4BCZA

Monomeric human cu,zn superoxide dismutase, loops iv and vii deleted, apo form.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
110
structure length
110
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHGAGGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKAGAGAGSRLASGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Global Structural Motions from the Strain of a Single Hydrogen Bond.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 23
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4bczA00
3L9EA 3KM2A 5CU9A 1Z9NA 2WYZA 1RK7A 1E9QA 2JCWA 2GBVA 2AQRA 4A7UA 4MCNA 2WKOA 4FF9A 3RE0A 2E47A 4N3UA 3T5WA 2K4WA 2C9UA 3GQFA 2Z7YA 1HL5A 3H2PA 2WWOA 4A7TA 4OH2A 1OALA 1MFMA 2LU5A 1BZOA 4A7VA 2AQSA 3GZPA 1B4TA 1YAIA 2WYTA 3GTTA 1IBDA 1E9QB 4MCMA 1N19A 4L05A 4BCZA 2NNXA 3CE1A 1ESOA 1PU0A 1UXMA 1YAZA 2WWNA 1SXAA 3K91A 2AQTA 1Q0EA 1F1DA 1JK9B 1CB4A 2APSA 1TO5A 2Z7ZA 2VR6A 3SODB 5KBKA 4BD4A 1S4IA 1JK9A 2XJLA 4B3EA 1OZUA 2Q2LA 3ECUA 2WZ0A 1SXBA 1FUNA 1IBBA 1AZVA 1SXNA 1CBJA 1XTMA 1P1VA 1SRDA 2ZOWA 3CQQA 3LTVA 1COBA 2WKOF 3GTVA 2WZ5A 1EQWA 3HFFA 3KH3A 2VR8A 3KM1A 1IB5A 2ZKYA 3CQPA 1PZSA 2Z7WA 2SODB 3GZQA 1SXZA 1U3NA 3KBFA 1N18A 2ZKXA 1DSWA 1PTZA 1HL4A 4A7SA 2Z7UA 1F1AA 1SXSA 1E9PB 5KBMA 1E9OA 2AQQA 3MNDA 2C9VA 1SDAB 2GBTA 1JCVA 1E9PA 1DO5A 1XSOA 2XJKA 2VR7A 3F7LA 3QQDA 4A7GA 1SDYA 1OZTG 1KMGA 1F1GA 1XTLA 2AEOA 2V0AA 1BA9A 2JLPA 2AQNA 4BCYA 2AF2A 3GZOA 3KH4A 2E46A 3ECWA 5KBLA 1OEZW 2R27A 1QUPA 1B4LA 3L9YA 3PU7A 1E9OB 1F18A 1EJ8A 1SPDA 4A7GF 4A7QA 3KBEA 2ZKWA 3MKGA 1L3NA 1YSOA 3H2QA 3F7KA 2AQPA 1IBHA 3QQDB 4N3TA 1Z9PA 2WZ6A 3S0PA 1TO4A 2GBUA 1IBFA 1UXLA 1SXCA 3HOGA 1SOSA 2C9SA 1OAJA 3HW7A 3ECVA 4U4IA 4OJAA
chains in the Genus database with same CATH superfamily
3MVSA 3RIFK 3TZVC 5LLIC 5D7LE 4FQXB 4KKPA 3IDYC 1K4CA 1QW9A 2DW5A 3DTXA 3FB5A 4PP1C 4XPHH 2NX5B 1J0HA 1XHHA 1T03H 5EUOF 4C83A 4OB5L 2YUVA 3D3VB 4UIKH 5GSVB 4E41D 5F9WB 4LVHB 1XF1A 5LUMA 5DZOA 4FNLH 4MSWB 4Z7QF 3O3BA 2XQ0A 1A4CA 5DD3L 3RZCD 2F7IA 3HS0B 1TYJA 1MLBB 2Q3XA 5K1JA 5HPMB 1M7DB 5FYKL 3OJMB 4N2KA 3LNIA 5FM8A 3MBEC 3GBMH 3FBKA 2CM6A 4HD9A 4K71C 3SGJC 3WFEH 2VDPH 3HN8A 4KJWD 3WNJA 1H6FA 4OFKA 3Q8BA 3V9FA 3T6QC 4M1CC 5FA3A 4FI7A 1RUKH 1H0DA 3OZLA 4G6FD 1SJHB 3ARBC 3GIZL 3ARFB 3I84A 1A8JH 1AGDA 4PRID 1AD0A 4HS3B 3BUYA 4QRAA 4RNRA 4QMEA 1ZLVK 1OP3H 2WQUA 4NBZB 4ECNA 2IH1B 1PBYA 1U36A 3EOAB 2XKNA 3ZDWA 1JPFB 2CGRH 4Y1TA 2XXCB 4NC2B 4XH2B 1WFNA 5EZJA 1Y6MR 3KPRE 4F7CB 3SKMA 3HI6L 1NIBA 3QYMA 4M3JA 3QT2A 3O9WB 3HPLB 2JKSA 1FNSH 4WI0A 5KANI 3GIZH 3ABLB 4PWFA 1PEZA 1X5AA 5L4JA 3EYSH 2DQIH 3FQTB 3B9DA 1AKJB 3CQFA 4PTUA 4DP0X 4XZUA 3RB5A 3VFUB 2E7DA 1IMHC 1OP4A 1MH5B 3W81A 3ULUH 2MPAL 4WUKL 2C1PB 4FN0A 4QF1A 5FW8A 4N2CA 5EIIA 2AVGA 3HI6H 4Y5VA 5K5YA 5LBVA 4GW4B 4CVUA 3UJJH 3ZZQA 4RQQA 1FL6A 2IQAA 5JXEA 4K3EL 1BD2B 3KLHD 2JB6A 1B4LA 4LLVA 5AKSA 5E08L 4ZMAT 3RVXD 1NM4A 3KEDA 1MI5E 2WK2A 2VDNL 1EDQA 2BNRE 2EUWA 3PUUA 3NEXA 3KVPA 1CUOA 1UZ8B 2XG5B 3DJSA 5IQOA 3UG3A 1I31A 1L6PA 2WSDA 3HZMB 1BF2A 1BMGA 4X6DB 4ZSOB 4P9MH 1A7BA 3HAEG 1A0QL 2IAMC 2C5DC 3M7FB 3GPEA 4U1NB 4ZYKB 3D0LA 3FHQA 3CVCA 4PGEA 2H8PA 2QADC 1EVTC 4FJ6A 4GS7B 4UILL 4U7SA 1AJ7L 1KGJA 1R3LB 2HJLB 2NYYD 2VDNH 2P28B 3QXWA 2FWSA 4TQEH 2WBXA 3BIKB 2EDOA 4PV8A 2MCG1 4HG4K 1MJ8H 3IU4H 2IC2A 4IBSA 1M6OB 1YC8A 4K3GA 1G6RA 2XG4B 3MV7A 5D6DC 1Z3GH 3OSVA 2XSKA 3NCMA 5I1AA 5GGUA 1E5UI 4N8CL 4D8OA 3OWEA 3H9ZA 4C56A 1LNUB 1QA9A 1KIRA 2EE3A 6FABH 4GW1A 3TZVA 3X3FH 3WSQL 1U91A 1RZJH 3H2WA 1AGFA 2PWGA 2WMPA 4KZCA 5JHLA 4NWUL 1GMEA 4ZFFB 2A6JB 2WWKO 3V4PB 4HJ0D 1T3FB 4YHYB 4K5OA 4X8CA 4NQQA 1X9QA 1KLGA 1QUNB 1VEPA 3G6JE 4CW1B 2QHRH 1USZA 4UOW0 5E8DL 3UTSE 5IMOB 4U0QB 5F8QC 1TTAA 1L7IL 4N8CH 5B3NA 4E5XB 4UM9A 3K6NA 1OGAB 5A2IH 5JIIA 3O2VH 1AZCA 3MBEA 3DOIA 1QFUH 2BSDA 4G9FA 3SGJA 1KJ3L 3CXHJ 3L7EA 4M61B 2BXYA 3M07A 5M7QA 4J4PC 4ODHL 3OAZH 4FMKA 1Z9LA 5M94B 1KB9K 4JFDD 3QZOA 2OXHB 4NO0A 2Z65C 3ARBA 4FFVD 3QQ3A 4MDIA 4RGND 4UTBH 4NIKB 1T04A 2G60H 3GMQA 4RAUA 5IV2B 3GXPA 5DA0B 5TD4A 5HYEA 1N9PA 4L1LA 3NJKA 3TIDB 3GSRA 4WLCA 1P4UA 2EC8A 4PRDA 1R5IB 3ATAA 5IP4A 2RAMA 5D70L 1ZA3A 2DD8L 2Y1VA 4GXUN 5LN8A 2FJUB 3S34H 4OM1L 1I3GL 4I3RH 3CCHB 2HMID 2A77H 3FQRA 2DQDH 3PQYB 2X6BA 4NRXA 5T3ZL 4ABWA 3M8OH 2PUQT 1CFNB 4LPCA 4MNGA 5IEHA 2K7PA 3MNZB 3V2AR 4NQEA 1YEHL 4G8GE 1GYWA 1DBKL 3II3A 4WI3A 3SQBA 4KH9A 2JKNA 2VDLB 2Y3NA 3ZUCA 1MRFL 1OE2A 4B50A 1A4JB 1UWXK 2JCWA 1P4IL 4RX4D 2W1NA 4NSKB 2R69A 4UUJB 1K4DA 4HUKB 4C4BA 4ZAKD 2CO7B 4WEBL 4CN6A 1MVFA 2IFFL 2V5RA 4OM1H 3CLEL 3OAYH 4EEEA 1PZ2A 4A2LA 3MRHA 1L9MA 1MRDH 2O5YL 3CSBA 1Q9WB 1DQTA 3VA2C 4L3EB 4P46B 2O72A 2VDQL 3UZEC 3VI3A 3VWKD 1IKOP 3GSVA 4PLJC 1C5BH 1DBKH 4HWEH 3GXFA 1SDDA 3DI2B 3Q8FA 1CDCA 1UKQA 2V3FA 2XBTA 4PRBA 4WI6A 4NQDA 2OYLA 4LPYA 3JWOH 4D0CA 1JNJA 4O4YH 2IAMA 2OZ4L 2WXRA 1YAZA 2AEQL 2XPGA 4WEBH 3CSYA 2AK4B 3IJ7A 3GSXB 1M71A 3CLEH 3KJ4B 5FECB 3OGCB 3N6YA 3LB6D 4OCYL 2WGXA 3N91A 4XOBA 1AGEA 3A5VA 3UXFA 5A2LH 2WLLA 5F3HB 4ONGH 3PWPB 4KJQC 3T1FB 1YYLH 1T22A 2AC0A 1MHHA 3KPPA 