4BD1A

Neutron structure of a perdeuterated toho-1 r274n r276n double mutant beta-lactamase in complex with a fully deuterated boronic acid (bzb)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOHO-1 BETA-LACTAMASE
publication title Neutron and X-Ray Crystal Structures of a Perdeuterated Enzyme Inhibitor Complex Reveal the Catalytic Proton Network of the Toho-1 Beta-Lactamase for the Acylation Reaction.
pubmed doi rcsb
source organism Escherichia coli bl21
molecule tags Hydrolase
total genus 94
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4bd1A00
1N9BA 3NY4A 1PI5A 1Y54A 5FDHA 3HBRA 1GA0A 4CJNA 2Y2MA 1JWPA 4XUZA 1KVMA 1WYCA 1K56D 5CGSA 4ZBEA 4HBUA 3ZGAB 4CPKA 1S0WA 1BLSA 2P9VB 3VP3A 1EI5A 3FKWA 4QY5A 1VM1A 4MEZA 1VQQA 2XK1A 5M18A 1L0FA 4GDBA 4XXRA 4BD0A 1EWZA 5GLCA 3EQVA 3HREA 2I72A 3HVFA 4UA9A 3C7VA 4IBXA 1KGGA 4C3QA 2HPBA 3QNCA 5CRFA 3VSLA 4E3MA 4KZ9A 1ZKJA 3PAEA 2HDRA 5GLAA 2EFUA 5GLDA 3CG5A 4R4SA 4RX2A 3Q81A 3MFDA 2CC1A 3OZHA 3UO9A 1FOFA 4S2PA 5TFQA 3DTMA 2IWDA 3ZG0A 4R1GA 3RXXA 3SH9A 3HLFA 3G31A 2ZQDA 1PIOA 4NETA 5D3OA 5DF8A 3G2ZA 5FI2A 2Y4AA 5AQBA 5I94A 1IKGA 3WWXA 1YQSA 3P98A 1M6KA 5CTNA 3WS0A 1CI8A 2C5WB 3V39A 3A3IA 3Q1FA 4LV2A 1ERMA 1IEMA 3ZCZA 4X6TA 4GN2A 2OLVA 3IWQA 1ONHA 3IWIA 4HBTA 4GOGA 4E3IA 1JTDA 4KZ3A 1TEMA 5FASA 4KQQA 2H10A 3E2KA 2Y2QA 3TG9A 4JXWA 4KG6A 2Y2KA 2WZXA 3NIAA 5AQ9A 1FR6A 1HTZA 4N9LA 2EXBA 4OP8A 3UNWA 3PBOA 5FQQA 4WM9A 4LCLA 3VMAA 3ZG5A 1C3BA 2V1ZA 4MBKA 5DF7A 4B88A 1HVBA 1KVLA 2WK0A 1IYPA 2Y55A 1E25A 4DKIA 2A49A 1FCMA 4X69A 3ITAA 4PM9A 1WE4A 1NZUA 2XD5A 2J9OA 3NDGA 3QNBA 3V3RA 5F1FA 5DTTA 3IXBA 3UPNA 4E3KA 5KZHA 1E3UD 4ZDXA 4S2NA 1BZAA 1KE3A 5CGXA 1W79A 3IXGA 3LY3A 3CMZA 4GZBA 3GVBA 4JXGA 4N9KA 4JXVA 4ZJ1A 1MPLA 2RCXA 1K25A 4R4RA 5FQJA 1ONGA 2OV5A 4LV0A 4C75A 2HP9A 1MBLA 3O87A 3FWLA 3O88A 4RA7A 2Y2PA 1DJAA 1QMFA 1FQGA 2OSUA 1S6RA 4IEDA 2H0TA 4PM6A 1GCEA 4DRTA 1Q2QA 1FCNA 1FSYA 1SCWA 3AGDA 1K55A 5GHZA 4E3JA 4MBHA 4EWFA 1KE4A 4K0XA 2ZQAA 2P74A 3IQAA 4S2IA 3M6HA 2H0YA 3M6BA 4MBFA 3MBZA 2EXAA 3PBRA 1KDWA 2ZMAA 4GB7A 5EUAA 4D2OA 4JXSA 4BL3A 4E3NA 2OLUA 2IWBA 2JCHA 4KZ8A 3RXWA 2ZC3B 1ZG4A 3WS5A 1BSGA 5EECA 3C7UA 3V50A 3GV9A 1W7FA 3IHAA 3MXRA 3OPRA 4QU3A 4E6WA 4U0TA 1CI9A 4Q8IA 3VFFA 1EROA 1I2SA 4DDSA 1GA9A 2DCFA 3W4QA 1H5XA 3NI9A 4OLGA 1Z6FA 4RX3A 5F82A 5TR7A 1PWDA 1XKZA 2Y2HA 5FQKA 3HUOA 5E2GA 4WYYA 4UHUA 3DWZA 3OPLA 3PBQA 1MWUA 4FCFA 2ZC6B 1MWRA 2XR0A 3PBNA 4S2NC 5EVIB 1NRFA 2WGWB 3BFCA 4FH4A 1CK3A 1XA1A 3CZDA 3OCLA 3LY4A 4BQMA 2RL3A 3D4FA 1RGYA 3IWOA 1ERQA 5M19A 3QHYA 4OOYA 3VP0A 1PI4A 3ZG8B 1KE0A 3VSKA 1KDSA 1M40A 4OPYA 2UWXA 2X71A 1BLCA 3NDEA 1K55C 3UPOA 1N4OA 3V3SA 2R9WA 1HD8A 5E2HA 3UPPA 5FATA 3C5AA 2Y2IA 1YLYA 3HLWA 4E3LA 1E3UA 1LL9A 3DWKA 4O7DA 5F1GA 5CTMA 1WYBA 1K6RA 3W4OA 3ZVTA 5E2EA 3RJUA 4L0LA 5HFOA 1H8YA 2XFSA 1BUEA 2X01A 3WS1A 4ZTKA 1SDNA 4RYEA 1BTLA 4RVAA 2HP5A 4PMAA 1YLJA 1IELA 1MWTA 5FAQA 4EQIA 3A3JA 4JLFA 5CEBA 3Q7ZA 4N92A 1XPBA 5EVIA 1U60A 1CEGA 3VP4A 2WGWA 3MZEA 3BFEA 3S22A 2XDMA 2ZM0A 4NK3A 3N8LA 3PTEA 4DE3A 1ES3A 1SKFA 2XQZA 4A5RA 2G2WA 3I7JA 4EBPA 2XGNA 5GLBA 2P9VA 3G2YA 3N7WA 1NZOA 4QB8A 3GMWA 1LLBA 5KSCA 1Q2PA 4DXCA 2Q9MA 4OPQA 1YMSA 3ZVWA 3ZNYA 5E2FA 4DE1A 4DDYA 3FZCA 4E3OA 1YM1A 4JF5A 5U47A 4BL2A 1TDLA 4DF6A 1RGZA 5KMWA 1YLTA 3NCKA 4OPZA 4X53A 1ES2A 2FFFB 2BLSA 2HDUA 2WAFA 1YLZA 1MWSA 1K6SA 2ZQCA 3BLMA 4GD8A 4OOMA 1MY8A 1XX2A 1LI0A 1PZPA 1NYYA 3MKFA 3PBSA 3LCEA 3V5MA 1PW1A 1FCOA 1IYSA 3VP1A 4C6YA 5CECA 1IYQA 2ZJ9A 3HLDA 4S2LA 2WADA 2ZM8A 5CHMA 3BFFA 3ZG9B 5KSHA 3HUMA 2XLNA 2WZZA 1JWVA 5CXWA 4DE2A 5EOOA 3UN7A 1KGFA 2WKHA 5E43A 1DY6A 3A3EA 4HEFA 1FSWA 1K54A 1PZOA 3ITBA 4EBLA 5EVID 4DE0A 3PBTA 4PM8A 2QMIA 5EVIC 2EX8A 4Y0TA 1GHPA 2DRWA 2J8YA 3AGFA 3IF5A 2ZQ8A 4GNUA 3GSGA 4N1HA 4R23A 1LHYA 3N4IA 2QPNA 5FI6A 3UE1A 5HL1A 3OC2A 2Y91A 3MZDA 2V20A 5CEDA 4ZJ2A 3E2LA 3NC8A 4MNRA 3A3DA 3BYDA 4WMCD 4ZJ3A 4ZAMA 3SS3A 3W8KA 4X56A 5EOEA 4BD1A 2X02A 4DXBA 3C4OA 4MLLA 3HLGA 4B4ZA 2G2UA 3Q07A 2E8IA 3HLCA 4HESA 1SHVA 2VGJA 4QHCA 4YINA 3UDFA 3SOIA 1H8ZA 4X68A 3S4XA 5TGFA 3BRMA 3IH8A 4OLDA 2ZD8A 4Y0UA 4R3JA 1MKIA 1FR1A 4P85A 4PPRA 4KQOA 3UE0A 1BULA 2ZLYA 4H8RA 5CHJA 4XUXA 2WUQA 4E6XA 1ES4A 4X55A 2Y2JA 1NXYA 5CERA 1IKIA 4K0WA 1PWCA 5EVLA 2XFTA 4GDNA 5A91A 1O07A 3HUNA 2PU2A 1W8QA 5AQ7A 3S1YA 4EV4A 3BLSA 4WZ5A 1GHMA 3FKVA 1W5DA 2V2FF 3UDXA 4ID4A 4IVKA 4KZ6A 2XH9A 4PM5A 1CEFA 4WEKA 1O7EA 4QJGA 2ZC7A 5EPHA 3VP2A 2Z2MB 1K54C 3TSGA 5DF9A 1G68A 3OPHA 5JYPA 1NYMA 1MXOA 4JKTA 3B3XA 4WBGA 4S2OA 4OQHA 3BM6A 3G30A 1XP4A 4P0MA 2HDSA 1K4EA 3IT9A 3GTCA 5M1AA 3G35A 4F94A 5FI7A 4Y0OA 1L0DA 5BOHA 5HW3A 1YLPA 2EX6A 5HAQA 2JC7A 3MKEA 3LEZA 3ZHHA 3ISGA 1JTGA 2ZQ7A 4FSFA 4IBRA 4OQGA 5AQAA 2BG1A 3ZNTA 4EUZA 2HDQA 1PWGA 2IWCA 2WGVA 3IF6B 4OKPA 2Y2OA 1K38A 2QZ6A 3W4PA 3A3FA 1XXMA 3GRJA 2XEPA 4WELA 3VOYA 3IHBA 2ZC4B 5DTKA 4OONA 4UA7A 1I2WA 3MZFA 4BENA 2HP6A 4KZ4A 3UE3A 3N8SA 1L2SA 5DTSA 4PM7A 2VGKA 3N6IA 3ZG7B 3IXDA 4U0XA 4BJPA 1E4DA 4KZ5A 5FA7A 4BLMA 5FQ9A 2WKEA 3O3VA 4WZ5C 5GHYA 3SS5A 5A93A 4WMCA 1I5QA 2ZQ9A 2ZC5B 2ZM2A 1LL5A 1SDEA 2J9PA 3AGEA 3OPPA 1QMEA 2JBFA 1PW8A 4K91A 3ZFZA 5JYOA 2A3UA 3G34A 1RP5A 3BFGA 3WRTA 3HL9A 3SS4A 4JPMA 1ESUA 5FQIA 2C6WB 2EFXA 1DJCA 3M2KA 2J7VA 1W8YA 4WZ4A 4OQ0A 1XA7A 5J8XA 4P87A 2WYXA 3WRZA 3Q82A 5F83A 3IF6A 1L0EA 4R3BA 1ESIA 1BLPA 1TVFA 3BEBA 3DW0A 4UA6A 1YMXA 3G4PA 1J9MA 4FH2A 1ZC2A 5CHUA 5HARA 4KZAA 3G32A 3BFDA 4Y7PA 2WAEA 4Z9QA 4JBFA 3Q7VB 1GHIA 3WS2A 3WS4A 1K57A 4LENA 3IXHA 2Y2LA 2FFYA 4KENB 4LV3A 1ES5A 1YLWA 2JE5A 4OPRA 2WKIA 1BT5A 1BLHA 1ZG6A 2B5RA 1JWZA 3UY6A 3FYZA 1K4FA 1YT4A 5HAIA 1LI9A 1PYYA 1TDGA 1AXBA 3GR2A 1K56A 2R9XA 1NY0A 5L2FA 4IVIA 5GHXA 2XD1A 2Z2LB 4U3TA 3EQUA 3IH9A 3PAGA 3HLEA 4S2JA 1IYOA 5FAPA 4M3KA 5A90A 4B4XA 4KQRA 4KZBA 3TOIA 2XF3A 1NJ4A 3VFHA 3VOZA 3MXSA 3N8RA 1G6AA 3OCNA 2EX2A 4S2KA 4LV1A 3CJMA 4KG2A 1DJBA 4YFMA 4OH0A 4P6BA 2EX9A 4EBNA 5FQMA 4JF6A 3M2JA 5A92A 4GKUA 3O86A 4OVDA 5DVAA 5HX9A 4OP5A 3UDIA 3P09A 3LO7A 5CGWA 4R0QA 3HLBA 3GQZA 2H5SA 4OQIA 5HAPA 1KGEA 3IF6C 3SH7A 1ALQA 2Y59A 4LCMA 2DNSA 3Q7VA 4N1XA 2PBYA 3JYIA 2Q9NA 1OMEA 1XGJA 3NBLA 3FV7A 5EE8A 4OOLA 2Y2GA 5G18A 5GL9A 3ZDJA 4QY6A 5FAOA 4FD8A 1HZOA 2PU4A 4WEJA 4JF4A 4GD6A 5FSRA 3SH8A 2Y2NA 1XGIA 4UAAA 3BECA 4S2MA 5IHVA 1K57C 2WGIA 1L0GA 1RCJA 4KZ7A 4KG5A 2GDNA 4QD4A 3C4PA 1JVJA
chains in the Genus database with same CATH superfamily
