HFFA 1SRDA 1E9QA 1Z9PA 3CE1A 1HL5A 1IBBA 5KBKA 1YAZA 1E9QB 2AQNA 2ZKXA 1F1AA 4A7QA 2E47A 1Z9NA 2WWNA 2APSA 3LTVA 4A7UA 3GTVA 2XJKA 4L05A 1SXCA 2C9UA 1IBFA 1OALA 4A7GF 4BCYA 3F7KA 1DO5A 4A7SA 3PU7A 1U3NA 2SODB 3GZOA 2GBVA 1XSOA 1DSWA 1N19A 2WYZA 4A7GA 1UXLA 1IBHA 1B4TA 1MFMA 2VR6A 2XJLA 3CQQA 2AQSA 1CB4A 3CQPA 4BCZA 5CU9A 1KMGA 1SXNA 2GBTA 1EJ8A 3KH4A 3GTTA 1L3NA 4A7VA 5KBLA 1PZSA 1JK9A 2Z7UA 2WZ0A 2ZKWA 2Z7YA 3SODB 4N3UA 1E9OA 2WWOA 3KM1A 4U4IA 2JLPA 1SDYA 4MCNA 1AZVA 1RK7A 2Q2LA 4BD4A 1PU0A 1OZUA 3H2QA 3HW7A 1EQWA 2V0AA 1SXAA 1HL4A 3L9EA 2AQPA 1SDAB 2VR8A 3S0PA 3MNDA 3KBFA 2K4WA 2WKOF 1FUNA 2C9SA 2JCWA 2AF2A 2NNXA 2LU5A 3KH3A 1YAIA 4FF9A 4B3EA 3ECUA 1XTMA 2ZKYA 4OJAA 1F18A 2AEOA 1N18A 3ECWA 1OAJA 1BZOA 2AQQA 1S4IA 2C9VA 2GBUA 1XTLA 1TO5A 1OEZW 4MCMA 1JK9B 1PTZA 1E9PA 2R27A 1IBDA 3ECVA 1E9OB 1YSOA 1E9PB 3GZQA 2WZ6A
chains in the Genus database with same CATH superfamily
1TQCC 4N90D 5JYMA 4XZ4A 2R4SL 5AUMB 3H3BC 4GG8B 3KVPA 1SY6A 3Q2NA 3M8OH 4WEBL 4FZ8L 2BP8B 2ZIDA 2CJUL 2PCPB 5MENB 5HDBF 2BFVH 1T2QH 2DYPA 3IWVA 2ED6A 1KN4H 1N67A 2OJZH 4XX1G 2EDRA 3VD4A 2RBLA 5GPRA 5I8CB 5IB4B 2UY7A 4U1NB 1NC4D 3NCCB 1OF2B 3JBG7 1YA5A 4PJGE 2FAUA 3HAEH 4LP8A 2BNQD 1MJJB 1V10A 4NO2B 4O2CA 4GKNA 1ZS2A 4PRBB 3RWEA 3TA3A 4GLRH 1AG6A 4CC0A 2HTLD 3L3OA 3NTCL 3C2AH 5CBEB 4OZHA 5BRZD 2GT9B 2X3BA 2NNRA 3B3IA 1E9QB 3RVUC 1N64H 3EDFA 4QAMB 2X9YA 4AOFA 5E5LA 4G11A 2J56A 4BCXA 2YARA 5GGSA 5T1MB 3TZVB 4HPOH 4YWGH 5HHMD 3WENA 4BQBA 1PQZA 1SFDA 2VLJA 2Y9RT 3MYZA 5K59E 2QQNH 3K6DA 3OTTA 1G7MB 3BUYA 4PS7A 1A7QH 1A7OL 3HPJA 2YO3A 4LPYA 4XAWL 4MNQE 1AOZA 1I9IH 5C97A 1PPIA 2ICEB 4HHAA 4GT7A 4LKCA 4P2OD 3L1GA 1UWFA 5HVWA 5MI0C 4A7GA 2WXNA 1M2OA 4NQDB 3AREC 3K3QA 4ADGA 5EFIB 3KLDA 1T4WA 4X8JB 1W0WA 2XJLA 1HZHL 2AQSA 4P23D 2WNGA 3VWJC 1YN7A 3IK2A 4EKXA 3NCFB 2VXUL 1KDIA 4H5SA 3FQ2A 1JHTA 4XP9H 4EPSA 1FSKC 1KF9B 3GC3A 3ZE0B 1Z66A 4K94H 1PMYA 4I0KA 4XCFH 3VD0A 3HFMH 1M1SA 2XKNA 4MQ7B 1XGQA 5F7DB 2V4LA 3S37X 1IM9A 1S9XB 1XIWC 3MJWA 4P2RD 4LLMB 3IJ8A 1FLRH 3F05A 5TPWL 5IW6A 5K5YA 5ESQB 1E6OH 2V9QA 2WVVB 1LO3H 2VW4A 4YS4A 4TVPH 4GKSB 3RUGA 2QLYA 4AYFB 5IMKB 1FAIH 3PWVA 3AMKA 2FGZA 4N9OB 5FYLD 3FTWA 1RFDH 4BEIA 1JBJA 1U8MB 3DX7A 2ED8A 3WFBH 4ZDHB 5D1ZA 4OAWA 4Z7UF 1LMIA 3VRJA 4HUMB 1YNKH 2VZOA 3D50A 2TSAA 1RIVL 1XF3A 3GI8L 4QHMB 4WFEE 5D7LA 1V3JA 3RTQA 4DGVL 5HJGA 2O61B 3SE6A 4XWGH 2FCBA 3SPIA 4P07A 3SDXF 5DVNA 4F7PB 4XNXL 1DR9A 3OLDA 4FC3E 4FQXB 4JPSA 1FWXA 4O58H 4PGBB 5C3IA 5JNYB 1UHVA 4AE0A 4UF7C 2OZ4A 4FFWD 1F3DJ 3M1OA 4EQ2A 3HI1B 3S34L 5DTFB 5MEOB 3OAZH 4M8QB 1VADA 4L9LA 5A2LH 5L4IA 4XP4H 1XSJA 3FN0H 1ZV2A 4MVBC 2E27H 2G3MA 1UXWA 2UZXB 3HLAB 3FBKA 4EJ1C 4NEHB 3V0HA 3MJ7B 3ATEA 3CFBB 2EINB 4JRXE 1G7LA 4RMWA 2CHZA 3JV6B 3TBVA 4W9JC 3MO1B 4O02B 1V54B 2G60L 1F6FB 4JRLA 2GITB 2CO1A 4N68A 4C4BA 3GRGA 2V2XB 5ENWB 1P9MA 4YFDB 1FAKT 4V2BA 5I6XC 2DM4A 3OAYK 4MD4B 2OAAA 2BY2A 3IU3B 2CA4A 2NXYB 1OHZA 4APQD 4JFSA 1S7SB 3P11H 1T0MB 3DURA 1PZ5B 4WV1C 1QMUA 1KZQA 2AQNA 3PXJA 4QXUL 5CGBA 2NR6A 2MFNA 4XN4A 1VEOA 4P04A 2YQ3A 2ZX7A 4KV5E 1OAUH 2CLVB 1Z9NA 1S7TA 4Y89A 1HHGA 3SQRA 1XMWA 1XMEB 4AVIA 3L9RB 3ZO9A 2EEAA 3KL0A 4KKAC 1BQHG 2FO4A 4DEPB 4X5QA 1JD9A 2ZNXA 3W56A 1L9TA 1EFXA 2JQAA 3QIBA 1NPJA 1NC2D 2GBVA 3B6SB 2GJZB 5F2FA 4CMMA 5IB3B 4NM8L 3QUZB 2NT0A 2W60B 2Y2TA 4Y16D 1I53A 4PJEA 5JUEL 2EVJA 5C2BH 2P7TB 4GJTB 1DQDL 4JK0D 1OWRM 4GSDL 1MDTA 4TNWF 1MFUA 3VH8B 1B6DA 1BVNP 1NIFA 2PR4L 3K2MC 3TO2B 1I3VA 5FO7B 3WS3A 1AMXA 3ARFD 5E9DB 4UT7H 4A2EA 4TVUA 5KUMA 1H3PL 2OX5B 2XN9D 3ATBA 3O2WH 2G4GA 1RK7A 3POHA 5AZEL 4PLJD 4HG4K 4NO0A 4MD5B 3AS1A 3V4PH 4I7ZC 4D9RE 2W0FB 1A14L 2QZQA 5CP3A 2CGRL 3T3MB 2DBLH 3QUXD 5I1LB 4XX1E 1E4XH 4PBXA 2NY2D 2J6EL 3UTSD 2OSLB 3FU7B 3HKFA 4IRJA 4Q58C 1IGFL 1XTMA 4KTDL 2TRYA 3TIDB 4DN3L 3ETBF 4I2XA 4X4YB 3SCMD 4MAYA 4UZUA 3HG1B 1QSEE 1LP9A 2JJTC 4LRIC 1GR7A 3TBTB 3T0VA 3V0AC 4CMHB 1GOHA 5GRWA 5DJZA 1E9OB 4WJKB 5E1GA 2VERN 5CZXD 3PJLA 2JTYA 3CVDA 1OSPL 2VN4A 3QPKA 1OXYA 5CFHA 1YG9A 5HBBA 5CBAB 2X4SA 4LPCA 2OTUB 3QZOA 4BFGA 2WINA 4KROD 1KPUB 3KWUA 3NJGA 1INEH 1B9ZA 1SXSA 4NQQA 4A7TA 4WKZB 1ZIBA 4R7NB 4NN5C 1T21B 5ITBH 3PABA 4AYMC 1AR1C 3V5KB 5KSAB 4WI2A 1QRKA 4JFED 5G2NA 2OK0H 2ZCKL 1S2EA 3Q1SH 4XP5L 1VGKA 5DQ9B 2P8MA 1U3HC 5EO0B 1KC5L 1MXDA 3OJDB 1JVOA 3MRCB 5EULV 2J20A 4DUVA 1ZVNA 2OCFD 3FONA 5EU6A 4HWBH 3LEVL 3QFDB 3UDWA 3CXHK 1Q0YH 2NUTB 3L1OL 2ITFA 4M6MH 3ETTA 4WFFD 4AUYA 4YK4B 4DVRH 3CSGA 1HHIB 5MP6L 1GYWA 1E50A 4JHUA 4M1GH 2A0LD 3ILQD 1RZJH 4WUKL 2P5PA 3W5MA 1J0JA 4DKFL 3QC5X 4NGHL 1K5WA 4H20L 1MW3A 2DYPB 2YD2A 4E0RA 4HJJH 1VJSA 3FT0A 5KN5A 5IHZA 4Z0XA 4LEXH 4JFQA 1BQKA 4PS4L 3CH1A 2V17L 1KCUL 2UY7B 4MJID 3VD5A 5JZ7D 2LOEA 4AVJA 1MW1A 1IMHC 4YHYC 1GY2A 3LMJL 4HMDA 4GKNB 1ZEAL 3TA3B 3RJDA 4PTTB 3Q8AA 3EH4B 4V2CB 4WUUE 3CUPA 3VA2C 1ITBB 2AXWA 3DLQR 3EJZD 4UV4L 3IMVA 4OZHB 5EIQA 3H9SD 3MCKA 4I1PA 4F91B 5GGSB 1Q9KA 5DVMA 2JB5L 3L95B 1PQZB 2VLJB 4IJ3B 4QWWD 3D39D 