3WNIA 5I17B 1ADQH 1URIA 2VZOA 5GS1C 3BKML 1OAZL 3ZHFA 2OR8A 1QEXA 2WP3T 3UJTL 1Z5LB 4OF5A 3QUZC 2NW2A 2XV0A 3FRPG 3I3DA 4K7PL 4PJ7E 2D03H 1HN1A 5IB5B 2QR0B 4Z18A 5D6DA 3RILA 1EO7A 2FSEA 4NLAA 1J0IA 1IC4L 4Y4FC 5D1XC 5ENWA 5IGXH 5EEZA 2OL3L 5CMAB 2EAEA 1Q94B 2LTQB 2N1KA 3CMGA 4JPIB 2P80A 1G87A 2QMJA 5HHMD 1JGVL 1CICC 5KJ4A 2KBGA 1NEZA 2JCCE 3HR5A 3MRQB 2EDTA 4ZODA 5MENB 2WQAA 4E0RB 1CQKA 1ZOXA 2NYKA 3K8KA 1JD9A 2AHIA 3L3DB 5AD0B 4UB0L 4NNYB 3CVHA 3BKMH 1OAZH 5ERWA 3AM8C 5FV1L 2C3XA 2IWKA 3FTGA 3EFOA 1OP3K 4XVJL 3L9RB 1RURH 1UCTA 1WQVT 1AANA 1D9KB 3MRDB 3PJSB 3QFGA 1ZVSA 4BCYA 3VMPA 1ETZA 1M1XA 4DO4A 4Z7NF 1JGVH 2E6QA 3LXUX 5I74C 5CEZL 3NFPA 2YWYA 4KFZC 3C8KB 3IJYB 1D3CA 3MYJB 3PG2A 1HI6B 2C4FT 4J4PA 1QFWI 5E2WL 4CMHB 4UB0H 2P26A 3CSTA 2PYFA 4IIQB 4MJIE 2FEEI 4WWID 4ABUA 5KW9L 5EN3A 1IBGL 4XOAA 1XCQA 1Y6NR 2R23B 1E30A 3ETBF 3HZYB 1UOVA 4F8PA 3SY6A 1T5XB 4QOKA 2XETA 1UVQB 5JNYB 1JERA 3UO1L 5GS0L 5CEZH 2ICWJ 4IKLA 3KWUA 3WCYA 3BP7B 4N9OB 4WWKC 3O8XD 3QEUA 3NJHA 3SOBL 1RIVL 3OR6B 2FL5B 1OAUL 1DZBA 3UADA 3L4XA 2OMBA 5AB2A 3L08A 3IFLL 4YC2B 3GLZA 4IBTA 1CZ8L 4PJXE 4F37K 4MD5B 4N2MA 3ENEA 3WIIH 3QI9D 4NN6C 2Y22A 3FO1A 1U95A 2JLLA 2YGPA 4FGMA 3U30B 1HH9B 2NY2D 4X98A 1IGYA 3ZKXB 5AZUA 3BISA 5HDOA 4IOIA 5CWSB 4XCNB 3W0WE 1CXKA 4J3OG 1IQWH 2ENYA 3SO5A 4IBUA 4Z7VF 3UTPD 3QDMB 2YD1A 3AS0A 4HIIB 1VIWA 5C07B 2Y7SA 3IFLH 3H42H 4YGVA 4GUOA 4MS8D 4Z77B 4QPEA 1X9RA 2LR4A 3C9NB 4G6JH 4KDWA 5F9AC 3UZQA 4AYFA 5SV3A 1QOKA 3UZEA 2WO3B 3ZTEA 3KL0A 5T33H 1D5ZB 4UT7L 3OPZH 2R2EA 3L1OH 1UADC 3FUHA 1MCRA 4OGXL 1MQ8A 4ZFZA 1AHWB 3KHOA 1UM5L 2CDEA 2FGWL 5T1DL 3FFDA 4JFZH 3L1EA 1QHPA 2OYMA 1A5FL 1LD9A 1TNMA 1JD7A 3K5SA 4NQEE 4PJBF 4XBGA 3NSJA 5CZRA 5IVZB 5I2IA 1BVOA 5E6IC 1CXFA 5I15L 2J8UF 1MUJB 3TYFB 1Q0XH 2EICA 2DQUH 5FGCB 1AQKL 4RDBA 5CLXA 3JV0A 2OTUB 1Y1DA 1VSCA 1U8QA 1DJIA 2VLKB 4KXZI 1OZTG 1KCUL 4IOSA 2XKUA 3NOIA 5EO0B 4QTIH 4TTDC 3ULUC 4GT0A 1HX0A 3BZFA 3MUZ1 5GS1A 5FX3A 4JFED 1DSFH 3QUXC 3QUZA 4N6RB 1YNTA 5GSRA 1MVUA 4N2GA 1MFCL 2ADYA 5SWSE 1EJ8A 3FRUB 4Y4FA 3U9WA 4OD2B 1MHCB 3IMWA 1PY9A 5J3HC 1ZJAA 3OLGA 3F7KA 1I7ZA 5A7EA 2I32A 3OAZK 1CICA 1QEWA 1BF5A 4IBWA 2L7JA 1KTDB 2PMZA 1ZLSL 3T6ZA 1NCTA 4QEGA 2UXTA 1KCUH 2JTYA 3Q0HA 2PPEA 3GMOB 4JKPL 5L9DH 1FFOB 4Z7AA 1XMWA 5DWPA 1XH2A 2BCMA 2ZPKL 1KULA 3AM8A 2EO1A 5E7FA 2D3NA 3FTWA 1MCCA 3ARGC 1NZRA 1VJSA 3QBTB 3SDXB 2EDLA 2BP5M 5IMKB 2ATKA 3VM7A 1JNHA 5JLZB 2FIKB 2WTRB 2IDFA 3IE9A 5ALCL 4M5ZL 5D1ZI 4R0LA 2BVOB 2FECL 4AK2A 1BQHB 2HRPH 3BD5A 1EJFA 3DVNB 3KE0A 4JFHD 2I5YL 2VW6A 7PCYA 5FO9A 2QKIB 3QHFL 5EU4A 4YJZL 4FZ8H 3IFNH 3G5ZA 3F7YA 4BFKA 4TQHA 2DQFA 1I8IA 4OZIB 2DMKA 3OKYA 3R1GH 2HFTA 2QVMA 1TLKA 3T4YA 2XZAL 4CC1A 1LE5A 5IMLB 1OGPA 1L6XA 1UJTA 1P9MA 2Y7LA 1NUFA 1NDTA 4M5ZH 1H8LA 4U3HA 2WCSA 4N0UB 4PJ8B 5DQDL 3VRLE 1OB1B 2MFNA 1RZJC 2RFXA 5IFHH 1OB0A 2D9CA 3CDGB 3OAYK 4WWKA 2O61A 1E2WA 2J1ZA 2ZIDA 2BXZA 3BVDB 1JZ4A 3U0TB 1IUZA 2JMRA 5LBSL 5GISH 2YPVH 3MLZH 5TF1L 5KSBB 1D7BA 5CIPB 1F2XK 3F7PC 3OKKA 5I1CL 4JKKA 2ZKYA 3U0WH 2GJZA 3FT1A 1ZIBA 4FNQA 3KPSA 4WO4D 3ULAB 1AP2B 4ZXBB 1KENL 4HIXH 4UT6H 4IKIA 3EJJX 4LSSL 3G5YA 3MX0A 1QHOA 4LEOB 1IFHL 2OMYA 1NEUA 3NPZB 5DQDH 1WICA 3ATFA 5I0DA 3CC5B 5DD5H 3RFZC 1U6AL 1IM9A 1JHLL 1MXDA 3BN9D 3L48A 1R3HB 4PYHA 4QD2E 4Z7OE 4YDIH 3LZNA 1ZV9A 2XVKA 1G7MA 3FB8A 1RVFH 5I1CH 3CN3A 5F3BA 4M62L 3V5HB 4WNQB 4OFQA 3W38A 4Y89A 4PHXA 1KENH 1YYCA 1CLOL 3ML9A 2CUMA 1RZIB 4F15B 2A9BA 1UASA 2DL9A 1I7RB 2AJXL 4UT9L 3T3PB 4HK3N 5IW1B 2AEPL 2BC4B 5D7HA 1P7KB 1SEQH 3P3UA 4NN7B 3DX6B 1OW0C 2G3NA 2VM4A 4D3CL 2X0UA 2B3IA 4F7KA 2E59A 4E9QA 1BPVA 3BO8B 3MREB 4GQ9H 1NGQH 5LN4A 2EO7A 4TYUA 2ITEA 4H25B 4U1JB 3Q6GL 5JR1H 4FFZL 4E42A 4XE0A 4J12A 4ELMA 2YZ8A 2PPAA 3KEHA 4JANB 1J8RA 2DYPB 1NKOA 2XWZA 3WHXB 2JELH 1SBBA 4GP4B 5T1MA 4ZFGH 3BDBA 4A7UA 1CCZA 3V0WL 5KSAB 3QQ4B 3QUXA 3X2QB 3M1OA 1JGDA 2A9NH 1FNGA 2AJXH 2R0LH 4M6AA 3KDMA 1KN2L 2BFVH 3VB8A 3LZFL 3NUKA 2ATAA 4KMTH 2AFNA 3RJQB 2VLJD 4F91B 4OIFA 2Y7OA 3MBXL 2J57A 3OC8A 4I5BA 2Y5QA 1EAPB 1ZA6B 4J28A 1ZS8B 2IVFC 1L9SA 3EGXA 5A1AA 5JQIB 4FA7B 2LW3A 5HGAB 1U8LA 3GHBL 3CN1A 1PYWA 2UX6A 1I3RA 1LHZA 5MEQB 5I76B 5AW6B 3JWOC 3ZSSA 3UIYA 3UBFA 3T3PF 1AGBA 2B16A 3LZFH 1JHTA 4YK4C 3HFML 3C87A 4OV5A 3TBVA 1T0NB 4TVPE 4N4YB 2H1PL 3KL3A 3UIZA 3BSZL 3FCUB 4I9WD 1JMXA 1FYTA 3ATDA 4WGKA 1K8IB 5D1XE 2ZUUA 3B2XA 4HU8A 2NY4C 2A7BA 2J71A 1G9EA 1UD2A 5LXVA 1GYVA 2CK0L 3C09C 4JUTA 4XP4L 3OLEA 5E8OA 3U1QA 4BQCA 4KZEL 4L4TB 4CC4C 2H9GB 2Z4QA 4HC1H 2VZTA 4GIPD 1NPNA 5JHDD 5IR1A 5IT2L 2DL2A 4CL7A 1NFDE 2P45B 2H1PH 2ZICA 2VW4A 2ZXGA 3LQMA 5TFSL 4WO0A 3M1BA 3JVGC 3S5LG 2M83A 4XNYH 1A6TA 3MPCA 3FFCB 3ZZLA 2HVKA 1HE8A 1H19A 5DJXA 2JLPA 3BVXA 1T5WB 2X0WA 4O2CB 3IJSB 4BDVB 1FN4A 4HKZA 3CLWA 1AIZA 3U9UB 1JGUH 2K1MA 4ZW7A 1HE7A 2EYRB 4J6RH 1MHPL 4Y1AE 3QCVH 2ZKMX 4NO2A 3ILPB 4DW2H 4ELKB 4Z1PA 5BOZG 4W9EC 4GQPH 4YE0A 3NJLA 2HLFC 3E6HA 1GY1A 3CBKB 1N0LA 1L9RA 2OP4L 3BVNA 2C9SA 5C92A 3GSWB 3V4LA 4ZBJA 3LMJL 5B7MA 2MQCA 2OI9B 3CAFA 4NOBA 5EDXA 3KYMA 2QDWA 1HZHH 1ECZA 4R84A 4G8EB 4FKEA 4UTBA 