4BD4A

Monomeric human cu,zn superoxide dismutase, loops iv and vii deleted, apo form, mutant h43f
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
109
structure length
109
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLFGFHVHGAGGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKAGAGAGSRLASGVIGIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Global Structural Motions from the Strain of a Single Hydrogen Bond.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 15
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2012-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4bd4A00
2C9UA 2XJLA 3HOGA 1S4IA 1SXCA 4A7QA 1YAIA 3PU7A 2XJKA 3T5WA 1XSOA 2SODB 3GZQA 4MCMA 2E46A 1JK9B 2WYTA 2LU5A 2WZ0A 2AQRA 1PZSA 3KM2A 4BD4A 1DSWA 1UXLA 4FF9A 1HL5A 1RK7A 2AQNA 1P1VA 3LTVA 4B3EA 1FUNA 2V0AA 2WKOF 3GTVA 2Z7YA 2NNXA 5KBLA 2GBUA 3H2QA 1OEZW 3MNDA 1SDYA 1JK9A 1B4TA 2C9SA 2WYZA 1N19A 1OALA 1OZUA 1XTMA 2WKOA 1EJ8A 4A7VA 1JCVA 3ECUA 3HFFA 1YAZA 1F1AA 1CB4A 3RE0A 3CQPA 1PTZA 1COBA 1E9QB 1SDAB 3H2PA 2APSA 4N3TA 2R27A 2Z7UA 2VR6A 1SRDA 1BA9A 1SXSA 1UXMA 2WWNA 5KBKA 2ZOWA 1CBJA 4N3UA 1IBFA 2JCWA 1EQWA 3MKGA 2Z7ZA 2ZKYA 2AQTA 1TO5A 1N18A 1AZVA 3GZOA 4A7UA 1F1DA 3GQFA 3GTTA 1E9QA 1OAJA 1F1GA 1B4LA 2K4WA 2VR8A 2WWOA 3CE1A 2ZKXA 3F7KA 1E9OB 1E9PB 1SOSA 1SXAA 3SODB 3KM1A 1HL4A 1L3NA 4A7TA 3CQQA 1DO5A 5KBMA 3HW7A 2WZ6A 3KH3A 4L05A 1IBBA 2GBTA 2AF2A 4BCYA 5CU9A 3L9YA 4A7SA 1TO4A 2ZKWA 3L9EA 1E9OA 3F7LA 3QQDB 1BZOA 1QUPA 1E9PA 2GBVA 2AQSA 1MFMA 3KH4A 1Z9NA 2VR7A 3S0PA 4BCZA 1IB5A 1XTLA 1PU0A 4A7GF 1U3NA 3KBEA 2E47A 1SXNA 2AQQA 1SXZA 2Q2LA 3ECVA 1Q0EA 2WZ5A 3K91A 1IBDA 1OZTG 1F18A 1SPDA 2AEOA 2Z7WA 3ECWA 4A7GA 4OJAA 1ESOA 3QQDA 1Z9PA 1YSOA 4U4IA 2AQPA 1SXBA 4MCNA 3KBFA 2JLPA 2C9VA 4OH2A 3GZPA 1KMGA 1IBHA
chains in the Genus database with same CATH superfamily
4NHCL 1BFVH 4ZO8A 2W0KA 5LNEA 3ZKND 3K80A 3NZ8B 1W15A 4F9LA 1JPSL 1YG9A 4P5TA 4G8AC 4JN1L 1MFAH 4MCMA 4NI3A 3D8MA 2RH0A 3AS2A 3IDGB 3KLHD 1H9DA 5CSZB 4M1GH 2HT4C 5DMIH 1TZHB 5E8PA 1CE1H 1CUOA 1JL8A 4GMTH 4LOEA 4HH9B 4NZTL 2KQNA 4ZMZA 2CGRH 5DMGC 5TD4A 3SE3A 4FQHA 4IHOA 4P23D 3N06B 4IK6A 4LCVA 2DMHA 2XWTB 2DIJA 3NUKA 3APFA 4L0PB 4L3AA 1NKRA 3QORA 4UM9A 1MJ7H 5FHAL 4RGOH 3SN6N 4LHUA 4L9LA 5E0QA 4ZS7H 4PUBL 2AXGB 4BSVB 3NFSH 3O6FB 1MCDA 4G3YH 5LGHL 1PLCA 3U36B 3I9GL 4BRJA 2K6WA 5IB4B 1AZZC 5D7KE 1GYUA 3UG3A 3W0WE 1J9SA 5E2VH 1AD9A 4ZFZA 3DUUB 1DANU 2H32H 2BP8B 2OL3A 5K9QG 4KWUA 4GQ9H 4BQCA 5IQ9A 2VUKA 2PR4H 3H3PH 3MV9E 5I9QB 3E80A 4BUQA 2EDHA 3ARBA 1CYWA 4U0RB 5J12B 5AW3B 2H32B 5DURB 1BZEA 1S9WB 3H4FA 4LCCB 5F72S 5FUZH 3CU1A 2AK4B 2G0LA 5C7XL 1WHPA 2WUCL 3N40P 2FEDC 2V5SA 3RKPA 3VGHA 1AYRA 5D71H 3ZYZA 4PJAA 2Z93B 4OLVL 3RNQA 1NCCL 3ZRCC 1DDHA 2QPSA 3MNMA 5FLVA 4UOW1 1OAZH 2WPGA 4QHKI 2HH0H 1MUJA 1RULH 2OSLB 3EKCA 5EIQA 3LX9A 4IMKC 4L8DA 2BPBA 3SDDC 4X98A 3RVUC 1Z1WA 2ZCKH 1EVTC 1XH1A 1E9PA 4Y5YB 3TFBA 5CAYB 1GGYA 1HI6A 3IDIB 4HFWA 3F5WA 3QO0A 4I9XA 1U3NA 3DMMD 4MXVF 2ADYA 3GM8A 2GJ6B 3QDMD 1ZANL 1F13A 2X44D 2ZWLT 4FXTA 4CBZA 2DV6A 5KVGE 2NTFB 4L4TA 2IADB 2H3KA 1T5XB 4LQFH 4PJHF 5D7JB 3DBXB 4Y4KC 2HMID 4GEJA 2RJMA 1JP5A 3QNXA 2HJKB 4NDMB 5I8OH 1XX9C 3VA2C 3W3BA 5I16A 1VB9A 1NGXA 1HNYA 5J56B 3IE4A 1TPXC 4YHKH 3TF7C 1F56A 1HHKB 4XCFH 2CBTA 2PYEE 3H7LA 4JY5L 5IUSA 1O9VA 1ZWIB 4IGBC 2A4CA 2YWZA 3KPSA 3ROOB 2DJUA 4LU5H 1BZQK 1MCFA 3QJSB 3TCLA 5CEXA 4UQDA 3SDYH 5I1IH 4JFDE 2WKOF 5D1ZI 2Q7NA 3NIFF 3QARA 4Y16C 1U42A 4FFVC 4JCLA 1G4RA 1JNHB 1PJ9A 2GSIB 5HHME 3FYIB 3P40A 3RX7A 5IKCA 3CG8A 2DQCL 2WC7A 2V7HA 4X0KB 2FHBA 1ZLWH 2KBGA 3V0WH 4XWOD 3EFOB 1FSKC 2A9CA 1E5AA 4PJ8C 3WGVB 2NW2B 5CMAB 5FUOH 3T0BA 3RDTD 4F7CA 4NX0A 2JKJA 2DICA 1Q9WA 5HJBA 3BRFA 5F6HJ 3OQRA 4AV0A 2VXSH 2JTDA 4Z5RA 4ZOBA 3G5ZA 3MJ7A 4QXTA 4MQTB 3T2LA 2W91A 2IAMB 4ODVH 5IMOA 4X6CF 2WSDA 2YGQA 3EZJB 2XG5B 3MKGA 2I85A 2VDKH 2IWGA 1RCYA 4IDLA 3S2AA 4R7DB 1FNSL 2CBOA 5F9AC 4J12A 4UCFA 2K8MA 5MEOA 4Y5XC 1NAMH 3FQTB 