4BD1A

Neutron structure of a perdeuterated toho-1 r274n r276n double mutant beta-lactamase in complex with a fully deuterated boronic acid (bzb)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neutron and X-Ray Crystal Structures of a Perdeuterated Enzyme Inhibitor Complex Reveal the Catalytic Proton Network of the Toho-1 Beta-Lactamase for the Acylation Reaction.
pubmed doi rcsb
molecule keywords TOHO-1 BETA-LACTAMASE
source organism Escherichia coli bl21
molecule tags Hydrolase
total genus 94
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4bd1A00
3ITAA 2Q9MA 4N92A 4S2MA 1NY0A 1LLBA 3BFCA 4R4RA 2QMIA 5DF8A 4KQQA 2ZD8A 3C7VA 3HLBA 5A93A 1MKIA 1LL9A 2XGNA 3GQZA 3MKEA 3G2ZA 1ALQA 2ZC4B 3Q1FA 2HPBA 3HVFA 3IT9A 3DW0A 4GZBA 1XP4A 3GTCA 4OQGA 3TG9A 5IHVA 4JXWA 5EVIC 4L0LA 2OLUA 3AGDA 4EWFA 3AGFA 1IKIA 2JE5A 1CK3A 4LCLA 3ZG5A 4B88A 1ES4A 3SOIA 1SCWA 1KE0A 4OLGA 4ZJ1A 1RCJA 5DF9A 4DF6A 4HEFA 3O86A 4PM7A 4E6WA 3V50A 2Y2GA 3PBTA 3GV9A 1YLTA 1E3UA 1J9MA 3SH7A 3O87A 3WS0A 2XLNA 4GN2A 4MNRA 5FA7A 4CPKA 5TGFA 1YLYA 5HX9A 4KG6A 3PBNA 1TDLA 3Q81A 4ID4A 4KZ6A 3ISGA 4M3KA 3MZFA 2OLVA 3MXRA 2XK1A 5HL1A 3IHAA 3W8KA 4PMAA 5FQIA 2EXAA 4N9LA 1JVJA 2Q9NA 4X6TA 1YQSA 3UDXA 3GR2A 3UE3A 1WYBA 4E3IA 3IF6C 4GB7A 4Z9QA 2ZM0A 4WZ5C 3ZFZA 3SS3A 4NETA 5CEDA 5G18A 4EQIA 3UPPA 4NK3A 1DJAA 2WGWA 2WUQA 1K6SA 3VFFA 3WWXA 1BLHA 1FR6A 1W5DA 4FH2A 5J8XA 3ZDJA 1G68A 4GD6A 4UA7A 3O88A 1GHMA 2EFXA 5EVID 1FOFA 5CHJA 3WS1A 1XGJA 4WEJA 3UY6A 1JTGA 1DY6A 4GDNA 5KSHA 2X01A 3W4PA 3BLMA 1MY8A 1H5XA 3BFGA 3QNCA 4WBGA 4C6YA 1MPLA 1M40A 2A3UA 1KGGA 3OPPA 1KVMA 4RX3A 1H8ZA 1KDWA 3IQAA 3NBLA 3P98A 2FFYA 3OPHA 2JC7A 4X55A 4GOGA 5CTNA 1LHYA 3SS4A 5A90A 2VGKA 1GCEA 3HLWA 3OCLA 1PI4A 1VM1A 5F83A 2B5RA 3OCNA 5HAPA 3ZVWA 1JWZA 1W8YA 4DXBA 4OOMA 5E2EA 5DTSA 2R9WA 2XDMA 1IYPA 4U0XA 2Y2HA 3N8LA 1YMSA 3NI9A 1HVBA 1MWUA 3WRZA 4MBFA 5EVIB 1FCNA 4HBUA 3AGEA 3VP1A 2DCFA 1HD8A 2Y2OA 3LEZA 4S2KA 1K57C 4DE0A 3IXHA 5KSCA 2UWXA 3ZGAB 2PU4A 3DTMA 2PU2A 3G2YA 2ZC6B 4K91A 5HW3A 1FR1A 1YLPA 1LI0A 4OKPA 2XD1A 2Z2MB 5D3OA 2EX8A 5CGWA 4DRTA 3C5AA 1K38A 3PAEA 1ES2A 1KDSA 2HDSA 2ZQ9A 3VSLA 3G35A 1DJCA 2J9OA 3IXGA 1RGYA 1IYSA 2EXBA 3Q7VB 2XR0A 2ZQ7A 1CI8A 4XXRA 5CERA 3DWKA 5GHXA 4HBTA 4OVDA 1K54C 1KE3A 3BYDA 5AQBA 4FH4A 3IF6B 4WMCA 4DDYA 4S2NA 4LV1A 3IH8A 3ZNYA 4B4ZA 2HP9A 4Y0UA 3MFDA 2WKIA 1GHIA 1C3BA 4R1GA 2P9VA 3UDIA 3DWZA 2VGJA 4WYYA 4JXVA 5CXWA 4E3KA 4C3QA 1PWCA 5GLBA 5CHUA 1Y54A 1K56A 1K55A 3OC2A 3WS4A 4BENA 4S2JA 4BD1A 1ONGA 4X69A 3VFHA 3ZG0A 3VP0A 2CC1A 4OOYA 4S2OA 2C6WB 3S22A 3HUMA 4QY5A 1S0WA 5EOEA 2Y55A 1IELA 4E3JA 1XGIA 4KG2A 3BLSA 4LCMA 1O7EA 4K0WA 1IYOA 2EX6A 3TOIA 4JF4A 2GDNA 4YFMA 3Q7ZA 3ZVTA 5F1GA 1E4DA 3ZG9B 4RX2A 3PBQA 2ZJ9A 2RCXA 4LENA 2J8YA 4P0MA 3SH8A 5U47A 3HUNA 4XUXA 4ZAMA 2ZM8A 3HLDA 4P87A 3GSGA 1L0EA 1MBLA 3HLEA 5FASA 4Q8IA 4BQMA 3N6IA 1U60A 1JTDA 4KZ9A 1N4OA 5FATA 3HREA 2G2UA 3M6HA 5F1FA 1PW1A 2EX9A 2XEPA 5CTMA 4BL3A 2ZLYA 4R3JA 3G31A 1KVLA 3GRJA 4U0TA 5HAQA 2XFSA 4Y0OA 3W4QA 3A3JA 1PI5A 4B4XA 2HDUA 4E6XA 3VP2A 5HARA 3NC8A 4JF6A 5TFQA 1S6RA 4X53A 1BLSA 4WELA 1PZPA 3GVBA 2JBFA 1NZUA 1YLZA 3M2KA 1BT5A 5FAOA 3IXBA 4OOLA 4OQ0A 4KENB 4OPQA 4PPRA 2XD5A 4X56A 4JPMA 4PM6A 3OPLA 3MZEA 5A92A 1TEMA 5GHZA 5JYPA 3V5MA 2HDQA 2WAFA 3HL9A 4EBNA 1L2SA 3UPOA 2XQZA 4UAAA 5CECA 2Y59A 5FQMA 4OPRA 5F82A 1L0DA 3HUOA 1CEFA 1SKFA 1W8QA 2XF3A 3VMAA 3M6BA 4MEZA 4KQOA 4N9KA 2J9PA 5FQKA 3NDEA 5DVAA 5EE8A 3GMWA 5GLCA 4Y7PA 1ERQA 2J7VA 4PM5A 4E3NA 1RGZA 4Y0TA 3W4OA 3PTEA 3PAGA 5HAIA 4MBKA 4O7DA 1E3UD 3CJMA 4E3LA 1TDGA 1XX2A 5JYOA 1K25A 2E8IA 2Y2IA 4LV2A 1IYQA 5GHYA 1YLJA 5M18A 3IWQA 3JYIA 3N8RA 5E2FA 5TR7A 3RXXA 3WRTA 1ZKJA 1SDEA 3G34A 1NXYA 5GLAA 4OPYA 3V3RA 2WZZA 4JF5A 3UPNA 4FD8A 4E3OA 4P6BA 4GD8A 1ESIA 3C4PA 2RL3A 3IXDA 3LO7A 4JXGA 5FI6A 1WYCA 1E25A 3C7UA 4QD4A 3V39A 4ZBEA 1PW8A 1OMEA 1QMFA 3IHBA 4D2OA 1MWTA 4RYEA 2BG1A 3A3DA 5HFOA 4KZ4A 5FI7A 2BLSA 4ZJ2A 1BSGA 2Y2MA 2QPNA 1FCOA 5GL9A 4EV4A 1DJBA 5EECA 3G4PA 2G2WA 3FKWA 3Q82A 5EOOA 1HZOA 2P74A 1KGFA 3O3VA 4KG5A 1ERMA 5EUAA 5FAPA 5KZHA 1I2WA 1FSYA 3UDFA 1AXBA 3UE0A 4JBFA 1CI9A 1KE4A 4OLDA 1FCMA 1MWSA 2I72A 3RXWA 4PM8A 4PM9A 3G30A 2HDRA 1K4FA 3PBSA 5DTKA 3NIAA 1L0FA 2XFTA 2V20A 4OP5A 5DF7A 4JXSA 3C4OA 1W79A 4LV0A 3BEBA 3OPRA 3BFDA 3WS5A 1K6RA 3V3SA 4LV3A 1LI9A 4KZBA 5FQ9A 3RJUA 3BFFA 1IKGA 1ONHA 1VQQA 3MZDA 3UO9A 4YINA 5E2GA 1I5QA 4R4SA 2WGWB 3A3IA 1BULA 3FZCA 3E2LA 3TSGA 1YT4A 3HLGA 4KZ5A 1K55C 3LCEA 4WEKA 3ITBA 1GA0A 3PBOA 1YMXA 1ZC2A 4ZDXA 1TVFA 5FSRA 1Q2PA 1WE4A 4WZ4A 3A3FA 2ZQCA 3P09A 1NJ4A 1YLWA 3UE1A 3ZG7B 3D4FA 5EVIA 2H0TA 4OONA 1Z6FA 2ZM2A 1BZAA 1I2SA 1MXOA 3VP4A 4UA9A 2WKEA 4IBXA 4KZ3A 1JWVA 4UA6A 5E43A 4N1HA 4R23A 2H0YA 3B3XA 4IBRA 5EVLA 1H8YA 1XKZA 2WKHA 5BOHA 2WYXA 1EROA 4DE2A 1ES3A 1FSWA 4H8RA 1XPBA 2DNSA 4HESA 4DDSA 3HBRA 5E2HA 1BLCA 1W7FA 3VOYA 1YM1A 1RP5A 3Q7VA 4XUZA 3NY4A 4N1XA 4WMCD 4S2LA 2Y2JA 4QU3A 1K4EA 4RVAA 4OH0A 1CEGA 4C75A 2V2FF 2OV5A 2ZQAA 3SH9A 4E3MA 1G6AA 3IF6A 3BRMA 2ZC3B 4OQHA 4BL2A 4WZ5A 5AQ7A 3FV7A 1K56D 1PYYA 3FKVA 5FQJA 2WZXA 1BTLA 5EPHA 4F94A 3BFEA 4U3TA 4KZ8A 4GNUA 2OSUA 2Y2NA 1L0GA 5DTTA 1KGEA 2X02A 3QNBA 5FQQA 3BECA 3M2JA 1LL5A 1PWDA 3G32A 3NCKA 3QHYA 3EQUA 3SS5A 5FDHA 2QZ6A 4QHCA 1O07A 2ZC7A 2WGVA 3ZNTA 4MBHA 4JKTA 4OPZA 1FQGA 3ZCZA 3S1YA 3N8SA 5FAQA 3IWIA 2EFUA 1ZG6A 2P9VB 2EX2A 2Y2PA 3N4IA 1SHVA 5M1AA 4FSFA 1NYMA 4R0QA 1NRFA 3VP3A 3EQVA 1N9BA 1GA9A 1GHPA 4BD0A 2IWCA 5AQAA 4GKUA 1BLPA 3S4XA 4EBLA 4JLFA 2IWBA 4EUZA 4DKIA 2IWDA 3A3EA 1IEMA 3CG5A 3FYZA 4DE1A 2ZQDA 4QJGA 2C5WB 1PWGA 3HLCA 3MBZA 5A91A 2ZMAA 2R9XA 4S2PA 2HP6A 1K57A 3CZDA 2Y2KA 3HLFA 3WS2A 4WM9A 4IVIA 1XXMA 3ZG8B 1NZOA 4MLLA 1JWPA 4GDBA 5KMWA 4UHUA 4DE3A 1MWRA 3I7JA 4RA7A 3UNWA 4BJPA 3MXSA 4CJNA 5AQ9A 3CMZA 3N7WA 3IH9A 2ZC5B 3PBRA 4P85A 2PBYA 2V1ZA 2DRWA 4QB8A 1EWZA 2WGIA 4QY6A 3BM6A 1PZOA 1PIOA 3IWOA 3VSKA 5CHMA 5CEBA 5L2FA 2Y2LA 3E2KA 2HP5A 3Q07A 4IEDA 5FI2A 4X68A 1K54A 5M19A 1XA1A 4KQRA 2FFFB 3NDGA 5CRFA 1BUEA 4FCFA 4R3BA 4KZAA 4BLMA 2H10A 1NYYA 1ZG4A 2WADA 2XH9A 4DXCA 1M6KA 2ZQ8A 1HTZA 4ZJ3A 2JCHA 5I94A 4S2NC 5CGXA 2A49A 2WK0A 1SDNA 4KZ7A 2Z2LB 1QMEA 4A5RA 2Y2QA 2Y91A 1ESUA 4ZTKA 3VOZA 3OZHA 2Y4AA 4EBPA 4OP8A 2H5SA 3UN7A 4K0XA 2X71A 3LY4A 4S2IA 1XA7A 3LY3A 1ES5A 1Q2QA 4IVKA 5GLDA 3MKFA 3IF5A 3FWLA 2WAEA 1EI5A 4OQIA 3ZHHA 5CGSA
chains in the Genus database with same CATH superfamily
