4BCZA

Monomeric human cu,zn superoxide dismutase, loops iv and vii deleted, apo form.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
110
structure length
110
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHGAGGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKAGAGAGSRLASGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Global Structural Motions from the Strain of a Single Hydrogen Bond.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
total genus 23
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4bczA00
1TO5A 1PU0A 1YAZA 4FF9A 4A7GA 1EJ8A 1E9PA 2AEOA 3GZQA 1F1AA 2AQPA 4A7GF 1P1VA 1U3NA 2WWOA 3CE1A 2WZ0A 4B3EA 1SXAA 2GBUA 1CBJA 1XTLA 2ZKWA 1SRDA 4N3UA 3MNDA 2ZOWA 2XJKA 3CQPA 1OEZW 3LTVA 2WZ6A 1E9PB 1UXMA 1F1DA 1XSOA 1OALA 1B4LA 1Q0EA 1SXZA 2VR8A 2WYZA 1RK7A 3ECWA 2ZKYA 2C9VA 3HOGA 3SODB 1IB5A 2JLPA 2APSA 1YSOA 1SDYA 4BCZA 1EQWA 2WYTA 2WZ5A 1OZTG 5KBKA 1N18A 4N3TA 1FUNA 4A7TA 1IBDA 1SOSA 3F7KA 1SXBA 2C9SA 2K4WA 4A7SA 2JCWA 2SODB 1COBA 1PTZA 2AF2A 1Z9PA 3GZPA 3KM1A 1PZSA 2V0AA 1OZUA 1UXLA 1OAJA 2Z7UA 3PU7A 1DO5A 1MFMA 1ESOA 2GBTA 4A7UA 2XJLA 3GTTA 3GZOA 2Z7YA 1BZOA 1F18A 1IBBA 2AQQA 4MCNA 5KBMA 4L05A 4A7QA 2VR7A 3H2PA 1IBFA 3GTVA 1XTMA 1E9QA 2AQRA 2AQTA 3L9YA 3ECUA 1TO4A 1SXNA 1JK9B 2C9UA 2R27A 4BCYA 1KMGA 1L3NA 2AQSA 1JK9A 3HFFA 2WKOF 5KBLA 4OH2A 1HL4A 2NNXA 2WKOA 2E46A 3KH3A 1SXCA 3QQDA 4MCMA 4BD4A 4U4IA 1DSWA 3KM2A 3S0PA 3F7LA 4OJAA 2AQNA 4A7VA 2LU5A 2Q2LA 2Z7ZA 3T5WA 1SDAB 2GBVA 1AZVA 2ZKXA 3ECVA 3KH4A 3MKGA 3RE0A 1IBHA 1HL5A 1Z9NA 1SXSA 1B4TA 1YAIA 1QUPA 2WWNA 5CU9A 1SPDA 1E9OB 1CB4A 3KBEA 3QQDB 1E9OA 2E47A 3K91A 1N19A 1S4IA 1BA9A 3GQFA 2Z7WA 3H2QA 3HW7A 1JCVA 1E9QB 3CQQA 2VR6A 3KBFA 1F1GA 3L9EA
chains in the Genus database with same CATH superfamily
4S1QL 2VISB 3D48R 4XPHH 1FLRL 5DI8A 1PZBA 1RZ8A 1TEGA 5F7WC 5J6SA 4G8GA 5D7HA 1MJUL 3N40P 3UO1H 5ETUA 1IARB 1R3HB 2WSKA 3N04A 4KI5C 5A6MA 1W16A 1FZOB 4KI1A 3GKZA 2QVFB 4YGVA 1LO2L 1DSFH 3FB7B 1A7QL 1GYVA 1QBBA 4PW9A 1AMXA 2VAJA 3DX3A 3A67L 1QFWM 1UA7A 3IFLL 4ZW7A 5D7SL 1K8DA 3O3UN 1IZKA 1DVFC 5ADOL 4KI5F 3LHPL 2VDQH 4DOHB 5AVYB 3ZE2E 3HE7D 1XBRA 3FC8A 3DVFA 1ET7A 2C3VB 4MRCA 2R7EA 3ROOA 4DQAA 3CZNA 5AW2B 2A6DA 3I02A 5BV7C 4BFNA 4HUVB 5GRVK 1TFHA 5I1JL 5KYYA 3V7MA 3D8MA 4HLEA 3S36X 1AJ7L 3QHZH 2GI0A 3D9AH 5CGYC 1ORQA 1KIUA 2QLVB 4FQ1H 4H88H 4HIHB 3VXMA 3BGFB 3CLFH 2H9GB 4RESB 1NINA 4TUUA 3S8WA 1HC1A 2GJ6E 3BPOC 3WFDL 2OI9B 2Z8RA 4KK8D 4W9GC 1NIBA 2C9RA 2CIIB 3FL7A 4U1JA 2BCKB 3VG0H 4ODWB 1J8HD 2V2TA 3AWEA 4FERA 4H26A 4PJGF 1MHPL 3CZSA 1FORL 3MV9D 1RXLA 5GS0D 3DLQR 5DMGC 5K1NA 4MA8L 4V11A 3F2LA 1L0XA 3Q48A 3S37X 2JJSA 5I1CH 4X6CB 4UT9H 4BZ1A 4G3YL 5GGUB 1JDDA 1QWNA 1TZGL 1M9SA 1WFIA 2BS71 3KDPB 4QRUB 3D85A 4N1EA 2AERT 4S10A 43CAA 5DUBB 2VMDA 3N44F 4GG6F 2ZNWA 1KEML 2FX7H 1A6UL 3OKLB 1NC2A 2VC2L 3FTGA 2NT0A 4GSRA 2OSYA 2G3MA 2J4WH 3U4EA 4RA0C 4HEME 3CDZB 2AXGA 2YAHA 2NLJB 3D69B 3EZJB 4FQ2H 4L3ED 1UB5A 5CZRA 4E9LA 3WFZA 5FA3B 1FDLL 2X4RA 3MNZB 3V7AE 1K2DB 2DL9A 1FGNL 1AZNA 3MRMB 1X6NA 2ADFH 3NIGB 1D9KC 4Q6KA 3FB7A 4Z7NE 2EDBA 3GBML 5BOJA 4KU1A 4O9HL 4KRNA 1YMHA 4M6NL 4EZMA 3LZFL 3VXOA 2QQQA 4HFUL 5C97A 4YHPB 5I8EA 1OCOB 3OSVA 1VZGA 1A9BB 3MX0A 4R8WH 1I3VA 2FO8A 1NAKL 3QXTA 4NM4L 1MUJA 5HD8C 3CFBA 2EC9T 1E9QB 3HRPA 3QFJE 4G6MH 4Z7WE 1GS6X 1KGWA 3HZYA 4HFWA 1XWVA 2W0FA 1TO5A 4WNQB 1GZPB 2VDKH 3TNMB 3TU6A 1MW2A 2IH1A 1RD6A 3O0RH 3QXAA 4PBWD 3D1MC 1I8LA 4ZS6D 4G6FB 1JGLH 1BQRA 1ILUA 2F58H 4XBPA 3E6FB 4W93A 2UX6A 3P9WB 5LQBH 1N64H 1OHQA 1PKQE 5D1XA 4OZIE 5FXCH 4L29B 3H2WA 1IRAY 4JCLA 3TBTB 3OBAA 1JK8A 1H8SA 2O5XH 1BFTA 1SJMA 1XF3B 1DANT 3JT2A 4IBZA 5F71A 5GGVY 1R9FA 4KZ0A 3TVMA 4BFEA 1FZKB 5GRYA 3CZFB 4XVOA 3UYPB 4ORZC 2VN7A 4I0CC 3G08B 4OCYL 5I23A 1P5UA 1CD9B 3OKEB 4O51B 4XAKD 4ZPVA 1ADQH 2HXAA 2PF6A 1KYDA 1MEXH 3UBXG 2ZX8A 1TU2B 5BS0A 4XP5L 5IREA 1UKQA 4XMPH 3MLXL 3WIFB 1RIUH 2ENSA 2OL3L 3D3VD 3EJYD 5DZOA 3VQ1C 1AS6A 4CVWA 4L8BA 2EAEA 1JZEA 1OTUD 1A1MB 3MXVH 2F0CA 4LSVL 1IQDB 4WUKH 3GZPA 3EH5B 5FV1L 1F5WA 1R3JB 3IM1A 5PAZA 4J3OH 4LOUD 1FRGL 2ZUSA 2ZAIA 1I7UA 4P9HC 3MFFB 1AXTL 4NNXB 4AMWA 4PJDA 2YPLE 1T6BX 1I53A 2VLRD 3JTTA 1SQ2N 1J9SA 2FJHA 3K7UA 4L05A 4FXKB 1MFBL 1Y0LB 4M43H 5MP6H 1TTRA 2P44B 1CLCA 3LS5H 5T1LD 1YY9C 2R27A 3ISYA 4X5WB 5DMKB 4K5OA 1WCBB 1JK9A 3T2NH 2J6EL 2PTUA 5E1AB 1EJOL 2PCFA 4IOIB 4MS8C 3QDMB 1RPKA 1E2ZA 1BD2A 1YO4A 2JKRM 2VDNH 5A2IH 3CZKA 4KO7A 4DESA 2BWQA 1QEWA 4TS6A 4M29A 3B9AA 3LNGA 3PL6B 1RZIB 4OZHE 3MV11 1QLRB 4WK2B 5G5DA 1VADB 4L29A 3T3PB 1A7RH 1HHJA 1NGXA 5DEGA 4KZCA 1JJUA 5EN3A 4ETQA 3QHFL 5B4MC 2R51A 3AWGA 2OMUB 5IEKB 4BUHA 1XR9B 5JO5B 3S36H 1A2YB 5KYYB 1ZK5A 5ACMA 4EKXA 4ZMAT 5KSBB 1B88A 4BKLB 5HYJA 1EV2E 3UYPA 2PXYA 1AHMA 3WKNA 4L4VD 2Y36H 3K72B 5F7AA 1KIPB 2DLIA 5HDBF 1Q9LA 2Z7WA 2UZIL 4EIZC 1Q94B 4R7XA 1PNCA 3X13B 2ETWA 2W07A 3L9EA 1VZHA 4JDZA 1XGYH 1PKQB 2Y3AA 5KVMC 4DP5X 1T1XA 3QP3A 4OIFA 3BIKB 4WEEA 3HC2A 5FYLL 2Y25A 2ZP0T 4G9DA 1JNLL 5JDSB 3GJFH 1GTFA 4AI7A 1CDYA 5GZOC 2B4CH 4AMKH 4JKWA 3RU8H 4PEEA 3GT6A 5BRQA 4WSGA 