3SYOA 5B8CB 3KPRA 1VFAB 2VDKB 2Z0UA 3QIUC 2A9BA 2CBMA 1LVEA 1M9WA 3DVIA 5DJ2A 4U6XB 5HVGB 5HXMA 1G5GA 1P9MA 2KYIA 3UJIH 1NAMB 3KW8A 2Y7SA 1KELH 3WKNA 4UQ3B 3NESA 5FGSA 3II3A 3BJLA 1XB3A 3JV4A 5FGBA 4A7TA 3NJMA 3NCCB 4PJDE 5ICYB 1OT2A 3BD4A 3IGUA 2KZ1B 5E8OA 5E6SB 5E8DH 4IRSC 2X1PA 4Q9QH 1S9XB 4DP6X 3VE0B 2R4SL 1Q1JL 2AJUL 3K8LA 1D6VH 2KDGA 4Q4IA 4PRDA 3BWUC 4L0YA 4KJWC 1NDTA 5KSVB 4FMKA 1ZGLB 3GMMA 3TT1H 2ZUUA 2B39A 3EJUA 5CM1A 3FN0H 3U1PA 1S7XA 2XTJD 1WIUA 1W0VB 2R7EB 4BWTA 5BS0D 2AZUA 4UV7H 2Z7WA 3GSUB 4G43A 4M61A 4JFFD 4UB0L 4XMLL 5K9KA 4EKXA 4D0BB 5A16A 2X7LA 2AJYL 5KYYA 1E3ZA 1OKEA 4J6IA 4KPHH 1VIWA 4AQEB 5JW4R 1MEXH 5FA4B 3GZQA 3AG2B 1R3IH 2DD8H 2MCPL 4X9HA 3ZDZB 2JNZA 1I3GL 2W60A 2GFBA 5E8NA 3EFDH 3SGKC 4ZUVA 1JPTH 3GWJA 4ZD3H 4AC4A 3QUXB 5I6XB 3EGXA 4QYAA 5GRUH 3UBGA 3TBCA 1HHIA 2D2OA 2W80C 3R4RA 1IC5L 1E3XA 4O4YL 1M6UA 4WFGD 4BCXA 4AJ0A 2V9TA 1IEBA 4LPUA 2FQDA 4BZYA 4ZNCD 4P4KD 4JG1H 4P57A 4APQC 2VR3A 3GS0A 4YMPA 4ETYA 4N90D 4FQXA 2JKIS 3S4SG 4QYOA 5E23A 3K6FA 1KCVL 3D0VB 5FYJL 3U4EA 4UUJB 3IJ8A 5MHSD 3L16A 2R29H 2X4PA 2PUQT 3NYKA 4L23A 4NPKA 1NBVH 3VACA 4I18A 4FFWC 5JHDB 1LJMA 4ONGL 5MI0B 3V4VA 1EAJA 1UA6H 3OZLA 5F93C 1H3PL 2DQTH 1E0OB 5C0AD 5F9WB 4MNGE 2JQMA 5JO5B 3EDFA 5DGQA 2D0FA 4WW2A 3HG4A 2QPDB 2WCGA 2EYSB 2N7AA 3DJSA 3DX8B 1NIDA 1Q9OB 4YSPA 4GKZA 3QRFM 2UWEE 3VXUE 3VD1A 4BXSV 4LO9A 5T3ZH 5IROA 2F53D 1DQLL 5L0QB 4ZO6A 3MJ8A 4MA8L 3ZTDC 4YR6A 3VFUA 1BX2A 1XR8A 3RJDA 3R7QA 2LLLA 3QIBD 1NGPH 1A1NB 1AR1C 3MJGX 3MLVL 4HJUA 2A6KA 4LDCA 3LEXB 5LBGA 4RA0C 4Y19E 3SGDH 2WLLB 4MDRA 4UI2A 4XP9H 5G2NA 3UP1A 2P7TA 4DJMA 2VDOH 3WNIA 1NFIA 4BZ2A 2Q87A 1JZ7A 2PYFA 2IH1A 2O5NA 1NOFA 4HKZB 3F7LA 3MAWA 4NCC2 4XMXA 3LEYL 4AQ8C 2OX5B 2X3AA 4WV1B 1F11B 3T1FB 3FQWA 4WKZA 3FFCD 1TVBB 1TZIA 1U8KA 1Z0MA 5D5MF 4NZFA 2ICWB 2HT3C 4UT9L 2Z8VC 4ZAKD 3EYOA 4JQIA 1IRAY 1BXXA 3C8KB 3PXLA 1HILA 1YMMD 2ZWYA 3WUWB 4IOFC 1WE5A 3IPBA 4MASA 3ARUA 1F18A 1KIQA 3QS2A 2JKLA 4UAHA 3RVVC 3NJIA 2W81C 1U3HD 1XT5A 1JD7A 2VZUA 3NFPB 4U6HA 2AKRA 3KBFA 3LKSA 1EDYA 3FO9A 4TUJA 4NQTA 4N6RA 3WJLC 4QNPE 2XN0A 2ZF9A 3D07A 3BN9D 3IVKA 1YEGH 4JDVA 4ZMTA 2G5RA 3CN0A 4I89A 3CDGB 5DHVA 3QEHA 5IWLA 4JO1H 1O7SA 1RZIA 1PZDA 4M8VA 4P9HC 3UZEC 5FECA 2CIKB 1EX0A 4M6ML 4HIXH 2NUTB 4H0LC 4JB9H 2NNFA 2LVCA 3SHSA 1A3RL 4FNPA 3C60C 4XNUH 5CGYD 5HVHB 1OOAA 3F7PC 1LO5B 1KLFB 2RQ8A 2R51A 3RGVA 2MNUA 2OXGA 4JFOA 4MCYB 3SE9H 3M88A 3B7UX 4J4PD 4H5SB 3VRIA 3CSYA 4AC2A 1B0RB 3FTXA 3LVEA 3OLDA 2YA1A 1NC4B 1J1OH 2FT6A 1AP2A 1UM4L 4UIKH 3GS4A 3WHE0 4HF5H 3WJMA 3WMSA 5KVEH 2HRGA 3E8UH 1M7DA 3FU9A 5IFAL 4TVPE 3MLPA 1E7VA 2FBJH 3VXOB 1LDSA 2YHGA 1JHKL 5DJZA 5EPMB 3WUWG 3OKKA 3IXAB 4WI9A 1OF0A 3LPPA 2YA2A 5TGBA 4WQOA 4L18A 3ZE2F 4Z95L 4CU8A 5I1LB 2NXZB 1RHHB 4S1QH 4AIXA 5HJDA 5FYKD 1OSZA 2HKFL 5DZPA 2J8UB 1FDLH 4HC1A 5DI8B 3TO4B 1UFUA 4NQVB 2Z31C 2W0PA 3O2DA 4QHLA 2HB0A 4MNQA 3VWJA 2YLHA 2ITDB 1GKOA 3GQFA 4CJ0A 1N8ZA 3QZPA 1R5VB 2W95A 2ZNXA 5I5MA 2BXYA 3LRGA 3RTQA 3NMEA 1ZA6A 2F5AH 4AVIA 2VN3A 4ZTPL 5DLLA 5TDOB 3H9SA 1T1XA 1NIFA 3B3BA 3IAGC 4LLWA 1NGWA 4XOBA 3VVWA 5KS9B 4U6TA 5IHZB 1HSBB 3EYQC 4MD5A 2V8MA 2LTQB 4ZSOE 2HPTA 4NOBA 3ULVH 3LKOA 1HCZA 2Z65C 1OARL 1X7SA 5T3XL 2IH8A 5DK2B 3F58H 4JUSA 5F9OH 4HS3B 2CDEB 2LGNA 3SBWC 2V8LA 5K1JA 3V9FA 3JWNC 2YBRA 3T8VA 1BMWA 2ADJA 3ARTA 3Q43A 5I18H 2W9EH 1UWGH 7FABL 2XWEA 2ZG1A 4LFHD 4OD3H 2NUPB 3KEDA 4GQQA 3GBML 4YL4A 4F1SA 4WRLA 1YEKH 4ODTL 4GIPD 1EK3A 1B2WL 4LLYB 4X8XA 1FZKA 4PM1A 4DKFH 1Z66A 3H85A 4QRQA 4E5XA 1QEWB 1WBXA 1FYTD 2C5DC 4AI7A 4U4IA 4JCWA 5DUBA 4F9PC 5D6CB 4TQHA 3WFCH 3ZO9A 2NY5H 1WD9A 1UOLA 4LMQE 3IJ9A 2J1KA 3FQRA 1JNLH 4R4FH 3ZTEA 1QKZH 5BV7L 3RIAF 3TYFB 2YEQA 2AQ2A 4FHJA 1M3JA 5CCKH 3ZO0A 4K3HA 1AGBA 4YBQD 5I5IA 4M62L 5I0XA 4FYRA 2NDGA 3V9CA 5B3NA 1ZE3C 3WIHH 5I8EA 1YJDC 4G7VH 4ODSH 1OP5K 1E5ZA 2GUYA 5E2WL 1PX8A 4X8JB 4PY8I 4HS8L 3TV3H 1I85A 5I8CB 2ZUQC 1N59A 4OKVB 2IBBA 1BIIB 4HCFA 2QQLH 3PGDA 3SCMD 2VAAB 4TSAL 2JMRA 4ZI8A 