4S2MA 1NY0A 1T18A 4KQQA 2ZD8A 5A93A 1KOUA 1LL9A 2PBDP 1FIKA 4NKPA 4E04A 2HPBA 5DFYA 5HD3A 2OOLA 3AGDA 4GCZA 3AGFA 4EWFA 2JE5A 1CK3A 3ZG5A 4B88A 3SOIA 4ZJ1A 4OLGA 2XA7M 4HEFA 1YPRA 4ETZA 3O87A 4M3KA 4ID4A 3ISGA 4B9OA 3IHAA 3W8KA 2O0YA 2Q9NA 1WYBA 1J3WA 4GJ4A 3ZFZA 4LGWA 5G4ZA 4EQIA 3UPPA 5EFWA 2WUQA 5J3WA 3E4QA 1BLHA 1W5DA 5J8XA 3ZDJA 1G68A 4GD6A 4WF0A 5EVID 1FOFA 3PXPA 3WS1A 4WEJA 3UY6A 2A24A 5KSHA 2X01A 1MY8A 1P97A 3OPPA 4RX3A 3NBLA 3IQAA 1UGUA 3OPHA 2JC7A 1S1YA 4L9GA 3OCLA 2YKFA 4BMWA 4DXBA 5DTSA 2R9WA 2XDMA 1IYPA 3WRZA 1HVBA 2HJEA 4HBUA 3VP1A 3ZGAB 2PU4A 4K91A 5HW3A 1FR1A 3C2WA 3RFBA 4ME4A 3MMHA 5KIZA 3C5AA 1K38A 3VSLA 2HDSA 1OTBA 1CI8A 4RQ9A 3DWKA 2HZ5A 1K54C 3S7PA 3T4QA 3BYDA 2OAP1 4WMCA 4DDYA 4S2NA 3IH8A 1GHIA 3UDIA 2KLIA 5HL6A 5CXWA 3EEHA 4E3KA 5CHUA 3WS4A 4S2JA 4BD1A 2JKFA 4ESPA 4QY5A 3MQ0A 1JNUA 1LSVA 3LYXA 4E3JA 4KG2A 5IT5A 4LCMA 4JGPA 1IYOA 3Q7ZA 2KX6A 3ZQ5A 5F1GA 1VEUA 4JGRA 2ZJ9A 3CUEC 4HH3A 4LENA 3JVUA 4EESA 4O8GA 4ZAMA 1MBLA 3HLEA 5FASA 3E4OA 1VHMA 5F1FA 5FATA 1N4OA 2G2UA 2EX9A 4BL3A 2ZLYA 1KVLA 3GRJA 4U0TA 2XFSA 3W4QA 5L09A 4NXBA 4BWIA 3B33A 4JF6A 5TFQA 1BLSA 2M7VA 4WELA 1F98A 3GVBA 1TS8A 2R78A 4UQIM 1TD5A 4OQ0A 4X56A 3HJKA 2XD5A 3OPLA 1TEMA 4LRZE 1L2SA 3UPOA 2XQZA 4UAAA 3BJNA 2W1RA 2Y59A 3HUOA 1SKFA 3VMAA 3M6BA 2Q0OA 4N9KA 1W63M 3TE8A 2XRNA 4DN0A 3B47A 2J7VA 2QYBA 4EEUA 4Y0TA 3PTEA 4O7DA 4Y2FA 1XX2A 3UB9A 5LBRA 4LV2A 1IYQA 3G6OA 3JYIA 1ZKJA 3V3RA 4OPYA 4E3OA 2XROA 1XFNA 4GD8A 3IXDA 4ZBEA 3IHBA 3LIEA 4RYEA 2BG1A 3A3DA 5FI7A 2Y2MA 2QPNA 5GL9A 4EV4A 4NXFA 3VV4A 3CHWP 3O3VA 5FAPA 1ERMA 4NXEA 4Z1WA 4JBFA 1FCMA 2LB5A 1K4FA 4I39A 3PBSA 4BBTA 2XFTA 5DF7A 5AVFA 4LV0A 3BEBA 3V3SA 4KZBA 1X0OA 2W3FA 1IKGA 2V0UA 4YINA 4R4SA 1G5UA 3E2LA 3QP8A 3ITBA 1GA0A 5F68A 5MC7A 2HJ9C 1TVFA 1VETA 2A24B 3JPUA 1NRJA 2IA2A 2ZQCA 3MJQA 3D4FA 4OONA 3T4JA 1I2SA 1YKDA 4KZ3A 4UA6A 3B3XA 2Y8HA 1ES3A 1T1BA 3VOYA 1BLCA 1W7FA 3Q7VA 2VGLS 4N1XA 1K4EA 4OH0A 4I3AA 4C75A 2HF6A 2ZQAA 1G6AA 2ZC3B 4Q0IA 4EERA 2QKPA 1IFQA 4R38A 4U3TA 3ZYTA 2Y2NA 4MN5A 4GS9A 3DTKA 4WN5A 3M2JA 3T4KA 3NCKA 3QHYA 3EQUA 3ZNTA 4DJ2A 4OPZA 3S1YA 3N8SA 2J3TD 4Y15A 3N4IA 4BBVA 3H9WA 3T4LA 1GHPA 2LB9A 4GKUA 3S4XA 3QP2A 4EBLA 4DKIA 2IWDA 4DE1A 2PDRA 1PWGA 3HLCA 4S2PA 2HP6A 4X25A 2MJ6A 1XXMA 3E4PA 1GSVA 1VEUB 2PYPA 4CJNA 2ZC5B 4QB8A 3PBRA 2PBYA 1PZOA 2Y2LA 3E2KA 4IEDA 1F5MA 5HDDA 5M19A 3PHYA 5G4YA 4KQRA 4O0PA 3NDGA 5CRFA 4BLMA 1VB6A 4ZJ3A 1HTZA 1SDNA 1QMEA 4A5RA 1OTIA 4I3IA 3UN7A 4FUWA 3C30A 1XA7A 3IF5A 1AWIA 3DTIA 4CLCD 2PAVP 5CGSA 2W3EA 2Q9MA 4LRXC 1UWNX 4R4RA 4EQ1A 5J7EA 3C7VA 4P6ZM 3GQZA 2PRFA 2ZMVA 3MKEA 3G2ZA 1OPXA 4GZBA 3IT9A 1LSXA 1XP4A 4OQGA 4JXWA 2OLUA 4LCLA 1CJFA 2VZWA 1KE0A 2BTFP 1RCJA 3O86A 3UMDA 2Y2GA 3SH7A 1YLTA 1J9MA 1H3QA 2XLNA 3A0RA 5FA7A 2FH5A 3PBNA 2O9BA 4KZ6A 3MZFA 2OLVA 4X6TA 4E3IA 4GB7A 4WZ5C 5G18A 1OTAA 1K6SA 4EXOA 3O88A 1GHMA 4GDNA 1V9ZA 4WBGA 1M40A 1KVMA 3RTYA 1KDWA 1IOUA 1XJ6A 2FFYA 2WKQA 3NJAA 4X55A 2VGKA 5F83A 1W8YA 4CLCC 3QP6A 1VETB 4U0XA 1OJGA 3NI9A 1MWUA 3F1PA 4QPRA 3AGEA 2DCFA 1HD8A 3LEZA 4S2KA 1K57C 4DE0A 2PU2A 3W2ZA 3V67A 2XD1A 1OTEA 2VX8A 2EWWA 1DJCA 3IXGA 5HSQA 3Q7VB 2EXBA 2XR0A 4XXRA 4UEYA 3L7HA 1OT6A 4HBTA 1UWPX 1KE3A 4R70A 3KO6A 4O01A 4FH4A 1ACFA 4B4ZA 4L9EA 2NUPC 1PFLA 3LUQA 4I5SA 2VGJA 3MR0A 4JXVA 3R4KA 4C3QA 1PWCA 5GLBA 1Y54A 3CI6A 4GS9B 1K55A 4BENA 2VV8A 1EW0A 4X69A 2CC1A 1IELA 1XGIA 5HDSA 3BLSA 4K0WA 2VKSA 3CWFA 3ULFA 4JF4A 2GDNA 4PKYA 1E4DA 5CX7A 2J8YA 4HNBA 3LR4A 5U47A 3HUNA 2EA9A 3GSGA 3S7QA 4XT2A 4Q8IA 4BQMA 1U60A 1JTDA 4KZ9A 5HAQA 3KSGA 3LI8A 3OBFA 3A3JA 5HARA 3NC8A 1H0MA 1PZPA 3JVVA 2L1MA 1NZUA 1YLZA 3NOUC 3M2KA 5FAOA 3IXBA 4OOLA 3VOLA 4BBUA 1NWZA 1P9WA 4PM6A 3MZEA 4H6JA 1ZTUA 5CECA 4OPRA 5F82A 2ZBBA 3MSHA 2BASA 1CEFA 1W8QA 2XF3A 4I38A 4KQOA 2DMWA 1DP9A 2JKGA 5DVAA 3K3CA 5EE8A 4F3LA 4IUKA 4Y7PA 3E0YA 5EM0A 4PM5A 4E3NA 2O99A 3PAGA 1K0KA 1E3UD 4E3LA 5GHYA 1YLJA 3N8RA 3RXXA 2VV7A 4JF5A 4FD8A 4P6BA 3LO7A 2RL3A 4JXGA 2VV6A 5EV0A 1E25A 3C7UA 1OMEA 3NOTC 5HFOA 4KZ4A 3UE6A 3T1XA 4ZJ2A 1BSGA 1DJBA 5EECA 3G4PA 2O9AA 2G2WA 2V8FA 3FKWA 3Q82A 3E98A 1HZOA 5EOOA 1KGFA 5EUAA 1I2WA 5HZHA 4Y13A 3KSFA 3CPTA 4PM9A 5F69A 3UB6A 3T12B 5HWWA 3NIAA 4JGOA 3C4OA 4KUOA 3VE4A 3PR6A 4HOIA 1NLYA 1LI9A 3T50A 1ONHA 3T4SA 5E2GA 2PYRA 3TSGA 3BWLA 3LR3A 1XJ2A 2VLGA 1WE4A 3A3FA 1NJ4A 1YAXA 5EVIA 1Z6FA 2ZM2A 3S7NA 1MXOA 4UA9A 4B93A 3DBAA 5E43A 4IBRA 1XKZA 2WKHA 3DAVA 3HJIA 5BOHA 2WYXA 2YKHA 2A2LA 1EROA 4DE2A 1OT9A 1MKMA 2DNSA 3F1PB 4MN6A 5E2HA 3A0SA 4XUZA 3S7OA 4WUJA 1F2KA 4QU3A 2B18A 4HJ6A 4RVAA 1CEGA 3IF6A 3LFVA 3BRMA 4OQHA 1H8MA 3FV7A 1K56D 1PYYA 5FQJA 2WZXA 5IS1A 4F94A 3BFEA 4HP4A 1L0GA 2PD7A 5FQQA 2X02A 3IX4A 4L9FA 3SS5A 2M7UA 4QHCA 2WGVA 4JKTA 3KYZA 1FQGA 5FAQA 2EX2A 2Y2PA 1SHVA 5M1AA 3NOPC 4R0QA 3FG8A 5FL3A 4BD0A 5AQAA 4JLFA 5TBMA 1IEMA 3FYZA 3T4OA 2ZQDA 2C5WB 4YNRA 2R9XA 3B42A 4HI4A 3WS2A 4WM9A 3LR0A 1MC0A 1NZOA 1JWPA 1SZVA 5KMWA 4NEED 1MWRA 4DMZA 3UNWA 4XT2B 2VA0A 2W3DA 2L4RA 3IWOA 5CHMA 4KUKA 3CLOA 3HCYA 1ZG4A 4DXCA 1L3LA 1M6KA 2JCHA 2WK0A 2L0WA 2PHYA 2Z2LB 2VGLM 2Y2QA 3VOZA 2GZAA 3P7NA 2H5SA 4OP8A 4Y3IA 3NHQA 4S2IA 3IS2A 4H6JB 3FWLA 1PNEA 3ITAA 4N92A 1LLBA 5DF8A 5IU1A 3HLBA 1MKIA 3KYQA 4IJGA 2ZC4B 2H28A 3F1NA 3HVFA 3R7WA 4F3LB 5IHVA 1S4SA 2V8CA 1SCWA 2OAQ1 5DF9A 4DF6A 4PM7A 3PBTA 3GV9A 3MFXA 2D02A 4MNRA 4CPKA 4Q0JA 2W3GA 1YLYA 5HX9A 4G3VA 3Q81A 2ZL1A 5L07A 5HL1A 1W63Q 4PMAA 5TJJA 1JVJA 1YQSA 3GR2A 5HPIA 2ZM0A 3SS3A 4NETA 1DJAA 2WGWA 3VFFA 3WWXA 3UB8A 3CPTB 4UA7A 5FDSA 1JTGA 4HIAA 1P0ZA 3BLMA 3BFGA 3LEQA 3QNCA 4C6YA 4Q0HA 1MPLA 3EGDC 2P08A 1KGGA 4MCWA 4ARZA 5CTNA 4GOGA 3SS4A 3KSHA 1GCEA 3HLWA 2B5RA 3OCNA 5HAPA 1JWZA 5DJUA 5HWVA 4OOMA 1TS6A 2Y2HA 1YMSA 4MBFA 5EVIB 1FCNA 4EEPA 2Y2OA 5L10A 4MMNA 4HJ3A 3G2YA 2ZC6B 2VK3A 1T1CA 1GSWA 4OKPA 2Z2MB 1S66L 2EX8A 5CGWA 2B02A 4G3KA 4DRTA 3IX8A 3PAEA 1ES2A 1KDSA 2ZQ9A 1RGYA 2ZQ7A 2FZ0A 5CERA 5AJGA 5F5YA 4GW9A 4I3JA 3IF6B 4IHQA 3ZNYA 2HP9A 2WKIA 4R1GA 2P9VA 3DWZA 4WL9A 4WYYA 3C38A 4EETB 3OC2A 3D72A 2GJ3A 3BQ8A 4OOYA 2C6WB 3S22A 1S0WA 1CQAA 3TOIA 2EX6A 4YFMA 3CITA 5DKLA 4RX2A 3PBQA 2RCXA 3HLDA 4P87A 5TBMB 1YSPA 4HH2A 4IUHA 3N6IA 3LIAA 3HREA 3M6HA 5CTMA 2XEPA 2PD8A 3G31A 3MS6A 1G28A 2WKPA 4Y0OA 1PI5A 4NG2A 3NECA 1S6RA 4X53A 2K7SA 4JPMA 1S1ZA 5JYPA 4M4XA 2WAFA 3HL9A 1BYWA 1Y4OA 4MEZA 2PR6A 2V0WA 3NDEA 2JKRM 3GMWA 3NULA 3IS2B 3W4OA 3CJMA 1TDGA 5FEFA 5JYOA 1DP6A 1K25A 2E8IA 2Y2IA 5M18A 4CLCA 5GLAA 1NXYA 1XFQA 2WZZA 3UPNA 1ESIA 5FI6A 3F1NB 3R7WB 4CLCE 4QD4A 4D2OA 1MWTA 3H7WA 2D01A 4R6LA 2WKRA 3F1OA 2P74A 5KZHA 3IX3A 1TS7A 1AXBA 3A0VA 1CI9A 4OLDA 2I72A 2ZL1B 4PM8A 3G30A 4PKYG 1L0FA 4OP5A 2V9AA 1HLUP 1W79A 3OPRA 3BQAA 2OWHA 4LV3A 1YSQA 5FQ9A 3BFFA 3RJUA 3UO9A 3MZDA 5C5KA 4KQDA 2EWVA 1A0KA 2WGWB 3FZCA 2JKTM 4KZ5A 1K55C 3IBRA 5EM1A 5I5LA 2XSSA 2Z6CA 3UE1A 3ZG7B 3D9YA 2H0TA 1BZAA 2ZOHA 3QP5A 2WKEA 4ARZB 1JWVA 4LRYC 4R23A 5EVLA 1H8YA 1FSWA 4H8RA 4HESA 4DDSA 1YM1A 1RP5A 3NY4A 4WMCD 2V2FF 2OV5A 4E3MA 4GHIA 3RH8B 2M1CA 3T1SA 3U4LP 1BTLA 4KZ8A 2OSUA 5DTTA 1KGEA 3QNBA 3BECA 2HGVA 3G32A 4HY8A 3ICYA 5FDHA 2ZC7A 3IWIA 2EFUA 2P9VB 3MQQA 4FSFA 3GDIA 3VP3A 2XA7S 3K3DA 3GECA 3EEAA 1MZUA 2ACGA 2IWBA 3CG5A 4QJGA 3MBZA 5A91A 2JHEA 4MLLA 5HPFA 4MDZA 4UHUA 3UB7A 3FC7A 3I7JA 3IBJA 4RA7A 3MXSA 5AQ9A 3IH9A 