1U8OA 3SPIA 1HINH 1CI5A 4NLHA 3ZQ9A 1CFQA 3KPQA 3HIZA 4ILDA 1RK7A 1TNNA 3EJJX 4JM2D 3KZ8A 3K5RA 5AW9B 3VFTB 2FJSA 4PJIF 4U0QB 3D7PA 4KROD 4YC2B 3SODB 3VXMB 1XSIA 3FXIC 1FO0B 1G7JA 3UJTL 1BJ1H 3CFQA 1B0GB 4WEBL 5J1SC 1CGTA 1XL6A 1RUPH 3DX7B 1N5AB 3A0OA 2WIIB 3ELAT 5F1SA 4OCWL 6FABL 5ADPL 4XRCB 3ABGA 4QHLA 1G7MB 4A7SA 3WHXB 1IM3D 2GITB 3H9HB 1ZHKA 2FGZA 2QLYA 5IOKA 3EJSA 1K6QL 4PS8A 4KJYB 4NDMB 3Q1EA 2PKDA 5EOCL 3PU7A 5J1AA 4D9RD 3A21A 1JIBA 5IEKA 1A9EA 4K3GA 3K6OA 4JL1A 2ERJB 2NY3B 2IWEA 1N6QL 4KMQA 1WAAE 2CUIA 2HRLA 1HDMB 3T0EA 4UAOC 1OP3K 4TKWA 5E1IA 4F15C 3MACH 1BFOB 3PPEA 5FLUA 1ZVSA 4RFEB 2G2NA 3ATBA 3GMNB 4QHNA 4BCYA 2W0PA 1YQ2A 2NSMA 1A4BA 2Z93A 5GRXG 1E5BA 3H0TB 2FRGP 2X1QA 3K6IA 3NDZE 1WA2X 2UWEE 2DLHA 2WGXA 1ZLVH 3EYFA 4YXKH 5EZLA 3UXFA 1A7OL 1SZNA 3DUHA 1EPFA 1KB9K 1WWCA 5DYFA 5BQ7A 4R3SB 1XAUA 2VABB 1Z32X 4HXBH 3T8XA 5DD0H 3U9PH 4AX3A 3D30A 1HL5A 5IW6B 4DKAA 4OV6F 4K7PH 2YAEA 4CDHA 4OD3L 5LGJA 3KPRD 1UUNA 3QEHA 5I8KL 4JFHE 4R5VA 4G8GB 4JRFA 2WWKT 3MCLH 2EZ0D 2FEJA 4P5RA 4PRAA 5B7EA 4XBPB 4FNPA 1XGPB 1D6VH 1JGEB 4PRNA 4GT0A 4WU5A 4BDVA 5D7LB 1LO3L 4OM0L 1PVHA 3BKCH 3EFFB 4ZI8A 4F2ME 5ILTH 5C0ND 2CIKA 3L54A 4C55A 1NGYB 2EDFA 2AQPA 1A7RL 3I3EA 2P47B 4XVJL 5I1DB 5LBVA 4HIEB 4QTHA 5GJTH 5JPNB 3LPFA 2CU9A 3O81A 3EOTH 1U8LB 3FQXB 5IFAL 3OG6B 3DMMB 1Q9KA 2NY5H 5CGYD 4DEUA 5I16B 1A1OA 2A6DB 3I02B 3WTWA 3WXVL 1GGTA 3QUML 4ALAC 3HG1D 4N2OA 4IW4C 1P4LB 4Z77A 5I17B 1DJHA 1BBDH 1EEZB 4KWUA 3V8CA 5CUSL 5FM8A 4N2AA 2VITA 4N1CA 4NXSA 4QTIL 1YNKL 5ISZB 3TPUA 4Z7OB 5IFHL 1NZRA 1WD8A 5DQJB 1WBXB 5HHXL 4ATWA 3H9SB 2L3BA 2CHZA 3EADA 4Q97A 4YHLL 1RZIA 5DMIL 2YPKA 5G5DB 1GZQA 5E9DD 3U1SH 3DVIA 2QDWA 1MQKL 4FNUA 5DFWH 4AGLA 4F7MB 3GLZA 3FN0H 2CBPA 1S5HB 4W9JC 3SE9H 3UERA 3K8LA 3AU1A 3HKFA 4IRJC 3U1PA 4PJEA 1W6WA 5C0AD 3T2PA 1JBJA 3GEWB 4MXVE 2AXFB 5F7HA 4TSCL 1N4XH 1MNNA 4DT2A 1L7TH 5ACZB 4D0CB 1PKOA 1MW3A 1FNAA 2GSIA 3KL5A 3WG7B 2VXUL 1UACH 4ONGH 5T1KA 3BI9X 5JW5A 4P9HL 2YMOA 5EUOE 5F1OB 1DZBA 3CZLA 1MCLA 2V17H 2DQUH 5CEZD 4RNRB 2GCYB 3CFCL 2R59A 1LMKA 4JEGB 4CVZA 1BD2B 5HDLA 3GMRA 4BE5A 1EFXB 4ZMZA 2A6JB 32C2A 4XVUD 3TJEH 3MNVB 5D4IA 1WO2A 3KPSD 2CIKB 4XB7A 1O7VA 5D93C 3HG5A 3EJCA 4QTHB 5JPNA 4AUJA 2YLHA 4PHXA 3STZB 4FABH 3ZDWA 1MFCH 5CEZE 3BUTA 5FK9B 2ZKXA 4HFWB 2X0UA 2JKXA 3CZGA 1QRNE 1YEDB 3T4YB 2Y07L 4LHQB 1J1XH 2X4QB 2IC2A 8FABB 2L7EA 5EF0A 2DY2A 3W3BA 3EH3B 1V55B 5LGKA 2JQAA 2YOCA 2D3NA 1O9ZA 4CJ1A 1NGZA 4GUPA 3UFIA 5D1XB 5I0DA 5CLXA 1KDJA 4FMVA 2JTDA 3W37A 1XGRB 5J1AB 4TL4A 2ZP9A 2AEOA 5BJTA 1PLBA 5ERWB 4R9HA 4U2YA 2YD7A 4AQEA 1IGML 5C9JA 3PQYD 3FO2B 1F3JB 3HE6C 5EBLB 5AVVB 3KLDA 4NUQA 3TA3A 4D0CA 3I9GH 3U6XA 1WS8A 5I8KH 2QMJA 2BNRA 3UC0H 2IEPA 5E08L 4X4ME 3ESMA 2XPGA 1SHMA 1VHPA 2Q3ZA 1RIHL 4UWQB 2CPUA 4RGMC 5C0CB 4XN7A 4Y0GA 3IE4A 2VERA 3FRUB 2O5NA 2AJ3B 3NSJA 4F5CE 5F9JA 5B3SB 2AKRA 2VZSA 4WF7A 1CLOH 4FOMA 4Q4IA 5T1LB 1X3DA 1BPVA 2CCWA 1NEZB 2XWTB 3ILPB 4JGUA 4P07A 4X42A 4CRPA 1KTLA 4G7YH 2EEBA 3F7RA 2DWXA 1JZ3A 5LGJB 1EERB 3VI3A 3T0EB 2TSBA 4N6QA 2R23A 3THMH 4KDWA 4DCQB 2VQ4A 4JRYE 3AGWA 1MI5D 1VEMA 1QBMH 3OWRA 2MCG1 5MEQA 2IGFL 3IFPB 2VQ1A 2R2BB 1SN5A 2Z8WC 1J87A 4PJ7F 5I0YA 2BHYA 1NMBL 2ICWB 1EUUA 2IO5A 3C60B 1H6FA 4EVNB 4EKJA 3QJQB 4Z7IA 3IPFA 2ZOLB 4UOQA 4AGMA 2EJ1A 3KYAA 1FL3B 1E3XA 2YN3A 3MRFB 1NOFA 3FU9A 3PWLB 1VF5C 2AQTA 5GZND 3SGEI 2Y4SA 2FL5B 2J8OA 4DVBA 2NUPB 2DQHL 2F8OA 3ERXA 4LMQE 1HEZA 1PF3A 3GXNA 2VKWA 4EDWL 3DTXA 1T21B 4FNLL 3GPEA 3ARGD 4PLJC 4FA7B 1DFBH 1TQTA 4XHJC 2VXVH 4UDUB 5BVJB 2COVD 2IWFA 3SE8L 5E8NB 1S7XB 1DUZA 3LQZA 4AM0Q 2Q76B 3APMA 1BJ1J 3ARFC 4B60A 1KPRA 3QUHA 2XYCA 3MRMA 1XCWA 3CHQA 4QRSB 2Q86B 1Q38A 1F58H 4XI5C 4XNQA 4XPFL 3OLDA 3VD1A 2BSSA 4XI5D 3IWUA 3FQUA 1UD8A 4IIQC 2B2XL 4Y5VA 5BVPH 4HSAC 4R4ND 1P84J 2OMZB 3JQOB 4HC1H 5F1KC 4FS0A 5C0CA 4UTBL 3NFNB 5IMLA 3NCYP 4JO2L 4KTDH 1U8LA 2BXYA 3FQXA 2GUOA 2FNBA 3QIBD 4XCFH 1YG9A 4L4TE 2X6AA 1JHTA 3MSPA 1MIMH 2VLRA 2RFXA 3NZ8B 1Y6KR 2WNKA 2KLRA 4MJHA 1ET5A 4FFWD 1AACA 2C9AA 3GMLB 2AV7A 1MDTA 2A38A 4NQTA 3X17A 3MUY1 1IGCH 3O9WA 3L7FB 1BMGA 2K8QA 4OFKA 5C08A 3KAAA 3BH8B 2BY1A 3ME0A 3DPDA 1RJCA 3IB4A 4YSPA 8CGTA 4MTMA 4EI5D 2JQZA 1JAEA 3DECA 4A2DA 4OAWB 2EEXA 4PH8A 1UJ3B 1RFDH 5KVFH 1T5WB 2ORBH 2WY3B 4HIJA 3W57A 4JG5A 4P06A 4M61B 3ZO0A 4YO0B 4L37B 5DURD 3ZE0B 3NA9L 4P2CG 2EO9A 4IKJA 4JR9H 5DRZA 1IBYA 4GSXA 4LNRB 4ZTOH 2ZAGA 1FBIL 3CMGA 2ZSVB 4ELDA 1E2WA 1ZXQA 2XKNB 2FHCA 4K94C 1CK0H 4RNRA 4OIIL 4PI2A 3HS0C 1WBZA 1IEHA 1ID5I 7TAAA 1QFWH 2IAMC 1ZGLB 1E6JH 3RWEB 1OZUA 2YKLH 4PMFA 1JWMA 2CCVA 4ISVA 4Y1TA 3RVWC 2V9QA 3SGKC 1CF1A 3TWCH 1NOLA 1PSKL 3II1A 5EO0A 2O30A 1KLUA 4OZFA 4NQEE 4MDIB 5IMMB 1C16B 5D6DA 5IGXH 5C1MB 1C12A 4OCXL 4FZEH 1SEBA 3ZDXF 4M3HA 1J48A 2VSKB 1AGFB 1XGUA 5GGQL 3B8YA 3OXRA 4PRHB 3R7QA 4U1MB 4FYTA 4NQSA 2JKTM 3EXLA 2TRHA 2WKOF 3VXPA 3CFTA 4OF0A 2CA3A 2NPLX 1IGYB 1M7IA 2Z4TA 3QFDB 5TE4H 5IFJB 3V6FB 2B15A 2OMTB 1N64L 1BCIA 3FRPA 4WI4A 4Z95L 2F8XC 1J9RA 3RLSA 3T65B 4FJ6A 2CD0A 2XZAL 5DA4A 4OZGE 4Y1AD 4KX9A 1TDQA 2FJFB 1S9XA 1QOKA 3ZRSA 2X87A 3QWOA 