1XD0A 3NIDE 2P8LA 2R69A 1RZQA 5CLYA 3M86A 2YD6A 2D73A 4GO6B 2P26A 2ARJA 3VX1A 4FLRA 1J5HA 2ZUSA 1NEPA 1T1YB 3FQNA 3FW6A 1A9BA 5H2BB 1AGCA 1KN2H 5IGXL 3MFGB 3ARDD 2BFVL 2CJTA 3U0PB 3HZ3A 5BRPA 4XN2A 1ZJAA 4GAAA 4UZGA 4KO9A 4YHML 1X44A 5E6ZA 4DGIL 1G9MH 3IDUA 3QUKB 3NOIA 4XO9A 5I9QC 5HGGS 3LD8C 4WGVB 4HHWA 4L8CA 3VSUA 1KCRL 1KXQE 1R34A 2MWCA 2C7UB 4U0RC 2EKSB 2QFRA 3RKDD 4RIRB 5EOCJ 1DUYB 3L5WA 2XWBB 1A7OH 1C5BH 1ASQA 1L4IA 4LCCC 4AL8H 3DHPA 3TVMB 2AJ3B 2VN4A 4FN0A 5I1HL 1NL0L 3D39B 4EXKA 2HT2C 2GHZA 1BQ5A 5F3BB 1DBJL 5DZVA 4NSKA 3FB5A 3EGSA 2HFTA 1GYWA 3FTUA 5JW5B 1AQKL 2WAQA 3U9UB 3QCTH 3C5XA 1PLBA 1WGVA 5K1NA 1CFMA 1KTLB 4XZUB 1YNKH 1F6FB 2COQA 2DYPD 2VQ4A 3QUZB 4Y5YC 1BXAA 3D85B 1TYJA 4N2OA 4BYHA 3QH3B 5HDBF 4NKIL 3FN9A 4R7XA 3WS6C 3TL5A 4ACPA 2YAQA 2YPVA 2Z64C 4PJFF 2MNJB 4P5TB 3QG7L 1HHJA 1X5FA 4CSTA 1O7DC 1NUDA 4PRPD 4U33A 4I77L 3V52L 4U3HA 3ECWA 3PWVB 5E8PB 5DJYA 4QJ5B 3O6LH 4OFPA 3VDBA 2C3HA 3UBXA 3ULUD 3K6DA 4J1UA 4P23A 5TFSH 2NQCA 5GRJL 2GEQA 4R7LA 4WNJA 4A68A 4FQHB 4XC3H 4P0DA 3T0AA 1IGYA 3LRKA 4Z7WE 5A3ID 5SX5H 4XC1H 3I50L 4CN6A 3WCYA 4TQ8A 5CZVH 4JFSA 4N2DA 4UNUA 3QORB 4UM9B 2UZXA 1Q72H 3X1GA 3PWLA 4X4ME 4LHUB 4L9LB 5GSVA 3X11A 5BOZG 3TFKC 3EHBB 4MJ4A 1UYWH 4X4ZA 3G6DH 4ODXB 2OL3H 4LDLB 1HL9A 3BUIA 1F4XL 3TH3T 3L13A 3FU3A 1B2YA 5KN5A 3UYPA 3UDWA 1JHLH 1AD9B 1CLVA 1ZRUA 1YHPA 4M7ZB 4ZFZB 4UQAA 2OL3B 1WJ3A 4OTXH 2E76C 4XN9A 5FM5M 4F80A 1JPEA 3HG2A 2QADD 1QSFB 2EDEA 3ARBB 1DBAH 1NBYA 3FSAA 2N4IA 1WFOA 3RZWA 3WGUB 4ANKA 4P2YA 1ZHBA 2WNXA 2Z7UA 4KK9C 4WKXA 5K59E 1SBSL 2A9ML 1IGIH 5EZIL 5KUMA 2WWKT 2JK5A 1R24A 3MGTA 4H8WL 5DRNA 4AYDC 3DC0A 4JEGB 3ZTJH 2WUBL 1WT5A 2AXFA 3LHPL 3R06A 4Y4HD 1IEAA 1DDHB 5E24E 1UOWA 1CFVH 2ZCHH 3SE8H 1MUJB 3PRZA 3H56A 3DPDA 3Q5TA 4RQQB 4CILA 1E9QA 1JZGA 1SLWA 3MRIA 1WICA 3B2UD 2GTWA 4L8DB 1P7BA 4X98B 4BFGA 1HQRA 2WLNA 5ETUB 1E9PB 3KJ6L 4GSDL 5EOTA 1HI6B 3DMMA 4JE4B 3GDBA 5AAMA 2RA1A 4HFWB 5T33L 3VU1A 3F5WB 3LNGA 3QO0B 5C70A 3QDMA 4HCIA 2D9CA 2G3MA 2WV3A 4KRPB 2DDQL 3X3GL 2Z6FA 1SEQL 5LLIC 1I1FA 5ELIA 4J2QA 1C16A 1S3RA 1WCQA 4PB9L 3BE1L 2J1ZA 4LNVA 1RUQL 5CJQL 4MZRA 2E7DA 4GO9A 4P5MA 1WA1X 1G9EA 4K0OA 3QNXB 1DQVA 2HRPL 4Q6IA 4Y2DD 3SDCB 3VFOA 4XP5L 2Q86A 3ML8A 3MV11 5I16B 3O81A 4YHZH 4YHIA 1NGXB 2F18A 3IS1X 5C07E 3KD4A 4LKCA 1EEYA 3QJTB 4M1CD 4F15B 1T83A 2BSED 3DJTA 1EO7A 4TTGA 5MEPA 4HWBL 4RMTA 5DJCA 3I6KA 4ZW5A 1U58A 3GZPA 4XCNA 3SBPA 4EZMA 5CEXB 4FFZA 2B5IC 3NZUA 4JGJA 2X53A 2FJFA 3Q6FA 4JREB 4P59L 5IKCB 4W1TA 3CFDA 1MW3A 2V7HB 1A65A 4DWHA 5A1AA 3OPZH 4ONHA 4XPTH 2R1YA 2F74A 3RDTA 3QUXC 4OGAC 5I6XC 1LE5A 1AKJD 3WTWA 4KHTH 1A0QL 2YKKA 4F7CB 3HKFA 4MAYD 4GJTB 5JXAL 1QRNE 1Q9WB 2V0AA 3PWPD 4PY8J 5LVEA 1Z6JT 5ECJE 2EEXA 2FRGP 5F7DA 4Z5RB 2A3TA 3EO9H 4KBPA 1D7FA 2IDSA 3G5ZB 3MJ7B 4QXTB 3SSGA 5IMOB 3CSTA 5CFAA 1HAUA 4NM8L 2XPGA 5AYQA 2OZNA 4JQVC 3NP4A 4JM2A 3RI5K 2R56H 2VKXA 3ZHFA 3V0JA 2VMEA 5MEOB 4WVRA 3RUGB 4N24A 5FCSH 3KPRB 4FC3E 2PPCA 1WFUA 1W6LA 1SVCP 3RWDA 2EUVA 5C0RH 4R8WH 1VPOH 5F9WC 3GSWA 1AD0A 3JXAA 2V4LA 1UWEL 3L4UA 5TJWK 3IKKA 3JV4B 2Q8BL 1JZ5A 3VUAA 3QCUL 1Z9SA 4Y7MA 1O5DT 3GSQA 3US9A 2BVUA 4RGNB 5E8OB 1JVOA 3V5HB 3QXTA 5L0QC 3STZA 5E03A 2O6CA 4YHOH 3T6VA 3CMOH 3FUHA 3GMMB 3WBDA 5GQBA 1YC8A 4NZDA 1BQHG 1S7XB 3G7TA 2EEDA 3STBA 5EUOF 5BS0A 1GTFA 3SKMA 5DK0A 4HIEA 1G9HA 1ACYL 2FECL 4JFFA 1JBJA 2X4OA 5BUAA 3T3MB 1ETJA 4G43B 3BKJH 4M61B 3BFQG 2PR9A 3RU8H 1QUPA 1M4KA 4HKBA 5K9KB 5EDSA 4EI6A 3KYMA 5A16B 2X7LB 5A2JH 3DX0A 4QAWA 1N2RA 5KYYB 1ZV5A 3WJJA 2ZOOA 3AS0A 1ASOA 3FYEB 3AT0A 2H2PC 3OAUL 2Z0BA 1LO0H 3W38A 1I8AA 4R4BA 1I9IH 2W60B 2P45B 3CX5J 2GFBB 5E8NB 4FAAB 1HHHA 4LLMA 4ZUVB 4GXFA 3EGXB 4FXGC 2D7QA 5MEND 3ULAB 4DETA 3EJYC 2ZKMX 5GGSY 1HHIB 1E4XI 4Y8DC 3L2NA 1KOAA 4P4KA 3UC0L 5GJTH 3T6XA 2ODHA 1IEBB 1OTSC 1T4KA 4XPFL 3WN5A 1OCCB 3P73A 3ZRSA 4P57B 1AHMA 2BRQA 3ZW3A 1Y7VA 4FNSA 3UPCA 5I8KH 2ZUTA 2O5ZL 1PL3A 4FQXB 4I2XB 1WLHA 4QYOB 5HI5D 4XBMA 3U4EB 3V4VH 4YSAA 2Y7MA 2J8HA 