4P85A 4ZDXA 2V1ZA 4QY6A 2DRWA 1EWZA 1PIOA 3VSKA 5CEBA 5FI2A 4X68A 1K54A 2FFFB 5HDCA 1BUEA 4FCFA 4R3BA 4KZAA 2H10A 1NYYA 1N9OA 2OWJA 4S2NC 1FILA 5CGXA 2A49A 4KZ7A 2Y79A 3EOIA 3LIFA 4EBPA 3BY9A 1Q2QA 4IVKA 5GLDA 5I94A 5A8BA 1GSXA 3BFCA 2QMIA 2XGNA 4PAUA 2AVXA 1ALQA 3Q1FA 3CUEA 3DW0A 1N9NA 3GTCA 3TG9A 5AVEA 4EU0A 3EWKA 5EVIC 4L0LA 2ZMFA 1SKOA 1IKIA 4Y17A 2GNXA 1ES4A 3EGXC 3SW1A 1XJ4A 2W1TA 4G3WA 4E6WA 1TS0A 4CLCB 3V50A 3QP4A 1E3UA 4QWOA 3WS0A 2W0NA 4GN2A 2CMNA 5TGFA 4II7A 1LL8A 4KG6A 1TDLA 4E6XA 3H7WB 3MXRA 2XK1A 5FQIA 2EXAA 4N9LA 3D3OA 3TW8A 3UDXA 4HQAA 3UE3A 3F1OB 2ZOIA 3IF6C 2E8JA 1PRQA 4Z9QA 3PYPA 2PT7A 5CEDA 1G6OA 4NK3A 3P01A 1FR6A 4FH2A 2EFXA 5CHJA 1XGJA 1DY6A 2B95A 3W4PA 1H5XA 2A3UA 4K08A 1H8ZA 3P98A 4FTXA 1P9RA 1LHYA 5A90A 5L8MA 3T1RA 1PI4A 1VM1A 3ZVWA 5K5BA 3OOVA 5E2EA 3N8LA 5KSCA 4UQIS 4NXGA 3IXHA 2UWXA 3DTMA 4MN7A 4YWZA 3SZTA 2JN7A 1YLPA 1LI0A 3OLOA 3H82A 1T19A 5D3OA 1S67L 2PR5A 2KDKA 4LFUA 3G35A 2O9CA 3BW6A 3T1QB 4D60A 2J9OA 1IYSA 2QJ7A 4CQHA 5GHXA 4OVDA 4R3AA 1OTDA 5AQBA 4GHIB 4LV1A 2W3HA 4Y0UA 3MFDA 1C3BA 3KX0X 4FOFA 1K56A 1D7EA 1ONGA 3O5YA 3VFHA 3VP0A 3MXQA 4S2OA 2HV1A 3HUMA 5EOEA 2Y55A 4LPZA 1O7EA 3MQOA 3ZVTA 5FEGA 3ZG9B 4X1LA 3SH8A 4P0MA 3LIDA 4XUXA 2ZM8A 1ZHHB 1L0EA 2K31A 1NLZA 1PW1A 4R3JA 3T4TA 4HHDA 4B4XA 2HDUA 2JKRI 3VP2A 3KYEA 5DFXA 2VJWA 4ETXA 2JBFA 1BT5A 4KENB 4OPQA 4PPRA 2QHKA 5A92A 5GHZA 3V5MA 2HDQA 4EBNA 4WLAA 5FQMA 2P04A 1L0DA 1OJ5A 5DJTA 3UMEA 2J9PA 5FQKA 5GLCA 3FPVA 1ERQA 2V1AA 1RGZA 5HAIA 1LT0A 4MBKA 2J3WA 5DKKA 3IWQA 5E2FA 5TR7A 3WRTA 3G34A 1SDEA 3LR5A 3C4PA 1WYCA 3V39A 1PW8A 2GX5A 1QMFA 5J4EA 1SKOB 2BLSA 3FPWA 5HWTA 2JKTI 1FCOA 2W1TB 4AFIA 1T1AA 4KG5A 4EUVA 2KOIA 3LICA 1FSYA 4HP9A 3UDFA 3UE0A 1KE4A 1MWSA 4YOFA 3RXWA 2HDRA 1XJ3A 5DTKA 2V20A 4JXSA 4LLOB 3K2NA 5HD5A 3CAXA 1CF0A 3BFDA 3WS5A 3LI9A 3KSIA 1K6RA 5F6AA 1VQQA 4Y5FA 1I5QA 3A3IA 1BULA 1YT4A 3HLGA 1ODVA 3LCEA 4WEKA 3PBOA 1TF1A 1YMXA 1ZC2A 3C8CA 1V9YA 5FSRA 1Q2PA 4WZ4A 3P09A 1YLWA 3UB5P 2QJ5A 3VP4A 4IBXA 4JGQA 2J3TC 4N1HA 2H0YA 1WA9A 2UV0E 3VE3A 3TJZC 1XPBA 3HBRA 4X1MA 4S2LA 2Y2JA 2I9VA 2V1BA 2INWA 3MF0A 3SH9A 2W27A 3H82B 3L9KA 4BL2A 4WZ5A 5AQ7A 2K2NA 4HJ4A 3FKVA 1Z09A 1N9LA 5EPHA 2J80A 4GNUA 1LL5A 4P6ZS 1PWDA 2QWSA 4EW7A 2QZ6A 1STZA 3QP1A 1O07A 4MBHA 3ZCZA 1ZG6A 1NYMA 2VEAA 1NRFA 1D06A 3EQVA 1N9BA 1D1JA 1GA9A 2IWCA 1BLPA 4GLQA 4EUZA 3A3EA 1F9IA 1S4RA 2ZMAA 1K57A 3CZDA 2Y2KA 3HLFA 2NUTC 4IVIA 5EVEA 3ZG8B 4GDBA 4DE3A 2G7UA 1DP8A 4ZRRA 4BJPA 3LGOA 3CMZA 3LIBA 3N7WA 4DJ3A 3ZG0A 2P7JA 3BY8A 2WGIA 3BM6A 1Y28A 3U2AA 5L2FA 2Z6DA 2HP5A 3Q07A 3TRCA 1XA1A 4PHTA 2WADA 2XH9A 2ZQ8A 2Y91A 3DTEA 1ESUA 4ZTKA 3OZHA 2Y4AA 1DRMA 4K0XA 2X71A 3LY4A 3LY3A 1ES5A 3MKFA 1LSWA 2WAEA 1EI5A 4OQIA 3ZHHA
chains in the Genus database with same CATH topology
3ITAA 2Q9MA 4N92A 4S2MA 1NY0A 1LLBA 3BFCA 4R4RA 2QMIA 5DF8A 4KQQA 2ZD8A 3C7VA 3HLBA 5A93A 1MKIA 1LL9A 2XGNA 3GQZA 3MKEA 3G2ZA 1ALQA 2ZC4B 3Q1FA 2HPBA 3HVFA 3IT9A 3DW0A 4GZBA 1XP4A 3GTCA 4OQGA 3TG9A 5IHVA 4JXWA 5EVIC 4L0LA 2OLUA 3AGDA 4EWFA 3AGFA 1IKIA 2JE5A 1CK3A 4LCLA 3ZG5A 4B88A 1ES4A 3SOIA 1SCWA 1KE0A 4OLGA 4ZJ1A 1RCJA 5DF9A 4DF6A 4HEFA 3O86A 4PM7A 4E6WA 3V50A 2Y2GA 3PBTA 3GV9A 1YLTA 1E3UA 1J9MA 3SH7A 3O87A 3WS0A 2XLNA 4GN2A 4MNRA 5FA7A 4CPKA 5TGFA 1YLYA 5HX9A 4KG6A 3PBNA 1TDLA 3Q81A 4ID4A 4KZ6A 3ISGA 4M3KA 3MZFA 2OLVA 3MXRA 2XK1A 5HL1A 3IHAA 3W8KA 4PMAA 5FQIA 2EXAA 4N9LA 1JVJA 2Q9NA 4X6TA 1YQSA 3UDXA 3GR2A 3UE3A 1WYBA 4E3IA 3IF6C 4GB7A 4Z9QA 2ZM0A 4WZ5C 3ZFZA 3SS3A 4NETA 5CEDA 5G18A 4EQIA 3UPPA 4NK3A 1DJAA 2WGWA 2WUQA 1K6SA 3VFFA 3WWXA 1BLHA 1FR6A 1W5DA 4FH2A 5J8XA 3ZDJA 1G68A 4GD6A 4UA7A 3O88A 1GHMA 2EFXA 5EVID 1FOFA 5CHJA 3WS1A 1XGJA 4WEJA 3UY6A 1JTGA 1DY6A 4GDNA 5KSHA 2X01A 3W4PA 3BLMA 1MY8A 1H5XA 3BFGA 3QNCA 4WBGA 4C6YA 1MPLA 1M40A 2A3UA 1KGGA 3OPPA 1KVMA 4RX3A 1H8ZA 1KDWA 3IQAA 3NBLA 3P98A 2FFYA 3OPHA 2JC7A 4X55A 4GOGA 5CTNA 1LHYA 3SS4A 5A90A 2VGKA 1GCEA 3HLWA 3OCLA 1PI4A 1VM1A 5F83A 2B5RA 3OCNA 5HAPA 3ZVWA 1JWZA 1W8YA 4DXBA 4OOMA 5E2EA 5DTSA 2R9WA 2XDMA 1IYPA 4U0XA 2Y2HA 3N8LA 1YMSA 3NI9A 1HVBA 1MWUA 3WRZA 4MBFA 5EVIB 1FCNA 4HBUA 3AGEA 3VP1A 2DCFA 1HD8A 2Y2OA 3LEZA 4S2KA 1K57C 4DE0A 3IXHA 5KSCA 2UWXA 3ZGAB 2PU4A 3DTMA 2PU2A 3G2YA 2ZC6B 4K91A 5HW3A 1FR1A 1YLPA 1LI0A 4OKPA 2XD1A 2Z2MB 5D3OA 2EX8A 5CGWA 4DRTA 3C5AA 1K38A 3PAEA 1ES2A 1KDSA 2HDSA 2ZQ9A 3VSLA 3G35A 1DJCA 2J9OA 3IXGA 1RGYA 1IYSA 2EXBA 3Q7VB 2XR0A 2ZQ7A 1CI8A 4XXRA 5CERA 3DWKA 5GHXA 4HBTA 4OVDA 1K54C 1KE3A 3BYDA 5AQBA 4FH4A 3IF6B 4WMCA 4DDYA 4S2NA 4LV1A 3IH8A 3ZNYA 4B4ZA 2HP9A 4Y0UA 3MFDA 2WKIA 1GHIA 1C3BA 4R1GA 2P9VA 3UDIA 3DWZA 2VGJA 4WYYA 4JXVA 5CXWA 4E3KA 4C3QA 1PWCA 5GLBA 5CHUA 1Y54A 1K56A 1K55A 3OC2A 3WS4A 4BENA 4S2JA 4BD1A 1ONGA 4X69A 3VFHA 3ZG0A 3VP0A 2CC1A 4OOYA 4S2OA 2C6WB 3S22A 3HUMA 4QY5A 1S0WA 5EOEA 2Y55A 1IELA 4E3JA 1XGIA 4KG2A 3BLSA 4LCMA 1O7EA 4K0WA 1IYOA 2EX6A 3TOIA 4JF4A 2GDNA 4YFMA 3Q7ZA 3ZVTA 5F1GA 1E4DA 3ZG9B 4RX2A 3PBQA 2ZJ9A 2RCXA 4LENA 2J8YA 4P0MA 3SH8A 5U47A 3HUNA 4XUXA 4ZAMA 2ZM8A 3HLDA 4P87A 3GSGA 1L0EA 1MBLA 3HLEA 5FASA 4Q8IA 4BQMA 3N6IA 1U60A 1JTDA 4KZ9A 1N4OA 5FATA 3HREA 2G2UA 3M6HA 5F1FA 1PW1A 2EX9A 2XEPA 5CTMA 4BL3A 2ZLYA 4R3JA 3G31A 1KVLA 3GRJA 4U0TA 5HAQA 2XFSA 4Y0OA 3W4QA 3A3JA 1PI5A 4B4XA 2HDUA 4E6XA 3VP2A 5HARA 3NC8A 4JF6A 5TFQA 1S6RA 4X53A 1BLSA 4WELA 1PZPA 3GVBA 2JBFA 1NZUA 1YLZA 3M2KA 1BT5A 5FAOA 3IXBA 4OOLA 4OQ0A 4KENB 4OPQA 4PPRA 2XD5A 4X56A 4JPMA 4PM6A 3OPLA 3MZEA 5A92A 1TEMA 5GHZA 5JYPA 3V5MA 2HDQA 2WAFA 3HL9A 4EBNA 1L2SA 3UPOA 2XQZA 4UAAA 5CECA 2Y59A 5FQMA 4OPRA 5F82A 1L0DA 3HUOA 1CEFA 1SKFA 1W8QA 2XF3A 3VMAA 3M6BA 4MEZA 4KQOA 4N9KA 2J9PA 5FQKA 3NDEA 5DVAA 5EE8A 3GMWA 5GLCA 4Y7PA 1ERQA 2J7VA 4PM5A 4E3NA 1RGZA 4Y0TA 3W4OA 3PTEA 3PAGA 5HAIA 4MBKA 4O7DA 1E3UD 3CJMA 4E3LA 1TDGA 1XX2A 5JYOA 1K25A 2E8IA 2Y2IA 4LV2A 1IYQA 5GHYA 1YLJA 5M18A 3IWQA 3JYIA 3N8RA 5E2FA 5TR7A 3RXXA 3WRTA 1ZKJA 1SDEA 3G34A 1NXYA 5GLAA 4OPYA 3V3RA 2WZZA 4JF5A 3UPNA 4FD8A 4E3OA 4P6BA 4GD8A 1ESIA 3C4PA 2RL3A 3IXDA 3LO7A 4JXGA 5FI6A 1WYCA 1E25A 3C7UA 4QD4A 3V39A 4ZBEA 1PW8A 1OMEA 1QMFA 3IHBA 4D2OA 1MWTA 4RYEA 2BG1A 3A3DA 5HFOA 4KZ4A 5FI7A 2BLSA 4ZJ2A 1BSGA 2Y2MA 2QPNA 1FCOA 5GL9A 4EV4A 1DJBA 5EECA 3G4PA 2G2WA 3FKWA 3Q82A 5EOOA 1HZOA 2P74A 1KGFA 3O3VA 4KG5A 1ERMA 5EUAA 5FAPA 5KZHA 1I2WA 1FSYA 3UDFA 1AXBA 3UE0A 4JBFA 1CI9A 1KE4A 4OLDA 1FCMA 1MWSA 2I72A 3RXWA 4PM8A 4PM9A 3G30A 2HDRA 1K4FA 3PBSA 5DTKA 3NIAA 1L0FA 2XFTA 2V20A 4OP5A 5DF7A 4JXSA 3C4OA 1W79A 4LV0A 3BEBA 3OPRA 3BFDA 3WS5A 1K6RA 3V3SA 4LV3A 1LI9A 4KZBA 5FQ9A 3RJUA 3BFFA 1IKGA 1ONHA 1VQQA 3MZDA 3UO9A 4YINA 5E2GA 1I5QA 4R4SA 2WGWB 3A3IA 1BULA 3FZCA 3E2LA 3TSGA 1YT4A 3HLGA 4KZ5A 1K55C 3LCEA 4WEKA 3ITBA 1GA0A 3PBOA 1YMXA 1ZC2A 4ZDXA 1TVFA 5FSRA 1Q2PA 1WE4A 4WZ4A 3A3FA 2ZQCA 3P09A 1NJ4A 1YLWA 3UE1A 3ZG7B 3D4FA 5EVIA 2H0TA 4OONA 1Z6FA 