3G5WA 4KDTC 4GXVH 2WQ8A 5FUCE 1OTUC 3BUYB 3UP6A 5IWLC 1CYXA 4ODUA 4M7JH 4MSWB 3DHMA 4G9DA 5SX5K 2NNFA 3IAGC 3KW7A 3UG3A 5T5NF 1MSPA 2MCPH 1T04A 1EMTL 4PJFA 3QDGD 1IKNC 2X1PA 3ZJAA 3IFOA 1SM3L 2C7UA 2I9TA 3C5ZC 4ANKA 2NNXA 1KXQA 1DVQA 3DGGA 5CILL 3H3PL 3PWJB 2IEPA 1W0WB 5GJSL 1YN7B 4E9TA 3VB9A 1DFBH 4H5SB 4UQ9A 3SE9L 2HLFD 2B5IC 3O9WC 3DA0A 5EWIH 3GNML 5I0DA 1JV5A 2XKNB 3P4OA 4ZNEA 2VYRE 3NK3A 1IM9B 1L9MA 2EILB 3IDYC 4KK5C 3LX9A 1IEHA 1JP5A 1W6WA 2PPAA 3RUGB 3GIZL 3PWPA 3PWVB 3WXWL 2EH8H 3B9KD 4ZS6C 3FAXA 4YEEA 1TTCA 3DX7B 4P05A 1KBGL 5FYJU 3VRJB 4EAEA 3HBPA 4PW9A 2E76C 4W9CC 1XF3B 3H55A 5D7LB 1P4IL 3RTQB 5D1XA 3WUZA 2IPUG 3QQ3B 4LIQL 2EDNA 4N3TA 5CS7A 3H0TA 5ECGA 2IXQA 4FABL 3IDGA 3IBEA 4JPQA 3VACA 3K1DA 5C6TL 1FP5A 5BO1H 4F3FA 4FXKC 2NY5L 1VADB 4L9LB 2A7BA 3FULA 4KKPA 4XHJD 5DDHA 5TE7H 4GSUA 3WFEL 1UXWB 5MHSE 4NB7A 1QI4A 3VXMA 1G7HA 1IV8A 3NZ8A 4PJHE 4O4YL 3MLUL 5AFAA 3OB0H 5AOZA 4ZPTA 1G7LB 3TBVB 1NGQH 2F15A 4PJIB 4TULL 3TOPA 1I9JH 2WQVA 4E9LA 2PTTA 4M6NL 1TETH 2HPOA 2X3CA 2J8OA 2XICA 4XNUL 4B5ZA 2HFGH 3N9GL 5IJDC 1OE1A 5J11B 4G6JH 1NKOA 3GMMB 2CPCA 5KWYC 3E6FB 4PGZA 5IB5A 1YRKA 4N2MA 4PGCA 1XGYL 4Z7VB 2OA9A 2B77A 2YAHA 5DZ9A 4W68A 5DD1L 2Q1EA 3DURB 4LGRB 1DO6A 3MMEB 1XR8B 1UWGL 1R0AH 4BFJA 3DOIA 4YHOL 4XXWC 3O2VL 1CK0H 1ZTXE 1MG3C 1S7TB 2IDTA 4HFUL 5LJYH 4KJWC 3QG6A 1YZZA 2DAVA 3RIFK 4NWUH 2EDJA 3IRZA 3RJOA 3VFPA 1E8XA 2K70A 3BYTA 4ZBJA 4FAAB 6PCYA 4YHNA 4ETYA 1EFXB 3VX1A 5CM1A 5I1AB 4KO5A 2ICWI 1W9XA 3IKKA 3TVMA 4HT1L 5EEZA 4GRLB 1MI5D 4PY8I 2G5BA 5TF1H 3LB6D 1C1EL 1NEUA 4Z77A 4MNGE 4OJEH 4PJEB 4FFZA 3PWUA 2CR6A 4X0NA 3D6GA 5B1KA 2ADIB 1R3HA 4KJQC 1TJGH 4R7XA 4Z7UA 5C0FA 2LTQC 3VXSB 4OQTH 3ZTNH 3VJ6B 1BD2D 1RURH 5CSGA 3WS3B 5IBTH 3B7RL 1O6SB 2W38A 1G6RB 3SDXA 2WCSA 2CNZA 4PGEA 4GAGH 3SPCA 3F7LA 4NO0B 5F44A 5KSVB 3MJ8A 3UTQA 1UC6A 2JQMA 1DSFL 4LDOB 5E0FA 2J3SA 4DUXA 4JUSA 1IILE 1Q72H 2P44B 5I5JA 4AJVA 4BH7A 3UEQA 4N2EA 5IZ7A 5DJCA 4XGZA 2DQHH 4UANA 1CLOL 4DGIL 5TQ2L 4IRJB 4MS6A 2K7PA 3UBHA 5EIIA 5T1KD 3CJJA 4UNIA 3EF7A 5AAPA 4M6OH 4OJYA 2J73A 2G75A 2JJVA 4RDQG 1LP9B 1HILA 3EYOB 4PJDB 3TCLA 3K8KA 4QRPA 5DJZB 1RH8A 1P1ZB 4BHUI 3WHE0 3VI3E 4OI7A 2XZCL 4BFIA 1BQ5A 2OI9C 3CZFB 3SYQA 2NTSP 2Y7OA 2X4SB 1K85A 2F7IA 1WG3A 4PCSA 2KI6A 1WDAA 5KVGE 2DV6A 1YEIH 4E68A 4PRAA 3P9WB 2XPYA 2ODIA 3UZQA 3PABB 4P5TA 3UO1H 3N44B 3BX7C 3QPQC 1VGKB 2XBTA 1QFUL 1M6UA 1G9NH 4MA3B 2QVTA 4KVNL 2PR9A 3AT0A 4OCSL 3RB7A 1QFWL 5I28A 4I1NB 4UNVA 2ZCHL 1AHKA 1R6VA 3FONB 5BW7C 1JZJA 3QDMB 5EU6B 3D08A 1TKWB 2AQ3A 2Y3AA 4WNJA 3RL1A 5E6SB 2K6YA 3AG3B 1VCAA 5EO1A 4DO6A 1IC0A 1J1PL 1MRFH 1NFDF 4A2FA 1AZBA 3NJXA 3WO4B 4OFQA 1Z5LA 3JWOC 5JIHA 1U95A 4ZODA 3KJ4B 3IGLA 3VXTA 2H1PL 4WWKD 1KULA 2EKJA 2Y25A 4HEME 1HX0A 3C87A 2K8MA 4NKQB 5KN5B 2UX7A 4LCCC 4Z0XB 2X6BA 4JFQB 4HEPG 2XQBH 3MFGB 4XH2A 1PYWA 3MV11 3K0WA 4N5EC 1M1XB 6FABL 1AQHA 1JYXA 4ZSOA 3RDTC 3DSFH 5I19L 5HDLA 1KELL 3FC8A 1CF1A 4RMUA 2H3NA 2DL2A 3GSNA 3CUPB 4BXSV 1T03H 4TOYL 4HH9A 1BFOA 2WXLA 3KVQA 2E74C 3MCKB 4WKXA 1PGRB 1OTTD 4YHMH 5IROA 3BAXA 4FRWA 1N68A 3WI9A 5L2KD 2Y22A 5CZVH 4Y9EA 3N1MC 4WO0A 4NCC1 4DO5A 1H3GA 4ODUB 1L0YA 4G9DB 3JTTB 2DOCA 2XETA 2PNDA 3SPVA 5HPOA 1GIGL 4X80H 2OW6A 3LEXB 3K7UA 1T04B 4LCWD 4PJFB 5L2JA 1ZA3A 2X4PA 3B5TA 1H6TA 3IFOB 3O4OB 2C7UB 4HC1H 4ONHA 3J7HA 5FS5A 1MFDL 2X6CA 4XN8A 3VMPA 3G9VA 1CDYA 4QHLA 3WXVL 3DGGB 3ZE2B 1PLCA 1C5CL 3HVDA 3SEPA 2FSEB 3BKYH 3DJTA 5EORL 2DI7A 4PN6A 4XI5D 2Y2YA 4PMFA 3LCYA 1LO0H 4E9QA 1C7TA 1I8LC 3GS7A 3IDNA 5F9AC 5LNDA 1QLFA 1NCCL 2CMRL 3IJEA 2AEQL 5JXEA 1JXDA 1E8WA 1TVDA 4LHQB 3WUWG 1L9QA 4XPGL 2WBJA 1TLMA 1I9EA 1JWMA 4GBXC 4WF7A 3QI9C 3SD2A 1WCBA 3PWPB 3VTAA 3CQFA 1MCLA 1I8AA 1N9PA 4MS8D 4LOUC 1YEHH 5E4EC 1JGUL 1NFIA 3LEYH 3LTVA 4G80A 4U49A 4XXCA 3K8MA 3ZUNC 4DGUA 2P43B 4Z7WF 2ARJA 2XIIA 2FHCA 3X1BA 1WJ3A 5HDBB 5EUKB 4HD9A 5D1XB 5KEZA 3CFIC 1JZ6A 3OQRA 4LVNB 5HDQH 3VM5A 4JR9H 2C3XA 3NJKA 3H0TB 1N19A 3FUIA 4JPVL 3IDGB 3U9UA 2BVQB 3BDYL 5D71H 3RGHA 3RWCA 1RJLA 1RUML 3L7FA 3CZGA 3BEWB 3JVGA 4XMZA 1EJOL 3DTXA 3PIQA 4QRRD 4F3FB 5A6LA 3EJYD 3BUDA 3O2DL 4OIIH 4DK5A 4XPBL 4GUPA 1PL3A 1MCWM 4G8FB 4E42A 3VXMB 3G5ZA 1HINH 1PEZA 3NZ8B 3Q48A 2E9BA 4PJBE 3W2DH 5EV7A 4GP4B 4V1DA 5EF2A 1W72H 3DK2A 5E2WL 2EEFA 4BFFA 5D6DA 3W0WA 2PTTB 4UIKH 5DHDA 1G6RL 1CGVA 3HB3C 3ZHKA 1E2WA 2HMID 2AF2A 1H19A 5LAXA 5IB5B 1I75A 2VDNH 1DQJB 1IKFL 3I6LE 3KH3A 4PGCB 1DQVA 3GBEA 3WNIA 1NAKL 2YK1L 4HJUA 4XWOD 4GS7B 4P46D 3VVVA 1JERA 5I8KL 3AY4A 4ONFH 1P7KB 1KGYE 1OEZW 1MHPL 1P6FA 4CW1A 4GXFA 3KLHC 1L7TH 2D0FA 3B56A 3I74A 5C0BA 3QG6B 1JNNL 3GZPA 3MV9A 3R19A 3DMMC 4Z95H 2J7LA 5FCUH 3SKMB 4CC1A 1D7DA 1JPFA 5B21A 5HHXL 4F7CA 1P4LA 3T0EE 2V2TA 4MFHA 1MJ7L 1E3ZA 1TYRA 4FNLL 4Q56A 4Q8BA 2G5BB 1DZBA 3MLVH 1FE8H 1QX1A 4QDGA 5TH2A 4Z77B 5HHPB 1BZEA 2XBZA 4NZRL 4N0FA 5KSUA 4DP6X 5EEXA 2LVEA 5C0FB 1AYRA 5MEND 3EHBB 3QZBA 4PY7B 2KQMA 3VGBA 1W8OA 2GK0B 5CGYC 3BKML 1B4LA 2YA2A 1CFVL 3QIWC 3PS6A 3C09C 2A9NL 