3O5YA 4Y13A 4CJNA 3FG8A 5L8MA 1WYCA 5DKLA 4ZBEA 2WKRA 4HBUA 4CLCA 4MEZA 5HDCA 4GDBA 4WLAA 2I72A 1KGGA 4E04A 2MJ6A 4E3MA 2HDRA 2BASA 5GLDA 5GLAA 4R4SA 4PAUA 1FOFA 3G31A 1PIOA 5D3OA 5DF8A 2Y4AA 1G28A 1YQSA 3WS0A 4YWZA 4G3VA 1ERMA 4LRZE 1VETB 3IWQA 1ONHA 3IWIA 4I3AA 3RTYA 4AFIA 4EEUA 4IUKA 3TG9A 4JXWA 4KG6A 3NIAA 3KSIA 4FTXA 4H6JA 5CX7A 5AQ9A 1HTZA 4N9LA 1JNUA 3UNWA 4WM9A 3VMAA 5DF7A 3JVVA 2ACGA 4X69A 2B18A 1V9ZA 2Z6CA 1GSVA 4ZDXA 5CGXA 3LY3A 4JXVA 4DN0A 2V8CA 4ESPA 1ONGA 4C75A 2HP9A 4HH3A 1S6RA 4PM6A 5IU1A 1Q2QA 3AGDA 5GHZA 4UEYA 4NEED 4MN7A 4EWFA 4S2IA 1G5UA 3NOUC 3PBRA 1KDWA 4GB7A 4E3NA 1L3LA 4KZ8A 4O01A 4B9OA 3RXWA 4ARZA 3GV9A 3IHAA 4U0TA 2D01A 1EROA 4DDSA 1GA9A 3W4QA 1S67L 5E2GA 1IFQA 3DWZA 3OPLA 2P7JA 1MWRA 2XR0A 2ZC6B 4S2NC 2W3EA 4BQMA 2RL3A 1NRJA 2EA9A 1F9IA 3VP0A 3ZG8B 3CLOA 2XA7M 2UWXA 2X71A 3NDEA 3DTKA 3EEHA 4HY8A 1N4OA 3V3SA 2R9WA 3IS2B 3UB7A 3C5AA 1LL9A 5CTMA 5TBMA 3ZVTA 3LIBA 2K7SA 5HFOA 2X01A 1T18A 1BTLA 1HLUP 2OOLA 5F6AA 1IELA 1CEGA 5DFYA 3MZEA 3S22A 3KYQA 2XDMA 2ZM0A 3K3DA 2HGVA 5EVEA 1XJ4A 4DE3A 1ES3A 2XRNA 3LI8A 5HSQA 3H7WB 3GMWA 1LLBA 1Q2PA 2PAVP 4GS9B 1PRQA 4OPQA 3ZVWA 4DJ2A 2W27A 2I9VA 5U47A 1TDLA 5KMWA 1YLTA 4HP9A 5HD3A 1K6SA 1MY8A 3PBSA 1W63M 1IYSA 4IJGA 5KSHA 2XLNA 4HI4A 2A24B 4DE2A 5EOOA 1KGFA 2JHEA 2WKHA 3A3EA 3T12B 3CWFA 4EBLA 3BWLA 4DE0A 4PM8A 2Y8HA 1KOUA 2QKPA 4GNUA 4R23A 1LHYA 2QPNA 3A0VA 2P04A 3NC8A 4ZAMA 4BD1A 1F5MA 2QHKA 4ZRRA 2W3HA 2B95A 1FILA 4YINA 1H8ZA 4E6XA 4X55A 4GDNA 3S1YA 1W8QA 3JVUA 2V2FF 4RQ9A 4IVKA 4UQIS 4NG2A 1CEFA 4WEKA 4QJGA 2Z2MB 3HJKA 1ACFA 1K54C 5DF9A 3OPHA 2ZOHA 3B3XA 5LBRA 4OQHA 2HDSA 5FI7A 4Y0OA 1YLPA 2BG1A 4EUZA 2IWCA 3IF6B 3W4PA 3A3FA 4WELA 2XEPA 5KIZA 1UWNX 2ZC4B 3IHBA 4R3AA 1I2WA 2LB5A 4KZ4A 3N8SA 5DTSA 3ZG7B 3IXDA 3FPWA 1S4RA 1I5QA 3NJAA 2ZC5B 1QMEA 3KSFA 1ESUA 5FQIA 3KO6A 2J7VA 4O0PA 5A8BA 3BY8A 2O9CA 3FPVA 5F83A 1BLPA 3DW0A 4FH2A 1ZC2A 5CHUA 2OAQ1 4Y7PA 3Q7VB 1GHIA 3VE4A 1K57A 2Y2LA 1OJ5A 2HF6A 4KENB 2GX5A 3GECA 1ES5A 4HIAA 3HJIA 1JWZA 3C2WA 2V1AA 1ZHHB 1YT4A 1PYYA 2R9XA 1NY0A 3SW1A 3HCYA 4IVIA 5GHXA 3IH9A 3PAGA 4S2JA 1MKMA 5FAPA 4CLCB 5A90A 3TOIA 2J3TD 1TD5A 3N8RA 3OCNA 1NWZA 3CJMA 3D72A 4YFMA 3D3OA 2KDKA 1D7EA 5DVAA 4R0QA 3VV4A 5HAPA 4BMWA 2Y59A 4LCMA 2PBYA 1UGUA 3JYIA 2XSSA 1XGJA 3NBLA 3FV7A 3ZDJA 2Y2GA 3MQOA 4QY6A 2PU4A 2HZ5A 2Y2NA 3BECA 5IHVA 3CPTA 4KZ7A 4LPZA 1JVJA 4GCZA 1DP9A 2W1RA 1PI5A 3HBRA 3T4SA 4XUZA 5MC7A 5CGSA 4CPKA 3ZGAB 1S0WA 3TJZC 4QY5A 4MN6A 5M18A 1L0FA 2GJ3A 2ZOIA 4XXRA 4H6JB 4BD0A 3HREA 4Y5FA 3C7VA 4IBXA 2HPBA 3VSLA 2P08A 1T1BA 4Y2FA 3CG5A 3MFDA 2XA7S 5HWVA 4S2PA 5EM0A 2IWDA 4JGOA 2L1MA 2FZ0A 1M6KA 4EETB 4FOFA 3Q1FA 4P6ZM 2K2NA 5DFXA 3UMEA 1IEMA 4HBTA 3P01A 4E3IA 3EEAA 4BBUA 1CJFA 1TEMA 5FASA 2Y2QA 3SZTA 3T4LA 3IX3A 2WZXA 2EXBA 3PBOA 4ARZB 5FQQA 5HL6A 3IX8A 3ZG5A 4B88A 1C3BA 2JKFA 2V1ZA 4MBKA 4DKIA 3MFXA 4KUKA 1FCMA 3ITAA 3IX4A 3ZYTA 1WE4A 3V3RA 2M7VA 2J9OA 3QNBA 4E3KA 5KZHA 1IOUA 1BZAA 1W79A 3IXGA 3CMZA 4IHQA 2HV1A 4ZJ1A 1V9YA 2RCXA 3QP4A 1K25A 3O87A 4EUVA 3FWLA 2O9BA 1QMFA 1FQGA 2OSUA 4I5SA 4IEDA 4BWIA 1DP8A 4DRTA 3BW6A 2A2LA 4E3JA 5G4YA 2P74A 2W0NA 3F1PA 1OJGA 1GSWA 2ZMAA 4D2OA 2OLUA 2IWBA 1XFQA 5TBMB 3MXRA 1W7FA 4QU3A 4E6WA 3OPRA 4Q8IA 1CI9A 3KSHA 1XJ2A 4JGPA 3OLOA 1Z6FA 5F82A 5FQKA 3HUOA 5HPFA 4G3KA 3PBQA 1MWUA 4FCFA 4FH4A 1X0OA 3OCLA 3MS6A 3CZDA 3LY4A 4NKPA 3D4FA 2VA0A 5J4EA 5M19A 5HWTA 1PI4A 1KE0A 1KDSA 3T4OA 1CF0A 1D06A 1K55C 4WL9A 1G6OA 3UPOA 1YAXA 1HD8A 5E2HA 2VV7A 4MCWA 5F1GA 1WYBA 3FC7A 4LRXC 1H8YA 3WS1A 4QWOA 3H82A 4RYEA 1YKDA 4I3JA 1T1CA 2W3GA 4PMAA 5FAQA 3RFBA 4N92A 4KQDA 5EVIA 1U60A 3VP4A 2WGWA 3BFEA 3N8LA 3JPUA 1SKFA 2XQZA 1Z09A 1N9OA 4EBPA 2XGNA 1F2KA 4QB8A 5KSCA 1YSQA 2LB9A 4II7A 4DDYA 4Q0HA 3FZCA 1YM1A 4R70A 1RGZA 3EGXC 4X53A 1ODVA 1OTAA 2BLSA 1YLZA 2KOIA 3BLMA 3UB8A 1XX2A 1LI0A 1PZPA 5AVFA 1LSWA 5CECA 3HLDA 4LRYC 2WADA 1JWVA 4HEFA 1XJ3A 4HH2A 3L7HA 3UB6A 3PBTA 2EX8A 3KYEA 3IF5A 2ZQ8A 3UE1A 5HL1A 3OC2A 3PHYA 2V20A 5CEDA 4ZJ2A 3W8KA 4MNRA 2HJEA 1S1YA 4K08A 2X02A 3D9YA 3C4OA 2G2UA 4HESA 1SHVA 3IBJA 3E4PA 4GHIA 3SOIA 4X68A 3LIDA 5TGFA 3BRMA 4R3JA 1MKIA 2NUTC 2WUQA 5CERA 2QJ5A 4K0WA 3TRCA 1PWCA 1O07A 3HUNA 3BLSA 1GHMA 1O7EA 4L9FA 3K2NA 3PYPA 5K5BA 5JYPA 4JKTA 4PKYA 2PYPA 4JGRA 4WBGA 3BM6A 1XP4A 3VE3A 5BOHA 5HW3A 2EX6A 5HAQA 3ZHHA 4R6LA 1PWGA 2WGVA 4OKPA 1K38A 2QZ6A 2V0WA 3LIEA 4GLQA 3UB5P 3LI9A 4XT2B 3N6IA 4U0XA 1TS0A 4BJPA 1E4DA 4KZ5A 3LIAA 4WZ5C 5HZHA 2ZM2A 3OPPA 1SDEA 3NOTC 5EFWA 2A3UA 3WRTA 2JKRI 3PXPA 2PR5A 4NXFA 3M2KA 5G4ZA 4WZ4A 4OQ0A 1OT6A 4P87A 3T4TA 2EWWA 1ESIA 1TVFA 3BEBA 4P6ZS 1ZTUA 5DKKA 3G32A 3BFDA 3MJQA 5HPIA 4Z9QA 4JBFA 4X1MA 4LENA 1STZA 3MXQA 3F1OA 1Y4OA 2WKPA 1YLWA 2WKIA 1BT5A 1BLHA 1ZG6A 3CPTB 5F5YA 2EWVA 1K4FA 1LI9A 4MMNA 3GR2A 3MSHA 1K56A 2XD1A 4U3TA 3TW8A 4FUWA 1IYOA 2O99A 3CUEC 1NJ4A 3MXSA 2EX2A 3ICYA 4F3LB 4LV1A 4KG2A 3O86A 4OVDA 4OP5A 3UDIA 3LO7A 4NXBA 3LR0A 2H5SA 1VHMA 3IF6C 4G3WA 3SH7A 4N1XA 4NXEA 2Q9NA 1OMEA 5EE8A 5GL9A 4OOLA 5FAOA 3CAXA 5AJGA 2PD8A 3LR5A 4GD6A 4UAAA 2WGIA 1L0GA 4KG5A 3BJNA 1N9BA 3NY4A 5FDHA 1GA0A 2Y2MA 1WA9A 1JWPA 3S7OA 3S7NA 1EI5A 4HJ6A 1VQQA 3MF0A 5GLCA 5HD5A 3HVFA 3QP8A 4L9GA 4C3QA 5CRFA 3QNCA 3EOIA 4KZ9A 1ZKJA 3PAEA 3UO9A 1N9NA 2CC1A 3OZHA 3UMDA 5TFQA 3DTMA 4R1GA 3SH9A 3F1NA 4NETA 4EW7A 4Y15A 3G2ZA 2W1TA 5DJTA 1IKGA 1S1ZA 4DMZA 2C5WB 3V39A 5I5LA 3ZCZA 4X6TA 2YKFA 2OLVA 1AWIA 1TS7A 3F1PB 1FR6A 4OP8A 4CLCC 1P9WA 4LCLA 3E98A 1H0MA 1KVLA 2WK0A 2Y55A 1E25A 2A49A 4XT2A 2XD5A 1GSXA 3NDGA 1E3UD 4S2NA 4GZBA 3GVBA 2VGLM 4NXGA 1TS6A 2PR6A 3UE6A 5FQJA 2OV5A 4RA7A 2Y2PA 1FSYA 1OT9A 3CHWP 4MBHA 1KE4A 4K0XA 2ZQAA 4X1LA 2H0YA 3M6BA 4MBFA 3MBZA 4EXOA 1LSVA 1DP6A 4BL3A 1XFNA 2JCHA 3P7NA 3T4JA 3G6OA 4CQHA 1ZG4A 3LR4A 5EECA 3VFFA 3K3CA 1H5XA 3H82B 3NI9A 4RX3A 1PWDA 4HHDA 4WF0A 1Y28A 2VJWA 4WYYA 4ETXA 4UHUA 5EVIB 3R7WA 1NRFA 3S7PA 2WGWB 3BFCA 1SZVA 3A0RA 3NHQA 3QP2A 1RGYA 5L07A 1ERQA 3QP1A 3B42A 3VSKA 1M40A 1D1JA 1BLCA 5EV0A 4F3LA 2W3DA 1A0KA 4DJ3A 2Y2IA 3HLWA 1E3UA 3DWKA 4O7DA 1K6RA 3W4OA 2XFSA 2WKQA 2HP5A 3T4QA 4EQIA 3A3JA 4ME4A 2VX8A 1OTBA 4JLFA 3Q7ZA 3NULA 3UB9A 4NK3A 2ZL1A 3L9KA 2G2WA 3I7JA 3G2YA 3N7WA 3W2ZA 5FEGA 2Q9MA 1YMSA 5TJJA 3ZNYA 5E2FA 4E3OA 2DMWA 4BL2A 4GHIB 3NCKA 4OPZA 3DBAA 2WAFA 4GD8A 5F68A 1NYYA 3MKFA 3LCEA 3V5MA 1PW1A 1FCOA 1IYQA 2ZJ9A 5EM1A 4S2LA 2ZM8A 3BFFA 5FDSA 1P97A 5CXWA 3UN7A 5E43A 1DY6A 1K54A 1PZOA 3BY9A 5EVID 1H8MA 2QMIA 4Y0TA 1GHPA 4N1HA 5FI6A 3N4IA 1N9LA 3MZDA 3BQ8A 3T1QB 3E2LA 3SS3A 3A3DA 4WMCD 4ZJ3A 2W3FA 4X56A 4DXBA 3V67A 1NLZA 4B4ZA 3Q07A 2E8IA 3HLCA 4MDZA 2JKRM 2VGJA 4QHCA 3UDFA 3S4XA 4OLDA 3IH8A 1OTDA 2ZD8A 4P85A 3UE0A 2ZLYA 5CHJA 2PBDP 1NXYA 3T1SA 5EVLA 2PU2A 2V9AA 4D60A 2H28A 3FKVA 3TE8A 3UDXA 4PM5A 2ZC7A 5EPHA 2J80A 3TSGA 1NYMA 1MXOA 4S2OA 5DJUA 1K4EA 4F94A 1L0DA 3EWKA 2JC7A 3MKEA 2AVXA 3ISGA 4FSFA 4IBRA 4OQGA 5AQAA 3ZNTA 1XXMA 2GNXA 3VOYA 1YPRA 4OONA 4UA7A 2HP6A 3UE3A 1L2SA 2VGKA 3F1OB 3U4LP 1P9RA 4BLMA 2INWA 5FQ9A 2WKEA 2KLIA 5GHYA 3SS5A 5A93A 4WMCA 1UWPX 2ZQ9A 1LL5A 2J9PA 1EW0A 5F69A 3ZFZA 3G34A 2G7UA 2C6WB 3QP6A 2E8JA 1DJCA 2VEAA 1W8YA 2WYXA 1S4SA 1SKOA 4R3BA 3CI6A 1J9MA 5HARA 4KZAA 3WS2A 2VV8A 3IXHA 2L0WA 2FFYA 5IT5A 4Q0JA 4PHTA 2B5RA 3UY6A 3FYZA 3NOPC 4BBVA 1TDGA 4HJ3A 3E4OA 2L4RA 3HLEA 4HQAA 3EGDC 4M3KA 4B4XA 