1LEIA 1TFPA 2B5IB 5F8RC 3R8QA 3MV01 2J21A 4TN9A 4YMPA 1RZFH 3O2WH 3NCYP 3FUIA 3OXSB 1TT6A 3D2TA 5E94A 1FCGA 1ZEAH 4UAOC 4GRLB 2CJTA 5KS9B 1F3DH 1ZPLA 3QA3B 5DJDB 3RWEA 4JLRA 4JFSA 1EA9C 1B3JA 2NXZD 5CR1A 3SD2A 5TGBA 3ILQC 3QB7C 4RFEA 5D7SL 2BVYA 2PTTA 2VERA 2XQYK 2NW3A 5GGTL 1ZXKA 1A6WL 3VRJA 1NCIA 4LLMB 1PU0A 1O9WA 4RIRB 5K1NA 2ZOTA 3BH9B 3UAFA 2WWNA 4X0KA 2GJRA 4KK6C 3EFDH 3JUYA 4N0YL 3ESUF 2CKBL 4U31A 4FABL 2BIHA 1V8HA 1JK9B 4HSQA 1HXMA 3K80A 3LNDA 2P5WD 1ZS2A 3QXUA 4PRHD 4JJ5A 1OZUA 4H0IA 3QEGH 3CDZA 5DQ9B 5CKAA 4WUUB 2OJZL 1KBGL 2MMXA 3VH8G 5I9QC 2Z3FA 2W0KA 1ORQB 2JB5L 3FCTB 3MJ8A 3NIFB 4XP1L 4FFYL 3HNSL 4OFPA 3VH8A 3KBFA 3GBDA 4FABH 3UGUA 3QG7L 3EIFA 1E4JA 2F5AL 3O81A 4OZGA 1RUPL 4GQRA 2H7WA 1BFOB 2JJUA 3S4SG 4EN3B 4O51A 3BLPX 3LCYA 4V1DE 1FSKB 3N41F 3HHSB 4U6HA 1OP5H 3RPKA 3VFMB 4DEPC 3F5WA 4ZTPH 1S7RA 2VSKB 5K9KA 5FM5O 3ULUE 4RGMC 4APQB 5ACZA 5F7DA 4MB1A 3FOLA 1KBGH 2J88H 4U3SA 4GKOA 3RU8H 5JA9A 5BRPA 1HQRA 3PWLA 5K1VA 4XP1H 4CN4A 3V6FB 4OQ1A 2PPCA 2A4EA 1SQMA 3AVEA 4G6KH 3CSGA 1T2XA 35C8L 1E4XH 5DEFA 3LEXA 2OK0L 2EDHA 1SHMA 1P5VA 5J8OA 4LEXL 2O5ZH 4P9HC 2APVA 1MCDA 2NLJA 4IK6A 4OF0A 4RMQA 4CC4A 5AOLA 1D6VL 3BPOB 5C09A 5ABDE 3PP4H 2ED7A 5BXFB 1RIHL 4P23C 2OQJB 4U4BA 3ZN6A 3JVGA 4KY1H 1FLRH 3B6SB 3PGCB 3RP1A 2CUIA 2QPUA 3TT3H 1IJNA 1NCAL 1Z5HA 5IG7B 5D7JD 3V8OA 4JFOA 1U8CA 2IXQB 4UBDD 5ISZA 3J8F7 2PCPA 1S7SA 1AMXA 1FAIH 5IB3A 4GY4A 1KIQA 2DQHH 3HE6D 4LEXH 3CSPA 1AY1L 1CIDA 5J0BA 1U8OB 2NY5L 3SE9L 4FLQA 1BJ1J 2PW2A 4NJ9H 4XXCC 3QO0A 4CAGA 5CBAB 3O41B 1T1YB 1NC2B 4LHUB 2VZVA 3WEXB 1J9CT 4IDLA 5HI4C 2P8PA 3BZ5A 4MKMA 3O0RL 2WIIB 4E41B 2QV2A 1C08A 3MGTB 4OZHB 4P99A 5DZJA 2R29L 2ZWLT 1UB5B 4GP8B 5EDSA 4FTVD 4LLQA 3SJVA 4D9QD 4G9DB 1G7LA 4G6ML 3SE9H 2VDOH 4YQXL 5GXBB 3D08A 4PQXA 4N0CC 4OUOA 3C60D 1UWGL 5A3ID 3D50A 4G6FB 4GI8A 2ZOWA 4Y9FA 2CXKA 4PRIB 4F33B 4LMQE 4YEFA 4PJHF 4Y4HC 1KY6A 5JW4N 2BWQA 2GW5A 3PFQA 4PG9A 1IGIL 3HPJB 2FR4A 4Y5XC 5HHNA 4P49A 3TF4A 2BOCB 2DYSB 1LO0L 5DFTA 4LO9A 4YQXH 2C9VA 4HIJB 5HI3C 2XTJD 3GB7B 4NQCD 1KG0B 1HZLA 2ZUVA 4FS0A 3SDCC 4MNQD 3K0WA 3C08H 2ENPA 3LHPH 4RMUA 4PEEA 2JFCA 3GMNB 1Q72L 5C0BE 2WVVB 1JDAA 1DUYA 4GUQA 4IOFD 1A6VL 2GJ6A 3SSGA 5HDRA 3ARYA 5KBNC 1HL9A 4PIRF 1A3QA 3QAQA 3UEZA 5HJ3B 1MNUH 3TWCL 4FLHA 4IRSB 4S1QL 1DVSA 3VG9B 2YPLE 1IC5L 2V33A 4XCCL 4MJJA 1N8ZA 5D4QA 1LDPH 1JRHH 4F7EB 1QR1A 1NDGB 4YZFF 2FK9A 2IBZX 2XVGA 4HFWB 4B9ZA 2X6MA 2A0LC 3ZUNC 5F3FA 3MOAL 4N9GB 3QUMA 3L1GA 3FB5B 4M93B 5LWYL 1LE9A 1Q72H 2FX9H 4P5TD 3G6DL 3IXTB 5ID1A 3BT2H 1INEH 1NLBH 3GGWA 5B8CB 1MY7A 1BZ7B 4PY7B 2EDRA 4MZIA 2XVLA 4EIGB 1RIUL 3ZBMA 3GEFA 4DWHA 5CD5D 3N55A 2KMWA 4TM9A 5CILL 4G7QB 2VMEA 1YN7A 4GO9A 2WXLA 3S96A 1K3IA 3WOVA 1Z7JA 5T3ZE 1OCWH 4U1MB 4TUKH 1FFNB 4CKQA 3V6OC 1TTUA 3ZE0B 4G7VL 2WQXA 4YAQA 3G6JF 4I88A 3FU9A 4IRJD 4P2QA 4KI5C 3MRMB 1ZKAA 1CE6B 3MRNA 1H0DB 4HCIA 2XQYG 3HLAB 4DHLA 5L6YH 1QBAA 1CLVA 1CR9H 4PRPA 3SKJL 4CMMA 4PUBH 4AMWA 3II2A 3UX9B 1ACZA 1RIUH 1VGEL 4WTZG 4MJHA 3KYKH 4XWGL 4YOKA 1QRNE 4P23A 4ZX4A 4LNVA 4G83A 3QJFB 4OD1H 4L1SA 1QSVA 2GHZA 1GZPB 3BMWA 4LPUA 5B1AB 3NAAH 5F7MC 3UP1A 2DIJA 3SODB 2E7HA 4DO5A 2OMZB 2FJGA 4B3EA 3H7BA 1FNLA 3GKWH 3O4OC 5DJ8A 1IILE 4MX7A 5DZPA 1YN6B 3SIKA 3LEYH 3PGFH 3LTVA 1JJUA 3RAJH 1EQWA 3EJYC 1I85C 4XWGH 2EUXA 4PTUB 4XZUB 4ODSH 4LDCA 1CGUA 2EDEA 2VL5A 3EH5B 3HZVA 2VDMB 4FFWD 3BRDA 3P4LA 2DY2A 2B3RA 1UD5A 4AQ1C 4QF1B 4WU7B 4XHJD 5CN3A 4XC1L 3CFKA 3NIGB 4MB4A 2XIBA 3QHZL 1M2VA 2BNQE 3AS2A 3MV9A 4RQQB 1JL8A 3P4NA 3VWJD 1XIWD 4LCWA 4FOMA 4QNPE 1S9VA 1QBLL 3W11D 1QLEL 3IJEA 5AFAA 1BYNA 1VFUA 3NDZE 1ITBB 4JFDB 2X4OA 2OCJA 2O26U 2VR9A 4GLRI 4Y4HA 4MQ7A 3L5HA 4MQXC 1TQCB 3I9PA 2YPVA 5ICZB 3HKZA 2WNKA 2ARJA 4GYBA 2XYBA 3F6IA 4XAWL 3MU3A 4Y5XA 3D0LB 4AL8L 5C70A 1OSPL 2W81C 3WLWD 1VA9A 3VUAA 3NJVA 4PGEB 4JQIH 1OP5K 4NCC2 4PJAE 4X6FA 1P53A 3VXRD 4UNVA 4UT6A 4I87A 3SDCA 2YKLH 4EZKA 2XN9A 1ACYL 4AMKL 2GBVA 3W1ZA 3A47A 1J5DA 1GR7A 2AJ3B 4PV8B 1C12B 3WJMA 1TR7A 1CGXA 1CTNA 4X8GA 1BREA 2K8QA 2MQ3A 3WS3A 3IDXH 5CEZE 2G3ZA 2NPLX 1CK0H 1M4KA 3MV7B 4P3DA 5T1LD 3IDNA 3ZGIA 4A6YL 3A6BL 5BS0E 4NZFA 1OSPH 5GGUB 2F5BH 3ULVD 4C56B 2CLVA 4GMTL 1DLFL 1QA9B 3STBA 1DO6A 1KIRB 1XD0A 2ZXQA 3V4VL 4HLZH 4UI2A 5LG1A 3LX9A 5IJKC 1A14H 3B9AA 4PJ7F 4QUOA 1AD9A 3SQOH 4Z3JA 4GIOA 1RP9A 4I0PD 4AMKH 4R4NC 5IQ9B 2OSWA 4NKDA 1TYEB 4BWWA 3EO9H 3UZVB 4LOVA 2OXGA 4A6YH 4HFUL 1DDHA 1U8MA 3NZ8A 5EBWB 4N2NA 1ZGLA 3ARTA 4A04A 1A2YB 4UM9B 5IHZA 1A64A 4F57H 3FSOA 4K3DH 4KK8D 2GVYA 1BX2A 3ZDZF 4G9FB 3V6OA 3NSDA 3C6SA 3EOBB 2Z35B 4N2DA 2VABB 5FFGA 3UPRB 4AOFA 4L5FH 3TS8A 2PLTA 5D6CA 3G5VA 5HXMA 2OMTA 1FBIL 2VWEC 1YUHA 3G08A 3MLXL 4M6ML 4EXKA 2BSRA 5BQ7B 1AG0A 4YSOA 3BAEL 4WFEE 4DN4L 3MMEA 5IB1B 4KQ3L 1P1ZA 5D7LD 3IVKB 1R5VA 2ICEC 3JZ7A 4AENA 1OANA 1UT1A 5EORL 4L23A 1J18A 3OLDA 1KZQA 3QUHA 5DHDA 1EZLA 1TPXC 4JNXA 1Q1JH 1WA2X 4XP6L 1TDQA 2YA0A 4WKXA 1SY6L 1I85A 2YD7A 3F7RA 1F58H 4MNGB 1GCFA 4R83A 2OMVA 1MREH 5I8CA 5IEHB 3QJRB 4J3BA 4KQ3H 4WWOA 3MNVB 2B1AL 3DMMD 3A67L 1KT2A 4FJZA 1W6LA 2ZYRA 3WEMA 4J8QA 1ZHBB 