3SDXB 2EYSA 5C0IA 3MRRA 4XOBA 4U6VL 3UTQB 4YBQC 4BH7B 3U25A 1BVNT 1JPST 4ATWA 4XGZB 5DHVH 3ZTEA 1NJ9A 5FUCC 3HRZC 1IFRA 3S8GB 5HHNA 5EIIB 4F9LA 2ZOOA 1GPOL 2YXVA 3N1QC 5LCVL 3TEUA 3GRWH 3TZVD 1EDHA 4QJ3B 1I7UB 2HFTA 1HILB 2QL1A 3PP3K 3BUTA 1O7SA 5ANMA 2VKXA 3RFZC 3K80A 4QRPB 4LU5L 3VX0A 4S1DC 1BVZA 3T77A 2WM0A 4U1SB 2LU3A 1TENA 3V8OA 1E30A 4U1GB 4RMQA 3R4DA 2VDRB 1UWEH 5ID0A 1AANA 4JHWL 1AHMA 4RVBA 1LK2A 1LE5A 1JZDC 3UZQB 3BSZA 4P5TB 1CL7I 3MNVA 1OTSD 3BT2L 1NIEA 2DWYA 4NZTH 1Z0NA 3F58H 1I3GH 1CVRA 4AIOA 1NDGA 1V3MA 3L9EA 5FXCH 3A6CH 5D7JA 4F5CE 1V3KA 3V8CA 4NQXA 1UATA 5TE4L 5CEYA 4MXQD 4B96A 2A9ML 3RL1B 2AXJA 4PJ5A 4C55A 3F7RA 2Y6SD 3MU3A 5EO1B 1V7NL 3DC0A 5CJOL 1U30A 2D3JA 4G8GD 5C0AA 5FYJH 3FXIC 5D1ZI 1JRHL 1NGWA 3EJUA 4OZIB 1WWWX 1EZVY 1EPFA 1J5CA 5E9NA 3GO1H 1NBCA 3GMPB 4IDJH 4AW4A 1LK3H 1Z9MA 2G0LA 3VXTB 2YD7A 3BZ5A 2L7UA 1TZ8A 4X5XA 4YDMA 4MA8L 3D25B 2VDMH 5HYJE 3SZ6A 4NLAA 5LHDA 1LE9A 3HG0A 3L5XH 5CCKL 2FR4A 4KNQA 1X3DA 3WFDH 4XH2B 3STZA 4FXGA 1EX0A 1V5JA 4LRNH 3BP7B 4ZSOB 3MBXL 3NJMA 2HP4A 4OCWL 1MFBL 2JCCE 2DQTL 4X83A 1MUJA 1F90L 3QEQE 3RRQA 3WEOA 4B60A 1EA9C 2H3NB 3KPTA 3GSNB 2R39A 1ZLUH 3RVXD 4O9HL 4AEEA 2ZQKA 3CC5A 3PDOA 4QRSB 3HZVA 3WJLA 1BFOB 3VGGA 4YDIL 2OMVA 3C5SB 1RPUA 4R90H 5A3ID 3KM2A 1KIUA 3ZGIA 2Y0SA 3EYSL 3MRMB 6PAZA 2DDQL 1ZHBA 1MFAH 2ESVA 1SOSA 3BO8B 2CIIA 4G2AA 1S78D 1BBDL 3W11D 5IQNA 2DTSA 2I60L 1PZUB 1MCEA 4E2OA 3N50A 1RKRA 1F4XL 3SPVB 3G5YA 2QQLL 5I75C 5L2JB 2P28B 2X4PB 3MLXL 4ONHB 4LPTA 4HHGA 3KYNA 4QHLB 3S8WA 4YZFF 2NXYD 3KWVA 1L9RA 3UC0H 5ACZA 4FZEH 2O93L 4JG5A 1ZV5A 3ZHLA 2ZUXA 2ZP0T 3EO9H 5IIEA 3IDNB 1AJ7L 1QLFB 5K9OA 1YMHA 3IJEB 3KL5A 4KAQH 3BFQG 4KXZI 4YX2L 4ABVA 5FEBA 5E6IC 5J7CC 5T3XD 2OP4L 4WEUD 3TT1L 2WBJB 4L8BA 4NQTA 3SDYL 1MJ8H 1X7TA 4I0PA 2CKNA 3EJJX 1F58H 1NFDA 3Q6FA 5D93C 4GMSL 1WCBB 1WICA 1PJ9A 2ALWA 4HBCH 1QO3B 1JYNA 4M8RA 4NJ9H 2VC2L 3QUZD 4MCNA 1NFIB 4G80B 4JPKH 5DJ6A 4PW3A 4BD4A 2AJVH 2ARJB 1NPNA 5DCCA 3FAWA 2FWLB 4ALAL 2NY4B 4UDUB 1OLZA 3U9UB 3VGEA 2D3VA 4OFIA 2MCG1 1A02N 3RWCB 3L7FB 4R4FH 2Q7AA 4G70B 2RMNA 2KL6A 2APBA 2ZNWA 5J89A 5D7EA 3QJXA 3QHZH 2XQ0A 4M7LT 3SOTA 3NP3A 2CCLA 4GUPB 1HYSD 4E42B 1BDYA 3TM6A 2VLRA 4WCYH 4L5FE 3CSYA 2QHRH 1U0QA 4MDJA 5GISH 1UYWL 2GIMA 1ZY9A 3QHFL 2G9HA 1CXKA 3HG1D 3O4LE 3W0WB 1JF1A 2N01B 2MQGA 2YRZA 3T6XA 5AZ2H 2IBGA 2LE9A 2FLBT 3KDMB 3F65A 4K7FA 4JFUA 1WFJA 1W0YT 1AXTL 1PG7L 1Z2KA 2Q7YA 2AJXH 1U6AH 2CJ3A 3C5JB 1GGYA 4X6CF 1EAPA 3BRGC 2Z6FA 1IB5A 4M00A 5B3JF 1AO7E 1PZBA 4FQQB 4ISVA 4LMQI 1S5IH 2IIJA 3DPDA 5IEKA 2WQSA 4CW1B 4OT1H 4YL4A 5KSAD 1XAUA 3JZ7A 5C0BB 5KOVC 3DRTA 1AGEB 4IBWA 3V4UH 1F56A 4F2MA 2DM2A 2MOQA 3OZ9H 2C8NA 6CGTA 2W91A 1KCRH 1CU4L 3SDCB 4XPTH 3C60A 4HIHA 2QMKA 1JPFB 4F7CB 4IK6A 1P4LB 2DTMH 3LKRA 4BINA 2V2TB 2APSA 1SOXA 1GSMA 3NJFA 5AVYB 2VDRL 4MBOA 2O26U 25C8L 3IGFA 5TH2B 3OKOB 1IFHL 4NN6B 4EXKA 1G4MA 1IC5L 3OKKA 3FPYA 3II1A 3BLPX 5KSUB 4Z7WA 4YDVA 1L0PA 2XA8H 1NL0L 2BSRA 3QVAA 4YXLH 4HA1A 2J8UE 1E2VA 5ISZA 3ARWA 3GMLA 4QAWA 4R26L 4Q6KA 5AW2B 3N43F 4NQEE 1KYAA 2R0LH 5ABAA 2EYSB 1FH5L 1MELA 3MRRB 5FYKL 4ZX3A 1L5GA 3MOBH 4MB5A 4PUBL 3ZDWA 2WLZA 1Q9LA 4ZX5A 1FPTH 1ETA1 1HFUA 2NYYC 5IQLA 1CD1B 5HHNB 2W0LA 2W07A 2XOTA 4JPWL 3P2DA 5CJBA 3SGJA 2VR4A 4QOKE 2N1KA 4ZXBC 4HETA 1QHQA 2HX8A 1UENA 3TO4D 5F96H 2OR8A 2VLJD 2ZKMX 1S7QA 2K7QA 5BV7L 1QTYT 4LCYB 5ANMB 4X9IA 3WG7B 4MZRA 5ID1A 1XXFC 3I3EA 5IM7B 3HC2A 3OKLA 1WEJH 2Y23A 4MX7A 3OHMB 4ODSH 3T77B 5DGRA 4XNDA 4Z3JA 3K5SA 4HWBA 2XI9A 1CQKA 4HIPA 3QAZC 4MWFA 1LK2B 1LE5B 1KCLA 5F9WC 4HIXH 4J1UA 3AGWA 5KS9A 2NNAA 3MNVB 1SBSL 2EICA 1SPDA 1S7VA 3VFVA 5JW4M 2UZIH 3LPWA 1VZHA 1H15B 2FJUB 3ILDA 3AB0B 1NDGB 1V05A 3FQTA 3S5LG 4A68A 4NQXB 3WE6A 1U92A 3JYCA 1PSKH 4KK8C 5C0CE 1M42A 4HWEH 4B9FA 5HVFB 4JMXA 5I1EH 4PJ5B 4ZOBA 3JWOH 1IM9D 1K4CA 3ZR6A 4NZDA 2WSPA 4POZC 4KKBD 3GEWB 5AVXB 5C0AB 3HAEB 1VRSA 3ATAA 3ARDD 1EUUA 2J5LC 4Z7QF 3D9AH 2JKIS 1DQQA 1AXIB 4RWYL 4HK3N 3V6ZA 4D8OA 2CH8A 5IK3A 1JV2A 1S3KH 4NHUB 4J3OG 3TN0C 3UOAB 4K15A 3MODH 5DVLA 2PLTA 4X5XB 5CEZE 4TPRH 2EABA 3L5IA 3UZEC 1X9QA 1LE9B 5F1KC 1UWXK 1X7QA 1YEKL 4KVPA 3STZB 5L9DL 1YY9C 3FPXA 2XN0A 1QPPA 3S48A 2F18A 4BK8A 2AW2A 3CX2A 1RZKC 1NMAH 1MUJB 2K3TA 2BNRE 3QPXH 4OKVB 1CXIA 4UT6A 1DVFD 3CC5B 3PDOB 4R8WH 4JFVA 3F7KA 3B9DA 3HVNA 2DKUA 1IZKA 5IUCA 4JHAH 3ALWA 3VH8G 2F1EA 5C0GA 1ZHBB 2ESVB 3SE3C 2P5WB 2CIIB 2D2OA 1ZLSL 2DRUA 2X4RA 2DQDL 2BW5A 1D5ZB 2NX5D 3B7YA 1AQMA 3EFFA 3LH2H 4DEWA 3DPBB 5E7BA 1RL1A 3KLQA 1CE1L 3QDJA 1CLZL 2G5UA 2LV4A 3G5YB 1H9VA 2YKLL 3MHZA 3VSVA 1RV6X 2LLGA 4HKXA 4DGWC 1DBJL 1MDAA 3KYNB 5ICYA 4IKKA 1SDYA 4PJ8A 1FNGA 2AQ1A 1RJCA 5JQHC 1ACYL 3MZTA 4G9FE 1TYEB 2GYSA 5DQJA 2UXGA 3BWUC 3VFTB 3T0EC 5IIEB 2C3WA 2CA3A 3NCYP 5K9OB 2BWDA 4NM4H 3UAJA 1RU9L 3B37A 2R1XA 4L8BB 4NRZB 1X5GA 3LN4B 1EFXD 3N41B 4PCYA 1A3RL 2GBUA 3Q6FB 3GJFK 5I1HH 2WP3O 4GRLD 3TIEA 5DR5L 1R17A 3K91A 4N8UA 1J1OH 5CINH 4YGAB 4JHBA 1KEMH 1MIML 3BRDA 3X3FL 2KT6A 