2VGLS 4X25A 2FH5A 4B93A 2VKSA 5C5KA 1DJBA 4P6BA 2EX9A 4EBNA 4JF6A 3M2JA 4GKUA 2JN7A 3P09A 3GQZA 3PR6A 1KGEA 3LEQA 2JKTI 2DNSA 4JGQA 4EU0A 5G18A 3F1NB 2BTFP 1HZOA 4WEJA 2W1TB 3SH8A 4GW9A 1XGIA 1K57C 1RCJA 2GDNA 2PT7A 3C30A 4QD4A 3C4PA 4Y3IA 1VEUB 1Y54A 1DRMA 1KVMA 1K56D 2B02A 1BLSA 2P9VB 3VP3A 3FKWA 3DAVA 1MC0A 3MMHA 1J3WA 3OOVA 3T50A 1VM1A 2XK1A 1EWZA 3EQVA 4UA9A 2D02A 5J7EA 1W63Q 1CQAA 1P0ZA 3B47A 2CMNA 3E4QA 2EFUA 4MN5A 4EESA 4RX2A 3Q81A 2V0UA 3ZG0A 4HP4A 3RXXA 3HLFA 2ZQDA 3DTIA 5FEFA 4PKYG 5FI2A 3U2AA 5AQBA 5I94A 3WWXA 3P98A 5CTNA 2Y79A 4ETZA 1CI8A 3A3IA 4LV2A 3LIFA 1YSPA 4QPRA 4GN2A 4HJ4A 3KSGA 4GOGA 1JTDA 4KZ3A 3T4KA 4KQQA 2H10A 3E2KA 4LFUA 4I3IA 2Y2KA 3ULFA 4M4XA 1HVBA 1IYPA 5AVEA 4PM9A 1NZUA 5F1FA 5DTTA 3IXBA 3UPNA 1S66L 2OWJA 1KE3A 1MZUA 4JXGA 4N9KA 4L9EA 1MPLA 4HNBA 4R4RA 3R7WB 4LV0A 1MBLA 3O88A 1DJAA 2XROA 2H0TA 1GCEA 1FCNA 1SCWA 1K55A 4WUJA 1VETA 2VK3A 3IQAA 1T19A 3M6HA 1K0KA 2EXAA 2J3TC 2OWHA 5EUAA 4JXSA 4IUHA 2ZC3B 3A0SA 3WS5A 1BSGA 3GDIA 3C7UA 3V50A 1I2SA 2DCFA 5TR7A 4OLGA 1LT0A 1XKZA 2Y2HA 2ZMVA 3NECA 2ZBBA 3PBNA 2PYRA 1CK3A 1XA1A 2KX6A 1XJ6A 2OAP1 4I39A 3IWOA 3QHYA 4OOYA 2ZL1B 3MR0A 4R38A 2O9AA 4OPYA 3LR3A 3UPPA 3KX0X 5FATA 5FL3A 1YLYA 4E3LA 2K31A 3S7QA 1PNEA 5E2EA 1TS8A 3RJUA 4O8GA 3C38A 4L0LA 4Q0IA 1BUEA 3VOLA 4ZTKA 1SDNA 4YNRA 4WN5A 2V1BA 4RVAA 1YLJA 1MWTA 5CEBA 1XPBA 1NLYA 1H3QA 1VEUA 4BBTA 2YKHA 3PTEA 4A5RA 5GLBA 2P9VA 3CITA 1OTEA 1NZOA 2NUPC 4DXCA 2ZMFA 3IS2A 4DE1A 1OPXA 4JF5A 2PD7A 3ZQ5A 4DF6A 2QWSA 5HWWA 1ES2A 2FFFB 2HDUA 1VB6A 2ZQCA 1MWSA 4OOMA 3QP5A 3T1RA 2GZAA 3VP1A 4C6YA 5CHMA 3ZG9B 3HUMA 2WZZA 2Q0OA 4I38A 3OBFA 1FSWA 3ITBA 4HOIA 3B33A 5L09A 5EVIC 2DRWA 2J8YA 3KYZA 3H7WA 3AGFA 3GSGA 2Y91A 2M7UA 4GS9A 2JKGA 3BYDA 5EOEA 2VLGA 4MLLA 1T1AA 3HLGA 4Y0UA 1FR1A 4PPRA 3E0YA 4KQOA 1BULA 4H8RA 4XUXA 4KUOA 5IS1A 1ES4A 1PFLA 2Y2JA 3LUQA 2XFTA 5A91A 3C8CA 5AQ7A 4EV4A 4WZ5A 4EQ1A 2A24A 1W5DA 3RH8B 4ID4A 5L10A 4KZ6A 2XH9A 2VV6A 3VP2A 1BYWA 2VZWA 1G68A 3LYXA 3G30A 2V8FA 4P0MA 3IT9A 5M1AA 3GTCA 1OTIA 3G35A 3MQQA 2HJ9C 2M1CA 5HDSA 3LEZA 5HDDA 4GJ4A 1JTGA 2ZQ7A 1SKOB 2HDQA 2IA2A 2Y2OA 3GRJA 5DTKA 4EEPA 3MZFA 2UV0E 4BENA 2PDRA 2Z6DA 4PM7A 2JKTM 1TF1A 5FA7A 1FIKA 3O3VA 3LICA 2J3WA 2R78A 4LLOB 3AGEA 5JYOA 2JBFA 1LSXA 1PW8A 3CUEA 4K91A 4Z1WA 4CLCE 1RP5A 3BFGA 3HL9A 2PRFA 3SS4A 4JPMA 2EFXA 2QYBA 1XA7A 3IBRA 1LL8A 5J8XA 4YOFA 3WRZA 3Q82A 3IF6A 1L0EA 4LGWA 3MQ0A 4UA6A 4CLCD 1YMXA 3R4KA 3G4PA 4EERA 2WAEA 1F98A 3WS4A 4LV3A 3BQAA 2JE5A 3DTEA 4OPRA 5HAIA 1AXBA 5L2FA 2Z2LB 3LFVA 3EQUA 3H9WA 2QJ7A 4KQRA 4KZBA 3VFHA 2XF3A 3VOZA 4UQIM 1G6AA 4S2KA 3LGOA 2O0YA 4OH0A 2PHYA 5FQMA 5A92A 5HX9A 3T1XA 5CGWA 3HLBA 4OQIA 1ALQA 3Q7VA 5J3WA 4FD8A 4JF4A 5FSRA 4S2MA 4Y17A 1IKIA
chains in the Genus database with same CATH topology
1N9BA 3NY4A 1PI5A 1Y54A 5FDHA 3HBRA 1GA0A 4CJNA 2Y2MA 1JWPA 4XUZA 1KVMA 1WYCA 1K56D 5CGSA 4ZBEA 4HBUA 3ZGAB 4CPKA 1S0WA 1BLSA 2P9VB 3VP3A 1EI5A 3FKWA 4QY5A 1VM1A 4MEZA 1VQQA 2XK1A 5M18A 1L0FA 4GDBA 4XXRA 4BD0A 1EWZA 5GLCA 3EQVA 3HREA 2I72A 3HVFA 4UA9A 3C7VA 4IBXA 1KGGA 4C3QA 2HPBA 3QNCA 5CRFA 3VSLA 4E3MA 4KZ9A 1ZKJA 3PAEA 2HDRA 5GLAA 2EFUA 5GLDA 3CG5A 4R4SA 4RX2A 3Q81A 3MFDA 2CC1A 3OZHA 3UO9A 1FOFA 4S2PA 5TFQA 3DTMA 2IWDA 3ZG0A 4R1GA 3RXXA 3SH9A 3HLFA 3G31A 2ZQDA 1PIOA 4NETA 5D3OA 5DF8A 3G2ZA 5FI2A 2Y4AA 5AQBA 5I94A 1IKGA 3WWXA 1YQSA 3P98A 1M6KA 5CTNA 3WS0A 1CI8A 2C5WB 3V39A 3A3IA 3Q1FA 4LV2A 1ERMA 1IEMA 3ZCZA 4X6TA 4GN2A 2OLVA 3IWQA 1ONHA 3IWIA 4HBTA 4GOGA 4E3IA 1JTDA 4KZ3A 1TEMA 5FASA 4KQQA 2H10A 3E2KA 2Y2QA 3TG9A 4JXWA 4KG6A 2Y2KA 2WZXA 3NIAA 5AQ9A 1FR6A 1HTZA 4N9LA 2EXBA 4OP8A 3UNWA 3PBOA 5FQQA 4WM9A 4LCLA 3VMAA 3ZG5A 1C3BA 2V1ZA 4MBKA 5DF7A 4B88A 1HVBA 1KVLA 2WK0A 1IYPA 2Y55A 1E25A 4DKIA 2A49A 1FCMA 4X69A 3ITAA 4PM9A 1WE4A 1NZUA 2XD5A 2J9OA 3NDGA 3QNBA 3V3RA 5F1FA 5DTTA 3IXBA 3UPNA 4E3KA 5KZHA 1E3UD 4ZDXA 4S2NA 1BZAA 1KE3A 5CGXA 1W79A 3IXGA 3LY3A 3CMZA 4GZBA 3GVBA 4JXGA 4N9KA 4JXVA 4ZJ1A 1MPLA 2RCXA 1K25A 4R4RA 5FQJA 1ONGA 2OV5A 4LV0A 4C75A 2HP9A 1MBLA 3O87A 3FWLA 3O88A 4RA7A 2Y2PA 1DJAA 1QMFA 1FQGA 2OSUA 1S6RA 4IEDA 2H0TA 4PM6A 1GCEA 4DRTA 1Q2QA 1FCNA 1FSYA 1SCWA 3AGDA 1K55A 5GHZA 4E3JA 4MBHA 4EWFA 1KE4A 4K0XA 2ZQAA 2P74A 3IQAA 4S2IA 3M6HA 2H0YA 3M6BA 4MBFA 3MBZA 2EXAA 3PBRA 1KDWA 2ZMAA 4GB7A 5EUAA 4D2OA 4JXSA 4BL3A 4E3NA 2OLUA 2IWBA 2JCHA 4KZ8A 3RXWA 2ZC3B 1ZG4A 3WS5A 1BSGA 5EECA 3C7UA 3V50A 3GV9A 1W7FA 3IHAA 3MXRA 3OPRA 4QU3A 4E6WA 4U0TA 1CI9A 4Q8IA 3VFFA 1EROA 1I2SA 4DDSA 1GA9A 2DCFA 3W4QA 1H5XA 3NI9A 4OLGA 1Z6FA 4RX3A 5F82A 5TR7A 1PWDA 1XKZA 2Y2HA 5FQKA 3HUOA 5E2GA 4WYYA 4UHUA 3DWZA 3OPLA 3PBQA 1MWUA 4FCFA 2ZC6B 1MWRA 2XR0A 3PBNA 4S2NC 5EVIB 1NRFA 2WGWB 3BFCA 4FH4A 1CK3A 1XA1A 3CZDA 3OCLA 3LY4A 4BQMA 2RL3A 3D4FA 1RGYA 3IWOA 1ERQA 5M19A 3QHYA 4OOYA 3VP0A 1PI4A 3ZG8B 1KE0A 3VSKA 1KDSA 1M40A 4OPYA 2UWXA 2X71A 1BLCA 3NDEA 1K55C 3UPOA 1N4OA 3V3SA 2R9WA 1HD8A 5E2HA 3UPPA 5FATA 3C5AA 2Y2IA 1YLYA 3HLWA 4E3LA 1E3UA 1LL9A 3DWKA 4O7DA 5F1GA 5CTMA 1WYBA 1K6RA 3W4OA 3ZVTA 5E2EA 3RJUA 4L0LA 5HFOA 1H8YA 2XFSA 1BUEA 2X01A 3WS1A 4ZTKA 1SDNA 4RYEA 1BTLA 4RVAA 2HP5A 4PMAA 1YLJA 1IELA 1MWTA 5FAQA 4EQIA 3A3JA 4JLFA 5CEBA 3Q7ZA 4N92A 1XPBA 5EVIA 1U60A 1CEGA 3VP4A 2WGWA 3MZEA 3BFEA 3S22A 2XDMA 2ZM0A 4NK3A 3N8LA 3PTEA 4DE3A 1ES3A 1SKFA 2XQZA 4A5RA 2G2WA 3I7JA 4EBPA 2XGNA 5GLBA 2P9VA 3G2YA 3N7WA 1NZOA 4QB8A 3GMWA 1LLBA 5KSCA 1Q2PA 4DXCA 2Q9MA 4OPQA 1YMSA 3ZVWA 3ZNYA 5E2FA 4DE1A 4DDYA 3FZCA 4E3OA 1YM1A 4JF5A 5U47A 4BL2A 1TDLA 4DF6A 1RGZA 5KMWA 1YLTA 3NCKA 4OPZA 4X53A 1ES2A 2FFFB 2BLSA 2HDUA 2WAFA 1YLZA 1MWSA 1K6SA 2ZQCA 3BLMA 4GD8A 4OOMA 1MY8A 1XX2A 1LI0A 1PZPA 1NYYA 3MKFA 3PBSA 3LCEA 3V5MA 1PW1A 1FCOA 1IYSA 3VP1A 4C6YA 5CECA 1IYQA 2ZJ9A 3HLDA 4S2LA 2WADA 2ZM8A 5CHMA 3BFFA 3ZG9B 5KSHA 3HUMA 2XLNA 2WZZA 1JWVA 5CXWA 4DE2A 5EOOA 3UN7A 1KGFA 2WKHA 5E43A 1DY6A 3A3EA 4HEFA 1FSWA 1K54A 1PZOA 3ITBA 4EBLA 5EVID 4DE0A 3PBTA 4PM8A 2QMIA 5EVIC 2EX8A 4Y0TA 1GHPA 2DRWA 2J8YA 3AGFA 3IF5A 2ZQ8A 4GNUA 3GSGA 4N1HA 4R23A 1LHYA 3N4IA 2QPNA 5FI6A 3UE1A 5HL1A 3OC2A 2Y91A 3MZDA 2V20A 5CEDA 4ZJ2A 3E2LA 3NC8A 4MNRA 3A3DA 3BYDA 4WMCD 4ZJ3A 4ZAMA 3SS3A 3W8KA 4X56A 5EOEA 4BD1A 2X02A 4DXBA 3C4OA 4MLLA 3HLGA 4B4ZA 2G2UA 3Q07A 2E8IA 3HLCA 4HESA 1SHVA 2VGJA 4QHCA 4YINA 3UDFA 3SOIA 1H8ZA 4X68A 3S4XA 5TGFA 3BRMA 3IH8A 4OLDA 2ZD8A 4Y0UA 4R3JA 1MKIA 1FR1A 4P85A 4PPRA 4KQOA 3UE0A 1BULA 2ZLYA 4H8RA 5CHJA 4XUXA 2WUQA 4E6XA 1ES4A 4X55A 2Y2JA 1NXYA 5CERA 1IKIA 4K0WA 1PWCA 5EVLA 2XFTA 4GDNA 5A91A 1O07A 3HUNA 2PU2A 1W8QA 5AQ7A 3S1YA 4EV4A 3BLSA 4WZ5A 1GHMA 3FKVA 1W5DA 2V2FF 3UDXA 4ID4A 4IVKA 4KZ6A 2XH9A 4PM5A 1CEFA 4WEKA 1O7EA 4QJGA 2ZC7A 5EPHA 3VP2A 2Z2MB 1K54C 3TSGA 5DF9A 1G68A 3OPHA 5JYPA 1NYMA 1MXOA 4JKTA 3B3XA 4WBGA 4S2OA 4OQHA 3BM6A 3G30A 1XP4A 4P0MA 2HDSA 1K4EA 3IT9A 3GTCA 5M1AA 3G35A 4F94A 5FI7A 4Y0OA 1L0DA 5BOHA 