2ZM2A 1BZAA 1I2SA 1MXOA 3VP4A 4UA9A 2WKEA 4IBXA 4KZ3A 1JWVA 4UA6A 5E43A 4N1HA 4R23A 2H0YA 3B3XA 4IBRA 5EVLA 1H8YA 1XKZA 2WKHA 5BOHA 2WYXA 1EROA 4DE2A 1ES3A 1FSWA 4H8RA 1XPBA 2DNSA 4HESA 4DDSA 3HBRA 5E2HA 1BLCA 1W7FA 3VOYA 1YM1A 1RP5A 3Q7VA 4XUZA 3NY4A 4N1XA 4WMCD 4S2LA 2Y2JA 4QU3A 1K4EA 4RVAA 4OH0A 1CEGA 4C75A 2V2FF 2OV5A 2ZQAA 3SH9A 4E3MA 1G6AA 3IF6A 3BRMA 2ZC3B 4OQHA 4BL2A 4WZ5A 5AQ7A 3FV7A 1K56D 1PYYA 3FKVA 5FQJA 2WZXA 1BTLA 5EPHA 4F94A 3BFEA 4U3TA 4KZ8A 4GNUA 2OSUA 2Y2NA 1L0GA 5DTTA 1KGEA 2X02A 3QNBA 5FQQA 3BECA 3M2JA 1LL5A 1PWDA 3G32A 3NCKA 3QHYA 3EQUA 3SS5A 5FDHA 2QZ6A 4QHCA 1O07A 2ZC7A 2WGVA 3ZNTA 4MBHA 4JKTA 4OPZA 1FQGA 3ZCZA 3S1YA 3N8SA 5FAQA 3IWIA 2EFUA 1ZG6A 2P9VB 2EX2A 2Y2PA 3N4IA 1SHVA 5M1AA 4FSFA 1NYMA 4R0QA 1NRFA 3VP3A 3EQVA 1N9BA 1GA9A 1GHPA 4BD0A 2IWCA 5AQAA 4GKUA 1BLPA 3S4XA 4EBLA 4JLFA 2IWBA 4EUZA 4DKIA 2IWDA 3A3EA 1IEMA 3CG5A 3FYZA 4DE1A 2ZQDA 4QJGA 2C5WB 1PWGA 3HLCA 3MBZA 5A91A 2ZMAA 2R9XA 4S2PA 2HP6A 1K57A 3CZDA 2Y2KA 3HLFA 3WS2A 4WM9A 4IVIA 1XXMA 3ZG8B 1NZOA 4MLLA 1JWPA 4GDBA 5KMWA 4UHUA 4DE3A 1MWRA 3I7JA 4RA7A 3UNWA 4BJPA 3MXSA 4CJNA 5AQ9A 3CMZA 3N7WA 3IH9A 2ZC5B 3PBRA 4P85A 2PBYA 2V1ZA 2DRWA 4QB8A 1EWZA 2WGIA 4QY6A 3BM6A 1PZOA 1PIOA 3IWOA 3VSKA 5CHMA 5CEBA 5L2FA 2Y2LA 3E2KA 2HP5A 3Q07A 4IEDA 5FI2A 4X68A 1K54A 5M19A 1XA1A 4KQRA 2FFFB 3NDGA 5CRFA 1BUEA 4FCFA 4R3BA 4KZAA 4BLMA 2H10A 1NYYA 1ZG4A 2WADA 2XH9A 4DXCA 1M6KA 2ZQ8A 1HTZA 4ZJ3A 2JCHA 5I94A 4S2NC 5CGXA 2A49A 2WK0A 1SDNA 4KZ7A 2Z2LB 1QMEA 4A5RA 2Y2QA 2Y91A 1ESUA 4ZTKA 3VOZA 3OZHA 2Y4AA 4EBPA 4OP8A 2H5SA 3UN7A 4K0XA 2X71A 3LY4A 4S2IA 1XA7A 3LY3A 1ES5A 1Q2QA 4IVKA 5GLDA 3MKFA 3IF5A 3FWLA 2WAEA 1EI5A 4OQIA 3ZHHA 5CGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ITA A;  2Q9M A;  4N92 A;  4S2M A;  1NY0 A;  1LLB A;  3BFC A;  4R4R A;  2QMI A;  5DF8 A;  4KQQ A;  2ZD8 A;  3C7V A;  3HLB A;  5A93 A;  1MKI A;  1LL9 A;  2XGN A;  3GQZ A;  3MKE A;  3G2Z A;  1ALQ A;  2ZC4 B;  3Q1F A;  2HPB A;  3HVF A;  3IT9 A;  3DW0 A;  4GZB A;  1XP4 A;  3GTC A;  4OQG A;  3TG9 A;  5IHV A;  4JXW A;  5EVI C;  4L0L A;  2OLU A;  3AGD A;  4EWF A;  3AGF A;  1IKI A;  2JE5 A;  1CK3 A;  4LCL A;  3ZG5 A;  4B88 A;  1ES4 A;  3SOI A;  1SCW A;  1KE0 A;  4OLG A;  4ZJ1 A;  1RCJ A;  5DF9 A;  4DF6 A;  4HEF A;  3O86 A;  4PM7 A;  4E6W A;  3V50 A;  2Y2G A;  3PBT A;  3GV9 A;  1YLT A;  1E3U A;  1J9M A;  3SH7 A;  3O87 A;  3WS0 A;  2XLN A;  4GN2 A;  4MNR A;  5FA7 A;  4CPK A;  5TGF A;  1YLY A;  5HX9 A;  4KG6 A;  3PBN A;  1TDL A;  3Q81 A;  4ID4 A;  4KZ6 A;  3ISG A;  4M3K A;  3MZF A;  2OLV A;  3MXR A;  2XK1 A;  5HL1 A;  3IHA A;  3W8K A;  4PMA A;  5FQI A;  2EXA A;  4N9L A;  1JVJ A;  2Q9N A;  4X6T A;  1YQS A;  3UDX A;  3GR2 A;  3UE3 A;  1WYB A;  4E3I A;  3IF6 C;  4GB7 A;  4Z9Q A;  2ZM0 A;  4WZ5 C;  3ZFZ A;  3SS3 A;  4NET A;  5CED A;  5G18 A;  4EQI A;  3UPP A;  4NK3 A;  1DJA A;  2WGW A;  2WUQ A;  1K6S A;  3VFF A;  3WWX A;  1BLH A;  1FR6 A;  1W5D A;  4FH2 A;  5J8X A;  3ZDJ A;  1G68 A;  4GD6 A;  4UA7 A;  3O88 A;  1GHM A;  2EFX A;  5EVI D;  1FOF A;  5CHJ A;  3WS1 A;  1XGJ A;  4WEJ A;  3UY6 A;  1JTG A;  1DY6 A;  4GDN A;  5KSH A;  2X01 A;  3W4P A;  3BLM A;  1MY8 A;  1H5X A;  3BFG A;  3QNC A;  4WBG A;  4C6Y A;  1MPL A;  1M40 A;  2A3U A;  1KGG A;  3OPP A;  1KVM A;  4RX3 A;  1H8Z A;  1KDW A;  3IQA A;  3NBL A;  3P98 A;  2FFY A;  3OPH A;  2JC7 A;  4X55 A;  4GOG A;  5CTN A;  1LHY A;  3SS4 A;  5A90 A;  2VGK A;  1GCE A;  3HLW A;  3OCL A;  1PI4 A;  1VM1 A;  5F83 A;  2B5R A;  3OCN A;  5HAP A;  3ZVW A;  1JWZ A;  1W8Y A;  4DXB A;  4OOM A;  5E2E A;  5DTS A;  2R9W A;  2XDM A;  1IYP A;  4U0X A;  2Y2H A;  3N8L A;  1YMS A;  3NI9 A;  1HVB A;  1MWU A;  3WRZ A;  4MBF A;  5EVI B;  1FCN A;  4HBU A;  3AGE A;  3VP1 A;  2DCF A;  1HD8 A;  2Y2O A;  3LEZ A;  4S2K A;  1K57 C;  4DE0 A;  3IXH A;  5KSC A;  2UWX A;  3ZGA B;  2PU4 A;  3DTM A;  2PU2 A;  3G2Y A;  2ZC6 B;  4K91 A;  5HW3 A;  1FR1 A;  1YLP A;  1LI0 A;  4OKP A;  2XD1 A;  2Z2M B;  5D3O A;  2EX8 A;  5CGW A;  4DRT A;  3C5A A;  1K38 A;  3PAE A;  1ES2 A;  1KDS A;  2HDS A;  2ZQ9 A;  3VSL A;  3G35 A;  1DJC A;  2J9O A;  3IXG A;  1RGY A;  1IYS A;  2EXB A;  3Q7V B;  2XR0 A;  2ZQ7 A;  1CI8 A;  4XXR A;  5CER A;  3DWK A;  5GHX A;  4HBT A;  4OVD A;  1K54 C;  1KE3 A;  3BYD A;  5AQB A;  4FH4 A;  3IF6 B;  4WMC A;  4DDY A;  4S2N A;  4LV1 A;  3IH8 A;  3ZNY A;  4B4Z A;  2HP9 A;  4Y0U A;  3MFD A;  2WKI A;  1GHI A;  1C3B A;  4R1G A;  2P9V A;  3UDI A;  3DWZ A;  2VGJ A;  4WYY A;  4JXV A;  5CXW A;  4E3K A;  4C3Q A;  1PWC A;  5GLB A;  5CHU A;  1Y54 A;  1K56 A;  1K55 A;  3OC2 A;  3WS4 A;  4BEN A;  4S2J A;  4BD1 A;  1ONG A;  4X69 A;  3VFH A;  3ZG0 A;  3VP0 A;  2CC1 A;  4OOY A;  4S2O A;  2C6W B;  3S22 A;  3HUM A;  4QY5 A;  1S0W A;  5EOE A;  2Y55 A;  1IEL A;  4E3J A;  1XGI A;  4KG2 A;  3BLS A;  4LCM A;  1O7E A;  4K0W A;  1IYO A;  2EX6 A;  3TOI A;  4JF4 A;  2GDN A;  4YFM A;  3Q7Z A;  3ZVT A;  5F1G A;  1E4D A;  3ZG9 B;  4RX2 A;  3PBQ A;  2ZJ9 A;  2RCX A;  4LEN A;  2J8Y A;  4P0M A;  3SH8 A;  5U47 A;  3HUN A;  4XUX A;  4ZAM A;  2ZM8 A;  3HLD A;  4P87 A;  3GSG A;  1L0E A;  1MBL A;  3HLE A;  5FAS A;  4Q8I A;  4BQM A;  3N6I A;  1U60 A;  1JTD A;  4KZ9 A;  1N4O A;  5FAT A;  3HRE A;  2G2U A;  3M6H A;  5F1F A;  1PW1 A;  2EX9 A;  2XEP A;  5CTM A;  4BL3 A;  2ZLY A;  4R3J A;  3G31 A;  1KVL A;  3GRJ A;  4U0T A;  5HAQ A;  2XFS A;  4Y0O A;  3W4Q A;  3A3J A;  1PI5 A;  4B4X A;  2HDU A;  4E6X A;  3VP2 A;  5HAR A;  3NC8 A;  4JF6 A;  5TFQ A;  1S6R A;  4X53 A;  1BLS A;  4WEL A;  1PZP A;  3GVB A;  2JBF A;  1NZU A;  1YLZ A;  3M2K A;  1BT5 A;  5FAO A;  3IXB A;  4OOL A;  4OQ0 A;  4KEN B;  4OPQ A;  4PPR A;  2XD5 A;  4X56 A;  4JPM A;  4PM6 A;  3OPL A;  3MZE A;  5A92 A;  1TEM A;  5GHZ A;  5JYP A;  3V5M A;  2HDQ A;  2WAF A;  3HL9 A;  4EBN A;  1L2S A;  3UPO A;  2XQZ A;  4UAA A;  5CEC A;  2Y59 A;  5FQM A;  4OPR A;  5F82 A;  1L0D A;  3HUO A;  1CEF A;  1SKF A;  1W8Q A;  2XF3 A;  3VMA A;  3M6B A;  4MEZ A;  4KQO A;  4N9K A;  2J9P A;  5FQK A;  3NDE A;  5DVA A;  5EE8 A;  3GMW A;  5GLC A;  4Y7P A;  1ERQ A;  2J7V A;  4PM5 A;  4E3N A;  1RGZ A;  4Y0T A;  3W4O A;  3PTE A;  3PAG A;  5HAI A;  4MBK A;  4O7D A;  1E3U D;  3CJM A;  4E3L A;  1TDG A;  1XX2 A;  5JYO A;  1K25 A;  2E8I A;  2Y2I A;  4LV2 A;  1IYQ A;  5GHY A;  1YLJ A;  5M18 A;  3IWQ A;  3JYI A;  3N8R A;  5E2F A;  5TR7 A;  3RXX A;  3WRT A;  1ZKJ A;  1SDE A;  3G34 A;  1NXY A;  5GLA A;  4OPY A;  3V3R A;  2WZZ A;  4JF5 A;  3UPN A;  4FD8 A;  4E3O A;  4P6B A;  4GD8 A;  1ESI A;  3C4P A;  2RL3 A;  3IXD A;  3LO7 A;  4JXG A;  5FI6 A;  1WYC A;  1E25 A;  3C7U A;  4QD4 A;  3V39 A;  4ZBE A;  1PW8 A;  1OME A;  1QMF A;  3IHB A;  4D2O A;  1MWT A;  4RYE A;  2BG1 A;  3A3D A;  5HFO A;  4KZ4 A;  5FI7 A;  2BLS A;  4ZJ2 A;  1BSG A;  2Y2M A;  2QPN A;  1FCO A;  5GL9 A;  