3I6KA 3APNA 3VXSD 3BQVA 3TESA 3QUYD 1DQLL 4EQ3A 4NQDE 3FTUA 4I4WA 1F41A 1CYGA 4N2CA 1L7IL 3V9CA 3JWNG 2EIZB 1LDPH 4UTBL 3IJHB 3U82B 1LWHA 5JOEA 4NO0D 3P9MB 4TL4A 5I6KA 3ZE0E 4BA8A 4GIPD 2WB1A 3MXVL 5I76B 5L7XL 5IW3A 2VLRB 2X10A 1U8JA 3CSYB 3FTGB 1SRDA 2AK4A 4AGMA 3UG5A 3FU6A 4WU5B 1GGUA 1CDGA 5CAYB 3GT6A 3OWEA 2G9HB 3BN9C 4X7SH 2Q5BA 4XVTH 3D48R 1G1OA 1X5YA 3IPFA 3FB7A 4LCUB 3ESVF 4S1SH 2NY6C 1N70A 3VRIB 5J1TC 2Q7YB 2IGFH 4Y9CA 1B0RA 2HX7A 2RQEA 1EAPB 2JIXA 3LOWA 4DSYA 1JS4A 1RUPL 2XX1A 3WMSA 3BH9A 3QORA 1BQLH 3BVNA 1GVIA 2YGNA 5IEKB 1MIEH 4PFEA 2UZYA 3KGRA 1EHAA 3MBEA 3DRTB 4P06A 3WLWC 2A6DA 3CN1A 4F2MB 1GGCL 4D9LL 4LSSH 4FQHA 4OCRH 3VG9C 2ATPA 3MLWL 4RAHA 3BVTA 2D7TH 2CO6A 1NUFA 4CSZA 3C60B 4I77H 3D0VA 3QDMD 5BZWB 2V37A 2O72A 3SODB 3LKRB 1N0XH 4KHXL 1CLVA 3C12A 1J87A 5I24A 4Q0XH 4D3CH 3PQYA 2GC7C 1OZUA 1W80A 3H6AA 3OKKB 4FCHA 5AVZB 4ELKA 5KYUB 4OLUH 1E5CA 4Z7WB 3VI4B 2BSRB 3M8OL 4X7EC 1NBZB 3CXDH 3GMLB 3HJEA 2F58H 4FQ1H 4GFTB 1T2QL 3HS9A 2OJZL 3X1NA 1AIFA 3TH4T 4K4KA 4AVKA 4KVCH 4E41A 1U93B 1BFVH 1L5GB 1OB1A 4TM9A 1WS7A 4UUJA 2K4AA 3WHXB 2J71A 1Q9LB 4FNQA 1T1XA 4ZW7A 2ZXCA 2IBBA 4JKNA 3V4VA 5AW9B 2B20A 2W07B 1QWNA 1CWVA 1AD9B 2WJ7A 5SX4I 4B3VA 3KPSA 4X8GA 3RJQB 4PJ9C 3RKPA 3KMDA 4YC2C 4HPOL 5ID1B 3LY6A 4ZT1A 3OKLB 4ZUVA 4EVNA 3V6OA 3WLBA 3SPHA 2BMKB 2PXYA 1FFQA 3GXTA 4NQVA 1A7QL 3ZMRA 3KPRD 2AEPH 4X6CA 3AQYA 5DUMH 2WXIA 3IGUA 3HE7C 2I26N 4YAQA 1I9IL 4MWFB 4AIZA 5E9DE 3EYQD 1IEBA 2PWFA 3MX0A 4J1UB 4PWIA 2NNAB 4LE8A 5B3SB 5C08A 1UD2A 5ECJE 3T2LA 1S7VB 3VFVB 2W92A 5T3ZL 5C07A 3ERXA 1NCTA 3FQTB 3WE6B 2XFXB 4XX5A 2Z1PA 3S3CB 4KKZA 4QXWA 4GUQA 4XP9L 2YWYA 3MLRL 4K94L 1BJ1H 4XCFL 2MPAH 1H3VA 2R23A 1K4CB 1J7VR 4FLOA 4RGNB 1QP1A 3DO4A 3ARGC 2RACA 1FLRL 3N40P 3UADA 3LQAC 4HV8A 1GJUA 2ED9A 4N2AA 1NLBH 3GZOA 1DQQB 1LO3L 3PWPD 5DJDB 1TCRA 4UBDC 3V0DA 3HCVA 4C54A 1FAIL 1MVUA 4HUXA 2GAZA 3C6LC 1KPRB 4JFWA 3MXWH 1D9KC 1UGNA 1UA7A 3U4EA 3QZNA 3WFBL 2ZOKA 2IJ0C 1A1NA 4GQ9H 4HX1A 4JFYB 4KKLD 3WTUA 3LIZA 3SE8H 1NOAA 3EOYG 1D2OA 1EGJA 4XWGL 5FA3A 4FFYL 5DMYA 4XNMB 5AKVA 2F54A 4Q97A 4KKCD 1JUFA 1DYZA 1UQSA 3D05A 4O58L 3LDBB 2ZF9A 3AU0A 5EUOE 3UO8B 2O5XH 2HRGA 4HS3A 4N0UA 4N4YB 2I7SA 2R0WH 4KNTA 2OL3H 4XP4L 3MCLH 5C0GB 1OY3B 3FN0L 3JWNE 2E27L 4E5XB 5KOMC 3WDJA 4RMVA 3E9UA 3I9GH 4OJAA 1LQSR 4QHNA 3VSQA 4BDVB 2NDGA 1VZGA 3BGFB 1XIWA 2VJXA 4L4TA 3WGUB 1ZTXH 4Q9CA 1P6AB 3QRGH 3RY6C 1RXLA 3QDJB 4TSCH 1XB3A 2V7HA 4HKXB 1JJUA 1XGPA 3OZLA 3LZFH 3QDAA 4YO0A 5AL0A 1JFQH 5ICYB 5KSBB 3VD2A 1X9LA 4PJ8B 5GS2D 3FJTA 4TUJA 1JNJA 5DRNA 1FNGB 3QUHA 2CHWA 2WP3T 4ZMZA 5DQJB 1J0HA 5PAZA 3O8XC 1SVZA 1T20B 2O6CA 3PFUA 1QSFB 4M02A 1GW6A 2VUOA 1NCIA 2JNZA 4BSWA 5JDJA 3FTZA 4OZHE 5DWPA 5CN3A 1MHHA 2XPZA 4LL9A 4R2GD 4M3KB 3EYUH 4N0YH 1FQ9C 4WI0A 1PX8A 4HAGA 2HJFA 3RE0A 3FO0L 2B2XH 4J39A 4KRNA 4LASH 4OQ1A 3MUGA 3MUHL 3H9ZA 3T2NH 4NXSA 3QUKA 1WE5A 5LG1A 1DUZA 2X4OA 1FCCA 5C2BL 3I6KB 3EHBD 3E1F1 5GZNA 1XZWA 2EE9A 3SBQA 3SKOA 4I4WB 1F13A 5JORA 3NRFA 3L6FA 3L4YA 4ZS7L 3RBGA 2ZYIA 1SXCA 3RWHB 1HXMA 4DW2L 3O2WL 2XBDA 5ERWB 5F7YC 2VZSA 2L4OA 5C9JA 3V4PL 3AM8C 2QMJA 1LXMA 1E8ZA 2DBLL 2IANA 5IBUB 4G5ZH 1U8JB 4XVJH 2FATH 4AQAA 5KVGH 2BP5M 3CQPA 1IAKA 2WQXA 2GBTA 3BYYA 3RUGE 3I02A 2BHFA 1BAWA 2OMYA 2FEEL 5AB2A 4DWHA 3FB7B 3T4AA 2D4FA 4F7EA 4QRPD 5LNEA 1K5NA 1M57B 5D7LE 4NENA 3B34A 2QDWA 3KLKA 3GZKA 4LL1A 4P8QA 4YDJA 1JDDA 2IQ9L 2NOYA 2LVCA 5I0XA 3QCVH 1INEL 3ROLA 3S8FB 5FLVA 5E00A 5JPMB 4AENB 4XNBA 2UZYB 3ECQA 4OB5H 3BUQA 4QKTA 1P84K 3MBEB 4QI3A 1A7NH 2OK0L 2A6DB 3TGXA 2WKGA 3SB3A 2ATPB 3D12B 4QYOA 1OP3H 5EPMA 2CO6B 2BERA 4NPKA 3LKOA 3THML 3EIFA 4FEIA 1ML0A 2ATAA 1QLEL 1I82A 1U8QB 2PYEE 3QO0A 2CALA 2WXFA 1Q0YL 3QULA 5IKCA 2E86A 2NY1C 4M6ML 1J9CT 1XBDA 2E7MA 4DVRL 5B22A 3U48A 2PO6D 2IDSA 3PV7A 3K2UH 2A74A 4X7TA 3T1WA 5I1CH 3IMUA 1RZJL 2CUAA 3QWRA 1OL0A 3L2MA 3GIVB 2F7QA 4UILH 4AI7A 1QD0A 1XR9A 5IEHA 2N7AA 2OPCA 1ROCA 3NSCA 5BVPL 1AIFB 1ERNA 1YO4A 1QG3A 4LEXL 4OTXH 4KV5F 4N2FA 4E41B 3ZU8A 4EUPG 2HG5B 4YFEA 2J1WA 1OB1B 2NY0B 5MEPA 3V6BR 1H8LA 3F7VA 2G3XA 4GSQA 1TZIB 2BZCA 5EDXA 3ZZLA 2IDFA 3DIVA 4E9RA 4M9OA 2Z92B 5CSZA 3ABMB 2E8YA 4A7QA 3KL3A 1QYGL 2GY7B 2WTPA 4BKSC 4OZ4A 1GC1C 2HG0A 3VXOA 4AL8L 4JM4H 3KZ8A 5DK2A 3U4KA 3GSRB 4N1CA 2C34A 2BXYA 3ROOA 4PJEE 1T83C 1U4EA 4GXVL 4P4KD 4JM0A 1IBFA 2WAQA 4KMQA 3WLBB 4NQVB 2PXYB 3VQ2C 4S1RL 1LHZA 3L4ZA 3GSUA 1DJXA 1TQCB 3GLZA 4X6CB 3VRLE 5CMAB 2F7PA 5CIPA 1OK0A 3DGDA 4YAQB 4AIZB 2WYZA 5HPMA 4BZ1L 1OAQL 4HAFA 3IYLW 3WAJA 1HEJC 1IEBB 1QA9A 4NC2B 4OD3L 3MX0B 1UOVA 1HTYA 5C08B 1YVLA 5KTEH 2HFEA 4AX3A 3VFSB 4BCZA 5C07B 1KJ2A 3ZW3A 4OF7A 3GF8A 1I7ZA 4UM9A 3Q8CA 1Z3GH 1KB9J 5F0MB 1DFBL 3UPCA 1FVCA 5JXED 1Q9OA 3UP1A 1G1CA 3SGDI 3GEFA 1JCKA 4PU2A 4U1MB 5FLUA 4I2XE 3UBGA 4NUJB 2ICEC 5G4MA 1LP9E 2VT0A 5HY9A 5LNGA 1E28A 2JCWA 3IJ9A 5F1SA 2QKSA 1TCRB 4L8SA 2EQDA 3TNMB 5DVKA 3HUJF 1UEMA 5CD5C 1FG2A 2I07A 1MVUB 4HUXB 2PTUA 3RP1A 4KDTA 2X1QA 4JZJA 4S1QL 3U4EB 4WI4A 