5HW3A 1YLPA 2EX6A 5HAQA 2JC7A 3MKEA 3LEZA 3ZHHA 3ISGA 1JTGA 2ZQ7A 4FSFA 4IBRA 4OQGA 5AQAA 2BG1A 3ZNTA 4EUZA 2HDQA 1PWGA 2IWCA 2WGVA 3IF6B 4OKPA 2Y2OA 1K38A 2QZ6A 3W4PA 3A3FA 1XXMA 3GRJA 2XEPA 4WELA 3VOYA 3IHBA 2ZC4B 5DTKA 4OONA 4UA7A 1I2WA 3MZFA 4BENA 2HP6A 4KZ4A 3UE3A 3N8SA 1L2SA 5DTSA 4PM7A 2VGKA 3N6IA 3ZG7B 3IXDA 4U0XA 4BJPA 1E4DA 4KZ5A 5FA7A 4BLMA 5FQ9A 2WKEA 3O3VA 4WZ5C 5GHYA 3SS5A 5A93A 4WMCA 1I5QA 2ZQ9A 2ZC5B 2ZM2A 1LL5A 1SDEA 2J9PA 3AGEA 3OPPA 1QMEA 2JBFA 1PW8A 4K91A 3ZFZA 5JYOA 2A3UA 3G34A 1RP5A 3BFGA 3WRTA 3HL9A 3SS4A 4JPMA 1ESUA 5FQIA 2C6WB 2EFXA 1DJCA 3M2KA 2J7VA 1W8YA 4WZ4A 4OQ0A 1XA7A 5J8XA 4P87A 2WYXA 3WRZA 3Q82A 5F83A 3IF6A 1L0EA 4R3BA 1ESIA 1BLPA 1TVFA 3BEBA 3DW0A 4UA6A 1YMXA 3G4PA 1J9MA 4FH2A 1ZC2A 5CHUA 5HARA 4KZAA 3G32A 3BFDA 4Y7PA 2WAEA 4Z9QA 4JBFA 3Q7VB 1GHIA 3WS2A 3WS4A 1K57A 4LENA 3IXHA 2Y2LA 2FFYA 4KENB 4LV3A 1ES5A 1YLWA 2JE5A 4OPRA 2WKIA 1BT5A 1BLHA 1ZG6A 2B5RA 1JWZA 3UY6A 3FYZA 1K4FA 1YT4A 5HAIA 1LI9A 1PYYA 1TDGA 1AXBA 3GR2A 1K56A 2R9XA 1NY0A 5L2FA 4IVIA 5GHXA 2XD1A 2Z2LB 4U3TA 3EQUA 3IH9A 3PAGA 3HLEA 4S2JA 1IYOA 5FAPA 4M3KA 5A90A 4B4XA 4KQRA 4KZBA 3TOIA 2XF3A 1NJ4A 3VFHA 3VOZA 3MXSA 3N8RA 1G6AA 3OCNA 2EX2A 4S2KA 4LV1A 3CJMA 4KG2A 1DJBA 4YFMA 4OH0A 4P6BA 2EX9A 4EBNA 5FQMA 4JF6A 3M2JA 5A92A 4GKUA 3O86A 4OVDA 5DVAA 5HX9A 4OP5A 3UDIA 3P09A 3LO7A 5CGWA 4R0QA 3HLBA 3GQZA 2H5SA 4OQIA 5HAPA 1KGEA 3IF6C 3SH7A 1ALQA 2Y59A 4LCMA 2DNSA 3Q7VA 4N1XA 2PBYA 3JYIA 2Q9NA 1OMEA 1XGJA 3NBLA 3FV7A 5EE8A 4OOLA 2Y2GA 5G18A 5GL9A 3ZDJA 4QY6A 5FAOA 4FD8A 1HZOA 2PU4A 4WEJA 4JF4A 4GD6A 5FSRA 3SH8A 2Y2NA 1XGIA 4UAAA 3BECA 4S2MA 5IHVA 1K57C 2WGIA 1L0GA 1RCJA 4KZ7A 4KG5A 2GDNA 4QD4A 3C4PA 1JVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9B A;  3NY4 A;  1PI5 A;  1Y54 A;  5FDH A;  3HBR A;  1GA0 A;  4CJN A;  2Y2M A;  1JWP A;  4XUZ A;  1KVM A;  1WYC A;  1K56 D;  5CGS A;  4ZBE A;  4HBU A;  3ZGA B;  4CPK A;  1S0W A;  1BLS A;  2P9V B;  3VP3 A;  1EI5 A;  3FKW A;  4QY5 A;  1VM1 A;  4MEZ A;  1VQQ A;  2XK1 A;  5M18 A;  1L0F A;  4GDB A;  4XXR A;  4BD0 A;  1EWZ A;  5GLC A;  3EQV A;  3HRE A;  2I72 A;  3HVF A;  4UA9 A;  3C7V A;  4IBX A;  1KGG A;  4C3Q A;  2HPB A;  3QNC A;  5CRF A;  3VSL A;  4E3M A;  4KZ9 A;  1ZKJ A;  3PAE A;  2HDR A;  5GLA A;  2EFU A;  5GLD A;  3CG5 A;  4R4S A;  4RX2 A;  3Q81 A;  3MFD A;  2CC1 A;  3OZH A;  3UO9 A;  1FOF A;  4S2P A;  5TFQ A;  3DTM A;  2IWD A;  3ZG0 A;  4R1G A;  3RXX A;  3SH9 A;  3HLF A;  3G31 A;  2ZQD A;  1PIO A;  4NET A;  5D3O A;  5DF8 A;  3G2Z A;  5FI2 A;  2Y4A A;  5AQB A;  5I94 A;  1IKG A;  3WWX A;  1YQS A;  3P98 A;  1M6K A;  5CTN A;  3WS0 A;  1CI8 A;  2C5W B;  3V39 A;  3A3I A;  3Q1F A;  4LV2 A;  1ERM A;  1IEM A;  3ZCZ A;  4X6T A;  4GN2 A;  2OLV A;  3IWQ A;  1ONH A;  3IWI A;  4HBT A;  4GOG A;  4E3I A;  1JTD A;  4KZ3 A;  1TEM A;  5FAS A;  4KQQ A;  2H10 A;  3E2K A;  2Y2Q A;  3TG9 A;  4JXW A;  4KG6 A;  2Y2K A;  2WZX A;  3NIA A;  5AQ9 A;  1FR6 A;  1HTZ A;  4N9L A;  2EXB A;  4OP8 A;  3UNW A;  3PBO A;  5FQQ A;  4WM9 A;  4LCL A;  3VMA A;  3ZG5 A;  1C3B A;  2V1Z A;  4MBK A;  5DF7 A;  4B88 A;  1HVB A;  1KVL A;  2WK0 A;  1IYP A;  2Y55 A;  1E25 A;  4DKI A;  2A49 A;  1FCM A;  4X69 A;  3ITA A;  4PM9 A;  1WE4 A;  1NZU A;  2XD5 A;  2J9O A;  3NDG A;  3QNB A;  3V3R A;  5F1F A;  5DTT A;  3IXB A;  3UPN A;  4E3K A;  5KZH A;  1E3U D;  4ZDX A;  4S2N A;  1BZA A;  1KE3 A;  5CGX A;  1W79 A;  3IXG A;  3LY3 A;  3CMZ A;  4GZB A;  3GVB A;  4JXG A;  4N9K A;  4JXV A;  4ZJ1 A;  1MPL A;  2RCX A;  1K25 A;  4R4R A;  5FQJ A;  1ONG A;  2OV5 A;  4LV0 A;  4C75 A;  2HP9 A;  1MBL A;  3O87 A;  3FWL A;  3O88 A;  4RA7 A;  2Y2P A;  1DJA A;  1QMF A;  1FQG A;  2OSU A;  1S6R A;  4IED A;  2H0T A;  4PM6 A;  1GCE A;  4DRT A;  1Q2Q A;  1FCN A;  1FSY A;  1SCW A;  3AGD A;  1K55 A;  5GHZ A;  4E3J A;  4MBH A;  4EWF A;  1KE4 A;  4K0X A;  2ZQA A;  2P74 A;  3IQA A;  4S2I A;  3M6H A;  2H0Y A;  3M6B A;  4MBF A;  3MBZ A;  2EXA A;  3PBR A;  1KDW A;  2ZMA A;  4GB7 A;  5EUA A;  4D2O A;  4JXS A;  4BL3 A;  4E3N A;  2OLU A;  2IWB A;  2JCH A;  4KZ8 A;  3RXW A;  2ZC3 B;  1ZG4 A;  3WS5 A;  1BSG A;  5EEC A;  3C7U A;  3V50 A;  3GV9 A;  1W7F A;  3IHA A;  3MXR A;  3OPR A;  4QU3 A;  4E6W A;  4U0T A;  1CI9 A;  4Q8I A;  3VFF A;  1ERO A;  1I2S A;  4DDS A;  1GA9 A;  2DCF A;  3W4Q A;  1H5X A;  3NI9 A;  4OLG A;  1Z6F A;  4RX3 A;  5F82 A;  5TR7 A;  1PWD A;  1XKZ A;  2Y2H A;  5FQK A;  3HUO A;  5E2G A;  4WYY A;  4UHU A;  3DWZ A;  3OPL A;  3PBQ A;  1MWU A;  4FCF A;  2ZC6 B;  1MWR A;  2XR0 A;  3PBN A;  4S2N C;  5EVI B;  1NRF A;  2WGW B;  3BFC A;  4FH4 A;  1CK3 A;  1XA1 A;  3CZD A;  3OCL A;  3LY4 A;  4BQM A;  2RL3 A;  3D4F A;  1RGY A;  3IWO A;  1ERQ A;  5M19 A;  3QHY A;  4OOY A;  3VP0 A;  1PI4 A;  3ZG8 B;  1KE0 A;  3VSK A;  1KDS A;  1M40 A;  4OPY A;  2UWX A;  2X71 A;  1BLC A;  3NDE A;  1K55 C;  3UPO A;  1N4O A;  3V3S A;  2R9W A;  1HD8 A;  5E2H A;  3UPP A;  5FAT A;  3C5A A;  2Y2I A;  1YLY A;  3HLW A;  4E3L A;  1E3U A;  1LL9 A;  3DWK A;  4O7D A;  5F1G A;  5CTM A;  1WYB A;  1K6R A;  3W4O A;  3ZVT A;  5E2E A;  3RJU A;  4L0L A;  5HFO A;  1H8Y A;  2XFS A;  1BUE A;  2X01 A;  3WS1 A;  4ZTK A;  1SDN A;  4RYE A;  1BTL A;  4RVA A;  2HP5 A;  4PMA A;  1YLJ A;  1IEL A;  1MWT A;  5FAQ A;  4EQI A;  3A3J A;  4JLF A;  5CEB A;  3Q7Z A;  4N92 A;  1XPB A;  5EVI A;  1U60 A;  1CEG A;  3VP4 A;  2WGW A;  3MZE A;  3BFE A;  3S22 A;  2XDM A;  2ZM0 A;  4NK3 A;  3N8L A;  3PTE A;  4DE3 A;  1ES3 A;  1SKF A;  2XQZ A;  4A5R A;  2G2W A;  3I7J A;  4EBP A;  2XGN A;  5GLB A;  2P9V A;  3G2Y A;  3N7W A;  1NZO A;  4QB8 A;  3GMW A;  1LLB A;  5KSC A;  1Q2P A;  4DXC A;  2Q9M A;  4OPQ A;  1YMS A;  3ZVW A;  3ZNY A;  5E2F A;  4DE1 A;  4DDY A;  3FZC A;  4E3O A;  1YM1 A;  4JF5 A;  5U47 A;  4BL2 A;  1TDL A;  4DF6 A;  1RGZ A;  5KMW A;  1YLT A;  3NCK A;  4OPZ A;  4X53 A;  1ES2 A;  2FFF B;  2BLS A;  2HDU A;  2WAF A;  1YLZ A;  1MWS A;  1K6S A;  2ZQC A;  3BLM A;  4GD8 A;  4OOM A;  1MY8 A;  1XX2 A;  1LI0 A;  1PZP A;  1NYY A;  3MKF A;  3PBS A;  3LCE A;  3V5M A;  1PW1 A;  1FCO A;  1IYS A;  3VP1 A;  4C6Y A;  5CEC A;  1IYQ A;  2ZJ9 A;  3HLD A;  4S2L A;  2WAD A;  2ZM8 A;  5CHM A;  3BFF A;  3ZG9 B;  5KSH A;  3HUM A;  2XLN A;  2WZZ A;  1JWV A;  5CXW A;  4DE2 A;  5EOO A;  3UN7 A;  1KGF A;  2WKH A;  5E43 A;  1DY6 A;  3A3E A;  4HEF A;  1FSW A;  1K54 A;  1PZO A;  3ITB A;  4EBL A;  5EVI D;  4DE0 A;  3PBT A;  4PM8 A;  2QMI A;  5EVI C;  2EX8 A;  4Y0T A;  1GHP A;  2DRW A;  2J8Y A;  3AGF A;  3IF5 A;  2ZQ8 A;  4GNU A;  3GSG A;  4N1H A;  4R23 A;  1LHY A;  3N4I A;  2QPN A;  5FI6 A;  3UE1 A;  5HL1 A;  3OC2 A;  2Y91 A;  3MZD A;  2V20 A;  5CED A;  4ZJ2 A;  3E2L A;  3NC8 A;  4MNR A;  3A3D A;  3BYD A;  4WMC D;  4ZJ3 A;  4ZAM A;  3SS3 A;  3W8K A;  4X56 A;  5EOE A;  4BD1 A;  2X02 A;  4DXB A;  3C4O A;  4MLL A;  