5LQBL 4Z0BH 4MX7B 4W9IC 1KFAH 2FT6A 3UDWC 3ZL2A 3ZHNA 1SF3A 1N0XL 3H9YA 5FO7B 4XNBA 1BQHG 2FJGA 2D73A 2HVBA 1H8OA 4K23L 1F1GA 1OAKH 4UUJA 3STLB 1HZHL 5IQ7H 2CLRB 4QJ3B 5E6SB 3VTAA 4JFED 1SEQL 4MNGE 1DVFA 2WXKA 4XAKE 1ED3B 1JYNA 3TN0D 3SJVB 2PO6D 1S78C 3MRPB 1QSFB 2XWBB 3MRJB 2FGWH 4J3OF 4Z7UE 1XCTA 4ZNEE 1ACYH 4HC1L 2H1PL 2NZ1A 5FOJA 1BYPA 1UT1A 1I1YB 3SKNB 1I9JL 5I1AA 3VRJA 3I84A 4P2QD 3V0DA 4C56A 3ULUE 1VFUA 4TLUA 2W9EL 3FAWA 1USZA 1FYTB 1UVQB 1FAKT 1NMCC 4BCXA 3LXAA 4IMLA 3RFZA 4M62L 3JYBA 3LEXB 3E6HB 3PXJA 4L5FH 3NJKA 1FHGA 1JNNL 1SOXA 1ETB1 4BFFA 4K71C 3WL9A 4N9GA 2AHIA 4A2EA 1GGIH 2Q76A 5ANMA 2NW3B 4MA8H 1I9IH 2BO0A 1CR9H 4NN6B 1O5PA 4X99A 3IF1A 2Z31D 2VLLB 4IEFA 5EUOB 5TDOA 2P5WE 4HS3B 2DEXX 1R5IB 1HWGB 2SODB 2PO6B 2RQEA 4JO4L 5CSZA 1I1RA 3DTUB 4XBGA 1MJ7L 3MLUH 1ZY9A 4JM2A 1G6RH 2WVSA 3UP6A 2FJFA 3VACA 1IKNA 2EDLA 3D52A 5AKSA 1OSZA 1QSEE 4TQ8A 4OLVH 5DK0B 2DMKA 4OLYL 3Q8FA 5JA8B 4R97B 4G43A 1GOGA 5ANHA 3R8BB 5DMGD 3VXSE 3DNKA 3CVHL 4YXHH 2A73B 3ECUA 3N1FC 2CAKA 3QXVA 2W0KA 4MGXA 5HHOE 2AVGA 3MV9B 4F7EB 2NX5D 4O9HH 1PG7X 1FQ9C 3GSQA 2BFGA 3P73B 5GZOA 2MPVA 3BKYH 5C0BB 4MRBA 2NXZC 4K3JH 5D5MA 1GIGH 2HFGH 2A9AA 2B1HL 5BXFA 1I8KA 5KW9H 4H1LH 1FL6B 5J4MA 5TFSL 1VAHA 3O6LL 4N6RB 4YSDA 3V9FA 2AJVH 3WO3B 1PCSA 3ZDXB 5L8KB 3V9CA 1WPCA 1WRFA 3NCMA 5HXMA 1KGJA 2G4EA 3ABKB 4RMBA 1TPXB 1WZ1H 4P2RB 2K45A 3E8UH 1XAKA 4KVCH 2D2OA 3MRHA 4QHMB 2HJFA 2YA2A 3GKWH 4B7IA 2O6PA 4NZFA 2EEDA 4F8NA 5JXAH 1IFGA 1AQKH 1EO8H 3Q8AA 4JBSA 1WBZB 4E5XA 2BNQD 5I9QB 2N0MA 4PRAB 2FH8A 2BNRB 3S5ZA 2XG5A 5DXWA 5DJ0B 4MA1C 3LKOB 5GZNC 3GXDA 5HI3D 4FF9A 4G5AA 4MMZA 5HPMB 1U2YA 5D7LA 5G2NA 4IIQB 4XN9A 5DJCB 1NMAH 2ZP8A 3BZFA 3BVVA 4RAHA 2CBTA 3GBNL 4KRPD 5BMFH 5JORA 1HJCA 1LP9B 4Q9BA 1WFNA 3F3HA 5CP3H 2BS9A 4UOJA 1MCPH 3U6RA 3NJLA 3MLTB 2RMNA 4IKIA 1MCDA 5T3XL 2UZXA 3AXIA 3VG0L 1AOHA 1NPJA 1N6QH 5KTEL 3AROA 1QBAA 1U8CB 4NWUH 4P2AA 4IU3B 2C7UA 3KGRA 3U0TA 3BWSA 3KWVA 4J5VA 3VMOA 3TONA 4KZEH 1RY7B 1AP2B 2QQNL 4JUTA 4KFZC 3WIIL 4DPRA 1F11A 5FA3A 1G6RA 5F1IA 5E2VH 2AEQL 4ELMB 4EN3C 2A2QT 5D7JB 4LF3B 4KKRA 5DJAB 4HWBA 1AR2A 3BP6B 3PWPE 3S3DB 3QDJA 4F58H 2ICEA 3O6FA 3D85D 4K7PX 5AKRA 2ZKHL 5E2TL 3GM8A 2Y06H 4EUPH 3VGEA 5D9SB 1QVOA 5E0FA 5KAQF 2RD0A 2IGTA 5AQ0A 2AF2A 4MYPA 1NBVH 5DVLA 4NQDA 1LD9A 1P5UC 3BP7A 1IFHL 1L0YA 4XPBL 3QDGD 1FFPB 2VDRB 3KWWB 5AKVA 3V55A 5BV7H 1A7OH 1AD9A 1FN4A 1ZA6B 3GB7A 3RX8A 5CLYA 1ZWIB 3HRZA 1ZRUA 2VR3A 3HS0B 1OCZB 4GSUA 4F1SA 4N2DA 1ZOXA 5BRZA 5FHAH 4XP1L 5DJ0A 1L0QA 2GY7B 3WKML 4CJ0A 2KMWA 3EAKA 4AY0A 1LQSR 1T1ZA 3OX8B 1O7DC 3GTNA 3E1F1 4QRPB 1MRCL 2FECI 3HE7A 4O2FA 4A2HA 4ZDHA 3OJMB 1QG3A 1NGPH 3CIAA 5CFAA 1TYRA 5AW7B 1ROCA 1JN6A 3DIDA 3FFCD 4IMLB 3RFZB 4X9IA 1WLHA 2GK0A 5K33A 3PDOB 2VDMB 3TBSB 2D0GA 5CUSH 3LV3B 5L8JB 1UXSA 3PABA 1BF5A 1JXGA 3ZMNA 3N43F 5DJ8B 2A4ZA 1T2XA 1MG3C 3UADA 5D4HA 1NCOA 4PRBB 1NPNA 3WXVH 1GSMA 2DBJA 3KLAA 3OPZL 4GUCA 1OY3B 4IRZH 4Q9QL 2PPAA 5D1XC 2J44A 4U33A 1CVSC 1CXKA 1EX0A 1E28B 4BFJA 1DVFD 5TK4A 2VXTL 4Y4KD 1NCDH 3DYPA 4ACPA 3B83A 3WGUB 2PR9A 1ECYA 5F3HA 3VE0B 3NSFA 3VQLA 4TSCH 4Z7WF 5GSRB 1HYSD 1CZ8H 4ODXA 4J1UA 4W9CC 2JNZA 4GFTB 1FNEB 4QHPA 1JYVA 3ARTA 4KO6A 4WEBH 2G3XA 1CTOA 2B7DT 5A16A 4RX4A 3QIBC 4KY2A 4Y2DD 3O9WC 2I7SA 2WZ6A 4X4MA 3GB7B 4WI0A 3EH2A 1OOWA 2XQYA 3F58L 4AEIL 4B5EA 4BFRA 2A6KB 4Z0XA 2FH6A 4HS3A 2PLTA 3QIWC 5GS0H 3VXME 3PWNB 1VFMA 2BNUB 1F56A 5CJ8A 4G5ZL 1CGSH 5EO1B 5EBWA 5FECA 1KCKA 5T5NG 3MRQB 4D8PB 1ZGLA 4JFWA 3VXMD 1JGIA 2HKFL 2IMMA 5KBKA 1N18A 3D4ZA 3DYOA 4HSQA 4TSBH 4L8BB 4XX1G 5F96H 3LN5B 2OMUA 4UQAA 3UTTA 1SJHA 2ZXBA 3VFNB 2EIJB 1NDMB 5DJZB 4HWZA 3VXUE 3VYPA 4O2CA 3PYCA 4FG6C 3UPRA 4PUBH 4GH7B 5ALCH 5CCJA 2OR8A 3FK3A 3PFUA 4NFBA 4F3FA 2YUVA 4PB0L 3TA3D 3ZRFC 2Q10A 1QSEA 4AIZA 2Q7NA 2JKJA 4AW7A 4XNDA 1NM4A 1ZVYA 3TFKD 1FSKB 5FFLA 3TTYA 2IF7A 4A04A 3GYRA 2OMTA 3VDAA 2XY1A 4YQXL 1NLBL 3MGAA 4NI3A 3WO4C 5ID0A 1FZJA 3IKCB 3DARA 1CFMA 2J6EA 4RGNB 4LLYB 3UZVB 4L48A 1UD2A 1ZHNA 2DWSA 4ANVA 4OUUB 2PWEA 2YUZA 1U58B 5L88H 3T0AA 2KERA 1CQYA 1T2QH 4NZTH 4ODXB 4U7KA 3O2VH 1CT8B 3BLKA 4JFQB 2X9XA 3UYOD 4EPSA 1B0RA 4L1DA 2W59A 1HILA 3X14B 3E8VA 3CVBA 2JK5A 4G9FD 2WLLA 4LKCB 3TEUA 1GJWA 4MNHB 1BAFH 3IXTA 3BYTA 3QJZA 1SHWA 4MMYA 2NY0D 1RIHH 1ZLVK 5I8EB 3G6JF 2DQCH 3HG1E 4HUWA 4L4TB 3VCLA 3P4MA 4OT1L 4AM0B 1PJ9A 3HCVB 4PCYA 2F7PA 4JGJA 3GGWB 1OIOA 2JB5L 1DVTA 3RZCC 4NAJA 4I13B 5I0VA 4Z7WB 1RMFL 1BEYL 3NVQA 4Y2OA 4LT7A 3KE0A 4ZXBA 1I9RH 1INQB 1PU0A 4F7PB 3BP7B 1U8CA 3NMEA 5EUKB 4HKXA 1S3KH 4RCAA 3HE6D 3F6LA 2I9LB 4FI7A 4P4RB 5KZCB 1F90H 4LCIH 1ZPLA 5HGAA 3IK2A 3DI2B 1AGEA 3P69A 3WAJA 3UBXI 4JFHD 3U1SL 4PTTB 4PJ6A 3S35L 4ONFL 2LLLA 3T71A 5JYMA 2K78A 2XI9A 3JWOL 2A9DA 1P84K 1KB5L 2HT2D 3W1ZA 2X1OA 3DSNB 2Z93B 1HXMB 1FVDB 4KHXH 2ESVA 3TASA 3ECQA 5AW5B 5DMYA 5I24A 1I3RB 1B0GA 5GHWL 2ZG1A 2PPFA 2F19H 3OZKA 3P02A 4IIZA 3ZRCC 4WUUE 3UROR 3V6BR 1D7CA 2R1YA 1LEKB 4JLRB 4WI7A 1U8QB 3BGMA 2KKQA 3RTLA 3FB5A 4X9YA 1LM8V 3TWCL 3S37L 4YMPA 3FT4B 3L5WA 2D4FA 3TJEL 4LEEA 4GI9A 2ZXCA 3HG1A 3ROOB 1ZDSA 4J6IA 3OQRA 1T22A 