2VL5A 1MDAA 1CVRA 3U4BH 4NZUH 4HJIA 2CUAA 4GAJL 1HL5A 4G6KH 2X4PB 4ZTEA 1FL5A 1WFNA 4I18B 5C0AA 3V4VB 1MVUA 3F12A 4QTIH 5KBLA 1QAWA 3NPSB 1PYWA 2Z4QA 4NCDA 2YOCA 4EOWH 3UTZA 1U8LA 3FNKA 1N19A 4LPWA 4WW2B 5BRZA 1BWMA 1OGSA 1CGSL 4S1DC 1AC6A 1F2XK 4N1HB 4NO5A 1I8MA 2A1WH 2F53A 3FK3A 4GKZB 4JRWA 2DJ4A 2PKDA 3LZRA 3VB9A 3O4LD 3DK2A 4LAQL 1NGQH 2A77H 2QSCH 4LEEA 1GKEA 2ZWKA 1EHLL 3L4VA 1C08A 3MJ8B 3QIBA 4UDUA 4ZX4A 4YR6B 3V0GA 3AMKA 2XWJA 3VFUB 1BX2B 5DJXA 1XR8B 1KDJA 3S8WA 1DBMH 4BZ2H 5EU7C 1R6VA 1QBAA 2VIRA 1IFHL 2A6KB 3AXLA 4NQDE 3HG1D 5DU7A 4CBPA 2I26N 3LKQA 1PZCA 1MFEL 2PF6A 1ZVNA 4KY1L 1X6LA 3HVDA 4EDXA 2P7TB 4HGMA 5HGAA 1NFIB 2GTQA 4UIMB 1LYQA 2PYFB 6TAAA 2IH1B 5GGQH 2WBKA 3FFCA 5I24A 4JQIH 4AQAA 2WLMA 5JHLL 3AG3B 3FQWB 4WKZB 4ZAKA 3NEEA 3IKCB 1J11A 1TZIB 1U8KB 5D72H 4N86A 3UG5A 2DH3A 1TG8A 3EYOB 3O3UN 4KVCH 4QCIA 2EH8H 3HNVH 4G8EA 1HILB 1EEUA 4IIZA 3VD0A 1F58H 1KEMH 4LASH 4WNSA 1KGIA 1E2ZA 1OTTC 1U3HA 4P9ML 1KIQB 4TQEL 3WEOA 1TO4A 1TJMA 1KYUA 1UCBL 1EANA 5DHVH 2V2TA 1U3ZA 4U6HB 2AKRB 3TN0D 4KX9A 3FO9B 4TUJB 4N6RB 4ODHH 4AUYA 2ZXWB 3IVKB 2EINB 2PN5A 4HOXA 5EORH 1ERNA 2FGWH 4Z3HA 1KJ2A 3OMAB 3BLPX 2CO3A 4IRZA 4JDVB 4K8RL 2E0PA 1IAIM 1HZKA 3MRBA 4OZGA 3QEHB 5DHVB 1LEKA 5KBNC 1RZIB 5E6ID 3DI3B 1HH9A 5C6PB 5FECB 7PAZA 5JHAA 4LEXH 2JKWA 2HRHA 4R4NC 3L1FA 1ZPUA 1IZJA 1SUJA 1XIWB 3AQZA 1LNUA 2EE6A 2EC8A 4LSVH 3HE7A 3KJ4B 4MWFA 2OXGB 4JFOB 3WD5L 5DVMA 3VRIB 3CSYB 4H0GA 3VFGL 3WTUA 3FTGA 2XA8H 1UVQA 3MYJA 4GI8A 2Z1KA 3WJMB 1AP2B 2LU5A 2NY5C 1M7DB 4X7SL 5T5NG 4A2DA 4XODA 2JI2A 2GJPA 5DJZB 4YWGL 3AROA 3L5XL 1E27A 4FNQA 2IQ9H 4JZJA 1UC6A 3OKKB 5CLWA 4L5FH 5AVVB 3KL5A 2XXGA 4Z78A 5MEQA 1DQKA 4HC1H 4J6RH 5TGBB 3ZYJA 3FZUD 2JFCA 2PXYD 4F8TA 3O2DH 1ZLUH 2FECI 3UL4A 4FGMA 1CFSA 4BH7A 3T8MA 4MXVE 5AVUB 3THML 1OSZB 2CD0A 1EVUA 3L2LA 4HULB 1PLGL 1PLAA 4YLQT 4QHLB 5D7KD 3QNZA 3RE0A 4MNQB 5F0JB 4OGYL 3VWJB 2VDQL 1F4YL 3W0WD 4PJHE 2BX5A 4PGCA 3SOTA 5IHUL 5IESL 3QULA 1BAFH 3P0VH 3RTQB 2C9RA 4LCIL 1ZA6B 3SBQA 3BT2H 3MV9D 3Q5YA 5KTEL 1CFNA 4Z7OB 2KPWA 4GSUA 4JNXA 4XVUC 3H9SB 1T1XB 4YDLB 2BSRA 1NGWB 3T77B 3L54A 2NY7H 2R9HC 3T6WA 4MD5B 4AT6A 2RD0A 4YSQA 3ARFD 2PW1A 1JRHL 3LKOB 5IBTL 1HCVA 5EEXA 3FT0A 4JLRA 3CZJA 1ROWA 3DA0A 1MCOH 1ZEAH 3G9AB 2IO5A 2M26A 3NIFE 3TVMC 5FO2A 2D7NA 5GJSL 4B9YA 3QI9D 3IBEA 1BBDH 1JDAA 2ICES 2V9QA 2YBRB 4M43H 2ADJB 2VXVL 4OQTL 1PBYA 4DKTA 2NYYD 4ABVA 3IN0A 3NEXA 3ARRA 5ADPH 4KZEH 1P4BL 2CGYA 1FZKB 3L48A 3ZJAA 4FHKA 1V7NL 2Z8RA 1G7IA 4QRQB 1A7QH 3VI4A 4E5XB 1WBXB 4D3CH 1LL1A 5DUBB 1F02I 1MHEA 3QUZC 1CF1A 2JCCF 2J88L 3X13A 4BCZA 3DHUA 4QXGH 5B21A 4H8PA 4DZBA 3FQRB 3TBVA 4F9LC 4JY6A 4X6CE 2FIKA 4P5TC 3AB0C 3DTUB 1OD7A 2BZCA 5KW9L 3BDBA 35C8L 1AGBB 1NMCC 3INUH 4MQSB 2K9UA 5KZCB 1MVYA 4LHJB 1P53A 1KPRA 3W11D 5FKAB 5BMFL 4F58H 5I8EB 4KKCD 2C9VA 3Q8AA 5HHVH 3SE3C 4WWID 3UFIA 2R69H 2MTPA 2PYED 3SCMA 1JGEA 1N59B 3CPUA 1UT1A 4RISH 4DO4A 3VVVA 4LL9A 3B9KD 3PGDB 1UENA 5L4FA 3G5YA 4J3WA 5GIRB 5H94A 1DYZA 4JFDD 2P8LB 3NAAL 2VWEC 1DEDA 5CD5C 5HHMD 3I3BA 5T1DH 1F2QA 2ARJB 3EBIA 4BQ6A 3GJFA 2JE8A 3ARDA 3EHBC 3DXAE 5DUPL 1A4KA 3FQNB 1INEL 1A9BB 3P4MA 1L7TH 1EAPA 3P9MA 3NH7H 1TR7A 1OEZW 1UQSA 1HCFX 1MF2H 1QFUH 3GPSA 3S37X 3SGEI 3SPIA 4JKMA 3ZR6A 1S3KH 4WEBH 4E9YA 5F1NA 3DLQR 1U2YA 1QLRA 3BAWA 1N5YH 5AG9A 4L8CB 3US0A 3ARBC 1I8LC 1LD9A 4N3TA 1DBBH 3L5WB 4V2CB 2XRAL 4A55A 4K5PA 1CWVA 4LSSL 1DJGA 3HB3D 2YAMA 1J1PL 2P5WE 1CU4L 3FQUA 4Q6YA 3VGAC 1G5AA 4NSKB 5C86A 3FB5B 3EGSB 1E7UA 2YEVB 1X5LA 2OYKA 3DVNA 4B41A 3ZVVA 4WUKL 3CXHJ 3NDYE 2BVPA 4U7KA 3F65A 3CVIH 3O11B 3RURA 2DYPA 3ZT5A 3D06A 1LM8V 5KAQF 4HAFA 3UO8B 1TTGA 4YSSA 1DJHA 2YPVH 5ANMA 4QEGA 4L8SA 4FABL 5A40E 5SX5K 3T0XA 3TCXA 4ATWA 1QTSA 3IDJA 1AIFB 3GLAA 5E2UH 4PRPA 3ZZ1A 1DSFH 4KRPC 1XV8A 2ZQKA 5I6NA 3VFMA 1HHJB 5IIEA 2D03L 3WY2A 4P49A 3QG6A 1R0AL 1NIBA 3UBXB 5IM7B 4GAYA 3NZHL 5SX4H 4M7LT 1SJVA 5J6GA 4J1UB 1ACXA 4P23B 1YEEH 4JFXA 3SDCC 5JOFA 3S36X 2XN9E 4CC4A 1IGYB 4QKXB 3FUEA 