4EV4 A;  1DJB A;  5EEC A;  3G4P A;  2G2W A;  3FKW A;  3Q82 A;  5EOO A;  1HZO A;  2P74 A;  1KGF A;  3O3V A;  4KG5 A;  1ERM A;  5EUA A;  5FAP A;  5KZH A;  1I2W A;  1FSY A;  3UDF A;  1AXB A;  3UE0 A;  4JBF A;  1CI9 A;  1KE4 A;  4OLD A;  1FCM A;  1MWS A;  2I72 A;  3RXW A;  4PM8 A;  4PM9 A;  3G30 A;  2HDR A;  1K4F A;  3PBS A;  5DTK A;  3NIA A;  1L0F A;  2XFT A;  2V20 A;  4OP5 A;  5DF7 A;  4JXS A;  3C4O A;  1W79 A;  4LV0 A;  3BEB A;  3OPR A;  3BFD A;  3WS5 A;  1K6R A;  3V3S A;  4LV3 A;  1LI9 A;  4KZB A;  5FQ9 A;  3RJU A;  3BFF A;  1IKG A;  1ONH A;  1VQQ A;  3MZD A;  3UO9 A;  4YIN A;  5E2G A;  1I5Q A;  4R4S A;  2WGW B;  3A3I A;  1BUL A;  3FZC A;  3E2L A;  3TSG A;  1YT4 A;  3HLG A;  4KZ5 A;  1K55 C;  3LCE A;  4WEK A;  3ITB A;  1GA0 A;  3PBO A;  1YMX A;  1ZC2 A;  4ZDX A;  1TVF A;  5FSR A;  1Q2P A;  1WE4 A;  4WZ4 A;  3A3F A;  2ZQC A;  3P09 A;  1NJ4 A;  1YLW A;  3UE1 A;  3ZG7 B;  3D4F A;  5EVI A;  2H0T A;  4OON A;  1Z6F A;  2ZM2 A;  1BZA A;  1I2S A;  1MXO A;  3VP4 A;  4UA9 A;  2WKE A;  4IBX A;  4KZ3 A;  1JWV A;  4UA6 A;  5E43 A;  4N1H A;  4R23 A;  2H0Y A;  3B3X A;  4IBR A;  5EVL A;  1H8Y A;  1XKZ A;  2WKH A;  5BOH A;  2WYX A;  1ERO A;  4DE2 A;  1ES3 A;  1FSW A;  4H8R A;  1XPB A;  2DNS A;  4HES A;  4DDS A;  3HBR A;  5E2H A;  1BLC A;  1W7F A;  3VOY A;  1YM1 A;  1RP5 A;  3Q7V A;  4XUZ A;  3NY4 A;  4N1X A;  4WMC D;  4S2L A;  2Y2J A;  4QU3 A;  1K4E A;  4RVA A;  4OH0 A;  1CEG A;  4C75 A;  2V2F F;  2OV5 A;  2ZQA A;  3SH9 A;  4E3M A;  1G6A A;  3IF6 A;  3BRM A;  2ZC3 B;  4OQH A;  4BL2 A;  4WZ5 A;  5AQ7 A;  3FV7 A;  1K56 D;  1PYY A;  3FKV A;  5FQJ A;  2WZX A;  1BTL A;  5EPH A;  4F94 A;  3BFE A;  4U3T A;  4KZ8 A;  4GNU A;  2OSU A;  2Y2N A;  1L0G A;  5DTT A;  1KGE A;  2X02 A;  3QNB A;  5FQQ A;  3BEC A;  3M2J A;  1LL5 A;  1PWD A;  3G32 A;  3NCK A;  3QHY A;  3EQU A;  3SS5 A;  5FDH A;  2QZ6 A;  4QHC A;  1O07 A;  2ZC7 A;  2WGV A;  3ZNT A;  4MBH A;  4JKT A;  4OPZ A;  1FQG A;  3ZCZ A;  3S1Y A;  3N8S A;  5FAQ A;  3IWI A;  2EFU A;  1ZG6 A;  2P9V B;  2EX2 A;  2Y2P A;  3N4I A;  1SHV A;  5M1A A;  4FSF A;  1NYM A;  4R0Q A;  1NRF A;  3VP3 A;  3EQV A;  1N9B A;  1GA9 A;  1GHP A;  4BD0 A;  2IWC A;  5AQA A;  4GKU A;  1BLP A;  3S4X A;  4EBL A;  4JLF A;  2IWB A;  4EUZ A;  4DKI A;  2IWD A;  3A3E A;  1IEM A;  3CG5 A;  3FYZ A;  4DE1 A;  2ZQD A;  4QJG A;  2C5W B;  1PWG A;  3HLC A;  3MBZ A;  5A91 A;  2ZMA A;  2R9X A;  4S2P A;  2HP6 A;  1K57 A;  3CZD A;  2Y2K A;  3HLF A;  3WS2 A;  4WM9 A;  4IVI A;  1XXM A;  3ZG8 B;  1NZO A;  4MLL A;  1JWP A;  4GDB A;  5KMW A;  4UHU A;  4DE3 A;  1MWR A;  3I7J A;  4RA7 A;  3UNW A;  4BJP A;  3MXS A;  4CJN A;  5AQ9 A;  3CMZ A;  3N7W A;  3IH9 A;  2ZC5 B;  3PBR A;  4P85 A;  2PBY A;  2V1Z A;  2DRW A;  4QB8 A;  1EWZ A;  2WGI A;  4QY6 A;  3BM6 A;  1PZO A;  1PIO A;  3IWO A;  3VSK A;  5CHM A;  5CEB A;  5L2F A;  2Y2L A;  3E2K A;  2HP5 A;  3Q07 A;  4IED A;  5FI2 A;  4X68 A;  1K54 A;  5M19 A;  1XA1 A;  4KQR A;  2FFF B;  3NDG A;  5CRF A;  1BUE A;  4FCF A;  4R3B A;  4KZA A;  4BLM A;  2H10 A;  1NYY A;  1ZG4 A;  2WAD A;  2XH9 A;  4DXC A;  1M6K A;  2ZQ8 A;  1HTZ A;  4ZJ3 A;  2JCH A;  5I94 A;  4S2N C;  5CGX A;  2A49 A;  2WK0 A;  1SDN A;  4KZ7 A;  2Z2L B;  1QME A;  4A5R A;  2Y2Q A;  2Y91 A;  1ESU A;  4ZTK A;  3VOZ A;  3OZH A;  2Y4A A;  4EBP A;  4OP8 A;  2H5S A;  3UN7 A;  4K0X A;  2X71 A;  3LY4 A;  4S2I A;  1XA7 A;  3LY3 A;  1ES5 A;  1Q2Q A;  4IVK A;  5GLD A;  3MKF A;  3IF5 A;  3FWL A;  2WAE A;  1EI5 A;  4OQI A;  3ZHH A;  5CGS A; 
#chains in the Genus database with same CATH topology
 4S2M A;  1NY0 A;  1T18 A;  4KQQ A;  2ZD8 A;  5A93 A;  1KOU A;  1LL9 A;  2PBD P;  1FIK A;  4NKP A;  4E04 A;  2HPB A;  5DFY A;  5HD3 A;  2OOL A;  3AGD A;  4GCZ A;  3AGF A;  4EWF A;  2JE5 A;  1CK3 A;  3ZG5 A;  4B88 A;  3SOI A;  4ZJ1 A;  4OLG A;  2XA7 M;  4HEF A;  1YPR A;  4ETZ A;  3O87 A;  4M3K A;  4ID4 A;  3ISG A;  4B9O A;  3IHA A;  3W8K A;  2O0Y A;  2Q9N A;  1WYB A;  1J3W A;  4GJ4 A;  3ZFZ A;  4LGW A;  5G4Z A;  4EQI A;  3UPP A;  5EFW A;  2WUQ A;  5J3W A;  3E4Q A;  1BLH A;  1W5D A;  5J8X A;  3ZDJ A;  1G68 A;  4GD6 A;  4WF0 A;  5EVI D;  1FOF A;  3PXP A;  3WS1 A;  4WEJ A;  3UY6 A;  2A24 A;  5KSH A;  2X01 A;  1MY8 A;  1P97 A;  3OPP A;  4RX3 A;  3NBL A;  3IQA A;  1UGU A;  3OPH A;  2JC7 A;  1S1Y A;  4L9G A;  3OCL A;  2YKF A;  4BMW A;  4DXB A;  5DTS A;  2R9W A;  2XDM A;  1IYP A;  3WRZ A;  1HVB A;  2HJE A;  4HBU A;  3VP1 A;  3ZGA B;  2PU4 A;  4K91 A;  5HW3 A;  1FR1 A;  3C2W A;  3RFB A;  4ME4 A;  3MMH A;  5KIZ A;  3C5A A;  1K38 A;  3VSL A;  2HDS A;  1OTB A;  1CI8 A;  4RQ9 A;  3DWK A;  2HZ5 A;  1K54 C;  3S7P A;  3T4Q A;  3BYD A;  2OAP 1;  4WMC A;  4DDY A;  4S2N A;  3IH8 A;  1GHI A;  3UDI A;  2KLI A;  5HL6 A;  5CXW A;  3EEH A;  4E3K A;  5CHU A;  3WS4 A;  4S2J A;  4BD1 A;  2JKF A;  4ESP A;  4QY5 A;  3MQ0 A;  1JNU A;  1LSV A;  3LYX A;  4E3J A;  4KG2 A;  5IT5 A;  4LCM A;  4JGP A;  1IYO A;  3Q7Z A;  2KX6 A;  3ZQ5 A;  5F1G A;  1VEU A;  4JGR A;  2ZJ9 A;  3CUE C;  4HH3 A;  4LEN A;  3JVU A;  4EES A;  4O8G A;  4ZAM A;  1MBL A;  3HLE A;  5FAS A;  3E4O A;  1VHM A;  5F1F A;  5FAT A;  1N4O A;  2G2U A;  2EX9 A;  4BL3 A;  2ZLY A;  1KVL A;  3GRJ A;  4U0T A;  2XFS A;  3W4Q A;  5L09 A;  4NXB A;  4BWI A;  3B33 A;  4JF6 A;  5TFQ A;  1BLS A;  2M7V A;  4WEL A;  1F98 A;  3GVB A;  1TS8 A;  2R78 A;  4UQI M;  1TD5 A;  4OQ0 A;  4X56 A;  3HJK A;  2XD5 A;  3OPL A;  1TEM A;  4LRZ E;  1L2S A;  3UPO A;  2XQZ A;  4UAA A;  3BJN A;  2W1R A;  2Y59 A;  3HUO A;  1SKF A;  3VMA A;  3M6B A;  2Q0O A;  4N9K A;  1W63 M;  3TE8 A;  2XRN A;  4DN0 A;  3B47 A;  2J7V A;  2QYB A;  4EEU A;  4Y0T A;  3PTE A;  4O7D A;  4Y2F A;  1XX2 A;  3UB9 A;  5LBR A;  4LV2 A;  1IYQ A;  3G6O A;  3JYI A;  1ZKJ A;  3V3R A;  4OPY A;  4E3O A;  2XRO A;  1XFN A;  4GD8 A;  3IXD A;  4ZBE A;  3IHB A;  3LIE A;  4RYE A;  2BG1 A;  3A3D A;  5FI7 A;  2Y2M A;  2QPN A;  5GL9 A;  4EV4 A;  4NXF A;  3VV4 A;  3CHW P;  3O3V A;  5FAP A;  1ERM A;  4NXE A;  4Z1W A;  4JBF A;  1FCM A;  2LB5 A;  1K4F A;  4I39 A;  3PBS A;  4BBT A;  2XFT A;  5DF7 A;  5AVF A;  4LV0 A;  3BEB A;  3V3S A;  4KZB A;  1X0O A;  2W3F A;  1IKG A;  2V0U A;  4YIN A;  4R4S A;  1G5U A;  3E2L A;  3QP8 A;  3ITB A;  1GA0 A;  5F68 A;  5MC7 A;  2HJ9 C;  1TVF A;  1VET A;  2A24 B;  3JPU A;  1NRJ A;  2IA2 A;  2ZQC A;  3MJQ A;  3D4F A;  4OON A;  3T4J A;  1I2S A;  1YKD A;  4KZ3 A;  4UA6 A;  3B3X A;  2Y8H A;  1ES3 A;  1T1B A;  3VOY A;  1BLC A;  1W7F A;  3Q7V A;  2VGL S;  4N1X A;  1K4E A;  4OH0 A;  4I3A A;  4C75 A;  2HF6 A;  2ZQA A;  1G6A A;  2ZC3 B;  4Q0I A;  4EER A;  2QKP A;  1IFQ A;  4R38 A;  4U3T A;  3ZYT A;  2Y2N A;  4MN5 A;  4GS9 A;  3DTK A;  4WN5 A;  3M2J A;  3T4K A;  3NCK A;  3QHY A;  3EQU A;  3ZNT A;  4DJ2 A;  4OPZ A;  3S1Y A;  3N8S A;  2J3T D;  4Y15 A;  3N4I A;  