4HUXB 1OAJA 4ZRGA 5CZXC 3MLWH 2XIDA 1YECL 3SYAA 3WKPA 4ZQTA 4KUZL 4PRHE 1KTJA 4L9DA 3DV6B 4UTBH 3W38A 3FTWA 5KUMA 1Y0LA 1SF5A 1PS3A 1KCVL 1DN0B 4RFEA 4ZQKB 4Z7QE 4U1GC 3N91A 3LDBC 4X6DB 4XPFH 3MI6A 2UZYB 3V0VB 1J0ZA 2EUWA 1D5XA 4WI6A 2CXKA 1TO4A 4MJIB 1JK9B 2H1LM 4NB7A 4P49A 4ZFFB 4J7RA 4Y88A 1ID2A 2X5PA 4HETA 3ENEA 3QDMA 4ZZKA 4OH2A 2MKWA 3R0NA 3BAXA 5EU4B 1NCIA 3MRGB 3KR3L 1NDGB 3BFOA 3EOTL 3F64A 5I8OH 4EI0A 4GQZA 4JE0A 4W1TA 3C75A 1KC5L 3VXSA 2Z7ZA 5CZXD 1HS6A 5JDJA 1B4JH 4R90H 4JO1H 3X12A 4GSDL 2Y6TE 5EOQL 5DZNA 5FKPB 3V5KA 5F3HB 2E7LC 2EDEA 5KS9B 4D0DB 2WBXA 4MMXB 3QIUA 1L9QA 5JORB 2D7TL 3GHBL 3SCMA 4KKAD 3K5SA 4X9BA 4WRLA 5DGQA 4AC4A 2Y22A 4R83A 2DQFB 5C2UB 1TTAA 1S9YB 2GYSA 2VR6A 3AM8C 3RUGB 1BIIA 4XXDB 2IVFC 3AM8A 4GLRI 1SVBA 3V6ZB 4EQ3A 5AAWA 4ZUVA 5JUEL 1ETZB 1TVHA 4NHUB 3V4VL 1BXXA 4NAMA 2F8IA 2FD6H 3FCUB 1M05A 3RWJB 5KVGH 1IBZA 3ZDYB 4KQ4H 3DPBB 2FLBT 5HHNB 3ZE0F 4F7CA 1YEIL 2GY5A 4HH9B 5CBEA 1EZVX 5I18H 4PJXB 2IBBA 4L3CB 1WD9A 3VJ6A 1ZE3H 3LTVA 4ONGL 4H5SA 5D2NA 3O41B 4APXB 3E2HB 4JQXC 1WC7A 1IC5H 4J8RB 5LLIC 1IFHH 1SXZA 4XPBH 4I48A 4HAKA 3PUUA 3WIAA 1J0KA 5IBTH 1CICD 2MIZA 1NDMA 5DJZA 3KMDA 4F2MB 2J57A 2MMXA 2DQ6A 3BUBA 5DUPH 2ENYA 2DEWX 3U2IA 1M1XB 1RZFH 3ZHLA 4JJOA 4AGNA 4K55A 3UBFA 1JRHI 1NCAL 1RUMH 4M5ZL 2NW3A 1S5HA 4PV9B 1FZKA 1IE4A 4HEPA 4BEIA 1BM3L 1IBDA 3B7RL 3K4ZA 4G6KL 2DQGH 3SE3C 3WLBA 1W2KT 5A2FA 1L9RA 4HHAA 2WLYA 4F33A 4D3CH 5J9PB 4LLYA 3UZVA 2JCCF 3ASOB 1EVTC 2AANA 3J8F7 3LNFA 4TQIA 4X83A 1TCMA 2NMSA 3VWJB 2FLMA 3V95A 3GJEB 1XO8A 1U2HA 2WBJA 3FQTA 3H9SE 2AQ3A 2IALA 3NACL 4LAQL 1S7VB 4CC4C 3CFDA 2A9BA 2VLKB 1I3GH 1JXJA 1XTMA 2DKUA 3N1PC 5EUOF 5FGBC 4ZOBA 2A4EA 1SVZA 3S88H 4IBVA 5LG1A 3N9GH 4WK0B 4X7CC 3NTCH 4WW2B 3HA0A 5DSCB 2XN2A 4W9KC 5D7IF 5BO1L 2CDFB 4X8JA 1U8NA 2CH8A 3V0WL 3AREA 3D39A 5KVDL 2JSFA 3DPBA 4OD2B 2VIRB 3KLAB 2VZOA 3LZLA 2AW2A 2Z65C 4AH2A 1I3RA 1A5FL 2YZ8A 4HIIB 3A67H 3IJ9A 1NQBA 3TH3T 5C92A 3DOSA 3L95A 4JX0A 3WUWA 4XWGL 4IU2B 1NIFA 4Q4EA 3QZMA 4YHNA 1SPDA 4L18A 2RCSL 1KCRH 4JPKL 3FNKA 5IVXE 1U2CA 1OTSC 4U6VH 5K69A 4AGOA 5I75C 4WU7B 2JWYA 5TE7H 4LHUD 3MBEB 3ARRA 3LKNA 1HWHB 3ARGC 3G6AB 4PSRA 4DSYA 2VJXA 5KYWA 4FQJH 2WKLA 5C3TA 1GW6A 1ZA3A 1RFDL 1THCA 3N42B 1TJMA 2QKSA 5FGCE 4DAGH 4GINA 2OQJA 4OLWH 4G8EB 4FD0A 2EDNA 1AC0A 3K71A 2X0VA 4ODUA 4HWNA 2XBDA 3AITA 4N26A 4ZNCD 1JRHH 2JQMA 2DIJA 2VQUA 3AU0A 4JZJB 1LP9A 3IDYB 4E41A 2PXYC 2Q6WA 3L4YA 1UWFA 1FBIH 4D8PA 4B50A 3PJNA 2RTTA 4R0LC 4RAUB 3GHBH 3S3SA 4OZ4B 3E9UA 3NEEA 4OZHB 4P3WA 5CGTA 1HHKA 5EDSA 3HPJA 1VGEH 4P5TD 5JMOC 1W9XA 3DTXB 3T6QC 5E7FA 3VNZA 1BOGA 2PPCA 1IJ9A 3QIWA 2XN9B 3HI1B 3JTBA 3TH2T 4F8TA 2IADB 1BQSA 4LRNL 4GG8A 3HMXA 4N8PA 5AOZA 5H37G 4JPVH 1KG0B 5D7JA 2V6HA 1XR8B 3EO1A 5DI8B 1MVYA 4KKBC 4GXVH 2YC1A 5F3BB 5AAPA 5I2IB 2ZX7A 4EDXB 4IBWA 4MMXA 1PGRB 2MRYA 2XWEA 2MQ3A 3W11C 1CL7I 4JFXA 5HDBE 1X5FA 3GK8H 4JANA 1ADWA 4G6AC 4KX8A 3AB0C 5GS1A 5C0CE 1UWEH 2V5YA 3FSOA 1Y6NR 1CU4H 1EJFA 5INDB 2OULB 1W72B 3GKWL 3ZMRA 1JPGB 4PJ8C 5GRVL 4M48H 5EU4A 1FL5B 4JHAL 3HRZB 1B0RB 3IU3B 1IAOA 2ZE0A 3QCVL 3TFBA 3HG3A 1LNUA 3Q01A 4OKVA 3TJHC 5ICXB 1Y1UA 4KJQD 4OI9A 3OMNB 4Q0XH 5IOPB 4RGOL 2VOTA 3P40A 3T4AC 3HNVH 4H5SB 3SDXB 2DMBA 1FO0H 4D0DA 4WNJA 4PRHD 1TJHH 1BFOA 2VNCA 3RZCB 4F9PC 4MAYC 3ZTDC 3KNBB 3VFVB 6PAZA 1F90L 4K94L 2E59A 1XF5A 5JHBA 1MFVA 2P80D 4OZ4A 5IQOA 3SDCA 1JWSA 1CE1H 3L3JA 4NRXB 2WXLA 4PW3A 2QADC 5EU7C 4ODSH 2NR6D 2R1WA 4QGYA 1IAII 3RPBA 3TV3L 1EHNA 3GQFA 1PZ5A 1LO2H 3MBWA 4POZD 4Y19A 3HZKA 4XNUH 1NEUA 4PRIB 5C09A 5IWLA 5TDNA 2JJSC 4PTTA 4JQIA 4UI2A 4NM8L 3BE1L 4UQ2A 5HHQB 2R9HD 3LDBB 4OM1H 4L1LA 5FOBA 2J3SA 4IOFD 1NBVL 4LRIA 4HJ1A 4Q14A 4N90D 1NUFA 2C9PA 4B3EA 4JFFE 1F4HA 1JNHA 2FHFA 2F7OA 1ZLUH 3SE9L 2YFNA 3D0VA 4IGBA 3QAZC 1EZUA 4JFYB 4JHWL 1A6WH 4J2QA 3QDJD 4JHBA 3Q6FA 2ZNXA 4IBQA 3ZKMC 2VR8A 1D9KA 3ETBJ 5T5FL 4P2QB 1LLAA 3FRUA 2DJMA 4ANXA 1OAXL 4X4YB 3PL6A 2CO4A 4OZIF 1PAMA 3VXRD 4HS8L 3SE6A 4Y16A 2B77A 3CN3A 2A7BA 1KGIA 4KK6D 4PLOB 3TZVD 5ICZB 3IKKA 4M02A 2H7WA 1JG9A 2KPWA 2H2PD 3RKPA 5A2BA 4LEXH 4WHTB 2WUCH 4WHDA 2G3NA 3ARDA 5EHFA 1CD1B 5IB3A 4M9OA 1H3PL 1SOSA 4WTXA 3RGVC 4NNPH 3CVHH 5AOKA 5IM7B 4YDJA 2YSTA 2X10A 3NFSL 5HYFA 3AAZA 3UP1A 2D3LA 3ZIMA 3JWDL 3C6LD 4YPGA 3T1FA 4JZNA 5CP7A 1NGPL 5HHOB 3FU7A 3M7FB 4MDRA 2E4TA 3ARVA 4H8PA 3VWKC 1P6FA 4FI8A 5D2LF 2BHZA 1U8NB 1VA9A 1D7BA 1JPSL 2P5EE 4L23A 5I1KL 3VSTA 5IV2A 4WTZA 3NBNA 4BSVA 1E9QA 2ROYA 4DVBB 4M6MH 2BRRL 3SPJA 5H4YA 2FYYB 1Z5LA 3CUPA 3GMQB 1MWAH 4EUPG 4PVLA 5HGHB 3OHMB 3TT1L 3UMTA 4BKTC 3QXAB 5DJDA 4OBRA 4HC1A 5EU3A 5JXAL 3VFGL 3ZLQC 2AK4A 1V8HA 1W0WA 3FQ1A 3FO9A 4PU2A 4HH8A 5DTFB 3UGXA 1KV7A 2OI9C 5FYJU 4N5UA 3EGDA 4D8OA 1ETA1 3ARSA 3NRFA 5SV4A 3RUGA 3HZMA 1LE9A 3LJ3A 4N9GB 3C09B 1RMFH 2CDGA 3QEQE 3MJ7B 4KK8C 3L4WA 4UQCA 3I6GB 2Q8BH 4AT6A 2XXCB 4FFWC 4R4FL 5AVXB 5DEJA 1BJ8A 4N2BA 4W4NA 4JZJA 2B14A 3KHQA 5KTEH 3FUDA 1YYML 2BVYA 2B08A 5FUOL 4IMKC 4FADA 1NTDA 4ENZA 4IOSA 3V52H 4J2XA 1A9VA 3UOAB 5KVFL 1JPFA 2WZ0A 3FQ4A 4Z7AA 1L7IL 2Z31A 4XP5H 5FKAB 3N40F 3BPNB 3QGVA 1MH5A 