4L3AA 4AQ1A 5E6YA 3DO7A 1SOSA 4XB7A 2Z93A 4K5NA 5DHXB 1K4DB 1HINH 5JO5A 3CUPA 1C16A 1D6EA 2EIKB 4HA1A 5D1QC 4ZTEA 5F70A 5DK0A 3BZEB 1PD1A 3MRHB 1XCTA 2B20A 1CLCA 1OD7A 1HOCA 1A7PL 1LO3H 2WIMA 1HU8A 3QXTA 4MAYC 3KPRD 4UQBA 1WWCA 1SDDB 3R06A 4PRBB 4NQDB 8FABA 1JWUA 3ERXA 1NCHA 4LZKA 1YAIA 2IAMB 3EJZD 3GMLA 4DGYL 4JRXE 4JW3A 4PJIE 4M4PA 5J12C 1VHPA 3CSYB 4YFLF 3RY5A 2FDBP 4Z78B 3ZYIA 1TJHH 4Q89A 4I8DA 5CHNB 3D06A 3EADA 1RJZA 3LRLA 1KTLB 4Y19D 4NQVB 2WLLB 3BVUA 1XGUB 4JPKL 3P0VH 2PTUA 1QFHA 1XXDC 1T22B 3S6CA 1FHGA 1MHHB 3KPPB 2FB4H 2NR6C 1WFOA 4LCWE 5KJ7E 2CNZA 2IGFL 3D87B 2ERJB 3ATBA 2NW2B 1HKLH 2NY2B 1RUML 5B1KA 3WUWG 5L7XH 1D5BB 1WPCA 2FSEB 4N2LA 4ZQKB 4HF5L 1ACXA 2ZX6A 1GZQB 1RERA 4LSDA 3L3GA 4M5TA 3RIFF 5DYFA 1MI5D 3WUWA 4ZW6A 2BNRD 5FKAA 3S8WA 2O93L 3KM1A 3ARPA 4R9HA 3TJHD 3HR5B 1NEZB 5MHSE 4X9FA 3GUFA 4LEBA 5IJKA 4JPKH 3NFNA 2IDUA 5AOIA 1AXTH 2CIIB 3VI3F 4KKLD 3CVHB 2H2SD 4LSUH 3CSFA 5T1JA 5ERWB 5AG8A 2E7LC 3I02B 1OE1A 3EFOB 5KVFH 1N4XL 3KXFA 2Z92B 2KH2B 3LN5A 4GJTB 4K3HA 4LLUA 1O75A 3EGDA 3ASWA 4KU1A 4H5SB 2OAAA 1I3UA 1ZVSB 2BP0A 4L2LA 2COVD 3H4HA 1RQ5A 3IKCB 1DEDA 1XGTB 1G9NL 1WG3A 3DX7B 3MLWH 3WBDA 3WE1A 4NO3A 1SOKA 3QIBD 1WO2A 3NACL 2W9LA 4Z0BL 4NM4L 3QORD 3ZU8A 3H3KA 4KZDH 4MBRA 5B4MC 2X9YA 3BPNB 3DJ9A 4OY9A 3ZMEA 4CBZA 4QDGA 1VCAA 1YZZA 2DLHA 2VN5A 2VXSH 1XCQB 3Q9QA 5JQHC 1PG7W 1SHWA 1MFDH 1QFWH 1UXSB 3C12A 4JFEB 1T4KB 2XN1A 4PGJA 1EFQA 3MV8A 3LKNB 4QOKB 3QJOA 2JI3A 3QQNA 3TA4D 1T6BX 2ICEA 4K8RL 4E9YA 2K8MA 5BUGA 4NI6A 4P8QA 1LK2A 4MQTB 5E6RB 1F41A 3NACH 1WF5A 5EHFA 5JOFA 4TSBH 5AVZB 3TASA 1M56B 2ODHA 1J86A 3WFCH 5IHUL 4ZO7A 3UTSD 5FDWA 4N24A 5I71B 4BUHA 3V6OE 3ZGHA 4KKZA 2ZP8A 3FO1B 2BW5A 3DX1A 4FG6C 1A6PA 4Z7UA 1N10A 2EIJB 3FU5A 4P3WA 3RI5K 4NZUL 5HSFA 4LCIL 2V4LA 5SX4I 1J9TA 1QTPA 1H6UA 3BOVA 1WT5A 2CXGA 3NJMA 2MPVA 5MEPB 4A1RA 4IOIB 3PNWA 1BGXL 3LH2H 5HHOE 3T65A 2ZYSA 3OR7B 2EECA 3ROLA 3HN3A 4ADGA 5I1DB 2NCEA 4KTYA 5DD1L 5IBTL 4WEUD 2ZOLB 4YGVB 5C6TL 1JS4A 1UFUA 3OF6A 2ZWZA 4LVNC 1NJ9B 4NKMA 3FN0L 4W9FC 2YC1A 3INOA 4AYFB 3UZQB 1MRCL 3PHOA 1N6UA 2NY3C 2AZUA 5F1IA 2BCKB 1BZDA 1YEKH 2WXIA 2VDKB 4WHDA 3CFNA 1RZKL 3LDBC 5KUMA 4NZUH 4MAYA 3TP4A 3IJ8A 5AG9A 3EJSA 3ASNB 3LD8B 4ZFZB 2HN7B 4HMDA 4IJ3C 2CDEB 5AAMC 1WWAX 4NX0A 2BZDA 4TTGA 3BAIA 3P69A 4LSTH 4NDMA 3ZKNC 1LD9B 4XBGB 3MNMA 3VFTB 1JGLL 3FQWA 3HNVL 3NJXA 5HHQB 5I2IB 3CQPA 2ZWNA 4H0LC 4JRWA 4JFWA 2EKSA 3C5JA 3L4CA 3FHAA 3AJ7A 3I6LE 3IMBA 4QLWA 3SE3A 2WBJD 5DMIH 1J5OL 3SKOA 1F4XH 1SXSA 1SVBA 4G8GD 4KHXL 3R0NA 1IE4A 5JQ6H 4AVIA 4AEIL 5GGSA 2NR6A 1QABA 2DAVA 3B9KC 1EZSA 1XGYH 4KUCD 2EIZA 4F58H 5GQBA 3AGWA 2WN3A 2XUWA 3A22A 3JTTA 1QWNA 1TKWB 2PKDA 1CO1A 4WW2C 1YNTB 3QJZA 4KXZH 1MVUB 3AITA 2EXTA 4RA0C 2DN7A 4JG0L 3QPQD 5FYJH 3ZXAC 5FYKU 5DT1H 4X6CA 3MCYA 1I7ZB 5IUCA 1NFKA 1J05A 1EBPA 4NZRL 1SOQA 1NDMB 1J5OH 4YHIB 4A7GF 1HT6A 4MJ5A 5IZ7A 3CDCA 3QQDB 4HZAA 3FZUC 3ATEA 3EH2A 4MXVE 2JJWA 2E7LA 1AXSA 4X7FC 2YRZA 3H6JA 3K6IA 1WZ1H 5I0VA 4AK1A 1NOFA 5CGMA 2HFGH 1EJOL 1I8UA 4BSVB 1JNHB 3ESOA 3TJPA 3NJGA 5AOMA 4HZLB 4Y1SA 4MKTA 5AZEL 3UBXI 3VQLA 1XR9B 1IO4C 1OM3H 3GJEA 4R0LB 3OKMA 5F9DC 5I74B 4OCXH 4N87A 3FS9A 3RGBA 4X7TA 3GQFA 2C9UA 3Q2WA 5JDSA 4QRBA 1ED3A 3TN0D 2JIXD 1G7JA 3G5ZB 3T0EC 2DQFB 1I8IB 3WFBH 3ZDXB 1CD8A 3RVTD 3ILEA 4JE4B 1PDKB 3ARED 1OTTC 1YNTF 2EO9A 2X1XR 3Q9PA 3QUYD 5JMOC 5DR5H 5CZVH 3HN5A 2YS4A 5BZWA 3HG1E 4PBDA 5FYLH 4FYTA 1MWAL 1INQB 3BWZA 3VD4A 2HTLC 1NFAA 3ZHDA 2LQRA 2VLJB 2CR3A 3WN5A 1AQHA 3FT2B 1K6QL 2O61B 3B1UA 5IK3A 2IANE 3DGCR 4X6BA 1FF5A 2UX7A 4XMPH 3VXSA 3FTYA 4BD4A 2OBGA 1NFDF 3FB6A 4HKXA 2GUOB 2NZ9D 3SY0B 4X99A 2H26B 1JFQL 3MCKA 1INDL 1AZVA 1BAGA 3NCFB 4PJFE 1LLAA 3VCLA 1AYRA 3LKQB 1FV1A 3STZA 1JPGB 5DQJA 3BESR 4MCZA 2ATPB 4G8IA 3KPSB 2CA3A 3TT1L 2VWEE 3LNGA 4Z8FL 1QD0A 4N25A 1KB5L 1SM3H 2MTPA 4QHLA 3NCJH 3MX0B 3QWNA 2DB8A 2DWXA 1N18A 1WFJA 4C4KO 1UZ6F 5C08E 1CLZL 1IM9B 1F1AA 1ZVNA 1MFEL 2VXQA 3NGBC 5E99H 1ZK5A 1G7MB 2WQ8A 3ZL4L 4XI5C 4NGHH 1AZNA 1ITCA 3LSOA 4PJDA 1INDH 1DVUA 5K59E 4BWTA 2OSLA 3TVMC 3BEWB 3E3QE 3ZDYE 5AAWA 3CZUB 2DLFL 1U8KA 2AMUA 1HYSC 5DMYA 3QZMA 3N43F 4V2BA 5AAMA 5JHDB 4QRTA 3VW3H 1BZ9B 1U9KA 3X3GH 3MAWA 3EJPA 1DYZA 3QDJA 4PW9A 3P54A 4KITB 2FWLB 3DHMA 3KBPA 4NKQB 4PIBA 2R2BB 3THML 2VLLB 1F97A 1I1AC 4E42B 4ELMB 3NZUA 3A4FA 2D4DA 1IM3D 3KWXA 4NLHA 3IETB 4RAHA 3D85D 4B5EA 3W0WD 4HWBA 5HVFB 3B9KA 5C97A 5D1QE 2PXYA 1IC7H 5JUEH 1PL3A 3HMWL 3X14B 3ZVVA 4J3UA 2GI7A 3BGAA 3QFJA 4WW2A 2ZX8A 4CJ0A 1X4YA 1RXLA 4GH7B 4J7RA 5E51A 4W93A 5IROC 2XFXA 4OQTH 3UROR 3GXIA 4FCAA 4ZS7H 5JIQA 3DJTA 2UY7B 4I18B 5JTWA 4MXQD 5B3JF 3BFOA 1OALA 1MFMA 4R97B 3OKNA 2WXKA 2AQSA 4LIQH 4Q6IA 3UERA 2GI0A 1PYWB 3FCSA 1C8PA 1I3RB 2CZNA 1BXUA 3I74A 4BSJA 1OARH 4P2OC 4YPGB 3PNRB 4CVZA 4BCZA 1C5DA 5JZ7D 3OZ9H 5DFWH 1H8OA 1MCBA 3HE7D 2KQMA 1MDAA 1AGBB 4QRRE 1JHTB 1QTYT 2NXZB 1N5YH 4YZWA 4OV5B 2AJVH 4JQIA 3RGVD 3TBVB 2VDRH 1AHMA 3HEIB 3ZYOA 4EDWH 1G1YA 1JZEA 2B2XL 5I8OL 4LSRL 1MLCA 4ELMF 1FYTB 1IGFH 1KCSH 2NOYA 5CZXC 5FK9A 3MRIA 1LMKA 1P4BL 5FM4A 3PV7A 3ULUF 3OKLA 2VE6A 3T0EA 