3ATFA 3PF2A 1A1NB 4HX1B 1YYML 5INCA 1RZKH 4IEFA 4HS8H 3N43B 5ANHA 3OB0K 4XTRD 3NZSA 5FA3B 1IKNA 2NY4D 4TLSA 3FDWA 3G08A 3Q8BA 2F54B 2EXYD 1DBKH 4FP8L 1I85C 4LQ1A 5A7BA 1UQSB 2YQGA 1HS6A 4X4KA 4LMQE 5MI0B 2ZAIA 4BFKA 1XH0A 5BO1L 5I30H 4HS3B 3L2LA 4FHKA 3VWJB 2ICWJ 5EU6E 3QEGH 5TE7L 3BGMA 5G5DA 4Y5YC 3WNJA 3B4NA 3EBHA 3LH9A 3PL6A 3ULVF 5K1JA 2Y24A 3DV4A 4QHNB 5CZKA 1XCWA 3FFCE 1NGQL 1XIWB 4L4TB 4HW6A 3LXCA 2EDEA 1HAUA 1LEIA 1QWHA 2XVBA 3HC4H 3KW8A 4FQXC 3CD4A 1JSYA 1DQMH 2V7HB 1LD9A 1TETL 4AMXA 2B15A 3GB7B 4YO0B 3ARBC 4N2LA 1E5ZA 5CJ8A 1ZLWH 4G6JL 2E9GA 4IRSC 2IOIA 1U58A 2B16A 2P5EA 4KI5F 4R6UA 7PCYA 3N06B 5GRXG 5TE6H 3SKNB 4X7DC 1JTPA 2X0VA 4OF0A 4OM0H 4U3CA 2R7EA 2WXJA 1DJIA 4BZ2H 3BAIA 1R0AL 4CN4A 4DKDC 5HVHB 5C0BD 5AEAA 3ZL1A 1X5LA 1CK0L 1WFMA 1Z9LA 2XQYG 2EUZA 5FO2A 1UM6H 3HMXH 4W6WB 5ELIA 1MHHB 2EZ0C 4NWUL 4JFFD 4AYEC 3SDCD 2SODB 1OQOA 3BVUA 4GAYA 3U2JA 2HJFB 1MVFA 3LNHA 4HSAC 1EXUA 2FEDD 4YPGB 4Z7QB 1KBWA 2H0FA 3QUKB 3VDCA 5TF1L 5LXGH 1DUZB 4AK2A 4FD0A 2X4OB 1BXXA 2PTVA 4J3OC 1T1WA 2R8SH 4XE0A 1CDIA 1TJGL 2ZXWB 3I85A 2X2IA 1NBVH 1RZ7H 3C6SA 1BOGA 3AT8A 4OQTL 3L6FB 5JORB 2EVIA 4CN6A 3GM8A 4IOFC 1RURL 5I6XB 5IBTL 2X1XR 5D5MB 1NKGA 4GXUN 2GFBA 1WBXB 1UOLA 4ZUWB 4GAGL 1NIAA 1FORH 4MJ5A 5C9JB 4BYHA 4RA3A 1Q4NX 2XC8A 2VDNB 2APXA 1DJYA 2E7CA 1UM5H 4ZNEE 5INDA 2IANB 4PR5A 3ZZ1A 5T5FA 2CAKA 2UXFA 2Y36H 3BCDA 2JVUA 2DQHL 3DUUA 4AQAB 4X6EB 1MKFA 5KVEE 2VDQH 5ESAA 3Q6GL 1IAKB 3NCJH 3QR0A 1UVQA 2B4CL 3FKUS 2IV9A 4G72B 4RMTA 3I02B 4DPCX 2OMYB 3KEHA 4J3VA 3R06A 3T4AB 5JIQA 2X87A 4NPYB 2KLTA 2FD6H 2I69A 3QHTC 3I9PA 5HI5C 1K5NB 4GKLA 2WHVA 4DKAA 2EDDA 4PRID 3EYVB 4NENB 5D1XE 3LVEA 4YDJB 1NCOA 2E4FA 4JFDA 4JGNA 5C3TA 3LZOA 4BBWA 2XXMB 1UXSB 2JV6A 3ROLB 4TSBH 2X2UA 4JVUA 5E00B 3BUBA 2FX7L 4BRVA 3WSQH 1CO1A 2ARWA 2X53A 2N7BA 1G9NL 4J4PD 1HIMH 4GSXA 3VXME 2ZXEB 1TEYA 4WI9A 5EPMB 3TX4A 3WDIA 1AGDB 4LF3A 2VR7A 3U1QA 4ETQA 4MB1A 4JFPA 1OARH 3TFBA 1GGBL 4WAFA 4MNQA 4AEIH 4NQSA 2NSXA 4KOBA 4JFXA 2A74B 4IGBC 2V9TA 4X7TB 2RHEA 4GIOA 4PREA 1RCYA 1DN0B 3SDDC 2HCZX 3A22A 2ZE0A 5IEHB 3NCMA 2Z91B 2B3RA 1QFPA 4PCTA 2XQBL 4OLXH 4ZMOA 4W93A 3JWNC 3WMQA 5MEPB 2YR3A 2YAQA 3QZPA 4Y2DC 1UB6A 3KNBA 2VITB 3DSFL 3TJEH 4N6QA 4NN5B 5SWSD 1H5BA 1OWWA 3ZDZE 4WTZG 1FNHA 2Q3ZA 5E70A 5CSZB 2QR0A 4PHZA 4YN3A 3EF4A 2I5YH 5MEQA 1QATA 7CGTA 5I0VA 2XN9E 1BIHA 3LSOB 3KWTA 2CGYA 2P5WD 3VXOB 2FH8A 1IEAB 4YHML 2YAFA 3B2PA 3ROOB 1BPLB 1UZ6F 5JLZA 4PJAE 5IBLC 1CF8L 3FUMA 2M8XA 3OGOE 1SDAB 1MRDH 4Z7UE 1A6UH 2FK9A 3DHUA 4RBPH 3TA3C 2J25A 5DUPH 4Z0BH 4LLQA 5HPMB 3L3OC 4HC1L 5CGTA 4DK6A 3RGBA 2ARJQ 4TVPD 3SBWA 3VSUA 5DC9B 4XCNA 2R1YA 3BC9A 1ILSA 1DVYA 4LCCA 4TUUA 3BKYL 4IJ3C 2P80D 4W9ZA 1HNYA 1I7ZB 4EI6A 1EDYA 3RQ3A 2YLHA 2VDMB 3DGCR 3HE6C 1FVCB 4AYDC 3PWNA 1Q9OB 4YHYB 3FU3A 1BJMA 4P9MH 4IU3A 3LQAH 5T5NG 1T0PB 5IGXH 2YPVA 2B9AA 4ZFOL 3TFKC 1OM3H 4PRPB 1KB5H 5HY9B 3UTPE 4ODXA 1E28B 4IOIA 3NIFF 4L8SB 2W9EH 3PP4H 5L0QC 3MRFA 3RZWA 1C8QA 1OV8A 1B3IA 4JN2A 1D6VL 4JZJB 1YEHL 5DHMC 4ZFZA 1DUYA 4OLVH 4PVBA 4XCCH 4JREB 4L5FH 5INCB 3EXJA 4IEFB 2H32H 3SN6N 3DVGA 5I73C 5T1JA 5F7BA 3FL7A 5HDQL 3AY2A 4JR9L 3TBCA 1SYVA 3C75A 3G5VA 3H2WA 5K33A 2IH1B 1NGXA 4LSQH 2C9RA 4FJYA 5JOFB 3K2IA 3X17A 2GUOA 1XD0A 4NNPL 3Q2WA 4H8WC 2YSTA 2CM6A 4OIIL 4PVNA 5AVVB 5K39A 5D1ZC 5DURB 4YR6A 2B5IB 1O9VA 1I8LA 2DM7A 1A25A 3PL6B 4L4VB 1JZ4A 2WO2B 3ILPA 1HINL 3DV4B 3RTQC 1TZHA 2NMSA 4KO6A 4XCYA 1PVHA 3QWOA 3IDYB 4A7SA 2K45A 1W72L 4M1CD 4GBXA 3RTLA 3QI9A 3EDJA 5CO1A 4UIKL 5J6SA 4HMCA 4KXDA 2Q8BH 2FJHB 1T3FA 5CNHA 2ERJC 1HCZA 1S9VA 3UABA 4L9LC 2P5EB 3RX5A 3UEZA 4Z6AT 1BPVA 2DJUA 4B9GA 3FUHA 4WO4A 4R7DB 3SY0B 1ZK5A 2WV3A 2A73A 2DH2A 4BKTC 4ONFL 3LNEA 4K7PH 4N2HA 1L7TL 1B0IA 4I85A 2XVKA 4YSEA 3Q9QA 1P9MC 4HDIA 3A4FA 5DA4A 2WLHA 3GMOB 1L0QA 4QTFA 5D70H 5F9DC 4FLRA 4Z95L 5FCUL 3ISRA 1Z9SA 2KKQA 2WLIB 3NOIA 5ETUB 1F18A 5HHQB 1ET8A 3CTTA 2NR6C 4I18A 2EEXA 2R2EA 3HUJA 3MLVL 4FMFA 1FE8L 1U4FA 5D6CA 3PNRB 5C3LD 1T1WB 2EACA 3BE1H 3U79A 3FFDA 3WKYA 4XVUD 1MCFA 4QRQB 5FO8A 3DNKA 2HT2D 1A7BA 2KHAA 4XN1A 4AGLA 4FHBD 2J2ZA 1BOGB 3C6SB 5D7SH 2M83A 4LQFH 4Z7NE 3VXRD 2N3JA 2MRYA 4P49A 1N8ZB 5EU7E 5I82A 3V0WH 4JQIA 4ODVH 4R7LA 4C59B 4G1MB 1WITA 2GFBB 3NQKA 3QIBC 5D2NA 3WIFA 5D1QA 1F5WA 4MJ5B 3UC2A 2OYPA 1B4JH 4UM8A 1EEZB 4YE4H 1SXZA 1GAFH 1XBRA 3Q13A 5HGBA 5INDB 1XO8A 2WXMA 3FUNA 1UA3A 3VDAA 2W8CA 3VA6A 1BVLA 1OGTB 3F7PC 1UVQB 4KZCA 5DHEA 2DYRB 3ESOA 4LHUG 4GUOA 1ETZA 2QELA 3GRWL 3DMMA 4BV1A 3R06B 2YUWA 4B0MM 1T7YA 5A2AA 1HHJA 1MFNA 2LGNA 2XWTA 3WKQA 4OJFH 5E8NA 1JHKH 1LL1A 3FNKA 5TDOA 3L5JA 3BXNB 4WEMB 3EJCA 1IGCH 2AMUA 4YQXL 4NIKB 5DRWA 4IRJC 4FFVC 5FUZH 2LTQB 5I1KH 1WAEA 5C6PB 5G4NA 2DD8L 4MAYC 4C56A 1V27A 2A9BA 4FTVE 1IAIM 1O5PA 5CEZH 3BP6B 3PU7A 4F7MA 2A9CA 2A6KB 3A6CL 2R1WA 4LF3B 2P48B 5HD8C 1H0DA 1NCBH 3QB7C 4JFPB 4DOHB 4F1SA 5B4MD 5KVDL 3SYOA 4V1DE 3HRZA 1IM3A 2VKWA 4Y4KA 3MR9A 4WW1A 3KH4A 4MNQB 3RZCD 4QRUA 4PRDA 2IOOA 5FYJL 1WA1X 