4BBV A;  3H9W A;  3T4L A;  1GHP A;  2LB9 A;  4GKU A;  3S4X A;  3QP2 A;  4EBL A;  4DKI A;  2IWD A;  4DE1 A;  2PDR A;  1PWG A;  3HLC A;  4S2P A;  2HP6 A;  4X25 A;  2MJ6 A;  1XXM A;  3E4P A;  1GSV A;  1VEU B;  2PYP A;  4CJN A;  2ZC5 B;  4QB8 A;  3PBR A;  2PBY A;  1PZO A;  2Y2L A;  3E2K A;  4IED A;  1F5M A;  5HDD A;  5M19 A;  3PHY A;  5G4Y A;  4KQR A;  4O0P A;  3NDG A;  5CRF A;  4BLM A;  1VB6 A;  4ZJ3 A;  1HTZ A;  1SDN A;  1QME A;  4A5R A;  1OTI A;  4I3I A;  3UN7 A;  4FUW A;  3C30 A;  1XA7 A;  3IF5 A;  1AWI A;  3DTI A;  4CLC D;  2PAV P;  5CGS A;  2W3E A;  2Q9M A;  4LRX C;  1UWN X;  4R4R A;  4EQ1 A;  5J7E A;  3C7V A;  4P6Z M;  3GQZ A;  2PRF A;  2ZMV A;  3MKE A;  3G2Z A;  1OPX A;  4GZB A;  3IT9 A;  1LSX A;  1XP4 A;  4OQG A;  4JXW A;  2OLU A;  4LCL A;  1CJF A;  2VZW A;  1KE0 A;  2BTF P;  1RCJ A;  3O86 A;  3UMD A;  2Y2G A;  3SH7 A;  1YLT A;  1J9M A;  1H3Q A;  2XLN A;  3A0R A;  5FA7 A;  2FH5 A;  3PBN A;  2O9B A;  4KZ6 A;  3MZF A;  2OLV A;  4X6T A;  4E3I A;  4GB7 A;  4WZ5 C;  5G18 A;  1OTA A;  1K6S A;  4EXO A;  3O88 A;  1GHM A;  4GDN A;  1V9Z A;  4WBG A;  1M40 A;  1KVM A;  3RTY A;  1KDW A;  1IOU A;  1XJ6 A;  2FFY A;  2WKQ A;  3NJA A;  4X55 A;  2VGK A;  5F83 A;  1W8Y A;  4CLC C;  3QP6 A;  1VET B;  4U0X A;  1OJG A;  3NI9 A;  1MWU A;  3F1P A;  4QPR A;  3AGE A;  2DCF A;  1HD8 A;  3LEZ A;  4S2K A;  1K57 C;  4DE0 A;  2PU2 A;  3W2Z A;  3V67 A;  2XD1 A;  1OTE A;  2VX8 A;  2EWW A;  1DJC A;  3IXG A;  5HSQ A;  3Q7V B;  2EXB A;  2XR0 A;  4XXR A;  4UEY A;  3L7H A;  1OT6 A;  4HBT A;  1UWP X;  1KE3 A;  4R70 A;  3KO6 A;  4O01 A;  4FH4 A;  1ACF A;  4B4Z A;  4L9E A;  2NUP C;  1PFL A;  3LUQ A;  4I5S A;  2VGJ A;  3MR0 A;  4JXV A;  3R4K A;  4C3Q A;  1PWC A;  5GLB A;  1Y54 A;  3CI6 A;  4GS9 B;  1K55 A;  4BEN A;  2VV8 A;  1EW0 A;  4X69 A;  2CC1 A;  1IEL A;  1XGI A;  5HDS A;  3BLS A;  4K0W A;  2VKS A;  3CWF A;  3ULF A;  4JF4 A;  2GDN A;  4PKY A;  1E4D A;  5CX7 A;  2J8Y A;  4HNB A;  3LR4 A;  5U47 A;  3HUN A;  2EA9 A;  3GSG A;  3S7Q A;  4XT2 A;  4Q8I A;  4BQM A;  1U60 A;  1JTD A;  4KZ9 A;  5HAQ A;  3KSG A;  3LI8 A;  3OBF A;  3A3J A;  5HAR A;  3NC8 A;  1H0M A;  1PZP A;  3JVV A;  2L1M A;  1NZU A;  1YLZ A;  3NOU C;  3M2K A;  5FAO A;  3IXB A;  4OOL A;  3VOL A;  4BBU A;  1NWZ A;  1P9W A;  4PM6 A;  3MZE A;  4H6J A;  1ZTU A;  5CEC A;  4OPR A;  5F82 A;  2ZBB A;  3MSH A;  2BAS A;  1CEF A;  1W8Q A;  2XF3 A;  4I38 A;  4KQO A;  2DMW A;  1DP9 A;  2JKG A;  5DVA A;  3K3C A;  5EE8 A;  4F3L A;  4IUK A;  4Y7P A;  3E0Y A;  5EM0 A;  4PM5 A;  4E3N A;  2O99 A;  3PAG A;  1K0K A;  1E3U D;  4E3L A;  5GHY A;  1YLJ A;  3N8R A;  3RXX A;  2VV7 A;  4JF5 A;  4FD8 A;  4P6B A;  3LO7 A;  2RL3 A;  4JXG A;  2VV6 A;  5EV0 A;  1E25 A;  3C7U A;  1OME A;  3NOT C;  5HFO A;  4KZ4 A;  3UE6 A;  3T1X A;  4ZJ2 A;  1BSG A;  1DJB A;  5EEC A;  3G4P A;  2O9A A;  2G2W A;  2V8F A;  3FKW A;  3Q82 A;  3E98 A;  1HZO A;  5EOO A;  1KGF A;  5EUA A;  1I2W A;  5HZH A;  4Y13 A;  3KSF A;  3CPT A;  4PM9 A;  5F69 A;  3UB6 A;  3T12 B;  5HWW A;  3NIA A;  4JGO A;  3C4O A;  4KUO A;  3VE4 A;  3PR6 A;  4HOI A;  1NLY A;  1LI9 A;  3T50 A;  1ONH A;  3T4S A;  5E2G A;  2PYR A;  3TSG A;  3BWL A;  3LR3 A;  1XJ2 A;  2VLG A;  1WE4 A;  3A3F A;  1NJ4 A;  1YAX A;  5EVI A;  1Z6F A;  2ZM2 A;  3S7N A;  1MXO A;  4UA9 A;  4B93 A;  3DBA A;  5E43 A;  4IBR A;  1XKZ A;  2WKH A;  3DAV A;  3HJI A;  5BOH A;  2WYX A;  2YKH A;  2A2L A;  1ERO A;  4DE2 A;  1OT9 A;  1MKM A;  2DNS A;  3F1P B;  4MN6 A;  5E2H A;  3A0S A;  4XUZ A;  3S7O A;  4WUJ A;  1F2K A;  4QU3 A;  2B18 A;  4HJ6 A;  4RVA A;  1CEG A;  3IF6 A;  3LFV A;  3BRM A;  4OQH A;  1H8M A;  3FV7 A;  1K56 D;  1PYY A;  5FQJ A;  2WZX A;  5IS1 A;  4F94 A;  3BFE A;  4HP4 A;  1L0G A;  2PD7 A;  5FQQ A;  2X02 A;  3IX4 A;  4L9F A;  3SS5 A;  2M7U A;  4QHC A;  2WGV A;  4JKT A;  3KYZ A;  1FQG A;  5FAQ A;  2EX2 A;  2Y2P A;  1SHV A;  5M1A A;  3NOP C;  4R0Q A;  3FG8 A;  5FL3 A;  4BD0 A;  5AQA A;  4JLF A;  5TBM A;  1IEM A;  3FYZ A;  3T4O A;  2ZQD A;  2C5W B;  4YNR A;  2R9X A;  3B42 A;  4HI4 A;  3WS2 A;  4WM9 A;  3LR0 A;  1MC0 A;  1NZO A;  1JWP A;  1SZV A;  5KMW A;  4NEE D;  1MWR A;  4DMZ A;  3UNW A;  4XT2 B;  2VA0 A;  2W3D A;  2L4R A;  3IWO A;  5CHM A;  4KUK A;  3CLO A;  3HCY A;  1ZG4 A;  4DXC A;  1L3L A;  1M6K A;  2JCH A;  2WK0 A;  2L0W A;  2PHY A;  2Z2L B;  2VGL M;  2Y2Q A;  3VOZ A;  2GZA A;  3P7N A;  2H5S A;  4OP8 A;  4Y3I A;  3NHQ A;  4S2I A;  3IS2 A;  4H6J B;  3FWL A;  1PNE A;  3ITA A;  4N92 A;  1LLB A;  5DF8 A;  5IU1 A;  3HLB A;  1MKI A;  3KYQ A;  4IJG A;  2ZC4 B;  2H28 A;  3F1N A;  3HVF A;  3R7W A;  4F3L B;  5IHV A;  1S4S A;  2V8C A;  1SCW A;  2OAQ 1;  5DF9 A;  4DF6 A;  4PM7 A;  3PBT A;  3GV9 A;  3MFX A;  2D02 A;  4MNR A;  4CPK A;  4Q0J A;  2W3G A;  1YLY A;  5HX9 A;  4G3V A;  3Q81 A;  2ZL1 A;  5L07 A;  5HL1 A;  1W63 Q;  4PMA A;  5TJJ A;  1JVJ A;  1YQS A;  3GR2 A;  5HPI A;  2ZM0 A;  3SS3 A;  4NET A;  1DJA A;  2WGW A;  3VFF A;  3WWX A;  3UB8 A;  3CPT B;  4UA7 A;  5FDS A;  1JTG A;  4HIA A;  1P0Z A;  3BLM A;  3BFG A;  3LEQ A;  3QNC A;  4C6Y A;  4Q0H A;  1MPL A;  3EGD C;  2P08 A;  1KGG A;  4MCW A;  4ARZ A;  5CTN A;  4GOG A;  3SS4 A;  3KSH A;  1GCE A;  3HLW A;  2B5R A;  3OCN A;  5HAP A;  1JWZ A;  5DJU A;  5HWV A;  4OOM A;  1TS6 A;  2Y2H A;  1YMS A;  4MBF A;  5EVI B;  1FCN A;  4EEP A;  2Y2O A;  5L10 A;  4MMN A;  4HJ3 A;  3G2Y A;  2ZC6 B;  2VK3 A;  1T1C A;  1GSW A;  4OKP A;  2Z2M B;  1S66 L;  2EX8 A;  5CGW A;  2B02 A;  4G3K A;  4DRT A;  3IX8 A;  3PAE A;  1ES2 A;  1KDS A;  2ZQ9 A;  1RGY A;  2ZQ7 A;  2FZ0 A;  5CER A;  5AJG A;  5F5Y A;  4GW9 A;  4I3J A;  3IF6 B;  4IHQ A;  3ZNY A;  2HP9 A;  2WKI A;  4R1G A;  2P9V A;  3DWZ A;  4WL9 A;  4WYY A;  3C38 A;  4EET B;  3OC2 A;  3D72 A;  2GJ3 A;  3BQ8 A;  4OOY A;  2C6W B;  3S22 A;  1S0W A;  1CQA A;  3TOI A;  2EX6 A;  4YFM A;  3CIT A;  5DKL A;  4RX2 A;  3PBQ A;  2RCX A;  3HLD A;  4P87 A;  5TBM B;  1YSP A;  4HH2 A;  4IUH A;  3N6I A;  3LIA A;  3HRE A;  3M6H A;  5CTM A;  2XEP A;  2PD8 A;  3G31 A;  3MS6 A;  1G28 A;  2WKP A;  4Y0O A;  1PI5 A;  4NG2 A;  3NEC A;  1S6R A;  4X53 A;  2K7S A;  4JPM A;  1S1Z A;  5JYP A;  4M4X A;  2WAF A;  3HL9 A;  1BYW A;  1Y4O A;  4MEZ A;  2PR6 A;  2V0W A;  3NDE A;  2JKR M;  3GMW A;  3NUL A;  3IS2 B;  3W4O A;  3CJM A;  1TDG A;  5FEF A;  5JYO A;  1DP6 A;  1K25 A;  2E8I A;  2Y2I A;  5M18 A;  4CLC A;  5GLA A;  1NXY A;  1XFQ A;  2WZZ A;  3UPN A;  1ESI A;  5FI6 A;  3F1N B;  3R7W B;  4CLC E;  4QD4 A;  4D2O A;  1MWT A;  3H7W A;  2D01 A;  4R6L A;  2WKR A;  3F1O A;  2P74 A;  5KZH A;  3IX3 A;  1TS7 A;  1AXB A;  3A0V A;  1CI9 A;  4OLD A;  2I72 A;  2ZL1 B;  4PM8 A;  3G30 A;  4PKY G;  1L0F A;  4OP5 A;  2V9A A;  1HLU P;  1W79 A;  3OPR A;  3BQA A;  2OWH A;  4LV3 A;  1YSQ A;  5FQ9 A;  3BFF A;  3RJU A;  3UO9 A;  3MZD A;  