3U30C 3BESR 2C9QA 3QYCA 4TNWF 1YQVL 3QEGL 2Q1EA 4OZHA 4XPGH 3Q6GH 1ZVSA 1TETH 3BUDA 2X87A 4F15C 4ERSH 1ESOA 3RYMA 2UZXB 3PWLB 5GSVB 5IG7A 1GZQA 4IYKA 3X11B 5MERA 1H8OA 4LPCA 5IR1B 3ECQA 4KV5F 3EBGA 5LDSA 5ACZA 1JRHI 4JREC 1SLVA 5KN5B 2DMBA 3UYPB 1GMIA 2CLVA 3QPKA 1FP5A 1TYRA 2DIBA 1N5AA 1VADA 1NCDL 2IXQA 3CJJA 1XH2A 4HISA 3T0EE 3TJEH 3EDEA 2KDYA 3BWUF 4OFVA 2YD2A 1NBYB 2H41A 5DUMH 1KG0A 2R0KH 1ZHBB 3ILPA 2G3XA 3UABA 2Y06L 1RLBA 2Q7YB 5IJKA 1EMTH 2I7OA 2JK5B 1I7TB 1R24B 3MGTB 3BFWA 5D5ME 3DSNA 5DRNB 4HOZA 4Y4HA 2J5WA 1JZFA 4TVSa 3TS8A 2AXFB 4AEIH 1BFVL 3P30L 1HYRC 3R06B 3HJEA 4NN6B 1EJ8A 1IEAB 4KXAA 1MFAL 1UD8A 3TA3D 5BO1H 4LBEA 4M1GL 3SOBH 5KSUA 4Z9KB 1B4JH 1E9QB 4XOCA 3MRIB 2NY0D 3L4ZA 1CE1L 1PY9A 3OJDA 1PZBA 4GMTL 1HQRB 1TT6A 1PY0A 3EJPA 4OU3A 2B1HH 3GBEA 1Q4NX 4XO4A 2CGRL 5FOBA 2BSTA 2MMXA 2J55A 1P9MC 1UKQA 3DMMB 4PVMA 5CGTA 5AVYB 3MXWH 3VXUD 1A25A 3ATAA 4Y1AE 1EPFA 3QDMB 4PWHA 1EFXD 5FGBC 4DEUA 2P4AB 4DGVH 5HHXH 4A7UA 1KGXA 4Q0XH 1J88A 3BP7A 1I1FB 2CZNA 3IN2A 3AXHA 3NGBB 4LPYA 3RWHA 1C16B 4RGNC 5FYLE 5L6YH 1KTBA 1HINH 4R7VA 1MJ7L 2VSMB 2Y6SC 2EADA 4Y2DA 4RGOL 1MWAA 3U4AA 4Y19D 5I15H 4KKBC 4P5MB 4ZS7L 1A8ZA 4MAZA 4Q6IB 3NFSL 3GDCA 1H19A 4G3YL 1P0SE 3I6SA 5DRXB 3VFOB 1HJBC 2V3FA 2Q86B 4MFHA 2KS0A 4YHIB 2NPLX 5E2VL 2AVFA 2BSEA 4BCYA 4LKCB 1XZ0A 1YN6A 1EEYB 2AABH 4FFZH 4GQ9L 1FGNH 2NY6D 3H3PL 1AO7E 3UADA 1OCWH 4BE6A 4M8UA 3ZE2E 4MXWH 4BIKA 5MEPB 1UM5L 5DJCB 3GC3A 3I6KB 1U58B 4XCNB 3ERXA 1KGJA 1TVHA 2B1AH 5FUZL 2FJFB 1IEHA 1Y1UA 2OMVA 1WG3A 3Q6FB 2WANA 3EXJA 2JTYA 1RU9H 1GSKA 3CFDB 5D71L 2DAVA 1AKJA 4ONHB 4UM8A 4NKQB 2F74B 2YD8A 3RDTB 1OAZL 4MAYA 3L3OA 2HH0L 4PCKA 1RULL 2UZYA 4XE0A 5HY9A 2D3VA 3PWPA 4WAFA 4RGMB 4AKOA 2JLPA 4EZLA 2TRYA 3WI9A 2ZCKL 3TWCH 4I3RH 4KTEH 5DFVD 2VJXA 3SPJA 2L7EA 4MBRA 4JRYA 2XPGB 3H55A 4ELMF 4HSQA 5EZOL 4NAQA 2CK2A 1VACB 3VWKD 5D7EA 3K0WA 4PCTA 4LQFL 4TVPD 3RWDB 3H54A 4XRCA 5DC9B 4JDZA 3SYCA 4WSGA 2XIBA 3NPSC 3OTTA 3SD2A 5EEYA 2O5YH 3BKCH 1B4TA 3GSWB 1AD0B 3Q2NA 3MCKA 4IU2A 5I82A 5I8OL 3KR3H 3K6NA 4FFYA 4GSQA 4WW2C 5IBLC 3B7RL 4NWTH 3V8CA 1TQSA 2QPFA 1RZ7H 2Q0ZX 1UJ3C 5CEYA 1Z9SB 1RUKH 4FQJH 1JGDA 3GSQB 4YHKL 3V4UL 4XCFL 3H6AA 1UD6A 4FTVE 1BFSA 3GS7A 3A3YB 2E9WA 3QFDA 4LU5L 3STZB 1A6TA 3SDYL 3NQKA 2EE3A 2N56A 3HNTH 4ZYKA 4Y7OC 2XTJB 4WWKD 2V9UA 5F88A 3L3GA 2J7LA 4GIOA 5BS0B 2CM6A 5K9OA 3SKMB 5DK0B 8FABA 4HIEB 5AALA 3V0WL 4O51A 5C8JA 2ZX6A 4JFFB 2AHIA 2R8SH 2X4OB 1TNMA 3MO1A 3V0EA 5FUOL 5EIIA 1C7TA 4PBDA 1XSJA 1C9SA 4HKBB 4HBQA 3KYMB 2BMKA 3LAFA 1TUPA 1N2RB 3ZHNA 3PHAA 1DFXA 5FF6A 1NFDA 2H2SC 4ZBJA 3PDOA 2IBGA 2VXSL 1NJ9A 4BBWA 4TUKL 3A47A 4BWUA 4F8PA 1KXVC 4M8QA 1Q9LA 4X6EA 3MV8E 5K9QI 1C1EH 4ODVL 3T3PB 2VABA 1FO0A 2VDKL 1HHHB 4FYTA 4LLMB 5E5RB 3TH2T 2VM9A 5IB3B 1YMHA 4J5VA 3N91A 4MA1C 3II1A 4HD5A 1NAML 2CUIA 4YS4A 3GSXA 4P4KB 4TTDC 3S3CB 4UBDC 4NQEA 3D05A 4Q9CA 1P84K 4WWNA 5KYXA 4AYBA 4A7GF 1T4KB 3FCUB 4WLCA 3WN5B 1P5UA 4ODUA 2YAPA 3P73B 5CLXA 3VMNA 3UJIL 1LO3H 3BAJA 2JKNA 2W07A 1KELL 4NPJA 3ROLA 1Y18A 2NQ3A 5ICUA 3VGBA 1ODAA 2ED7A 1BYNA 2VL5B 2WXJA 1DSYA 2PWHA 4XMPH 1XIWC 5I0ZA 4L8BA 4RRPG 1T2JA 5E8DL 2FR4A 1A7RH 4Q9QL 5C0AB 2BOLA 4G70B 1MVUB 3F12B 3GSVA 3J2PA 5KUKA 4TL4A 1D6VL 4K3JH 2RFXA 4YBLC 1PYWB 2Z4QB 2WQAA 5FA3A 3QAZB 1H8NA 2NR6D 3UTZB 1U8LB 3TT1L 3FN0L 5GPRA 3GSNB 1FAIH 1S2EA 3C6LD 5EF3A 3O4LA 1JXKA 1NMBH 2XQYG 4NO5B 1I8MB 3PGCA 2F53B 2MFNA 4EKJA 1CL7H 1YEHH 4UV7L 1O9ZA 1MHPH 4EJ1C 1P7HL 1FFQA 2Q3XA 5HDBE 3U0TA 5INDA 1C08B 3QIBB 4UDUB 1D5IH 3EUUA 2XWJB 1E5BA 4KPHL 4PJFE 5DJXB 1S7RA 3HG1A 5IT2L 2PABA 1MEXL 4WI6A 2V3DA 2VIRB 3AXLB 1R3IL 2DD8L 3HFFA 3LKQB 4YK4C 1F0LA 1E8WA 1RMFH 4PRBA 5E9NA 5BOJA 5HYEA 1A14L 4EDXB 5CJOH 5HGAB 3H2PA 1JPTL 4DZ8A 5EV7A 4ZD3L 5TPWL 4F93B 1IGJA 5GRUL 1KCUH 3RTQC 3FFCB 4GB9A 4AQAB 1A1MA 5FR3A 2P28B 4LLQA 1VENA 1BIHA 3WXWL 2X2JA 4ZAKB 2BVTA 1Y6MR 32C2A 1YMMB 4JG1L 1JIBA 1OAYH 4BXVA 4QCIB 1GOHA 5IQMA 4HPOH 4G8EB 5CSBA 2DQGH 4X5LA 1BHGA 1U3HB 4L48A 4X7DC 