4ZFZB 2A5UA 3TCLB 4Z76A 3PP3K 3FUHA 2MFNA 3FULA 3QO0A 3WNJA 3UTSA 4NYLB 3AY4C 5F0PB 1NMBH 2BVTA 3KEHA 2JKWA 1AQDA 4RMRA 2GI7A 5C3IA 3UEQA 3INUH 1BZ8A 1EDYA 5I1CL 1G7QA 2W9DH 3VSUA 4EDXA 2LLGA 4F57H 3I6LE 1PLCA 1OAQH 3KLHD 1XGTA 3MNMA 1VDGA 3VA6A 2X44D 3B5GA 3G04B 4NKOB 1P6AB 1T5XB 5SWZA 2ZSVA 3QORA 4V1DD 3QJTB 2VT0A 4GMTL 4WWKB 4C83B 4WJ5B 2GEEA 1ZHBA 1KJ3L 4OFYA 5DO2D 5TE6L 3FONA 5C86A 1H15A 2IH8A 1KNOB 4KUZH 2H6PA 2RAMA 4M8VA 1VACA 1URLA 2ZOKA 2OTUB 3IE9A 4M93C 4RBPK 3IWVA 2H4EA 4HXBL 3U9PL 4QIRA 4NN7B 1CGUA 2R9HC 2A1WL 4Q74A 1N5YH 4Y19B 3SYOA 5DD6B 2ARWA 4IHOA 3VI4B 3LKOA 2RHEA 3LD8C 4LLUB 2CHXA 3RURA 1BWWA 3DMMA 2G2RA 3B1TA 5J6GB 2B3RA 4MYWB 4U1NB 3UAFA 4QI3A 6TAAA 5DR5H 3G5YA 4I1RA 4J3OC 1TQSA 1KEGL 1QFUH 1GW0A 1JYWA 3DX8A 4QKXB 3DX7A 4P5KB 2YPLA 2Z91A 1B2WL 2D7NA 3NCFB 3CSYB 2IGLA 3BKMH 4JDEA 3ULVC 3UTQB 3FFCB 3MV7B 4M1GH 4OFQA 4PJBA 4X8GA 5I6XC 1RZGB 1WYJA 3PWLA 3EJUA 2C1PA 4XH2A 5JMRA 4PY8J 1QACA 1E6OH 2HMIC 4DUXA 1J5DA 4AQ1B 5F1IB 4ELMA 5E9AA 1HI6B 5GIRA 1A6VH 3TJHD 5HHQA 4AL8C 4UDUA 1E42A 2LABA 1JS4A 2HWZH 4NOBA 1ZDQA 2FR4B 3NCJH 4HIHA 2P8LB 4XNZC 4OV5B 1G9NL 2CQVA 4MFHA 2CKBB 1OXYA 3VQ2C 5F0LB 5FDYA 2EKSB 2DJUA 2NNFA 3S5LB 1S5IL 5GS0L 2Y6SC 3FONB 4DKEL 1KGYE 3NGBC 3U82B 3QULA 3L9RB 4JPIA 4OJFH 5ADOH 3GBLA 2V8MA 3M7OA 5A7EA 2AJUL 2CRIA 2IADA 1SMAA 3B2UD 1FRGH 4UOW1 3T8XB 2XXGA 2LLNA 3O11A 1AIFA 1NAMH 1VFOA 2O6EA 1UWEL 4HZLB 3GI8H 2J8UA 4G6AD 4QAMB 3LXBA 3X3GH 4BA0A 4HV8A 2AS5M 3J7HA 4XMKH 3P77B 3QI9B 5E5RB 3RI5F 2BNQE 2NCMA 2GUYA 4GQ9L 1GY2A 3B7YA 1MRDL 1JV2B 1BZQK 2BWDA 2WYTA 2XXMB 3BUDA 1QUNA 1JZ2A 5E1AA 3FCTA 2R0KH 5DHYA 4PG9B 3QIBA 4DO4A 4XVUC 2CLVB 3QR0A 3G6DL 2BP0B 3HMWL 3L13A 4BQBA 4XOAA 4ZUTB 2XV6B 2VAAB 3FKUS 3L16A 2BSTB 5EO9A 2IV8A 5FPIA 1BF8A 3GMOA 4YXHL 4KQ0A 4Y16C 3CLEH 4QXGL 3DO4A 4IHBA 2VMCA 3CFBB 1OK8A 2H6OA 3U6XS 4UV4L 3KR3H 4V1DA 5GIRB 3BKYL 4U4BA 4KK5C 1X5YA 3MRDA 4S2SA 1LTXA 3N9GL 1S7TB 2AQQA 3QRGL 5EBLA 1LO4L 2AK4B 2ICWI 2XWJA 3UIYA 5DC0A 5D4JA 4ZSOB 1CLYL 1UB6B 3M1CA 1OAZH 3QXUA 1Z66A 4PLNC 5BVPL 3I75A 4OSUL 2BP8B 7PAZA 4ANKA 4Z18A 4GKZB 1PLGH 3R1GH 1HHIB 2A4CA 3CFIC 3WELA 1QSED 4ZZFA 1WAAA 2QBWA 1AZRA 3SPVB 3UTSB 5JHMA 3NK4A 1AZUA 2DLFH 3TLRA 4DTGL 1OTTD 3QWRA 3WY4A 4YFLF 4DQOH 1RHFA 5AKTA 3ESPA 4F9PA 4IRJA 4RMSA 3D05A 3MRKA 3UAJA 3HUJE 3VXPB 4JDVA 1LP9F 4NCC1 4BGLA 1R47A 3QQNA 3QUKA 3HNSH 1U30A 2IH1B 1IMHC 5F7LB 3VYNA 3REVB 2VDQB 3GUTA 2EZ0C 5HYQA 3L3IA 2H3NB 3RTQC 2D3VA 2VLJD 3NIGE 2RH0A 4CAGA 2ZOKB 1VPOL 3B9KD 5CLTA 4WU7A 3DSFL 4MJ4A 1FC2D 1NCHA 3BQVA 1ADQA 5C0NC 1KTRL 3CN2A 1LO0L 3MLVH 3BMWA 5GSVB 1F3DH 4HK0B 1QSEB 3GJFK 4LVNB 1VGEL 2OSLB 1SXAA 3S3JA 4QRAA 3OHXA 5ESAA 4QLWA 1XF2B 4CMHC 2ZXQA 1P7BA 5DMIH 3CCHA 1TITA 4QF1B 2VZ1A 3ZN6A 4WFGD 5EEUA 3V5DA 2J1WA 2PTTA 3TP4A 1S7TA 4WSKA 3QUXB 1RK0A 1WAAF 2PR4H 5EEZA 1W0VB 5M94B 4PLKC 3EYVB 1CICA 1VACB 3UG4A 3WBDA 1CICC 3VGAC 3PRZA 3N0AA 2W60B 4AL8L 4F8QA 3IBEA 1NIAA 1VESA 2D31B 1QATA 2JKNA 3TGXA 2Y69B 1V3JA 2VERN 4H8QA 4FHJA 2DQUL 5EWIL 4ETYA 1AQHA 2BIQA 2F53B 2CBOA 4MXVF 1FYTA 4QRRB 1F4XH 3NJJA 2QTVA 4GY4A 2H0JA 4U6HB 5D72L 5KSBA 2FWOA 3RGVA 4UIKL 3LIZL 3REWB 1FNLA 1HCYA 1PCXA 3FW6A 3X3GL 4JHAH 3VH8A 1X4ZA 3KWWA 1USQA 2M83A 4MVBD 4JDVB 4ADIA 2B0SH 4HUKB 1J5OL 4JB9L 4NRYB 3UJTH 3D50A 4G7VL 2ATPB 4HJTA 5I71B 5K9OB 1JPST 5DYOA 5KSVB 3I3DA 1VZIA 3WE6A 3G5XB 4WTQA 3S96A 4S11A 1T0NA 4QCIA 5L9DH 4ZXBD 3WSQL 4GAFB 4AG4L 1I7TB 3L5HA 5KVFE 2OXHB 2Y07H 3BH8A 5DRWA 4YBHA 1NGQL 5ICXA 3I6KB 1BQLL 1LWJA 1NEZA 5IVOA 3IMWA 3IAQA 1EZVY 4M7KH 5DJYB 2OSLA 3WTYA 1L0PA 2EYTA 1TJGH 1WUZA 3KL0A 4I85A 4PV8A 1PZAA 2YD4A 3Q2NA 5LAXA 1FCGA 5AAWC 3VFVA 3KPSA 3P73A 3VGFA 3IEAA 5I1IL 5FLVA 2CDEA 4QAWA 4DERA 1D5MA 3O6FD 1S7UB 1PMYA 4GO8A 5AVUB 2V5TA 1WFJA 25C8H 3K0YA 2C8NA 3NA9H 4LLVA 4S1RH 3FB6A 1KGCE 3KPLB 2YBGA 2GITA 3G6JE 5FF6A 1H6EA 3PJSB 5J3HC 2OKMA 1FYTE 2WXIA 4ZXBB 5C2BH 4AC2A 2JCCA 4E2OA 1OLLA 4XOBA 3IDIA 3VGHA 5AW4B 5FUCC 3JXAA 1MIEH 2AJZA 2J5WA 3E1ZA 3AQYA 4KK9D 5JHLA 1HDMA 5F0MB 3IS0X 5TF1L 4PJFA 1FYTD 4KUCF 4X6DA 1NCCL 2CHNA 3COOA 1TJXA 5INCB 1UEYA 3FUEA 1IGYA 2XU9A 3QFDA 5IFJA 3FCTB 4LL1A 1OALA 1FVDA 5BNXD 2GTQA 1JWUB 2HTLC 3BJLA 2BC4A 4CGTA 5JR1H 2DQMA 1EANA 4GEJA 4APQC 2WZAA 4DEPC 3TC9A 4GW4B 1E8XA 2J2ZA 3HMXL 5C0JB 4XMXA 2AJXH 3IDMA 5JYLA 3ZSSA 4EN2A 4OLYH 3I2CH 3IDJB 5EULV 1KENH 4WFGE 1IGFL 4LPYA 4RIRB 5IHWA 3I6KA 5GISH 4C54A 4RFNB 5JQ6H 3VRLE 2YXWA 3OXSB 4YH6A 2OTWB 5D2NC 4OJEH 4N5ED 3JWNG 5EFIA 3H3PH 4LCUA 4PWKA 3IFOA 3QNZB 1KEMH 2FX7L 4BUGA 1ORQB 1AGDA 4G71B 3CBKB 2HYMA 5T3ZE 1IC7H 2DW5A 2GTZB 4AQAA 4DF9A 1NLBH 1KGUA 2X70A 4XWOD 2X6CA 2XKSA 4KBPA 4PJGB 3CN4A 5KEZA 2CIIA 4FE9A 4GNKB 3M8OH 1KFAL 5ECGA 4Y5VB 4X4XA 2RACA 4H44C 4PTUA 3MOAL 2WNGA 2WZPD 2NX5A 4LLVB 1UENA 3BEVB 4YGAB 1C08B 4WWPA 2XC8A 3E8UL 3GXMA 4YFLI 5MERB 3UZQB 3OHXB 5ESAB 1DSYA 4B7LA 1SY6H 4R3SA 4C56B 4U7MA 4ZMPA 4JO8A 4Y4HC 5HYSB 3AQZA 5CZKA 2A6IA 4Z7QF 4FQIL 4GG6A 1RZPA 1QYGH 1X4YA 3BO8B 4R6UA 5DMJB 4WGWB 5C9JB 3ZKQD 4HDIB 3ARQA 4LU5H 2H1PH 1UACL 4WI2A 4AYDC 1VKXA 2JB5H 5MEPB 3O2DA 3T0ED 3GMLA 