5C5K A;  4KQD A;  2EWV A;  1A0K A;  2WGW B;  3FZC A;  2JKT M;  4KZ5 A;  1K55 C;  3IBR A;  5EM1 A;  5I5L A;  2XSS A;  2Z6C A;  3UE1 A;  3ZG7 B;  3D9Y A;  2H0T A;  1BZA A;  2ZOH A;  3QP5 A;  2WKE A;  4ARZ B;  1JWV A;  4LRY C;  4R23 A;  5EVL A;  1H8Y A;  1FSW A;  4H8R A;  4HES A;  4DDS A;  1YM1 A;  1RP5 A;  3NY4 A;  4WMC D;  2V2F F;  2OV5 A;  4E3M A;  4GHI A;  3RH8 B;  2M1C A;  3T1S A;  3U4L P;  1BTL A;  4KZ8 A;  2OSU A;  5DTT A;  1KGE A;  3QNB A;  3BEC A;  2HGV A;  3G32 A;  4HY8 A;  3ICY A;  5FDH A;  2ZC7 A;  3IWI A;  2EFU A;  2P9V B;  3MQQ A;  4FSF A;  3GDI A;  3VP3 A;  2XA7 S;  3K3D A;  3GEC A;  3EEA A;  1MZU A;  2ACG A;  2IWB A;  3CG5 A;  4QJG A;  3MBZ A;  5A91 A;  2JHE A;  4MLL A;  5HPF A;  4MDZ A;  4UHU A;  3UB7 A;  3FC7 A;  3I7J A;  3IBJ A;  4RA7 A;  3MXS A;  5AQ9 A;  3IH9 A;  4P85 A;  4ZDX A;  2V1Z A;  4QY6 A;  2DRW A;  1EWZ A;  1PIO A;  3VSK A;  5CEB A;  5FI2 A;  4X68 A;  1K54 A;  2FFF B;  5HDC A;  1BUE A;  4FCF A;  4R3B A;  4KZA A;  2H10 A;  1NYY A;  1N9O A;  2OWJ A;  4S2N C;  1FIL A;  5CGX A;  2A49 A;  4KZ7 A;  2Y79 A;  3EOI A;  3LIF A;  4EBP A;  3BY9 A;  1Q2Q A;  4IVK A;  5GLD A;  5I94 A;  5A8B A;  1GSX A;  3BFC A;  2QMI A;  2XGN A;  4PAU A;  2AVX A;  1ALQ A;  3Q1F A;  3CUE A;  3DW0 A;  1N9N A;  3GTC A;  3TG9 A;  5AVE A;  4EU0 A;  3EWK A;  5EVI C;  4L0L A;  2ZMF A;  1SKO A;  1IKI A;  4Y17 A;  2GNX A;  1ES4 A;  3EGX C;  3SW1 A;  1XJ4 A;  2W1T A;  4G3W A;  4E6W A;  1TS0 A;  4CLC B;  3V50 A;  3QP4 A;  1E3U A;  4QWO A;  3WS0 A;  2W0N A;  4GN2 A;  2CMN A;  5TGF A;  4II7 A;  1LL8 A;  4KG6 A;  1TDL A;  4E6X A;  3H7W B;  3MXR A;  2XK1 A;  5FQI A;  2EXA A;  4N9L A;  3D3O A;  3TW8 A;  3UDX A;  4HQA A;  3UE3 A;  3F1O B;  2ZOI A;  3IF6 C;  2E8J A;  1PRQ A;  4Z9Q A;  3PYP A;  2PT7 A;  5CED A;  1G6O A;  4NK3 A;  3P01 A;  1FR6 A;  4FH2 A;  2EFX A;  5CHJ A;  1XGJ A;  1DY6 A;  2B95 A;  3W4P A;  1H5X A;  2A3U A;  4K08 A;  1H8Z A;  3P98 A;  4FTX A;  1P9R A;  1LHY A;  5A90 A;  5L8M A;  3T1R A;  1PI4 A;  1VM1 A;  3ZVW A;  5K5B A;  3OOV A;  5E2E A;  3N8L A;  5KSC A;  4UQI S;  4NXG A;  3IXH A;  2UWX A;  3DTM A;  4MN7 A;  4YWZ A;  3SZT A;  2JN7 A;  1YLP A;  1LI0 A;  3OLO A;  3H82 A;  1T19 A;  5D3O A;  1S67 L;  2PR5 A;  2KDK A;  4LFU A;  3G35 A;  2O9C A;  3BW6 A;  3T1Q B;  4D60 A;  2J9O A;  1IYS A;  2QJ7 A;  4CQH A;  5GHX A;  4OVD A;  4R3A A;  1OTD A;  5AQB A;  4GHI B;  4LV1 A;  2W3H A;  4Y0U A;  3MFD A;  1C3B A;  3KX0 X;  4FOF A;  1K56 A;  1D7E A;  1ONG A;  3O5Y A;  3VFH A;  3VP0 A;  3MXQ A;  4S2O A;  2HV1 A;  3HUM A;  5EOE A;  2Y55 A;  4LPZ A;  1O7E A;  3MQO A;  3ZVT A;  5FEG A;  3ZG9 B;  4X1L A;  3SH8 A;  4P0M A;  3LID A;  4XUX A;  2ZM8 A;  1ZHH B;  1L0E A;  2K31 A;  1NLZ A;  1PW1 A;  4R3J A;  3T4T A;  4HHD A;  4B4X A;  2HDU A;  2JKR I;  3VP2 A;  3KYE A;  5DFX A;  2VJW A;  4ETX A;  2JBF A;  1BT5 A;  4KEN B;  4OPQ A;  4PPR A;  2QHK A;  5A92 A;  5GHZ A;  3V5M A;  2HDQ A;  4EBN A;  4WLA A;  5FQM A;  2P04 A;  1L0D A;  1OJ5 A;  5DJT A;  3UME A;  2J9P A;  5FQK A;  5GLC A;  3FPV A;  1ERQ A;  2V1A A;  1RGZ A;  5HAI A;  1LT0 A;  4MBK A;  2J3W A;  5DKK A;  3IWQ A;  5E2F A;  5TR7 A;  3WRT A;  3G34 A;  1SDE A;  3LR5 A;  3C4P A;  1WYC A;  3V39 A;  1PW8 A;  2GX5 A;  1QMF A;  5J4E A;  1SKO B;  2BLS A;  3FPW A;  5HWT A;  2JKT I;  1FCO A;  2W1T B;  4AFI A;  1T1A A;  4KG5 A;  4EUV A;  2KOI A;  3LIC A;  1FSY A;  4HP9 A;  3UDF A;  3UE0 A;  1KE4 A;  1MWS A;  4YOF A;  3RXW A;  2HDR A;  1XJ3 A;  5DTK A;  2V20 A;  4JXS A;  4LLO B;  3K2N A;  5HD5 A;  3CAX A;  1CF0 A;  3BFD A;  3WS5 A;  3LI9 A;  3KSI A;  1K6R A;  5F6A A;  1VQQ A;  4Y5F A;  1I5Q A;  3A3I A;  1BUL A;  1YT4 A;  3HLG A;  1ODV A;  3LCE A;  4WEK A;  3PBO A;  1TF1 A;  1YMX A;  1ZC2 A;  3C8C A;  1V9Y A;  5FSR A;  1Q2P A;  4WZ4 A;  3P09 A;  1YLW A;  3UB5 P;  2QJ5 A;  3VP4 A;  4IBX A;  4JGQ A;  2J3T C;  4N1H A;  2H0Y A;  1WA9 A;  2UV0 E;  3VE3 A;  3TJZ C;  1XPB A;  3HBR A;  4X1M A;  4S2L A;  2Y2J A;  2I9V A;  2V1B A;  2INW A;  3MF0 A;  3SH9 A;  2W27 A;  3H82 B;  3L9K A;  4BL2 A;  4WZ5 A;  5AQ7 A;  2K2N A;  4HJ4 A;  3FKV A;  1Z09 A;  1N9L A;  5EPH A;  2J80 A;  4GNU A;  1LL5 A;  4P6Z S;  1PWD A;  2QWS A;  4EW7 A;  2QZ6 A;  1STZ A;  3QP1 A;  1O07 A;  4MBH A;  3ZCZ A;  1ZG6 A;  1NYM A;  2VEA A;  1NRF A;  1D06 A;  3EQV A;  1N9B A;  1D1J A;  1GA9 A;  2IWC A;  1BLP A;  4GLQ A;  4EUZ A;  3A3E A;  1F9I A;  1S4R A;  2ZMA A;  1K57 A;  3CZD A;  2Y2K A;  3HLF A;  2NUT C;  4IVI A;  5EVE A;  3ZG8 B;  4GDB A;  4DE3 A;  2G7U A;  1DP8 A;  4ZRR A;  4BJP A;  3LGO A;  3CMZ A;  3LIB A;  3N7W A;  4DJ3 A;  3ZG0 A;  2P7J A;  3BY8 A;  2WGI A;  3BM6 A;  1Y28 A;  3U2A A;  5L2F A;  2Z6D A;  2HP5 A;  3Q07 A;  3TRC A;  1XA1 A;  4PHT A;  2WAD A;  2XH9 A;  2ZQ8 A;  2Y91 A;  3DTE A;  1ESU A;  4ZTK A;  3OZH A;  2Y4A A;  1DRM A;  4K0X A;  2X71 A;  3LY4 A;  3LY3 A;  1ES5 A;  3MKF A;  1LSW A;  2WAE A;  1EI5 A;  4OQI A;  3ZHH A; 
#chains in the Genus database with same CATH homology
 3ITA A;  2Q9M A;  4N92 A;  4S2M A;  1NY0 A;  1LLB A;  3BFC A;  4R4R A;  2QMI A;  5DF8 A;  4KQQ A;  2ZD8 A;  3C7V A;  3HLB A;  5A93 A;  1MKI A;  1LL9 A;  2XGN A;  3GQZ A;  3MKE A;  3G2Z A;  1ALQ A;  2ZC4 B;  3Q1F A;  2HPB A;  3HVF A;  3IT9 A;  3DW0 A;  4GZB A;  1XP4 A;  3GTC A;  4OQG A;  3TG9 A;  5IHV A;  4JXW A;  5EVI C;  4L0L A;  2OLU A;  3AGD A;  4EWF A;  3AGF A;  1IKI A;  2JE5 A;  1CK3 A;  4LCL A;  3ZG5 A;  4B88 A;  1ES4 A;  3SOI A;  1SCW A;  1KE0 A;  4OLG A;  4ZJ1 A;  1RCJ A;  5DF9 A;  4DF6 A;  4HEF A;  3O86 A;  4PM7 A;  4E6W A;  3V50 A;  2Y2G A;  3PBT A;  3GV9 A;  1YLT A;  1E3U A;  1J9M A;  3SH7 A;  3O87 A;  3WS0 A;  2XLN A;  4GN2 A;  4MNR A;  5FA7 A;  4CPK A;  5TGF A;  1YLY A;  5HX9 A;  4KG6 A;  3PBN A;  1TDL A;  3Q81 A;  4ID4 A;  4KZ6 A;  3ISG A;  4M3K A;  3MZF A;  2OLV A;  3MXR A;  2XK1 A;  5HL1 A;  3IHA A;  3W8K A;  4PMA A;  5FQI A;  2EXA A;  4N9L A;  1JVJ A;  2Q9N A;  4X6T A;  1YQS A;  3UDX A;  3GR2 A;  3UE3 A;  1WYB A;  4E3I A;  3IF6 C;  4GB7 A;  4Z9Q A;  2ZM0 A;  4WZ5 C;  3ZFZ A;  3SS3 A;  4NET A;  5CED A;  5G18 A;  4EQI A;  3UPP A;  4NK3 A;  1DJA A;  2WGW A;  2WUQ A;  1K6S A;  3VFF A;  3WWX A;  1BLH A;  1FR6 A;  1W5D A;  4FH2 A;  5J8X A;  3ZDJ A;  1G68 A;  4GD6 A;  4UA7 A;  3O88 A;  1GHM A;  2EFX A;  5EVI D;  1FOF A;  5CHJ A;  3WS1 A;  1XGJ A;  4WEJ A;  3UY6 A;  1JTG A;  1DY6 A;  4GDN A;  5KSH A;  2X01 A;  3W4P A;  3BLM A;  1MY8 A;  1H5X A;  3BFG A;  3QNC A;  4WBG A;  4C6Y A;  1MPL A;  1M40 A;  2A3U A;  1KGG A;  3OPP A;  1KVM A;  4RX3 A;  1H8Z A;  1KDW A;  3IQA A;  3NBL A;  3P98 A;  2FFY A;  3OPH A;  2JC7 A;  4X55 A;  4GOG A;  5CTN A;  1LHY A;  3SS4 A;  5A90 A;  2VGK A;  1GCE A;  3HLW A;  3OCL A;  1PI4 A;  1VM1 A;  5F83 A;  2B5R A;  3OCN A;  5HAP A;  3ZVW A;  1JWZ A;  1W8Y A;  4DXB A;  4OOM A;  5E2E