5E56A 3HUJA 3SKOA 4FADA 1KJ2H 3TN0A 1L0PA 2R29L 4IRZH 2DZEA 3V6OA 2V2TB 4MXQD 4B27A 3BUYB 1MVFA 3EH4B 3FB7A 5DD1H 1JV2A 1UA6L 2Q9OA 1QR1A 1KJ2B 1XF5A 2DQTL 3CHXA 4NHUA 5D7LE 3MRBB 1LEKB 4OZGB 5DLMH 5IREA 3DGDA 1HH9B 1R3HA 1MG3C 4WI8A 3B7SA 4JJOA 1QO3A 3ILQC 3L9EA 4HSCX 3OB8A 2ORBH 1K85A 2GBVA 1LNUB 1ZLUK 1IL1A 4U1HA 4HJJH 5T3ZL 4MWFB 4PS8A 2DTSA 2FWLB 3LS5H 2AITA 4XB3A 5T5FA 5ABDE 3FTGB 3NSYA 3QUGA 1UVQB 1N70A 3MYJB 1AHKA 1MWOA 3HBPA 1NGPL 1B3IA 5CJ5A 3L1GA 3X1EA 4ZJ9A 5J4MA 1JHTA 4XP9L 3RNKA 4FQ2H 2VDOL 1E27B 4R9HA 1J5CA 1M2VA 4JZJB 5BQ7A 2I27N 2PXYA 1WQVT 2IH3A 4Z78B 5B39G 5MEQB 5F7AA 4LSTH 1AS6A 2EZ0D 4QGTA 3VGFA 1OIOA 1CFSB 4BH7B 2WYTA 2UXVA 1XGPA 4OD2B 4QRTA 4A2HA 3W0WA 1AHWC 1YPZB 3SIKA 3QNZB 1UXLA 4FMFA 5D93C 4KKQA 5FS5A 2CIIA 4OZFG 3MV9A 3B9EA 4O00A 3V4PA 3WSQH 3QULB 4PU2A 4CMMA 4OLUH 1CFNB 1NPUA 5FV1L 1EDHA 2Y23A 2EVFA 1FFOA 2BSRB 1YEGL 3ARFA 4XMUA 1MN4A 4PN6A 5F6IC 4AENB 4AT6B 2HLFC 2IQAA 3S3SA 1CB4A 2ZYSA 3K6SB 2PW1B 4HIXL 3AITA 5H4YA 2Y5TA 4JO4L 4L1SA 5D7IF 4JB9L 4JLRB 2D3LA 3QI9A 5IY5B 1SGKA 5C6TL 4KFZC 4XNUL 4KOCA 3G9VA 1A6WH 4F37K 3JZ7A 1FH5H 2WTRA 3T0WA 1X5AA 4XBGA 2X6VA 2ZUWA 4LVEA 5DO2D 5GGSA 3RQ3A 1B9ZA 1J1OL 2BIHA 4UIKL 1B0GA 4HF5L 3GTTA 2ZSWA 3KZ8A 2I60L 1FYTB 5E1IA 2FBJL 1Z5YD 2OJZH 3W82A 3VI4B 1MHEB 3TIEA 3X13B 4HJEA 5DYOA 1XD1A 2KZKA 3KLHC 4DZBB 4JY6B 2FIKB 4S1QL 4FD0A 1FVEA 4X7EC 1BV8A 4PS4H 4ODWA 4DQAA 2X10A 4HEME 1A47A 4WI3A 1SZNA 1KPRB 3LXAA 1AGDA 1HWHB 1F97A 4P23C 4XPBH 2PYEA 4L1TA 5B38G 3BUPA 5C07D 2YN5A 2F5AL 3MLXH 3B9KA 3SCMB 1JGEB 2E47A 2IIJA 5JLZA 2ARJQ 5IB5B 4JFDA 3LKNB 3GRWA 2X6BA 1KGCE 3K3QA 3G5YB 3GJFH 4FQLH 1HKLH 5H94B 1KB5A 1ZHLA 3KWVA 5E00A 3ULVL 4UQ2A 1MKFA 3L3KA 2AJZA 3KCPA 4MCNA 4CJ1A 3ARDB 1A4KB 1IBHA 3F58L 3RZCC 3P4MB 4DK6A 1M7XA 5F9OL 3DX7A 1KTCA 1EAPB 3P9MB 1RVFH 3UBHA 3UDWC 4JFZH 1UQSB 2RALA 1QRND 1QR4A 5EUOE 5I18L 1UWGL 5F0LB 5C0DB 2F61A 4OD3L 4CA4A 5F1NB 5A2IH 1MFNA 4XNYH 1QLRB 1YEKL 4NKDA 1CT8A 3H3KA 2AQNA 3T4AA 4DKFL 3TURA 5AL8A 4OFYD 4POZC 1PCXA 3CSBA 1FC2D 1TXKA 3EG9A 4MSWA 2A7BA 3CZFA 3D0LA 3OKOA 3OZKA 5IOPA 1AS8A 3DK0A 3FQUB 4NN6C 1JNLL 2MTAA 1QKZL 2Y7NA 5J11C 2EILB 3DVNB 1UT9A 4JDTL 5GHWL 5CCKL 5JHBA 4QXUH 4DUVA 2BVPB 4RNRA 4DESA 3R19A 3K2IA 2DYPB 1V5JA 2YPLE 4PJDA 4XN8A 5AVZB 4EN3D 3R4DA 3WIHL 1A6ZA 1WC7B 4G7VL 4ODSL 1A6AA 5AYTA 5ANMB 3OAWA 3ZDZF 3DMMC 1ICTA 5AAMC 3TV3L 1HE8A 2ETWA 3H0TA 4Y9FA 3ULUH 2R1WA 3IDJB 5CBAB 4PRPB 4YZWA 2WLKA 4MVBD 2QQLL 3OJVC 3VFMB 5IIEB 2ICWI 4NO2A 1SDDA 4M56A 3NGBC 3VFRA 2PPEA 5FWQA 3QG6B 1LWRA 5I1KH 2CQVA 4GAYB 3N1PC 5J6GB 4P46D 1OTUD 4DTGH 2Y4SA 4JFXB 3E3QC 4Q6IC 4TLKA 2ZKHH 5CN3A 5JOFB 4BQ8A 3VFPA 2E7MA 1KN2L 1FHNA 2JLLA 2P8PA 4M4RB 3QRGH 4HYTB 5FDWA 5FB8A 1VGEH 2N1KA 4PJAE 2A74C 5KVMC 3MBWA 4OZHB 4X4XA 1G9ML 1ZVSB 4CVUA 1L6PA 2YFOA 1UJTA 1N12A 4WK4B 1T83C 3TGXA 1AS7A 1NCUA 2RBLA 3GHEH 3IPEA 1GZQB 1HX0A 2KUTA 2OK0H 3CFJA 1AFVH 5MERB 1HJCA 5L4IA 1A7OL 1C5BL 4PV8A 4G9DA 4AL8L 5ACZB 3FTYA 3QJXA 1JK8A 4XWOC 1MJUL 3EGDB 2B3RA 2CLVB 2E9BA 1IBDA 2H3XC 5FAAA 1VADB 2IXQB 3WFZA 2QADB 2LOEA 1VESA 1L9SA 2V5MA 1JMZA 5BUPA 3QCTL 1T2XA 3HIZA 4RGMC 3O3DB 4L4TE 3LEVH 1JUFA 1KG0B 2PP9A 1S4IA 1YNKL 4LSUH 3U7YH 4XBEH 3IJSA 5D2NE 3Q8EA 3DSNB 3I84A 3PUCA 4Y4HB 3UYRH 3U25A 3S3DB 3K7UA 3UPAA 2X3CA 3TA3A 4YDNA 5CEZE 4MNGA 4GRMA 2F8IA 3RG1C 4OV5A 1SQMA 2NY4C 4H0IA 2X0WA 4HLEA 4LBEB 25C8L 1MFVA 1J1XH 3OJDB 4JS7A 1TCRA 2UWEA 1DQTA 5TFSL 3VXUA 3EH1A 1D9KB 1GCFA 5FOBB 2BSTB 5JXED 1EFXA 4XC3L 3SDXF 1HKFA 3NJHA 3ZE1F 2QHRH 3MZGB 4NN7C 1WITA 3GIVA 5CLTA 1BBJA 2D9QB 3NA9H 1MWAH 5CP7A 4XC1L 1GC1H 1FL6A 1QSEE 1NEZA 3HMWH 3RWHB 3BP7B 2H3NA 5CZVL 1CXLA 4U1MA 4TOYH 2P48B 3HI5H 4Y19A 2JV6A 1BJ8A 3GD1C 2N01B 5I0YA 3KNBA 3NCBB 4Y2DB 1Q72L 4NQDD 2JIXD 1MWAB 1G84A 5KANI 4PYGA 4UTBL 1GYVA 1UYWL 1NCNA 4OLXH 2OL3L 2UZPA 2VL4A 4PR5A 2HPOA 2ZPKL 4O2FA 4OTXL 1XZ0B 1YN6B 4KGJA 4K3DL 3P77A 3HBGA 3QCVH 3EYSH 5I26A 1DBAL 4NBZB 2Q76A 3WKYA 5ABZA 5D7SL 1B90A 2ROYA 4HIJA 