3RTQD 2F54E 4PY8I 4R4FH 4EIUA 5DTFA 2ADIA 1DBAH 2IQAA 1T1YA 5L9DL 4CNIB 4FLRA 5J11B 3L5XL 3MJ7A 4BFKA 3VXNB 2X7LB 1TENA 5DD3H 4P4KD 4K7FB 4GKNB 1KSRA 1RVFL 1XCXA 4RH4A 35C8H 1MFAL 3RY4A 1QA9A 2FT7A 2GJRA 4L5FE 5DVPA 4DPCX 4FC3E 4Y4FC 4PJ5A 5T1LA 3TO4C 2J8UE 3WNIA 3HBQA 3MGOB 5C0DA 1D9KD 3TO4D 1QFOA 1NCBH 3SDDA 3FPXA 3Q9QA 3V6FA 4IOFC 1YC7A 2VJ8A 4X6EB 4M8UA 1JFQL 1TFPA 2VDOB 3N5AA 4IK7A 2CLZB 3WE6B 1GPOL 3HBGA 2J7LA 4PGJA 1U41A 3BAEH 4ZMTA 1QO3A 2E9GA 4GW5A 1OANA 2OXHA 2IJ0C 1NBCA 3PXHA 3HAEG 1KZYA 4Z76B 1P7QA 4G1EA 2VYRE 4PB0H 3JVGC 3OR7A 2EILB 4J8QA 1F02I 3GSWA 4N8VA 4JK0D 4Z8FH 15C8H 2PYFB 5E8OA 1U8PA 2O5ZL 3D4GA 4TNFA 1A0QH 5FCUL 1FGVL 1G7QB 2PYEA 3QZWB 5A16B 1RUKH 4JS7A 5C70A 1MFBH 3HUJF 1J11A 4GAGH 5D70L 1TU2A 4XX5A 2YRPA 4WNQA 1F13A 4QHKJ 3L3HA 1URIA 3SGJA 3J07A 5KW9L 3K0WA 3MRDB 4S2SB 2R29A 2SEBA 5KVDH 4X98A 1M2OA 5DRNA 2K4WA 2MHAB 4BH8B 5FUZL 1OW0C 1COBA 4ZSOA 3VGAB 3PWUB 3LHPH 3QIWD 1GZHC 1A5FH 3A3YB 1KT2A 1X5GA 3CV5A 5F1NA 3C5ZD 4HLZG 1QP1A 3RVXD 5IVXA 4UAHA 1S7QB 4RVBA 4Z3GA 3MZTA 1FPTH 1UA3A 1S7SA 3IMVA 5EIVA 2VDML 3N1QC 5EORH 2WQUA 3ML9A 5I6NA 1RUQL 2ZCLH 3OPUA 2FJGB 3S48A 3IJYA 4TOYL 4TPRH 1OGAE 2YEZB 5J8OA 1PEZA 3MLSH 2VXQH 1TQVA 2GJZB 2AQSA 3WXWH 1QSVA 4DW2H 4KJQC 4AIZB 4O2EB 3BRFA 4PYGA 5F6IB 2VM4A 2P9RA 2ZYHA 5CO1A 5LCVH 3O3EA 3F6JA 4FXLA 1AHWC 2RFXB 3NZ8A 3LKSB 1FORH 1PIGA 4ZPTB 1KTDA 3C6SA 3JUYA 1XZ0B 1RU9H 2P5PA 4ZT1A 3LNDA 2B8OT 1FFOA 3GSXA 5KWYC 1LEGB 1UJTA 3BE1H 3BP6A 3QW9A 4G82A 1WVZA 4UMSA 3U7WL 4JFZH 3CHXA 3EO0A 4DZ8B 2VXTH 3RWDB 1F41A 1MJ8H 5BJTB 2W65B 4A2FA 2YD3A 5I1LA 4PGCB 4CU6A 2JKSA 4IBSA 2O6CA 1T03H 2AEQH 4MD5B 1S9YA 4L0PB 3RTQA 4ERSL 2ZXWB 1AGDB 4C58B 4X4KA 4LGSB 2CJ3A 5DRZB 1S6NA 2BNRE 2P8LA 4K8RC 2PW1B 5C0GB 4F24A 4AZ8B 4L4JA 2AJUH 3G9VA 3NZHL 2XX1A 4JPQA 1QQDA 1E5YA 2QMKA 3QC5X 5L4FA 3W0WA 4FQXD 1SYVB 3GBMH 3NSYA 1AH1A 1DBAL 1NAML 5MENA 2A9NL 1OCWH 4FEIA 3Q44A 5GRZA 4W9EC 4RDBA 1P69B 2APWA 3DJZA 3QH3A 1C5CL 1FJ1B 4R8WL 3QCTH 4AOFA 4Y2OB 3Q13A 1Q9WA 3F7QA 3K8KA 5DD3L 4HUCA 1CU4L 1ZS8A 1F1DA 4EZKA 4ANUA 1DLHA 4YVUA 4OZFB 2WQAA 3VRIA 1OWRM 1G7LA 1YEKL 1OWWA 3HB3C 3EJTA 3RIKA 1GGUA 3TEZA 4E0RA 3U46A 1INEL 2V4LA 3GI9L 2XN0A 4Z7NB 5F7MC 1J05A 4JDZB 1L6PA 5F88A 1WTGT 4I77L 5F8RC 1ODUA 5CP3A 5TJWK 4DP7X 1T4KA 1YYCA 1WCQA 3HR5A 2G30A 2G9KA 4P4KC 5AEAA 5KVGE 5SV3A 1W15A 3QJSB 1MFDH 1EAPB 4CSTA 2KBGA 1E4XL 2UWEF 2DYPA 3PL6C 5E2UH 3KPMB 4ZW6A 5F9OL 1IIIA 3P2DA 4W6XB 1QTSA 4WV1B 1U8OB 4X6BA 5E9DE 5GRUH 3WHE0 3FBKA 1JPGA 1B6UA 2XFGB 4IRZL 4LCYA 4QHMA 1A7BA 3JTSB 4MCNA 4HCRH 4Y2NA 2QZQA 4A7QA 3CFUA 3OAUH 4ODHL 3P2BA 2VR4A 1KTKE 3KPSE 4PJCA 4YNYA 4OT1H 5JIHA 2IDQA 2KI6A 1MLCA 4FP8H 1AG6A 5DVKA 4EEEA 4MXWL 4PB9H 2HUEA 3LPOA 4IIQA 3U7YH 1KY7A 3FQUB 3EDEA 2WP3T 3BUIA 3H0TA 4LGRB 3KNBA 2UZYA 2FGWL 1KBWA 3NSXA 4U6VL 1I31A 2EH8H 1BYOA 1CD8A 4PJIE 4JFSA 3Q8CA 4KAQL 4AEIH 1WA1X 5DWUL 4FZEL 4U6XB 5EU6A 2E7MA 3LH9A 2DWDA 4PJ9B 5D71H 4H8VA 2KL6A 3O6KL 2CLZA 5IJKC 5B1BB 5SWQA 1TZHB 3SIKA 3POHA 3IRCA 4FFVD 3VFWB 3W56A 3K3QA 3KL3A 3NN8B 4H7VA 1UZ8A 4TVPH 3RILA 1R3IL 4E41D 1U42A 2OQJB 5B3JE 2R56L 1ES0A 3QJHA 1R1CA 2XLLA 3P0VL 2DQJL 1F2XK 2BW5A 3QHFH 5K59F 3I9AA 1BWMA 2WVUA 5AOIA 4YL4A 3JWOH 2OV0A 5HVHB 1IKOP 3TEWA 4H13C 3S5LG 2PYFA 5E8OB 2V37A 3H3PL 4MSWA 1SRDA 1HK6A 3G5ZA 4X5RA 2CRYA 5IV2B 1UT2A 1TG8A 3HPJB 3R18A 4OI7A 3D09A 1M42A 1AZCA 3BXNA 3VXRE 3IDGB 3DHUA 4K23H 1PD6A 4KTEL 2NY6D 3V10A 5DFVC 4PJCB 4YNYB 3FO9B 3C87A 2X4RB 3SQBA 4TULH 1KCVH 3OMAB 3SCMD 1QR1A 4Y89A 2YUXA 5IEHB 1CDHA 1ANUA 2VUYA 3P11H 2YPKB 4I48B 3MBED 3DHJA 1S3RA 3MLWL 3MXWL 3VE0A 5JHLH 4TUKL 5SX4I 4A2GA 1RJYA 3FT3B 5FHAL 3K6FA 2F7QA 4U6YA 4HKZA 3MX0B 4KV5E 5C7ZA 4PJEF 1GYAA 3DYMA 3LN4A 2WNXA 4KGLA 2EO7A 3MYJB 4NQSB 5CHNA 5I75B 4UBDD 1RJLB 1TXKA 2GSIB 4JFOA 1P4LA 4DTGH 2GBTA 4P2OB 4Z77B 3GTTA 1NBZA 4G2AA 1LQBC 1NANH 2F54A 4JGMA 4M6OH 3QAZB 5GGTA 1R19A 3GRWL 5LWYL 3L5XH 5DYOB 3S4SG 5KSVA 1VKXB 1RZJH 3GHEL 2ZIDA 1IGJB 2VR5A 4XNXH 3IDXL 1J1XL 1H19A 5EO1A 3KVQA 2X4PA 3V5HA 2YPVL 2A6JA 32C2B 3QJUB 4ALAH 3B9VA 2EE6A 1BX2A 2ZQKA 3QXWA 4Y4HA 4ZTEA 5I1EH 4IRSB 3SKMB 1I7ZA 3ALWA 5HGDB 4CVUA 3BUQA 3E7JA 1OM3L 5JPNC 1K2DA 4R97C 4MCMA 2BZDA 1JZJA 5JHDD 1I1AC 2ALAA 3DMMC 4D9RE 3VO0A 2HLAA 5HHME 4GFXA 4LSVH 2WJ7A 3H3KA 1H3UA 2G0LA 4D9QE 4OBSA 4G80B 4XN2A 3ULVF 2RJMA 4UT9L 3DC0A 1TQBB 3L5WB 1FWXA 2A0LC 4UZGA 2ENQA 2BNUA 2HT2C 4C47A 3IJEA 5J12B 1DQQA 2EDOA 1QR1B 1KJ2H 4JFDB 2BSEA 4QOKE 3O45A 4WV1A 5EZJB 1BOYA 3FH7A 4WEUD 2BSRA 2J21A 5T5FH 5MENE 1ODAA 2ADFL 3GS0A 3C5SB 1EAQA 1NMCB 4OW6A 2V2XB 5CS7A 1X4XA 2PYEB 3RY6C 4N3UA 3VH8G 2X9WA 1WWBX 3ZZQA 3VD9A 1J05B 3VWKA 1INDL 1CDUA 1QI4A 5INCA 1YEDA 1FFRA 2BSDA 5A3IC 3DX8B 1A6ZB 4G72B 3HOGA 2EKJA 1IQWH 1K3ZA 2DYSB 1A6TB 5FO8A 4OTXH 2VDMH 2COQA 3APFA 3RQ3A 3X1NA 1RUAL 2W9LA 3L3DA 2YPLD 3DUUB 1F4AA 1Q72L 3QZPA 3P0GB 3GMPA 4XPAH 5E2WL 2L8AA 4XVTH 1VLXA 3CVIH 3DIFA 5PCYA 1OD7A 2Q3XA 4JKMA 5CZVL 2QFPA 1NOAA 4DWHA 1LILA 4LCUB 3HEIB 2XTJD 1SY6A 4DGYL 4PJ7B 2J1YA 2VR9A 1MDAA 4P46D 5HHOA 1DFBL 5A2LH 4PD4J 3EH1A 3NG5A 4F9LC 3H9SD 