A;  5DTS A;  2R9W A;  2XDM A;  1IYP A;  4U0X A;  2Y2H A;  3N8L A;  1YMS A;  3NI9 A;  1HVB A;  1MWU A;  3WRZ A;  4MBF A;  5EVI B;  1FCN A;  4HBU A;  3AGE A;  3VP1 A;  2DCF A;  1HD8 A;  2Y2O A;  3LEZ A;  4S2K A;  1K57 C;  4DE0 A;  3IXH A;  5KSC A;  2UWX A;  3ZGA B;  2PU4 A;  3DTM A;  2PU2 A;  3G2Y A;  2ZC6 B;  4K91 A;  5HW3 A;  1FR1 A;  1YLP A;  1LI0 A;  4OKP A;  2XD1 A;  2Z2M B;  5D3O A;  2EX8 A;  5CGW A;  4DRT A;  3C5A A;  1K38 A;  3PAE A;  1ES2 A;  1KDS A;  2HDS A;  2ZQ9 A;  3VSL A;  3G35 A;  1DJC A;  2J9O A;  3IXG A;  1RGY A;  1IYS A;  2EXB A;  3Q7V B;  2XR0 A;  2ZQ7 A;  1CI8 A;  4XXR A;  5CER A;  3DWK A;  5GHX A;  4HBT A;  4OVD A;  1K54 C;  1KE3 A;  3BYD A;  5AQB A;  4FH4 A;  3IF6 B;  4WMC A;  4DDY A;  4S2N A;  4LV1 A;  3IH8 A;  3ZNY A;  4B4Z A;  2HP9 A;  4Y0U A;  3MFD A;  2WKI A;  1GHI A;  1C3B A;  4R1G A;  2P9V A;  3UDI A;  3DWZ A;  2VGJ A;  4WYY A;  4JXV A;  5CXW A;  4E3K A;  4C3Q A;  1PWC A;  5GLB A;  5CHU A;  1Y54 A;  1K56 A;  1K55 A;  3OC2 A;  3WS4 A;  4BEN A;  4S2J A;  4BD1 A;  1ONG A;  4X69 A;  3VFH A;  3ZG0 A;  3VP0 A;  2CC1 A;  4OOY A;  4S2O A;  2C6W B;  3S22 A;  3HUM A;  4QY5 A;  1S0W A;  5EOE A;  2Y55 A;  1IEL A;  4E3J A;  1XGI A;  4KG2 A;  3BLS A;  4LCM A;  1O7E A;  4K0W A;  1IYO A;  2EX6 A;  3TOI A;  4JF4 A;  2GDN A;  4YFM A;  3Q7Z A;  3ZVT A;  5F1G A;  1E4D A;  3ZG9 B;  4RX2 A;  3PBQ A;  2ZJ9 A;  2RCX A;  4LEN A;  2J8Y A;  4P0M A;  3SH8 A;  5U47 A;  3HUN A;  4XUX A;  4ZAM A;  2ZM8 A;  3HLD A;  4P87 A;  3GSG A;  1L0E A;  1MBL A;  3HLE A;  5FAS A;  4Q8I A;  4BQM A;  3N6I A;  1U60 A;  1JTD A;  4KZ9 A;  1N4O A;  5FAT A;  3HRE A;  2G2U A;  3M6H A;  5F1F A;  1PW1 A;  2EX9 A;  2XEP A;  5CTM A;  4BL3 A;  2ZLY A;  4R3J A;  3G31 A;  1KVL A;  3GRJ A;  4U0T A;  5HAQ A;  2XFS A;  4Y0O A;  3W4Q A;  3A3J A;  1PI5 A;  4B4X A;  2HDU A;  4E6X A;  3VP2 A;  5HAR A;  3NC8 A;  4JF6 A;  5TFQ A;  1S6R A;  4X53 A;  1BLS A;  4WEL A;  1PZP A;  3GVB A;  2JBF A;  1NZU A;  1YLZ A;  3M2K A;  1BT5 A;  5FAO A;  3IXB A;  4OOL A;  4OQ0 A;  4KEN B;  4OPQ A;  4PPR A;  2XD5 A;  4X56 A;  4JPM A;  4PM6 A;  3OPL A;  3MZE A;  5A92 A;  1TEM A;  5GHZ A;  5JYP A;  3V5M A;  2HDQ A;  2WAF A;  3HL9 A;  4EBN A;  1L2S A;  3UPO A;  2XQZ A;  4UAA A;  5CEC A;  2Y59 A;  5FQM A;  4OPR A;  5F82 A;  1L0D A;  3HUO A;  1CEF A;  1SKF A;  1W8Q A;  2XF3 A;  3VMA A;  3M6B A;  4MEZ A;  4KQO A;  4N9K A;  2J9P A;  5FQK A;  3NDE A;  5DVA A;  5EE8 A;  3GMW A;  5GLC A;  4Y7P A;  1ERQ A;  2J7V A;  4PM5 A;  4E3N A;  1RGZ A;  4Y0T A;  3W4O A;  3PTE A;  3PAG A;  5HAI A;  4MBK A;  4O7D A;  1E3U D;  3CJM A;  4E3L A;  1TDG A;  1XX2 A;  5JYO A;  1K25 A;  2E8I A;  2Y2I A;  4LV2 A;  1IYQ A;  5GHY A;  1YLJ A;  5M18 A;  3IWQ A;  3JYI A;  3N8R A;  5E2F A;  5TR7 A;  3RXX A;  3WRT A;  1ZKJ A;  1SDE A;  3G34 A;  1NXY A;  5GLA A;  4OPY A;  3V3R A;  2WZZ A;  4JF5 A;  3UPN A;  4FD8 A;  4E3O A;  4P6B A;  4GD8 A;  1ESI A;  3C4P A;  2RL3 A;  3IXD A;  3LO7 A;  4JXG A;  5FI6 A;  1WYC A;  1E25 A;  3C7U A;  4QD4 A;  3V39 A;  4ZBE A;  1PW8 A;  1OME A;  1QMF A;  3IHB A;  4D2O A;  1MWT A;  4RYE A;  2BG1 A;  3A3D A;  5HFO A;  4KZ4 A;  5FI7 A;  2BLS A;  4ZJ2 A;  1BSG A;  2Y2M A;  2QPN A;  1FCO A;  5GL9 A;  4EV4 A;  1DJB A;  5EEC A;  3G4P A;  2G2W A;  3FKW A;  3Q82 A;  5EOO A;  1HZO A;  2P74 A;  1KGF A;  3O3V A;  4KG5 A;  1ERM A;  5EUA A;  5FAP A;  5KZH A;  1I2W A;  1FSY A;  3UDF A;  1AXB A;  3UE0 A;  4JBF A;  1CI9 A;  1KE4 A;  4OLD A;  1FCM A;  1MWS A;  2I72 A;  3RXW A;  4PM8 A;  4PM9 A;  3G30 A;  2HDR A;  1K4F A;  3PBS A;  5DTK A;  3NIA A;  1L0F A;  2XFT A;  2V20 A;  4OP5 A;  5DF7 A;  4JXS A;  3C4O A;  1W79 A;  4LV0 A;  3BEB A;  3OPR A;  3BFD A;  3WS5 A;  1K6R A;  3V3S A;  4LV3 A;  1LI9 A;  4KZB A;  5FQ9 A;  3RJU A;  3BFF A;  1IKG A;  1ONH A;  1VQQ A;  3MZD A;  3UO9 A;  4YIN A;  5E2G A;  1I5Q A;  4R4S A;  2WGW B;  3A3I A;  1BUL A;  3FZC A;  3E2L A;  3TSG A;  1YT4 A;  3HLG A;  4KZ5 A;  1K55 C;  3LCE A;  4WEK A;  3ITB A;  1GA0 A;  3PBO A;  1YMX A;  1ZC2 A;  4ZDX A;  1TVF A;  5FSR A;  1Q2P A;  1WE4 A;  4WZ4 A;  3A3F A;  2ZQC A;  3P09 A;  1NJ4 A;  1YLW A;  3UE1 A;  3ZG7 B;  3D4F A;  5EVI A;  2H0T A;  4OON A;  1Z6F A;  2ZM2 A;  1BZA A;  1I2S A;  1MXO A;  3VP4 A;  4UA9 A;  2WKE A;  4IBX A;  4KZ3 A;  1JWV A;  4UA6 A;  5E43 A;  4N1H A;  4R23 A;  2H0Y A;  3B3X A;  4IBR A;  5EVL A;  1H8Y A;  1XKZ A;  2WKH A;  5BOH A;  2WYX A;  1ERO A;  4DE2 A;  1ES3 A;  1FSW A;  4H8R A;  1XPB A;  2DNS A;  4HES A;  4DDS A;  3HBR A;  5E2H A;  1BLC A;  1W7F A;  3VOY A;  1YM1 A;  1RP5 A;  3Q7V A;  4XUZ A;  3NY4 A;  4N1X A;  4WMC D;  4S2L A;  2Y2J A;  4QU3 A;  1K4E A;  4RVA A;  4OH0 A;  1CEG A;  4C75 A;  2V2F F;  2OV5 A;  2ZQA A;  3SH9 A;  4E3M A;  1G6A A;  3IF6 A;  3BRM A;  2ZC3 B;  4OQH A;  4BL2 A;  4WZ5 A;  5AQ7 A;  3FV7 A;  1K56 D;  1PYY A;  3FKV A;  5FQJ A;  2WZX A;  1BTL A;  5EPH A;  4F94 A;  3BFE A;  4U3T A;  4KZ8 A;  4GNU A;  2OSU A;  2Y2N A;  1L0G A;  5DTT A;  1KGE A;  2X02 A;  3QNB A;  5FQQ A;  3BEC A;  3M2J A;  1LL5 A;  1PWD A;  3G32 A;  3NCK A;  3QHY A;  3EQU A;  3SS5 A;  5FDH A;  2QZ6 A;  4QHC A;  1O07 A;  2ZC7 A;  2WGV A;  3ZNT A;  4MBH A;  4JKT A;  4OPZ A;  1FQG A;  3ZCZ A;  3S1Y A;  3N8S A;  5FAQ A;  3IWI A;  2EFU A;  1ZG6 A;  2P9V B;  2EX2 A;  2Y2P A;  3N4I A;  1SHV A;  5M1A A;  4FSF A;  1NYM A;  4R0Q A;  1NRF A;  3VP3 A;  3EQV A;  1N9B A;  1GA9 A;  1GHP A;  4BD0 A;  2IWC A;  5AQA A;  4GKU A;  1BLP A;  3S4X A;  4EBL A;  4JLF A;  2IWB A;  4EUZ A;  4DKI A;  2IWD A;  3A3E A;  1IEM A;  3CG5 A;  3FYZ A;  4DE1 A;  2ZQD A;  4QJG A;  2C5W B;  1PWG A;  3HLC A;  3MBZ A;  5A91 A;  2ZMA A;  2R9X A;  4S2P A;  2HP6 A;  1K57 A;  3CZD A;  2Y2K A;  3HLF A;  3WS2 A;  4WM9 A;  4IVI A;  1XXM A;  3ZG8 B;  1NZO A;  4MLL A;  1JWP A;  4GDB A;  5KMW A;  4UHU A;  4DE3 A;  1MWR A;  3I7J A;  4RA7 A;  3UNW A;  4BJP A;  3MXS A;  4CJN A;  5AQ9 A;  3CMZ A;  3N7W A;  3IH9 A;  2ZC5 B;  3PBR A;  4P85 A;  2PBY A;  2V1Z A;  2DRW A;  4QB8 A;  1EWZ A;  2WGI A;  4QY6 A;  3BM6 A;  1PZO A;  1PIO A;  3IWO A;  3VSK A;  5CHM A;  5CEB A;  5L2F A;  2Y2L A;  3E2K A;  2HP5 A;  3Q07 A;  4IED A;  5FI2 A;  4X68 A;  1K54 A;  5M19 A;  1XA1 A;  4KQR A;  2FFF B;  3NDG A;  5CRF A;  1BUE A;  4FCF A;  4R3B A;  4KZA A;  4BLM A;  2H10 A;  1NYY A;  1ZG4 A;  2WAD A;  2XH9 A;  4DXC A;  1M6K A;  2ZQ8 A;  1HTZ A;  4ZJ3 A;  2JCH A;  5I94 A;  4S2N C;  5CGX A;  2A49 A;  2WK0 A;  1SDN A;  4KZ7 A;  2Z2L B;  1QME A;  4A5R A;  2Y2Q A;  2Y91 A;  1ESU A;  4ZTK A;  3VOZ A;  3OZH A;  2Y4A A;  4EBP A;  4OP8 A;  2H5S A;  3UN7 A;  4K0X A;  2X71 A;  3LY4 A;  4S2I A;  1XA7 A;  3LY3 A;  1ES5 A;  1Q2Q A;  4IVK A;  5GLD A;  3MKF A;  3IF5 A;  3FWL A;  2WAE A;  1EI5 A;  4OQI A;  3ZHH A;  5CGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...