4X5WA 4Y88A 1TVHB 1IGIL 2Y24A 3TTYA 2OMVB 4EZJA 2ITEA 1FBIL 5IQLA 3HG5A 3JZYA 3TCTA 1F4AA 4OIFA 3B2DC 5IFJA 1AKJB 1RI8A 4UM8B 2R0WH 1CFVL 1VEPA 3OG4B 2PLTA 1MIMH 5GGTL 3SE8L 1E4KC 3L3OB 4KXZH 5HHPA 2UZYB 4JFHE 4KDVA 5HY9B 3PWPB 1G0YR 4UTAA 4N26A 4WJ5B 2J8UF 2B1OA 4P4KC 4EMZA 3RIFK 2J71A 3KVPA 5JDJA 4MGXA 4MA3A 1KCWA 1OCOB 1SHMA 3WFDL 4AEFA 3UPRA 3PIQA 3KMDA 3GXMA 2WMPB 2AEQH 1HHGA 2GI0A 1MCWW 4N1EA 3GMNB 4XCYA 3VWKA 3GXIA 1C12A 2K6ZA 4GP8B 3D9AH 1PKQE 3UTSE 4YXKH 1BD2E 5JIQA 3AXIA 4JGMA 3CSFA 4FFYH 5CZKA 3DUHA 2L3BA 4XRCB 4JDZB 5CEZL 3BH8A 3WO4B 1S7UA 4H25A 3WV0A 3QAZC 4IU2B 2ZX5A 3MCKB 4EUPG 5AKRA 3VQ2C 1DE4A 2D7OA 4G72B 1CICD 2D4FA 1IKOP 1Y07A 5CEYB 1I31A 1JGDB 3QHFH 5AW5B 3NK4A 4OF3A 3F04A 2XQYK 3QPQD 3N85H 1CTNA 2WN2A 3VG0L 2JCCE 1C5DB 3ZDXF 3QFDB 3AT9A 1JI2A 3QIBC 4WWKA 2CR3A 1A6TB 4NLHA 4ZYKB 1A4AA 2XWRA 3MQIA 4DUXA 1AZRA 3SY0A 1FNFA 1GA2A 3VXSD 4IW4C 5E1QA 1MH5A 5K9OB 1TU2A 3CN2A 3O2VL 2P24A 4R26L 3OPZL 5C8JB 4XPTL 1BYOA 4PJCF 4ZSOA 5F2FA 5AFAA 1SYSB 3OXSA 1KYOJ 5EN3A 2DQMA 2BMKB 2EDOA 1KBPA 5FF6B 1NFDB 4D9LH 1FO0H 1JZEA 1NJ9B 3APNA 3EO9L 4HJ1A 5E7FA 1R3JA 4M8QB 1Q9LB 4X6EB 2MRYA 1GYCA 4GKOA 3ABKB 2CLRA 4U3XA 2ICWJ 4GAFB 4PBWD 5MENB 2VABB 5DA4A 2NZIA 15C8H 1FO0B 4QMEA 3FQXA 4IBVA 1MI5E 3H1ZA 2Q10A 1YMHB 5CZXD 4UV4H 5I28A 3BN9C 1MJ8H 4WU7A 4Z7QF 4NZTH 4P48A 3Q2VA 1WVZA 1P7QD 4A63A 3I9PA 4R8WL 1VPOL 1WK0A 1P5UB 4ODUB 1PY4A 4YGVA 3TP4A 3D1MC 4GFTB 4IEFA 1FVDA 2W07B 3D2TA 3ROLB 1Y18B 5EO1A 3W2DH 1DCEA 5CGYC 3FT9A 3HLAB 3OKEA 1OB0A 5BQDA 2XZAL 1NC2D 4L8BB 3GLDA 4Z18A 2F5BH 3ETTA 4J4PC 2FR4B 1M6OA 2CO1A 1UFGA 4LHQB 3GSVB 2K6YA 2NR6A 1FNLA 5C97A 1F8TL 1NCIA 2RFXB 4YHYB 5K9JH 4YHOL 5FA3B 3CMOL 3C6LA 1SBBA 3QC5X 2VCOA 4P3DA 2E59A 4P2RE 5AOJA 3V79C 3R0NA 5F9DC 3O4LB 1YNTA 2PMZA 4X0NA 3PGCB 4JZJC 2JKSA 5DRWA 2WP3O 3HPLA 1HN1A 4MKTA 4HP5A 3U0TB 1PNCA 2OP4H 3NJLA 3RU8L 5INDB 3LRHA 3GLEA 4OUOA 5CHNB 4U4BA 2GT9A 1S7RB 3HG1B 3LDBB 2MQ3A 1TFPA 2KMWA 3DXAD 5E6YA 5C7XH 1ZY9A 2FK9A 3SQOL 1OF2A 1LO0L 3ZQXA 1NM4A 2YXWA 4EO5A 4ANWA 4DEPC 3RILA 4LIQH 4PRBB 1I9IL 2YMTA 2EIJB 3QS3A 5GRZA 5BZZA 4DZ8B 2NTSP 1IGJB 1BQUA 2XTSA 2QV2A 1KXQA 1I3VA 2CUMA 2GBUA 1HT6A 1A1MB 4LLQB 2MCMA 4AJVA 2H26A 2CPCA 5GJTL 1T20A 1QASA 5DCCA 32C2B 1U8PA 2WLYA 3KL0A 3VFTA 3K8KA 1ACCA 1RFDH 2LAGB 3DETD 4LEOA 1WFMA 5I8KL 2NSQA 2BNQE 5T1LA 3HAEB 3N50A 3S35L 3V4VL 1O0VA 2P5WD 3U4BL 2EDJA 3D34A 2A6DA 3HUJB 1AOHA 3SKOB 4NZUL 3U7WH 3TN0B 1N10A 1BQLH 4G6KL 5IB2A 2FJHA 4KV5E 5F7HA 4LARH 1IJNA 1PD1A 3UGXA 1Q9KB 4M93C 4QJ4B 5KSAD 3FB7B 4QTIL 4B0MM 5E6IB 4W68A 3ZX1A 1XF5B 4NHUB 2BVEA 4WHYH 1CI3M 3MV7E 2ZICA 4X5RA 2X4TA 3ETSA 3Q8BA 3P0YH 1QO3B 2CKNA 2WYIA 5T5FH 1QZNA 2A1WL 4P06A 4N28A 3E6HB 4MMXA 3D87B 4U1HB 2A77L 2OMXA 2QFPA 4GP4B 3E9UA 1JVLA 4FNUA 4F7KA 1HL4A 3QXWA 1D7DA 3I85A 1CJYA 1PD0A 2AVGA 4YBQC 3DROA 2Q5BA 5H37G 1R33A 1DBML 4Z7WA 4BZ2L 1TCMA 2OSXA 1WWAX 3GK8H 3L4TA 1X5GA 3BWAA 3ATEA 4K55A 1F3JA 1JHTB 2EACA 3RNKB 1IC7H 4PWJA 1DDTA 1IC0A 5BQ7B 2DEYX 3BW9A 3HAEG 2PXYB 2W65A 4K15A 1I7ZA 4PGBA 4X4MA 4KUCF 4J8RA 4MJJA 4JQIL 5GGQL 3SCMC 3MRPA 3R8QA 1TJGH 5F7FA 3OZ9H 4EQ2A 3BDYH 1JSYA 1XGPB 1K9TA 3V4PH 4QRTB 3QWNA 2D0GA 3FHEA 3N41F 4KVCL 3W0WB 3T2QA 3A24A 1N6QL 1RSFA 2EH8L 4PP1D 3AM8C 1F58L 1KEML 2CIIB 3AW5A 4LASL 5AENA 3MV9B 3ARDC 3V4PB 3M1BA 2AAVA 4LVOC 5IW6A 4FS0A 2OYLA 2XBZA 2G0KA 3LQAL 5IF0A 1U8HA 1EJFA 3GMQA 4ODHL 3IFNH 4DP9X 1JXGA 1FFOB 5EORL 1HZHH 2FGWL 3ABGA 4KMTH 3UZVA 1MRCH 3ARFB 4ABWA 3F7YA 1PCSA 3TEYA 4MYWB 1KBKA 2IQAB 1TQCB 3B7YA 2GTZA 3ZL2A 1Q38A 4HHAA 2Y5TB 2NY3D 4LEXL 5G4NA 4KNUA 5LGKA 4H88H 5FFOA 1ZLEA 3CLFH 2OR9L 2Q8AH 1MSPA 5EU5A 4MQ7A 4LSVL 5DFWH 5PAZA 2AJUH 4TPRL 2WTRB 2OTWA 1JCVA 3ISRA 4XBGB 3IXTA 2HSIA 4KKNA 1DVFD 4KQ3H 3U6RA 5EF2A 5DZNA 5GGSB 1B0GB 4P4RA 4JHWH 4NRXB 3TH4T 5KVGH 2R0ZH 2ZSWB 4J3TA 4N87A 4LCYA 4HWZA 4Y1AD 4LK4A 3LPWA 1ZTXE 2VXQA 4NN5B 4YFEA 2OMYA 1DJWA 1TZOA 4L5FL 3TIEB 4JPVL 4UB0H 1AKPA 3V8OA 4J6RL 5I0DA 2VLJE 5DYOB 3P3RA 1D5MA 