3HLG A;  4B4Z A;  2G2U A;  3Q07 A;  2E8I A;  3HLC A;  4HES A;  1SHV A;  2VGJ A;  4QHC A;  4YIN A;  3UDF A;  3SOI A;  1H8Z A;  4X68 A;  3S4X A;  5TGF A;  3BRM A;  3IH8 A;  4OLD A;  2ZD8 A;  4Y0U A;  4R3J A;  1MKI A;  1FR1 A;  4P85 A;  4PPR A;  4KQO A;  3UE0 A;  1BUL A;  2ZLY A;  4H8R A;  5CHJ A;  4XUX A;  2WUQ A;  4E6X A;  1ES4 A;  4X55 A;  2Y2J A;  1NXY A;  5CER A;  1IKI A;  4K0W A;  1PWC A;  5EVL A;  2XFT A;  4GDN A;  5A91 A;  1O07 A;  3HUN A;  2PU2 A;  1W8Q A;  5AQ7 A;  3S1Y A;  4EV4 A;  3BLS A;  4WZ5 A;  1GHM A;  3FKV A;  1W5D A;  2V2F F;  3UDX A;  4ID4 A;  4IVK A;  4KZ6 A;  2XH9 A;  4PM5 A;  1CEF A;  4WEK A;  1O7E A;  4QJG A;  2ZC7 A;  5EPH A;  3VP2 A;  2Z2M B;  1K54 C;  3TSG A;  5DF9 A;  1G68 A;  3OPH A;  5JYP A;  1NYM A;  1MXO A;  4JKT A;  3B3X A;  4WBG A;  4S2O A;  4OQH A;  3BM6 A;  3G30 A;  1XP4 A;  4P0M A;  2HDS A;  1K4E A;  3IT9 A;  3GTC A;  5M1A A;  3G35 A;  4F94 A;  5FI7 A;  4Y0O A;  1L0D A;  5BOH A;  5HW3 A;  1YLP A;  2EX6 A;  5HAQ A;  2JC7 A;  3MKE A;  3LEZ A;  3ZHH A;  3ISG A;  1JTG A;  2ZQ7 A;  4FSF A;  4IBR A;  4OQG A;  5AQA A;  2BG1 A;  3ZNT A;  4EUZ A;  2HDQ A;  1PWG A;  2IWC A;  2WGV A;  3IF6 B;  4OKP A;  2Y2O A;  1K38 A;  2QZ6 A;  3W4P A;  3A3F A;  1XXM A;  3GRJ A;  2XEP A;  4WEL A;  3VOY A;  3IHB A;  2ZC4 B;  5DTK A;  4OON A;  4UA7 A;  1I2W A;  3MZF A;  4BEN A;  2HP6 A;  4KZ4 A;  3UE3 A;  3N8S A;  1L2S A;  5DTS A;  4PM7 A;  2VGK A;  3N6I A;  3ZG7 B;  3IXD A;  4U0X A;  4BJP A;  1E4D A;  4KZ5 A;  5FA7 A;  4BLM A;  5FQ9 A;  2WKE A;  3O3V A;  4WZ5 C;  5GHY A;  3SS5 A;  5A93 A;  4WMC A;  1I5Q A;  2ZQ9 A;  2ZC5 B;  2ZM2 A;  1LL5 A;  1SDE A;  2J9P A;  3AGE A;  3OPP A;  1QME A;  2JBF A;  1PW8 A;  4K91 A;  3ZFZ A;  5JYO A;  2A3U A;  3G34 A;  1RP5 A;  3BFG A;  3WRT A;  3HL9 A;  3SS4 A;  4JPM A;  1ESU A;  5FQI A;  2C6W B;  2EFX A;  1DJC A;  3M2K A;  2J7V A;  1W8Y A;  4WZ4 A;  4OQ0 A;  1XA7 A;  5J8X A;  4P87 A;  2WYX A;  3WRZ A;  3Q82 A;  5F83 A;  3IF6 A;  1L0E A;  4R3B A;  1ESI A;  1BLP A;  1TVF A;  3BEB A;  3DW0 A;  4UA6 A;  1YMX A;  3G4P A;  1J9M A;  4FH2 A;  1ZC2 A;  5CHU A;  5HAR A;  4KZA A;  3G32 A;  3BFD A;  4Y7P A;  2WAE A;  4Z9Q A;  4JBF A;  3Q7V B;  1GHI A;  3WS2 A;  3WS4 A;  1K57 A;  4LEN A;  3IXH A;  2Y2L A;  2FFY A;  4KEN B;  4LV3 A;  1ES5 A;  1YLW A;  2JE5 A;  4OPR A;  2WKI A;  1BT5 A;  1BLH A;  1ZG6 A;  2B5R A;  1JWZ A;  3UY6 A;  3FYZ A;  1K4F A;  1YT4 A;  5HAI A;  1LI9 A;  1PYY A;  1TDG A;  1AXB A;  3GR2 A;  1K56 A;  2R9X A;  1NY0 A;  5L2F A;  4IVI A;  5GHX A;  2XD1 A;  2Z2L B;  4U3T A;  3EQU A;  3IH9 A;  3PAG A;  3HLE A;  4S2J A;  1IYO A;  5FAP A;  4M3K A;  5A90 A;  4B4X A;  4KQR A;  4KZB A;  3TOI A;  2XF3 A;  1NJ4 A;  3VFH A;  3VOZ A;  3MXS A;  3N8R A;  1G6A A;  3OCN A;  2EX2 A;  4S2K A;  4LV1 A;  3CJM A;  4KG2 A;  1DJB A;  4YFM A;  4OH0 A;  4P6B A;  2EX9 A;  4EBN A;  5FQM A;  4JF6 A;  3M2J A;  5A92 A;  4GKU A;  3O86 A;  4OVD A;  5DVA A;  5HX9 A;  4OP5 A;  3UDI A;  3P09 A;  3LO7 A;  5CGW A;  4R0Q A;  3HLB A;  3GQZ A;  2H5S A;  4OQI A;  5HAP A;  1KGE A;  3IF6 C;  3SH7 A;  1ALQ A;  2Y59 A;  4LCM A;  2DNS A;  3Q7V A;  4N1X A;  2PBY A;  3JYI A;  2Q9N A;  1OME A;  1XGJ A;  3NBL A;  3FV7 A;  5EE8 A;  4OOL A;  2Y2G A;  5G18 A;  5GL9 A;  3ZDJ A;  4QY6 A;  5FAO A;  4FD8 A;  1HZO A;  2PU4 A;  4WEJ A;  4JF4 A;  4GD6 A;  5FSR A;  3SH8 A;  2Y2N A;  1XGI A;  4UAA A;  3BEC A;  4S2M A;  5IHV A;  1K57 C;  2WGI A;  1L0G A;  1RCJ A;  4KZ7 A;  4KG5 A;  2GDN A;  4QD4 A;  3C4P A;  1JVJ A; 
#chains in the Genus database with same CATH topology
 3O5Y A;  4Y13 A;  4CJN A;  3FG8 A;  5L8M A;  1WYC A;  5DKL A;  4ZBE A;  2WKR A;  4HBU A;  4CLC A;  4MEZ A;  5HDC A;  4GDB A;  4WLA A;  2I72 A;  1KGG A;  4E04 A;  2MJ6 A;  4E3M A;  2HDR A;  2BAS A;  5GLD A;  5GLA A;  4R4S A;  4PAU A;  1FOF A;  3G31 A;  1PIO A;  5D3O A;  5DF8 A;  2Y4A A;  1G28 A;  1YQS A;  3WS0 A;  4YWZ A;  4G3V A;  1ERM A;  4LRZ E;  1VET B;  3IWQ A;  1ONH A;  3IWI A;  4I3A A;  3RTY A;  4AFI A;  4EEU A;  4IUK A;  3TG9 A;  4JXW A;  4KG6 A;  3NIA A;  3KSI A;  4FTX A;  4H6J A;  5CX7 A;  5AQ9 A;  1HTZ A;  4N9L A;  1JNU A;  3UNW A;  4WM9 A;  3VMA A;  5DF7 A;  3JVV A;  2ACG A;  4X69 A;  2B18 A;  1V9Z A;  2Z6C A;  1GSV A;  4ZDX A;  5CGX A;  3LY3 A;  4JXV A;  4DN0 A;  2V8C A;  4ESP A;  1ONG A;  4C75 A;  2HP9 A;  4HH3 A;  1S6R A;  4PM6 A;  5IU1 A;  1Q2Q A;  3AGD A;  5GHZ A;  4UEY A;  4NEE D;  4MN7 A;  4EWF A;  4S2I A;  1G5U A;  3NOU C;  3PBR A;  1KDW A;  4GB7 A;  4E3N A;  1L3L A;  4KZ8 A;  4O01 A;  4B9O A;  3RXW A;  4ARZ A;  3GV9 A;  3IHA A;  4U0T A;  2D01 A;  1ERO A;  4DDS A;  1GA9 A;  3W4Q A;  1S67 L;  5E2G A;  1IFQ A;  3DWZ A;  3OPL A;  2P7J A;  1MWR A;  2XR0 A;  2ZC6 B;  4S2N C;  2W3E A;  4BQM A;  2RL3 A;  1NRJ A;  2EA9 A;  1F9I A;  3VP0 A;  3ZG8 B;  3CLO A;  2XA7 M;  2UWX A;  2X71 A;  3NDE A;  3DTK A;  3EEH A;  4HY8 A;  1N4O A;  3V3S A;  2R9W A;  3IS2 B;  3UB7 A;  3C5A A;  1LL9 A;  5CTM A;  5TBM A;  3ZVT A;  3LIB A;  2K7S A;  5HFO A;  2X01 A;  1T18 A;  1BTL A;  1HLU P;  2OOL A;  5F6A A;  1IEL A;  1CEG A;  5DFY A;  3MZE A;  3S22 A;  3KYQ A;  2XDM A;  2ZM0 A;  3K3D A;  2HGV A;  5EVE A;  1XJ4 A;  4DE3 A;  1ES3 A;  2XRN A;  3LI8 A;  5HSQ A;  3H7W B;  3GMW A;  1LLB A;  1Q2P A;  2PAV P;  4GS9 B;  1PRQ A;  4OPQ A;  3ZVW A;  4DJ2 A;  2W27 A;  2I9V A;  5U47 A;  1TDL A;  5KMW A;  1YLT A;  4HP9 A;  5HD3 A;  1K6S A;  1MY8 A;  3PBS A;  1W63 M;  1IYS A;  4IJG A;  5KSH A;  2XLN A;  4HI4 A;  2A24 B;  4DE2 A;  5EOO A;  1KGF A;  2JHE A;  2WKH A;  3A3E A;  3T12 B;  3CWF A;  4EBL A;  3BWL A;  4DE0 A;  4PM8 A;  2Y8H A;  1KOU A;  2QKP A;  4GNU A;  4R23 A;  1LHY A;  2QPN A;  3A0V A;  2P04 A;  3NC8 A;  4ZAM A;  4BD1 A;  1F5M A;  2QHK A;  4ZRR A;  2W3H A;  2B95 A;  1FIL A;  4YIN A;  1H8Z A;  4E6X A;  4X55 A;  4GDN A;  3S1Y A;  1W8Q A;  3JVU A;  2V2F F;  4RQ9 A;  4IVK A;  4UQI S;  4NG2 A;  1CEF A;  4WEK A;  4QJG A;  2Z2M B;  3HJK A;  1ACF A;  1K54 C;  5DF9 A;  3OPH A;  2ZOH A;  3B3X A;  5LBR A;  4OQH A;  2HDS A;  5FI7 A;  4Y0O A;  1YLP A;  2BG1 A;  4EUZ A;  2IWC A;  3IF6 B;  3W4P A;  3A3F A;  4WEL A;  2XEP A;  5KIZ A;  1UWN X;  2ZC4 B;  3IHB A;  4R3A A;  1I2W A;  2LB5 A;  4KZ4 A;  3N8S A;  5DTS A;  3ZG7 B;  3IXD A;  3FPW A;  1S4R A;  1I5Q A;  3NJA A;  2ZC5 B;  1QME A;  3KSF A;  1ESU A;  5FQI A;  3KO6 A;  2J7V A;  4O0P A;  5A8B A;  3BY8 A;  2O9C A;  3FPV A;  5F83 A;  1BLP A;  3DW0 A;  4FH2 A;  1ZC2 A;  5CHU A;  2OAQ 1;  4Y7P A;  3Q7V B;  1GHI A;  3VE4 A;  1K57 A;  2Y2L A;  1OJ5 A;  2HF6 A;  4KEN B;  2GX5 A;  3GEC A;  1ES5 A;  4HIA A;  3HJI A;  1JWZ A;  3C2W A;  2V1A A;  1ZHH B;  1YT4 A;  1PYY A;  2R9X A;  1NY0 A;  3SW1 A;  3HCY A;  4IVI A;  5GHX A;  3IH9 A;  3PAG A;  4S2J A;  1MKM A;  5FAP A;  4CLC B;  5A90 A;  3TOI A;  2J3T D;  1TD5 A;  