3GMQA 4JFXB 2Q2EB 2VAAA 2GI0A 4KPHH 1ZLUK 4WEEA 3GO1L 4PREB 4ACTA 1LK3L 4TNVF 5IHBA 3I50H 1A6TB 3VFWA 1HXYA 2VDML 4K9JA 4QMEA 1G7JB 1D5XA 4CU6A 2FT7A 3L5XL 1MI5E 2OI9B 3P4MB 3D3VA 3WO3B 2ZG2A 2VCOA 3WFDL 4KK6D 3PNWB 4NFDA 3FRPA 4D9QE 3WTVA 4LRNL 3T0AA 2BSED 1UB6B 3KNBB 1MFCH 2D9CA 4C8XA 1MHCA 3ES6A 1CICD 5CCHE 3MV9E 4GKZB 4KC3B 3BWUF 2XU9A 2QR0B 1KYDA 3K72B 3QC6X 1GC1H 3MLZH 5DJAA 4RFOH 5MEQB 3CVHH 2AJYH 1JK8A 5GZOC 4KX9A 3BP4A 1I3UA 5KJRH 5GGUB 3TJHC 1E5YA 1HZKA 5AW1B 5JHDA 1MFAL 2VDLL 2QJDA 5JLZB 2BC4B 3BZEA 1BQHA 4G6MH 3EOBB 4P2CG 2XHNA 1DHKA 1KCVH 2A99A 1B2YA 5E1HB 3LKQB 4FCAA 3W37A 4LLQB 2N0KA 2XXCB 4PJ8D 1BX2A 4HUCA 1CIUA 4FGMA 5GS1A 5IESL 5I18H 4XCNB 2R1YB 2RB8A 4LCCB 5E08H 1HJCA 4ZUTA 3UC0L 1T66C 5MERA 1ADQA 2QQQA 4JO1H 3ZKNC 1YUHA 4EI6B 2CJTA 5E1AA 4FZEL 1QSFD 1D6EB 1HWGB 5HI3C 3TV3H 4OCNC 4L4JA 3PWNB 5IJKA 4NT6A 2ZYRA 3E0GA 1RZPA 1UM4H 4KAQL 4JRXB 4QXVA 3QJUB 3WELA 3GBLA 3UTTE 3IE4A 3PGCA 3B8SA 3O4OC 5C6WH 5AVTB 1J8HA 2C9QA 2VH5H 1MJ8L 4KY2A 1I1AD 1P4BH 1F58L 2XKUA 4ZRGA 5DO8A 1A6ZB 2AJUH 4HBCL 4JN2B 3J2PA 1OT4A 5DF0A 5DHYA 1DUYB 1FVDA 4ZFZB 4JPKL 2D03H 2AJVL 1HH6A 3RAJH 1TNMA 2XV6B 1ZDSA 4K8RC 5JQIB 4KO9A 1YJDL 1SYVB 4UCFA 12E8H 3G5VB 1CLYH 4IYKA 2WSKA 1NGXB 3A4EA 5I1IH 5JW4Q 4N22A 3L9BA 4R4FL 3FSAA 3IU4H 1DE4A 5GGTL 3DYPA 3D8MA 4PJ5E 3QHZL 4YR6B 1BF8A 1EZUA 1JWSA 1F45A 5AB0A 4JGJA 2HKAA 5C0AE 4APXA 5D1XC 5E6IA 4B0MB 1TZHB 4MNGA 1A65A 3AXHA 4OJDH 1N0LB 5GISL 3KS0J 4XCYB 3QWOB 2DB8A 3K2KA 5KYYA 2NY3C 4GBXB 4RIRA 3QI9B 2ZD0A 3VE0A 5J6GA 5AZ2L 4KUCD 1GW0A 5JXAH 5IFAH 1T3FB 1W2KT 2AJXL 1IVLA 1S9VB 1UA6L 2VQ1A 5E4EB 4WTQA 5IF0B 3D85A 2F5BH 1BZOA 2AABH 2I9LA 4NERA 4C4KO 5ALCH 3WV0A 3OD3A 3MBED 4OT1L 4TTDC 1N5AA 4YIQA 4BUHA 4YHPB 3CHPA 2LAAA 4ZO6A 1AY1H 1SJEA 1KY7A 1BMGA 4P57A 3Q5TA 3V4UL 1O7VA 1HHHB 3DOHA 3OZ9L 3L2NA 1KCRL 1BXAA 3RIAF 4XPTL 3D34A 3RWDA 2YQ2A 3T8XB 3CSBA 4J3OH 2DTML 4GS7C 2WQUA 4Y4HD 2QPSA 3CU7A 1N26A 5C7XL 5A1AA 3VGDA 1G94A 4LLWA 5D6CB 8FABA 3ISWA 3QGVA 2VO5A 3FFDB 1Z3RA 1XCQA 1XCXA 5DGQA 5FO8B 3HB3B 2XA8L 3ALXA 3SBRA 4YXLL 2J2ZB 4LSUH 2R0KH 5KBKA 3KHQA 1U8KB 1F2XK 5J1AA 1SEQH 1XEDA 1AACA 1RERA 4E41D 3WIFB 2R0LL 3TVMC 1OAXL 4L3CB 1JRHI 3D18A 4KMLB 2C9XA 1U8IA 5A43C 2DMGA 3MOBL 5HGBB 3S88H 4LDLB 3GSVA 4UAOC 5DK3A 4FI7A 1FPTL 4MBRA 3ABKB 1HAWA 2FBRA 2L7QA 4UYQA 2O30A 1NFDE 4NWTH 1ETZB 1UEYA 1P53A 2HAZA 3DMMB 1CDHA 5AVQB 4K73A 5F96L 1H6EA 5PCYA 3A21A 4MJ6A 1HHJB 2AVGA 3FO2A 2VR6A 2XWTB 1F8TH 2ZWSA 2PXYD 2BDNH 1G0XA 4IRZH 4G8EA 1JYVA 2OMTA 2BCMA 4ODSL 2Q87A 4Z3GA 4X0KA 5TDOB 1F4HA 4JDEA 4OM1H 4XNAA 2GTWA 4U4BA 3REVA 5DRWB 5K9KA 1AH1A 1NIBA 2RR3A 4N2GA 5FKAB 1P7HL 3RNKA 5J56B 2Q2LA 1BEXA 3CK0H 1DBBH 4UQ3B 4HIXL 3HC3H 5ICXA 4WUUB 5C07D 1IC1A 3QJRB 5DUBA 4JDVA 4F27A 1TITA 2UZIL 3MNDA 4R0LA 2G0KA 4L2LA 4F7MB 1SOKA 3BD3A 2HVKB 3K0YA 2R1WB 2VLRE 2YBGA 5JIMA 4JDZA 1PSKL 1CDBA 4AV0A 3QQ4A 2EDLA 4JQVC 5I1EL 3U4BL 3NYKA 1G7IB 1TTAA 3HRZB 4OIFA 2CRYA 2GJJA 2JKLA 3MR9B 4WW1B 4KJYA 4QRUB 5JMRA 3RVUD 3VM7A 1EAOA 5DZNA 1E9PA 2VAAB 4P5TC 5DJXB 3D9AL 3ECVA 3KLLA 2YEQA 3T3PE 5IVZB 4GSRA 5L8KB 1S3KL 3VFOA 5TFSH 1MAMH 4RA0C 1CFQA 3MODL 1P2CA 3RFZB 4TPRL 3JWNH 4FQIL 2OMXA 4FMVA 3VFWB 2EC9U 4ZW5A 2HFFA 3C2SA 1UKTA 3U7AA 1D5XB 1KFAL 4UZSA 1TFHA 1RD6A 4A38A 1N3NB 2C3VA 3OMIB 3GI9H 4ZZKA 3K8LA 1SY6H 2XN1A 2F54D 4AGNA 3QT2A 1CXFA 2ZCLH 1QZ1A 5JR1H 5CD3B 1IBGH 1NMAL 1MHCB 3ARED 3ES6B 3H2PA 3RX7A 4F2ME 3QPXL 1FBIH 4RSYA 2OW7A 5EBMA 5GGVL 3N85H 1AKJD 4XCEA 4ZX6A 4GYBA 1ZE3C 2F53D 3WIHH 3VWJD 4R8WL 2GBAA 3MNWB 1FV1B 3NCXA 4JHAL 4YSTA 5IW1A 1NPUA 4HJEA 3HFFA 5JHDB 2DWDA 3T9WA 3L3IA 2VISA 2E6JA 1BQHB 4M5ZH 1XIWD 3H7LA 4L4TD 2GCYA 1XEUA 3LH2L 1MY5A 4WFGD 5HI4C 4Z7WE 3KXFA 4DGYH 2P52A 4HH8A 2IAMA 5ISZE 2JXMA 1ORSA 5FV1L 5BZZA 1T6WA 3MZGB 4EEEA 4H2CA 2GUYA 4AEFA 1QSZA 3ZDXE 1BX2B 1LWJA 5GS1B 2FBJH 2R0ZH 3WY3A 3MJ9A 2A3TA 1CPUA 3MRQA 5IROC 5AOJA 1HN1A 2CCWA 5MERB 3UIZA 3LZLA 4Y5XC 4I88A 5EOCH 1WIUA 2D7PA 4NQCA 2DEYX 1HK6A 3HHSA 1YECH 5E2TH 4L8CB 4NM4L 1MCBA 2OYKA 4YGVA 3LS5L 4HHWA 4CBZA 4UB0L 3QZMA 2IH9A 4MASA 1MFVA 1J8HB 1P5VA 1JK9A 4K3EH 3B1UA 1E5AA 4LAQH 3ZMNA 4L9DA 4MVBD 2BIMA 5H8DA 3B5HA 2WLMA 2CR3A 3QQ9C 5EU7C 1CL7H 1FZKA 1NIDA 4FNTA 5H2BA 2XPGA 2CHDA 2QPDB 3ELQA 5DHYB 4DERA 1HH6B 1J1OL 1JZGA 5F70A 3IPBA 1KEML 2XTSA 1AP2A 3DVIA 3FQUA 3SKJH 2RD0A 1MXGA 1SQMA 3GD1C 4Y8DC 4I3GA 1ZXKA 2BRQA 2WBJC 3OKNA 5KS9E 1KDJA 4LARH 4H8WH 4GPVA 2VTFA 1LDPL 2AQQA 1KGCE 1HQ4A 4ZTOH 4MMZA 1DE4B 3NCYS 2ZG1A 4IBTA 3NFNA 2IAAC 5KW9H 2IAND 3C08H 3PWLA 4HJGA 3FH8A 4U3XA 4XXCC 4Z3EA 3T0EA 1QAWA 2YXWA 2FWSA 1JWSB 4E9WA 3MV8D 4ZMLA 5E6IB 2Z1KA 4MNGB 4C4KT 1ND0A 2FRGP 1MCQA 2YJQA 1RUKH 4I9WD 1A6PA 1G87A 1ZPUA 2OZ4H 4KKAD 3QG7H 4XMUA 1ODUA 4PSPA 1W0VA 4RIRB 4X7SL 5TDNB 5I1DB 1SXBA 3VE0B 4XVTL 2AMGA 2QBWA 2IDQA 5D93B 3JVGC 4S1SL 4HOXA 2IGFL 3U2IA 5J6HB 4YHLL 3D85B 2XZAH 2HRPH 1HVXA 1NDMB 3S98A 1BQLL 2ZUQC 2I9LB 3VXPA 2ENPA 2FIRT 1JCVA 2FB4L 4D0DA 4LFHG 4BFNA 4JFHD 2DW5A 