5JPMC 5SWSD 1NCDH 1XX9C 2Y7MA 4OFYD 1CFSA 4LDLB 3CXDL 4NM8L 3SGEI 1PW3A 2CO3A 4AQAA 5BOPA 5H35A 2G9HA 5I0YA 4LASL 1QZNA 5HD8C 2RIKA 1E6OH 5JW5A 2W94A 2B2XH 1T0OA 1XMEB 3HNTL 1CF8L 2V17H 3G3LA 1BEXA 3DXAA 3EBIA 3VXNA 1YEFL 2HVKB 3WIAA 4F37F 1P4BH 1DFXA 5DJXB 3WO4C 9PCYA 1SUHA 5GGRY 4GSUA 3GJFH 3AADB 1KYAA 1KMGA 5TE4L 3FONB 1FN4B 4HKZB 4NM8H 2OX5B 2VZSA 1RPUA 2APXA 2PXYD 2J1YA 3J2PA 2EXYD 4E2OA 2Z31A 1FFPB 3LRMA 4NO2B 1OAXL 1M2OA 1P5UC 3H53A 4TNWF 4D0BA 3E6HB 4NJAH 4HCRL 5EC1A 5HDBF 1AKPA 3BVNB 4KMQA 5EU5A 3TPUB 2O6FA 2YEVB 3H0TB 4ONFL 3ULSA 1AVAA 3FCGA 1QRKA 3V5DA 3OMNB 3KPQB 1JNNL 1RV6X 1U8PB 1OVZA 3T0XA 3Q5YA 4EO5A 2XA8L 2WYZA 5E94B 2FUTA 3TVMA 4PGDB 5GRYA 4HISA 3F04A 5F6IC 5I1LA 4JHUA 1SQ2N 2XTLA 4IBYA 3TJEH 5IVXA 5D2LB 5E9NA 2XCMC 3KJ6L 4RFEB 1JZHA 1CG9B 4BZYA 4ONFH 2NW3B 3IK2A 1XEUA 1IV8A 1NA8A 2R0ZL 3FQ1A 4JO8A 5TE7H 3VRJB 2J73A 3AXHA 4V33A 1I1AA 4MDRA 4TOYH 1JNNH 4F5CE 4QYAA 3VFGL 4MCMA 4X0KB 3UTQB 4UNTA 2Y36L 3CLFH 1NBZA 4M6NL 4MAUL 5TDPB 2ZX5A 3HE6B 1HXMB 4QHKI 4DN3L 1PNDA 4JCWA 2P52A 3U1SH 2GB2A 4M6OL 4L8BA 4HVBA 5ADOH 1ND0B 2LT9A 2IPTH 3KPOA 1DBJL 3CDZB 4HWUA 7CGTA 3AUWB 2Z8VC 5IROA 3H3BC 5MI0C 5D93C 1B0GB 4YUEL 5ANMA 3T9WA 3GDCA 4RAVB 4S1SL 3MJ8B 1JZ8A 1TITA 3DYMA 4V11A 4NFBA 3JYBA 4KTGA 3REVA 2AGJL 2BZCA 2W9EL 4FTVB 1E2ZA 4EVNA 5DJ0B 5D2NE 1MF2L 4P2OA 1SVCP 2BP8B 3T77A 2QT6A 4U6HB 4OJYA 4M6OH 4S1RH 1S9WA 3CH1B 1NWOA 1S7RB 3GM0A 4XMVA 5FO7A 5K9KB 1A4KB 2I9TA 4KK5C 4U1GB 1MZYA 1SF5A 1DJSA 3SYAA 5F7DB 1THAA 5GRUH 2ZCZA 3L2LA 4U3SB 5L88L 1N5AB 4AX3A 1HQRB 3F2LA 4J3OD 4ZT1A 2IWFA 4S1SH 4Y5YC 4HH9A 4AJWA 4GG6A 2W07B 1G4MA 2UXVA 4EJ1C 4RVBA 5C0GA 4G7RB 4IDJH 2MHAA 2C7FA 3IFPB 2AGJH 1F90L 5KG9A 1NANH 5FAAA 5L4FA 2CUHA 3C09B 2Q6WB 3L13A 4PLJD 3LEXB 4Q7DA 3EF7A 1P5VB 1IARB 2XTJB 3BGMA 1XQ4A 3RNKA 4NQCB 2VAJA 1MDTA 2NLJB 3DBXB 1XF3B 2HWZL 2OR9H 3EG9B 3I3BA 3NT0A 1KEGL 2QMKA 1PY4A 3U36A 4JX0A 2W38A 5IFJB 4KV5E 1NCBL 4MA3A 2K45A 2VAAB 3QIUA 4JDEA 1E28A 2LFGA 2BVEA 1TVBA 1BAWA 4JFOB 1BFVH 4OZGF 1NMCC 5A16B 5ISZB 4U1SA 1S7SB 3H9SA 4OAWB 5IB3B 5FUOH 1KIQB 3C5XA 4OT1L 5F7KC 3TV8A 1K8DA 4DZBB 4TVPD 3KZ8A 5DD6A 2SEBA 1XD1A 4P06A 2FYYB 4KTDH 2Y7QB 4NYLB 5TQ2H 3V52H 1P5UA 3QO0B 3HB3C 5D1XD 5AVSB 4A7TA 2B59B 4P5TB 5ECGA 5ABAA 1KXQE 1LP9E 2P5EE 2EYSA 3V8CA 1NCBH 1QSFA 3BX7C 4YE4L 4RZCB 1EZVX 2EABA 3UDWC 4I3SH 2AK1L 2MKWA 5D1ZC 4WJG3 5BV7L 5BUPA 1QATA 4I2XA 5B7EA 4AV4A 4UQEA 4PJCB 1PD0A 1Q1PA 4MMXA 5HDQH 4KQ0A 3SJVB 3A4AA 3PL6C 3CH8A 4YDMA 3NIDB 5CCKL 4KVNH 5EWIH 9CGTA 5A2BA 5EEWA 2X3BA 3KW8A 4IRJB 4OJDH 1DFBL 1ZHLA 1KWKA 2GY5A 3N04A 4FI8A 3U2JA 4OLWL 1XSKA 4Z6AT 1YEJH 1XTMA 1GS6X 1I8MB 4HMEA 3ETBJ 1WA1X 3Q2LA 1W72B 5CUSL 2HZHA 5CXPA 5DZVA 5BNXD 4Y1AD 2FR4B 8PAZA 5HHNB 4XMUA 1QPKA 5KYWA 4HCGA 1BIIA 3KPLB 2UV3A 4UV4H 1WUNT 4GAGL 5FB8A 1HQ4B 1JSYA 3DURA 1QVOA 2HXAA 4HJJH 3NVQA 1UA7A 1MJJB 2WXGA 5GZOC 1E9OA 1QSEA 2ENSA 4GFTB 1RHFA 5INCA 3E8UL 1DUYB 2PNDA 4J27A 5KSUA 3BP4A 3IF1A 4BZ2L 1UOLA 4ZUSB 1BVLA 3QIUD 4D2NA 4Y16D 5CUSH 4WVRA 5I9QB 4Z3IA 5AL0A 4FL4B 2EZ0D 4YSPA 1YNLH 1QR1B 3H9SD 3B2DC 3BPLC 2OS7A 3NIDF 4IBVA 3DA0A 2VERN 3V4PH 2WYIA 1GHFL 1DBAH 4AZ8A 4ZFOL 2ZNWA 3GZKA 1VF5C 1P7BA 4W4OA 1XIWB 3QUMB 2L0DA 5LCVH 1BVKA 2DLTA 4BKLB 1LE9B 1HNFA 3CHXA 3IDGA 5ID1B 4KNQA 3E8UH 4NBXB 1TO4A 4F27A 4XPTH 3DX0A 4LBAA 1NLDH 3DX8B 4WK4B 1KB3A 4AYBA 2HX7A 1KJ2L 4NPYB 3WAKA 3GJFK 5I23A 2FJFB 3L9EA 1KBPA 2FHFA 4Y5YA 3SPVB 3SDDC 2V2WA 5INDB 1AQDB 1TSHA 3QXDB 3DIVA 4XNZC 3E2HC 3S96B 3MJ9L 4FAAB 3D9AH 1QYGL 1TTGA 5EULV 3BVWA 5FYKD 1G1CA 1UWYA 5K9JL 5LXGH 3VXRB 2LU5A 4P2QB 1V3KA 3MRNB 4OI7A 1PIFA 4JUSA 1FCCA 2KZ1B 3FO0L 4FQJL 3IRPX 3J27A 1ORSA 1PPIA 4JGUA 4H88H 4PRPB 4HK3J 4CMMB 2G5RA 2QVTA 4S0HA 4G80B 1JNLH 4M48L 3ME0B 2E9BA 3BEVA 3EHBD 4PJEE 4YHLL 4ATTA 4B27A 4V1DD 1SOXA 4KC3B 3SO3C 4R7LA 5I1GH 1KIPA 3ULUD 4FQHA 2FJGB 3ES6A 3G9AB 5K9JH 5DJ8B 5DMGC 4ICWA 1PQZA 1WC7B 4MX7B 2C3WA 2XX0A 2YQGA 3L95A 1QSED 3D7PA 1OQXA 2VDLH 4Y0GA 3FO0H 2FYVA 3V7AG 4XBPA 4I0PB 2N0KA 3NCBB 3S37H 1P6WA 4PHZA 4X8JA 4APXA 5J3HD 1CURA 3FNKA 3PWJA 5EFIA 4UQCA 3E6FA 4B0MM 2PETA 1ZLWH 4DTGH 2DPKA 4Y4KA 4F2ME 3D18B 4MTMA 3B2UC 4NNXA 4JO4L 5J1AA 3IPFA 3EAKA 5D1ZA 1S3KL 4LSVH 3FUFA 5DD0L 3CFKB 2ZONA 1MAJA 2XX1A 4K7FB 4K7PY 3IPBA 3OTTA 1AI1H 3J07A 5LDUA 3Q5TA 4GW5A 3ARGD 3PL6A 4DGVH 1WEJH 5CSBA 1T20B 2A9AA 5KVFE 4POYA 4FG4A 3S2CA 4RH4A 3QQ9D 3TO2A 3ET9F 3HHRB 2X4OB 4QT5B 2ZUXA 2YUWA 1NCWL 4X9GA 3NN8A 4JO4H 3O6FC 1NAMB 3OHXC 2ZF8A 2DJ4A 4QXUH 5DD0H 2CA4A 4U33A 2ARJB 4BH7B 3BUQA 3D4ZA 1CVSC 1KY7A 3CZFA 2K6ZA 4LLYA 1L3NA 4GLRH 3MFFA 1AGCB 2AZAA 1AZBA 4QXWA 5DTFA 2QHLA 1MIMH 1TETL 4X7DC 3T8XA 2WNXA 1EXUA 2OA9A 4DOHE 2WLMA 3FT9A 5GZOA 4UIMB 1NBCA 4Q6YA 4DFHA 1AO7A 3CN4A 1F42A 3K3QA 3MRFA 3FU8A 4JRYE 3TBBA 4HPOH 1DQKA 3LV3A 3WS3B 1Z9SA 3IYLW 4ZD3L 4XB8A 4P3DB 3DMMB 3B4NA 1I9JL 1PG7L 3FSZA 4RBPH 3SD5A 2ZCKL 3O3DA 2DEWX 2CLVB 4L48A 5I6MA 4GEIA 1TETH 3ISRA 2MCMA 3QEQE 4H26A 4E36A 3N85L 4F8NA 3DSNA 2K0RA 3KS0J 1E4WL 1VFBA 4UCFA 3O4LA 4NKDB 1HXYA 3T2LA 4PVBA 4GAJL 3DUSA 4JM0A 3GSQB 1OSEA 3GSUA 4Z76B 