3N8R A;  3OCN A;  1NWZ A;  3CJM A;  3D72 A;  4YFM A;  3D3O A;  2KDK A;  1D7E A;  5DVA A;  4R0Q A;  3VV4 A;  5HAP A;  4BMW A;  2Y59 A;  4LCM A;  2PBY A;  1UGU A;  3JYI A;  2XSS A;  1XGJ A;  3NBL A;  3FV7 A;  3ZDJ A;  2Y2G A;  3MQO A;  4QY6 A;  2PU4 A;  2HZ5 A;  2Y2N A;  3BEC A;  5IHV A;  3CPT A;  4KZ7 A;  4LPZ A;  1JVJ A;  4GCZ A;  1DP9 A;  2W1R A;  1PI5 A;  3HBR A;  3T4S A;  4XUZ A;  5MC7 A;  5CGS A;  4CPK A;  3ZGA B;  1S0W A;  3TJZ C;  4QY5 A;  4MN6 A;  5M18 A;  1L0F A;  2GJ3 A;  2ZOI A;  4XXR A;  4H6J B;  4BD0 A;  3HRE A;  4Y5F A;  3C7V A;  4IBX A;  2HPB A;  3VSL A;  2P08 A;  1T1B A;  4Y2F A;  3CG5 A;  3MFD A;  2XA7 S;  5HWV A;  4S2P A;  5EM0 A;  2IWD A;  4JGO A;  2L1M A;  2FZ0 A;  1M6K A;  4EET B;  4FOF A;  3Q1F A;  4P6Z M;  2K2N A;  5DFX A;  3UME A;  1IEM A;  4HBT A;  3P01 A;  4E3I A;  3EEA A;  4BBU A;  1CJF A;  1TEM A;  5FAS A;  2Y2Q A;  3SZT A;  3T4L A;  3IX3 A;  2WZX A;  2EXB A;  3PBO A;  4ARZ B;  5FQQ A;  5HL6 A;  3IX8 A;  3ZG5 A;  4B88 A;  1C3B A;  2JKF A;  2V1Z A;  4MBK A;  4DKI A;  3MFX A;  4KUK A;  1FCM A;  3ITA A;  3IX4 A;  3ZYT A;  1WE4 A;  3V3R A;  2M7V A;  2J9O A;  3QNB A;  4E3K A;  5KZH A;  1IOU A;  1BZA A;  1W79 A;  3IXG A;  3CMZ A;  4IHQ A;  2HV1 A;  4ZJ1 A;  1V9Y A;  2RCX A;  3QP4 A;  1K25 A;  3O87 A;  4EUV A;  3FWL A;  2O9B A;  1QMF A;  1FQG A;  2OSU A;  4I5S A;  4IED A;  4BWI A;  1DP8 A;  4DRT A;  3BW6 A;  2A2L A;  4E3J A;  5G4Y A;  2P74 A;  2W0N A;  3F1P A;  1OJG A;  1GSW A;  2ZMA A;  4D2O A;  2OLU A;  2IWB A;  1XFQ A;  5TBM B;  3MXR A;  1W7F A;  4QU3 A;  4E6W A;  3OPR A;  4Q8I A;  1CI9 A;  3KSH A;  1XJ2 A;  4JGP A;  3OLO A;  1Z6F A;  5F82 A;  5FQK A;  3HUO A;  5HPF A;  4G3K A;  3PBQ A;  1MWU A;  4FCF A;  4FH4 A;  1X0O A;  3OCL A;  3MS6 A;  3CZD A;  3LY4 A;  4NKP A;  3D4F A;  2VA0 A;  5J4E A;  5M19 A;  5HWT A;  1PI4 A;  1KE0 A;  1KDS A;  3T4O A;  1CF0 A;  1D06 A;  1K55 C;  4WL9 A;  1G6O A;  3UPO A;  1YAX A;  1HD8 A;  5E2H A;  2VV7 A;  4MCW A;  5F1G A;  1WYB A;  3FC7 A;  4LRX C;  1H8Y A;  3WS1 A;  4QWO A;  3H82 A;  4RYE A;  1YKD A;  4I3J A;  1T1C A;  2W3G A;  4PMA A;  5FAQ A;  3RFB A;  4N92 A;  4KQD A;  5EVI A;  1U60 A;  3VP4 A;  2WGW A;  3BFE A;  3N8L A;  3JPU A;  1SKF A;  2XQZ A;  1Z09 A;  1N9O A;  4EBP A;  2XGN A;  1F2K A;  4QB8 A;  5KSC A;  1YSQ A;  2LB9 A;  4II7 A;  4DDY A;  4Q0H A;  3FZC A;  1YM1 A;  4R70 A;  1RGZ A;  3EGX C;  4X53 A;  1ODV A;  1OTA A;  2BLS A;  1YLZ A;  2KOI A;  3BLM A;  3UB8 A;  1XX2 A;  1LI0 A;  1PZP A;  5AVF A;  1LSW A;  5CEC A;  3HLD A;  4LRY C;  2WAD A;  1JWV A;  4HEF A;  1XJ3 A;  4HH2 A;  3L7H A;  3UB6 A;  3PBT A;  2EX8 A;  3KYE A;  3IF5 A;  2ZQ8 A;  3UE1 A;  5HL1 A;  3OC2 A;  3PHY A;  2V20 A;  5CED A;  4ZJ2 A;  3W8K A;  4MNR A;  2HJE A;  1S1Y A;  4K08 A;  2X02 A;  3D9Y A;  3C4O A;  2G2U A;  4HES A;  1SHV A;  3IBJ A;  3E4P A;  4GHI A;  3SOI A;  4X68 A;  3LID A;  5TGF A;  3BRM A;  4R3J A;  1MKI A;  2NUT C;  2WUQ A;  5CER A;  2QJ5 A;  4K0W A;  3TRC A;  1PWC A;  1O07 A;  3HUN A;  3BLS A;  1GHM A;  1O7E A;  4L9F A;  3K2N A;  3PYP A;  5K5B A;  5JYP A;  4JKT A;  4PKY A;  2PYP A;  4JGR A;  4WBG A;  3BM6 A;  1XP4 A;  3VE3 A;  5BOH A;  5HW3 A;  2EX6 A;  5HAQ A;  3ZHH A;  4R6L A;  1PWG A;  2WGV A;  4OKP A;  1K38 A;  2QZ6 A;  2V0W A;  3LIE A;  4GLQ A;  3UB5 P;  3LI9 A;  4XT2 B;  3N6I A;  4U0X A;  1TS0 A;  4BJP A;  1E4D A;  4KZ5 A;  3LIA A;  4WZ5 C;  5HZH A;  2ZM2 A;  3OPP A;  1SDE A;  3NOT C;  5EFW A;  2A3U A;  3WRT A;  2JKR I;  3PXP A;  2PR5 A;  4NXF A;  3M2K A;  5G4Z A;  4WZ4 A;  4OQ0 A;  1OT6 A;  4P87 A;  3T4T A;  2EWW A;  1ESI A;  1TVF A;  3BEB A;  4P6Z S;  1ZTU A;  5DKK A;  3G32 A;  3BFD A;  3MJQ A;  5HPI A;  4Z9Q A;  4JBF A;  4X1M A;  4LEN A;  1STZ A;  3MXQ A;  3F1O A;  1Y4O A;  2WKP A;  1YLW A;  2WKI A;  1BT5 A;  1BLH A;  1ZG6 A;  3CPT B;  5F5Y A;  2EWV A;  1K4F A;  1LI9 A;  4MMN A;  3GR2 A;  3MSH A;  1K56 A;  2XD1 A;  4U3T A;  3TW8 A;  4FUW A;  1IYO A;  2O99 A;  3CUE C;  1NJ4 A;  3MXS A;  2EX2 A;  3ICY A;  4F3L B;  4LV1 A;  4KG2 A;  3O86 A;  4OVD A;  4OP5 A;  3UDI A;  3LO7 A;  4NXB A;  3LR0 A;  2H5S A;  1VHM A;  3IF6 C;  4G3W A;  3SH7 A;  4N1X A;  4NXE A;  2Q9N A;  1OME A;  5EE8 A;  5GL9 A;  4OOL A;  5FAO A;  3CAX A;  5AJG A;  2PD8 A;  3LR5 A;  4GD6 A;  4UAA A;  2WGI A;  1L0G A;  4KG5 A;  3BJN A;  1N9B A;  3NY4 A;  5FDH A;  1GA0 A;  2Y2M A;  1WA9 A;  1JWP A;  3S7O A;  3S7N A;  1EI5 A;  4HJ6 A;  1VQQ A;  3MF0 A;  5GLC A;  5HD5 A;  3HVF A;  3QP8 A;  4L9G A;  4C3Q A;  5CRF A;  3QNC A;  3EOI A;  4KZ9 A;  1ZKJ A;  3PAE A;  3UO9 A;  1N9N A;  2CC1 A;  3OZH A;  3UMD A;  5TFQ A;  3DTM A;  4R1G A;  3SH9 A;  3F1N A;  4NET A;  4EW7 A;  4Y15 A;  3G2Z A;  2W1T A;  5DJT A;  1IKG A;  1S1Z A;  4DMZ A;  2C5W B;  3V39 A;  5I5L A;  3ZCZ A;  4X6T A;  2YKF A;  2OLV A;  1AWI A;  1TS7 A;  3F1P B;  1FR6 A;  4OP8 A;  4CLC C;  1P9W A;  4LCL A;  3E98 A;  1H0M A;  1KVL A;  2WK0 A;  2Y55 A;  1E25 A;  2A49 A;  4XT2 A;  2XD5 A;  1GSX A;  3NDG A;  1E3U D;  4S2N A;  4GZB A;  3GVB A;  2VGL M;  4NXG A;  1TS6 A;  2PR6 A;  3UE6 A;  5FQJ A;  2OV5 A;  4RA7 A;  2Y2P A;  1FSY A;  1OT9 A;  3CHW P;  4MBH A;  1KE4 A;  4K0X A;  2ZQA A;  4X1L A;  2H0Y A;  3M6B A;  4MBF A;  3MBZ A;  4EXO A;  1LSV A;  1DP6 A;  4BL3 A;  1XFN A;  2JCH A;  3P7N A;  3T4J A;  3G6O A;  4CQH A;  1ZG4 A;  3LR4 A;  5EEC A;  3VFF A;  3K3C A;  1H5X A;  3H82 B;  3NI9 A;  4RX3 A;  1PWD A;  4HHD A;  4WF0 A;  1Y28 A;  2VJW A;  4WYY A;  4ETX A;  4UHU A;  5EVI B;  3R7W A;  1NRF A;  3S7P A;  2WGW B;  3BFC A;  1SZV A;  3A0R A;  3NHQ A;  3QP2 A;  1RGY A;  5L07 A;  1ERQ A;  3QP1 A;  3B42 A;  3VSK A;  1M40 A;  1D1J A;  1BLC A;  5EV0 A;  4F3L A;  2W3D A;  1A0K A;  4DJ3 A;  2Y2I A;  3HLW A;  1E3U A;  3DWK A;  4O7D A;  1K6R A;  3W4O A;  2XFS A;  2WKQ A;  2HP5 A;  3T4Q A;  4EQI A;  3A3J A;  4ME4 A;  2VX8 A;  1OTB A;  4JLF A;  3Q7Z A;  3NUL A;  3UB9 A;  4NK3 A;  2ZL1 A;  3L9K A;  2G2W A;  3I7J A;  3G2Y A;  3N7W A;  3W2Z A;  5FEG A;  2Q9M A;  1YMS A;  5TJJ A;  3ZNY A;  5E2F A;  4E3O A;  2DMW A;  4BL2 A;  4GHI B;  3NCK A;  4OPZ A;  3DBA A;  2WAF A;  4GD8 A;  5F68 A;  1NYY A;  3MKF A;  3LCE A;  3V5M A;  1PW1 A;  1FCO A;  1IYQ A;  2ZJ9 A;  5EM1 A;  4S2L A;  2ZM8 A;  3BFF A;  5FDS A;  1P97 A;  5CXW A;  3UN7 A;  5E43 A;  1DY6 A;  1K54 A;  1PZO A;  3BY9 A;  5EVI D;  1H8M A;  2QMI A;  4Y0T A;  1GHP A;  4N1H A;  5FI6 A;  3N4I A;  1N9L A;  3MZD A;  3BQ8 A;  3T1Q B;  3E2L A;  3SS3 A;  3A3D A;  4WMC D;  4ZJ3 A;  2W3F A;  4X56 A;  4DXB A;  3V67 A;  1NLZ A;  4B4Z A;  3Q07 A;  2E8I A;  3HLC A;  4MDZ A;  2JKR M;  2VGJ A;  4QHC A;  3UDF A;  3S4X A;  4OLD A;  3IH8 A;  1OTD A;  2ZD8 A;  4P85 A;  3UE0 A;  2ZLY A;  5CHJ A;  2PBD P;  1NXY A;  3T1S A;  5EVL A;  2PU2 A;  2V9A A;  4D60 A;  2H28 A;  3FKV A;  3TE8 A;  3UDX A;  4PM5 A;  