4HD5A 1DJHA 1OQXA 4HIEB 4FA8A 1MIEL 5E6ZA 1NLDH 1N5AB 4PVLA 5D6DC 5SWZA 1GHFH 1BVOA 4P57B 2BFGA 4OLWH 2KDGA 3L3DB 1DFXA 3O6FA 2F7OA 4NKDB 4AZ8B 3DARA 4YPJA 3D30A 3BN3B 2AV1B 2D7TL 4S0SD 3K5RA 1NCAH 1MCSA 4UOQA 3NAAL 1N0XL 5D7KE 3AY4C 3NIFB 1K2DA 4YDKH 2HB0A 3QDJE 4Q0XL 4LIQE 2YZ8A 4D3CL 1IGYA 4LLWB 1DVUA 4J3SA 4YVUA 4YSAA 4QRTB 1XCQB 3MRHA 3DX6A 4KXZH 1RK0A 3OBAA 1FDLH 5HJDA 4NSKB 3CXDL 2ZT9C 3EGDA 2NPLX 2F58L 3KGUA 2NDFA 4EN3C 5J1AB 1ES0A 2EDQA 1RZFH 2F6AA 4UMSA 5FB8A 2A4ZA 2L0DA 1MCOH 1BFVL 3D18B 4IM8A 1U8IB 2ZUVA 4QPEA 3GSVB 1IAMA 5F93C 1AR1D 3S97C 1FL6A 1BP3B 3HW7A 5H37G 5IJVA 2Y1YA 2ATKB 3QYCA 4O5LH 4PG2A 1A2YA 2HRHA 1F0LA 1U3HD 2XCMC 3CC1A 5FFLA 4WWPA 5CP3H 1BG9A 3NACL 4QTHA 2Y1AA 3VWKC 2BINA 5FUOH 2GJ6D 4MJ6B 3H85A 1JNHA 3FO2B 4DP8X 4TTGA 1FC2D 4TV3A 4AKQA 5HYJA 2QT6A 1KBBA 3FRUB 3FB8A 3FMGH 3MRIB 4JDEB 1FVEA 4PGDA 2ADFL 2AEPL 4Z8FH 2GTWB 3REVB 4URTB 5DUML 5K9KB 1AHWA 4FYTA 1AC6A 4RFEA 5FYJD 2QGDA 2L7JA 4Q6IC 1E4WH 1N10A 5ICXB 5DD3H 2ROXA 1P1VA 3FSOA 5DUBB 4JDVB 3WY1A 5EOQH 4HULB 4G43B 4R0LB 2Z31C 3OC8A 2PCXA 2X6AA 1VPOH 3FHQA 4JDZB 5BS0A 3QQ4B 1IGTB 2AK4E 1UH2A 4R84A 4PRPD 2MPAL 4P0DA 1J8SA 1ZGLB 1NDTA 4KJYB 1R5VA 5DS1A 1RMFH 2F19H 3G04A 4LBAA 4ZXBB 1NLBL 2PPFA 3L7EA 4F9PA 1OCCB 1YEFL 3U4AA 4CVZA 1IBZA 4OF6A 1MZZA 1CFQB 4OIBA 1P2CB 5D7JC 1NA8A 1OTUD 2OMXB 3MXWL 3NA4A 5HTSA 2HFFB 2D0HA 1USZA 3U36B 2WBKA 3BPLB 4GQ9L 2C3VB 4AKPA 5T1DH 3SE8L 5M7QA 2ZSWA 4KXCA 1J5OH 3HE7A 1YMMA 3QAZB 3X1FA 3LS4H 3RDJA 4A7UA 3LYRA 3C5ZD 1KTRL 3S35H 3ZDYF 1OGAA 2ZOLB 1OGSA 5A40E 5F9WB 5GRZA 1UKSA 1SHXA 3H42H 4K2UH 3SO3B 3AU1A 5EBMB 4XCEB 2O5XL 4GKOA 1J1XH 3KS0H 1HEZA 4PJXF 1WBYA 5I15H 4Y2OA 5DURD 2HLEB 5IW1B 2R0WL 3MV7D 2OL3L 3O9WD 3MCLL 4L4VD 2R59A 3RGVC 4QT5A 3PQYE 1S3RA 2Y7MA 2OSWA 2OMUA 3I2CL 2VISB 4FXGC 2QADB 1KMGA 1PCXA 1DVZA 2EDMA 1A6AA 2C4FU 2GCYB 2H41A 5BZXA 4KK5D 3KXFB 3QS3A 2J1YA 1ZTXL 2O4EA 5TGBB 3ARGA 1XSIA 4G1EA 1HE7A 3RY5A 5T1LA 2J5LB 1IAII 2JXMB 4TSCL 4B9ZA 1ORSB 2Z9TA 1GYAA 4BSVA 1KB5A 4ZS6D 2YHGA 2P8LA 3LZFL 1JFQL 3QXDA 1R4XA 4J3OF 3C6LA 4K7PX 4NZFA 2HRLA 1D9KA 2GTZA 1NFKA 1AMYA 2VR8A 3MRQB 3EUUA 2C1OA 2DQCH 4XMTA 4CN1A 4G5AA 3GGWA 5G4OA 1G9MC 3B1TA 3CLFH 5GS3A 4ILDA 3P02A 2M2DA 4G7YL 1UD3A 4HK3J 5KYWA 5K69A 2WLJA 4R5VA 4M93B 4N86A 2YQBA 3ECWA 4YGVB 1WFOA 2AXFA 3L4TA 4QEGA 1G0DA 1LO4H 3KPSE 5HHOE 4AQ8A 2OXHA 3QR1A 1P5VB 2FNWA 1JK9B 3O4LA 4NKMA 4PLKC 4OGAC 2ENSA 3H9YA 3EYUL 1S7WA 3V6OE 1X9UA 2VABA 1FZKB 2B2XL 2UUDH 1RIUH 4K8RH 4LASL 5H2BB 2XPGB 4FXLA 2VLKA 3N91A 2H5UA 3H7BB 2N56A 4EUPH 3S7GA 5KVEH 1QEXA 3FQUB 5H4ZA 4OF5A 2AQRA 2WYHA 3NSFA 3FO1B 3O41A 1ZA6A 3BUIA 3OKNB 5C08E 3IRCA 2H8PA 3QQDB 2QPEB 1S7RB 2O6FA 3LXAA 4I0PC 4IKLA 1DJGA 1F4YH 1HQ4B 5HGAA 4MMZB 1CLCA 3HG4A 4F57H 1E3FA 5FHBL 2FJGA 2DLFH 1KNOA 1A3LH 1SN5A 3IDUA 2CKBL 3KJ6L 2WLKA 3CFMA 3O8XA 3PWLB 4HJGB 3FT4A 4Q52A 5CEXA 5KUKA 2ZKHH 3T0EB 3BZ4A 2VDPH 4JG1H 4PV8B 4G5ZL 4E9YA 1CFSA 4XVJL 4KJWD 5KVGL 1AVAA 1ND0B 2MHAA 3N0PB 5I66A 7PAZA 3FT2A 3T8VA 1W0VB 4RGMB 3GHPA 3N0AA 3QFJA 2YAEA 1FGNH 4KHTH 2GHWB 3B7SA 1QUNA 3US9A 4LL4A 1EHLH 4NKIH 2I85A 1PFCA 2WMPA 4OI8A 3HKZA 5IHLB 3KWXA 4KJQD 5EUOF 1OCWH 1S9YB 1KY6A 3N1GC 3PAYA 4D0DB 3QCVL 1MAKA 1YC8A 2WVUA 4YDNA 1Q8MA 1SLVA 4OB5L 4ICXA 2IPUK 4NAMA 5FOBA 4XMPH 1A7NL 4N0UE 3BZFB 4BK4A 1RIHH 3O6FB 1PLBA 3VFNA 4ES8A 4QOKA 2AI0H 2R69A 3IJSA 1OPGL 2QTVA 3MRNB 2WWOA 2L3BA 3AM8A 3K4AA 5GXBB 4LSPL 1T5XA 4XHQA 4EIZC 3ZN6A 2YN5A 1GGTA 3TBYA 2UXTA 3A4DA 1CCZA 2A5UA 3IM1A 3S36X 4H0LC 3SQBA 5DD6B 3FOLA 3OF6A 1IGYB 5FPIA 1R3LA 2ZWLT 1VA9A 1KGXA 1RVFH 3LKPA 2VXVH 5FGBA 2VDQB 3MRHB 4KUZL 5I1CL 4M1DH 5HHVL 3DX6B 1RK0B 4G7VH 2NY6B 3SDAC 2JB6B 3EGDB 2QV2A 1TR7A 1I3RA 3DIFA 3C60C 1ES0B 2VXQH 1DSYA 4FFZH 4U6TA 3MRGA 4OTXL 5FB8B 5CU5A 1ZSHA 3AAZA 2GC4C 3BIKB 4XMKH 3GZQA 1AQDA 3F7YA 1UXMA 1FL6B 4ZUUA 3TTYA 1DJWA 2NUPA 4ELDA 3QPQD 5I9QC 1HNFA 4JRWA 4U0QB 2YMOA 3L13A 1T2JA 5BZDA 4OH2A 4OI9A 3VG9B 1F86A 1GRWA 1ULVA 4N2OA 4QTHB 3HS0A 3WUWB 4Z7QE 2R9HC 1N2RA 3SJVE 5LXVA 1IARB 1JNHB 4JM4L 4ZFGH 3QARA 5HYJB 1UUSA 4KZ0A 2ITDA 1PBYA 4FYQA 3FB8B 4PW4A 2QGCA 1FVEB 5I8OL 5DS8A 2R2HB 1J86A 2VJ8A 3OPUA 2QVMA 4XNQA 1DANT 1SMOA 1AHWB 1B0WA 5HXMA 4U1LB 1M7IA 2JJSC 3GHEH 2CDGA 5HJ3B 1GMIA 3SGJC 4RZCB 3IN2A 4BFOA 5KTEL 1NAML 1KGWA 1B4RA 3WFHA 2N59A 1XD1A 4FJZA 2XWCA 4G8AC 4G6KL 4UIMA 4MA1C 4N5ED 4JUTA 4Q14A 1QFHA 4ANVA 2ICCA 3Q2LA 3RDTD 1HWWA 1GYVA 4JRXD 5EU4A 1QASA 4ZFFB 3FT3A 3BQUC 3IDIA 1RQ5A 2ICWA 3L81A 5I1JH 4JM2A 2V5RA 1TIUA 1AZNA 3G04B 4UOJA 3ARPA 3E8UL 5GRUH 1XFPA 3HZMA 2VMJA 4CVZB 5I6OA 4PJ9B 2WOBA 3LV3B 4HFWB 1OOAA 4J3XA 3A0OA 4Y7MA 4ELMA 1T83A 1XZ0A 2X5PA 3EYFA 3E6HA 3R8QA 3RFRA 4NN7B 1J48A 1BV8A 4GO9A 4G9FA 5EC1A 1TVBA 2VUYA 5E2JA 3AGVA 3CIQA 1T1ZA 2ZSWB 3H53A 5C9KA 3HE7B 1YMMB 4RGNC 1AZZC 3Q1EA 4HG4J 4M8VA 1ZE3H 3H4HA 4CA4A 4WZ9A 4X9FA 4P59H 1IL1B 2XNAB 3AU1B 3LRMA 1ZHKA 1QTPA 1HEZB 1ZT7A 3GMRB 3D2UA 2CM5A 3DTUB 3QEGL 4FF9A 2UWEE 3CMGA 1N59A 4I87A 4QT5B 