3QZWA 5HYJE 5MERA 4DZ8A 1L0PA 3KPRB 1LVEA 4NIYE 2FGZA 3GRWL 1DDHB 1I9JH 4NC0B 5CEYA 1F02I 1U8MB 1NGPL 5C0FB 4NQUA 5IY5B 4Z3TA 3SDDA 3VFNB 1U30A 2VSCA 3GLAA 3CN0A 5I1KL 2UZYA 1DVZA 4A68A 5C0BD 5C0AA 2VR6A 3OG6B 4OCLC 1W0WA 4HLEA 2CR6A 3ZL1A 1IIKA 2XQBL 5FO2A 4Y19B 2LU3A 3K6SA 3DLQR 3G5VB 4OQTA 3SBWC 1YUHB 3GI9H 5ESQA 1MCFA 3G08B 2YPLD 3PCYA 3SCMA 2BSRB 3B56A 2YOAA 4PYGA 5GPRA 1ETJA 3GRWH 4WY7H 5TPWL 5LAPA 3RL1B 1P1ZB 3UJIL 2CRMA 1WZAA 4FI6A 4JHWH 4XAKE 5I18L 1JZ7A 2Z7UA 1XB3A 1R5VB 1I1FA 2UVEA 4AENB 5F9WC 4LVHC 3I6GA 1D7FA 1CT8A 2PF6A 2WM0A 4ZUTA 1EEZA 2XQBH 1MI5B 4OD3L 4YXKH 3FT3B 3LPOA 1KPUA 1U8HB 4JZOB 1XSOA 5FDYA 3LQAC 1A1OA 2OL3A 3OL2A 3R4DA 4R3SA 1MJUL 2FH8A 1FI8C 5JYLA 2WUBL 4NRYA 1WBYA 2BMKA 1T2QL 1Q9LB 1AR1C 3II1A 2NY1D 1VLXA 4RRPG 4JK0D 5FM5M 1TJGL 2OMVB 5I8CB 5TPWH 4NO5A 5FXCH 6PAZA 5T3ZD 2A1WL 5DVPA 1DVQA 3D52A 3ARFC 3ECBA 1W0VA 4AQ1B 3SE8H 3VFVB 2CWRA 3DGGB 3MRPA 3DO7B 4ZNEE 1B4JL 4N8PA 5E5MA 2AQPA 1BHGA 2CLZA 3VG0H 4OD3H 5CEXB 1OTUC 1MCPH 1G1KA 4YL4A 1U58B 4Z7WA 3MRRA 3V95A 3PPSA 4KI5F 1M9WA 3CUPB 1C16B 1QRND 2WUBH 5T3XL 1D6EB 1ZV2A 2PR4L 3QIBB 3VB9A 3O4LD 1XCTB 2GABA 4XMZA 3PWUA 3BZDA 1TJGH 2HYMA 2MQGA 4PJ9A 1OT1A 4BWUA 5BUAA 4R8WL 3GUTA 2WXHA 3O9WC 2CIKA 4KHTH 3R06B 2I7SA 3FULA 3O6FA 1KTRL 3N1FC 3OX8A 2GEEA 4JMXA 5H37H 3OHXA 2F08A 2NY4D 1B4JH 2DDQH 3ZE2B 4NKIL 3GMLB 3V7AE 1CU4L 3KLAB 1MELA 1CFBA 2F7QA 5JOEA 4Q97A 3P9LA 2HX8A 3CDFA 1NMAL 3IJHA 2BWDA 4X5RA 5B39G 1FYHB 3G6AA 2Y72A 1C5CH 3ETTA 4UOQA 4JPWH 5EOQH 5IB4B 3WI9A 3UTSB 1MG2C 2M2DA 4MGXA 1FA4A 4L4VA 1QMUA 4GRWB 4J2QA 3LPGA 4XNQA 4Y2OA 2E6PA 1GKEA 3DOSA 4UF7C 2BNQD 3BUDA 4QCIB 2G9KA 4PSPA 1IBZA 5CS7A 5DEGB 4KROC 2R4RL 4MJ4A 1A9VA 2XWEA 4RSYA 4IBQA 1G9HA 3ZQ9A 3DNKA 3D1MC 1FUNA 3QULB 3CFBA 1DQJA 2J8OA 4KFMA 1P1VA 2ESVA 2HKHL 3VXUD 3K2IA 1YEIH 4EQ3A 3NFNB 5SX5K 2Z0BA 2WZ5A 5E03A 5C0IA 3NCWA 5IFAH 3JZYA 2QTEA 5MP6L 4GS7C 4FYQA 3KXFB 1DSWA 4PM1A 4AYDC 3LN5B 4LLUB 5E56A 4BV1A 2MSPA 3EGDB 4JL1A 2VITA 1XCWA 1ML0A 2N01B 3VXMA 3RJDA 3QR1A 1JTOA 2QL1A 3AG4B 2CSPA 1JWMA 2IBBA 3CJJA 3GEWB 5AW7B 1WAAE 1WH0A 2APBA 3NZHL 3VSTA 5CEZD 2WBJB 2EQDA 4ALAL 4L8DB 3WKNA 1FVDA 4GRWF 1M57B 3T71A 5BS0D 3PGDB 4XP5L 1BG9A 2MJWA 3KLLA 1KNOB 2QBWA 4GINA 2V2XB 3W37A 2F53A 3O2DH 4Y7MA 5CSGA 1L5GB 3MV8B 2WXOA 4ZUUA 4CU8A 5DRZA 4MB5A 1CF1A 2NY6D 4U05A 5K69A 2MCPH 1GZHA 2ZCHL 4HIEB 3RDTD 1YPZE 4ZG1A 3PJNA 2OCCB 3D39A 4ZZFA 2W65B 3N9GL 12E8H 1RMFL 3V0DA 5C2UB 1K5NB 4MSWA 4Z3FA 4KTEH 3BN3B 5JOFB 1TPXB 1MLBA 4D0DB 4ALAH 1T0PB 1M7DA 5HPMA 4KQ4H 2ARWA 5C0AE 3SDAC 2A73B 3E1F1 4Z3GA 1AS7A 2LGNA 2VJXA 5IQ7H 4Z7UB 3WY3A 2BRQA 5I26A 2DQEH 2WLKA 1SJHA 2CBPA 1A1MB 1F4YL 3ARFA 4FA6A 2ALAA 1DLHA 4U6TA 1BP3B 4QHMB 3NESA 4HS3A 2X4RA 3MCG1 4QHUA 3KVDD 4YDKH 3EXJA 4I13B 3ZZ1A 2HKFL 2D0FA 4GNKB 4PJ5E 1E9QB 1Q0YL 1SYVA 4PWJA 5E4EC 5SX4H 2F8VA 2XIDA 3EOAA 3FN3A 3OAUH 4JBSA 4NKMB 4XH2A 1K3ZA 4WFED 3K6FA 3PHOB 4WIQA 3T2PA 3TN0B 2X38A 1O6TA 2BHZA 3US0A 4XMKH 5BCAA 1PLCA 5ITFB 2WQRA 1Q0EA 1G9ML 3O9WA 4M8RA 4MAYB 2WJ5A 1V05A 4IBLT 2ID5A 3T2NH 1PY0A 1AKJA 4WNSA 2JCCB 3AU1B 4X5XB 5D71H 2BSTB 2H1LM 4ZOCA 4OZFG 3AB0C 4ZW3A 1E8ZA 3FQWB 5DJ2A 5D4HA 4KRMB 1EGJH 3C5JB 3DHJA 4P48A 5ILTL 5EN2A 4LLAA 3IXAB 1NMBL 1JYWA 3SKOB 5IREA 3TH4T 1GPOL 3AY4C 3MKKA 1FNHA 2IBGA 1NCCL 1KIUA 1BD2A 5A43C 4ISVA 2YMXH 2EIZB 3BDYH 4TNVK 4XPFL 4UQIM 1NBYB 3JTTB 4AKQA 3H56A 4DVBB 4P46C 2IWGA 1ERNA 4MJ6A 1ZT4B 4DKEL 3E80A 2WHVA 4QYOA 4YHZL 4HKBB 4X6CB 4GXUM 4U3XA 1KYOK 1J05B 4JR9L 4ZSOA 1UURA 1RSYA 2CJUL 4KKCC 3TX4A 4LGRB 5C0EA 4MJ5B 1P6FA 1S78D 1KFGA 3CD4A 1H3UA 1GGIL 3RIAK 2IDTA 4R90L 3KJ4C 2P3YA 4FYRA 4XPFH 4JRXD 1AXSB 43CAB 3US1A 4AEHL 3EYOB 4L9DA 3MGOA 3TESA 1R3LA 2HJLA 3RTQD 4X4MA 3M17B 1NGYA 3LYRA 4D9LH 4UV7H 4L4VE 3BUTA 5ECJE 3BIKA 3WTWA 2R4SH 2EJ1A 3RWCA 1JPSH 1XFPA 3D12B 4YXHH 2CJUH 2WLIA 3OKMB 3B8YA 2XG4A 5CNHA 5A6LA 1YMMA 2YD3A 4H8VA 4X7TB 5EUOE 5JDSB 3HG2A 3DHPA 3GS0A 3TIEB 1ED3B 2LTQC 4N0CD 2FQGA 1LNUA 1G7JB 3QO1B 1IM3B 2D0GA 3BFQG 4DK6A 4YBQC 4AEHH 3BHBA 1HL5A 3D85B 4YHML 1F8TL 4Q4IA 2DICA 1TXKA 5MHSD 5BZWB 4ZFFA 4ADIA 3MXVH 3D4CA 1MCLA 3V4PA 2IQ9H 2X4QB 3JXAA 4U1KB 2O5NA 2D3LA 4CW1A 1AYOA 1D9KC 3WN5B 1CFTA 2B15A 5LCVA 5IMOA 4JGJA 3UTZA 3AXLB 5IK3B 4E5XA 4X6BB 4QRPA 5SWZE 2YD5A 1ZANH 3MLRH 4QRFA 3VXSB 3SDAA 4HKXB 3MLPA 3BKYH 4M61A 4X99B 2Y06H 3MCKB 1F0LA 2D7TL 3STZB 1FV1B 1ZLUK 1EEQA 5JW3L 2J7LA 2CCVA 4G8IB 4F9PC 2OXHA 4UOJA 3HE7B 1ZRUA 3O6ML 4QHLB 4N8VA 4YSDA 5EOCH 4G5ZL 3VXPB 3RGVB 5KN5A 2NX5E 1BIHA 1JYXA 4M4RA 3UAAA 3TIDA 3D3VE 2DI7A 3QCUH 4LVNB 1WLHA 1TTBA 2LABA 3PF2A 4YHPA 3T09A 1WFMA 2COQA 3KGRA 2NY3B 3LSOB 3QIWA 4PJDB 3S35X 4NZTH 2DZEA 5JW3H 1OSZA 2IPKB 4YC2C 4JG1L 5GGQH 2D7OA 4BFBD 5CCJA 1U8KB 1CMOA 4KO5A 1E9PA 4PU2A 3CCHA 3L5XL 5E4OA 1KJVB 4FHKA 2QPFA 5F6HJ 1CFNA 2CMRL 3MNZA 3X11B 3QDJB 4PV1C 2ENQA 3U30C 3K1DA 3WFDL 2AF2A 2VLRA 3P0YL 5EO9B 3ZKXC 4AUYA 2VXUH 1SN0A 2K9UA 4TUJA 4KXAA 4S1DC 1HSAA 4ODUB 5TE6H 1A4JA 4MA7L 4CSZA 4EXPX 2YD4A 4UUJA 4ZZKA 2F54E 2GIYA 1HWWA 3AY4A 1ZAGA 4U7MA 3V0VB 5HHOD 2V5MA 3W57A 2PXYB 1HJCA 1E50A 1WITA 