2ZC7 A;  5EPH A;  2J80 A;  3TSG A;  1NYM A;  1MXO A;  4S2O A;  5DJU A;  1K4E A;  4F94 A;  1L0D A;  3EWK A;  2JC7 A;  3MKE A;  2AVX A;  3ISG A;  4FSF A;  4IBR A;  4OQG A;  5AQA A;  3ZNT A;  1XXM A;  2GNX A;  3VOY A;  1YPR A;  4OON A;  4UA7 A;  2HP6 A;  3UE3 A;  1L2S A;  2VGK A;  3F1O B;  3U4L P;  1P9R A;  4BLM A;  2INW A;  5FQ9 A;  2WKE A;  2KLI A;  5GHY A;  3SS5 A;  5A93 A;  4WMC A;  1UWP X;  2ZQ9 A;  1LL5 A;  2J9P A;  1EW0 A;  5F69 A;  3ZFZ A;  3G34 A;  2G7U A;  2C6W B;  3QP6 A;  2E8J A;  1DJC A;  2VEA A;  1W8Y A;  2WYX A;  1S4S A;  1SKO A;  4R3B A;  3CI6 A;  1J9M A;  5HAR A;  4KZA A;  3WS2 A;  2VV8 A;  3IXH A;  2L0W A;  2FFY A;  5IT5 A;  4Q0J A;  4PHT A;  2B5R A;  3UY6 A;  3FYZ A;  3NOP C;  4BBV A;  1TDG A;  4HJ3 A;  3E4O A;  2L4R A;  3HLE A;  4HQA A;  3EGD C;  4M3K A;  4B4X A;  2VGL S;  4X25 A;  2FH5 A;  4B93 A;  2VKS A;  5C5K A;  1DJB A;  4P6B A;  2EX9 A;  4EBN A;  4JF6 A;  3M2J A;  4GKU A;  2JN7 A;  3P09 A;  3GQZ A;  3PR6 A;  1KGE A;  3LEQ A;  2JKT I;  2DNS A;  4JGQ A;  4EU0 A;  5G18 A;  3F1N B;  2BTF P;  1HZO A;  4WEJ A;  2W1T B;  3SH8 A;  4GW9 A;  1XGI A;  1K57 C;  1RCJ A;  2GDN A;  2PT7 A;  3C30 A;  4QD4 A;  3C4P A;  4Y3I A;  1VEU B;  1Y54 A;  1DRM A;  1KVM A;  1K56 D;  2B02 A;  1BLS A;  2P9V B;  3VP3 A;  3FKW A;  3DAV A;  1MC0 A;  3MMH A;  1J3W A;  3OOV A;  3T50 A;  1VM1 A;  2XK1 A;  1EWZ A;  3EQV A;  4UA9 A;  2D02 A;  5J7E A;  1W63 Q;  1CQA A;  1P0Z A;  3B47 A;  2CMN A;  3E4Q A;  2EFU A;  4MN5 A;  4EES A;  4RX2 A;  3Q81 A;  2V0U A;  3ZG0 A;  4HP4 A;  3RXX A;  3HLF A;  2ZQD A;  3DTI A;  5FEF A;  4PKY G;  5FI2 A;  3U2A A;  5AQB A;  5I94 A;  3WWX A;  3P98 A;  5CTN A;  2Y79 A;  4ETZ A;  1CI8 A;  3A3I A;  4LV2 A;  3LIF A;  1YSP A;  4QPR A;  4GN2 A;  4HJ4 A;  3KSG A;  4GOG A;  1JTD A;  4KZ3 A;  3T4K A;  4KQQ A;  2H10 A;  3E2K A;  4LFU A;  4I3I A;  2Y2K A;  3ULF A;  4M4X A;  1HVB A;  1IYP A;  5AVE A;  4PM9 A;  1NZU A;  5F1F A;  5DTT A;  3IXB A;  3UPN A;  1S66 L;  2OWJ A;  1KE3 A;  1MZU A;  4JXG A;  4N9K A;  4L9E A;  1MPL A;  4HNB A;  4R4R A;  3R7W B;  4LV0 A;  1MBL A;  3O88 A;  1DJA A;  2XRO A;  2H0T A;  1GCE A;  1FCN A;  1SCW A;  1K55 A;  4WUJ A;  1VET A;  2VK3 A;  3IQA A;  1T19 A;  3M6H A;  1K0K A;  2EXA A;  2J3T C;  2OWH A;  5EUA A;  4JXS A;  4IUH A;  2ZC3 B;  3A0S A;  3WS5 A;  1BSG A;  3GDI A;  3C7U A;  3V50 A;  1I2S A;  2DCF A;  5TR7 A;  4OLG A;  1LT0 A;  1XKZ A;  2Y2H A;  2ZMV A;  3NEC A;  2ZBB A;  3PBN A;  2PYR A;  1CK3 A;  1XA1 A;  2KX6 A;  1XJ6 A;  2OAP 1;  4I39 A;  3IWO A;  3QHY A;  4OOY A;  2ZL1 B;  3MR0 A;  4R38 A;  2O9A A;  4OPY A;  3LR3 A;  3UPP A;  3KX0 X;  5FAT A;  5FL3 A;  1YLY A;  4E3L A;  2K31 A;  3S7Q A;  1PNE A;  5E2E A;  1TS8 A;  3RJU A;  4O8G A;  3C38 A;  4L0L A;  4Q0I A;  1BUE A;  3VOL A;  4ZTK A;  1SDN A;  4YNR A;  4WN5 A;  2V1B A;  4RVA A;  1YLJ A;  1MWT A;  5CEB A;  1XPB A;  1NLY A;  1H3Q A;  1VEU A;  4BBT A;  2YKH A;  3PTE A;  4A5R A;  5GLB A;  2P9V A;  3CIT A;  1OTE A;  1NZO A;  2NUP C;  4DXC A;  2ZMF A;  3IS2 A;  4DE1 A;  1OPX A;  4JF5 A;  2PD7 A;  3ZQ5 A;  4DF6 A;  2QWS A;  5HWW A;  1ES2 A;  2FFF B;  2HDU A;  1VB6 A;  2ZQC A;  1MWS A;  4OOM A;  3QP5 A;  3T1R A;  2GZA A;  3VP1 A;  4C6Y A;  5CHM A;  3ZG9 B;  3HUM A;  2WZZ A;  2Q0O A;  4I38 A;  3OBF A;  1FSW A;  3ITB A;  4HOI A;  3B33 A;  5L09 A;  5EVI C;  2DRW A;  2J8Y A;  3KYZ A;  3H7W A;  3AGF A;  3GSG A;  2Y91 A;  2M7U A;  4GS9 A;  2JKG A;  3BYD A;  5EOE A;  2VLG A;  4MLL A;  1T1A A;  3HLG A;  4Y0U A;  1FR1 A;  4PPR A;  3E0Y A;  4KQO A;  1BUL A;  4H8R A;  4XUX A;  4KUO A;  5IS1 A;  1ES4 A;  1PFL A;  2Y2J A;  3LUQ A;  2XFT A;  5A91 A;  3C8C A;  5AQ7 A;  4EV4 A;  4WZ5 A;  4EQ1 A;  2A24 A;  1W5D A;  3RH8 B;  4ID4 A;  5L10 A;  4KZ6 A;  2XH9 A;  2VV6 A;  3VP2 A;  1BYW A;  2VZW A;  1G68 A;  3LYX A;  3G30 A;  2V8F A;  4P0M A;  3IT9 A;  5M1A A;  3GTC A;  1OTI A;  3G35 A;  3MQQ A;  2HJ9 C;  2M1C A;  5HDS A;  3LEZ A;  5HDD A;  4GJ4 A;  1JTG A;  2ZQ7 A;  1SKO B;  2HDQ A;  2IA2 A;  2Y2O A;  3GRJ A;  5DTK A;  4EEP A;  3MZF A;  2UV0 E;  4BEN A;  2PDR A;  2Z6D A;  4PM7 A;  2JKT M;  1TF1 A;  5FA7 A;  1FIK A;  3O3V A;  3LIC A;  2J3W A;  2R78 A;  4LLO B;  3AGE A;  5JYO A;  2JBF A;  1LSX A;  1PW8 A;  3CUE A;  4K91 A;  4Z1W A;  4CLC E;  1RP5 A;  3BFG A;  3HL9 A;  2PRF A;  3SS4 A;  4JPM A;  2EFX A;  2QYB A;  1XA7 A;  3IBR A;  1LL8 A;  5J8X A;  4YOF A;  3WRZ A;  3Q82 A;  3IF6 A;  1L0E A;  4LGW A;  3MQ0 A;  4UA6 A;  4CLC D;  1YMX A;  3R4K A;  3G4P A;  4EER A;  2WAE A;  1F98 A;  3WS4 A;  4LV3 A;  3BQA A;  2JE5 A;  3DTE A;  4OPR A;  5HAI A;  1AXB A;  5L2F A;  2Z2L B;  3LFV A;  3EQU A;  3H9W A;  2QJ7 A;  4KQR A;  4KZB A;  3VFH A;  2XF3 A;  3VOZ A;  4UQI M;  1G6A A;  4S2K A;  3LGO A;  2O0Y A;  4OH0 A;  2PHY A;  5FQM A;  5A92 A;  5HX9 A;  3T1X A;  5CGW A;  3HLB A;  4OQI A;  1ALQ A;  3Q7V A;  5J3W A;  4FD8 A;  4JF4 A;  5FSR A;  4S2M A;  4Y17 A;  1IKI A; 
#chains in the Genus database with same CATH homology
 1N9B A;  3NY4 A;  1PI5 A;  1Y54 A;  5FDH A;  3HBR A;  1GA0 A;  4CJN A;  2Y2M A;  1JWP A;  4XUZ A;  1KVM A;  1WYC A;  1K56 D;  5CGS A;  4ZBE A;  4HBU A;  3ZGA B;  4CPK A;  1S0W A;  1BLS A;  2P9V B;  3VP3 A;  1EI5 A;  3FKW A;  4QY5 A;  1VM1 A;  4MEZ A;  1VQQ A;  2XK1 A;  5M18 A;  1L0F A;  4GDB A;  4XXR A;  4BD0 A;  1EWZ A;  5GLC A;  3EQV A;  3HRE A;  2I72 A;  3HVF A;  4UA9 A;  3C7V A;  4IBX A;  1KGG A;  4C3Q A;  2HPB A;  3QNC A;  5CRF A;  3VSL A;  4E3M A;  4KZ9 A;  1ZKJ A;  3PAE A;  2HDR A;  5GLA A;  2EFU A;  5GLD A;  3CG5 A;  4R4S A;  4RX2 A;  3Q81 A;  3MFD A;  2CC1 A;  3OZH A;  3UO9 A;  1FOF A;  4S2P A;  5TFQ A;  3DTM A;  2IWD A;  3ZG0 A;  4R1G A;  3RXX A;  3SH9 A;  3HLF A;  3G31 A;  2ZQD A;  1PIO A;  4NET A;  5D3O A;  5DF8 A;  3G2Z A;  5FI2 A;  2Y4A A;  5AQB A;  5I94 A;  1IKG A;  3WWX A;  1YQS A;  3P98 A;  1M6K A;  5CTN A;  3WS0 A;  1CI8 A;  2C5W B;  3V39 A;  3A3I A;  3Q1F A;  4LV2 A;  1ERM A;  1IEM A;  3ZCZ A;  4X6T A;  4GN2 A;  2OLV A;  3IWQ A;  1ONH A;  3IWI A;  4HBT A;  4GOG A;  4E3I A;  1JTD A;  4KZ3 A;  1TEM A;  5FAS A;  4KQQ A;  2H10 A;  3E2K A;  2Y2Q A;  3TG9 A;  4JXW A;  4KG6 A;  2Y2K A;  2WZX A;  3NIA A;  5AQ9 A;  1FR6 A;  1HTZ A;  4N9L A;  2EXB A;  4OP8 A;  3UNW A;  3PBO A;  5FQQ A;  4WM9 A;  4LCL A;  3VMA A;  3ZG5 A;  1C3B A;  2V1Z A;  4MBK A;  5DF7 A;  4B88 A;  1HVB A;  1KVL A;  2WK0 A;  1IYP A;  2Y55 A;  1E25 A;  4DKI A;  2A49 A;  1FCM A;  4X69 A;  3ITA A;  4PM9 A;  1WE4 A;  1NZU A;  2XD5 A;  2J9O A;  3NDG A;  3QNB A;  3V3R A;  5F1F A;  5DTT A;  3IXB A;  3UPN A;  4E3K A;  5KZH A;  1E3U D;  4ZDX A;  4S2N A;  1BZA A;  1KE3 A;  5CGX A;  1W79 A;  3IXG A;  3LY3 A;  3CMZ A;  4GZB A;  3GVB A;  4JXG A;  4N9K A;  4JXV A;  4ZJ1 A;  1MPL A;  2RCX A;  1K25 A;  4R4R A;  5FQJ A;  1ONG A;  2OV5 A;  4LV0 A;  4C75 