2XA3A 4MQTB 2WO2B 3MBXH 4K2UH 4YK4C 4WZ9A 4UNIA 5E6ID 4ZO9A 2LTQB 4Y1AB 1A65A 2YHGA 2WLJA 1MVFA 3S6CA 3T2QA 2P43B 4XPGH 3GHPA 5FYJH 1HNYA 1AOZA 3L9RA 2HG5B 1IGTA 4XCCL 1Z5LB 1SOKA 3EJZC 2J1ZA 4O02H 4APXA 4DP4X 1BIHA 2DQEH 3TF7C 2YEVB 3P9LA 4OCMC 1LVEA 1ZT4A 5C0AA 3WNLA 3RIAK 4AJYV 4RGNC 3PCYA 1WGOA 2CNZA 1GCYA 4X9GA 4B0MM 4Z1PA 3CFKA 2Z1PA 3WEXB 1QEWB 2NY6C 4HJGA 1AXTH 2X2YA 2YK1H 4PAZA 2LU5A 4WWOA 2HZHA 3GXPA 5B38B 3ARFA 3NJHA 1HI6A 4XB3A 3AY4A 4K4KA 1D5BB 4BH7A 3C60D 3QUYA 3MOQA 5HPMA 2WIMA 3TZVB 3LVEA 3TN0B 4RGMB 1E9OA 1WZLA 2BVOB 5MENB 3RZCA 4Y4FB 3VAEA 4G5ZH 5D9SA 4JE4B 4Q9RL 1PKQA 3LVTA 5D1XE 4MAYA 4UIMB 5B7FA 1LEKA 3SDYH 4LDLB 3VD5A 4X5PA 2F7RA 4NBZB 4WO0A 2OS7A 2PR4L 4B27A 4PRDB 4I9WD 3UAJC 4BZ1L 1X7TA 5L2KE 5HJ3B 2QPSA 3DIFB 4MHHI 5IBLD 2LVEA 2WV3A 1QSZA 1A6AA 1R0AH 3V9EA 4RA3A 3HI6H 1IM3B 4DGUA 4DUWA 5ISZE 1S7XA 1XB8A 3T0DA 1JHLH 1ML0A 1NC2D 3UH8A 3MJ8B 5E2UL 1IM9A 2PP9A 2LTQC 1Q0EA 1QLEL 1IEBB 3CH1B 4HV8B 4KKNA 4GRLA 2NTFB 3WAKA 1NC4B 1GTNA 3VU2A 2K8MA 4OD3H 3PWJA 4UV7L 5MEND 4GRWE 3QJXA 4UQ3A 1FZOA 5K1VA 12E8L 4O58L 2C3VA 1ZHBB 2R4RH 3NRPA 2OCCB 3NQKA 4TLTA 1B90A 1CF8H 4YSUA 3MJ6A 5I1GH 5BV7L 1U58A 2QSCH 4RMWA 4HXAL 4Q8BA 4QHLB 2FX9L 3KYMA 3RU8L 3SQOH 2A99A 5DD1H 2F54B 4YHZH 5BRPA 5ENWB 4O02A 4N1HB 5ESVA 2WWKO 3RKDC 3PAUA 5HYQB 4MWFB 1KIQB 2H9GA 2TRYA 1YN6B 4LLMB 4AVJA 5A3ID 1ZA3B 4LIQH 1UASA 3S4SA 1BVKA 1DJXA 2K9FB 5CGMA 5J6GA 4N28A 4KPHH 4R0LA 3CFJA 5TH2B 2E7HA 4HIEA 1HKLL 5IB1B 3Q6GL 2Y7NA 3BPLB 4QTIH 5H2BB 3T6XA 2C9UA 4PS4L 2AC0A 1KXVA 4GSDH 4U1GB 1KJMA 5EOQH 3H7LA 4R2GB 4OF5A 4XE0A 3FU7B 1KLGB 4PWHA 2LAGB 3RWIA 5DT1L 3UTQA 2WKOA 1EFXD 2B5IB 3FQWB 3KH3A 3BAWA 5IG7B 1GR7A 5IUSA 3LRKA 2ICEC 3O6FC 2Y72A 4PJAE 3RDJA 4S0HA 4OF7A 3WDIA 1DQTA 4OM1L 2DQTH 4CL7A 3EFDH 1F6AA 4FNQA 1YPZB 5GJSL 1IBGL 1DEEB 4ISVB 3ZKMD 2ESVE 1ZT1B 3QPQC 1BAGA 3MHZA 3ZHKA 4DHLA 4GP5B 3DVGA 3ATFA 2BCMA 2OX5B 5IROD 3GLDA 5I2IA 1WAEA 3QIUC 2BSRB 4Y19D 5GS1C 3NJFA 3BAEL 1M7UA 5IZ7A 3F85A 2KZKA 3RBSA 1IILE 2WLZA 2CK0L 2O5YH 4OQTH 4BZ2H 3FBQA 1I1AB 3DVNB 4NKDA 2ADYA 2GJPA 5FO7A 4UQBA 1AGFA 3VA2C 5D1QB 1U8IB 2VW6A 3B5HA 3H6AA 4YSTA 5ELIA 1ORSB 3MUGB 3HZYB 3QNYB 2DIEA 4FYQA 3MO1B 4HS8H 4M6NH 1NCGA 3HKZA 3NP4A 2YGVA 1EMTH 5E9NA 1X5IA 2XG4B 2IOOA 3QEUA 4K07A 1WIUA 1K5NA 1PLAA 4NQCB 1QTPA 1CGWA 2D7OA 2CRZA 2HUHA 2ZPKL 3DUSA 1Z9SB 3LD8B 5E4IA 3BZDA 4UT6L 3EUDA 2QPUA 4GRWB 5M7QA 3U36A 1J9QA 3ZDXE 3VWJA 1A64A 3SDXA 2CO6B 3VWJC 4B6ZA 1TJIL 4I0PC 4R7NB 4Y4KC 1S7VA 1IV8A 1D6VL 3HG0A 1CE6B 4KQ3H 5H2BA 3DRTB 3BVTA 2UZPA 1QUNB 3AQDA 1F4YH 1OPGL 1PYWA 2VTFA 3WN5A 4NRXA 1U92A 2P8PB 3GMMB 4E9YA 4DZBB 1QPXA 5DUJA 4NQUA 4HYTB 4MXQD 1NBZB 3NJGA 3K1DA 5IJDC 2DM3A 3SBRA 2MNJB 3QXDA 3RA7L 1PZ5B 3MBWB 3F6IA 5LXGH 3L5JA 1NEPA 1QLEH 2E75C 3ULUF 2WAHA 3LIZA 3OZ9H 4MHHG 3KPPB 5FA4B 3TWYA 5D4QA 2OX5A 3E2HC 2JCCB 3R1GL 3LKPA 4A6YA 4NNXA 4BFOA 1UZ6F 1V54B 2NCEA 4GAYA 1W8EA 4OR1A 4BINA 2BDNL 2W92A 4J4PA 3SD5A 3D18A 4MD0B 1QI5A 1CLZH 3U9UB 4B9ZA 1X7QA 5CJXA 3DK2A 2JELL 3TA4D 3NIFB 1WFTA 2H32B 2WLLB 5FYKU 1KOAA 1MW0A 2A73A 1UGKA 1ORSA 3A4FA 3MUGA 4KKLD 4XN4A 3QDHA 2UY6A 1ETZA 4AEHH 1I85A 3ZPDA 1ULVA 3Q3GA 4G6JL 2X4NB 2ITFA 4FJZA 3KYNB 4XOCA 1WDAA 4UT7L 2PXYD 2ZCKL 1RVFH 3PXLA 2FEEI 4MD4B 4B53A 4ZAKC 2EYTB 4PV8B 3TEXA 4JHWH 2H0PA 4JZJC 5TF1H 3VVVA 5HDRA 1DJGA 1PD0A 5DD5H 3GFUA 1KFGA 3P2TA 4F1ZA 5CSZB 4K3HA 2EP6A 4M4PA 1GRWA 4P5KA 5DEGB 4NO3A 4ODTH 3WD5L 3WDHA 2ZT9C 2P24B 2B59B 4KKQA 3QYCA 3MV7A 2OTWA 2XN9E 2Q3AA 5IW1A 5K5YA 2Z4QB 4IBYA 4JY4A 1DCEA 2F18A 4S1SH 5HGAB 2CHWA 2AFNA 2DMGA 4JN1H 3QO1A 2VZ3A 4NT6B 1H6TA 1TIUA 1JMXA 3WTTA 5H8DA 3TF4A 3S36L 5H94A 4Y4FD 1UZ8B 2BOBA 4MCYB 3QZBA 1S78D 5EC1A 4KK9C 2PXYB 1U9KA 1KC5H 3B1UA 1OOAA 2P48B 5C3LD 3TN0C 1WIPA 1WISA 2X4UB 2E7CA 2GC7C 4R0LB 1F4WH 1HAUA 1C08A 4G7RB 3LHAA 4I8DA 3T3PE 4MJIA 3WYRA 5I15H 2IPKA 5JQHC 2ZF9A 2PMZA 4Z5RB 4AVKA 5KBPA 1G1CA 4P99A 1QRNA 1VFBA 2V7NA 2WXGA 3IDMB 4EXKA 4WTZG 5DUMH 4HCFA 3SJVD 1CLVA 1O6VA 1M2VB 2LU7A 1T22B 4HUXA 2F53A 2OMYB 2EYSB 4H20L 2UXVA 1Q1JH 5C6PB 2W81C 3KYNA 4XGZB 5MEOA 2B0SL 4HS6A 1J5OH 4RISL 1DL7H 2OTPA 2J8UB 1JXDA 1N5AA 3GIZL 4U1HB 4QOKB 3E80A 3VTMA 4Q2ZB 4CC1A 2YD9A 5D7SH 3IFPA 4HIPA 4IDJH 2IG2L 3ASWA 2WBJD 4X80L 2FE0A 2W07B 2IDFA 3GRWH 3T3MB 2ZWLT 5F9WC 4BE6A 4RZKA 4WQOA 4IU2A 3P9LB 4KNTA 1J0IA 1T89A 5AVQB 3BSHA 5IP4A 4PVNA 4Y4HD 1HH9B 2BW4A 2R2HA 2R1WB 1KEGH 3MO1A 4Z3TA 4QXVA 4MNQB 1UYWL 4F91B 1EXHA 2VLRB 4EOWH 4HJGB 4JG0L 1DQDH 4N0YH 2WQWA 4PWGA 3TBWB 1BLNB 3CBRA 3P4LA 3RAJL 4P3DA 2Q87A 3N50A 3ZE0E 1MAML 3SDDD 3GSOB 4CMHB 2XN9D 4EIBA 4M5SA 5K9JH 3ROLA 3THML 2WN2A 2WQSA 1CVRA 1IUZA 3BSZA 4OCSL 5D2NB 1FH5L 1MHPH 4BKSC 3HE7C 1T0OA 3OR7B 4ZFOA 4P5SA 4Y5XC 5I0ZA 3TO2A 4G1MB 1NKGA 1R0AL 4L2LA 3LH8A 3QORB 4HBCH 1IC1A 5CJBA 1HEJC 1ZV2A 2GB2A 4TQEL 4Z3JA 3PWVA 4GKZA 2X89D 4P9MH 5E5LA 1UA6H 2R0LL 3NIDE 4A38A 4ZMLA 4PJ8B 2K70A 5IF0A 3E38A 1R75A 4HP5A 1KBPA 2NY1B 3WMSA 3QEQD 2OYLA 1SJVA 2FBJH 3X1GA 1S4IA 1R34A 1KCUH 2XIBA 3CK0H 1OHZA 4K8RL 4O5LL 1TMCB 3QUZD 4DP8X 1J1PH 2F5AL 1BMWA 3MRKB 4HGMA 3M6DA 4YR6B 