3B83A 2W65B 3B2VL 1OGPA 3WU1A 4KMTH 1T7WA 1A6AB 2VOTA 4JG9A 1YN6B 4GBXD 1QNZL 2BP3A 3QI9D 3ARGB 2KLRA 1I9RH 4HOZA 3V0IA 4G1EB 3HC4L 1BSIA 5T1LB 1BEYH 4WW2A 4BSVB 2QFRA 1DQML 1KB5B 1U3ZA 2PWGA 4EMZA 1CFBA 2VZTA 3KLSA 5DS2A 4LOUD 3UYPA 5DC2A 3C6LB 4ZPVA 3OKYA 3CFCH 1D9KB 2GTZB 2E9IA 4NUQA 4D9RD 2C1OB 3FQNA 5SX4H 4OM0L 1IU1A 3NPZB 2JKNA 3UXFA 3GGWB 3CN3A 2DWTA 1F11A 5F3BB 4EOWH 3DX4A 3H56A 2FEEI 3BGFC 4DPRA 4BZ2L 5KYWB 5DFVC 4AG4H 5IV2B 1ESOA 4X2UA 4BQ6A 3W82A 1KEGH 5F6HJ 3U7WH 3FCSB 3QS2A 1UM6L 3HMXL 2OXHB 1QSED 2B59A 3O4LB 2KERA 4NKMB 3CXHJ 4LGSB 1FO0H 1W8NA 1SGKA 3V55A 5ADOH 2W80C 1S7WB 1GKOA 3RA7H 2VABB 1ZHNA 1NCWL 1UTDA 2HXAA 1F1AA 2VLKB 3BESR 4PTUA 3PGFH 3LZPA 1AO7B 2NSMA 3PREA 1WO2A 2A77H 3AUVA 5TK2A 3UAJC 2R8SL 3HB3D 1IQWL 3UBXI 3DX0A 2XACC 1L6XA 3QIUA 4L05A 1ED3A 4DNLA 4NUPA 1NBVL 4JZOA 1E43A 1QRNE 4Z78A 4JY6A 2H8PB 2B1AL 1TEGA 2YAPA 1NOFA 4LLAA 4TMPA 4JZNB 4JDTH 1KV3A 2N0MA 1KNOB 1SHSA 2FJGB 1X5AA 5AZUA 4S10A 1KTDA 3O8XB 1B4TA 3M45A 2UVEA 1KCWA 3BZ4B 5E23A 3EO1A 4PJXA 3WNKA 3KLHD 2Y36L 1S5HA 4X5WA 5L88H 1W91A 3C5XA 4JPIB 2WO4A 3S5LA 2VDQL 2MHAB 3NCJL 4N2KA 4R96A 5I66B 3FT2B 4EIUA 3DMMD 2MQCA 3KPOA 4WK4B 4WTWA 1T80A 2J8UB 5J12C 5CWSB 1QUNB 3VFMA 5I1GL 4Y5VC 1TU2A 5K93A 4G82A 2NZIA 4NQEB 2WMPB 4XB3A 1AOHA 2C3HA 2VDKB 4JRYA 4ZMYA 3DJZA 1YAIA 1PEWA 3KYOA 1A7PH 4KKRA 5CGYD 4WUUD 4EDWH 2FDBP 5B7EA 4KO7A 3QIWD 5FOBB 3NN8A 1XF4B 1NCGA 5C09A 3WSQL 3VFNB 4X6DF 4QOKB 3EFDH 2FEJA 3C8KA 1HIML 3IJSB 4YBQD 5CN1A 4ZTEA 1T5XB 3SYAA 2Q76A 5E94B 1B6UA 3QORC 3APDA 3MA9H 3OR7A 5B1CA 3SQBB 3FOLB 3QCUH 1R3LB 3PRZA 4AEIL 4JLRA 1MJUH 3COOA 3DECA 2FQFA 2CBMA 2DQUH 3O45A 4A67A 2F8VA 2P5EE 2ZOWA 5EZIH 1N8OE 1FCGA 1I8IA 4M7KH 4AIEA 1IE4A 5EF0A 3GK8H 4S1DD 3DIFB 4ZO8A 1G5AA 3O3DB 3IDJA 4CSSA 1EVUA 3MRGB 2ZTBA 4NKOA 4OLXL 1DQKA 2BVTA 1P7QA 3AAZB 3DRQA 3OV6A 4AT6A 4ZI8A 2EIBA 1A0QH 2OS7A 3OKMA 4J3TA 1C08A 3F7YB 4L8DA 1OSZA 2YZ1A 3BPOC 4RLDA 1KIPA 1TTUA 4XO5A 2HPTA 1S46A 2QKIA 4EZJA 1UH3A 4R97B 1GOFA 4XO9A 2CSPA 2PETA 1G1KA 2I5YL 2MKLC 5BZDB 3RU8L 3TF4A 3AUWB 1EK3A 3HS0B 1N2RB 1Y18A 2XJKA 1M4KA 1VF5C 2VIRB 2V5TA 5F7KC 1INDL 4PH8A 3DV6A 4GEIA 4QXGH 2NY0C 1AI1H 3IAQA 5CZRA 3IS1X 3X12B 1E4HA 2NY1B 2DQEH 3EAKA 1XSOA 4L29A 5HGDA 1MRDL 1UD8A 3TTSA 2R4SH 1A6UL 1EFQA 1T7VA 1LYQA 2HN7B 5DUPL 4XNQB 5K9QG 4Z0BL 1FFPA 1XH2A 4WEBH 3PGDA 2F1AA 3MRLA 2CJUH 3T1FA 2BNRB 3SDDA 4FADA 1T5WA 5EUOA 2I25N 4BJLA 4KH9A 4AQOA 2APFA 2DQGL 5GSVA 4UIMB 3ZO0A 5MHSD 2WPGA 3VCLA 2WY3B 3V6OC 1BZ8A 1R5IA 5L4FA 4Y2DA 1A6WL 1KN2H 3FT3B 3MTRA 1EQWA 1YEGH 3IDIB 3ESPA 3BSZH 3LQAL 3NCWA 3NJNA 4P9ML 5IGXL 2WB7A 2ICWB 4YXKH 4OZFG 2OMWA 3X11A 3UL4A 2HT4C 1FG9C 3CVCA 3QNXB 2OQJB 4DQOH 2VRKA 5D7HA 3HZMB 5H94A 1ILUA 2W9EL 4ABWA 3PP4L 1A3QA 3WIHA 1AS6A 2E7HA 3CVHB 1WA0X 5FYKE 1XZ0B 2YOAA 4JFDE 1QI5A 3E6HB 3KYMA 3W81A 3WN6A 2R29A 2WANA 4EI0A 5EC1B 2EO9A 4G9FB 1TVBB 3HNVH 1T1ZB 4M5YH 2DN7A 1MCDA 3QISA 4J3WA 4P2QA 3CWGA 2WLYA 4N8VG 3BVVA 4JAMA 4LSQL 3J8F7 3HHMA 1ZHKB 3BISA 4XNYH 4QRBA 1HZHH 3D2UB 4DOHE 3QXVA 2VXUH 2ZAGA 1C7SA 3HE6A 4W9IC 1TQBC 5E6ID 2O5NA 1RZGA 2NLJA 2H2SC 2XY1A 3IKCB 2AKRA 3V95A 2FNBA 1HCFX 1D5IH 1D7CA 5A16A 5JTWA 4XP6L 2Q8BL 3D7PA 3QJOA 3IVKA 3TWCH 1S8DA 3UYPB 2ZKXA 3UJIL 1MQKH 4ZPVB 3D85D 1N12A 1G9MH 2DQFA 2A6JB 3FQNB 3FT1A 4IW4C 3I6GB 1KXVA 5T8IA 3GI8H 4EBQH 3ZDZF 4OJCA 3FS9A 3IF1B 4HP5A 5TQ0H 4K7PL 1KWKA 4RGOH 2R83A 4B9YA 4LKXA 5AKRA 2IOMA 3CZUB 2B59B 3J07A 3OX8A 4PJAF 4LO9A 3BD4A 1SFHA 3FUEA 1G9EA 2IVFC 3CV5A 4IKJA 1Q0XL 4Y5YB 5A2JH 1ZHNB 3NP4A 3WCYA 3K71B 4U6HA 4Q9RH 3ZBMA 1PDKA 4JFZH 4A7VA 2W81C 1FZMA 1HYRC 1ZWIA 2H6UA 5D8JH 4AGQA 5HVHC 5EA0L 1KJMA 3BE1L 2QVKA 1TPXC 3O3AA 4ORGA 3SGDH 3RWJA 2F74B 4FA6A 3QIUB 2WN3A 1ED3B 4WHTB 4Z78B 3ARBB 2CWRA 5D7SL 2CUIA 4JY6B 2WZAA 4LQFL 4IRSB 1ACXA 3KBFA 3V0WL 1ZVSA 2K4WA 5GHWL 1BWMA 1HE8A 2Q20A 1ZVYA 5DEFB 3UZVA 4H25A 3DKHA 1B4JL 4MAZA 4WFHE 1KTDB 2XWEA 3F12A 3F85A 4YE4L 4PRHE 3M7OA 4R4BA 2EYRB 3M46A 1E8YA 3EO1B 4PJXB 2PYEA 2WTOA 4L1HA 4X5WB 4JANB 2EUWA 3S5LB 2BIQA 1K9TA 5EDSA 2BY0A 5DQDH 5GZNC 1PTZA 4XMLL 5FHAL 1LO5A 2BHZA 3ZKXC 2CUMA 2H6OA 3FRPG 2OTWA 3UROR 5EBLA 1X5FA 2FH6A 1TU2B 2PW1A 1KTJA 1HDMA 3KVDD 4OJFL 5GGVY 2IC2A 4NM8H 5I6MA 1MREH 4Z23A 1JHKL 2OMBA 4OD2A 2YPKB 4JRYB 2CG9X 3LPPA 3HBGA 3S5ZA 3MYJA 1IGCL 2WKOA 1FN4A 3KYOB 4KTEH 1QBLL 2PR4H 1MH5B 3D69A 4RAVA 5FUZL 3QUMA 3UGXA 3VO0A 4N5UA 5I1KL 1KSRA 5F72S 1BZ7A 1Q1JH 1C16B 1NBYB 3NN8B 2ZP9A 4PLOB 3T4AC 2NW3B 3O0RH 5CEZL 5JHBA 4GNKB 4BK5C 3BH4A 3ZHNA 5F8QC 4JN1L 5C0DA 2CGRH 4JKMA 1QQDA 1Y1UA 1NCBL 4HKJA 3Q7JA 2NYYD 2ZICA 3CZJA 2IF7A 2J6EH 4XN2A 1HWHB 2IWFA 3OR7B 1GJIA 1JZ3A 1IGFH 1JZ7A 3BPCA 1O7DE 1JGEA 4JLRB 1A9EA 1IX2A 4KNUA 2XX0A 1XSKA 4DN3H 4ZXBD 1L3WA 3AADB 3GSWA 4IOSA 3IFLH 5JW3H 3ZL2A 3O45B 4ZZFA 1BZ9B 2R15A 4F15B 2MEJB 1KTLB 4D94A 1I8IB 2VE6A 3S36L 3ZTCC 1PY9A 3S35X 3I50L 1B0GA 2EDBA 1M7DA 5AAWC 5B39G 3F00A 4YSOA 3IDJB 4U7KA 5LBSA 2WYIA 3MUZ1 4NKOB 4YXHH 2E75C 1MRCL 4Z3IA 1CBVH