A;  2HP9 A;  1MBL A;  3O87 A;  3FWL A;  3O88 A;  4RA7 A;  2Y2P A;  1DJA A;  1QMF A;  1FQG A;  2OSU A;  1S6R A;  4IED A;  2H0T A;  4PM6 A;  1GCE A;  4DRT A;  1Q2Q A;  1FCN A;  1FSY A;  1SCW A;  3AGD A;  1K55 A;  5GHZ A;  4E3J A;  4MBH A;  4EWF A;  1KE4 A;  4K0X A;  2ZQA A;  2P74 A;  3IQA A;  4S2I A;  3M6H A;  2H0Y A;  3M6B A;  4MBF A;  3MBZ A;  2EXA A;  3PBR A;  1KDW A;  2ZMA A;  4GB7 A;  5EUA A;  4D2O A;  4JXS A;  4BL3 A;  4E3N A;  2OLU A;  2IWB A;  2JCH A;  4KZ8 A;  3RXW A;  2ZC3 B;  1ZG4 A;  3WS5 A;  1BSG A;  5EEC A;  3C7U A;  3V50 A;  3GV9 A;  1W7F A;  3IHA A;  3MXR A;  3OPR A;  4QU3 A;  4E6W A;  4U0T A;  1CI9 A;  4Q8I A;  3VFF A;  1ERO A;  1I2S A;  4DDS A;  1GA9 A;  2DCF A;  3W4Q A;  1H5X A;  3NI9 A;  4OLG A;  1Z6F A;  4RX3 A;  5F82 A;  5TR7 A;  1PWD A;  1XKZ A;  2Y2H A;  5FQK A;  3HUO A;  5E2G A;  4WYY A;  4UHU A;  3DWZ A;  3OPL A;  3PBQ A;  1MWU A;  4FCF A;  2ZC6 B;  1MWR A;  2XR0 A;  3PBN A;  4S2N C;  5EVI B;  1NRF A;  2WGW B;  3BFC A;  4FH4 A;  1CK3 A;  1XA1 A;  3CZD A;  3OCL A;  3LY4 A;  4BQM A;  2RL3 A;  3D4F A;  1RGY A;  3IWO A;  1ERQ A;  5M19 A;  3QHY A;  4OOY A;  3VP0 A;  1PI4 A;  3ZG8 B;  1KE0 A;  3VSK A;  1KDS A;  1M40 A;  4OPY A;  2UWX A;  2X71 A;  1BLC A;  3NDE A;  1K55 C;  3UPO A;  1N4O A;  3V3S A;  2R9W A;  1HD8 A;  5E2H A;  3UPP A;  5FAT A;  3C5A A;  2Y2I A;  1YLY A;  3HLW A;  4E3L A;  1E3U A;  1LL9 A;  3DWK A;  4O7D A;  5F1G A;  5CTM A;  1WYB A;  1K6R A;  3W4O A;  3ZVT A;  5E2E A;  3RJU A;  4L0L A;  5HFO A;  1H8Y A;  2XFS A;  1BUE A;  2X01 A;  3WS1 A;  4ZTK A;  1SDN A;  4RYE A;  1BTL A;  4RVA A;  2HP5 A;  4PMA A;  1YLJ A;  1IEL A;  1MWT A;  5FAQ A;  4EQI A;  3A3J A;  4JLF A;  5CEB A;  3Q7Z A;  4N92 A;  1XPB A;  5EVI A;  1U60 A;  1CEG A;  3VP4 A;  2WGW A;  3MZE A;  3BFE A;  3S22 A;  2XDM A;  2ZM0 A;  4NK3 A;  3N8L A;  3PTE A;  4DE3 A;  1ES3 A;  1SKF A;  2XQZ A;  4A5R A;  2G2W A;  3I7J A;  4EBP A;  2XGN A;  5GLB A;  2P9V A;  3G2Y A;  3N7W A;  1NZO A;  4QB8 A;  3GMW A;  1LLB A;  5KSC A;  1Q2P A;  4DXC A;  2Q9M A;  4OPQ A;  1YMS A;  3ZVW A;  3ZNY A;  5E2F A;  4DE1 A;  4DDY A;  3FZC A;  4E3O A;  1YM1 A;  4JF5 A;  5U47 A;  4BL2 A;  1TDL A;  4DF6 A;  1RGZ A;  5KMW A;  1YLT A;  3NCK A;  4OPZ A;  4X53 A;  1ES2 A;  2FFF B;  2BLS A;  2HDU A;  2WAF A;  1YLZ A;  1MWS A;  1K6S A;  2ZQC A;  3BLM A;  4GD8 A;  4OOM A;  1MY8 A;  1XX2 A;  1LI0 A;  1PZP A;  1NYY A;  3MKF A;  3PBS A;  3LCE A;  3V5M A;  1PW1 A;  1FCO A;  1IYS A;  3VP1 A;  4C6Y A;  5CEC A;  1IYQ A;  2ZJ9 A;  3HLD A;  4S2L A;  2WAD A;  2ZM8 A;  5CHM A;  3BFF A;  3ZG9 B;  5KSH A;  3HUM A;  2XLN A;  2WZZ A;  1JWV A;  5CXW A;  4DE2 A;  5EOO A;  3UN7 A;  1KGF A;  2WKH A;  5E43 A;  1DY6 A;  3A3E A;  4HEF A;  1FSW A;  1K54 A;  1PZO A;  3ITB A;  4EBL A;  5EVI D;  4DE0 A;  3PBT A;  4PM8 A;  2QMI A;  5EVI C;  2EX8 A;  4Y0T A;  1GHP A;  2DRW A;  2J8Y A;  3AGF A;  3IF5 A;  2ZQ8 A;  4GNU A;  3GSG A;  4N1H A;  4R23 A;  1LHY A;  3N4I A;  2QPN A;  5FI6 A;  3UE1 A;  5HL1 A;  3OC2 A;  2Y91 A;  3MZD A;  2V20 A;  5CED A;  4ZJ2 A;  3E2L A;  3NC8 A;  4MNR A;  3A3D A;  3BYD A;  4WMC D;  4ZJ3 A;  4ZAM A;  3SS3 A;  3W8K A;  4X56 A;  5EOE A;  4BD1 A;  2X02 A;  4DXB A;  3C4O A;  4MLL A;  3HLG A;  4B4Z A;  2G2U A;  3Q07 A;  2E8I A;  3HLC A;  4HES A;  1SHV A;  2VGJ A;  4QHC A;  4YIN A;  3UDF A;  3SOI A;  1H8Z A;  4X68 A;  3S4X A;  5TGF A;  3BRM A;  3IH8 A;  4OLD A;  2ZD8 A;  4Y0U A;  4R3J A;  1MKI A;  1FR1 A;  4P85 A;  4PPR A;  4KQO A;  3UE0 A;  1BUL A;  2ZLY A;  4H8R A;  5CHJ A;  4XUX A;  2WUQ A;  4E6X A;  1ES4 A;  4X55 A;  2Y2J A;  1NXY A;  5CER A;  1IKI A;  4K0W A;  1PWC A;  5EVL A;  2XFT A;  4GDN A;  5A91 A;  1O07 A;  3HUN A;  2PU2 A;  1W8Q A;  5AQ7 A;  3S1Y A;  4EV4 A;  3BLS A;  4WZ5 A;  1GHM A;  3FKV A;  1W5D A;  2V2F F;  3UDX A;  4ID4 A;  4IVK A;  4KZ6 A;  2XH9 A;  4PM5 A;  1CEF A;  4WEK A;  1O7E A;  4QJG A;  2ZC7 A;  5EPH A;  3VP2 A;  2Z2M B;  1K54 C;  3TSG A;  5DF9 A;  1G68 A;  3OPH A;  5JYP A;  1NYM A;  1MXO A;  4JKT A;  3B3X A;  4WBG A;  4S2O A;  4OQH A;  3BM6 A;  3G30 A;  1XP4 A;  4P0M A;  2HDS A;  1K4E A;  3IT9 A;  3GTC A;  5M1A A;  3G35 A;  4F94 A;  5FI7 A;  4Y0O A;  1L0D A;  5BOH A;  5HW3 A;  1YLP A;  2EX6 A;  5HAQ A;  2JC7 A;  3MKE A;  3LEZ A;  3ZHH A;  3ISG A;  1JTG A;  2ZQ7 A;  4FSF A;  4IBR A;  4OQG A;  5AQA A;  2BG1 A;  3ZNT A;  4EUZ A;  2HDQ A;  1PWG A;  2IWC A;  2WGV A;  3IF6 B;  4OKP A;  2Y2O A;  1K38 A;  2QZ6 A;  3W4P A;  3A3F A;  1XXM A;  3GRJ A;  2XEP A;  4WEL A;  3VOY A;  3IHB A;  2ZC4 B;  5DTK A;  4OON A;  4UA7 A;  1I2W A;  3MZF A;  4BEN A;  2HP6 A;  4KZ4 A;  3UE3 A;  3N8S A;  1L2S A;  5DTS A;  4PM7 A;  2VGK A;  3N6I A;  3ZG7 B;  3IXD A;  4U0X A;  4BJP A;  1E4D A;  4KZ5 A;  5FA7 A;  4BLM A;  5FQ9 A;  2WKE A;  3O3V A;  4WZ5 C;  5GHY A;  3SS5 A;  5A93 A;  4WMC A;  1I5Q A;  2ZQ9 A;  2ZC5 B;  2ZM2 A;  1LL5 A;  1SDE A;  2J9P A;  3AGE A;  3OPP A;  1QME A;  2JBF A;  1PW8 A;  4K91 A;  3ZFZ A;  5JYO A;  2A3U A;  3G34 A;  1RP5 A;  3BFG A;  3WRT A;  3HL9 A;  3SS4 A;  4JPM A;  1ESU A;  5FQI A;  2C6W B;  2EFX A;  1DJC A;  3M2K A;  2J7V A;  1W8Y A;  4WZ4 A;  4OQ0 A;  1XA7 A;  5J8X A;  4P87 A;  2WYX A;  3WRZ A;  3Q82 A;  5F83 A;  3IF6 A;  1L0E A;  4R3B A;  1ESI A;  1BLP A;  1TVF A;  3BEB A;  3DW0 A;  4UA6 A;  1YMX A;  3G4P A;  1J9M A;  4FH2 A;  1ZC2 A;  5CHU A;  5HAR A;  4KZA A;  3G32 A;  3BFD A;  4Y7P A;  2WAE A;  4Z9Q A;  4JBF A;  3Q7V B;  1GHI A;  3WS2 A;  3WS4 A;  1K57 A;  4LEN A;  3IXH A;  2Y2L A;  2FFY A;  4KEN B;  4LV3 A;  1ES5 A;  1YLW A;  2JE5 A;  4OPR A;  2WKI A;  1BT5 A;  1BLH A;  1ZG6 A;  2B5R A;  1JWZ A;  3UY6 A;  3FYZ A;  1K4F A;  1YT4 A;  5HAI A;  1LI9 A;  1PYY A;  1TDG A;  1AXB A;  3GR2 A;  1K56 A;  2R9X A;  1NY0 A;  5L2F A;  4IVI A;  5GHX A;  2XD1 A;  2Z2L B;  4U3T A;  3EQU A;  3IH9 A;  3PAG A;  3HLE A;  4S2J A;  1IYO A;  5FAP A;  4M3K A;  5A90 A;  4B4X A;  4KQR A;  4KZB A;  3TOI A;  2XF3 A;  1NJ4 A;  3VFH A;  3VOZ A;  3MXS A;  3N8R A;  1G6A A;  3OCN A;  2EX2 A;  4S2K A;  4LV1 A;  3CJM A;  4KG2 A;  1DJB A;  4YFM A;  4OH0 A;  4P6B A;  2EX9 A;  4EBN A;  5FQM A;  4JF6 A;  3M2J A;  5A92 A;  4GKU A;  3O86 A;  4OVD A;  5DVA A;  5HX9 A;  4OP5 A;  3UDI A;  3P09 A;  3LO7 A;  5CGW A;  4R0Q A;  3HLB A;  3GQZ A;  2H5S A;  4OQI A;  5HAP A;  1KGE A;  3IF6 C;  3SH7 A;  1ALQ A;  2Y59 A;  4LCM A;  2DNS A;  3Q7V A;  4N1X A;  2PBY A;  3JYI A;  2Q9N A;  1OME A;  1XGJ A;  3NBL A;  3FV7 A;  5EE8 A;  4OOL A;  2Y2G A;  5G18 A;  5GL9 A;  3ZDJ A;  4QY6 A;  5FAO A;  4FD8 A;  1HZO A;  2PU4 A;  4WEJ A;  4JF4 A;  4GD6 A;  5FSR A;  3SH8 A;  2Y2N A;  1XGI A;  4UAA A;  3BEC A;  4S2M A;  5IHV A;  1K57 C;  2WGI A;  1L0G A;  1RCJ A;  4KZ7 A;  4KG5 A;  2GDN A;  4QD4 A;  3C4P A;  1JVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...