1U95A 3HTLX 1RK1B 3V2AR 3UG5A 4FRWA 5H4ZA 1T1ZB 2AK1H 3MQIA 1I1AD 1AIZA 4G8GD 4U1HA 2EXYC 4X6EA 1NC4A 5FYKE 4QGTA 1D3CA 4QMEA 3AMLA 3FSVA 5EMYA 1WIOA 4Y19E 4XMVA 4UAOB 4AQ8A 2RCSH 3AT0A 1BQHB 4NNYB 1RUAH 1E9PB 4DZBA 2P5ED 1MN4A 4QT5B 3ARYA 3GSWB 4LIQL 4N8VB 4FKKA 4Y8AA 4PJHA 5AB0A 5I17A 2D7MA 2DQDL 3QNFA 1T83A 5LBSL 2J72A 2WINB 5EBMB 3GSNL 1ITBB 4RSVA 2ZJSH 5FFOA 3D0AA 1H3TA 4WKXA 4ZOAA 4R7VA 1LO4H 5T1KD 4DGVL 4ZOCA 3FRPG 1Q0XH 4HIIA 3CHRA 3LKRA 3NSDA 5C0EB 1NANI 1IC4H 4GBXC 3EO0B 3RL2A 4DZ8A 4OSUH 4UV4H 1W0WB 1T3FB 1C5DB 3PY9A 3ESNA 3PJLA 2NX5E 1SJHB 4F15B 1FF5A 4CW1B 3FQ2A 4G1MA 1UHVA 1XGPA 4YUEH 2TAAA 3AG2B 3N41B 5IBUG 2IFFL 4FG2A 4C4KO 3O2VL 5C8JA 1TJGL 3O4OC 5IVZB 2AITA 3SSGA 2Y7SA 1CG9B 2MCAA 1KLUB 4FQIH 1A4KA 4UUJB 3U1QA 2EDKA 2OMWA 3T0EE 4PY7A 1J5HA 3P3YA 2CG9X 2WVTA 5IW3A 1UCTA 4NKMA 3WCYA 3EDKA 3TX4A 2MCPH 4PLJD 4MQ7A 3OKEA 4X9HA 3K4AA 5ID0B 2E5EA 4ZMOA 2GVYA 5T1KB 4JFFA 4UM8A 3SKNA 3WIFA 3MLYH 1IL1A 1G1KA 2V17L 3O6KH 3JV6A 3RIFF 4A68A 2Y1VA 1BJMA 2R4SH 4LCWA 4Y5YA 5AENA 1T0PB 1UOLA 1FIEA 1QMUA 4HIXL 1C5CH 4WDIA 1MCCA 2H5UA 4LSTL 4MASA 4NHCL 3Q5YA 1HKFA 1DEDA 2FEDC 3GBEA 4E0RB 5DC9B 3VGDA 1DQDL 1E5ZA 3CVHB 1MJJB 2F08A 3O4LD 3QCVH 4WI9A 1L6ZA 2EYSA 5HHOD 3WS3B 4KMLB 4GEIA 1HSBA 1X9QA 2E7LA 4ZAKB 1TVDA 1UFGA 2VC2B 2G2RB 3CX2A 4MAUL 4QRQB 2X4UA 4L9LA 4LFHD 4JAMB 4OLVL 4E41B 4QHUA 4B9KC 1NCUA 4I9WE 1X5KA 3PIQA 2WTOA 5AUMA 5I76B 1XXDC 1XHHA 3OKOB 3HLAA 5C08E 4UNVA 5AD0B 1CD1A 5IB3B 1J8SA 2XFXB 5GRWA 2DBLL 2PP7A 3RDTD 2GHWB 2OP4H 2P5WD 4BBWA 4FQ2L 4KY1H 4OD1H 3N43B 1WBYA 3X11B 4ZD3H 1AHWB 2OMYA 3V0HA 1CIUA 2BMKA 1SFHA 1XSOA 2V5SA 1WFMA 4GKLA 4LK4A 4KTYA 2CM6A 2YPVA 5JPMA 1OP5H 2YC1B 1XF4A 2NXYC 3IDUA 3HZVA 4H40A 3QUZA 2CM5A 4QRRE 3GGWA 3MOAH 3WFHB 2AMGA 1T6WA 1I8KB 2EEAA 2X2HA 2J43A 3FCSA 5HI5C 1SDYA 2R69H 3GSNA 3R06A 3BHBA 5EOTB 1YZZA 3NJXA 3IF1B 4ZFQA 1XXFC 1QD0A 2CGRH 3MUUA 4M93B 3PGDA 4P8QA 2XZCH 3TNNA 3PREA 1R17A 1N8ZA 5A2CA 1I1FA 3D87B 1NGQH 3ELQA 4UT7H 3DJRA 2DYPB 2K6WA 5K9KB 1RUQH 2DZEA 1S8DA 2ZCLL 3QUYC 1IVTA 1GS8A 1N8OE 1AJ7H 3EJQA 1CXIA 2HVJA 1QWHA 1KN4H 5LJYH 2XG5B 3S7GA 1S7RB 4WKZB 4KH2A 3BUYA 2V3DA 1BZOA 1VFAB 4LOEA 1U3YA 4OGYH 3S34L 5D55A 3HVDA 2YD6A 1H3XA 2PCPA 3S97C 4GB9A 3WFBH 1G7JB 5CEXB 1ZXKA 1SXNA 3EYUL 4I3RH 3FN9A 1DO6A 1ZMYA 3HLAB 3MLTA 3RWGB 1C5BH 2Y1YA 1VERA 1BZ7A 5GJSH 5DHYB 2ZWSA 2FIRT 1XIWA 4FQHB 4S0SD 1JPFB 3T0BA 4F58L 1A4AA 1SXCA 2B1OA 4K3DL 2NR6C 1X7SA 5D7JC 2FQFA 3CPUA 3EBAA 1A1NA 3H9HA 5FHBL 3V4PA 2Z0UA 3ZHFA 1Q0YH 3HPLB 3B9EA 2H8PB 2YARA 5D1ZB 5B4MD 2CJTA 3U30B 5IWLC 3UIZA 3D4CA 3QO1B 4YQXH 3NAAH 1AZBA 4FCHA 1KPRB 4ADJA 3SEPA 3TESA 1VIWA 1WICA 4LASL 3QUYD 1HXYB 3AU1B 5CU9A 5CD5C 5GRJH 5ES4B 2C4FU 1XF4B 4J28A 3ULUL 3BDYH 2NXYB 4IRJD 4IJTA 1EXUA 2WK2A 1TETL 2CBQA 2MEJB 1PG7W 2NYZA 4HWUA 4IGBC 3SQRA 4UTBA 1A6PA 3QCUH 3MYZA 4M7LL 4QKTA 1T5XA 5SWZB 2C4XA 2IFGA 5BOZG 5CEZL 5IHHA 2Q86A 3IMSA 4JREB 4UT6H 3TIEA 4HJJH 2I9TA 4H1LB 2DLEA 5ABDE 3WKMH 2XSKA 4AKOA 5E6RB 4MMZC 1J0YA 4P2OA 1GGCL 2YBRB 4N2CA 5EB9A 3EH4B 4OFIA 2E86A 4Z9KB 2OA9A 3QH3B 3SBWC 1BW8A 5JQ6L 3M1OA 3I3BA 5BZDA 4LVOC 3DX4A 1D5ZA 4JL2A 3D2TA 3GI9H 1UWXH 1MFUA 2R0WL 3UL4A 1G0DA 3ISWA 4P04A 3QEGL 5DJYA 4BRJA 3MR9A 3ETSA 1ZVHA 4XVSH 4OM0H 3MOBH 1A7NL 3EGSA 3SDCC 1XGYL 5IIEA 4UNTA 4YDJB 4N2LA 4P57B 4NC1E 3PS6A 1JZ4A 1U3HD 4HQQL 1CFVL 4BCZA 3LIUA 3ARWA 1U92B 3BD5A 4WWID 3L6FB 1R46A 1N3NA 4XE5B 4HK0A 2DIBA 3I6GA 5LCVL 3SE3A 5F7FA 2VLMD 3WLBB 4U2ZA 1IBGH 1PTZA 4DIXA 2ADJB 2WLIB 5IB2A 2ZZUT 2YA0A 4HJ0C 4NGHH 1CLZL 1RU9L 4M7LT 4QRUA 4PJXA 1DO5A 3KPPA 2J12B 5FA4A 5JQIB 1MKFA 3GSOA 3L3HB 3BAJA 1SHSA 1GC1L 4Q58C 4TRPH 5IMOB 2OBGA 1JF5A 3REVA 4PHZA 4AEHL 1EBAA 2WBJC 5I5MA 1XEDA 3ARBB 4UOZA 3BYYA 3BGFC 1FNHA 2I69A 5GSRA 1U8MA 3QEQB 2DAVA 1C16A 1NAMB 3A4AA 1G0XA 1TTCA 1UM4L 3C6LC 1MW1A 3OX8A 4EUPB 1BAWA 1MFAH 2ZWKA 3DOIA 4ZS7L 1SLVA 2BSED 4YWGH 5GGRA 2JH2A 5CEYA 1CCZA 4M61A 1G43A 1NCCH 4LIQE 5FWQA 2PTVA 3REWA 1N59B 1UD4A 1OCWL 3T2NL 4FYSA 2D0HA 5HJGA 4G80A 1UXSB 2RGSA 3PABB 5JHDE 4IKNA 5LBSA 1SJEA 3AT8A 4G42A 1BV8A 1EAOA 3L3GB 3ZTCC 1A3ZA 5FO9A 4UQDA 3VFUA 4BQ8A 1VRSA 3OKDA 5C0FA 4G3YH 1A21A 4M3KB 5KSAD 2UY7A 3C6SB 4XHQA 4I18C 3RWFA 5KYXA 3K91A 5JIKA 2AABL 2QGCA 2NDFA 3HW7A 1DQLL 5MI0B 1NSNL 4PJ7E 3BPNC 5AZEL 3U4BH 1MCOH 3FYIB 3MNVA 4LLDB 5HHPA 5GQBA 1EDQA 3ZL4L 2EVGA 5HHMB 1MI5E 4X8CA 1IC7L 1E6OL 1V3MA 2AVFA 3V0IA 3ZYZA 1SEBB 5FB8B 1VFAA 2KT6A 5LGHH 5FR3A 2NUTA 1CF8L 5DWPA 1O7DE 3VI4E 4TULL 3HE6B 1HHGB 5ESQB 5FYLH 1MHCA 3B5TA 3LQAH 4JFEB 3EW3B 4MNQD 1FZMA 3SGJC 5GRUL 5DZJA 4Z0XB 1AQMA 2HT4C 3ZY7A 3IPBA 3BWAB 3VD0A 1BXAA 3FRPB 5K93A 1U0QA 3HN5A 3CFNA 4WW2C 1QSFD 4PJAF 2D9QB 1XMWA 1BOGB 1IB5A 3HHSA 1QLEB 3BPOB 1VB9A 4RZCB 2YGPA 3NJNA 7FABL 2NYYD 5L7XH 1MCWW 1R5VA 3GM0A 4GAJL 5E94A 2A9ML 4LU5L 5HYEA 3IAGC 1JGLL 2N0KA 3JSSA 3QORD 1JDAA 3WXWL 3PQYE 4I0PA 3GC3A 1U33A 1S3KL 4LKXA 4L3AA 3KM1A 3ZKSD 3G6JB 1AGBA 3LSOB 2Z64C 3KGTA 3AS3A 1GJUA 1RZ7H 4OV5A 3G5YB 4F92B 2VKXA 2EH8L 3ZU8A 2DOCA 4R7DA 5DF0A 1INQA 2DYPD 2OPCA 2Y5EA 2XPGB 1UEMA 3F04A 4BM7A 2Q7AA 3EUUA