1CGSL 4AE0A 3MLVH 4GUPB 1BECA 3GS7A 3QFJB 4WW2B 2HG5B 4P46A 1TYRA 4DH2A 4OJAA 2MQ0A 4X4XA 3FRPB 3CVBA 1CE1H 5CZKA 4A2EA 5JYMA 1AHWC 4X6EB 4EBQL 3FMGH 4U6VH 4PJDF 1RH8A 1VDGA 4Q6IB 3IS1X 1OAYL 4D8PA 2DLIA 5E24E 3EJYD 4DQOL 3FCSB 5C86A 3ZYJA 5FECA 1N64H 3GO1L 3PAVA 2BO0A 3RY4A 3VE0B 1B2WL 4L3FA 1C5DB 1A6ZB 2P42B 3NG5A 4MJ2A 4N2FA 2JVUA 1NGXA 3I6LD 2YXWA 2CLRB 5ADPH 1EANA 2UXFA 2YKKA 2E4TA 1NKRA 2M26A 1V27A 1NCUA 3SDYL 1NAKH 1MW0A 5IB5A 1PKQE 3PYCA 3IE4A 5FK9B 4UDTB 3MRIB 4IMLB 4JPIA 4H8PA 5E9DE 2KL6A 4M8QB 3OKLB 3QRGL 2VE6B 4X6DE 5F88B 2Y6TE 3VNYA 1TQTA 3T0BA 1B2WH 4QY8A 1CFSB 3MRQA 5AZ2H 2E8YA 4OV6F 2UWEB 5MENA 4QXGL 4WW2F 1CFQB 5H35B 4GKZB 4L37A 1CBJA 3C5SB 5AD0A 2Q9OA 2CKBA 4NNYA 3WDHA 4Q4EA 3PXLA 1KTJA 2DLGA 4ZO8A 1MCQA 3MGAA 5F7NC 5JW5B 2VLRD 4X4ME 1OCOB 2K3TA 1X7QB 1E65A 1D9KA 3MRDA 4TSAL 3VXNB 3DXAB 3WL9A 3W56A 5FUCC 5DJCB 1MAMH 1A6UL 5AW5B 3EDEA 4PS4L 4O02H 2OJ1A 4H8WL 4HJGA 2G0KA 1RZPA 4Q9RH 4NXKA 3C8KA 4H20L 3IJYA 4G3YL 2B7DT 3MYJA 3K2KA 1HI6A 1D5IH 4LPVA 4KV5F 2QKIC 2KLSA 3KPNA 2Z31B 2V5SA 4F9PA 4HT1L 4FQ1L 2HT2C 4B60A 2ZKHH 4D0BB 1YRKA 5EC1B 1KN4L 2X4SB 2QZ5A 4TSAH 5EU5B 2QQLL 2R23A 2XLLA 2QSCL 3HZYA 5AOZA 1T5XA 1R4XA 3S98A 3ULSB 1CDUA 4QXTA 5LQBL 1UVQA 3NGBB 4AI7A 5AALA 1MQKL 4PJ8C 5F1SA 3V5DB 3NA4A 1LWJA 1T7YA 3BP7A 1PZ5B 3BZ4B 3HG1D 4G8FA 1LP9F 1H3PL 4J8RA 4A55A 3DETC 5F2FA 3KWWB 4XBEL 4AWJC 4JHAH 5DRWA 1OGAE 2JKRM 3NMEA 4HT1H 4MD5A 3U2SA 5ALBH 2YFNA 1GIGH 1QNIA 2PO6C 2IAND 3LKPB 1KN4H 1DUZB 2W60B 2H32A 3K2MC 1PMYA 2WYHA 4W9JC 1DJGA 2R56H 1IU1A 4R5VA 1GGTA 4GAFB 5CWSA 2YXFA 1ZTXH 4DKFH 1IT9L 4BRJA 1PFOA 1UM4L 3QDMA 3FKUS 4A39A 4RGOH 1JOIA 4HIIA 3MACL 1NBZB 5C07A 1IQDB 3GHEH 3B5TA 4PLKC 1H3TA 2ICCA 3QDGA 4JHBA 4WFHE 4L1BA 3ROOA 4Z77A 2FLBT 3PXHA 2KZKA 5DHYB 5C08D 4R7DB 3QNFA 1FFQA 3TO4D 2QSVA 2XZQL 4F80A 2BH0A 5EIQA 3WIHH 4TV3A 4HXAH 5E1AB 3BD3A 2ROYA 3KPOB 4JN1L 1KCWA 4AQZA 4NN5B 4F15C 2Y3AA 3PQYE 2Z0UA 5FA4A 1AHWA 1DN2A 2I69A 4JM4L 5ANMB 1DCEA 3CV5A 1RUQL 2BVQB 2J5LB 4NN7C 1KELH 5H37G 3WTVA 3ARDA 1E5BA 3REVB 3FU6A 3TFKC 3ECUA 2ZZUT 1MUJA 4EVNB 5J13C 4YSUA 4P2OB 2XWTA 3UYRL 5L4MA 5IVXF 1R3KA 3BXNA 3DVGB 2VLKA 4BM7A 5FLVA 4D9RE 4HWZB 2H5UA 1HCVA 2H0JA 3JTBA 2I9TB 5AVYB 4GB9A 3PAUA 3I6KA 1E5ZA 5KSAC 3BAJA 4ZOBA 3RUGA 1BQLH 4L3EE 2Y1ZA 3BLBA 4GBXC 4GG6B 5D1QD 5IF0A 5C0GB 4NCC1 3FRUA 2V6HA 5CJ5A 5KJRH 2MHAB 1MHCA 3BSHA 1P4LA 4LCYB 5HGHA 1ET8A 2HH0L 5KG9B 4TL4A 3UABA 3UYRH 4WDIA 1KTDA 4B9FA 3RVVC 2J4WL 5KVMC 1O6VA 3UTTA 2AK4E 4BEIA 4Z7NE 1FFOA 6CGTA 1BVNT 2YJLA 5JOPE 2CM5A 1OTSD 2JKWA 3KR3L 2XNAB 3UMNA 5KZCD 3U36B 1CFVH 1KCRH 3PWPE 4KKAD 3SDXA 3WTTA 1FIGH 4ZUWA 3QIUB 4Y16B 3RQ3A 3WO4B 1E28B 1QWHA 2FIKA 2PYEA 1XGZA 1TVBB 4JM2D 4HQQL 5HGDA 4F9LA 2OYPA 3WNNA 3DPDA 3VFPA 1BQHA 4QRRD 5B1BB 4ZO6A 3H9SB 4N26A 3DVNA 2ORBL 2J4WH 2SEBB 2VDMH 2O6CA 2YA1A 2QKIA 4PJEF 3WD5L 4POZC 2WTOA 4X50A 4YLQT 3NPSB 5EF3A 1P5UB 1XGQA 4MNHA 5EU6A 4OZIA 2PN5A 4NENA 1CYWA 3KYOA 3GRBA 2WWKT 1J1XL 2EYSB 1MFAL 4AV5A 4GG6F 3L5IA 1QSFB 5AWNL 3SBRA 5IMLA 2VJ0A 2DKMA 1HIMH 2FVNA 1IAII 1WD9A 1FQ9C 4NP4L 5E8NB 4I2XB 1GRWA 1NC4D 5GZNA 3MFGB 2FHCA 4N0UA 2ORBH 1BZQK 4MMXB 3CDGA 2DTSA 3PFUA 5DDHA 1J0JA 1GJWA 3O2DA 4MA8L 3WXVH 1CQYA 3WGUB 3U0TA 2EDXA 3D34A 1G6RL 1M7XA 2VZUA 5KSBA 3RPIB 1EWHA 2I60H 2PO6A 4BFNA 1BOGA 3WV0A 3UCQA 1GOHA 1VRSA 5C0CA 1E8YA 4XNUH 2AJZB 5GRVL 1FPTL 4FHJA 4HUWB 4AYEC 4LSQH 5DZAA 1EERB 3WMSA 4LEOA 5DHVA 5AL8A 5B4MD 4V1DB 2EIEA 2RTTA 3CC5A 5JHLL 5KYWB 2EDBA 4HJTA 2UVFA 2OI9C 1BIIB 4MA8H 1R3HA 1QSZA 2ZCLL 1BJMA 3UTTD 3VVWA 1QVOB 4HW6A 1RKRA 4PJBE 1QSEB 1H3VA 4TULL 1S2EA 5CJXC 4A7SA 3ALWA 2L04A 4WNQA 4C54A 1B9KA 4GRLC 2O30A 3OJ2C 3BP4B 3Q2VA 2WTPA 4JZJC 1A22B 1FDLL 3IB4A 3MNWB 1KLUA 4WW1A 1YCSA 2C9PA 5FEBA 4CKVX 1I7RA 4F8QA 1HEHC 1U42A 4FDWA 2BC4A 1BF8A 4M9PA 1P7KA 3NDYE 1A7RL 4EI6A 4M3HA 2AV1B 2ZCLH 3MREA 4FG6D 4YSSA 4AZ8B 4LU5H 4H25A 4U1JA 1ET7A 4DPAX 4HS6B 2QPEB 3QDME 1IZJA 1BVKB 4WHTA 4TL5A 5C07E 1TZIA 3AG3B 1UKSA 2FSDA 4UQDA 4LARL 4FQIL 3L4VA 3QQ4A 2HT4C 4XT1C 1KEML 1XF4B 4R4BB 4GBXA 4Y5YB 4WJKB 3P0GB 4X83A 1MY5A 2V2WB 3BUPA 4UINH 3QW9A 4HBCL 4F3FB 4PB9L 4RMTA 1T1ZA 4Z5RB 5AYUL 4FC3E 1EAPA 4JO1H 3ABZA 3MZTA 4DP9X 4XO3A 2ZXEB 4MXWL 2OMWB 2Y5TA 5HGAA 5H94A 1EFXA 4EI5C 1NEPA 4LVOB 1E3FA 4ODTL 2N0MA 1A7QL 3SHSA 1ORSB 5MEQA 5FGCE 1WD8A 3LRHA 1P6AB 3GPSA 2I7OA 4N85A 4EN3C 4XC3H 1FSKC 4ANXA 2R69L 3BEVB 4XPAL 2HG0A 4APQC 3Q1SL 2DMCA 3AS1A 5T3XE 2J6EL 3BLKA 1BOYA 1KCVL 5B1JC 1IGCL 5F9JA 1OF0A 1PQZB 3O6LH 5D8JH 1XZ0A 3I2CL 4ODVH 1F1DA 4XBPB 3MLYH 1PIGA 3TYGL 5HI5C 4WI4A 2FJHA 1RZGA 2BDNL 5T8IA 4APXB 4HD5A 1XF2B 2R69H 3PWJB 3E6FB 4XO8A 2QV4A 4L4TA 1OXYA 1Z5YD 3EOTL 5AKRA 5EC2A 4Y4KB 3UBXA 5AW1B 4KGJA 2VH5H 3H55A 3BVVA 3L3IB 5D1ZB 2FQDA 5EPMA 4NOFA 3SE4C 1TQWA 3EFFB 2EXWD 5CJBA 5GRXG 1RU9L 1IGCH 4JFFA 1A7NH 1E7VA 3TLRA 4B96A 2FO4A 5FUCE 4OR1A 3DX9A 4GW5B 1SVZA 1EVUA 5IQNA 5IWLC 3I2CH 5J11B 1OOWA 4AT6A 1KB9J 1JF5A 5F7WC 3FH8A 3D2UD 3TYGH 3TO2B 2ETWA 3T2QA 4TMPA 4NNPL 3VDCA 3GK8L 1ECYA 3U9UA 4NQSB 4XXDA 4OLZL 3CHRA 3ARSA 1SJVA 4MLIA 3NN8B 1ZLDA 4AE1A 1TQSA 3BWSA 2Q3AA 3MYZA 2UYLA 1Q4NX 3CZFB 4YDVB 1LO4L 1RU9H 2O5XL 3HC3L 3IN0A 4M43L 4OI8A 1J9RA 1GAFL 4LLYB 3KH4A 3VGGA 5KUKA 3CVHL 3MFFB 1W2KT 4OM0L 5I1IH 2P5ED 2XI9A 3QRFM 2HJKB 1EXUB 4UNUA 4N0UE 1I75A 2B4CH 1A3LH 3GK8H 3VTAA 1N12A 2KUTA 1AO7B 3FUDA 5CJXA 5DUPH 1WV7T 3OXSA 3BKJH 3GXUB 4GRLA 5KS9A 3CMOL 2UZPA 4M1GL 5IESH 3QA3A 5DJDA 5FUZL 4JZJA 5L8LB 2VKWA 2DIEA 4I77H 2O5XH 3CU7A 1WIPA 5DVKA 2YIHA 5DYOB 1LEGB 2CPUA 3CVHH 3O3DB 2WZPA 2BVTA 4OM0H 3VFRB 3MUY1 1TJIL 4N0RA 1QLRA 4AG4H 5IQLA 2EUZA 4TVSa 5C3IA 2R39A 4H26B 4RIRA 3BPCB 2UZIL 2XOTA 1QRNB 3GMMB 1WAPA 1FORL 1IGML 4ODBD 1TZHA 4WKZB 3AW5A 3O4LB 5A6IA 4WNJA 3UGXA 3GM8A 2AAVA 4Y9GA 1O7DC 2WAQA 3QZWB 1JPST 4AXWB 5IVOA 3IDMB 4RWYH 4RFNC 3BUBA 5CEYB 2WANA 1P7QD 4BFEA 3SDDB 1OL0A 5F1KC 4NB7A 4XI5D 1ESOA 3RNQA 1J0KA 3FYEB 4JFFD 5DQ9A 2UZYB 4WUUA 4XNZB 5AKVA 4JDTH 3S36L 3BE1L 3LZLA 4XGZB 1W0WB 2UZIH 2QFPA 3ABKB 3T3PE 4LAJH 3VG9C 4KAQH 2BHYA 4Q58C 1HYSD 2HT3D 1NSNH 2WLHA 4EI5A 5KYXA 1GA2A 3K6SB 3BKCH 3OAWA 4ANUA 5ESQB 4LF3A 2PCXA 3SCMB 3F3HA 1BFOA 4EN3A 5JW4M 2CCLA 3VI4A 4DAGL 1IGTA 4M93C 4W6XB 3KLHC 3VFMA 3MRLA 3G7TA 1IVTA 3RVXC 5I6OA 3VMOA 2R0WH 4NEHB 4FXGC 5B8CC 1WA0X 5IHHA 3EKCA 2CR0A 3HUJA 1CT8B 1S7VB 2IADB 1A9BA 4ZUTB 3FQ2A 4FP8L 4P3CH 5BMFH 5B1JA 2VDKL 1KPUB 5CU5A 3VO0A 3UTOA 4CNIB 5JDJA 3HI1A 1A1OB 2OL3B 3R7RA 4FNSA 3VXUB 4KRPD 2VDRB 1WBYB 3QGVA 5DLML 5LBGA 3VACA 5EBMA 4XOCA 1RZ7H 2HCZX 1F4AA 4DT2A 4FQLL 4M7ZB 4NO5B 4OTXH 2IDSA 3B7TA 1U8JA 4O58L 5I6PA 5IW3A 5HHVL 1BA9A 2NYYC 3C2AH 1JYNA 3ECBB 1ZY9A 3VD1A 1LO5A 1ASQA 1XH3B 2CO1A 1FGVH 5I5MA 3JYCA 5D5MA 1B88A 1IAIM 4ANKA 5E5MB 4M7LH 4NC1C 4M02A 2QQQA 5AW4B 3B6SA 1MAKA 3KBEA 3MRRB 4U7KA 4KWUA 4BXSV 5EUKA 3CBJB 4Z7WB 5IWLA 5FHBH 2HTKC 1NBQA 4MQSB 4TVPL 1NBVH 2IXQA 1FZMA 3PWUB 2W8CA 2ISDA 4KO6A 4PJ9B 3DECA 4HJ1A 4FQLH 1URLA 5IBLD 5BS0B 3GUTB 1U8OA 3RVUD 3ECVA 5I30H 2NDGA 2KDYA 5F7UA 5HHVH 4LHUG 3C5ZD 3L4YA 5I6NA 4W70A 4JAMB 4O02A 3O6FB 2ILLA 3O41A 1T1YA 2VXTL 2VW7A 3OHXB 4ACTA 4DNLA 4X8XA 1HOEA 3WEXA 4HJ0C 3H9YA 1WJ3A 4IK7A 2BM3A 2NY6B 4QRSA 3E0GA 3RDTB 4BK5C 4E41A 1QI4A 2KLRA 3P9LB 4M1DH 3AQZA 4OZHA 5HJBA 1BWWA 4UDUB 3WKMH 4N2AA 5ICYB 3CK0H 4OJFL 3RZCA 3G6AB 1KOAA 2Q8BL 1NIEA 1FGNH 1UB5A 2LLLA 3FFCE 2WLJA 1XR8A 2FATH 2ADJA 4L1HA 5IMMB 4EZMA 5E2VL 2AMGA 1X5XA 2J44A 3I75A 4Y2OB 1XEDA 3ZHKA 1LO2L 2VQ4A 4UAHA 4R96A 4FFVC 3SKNA 5AOJA 1BAFH 4PRIA 4RGNC 1GY2A 3PS6A 4F33A 3WLBB 1OHZA 1IFGA 2WV3A 4JPQA 4Z7WF 4BINA 1FJ1B 3CVIL 2WOBA 3F84A 5T5NF 1TQCC 4A67A 4YEEA 3A6OA 5DC9B 2WQSA 3HPJA 1JVLA 3UAJD 2G0LA 1O0VA 1JXFA 3N06B 3BT0A 5C0IB 1MFVA 3F58H 2WKLA 4HIJA 4WCYL 5C7XL 1A02N 1F4WH 1KG0A 2YQ2A 4JHZA 1T7XA 3EOYG 4EDXB 2AXFB 2HMIC 4XPHL 1Q38A 2SODB 1CGVA 2Z7WA 3KHQA 1JBJA 1T03L 3I50H 4EMZA 1MW1A 3CVIH 1G0DA 3INUH 4YLCA 1WDAA 1XV8A 4UIKL 2DKUA 2X87A 3JWDH 4JRYD 2N7SA 1BCIA 3U7WH 1KPVB 5FFLA 4YHKL 4K9EH 2XJKA 1DO5A 3L3KA 4IRZH 4P04A 3FTUA 4F7EA 2AKRB 4NUGL 4HFWA 3GBML 3PP3H 3CGTA 4ZAKC 1NOAA 3WFEL 4CGUB 2VDPL 4KY2A 4N9GA 5F71A 3VXQA 2F53B 3IXTA 3MOBH 3QEQD 4J3WA 5DF0A 4U49A 4ZUUB 1RUKL 2VR5A 5DRZB 2YAOA 4FXGA 1S5IH 5B8CA 1BZ7A 4NZ8A 4PY7A 4WHYH 4BCXA 5CSZA 3D39B 2KPWA 3NSYA 3C8DA 2CQVA 3DV4A 2ZSVA 4K8RD 4YHKH 1XGPA 5G4OA 5HYJD 3TA3D 3GRGA 2IMMA 3N0PB 2CGRL 4WUUE 4NUGH 4YL9A 3U6XA 4ES9A 4KK9D 5HYSA 4U1MA 3L54A 1FFNA 5AB0A 5J57B 1AR1B 4OGAD 3NIFE 4OF3A 3LB6C 4JRXB 5JMRA 3MRMA 3NP4A 1CE6A 1M6UA 1W15A 3I9IA 3LY6A 1FNSL 3HLAA 4BQ6A 3RTQB 2LFEA 3WEOA 3P30H 3WKQA 1DLHB 3E8VA 5HHXH 3EYSL 2DQIL 5DCCA 3QJHA 2X4RB 4QHUB 1GVIA 2X4NB 5LB1A 4BE5A 2VR4A 1UM6H 1V7ML 1SYVB 5GGVL 3QJFA 3ULUL 2DQCH 4BH8B 1GZPA 3RWJA 3ZE1B 3ZW3A 3FH5A 2IAAC 4XTRD 5LHDA 2OMZA 4A63A 3UJJL 1YN6A 2WLZA 3L4TA 3Q43A 1WWWX 4PN6A 1J5HA 2FUQA 3LRSB 4B6ZA 4HIPA 4W9DC 1TG8A 4XCFH 5I6KA 4JEGB 3PDOA 4WI9A 1MVYA 5DUML 1WZLA 1CJYA 2ICWB 4HAFA 1YECH 4N1HB 1V7MH 5EIIG 5DJ2B 5GGVH 1L0YA 4BK5A 2X4PA 2X28A 5I6LA 4QR7A 1EHXA 2DQGH 1JZ3A 3ZY7A 4WU7A 5EN2B 5CP3A 4P9ML 2YSSA 3OVUB 1HHGB 2H41A 2CHWA 1FH2A 4JY4B 2OSXA 4PJHE 3ZX1A 1U0QA 1KIUB 4ISVB 1X7TA 1BBDH 2CK2A 2PCYA 1SHSA 4LAQH 1BEYH 4JFDA 2MTAA 5DUMH 4MJ6B 4QJ3B 5FKPA 1T5KA 2YA2A 1VKXB 4P5SA 3RURA 1DBMH 4KROB 4TQEL 4QYOB 1UACL 2BSSB 1JF6A 1MJ8L 3IU4L 1G7PB 1ZHNB 3N42B 4MS6A 2F1EA 3BQVA 3FQXB 3LS4H 5ICZA 5C0EB 2DM3A 2XV2A 3D6GA 1Z3GL 2RHEA 4FERA 4JDVB 3ZMNA 1CD0A 3LAFA 3TURA 2NQ3A 2VLME 2ZOOA 4AGNA 1KGYE 2KHAA 4OZHE 4AQ8C 3O8XC 2H45A 4EOWL 2VUYA 6FABL 5DMKB 1EUUA 3M1CA 2V9QA 2EE6A 3X3FL 3MGOB 3WXWH 4LP8A 1RZJL 4PJGB 1DQDH 1NGYB 3QPXL 4YZFE 3QI9C 1UWEH 3TF7C 1UACH 1CXHA 2AJ3A 2F18A 2PP9A 1C12A 4PS3A 2ERJC 3RWCB 4TPRH 4CSPA 1OD9A 2WLIB 2GBUA 2NY2C 2B4CC 1DVFD 2WXPA 4JJOA 1YMMB 3RBGA 2QHRL 5ACLA 3RA7H 4PRIE 3U9PH 1E42A 3ZO9A 1CBVL 4OLYH 4LOFA 4GQQA 1HVXA 4RX4A 4EOWH 3O2VL 2IFGA 1QFUL 4ZAKA 5C1MB 3BHBB 5ITBH 4I1NB 2R83A 4MS8C 5HHOB 1II4E 1N2RA 2WXNA 3QPXH 2ITCA 4DUXA 5IQ9A 4I4WB 3RE0A 4TQ8A 3MUHL 1T21A 25C8H 4YFEA 3VDBA 3ZL2A 2NXYD 5JIHA 3VWKA 4X6DF 3UZVA 4HS8H 4UTBL 2WNWA 4N1CA 3FTZA 4N6QA 3DOHA 1Q90A 2G60L 4WK2B 4EUPH 1AXIB 1S6NA 2GSGB 1CFTB 1I9RL