4ZX6A 3O2DL 1MXDA 1ADWA 1R5WA 2GPZA 1FVEB 4FULA 3MRDA 2VH5H 2AJSL 4ELME 3LH9A 5JW3H 4AVHA 4I48A 3UAEA 5TK4A 2P9RA 4YC2C 4MD0A 5C07A 4AV5A 2APWA 5DS2A 5BCAA 1AGDB 1JWMA 4K07A 3GUFA 3GRWH 2PYEB 1H5BA 1NCTA 3DJRA 4QUOA 1BAFL 5FGRA 1KB5H 1CDUA 3BT2L 1AO7D 3B9KB 4O4YH 1NDGA 1T7VA 1T66D 5JLZB 3T0DA 2CJ3A 4JFDB 4LP8A 5JA8B 3B34A 1L9RA 2IALB 3FXIC 3KPPA 3S5LG 5HHMB 4HLJA 3RUGF 2NY7L 1KB5B 1ZHLB 2ALWA 2DLHA 4K94H 4ODBD 5ESVA 4Z7NF 1FFPA 3TV8A 4AYEC 2CRYA 4UQ2B 1L0QA 5FOJA 3L3KB 5AB2A 2AJZB 3KCPB 1XCQA 3V4LA 3ZHDA 1ZEAL 3DX7B 4ONGH 1QRNA 3I3EA 1BBDL 3G5VA 4M43L 2OS7A 3VQ1C 2YR3A 4M6AA 5AOLA 2WTPA 1INDL 2QADC 3VDCA 4UU9A 1BLNA 3WO3B 3SQBB 5ADPL 4KZEL 5GZND 1DFBH 1UXWA 4NKDB 1CT8B 2DLGA 1SXBA 3ZL4L 1HWGB 4OFYA 3T4AB 1DJXA 1UH3A 1XMEB 1HS6A 1X5HA 2XJLA 3SO5A 1BMGA 3HB3B 4GUPA 1A7QL 5H8DA 2W0FA 5IJKC 4D3CL 5HD8D 4Y4HC 3EG9B 1DQLH 3E6FA 3CFUA 3V7MA 3D0LB 3OKOB 5IOPB 4I1NB 4QXGL 4Z7AA 3KPNA 3T3MF 2ZOLA 4PWFA 3FFOA 2VXUH 3HHRB 1OGAE 2NLJA 1C5CH 2DW5A 2R2EA 1AE6L 4CC0A 2V9RA 4X6DF 1FV1B 1OAKH 1UWXH 4RNRB 3WEMA 4EN3A 1J12A 4N0RA 3JV6A 4PJDB 1HXMA 3CCHA 4ZDHA 4J23A 4F58L 1RJCA 1A6ZB 1A6AB 1D9KC 3G3LA 5HHVL 3T2PA 3SE6A 2R69L 3H0TB 4O5LH 2R1WB 1LO2H 2ZWNA 3LZFH 3U83A 4FTVD 1I3RB 4RISL 1OP9A 1IAIH 3BZ5A 2O26U 3BPLC 5C09E 2RGSA 4NO2B 1SDDB 5SWSE 3TBBA 5CFHA 1COBA 3VFRB 2DJMA 4P46A 3PLYA 4XZ4A 1F3DH 3EAKA 1E6OH 3IJEA 4Y2DC 5T1DL 4Z3GA 4AJWA 2RB8A 3CZGA 2C1OA 2HAZA 1MFCH 1M9SA 5K69A 4KKAD 3PV7A 1TQVA 3MHZA 2WSKA 4U31A 1L7TL 2P8PB 1ANUA 1SMAA 4XP4H 2DN7A 5F7LB 5FDWB 3EOBA 5FB8B 1MF2L 1QFUL 4M1CC 2DTMH 3MBWB 5JPMC 4WEBL 2HP4A 2HFEA 3VD2A 2L8AA 2IAAC 2HJLA 3IMBA 1U8CA 4M6MH 5IJBC 1N5YL 5DZAA 2E6JA 3BWSA 3GEFA 4FG4A 3MV8D 3UGEA 4J2XA 2P44B 3CFJB 4X9FA 1DBBL 4J3OG 3ARED 4PV8B 4XNBA 4BSJA 4G9DB 1XEDA 3I74A 1JK8B 2FWOA 4JFPA 4J28A 1RUMH 4K3GA 4X6BA 3KL3A 4EIBA 1UM4H 2WQRA 1MIEH 3L3OC 3OC5A 4FMVA 1BVKA 3CVIL 4QHMA 1JHKH 5IVZA 1JUFB 3TONA 3WY1A 2YPVL 2I9TA 5HPOA 2E4TA 3IJSB 4TV3A 4S1SH 4QOKE 1ZXQA 3EDKA 4D9RE 3G5XA 5TDPB 3TA3B 3KW7A 3DECA 5F1OB 4MNGB 4GRMB 2QQQA 3MR9A 4X7FC 3U82B 4OV5B 4EBQL 3FO0H 1Z9PA 2NY0B 3S9DB 3GSRA 4B5EA 1P6AB 5T5NF 1TCRB 1NGYB 5CWSA 5JXEA 5HJGA 2UWEB 3VXUB 1YEEL 1ML0A 4HSAC 1WH0A 1G1CA 1EFXB 1QUNA 3H42H 3IJYA 4NQUA 5EZJB 1V27A 5EBWA 4BINA 1YEIH 2WGNB 2VDRH 5E95B 3WHXA 3GIVB 2X1QA 2UY7B 1BBJB 3UERA 5CP7B 5T1MA 1FL6B 1NEZB 3OMNB 2H3NB 2DQJH 3IRZA 4U1MB 3Q6GL 2JIXA 4NQDA 1RP9A 4XPGL 3I9IA 3MLZH 2VDRB 4MB1A 4Y19B 1A6UH 2WXOA 3BPOB 3KNBB 4PW3A 3LQMA 4ERSL 5C0BE 3LRSA 1H8SA 4JFVA 3NVQA 2CHZA 2FHFA 3DURA 5B1JA 4CSZA 1TEFA 1V3LA 5CJBA 1KZYA 3SZKC 2AJVH 1M7IA 4PR5B 1VDGA 2D7MA 3L45A 2BVYA 4JX0A 1F42A 2NY6B 1KENH 5J3HC 3BVDB 3MNVA 3MTRA 2DWSA 3BH9A 4NUQA 4O2FB 4QPEA 5GS1C 3TJEL 3P77B 4HA1A 3MBED 4MZ2A 3RGBA 4LEBA 2Q76B 2R0KL 3UBFA 4HIJB 4X5WB 1T2QL 1YO4A 4N5UA 1ZDQA 1SHWA 1EMTL 1WISA 3T2NH 5BXFA 1UEMA 4I0PC 1IVTA 3HS0C 4AEIL 4UTAH 3NACH 3ZHKA 4W6WB 5CCGE 4BA0A 5HHPB 5BO1L 5J06A 5D7LD 3N44B 4M62H 3SOBL 1KC5H 1KPUB 3H53A 5GS0D 1QNZH 3TASA 2X9ZA 4X5QA 1FGVH 2HA1A 1O7DE 1NH6A 2B1HL 1P5UC 5HI5C 4MA3B 1IC4H 4HXBH 4XXWA 3VD7A 1A22B 5FK9A 4TVPH 3DX6A 3UPRB 3PIQB 1OPOA 2E75C 4NQQA 1HHGB 4Q6KA 2UXTA 2WXNA 5HHXL 3VH8B 3VWKB 3MRRA 4XCYB 5D7IE 1C12B 4AGOA 1U33A 5L6YL 4TSBH 1HINL 4QY8A 4BHUI 4XNDA 1RZFH 5I15L 4MA7H 3MJ6A 4NQSA 3BH8B 5IB1A 1S7UB 3QQ4A 3LIUA 4H25B 4OLWH 1T03L 3QEUB 4XOEA 1W8EA 1CICA 2NZ9D 1DE4B 2VM3A 1UGNA 3PQYD 4BFJA 4FQIH 3U9PH 5ADOH 1YSOA 4HFUH 4IKLA 3MA9H 3BVVA 1J8HE 1I4FA 4I13B 3FCGA 4UYQA 1G94A 2AABL 4FFZL 2PW2A 1KCRH 4U1KA 4FE9A 4BGLA 1OCWL 4PJHA 4K9EH 1U36A 2E56A 3AJ7A 5D7HA 3V6FA 4MXWL 3U0WL 3HEIB 1YCSA 1JTPA 1T1ZB 4WWKB 2XV6B 2CHWA 3KPQA 3LIZA 1KJ3L 2F68X 2B1AL 2RACA 2WNGA 3ECBA 3EBHA 4JJ5A 1MCJA 3SY0B 1OW0C 5I1HH 5IHLB 1RU9L 1A9EB 1OQOA 1DBJH 3C8DA 1CD1A 1MH5B 5HI3D 3BAXA 1D6EA 1OAXL 1TU2B 5T1JA 2B59A 4ADGA 4C8XA 1ITBB 2X4NB 3R8BB 5TDNB 8PAZA 3ALXA 4ZSOB 4F1ZA 4HAKA 4K7FA 1L9PA 3OXSB 1CG9B 4AQ1C 2LFEA 3VH8G 2EXYC 3TF4A 2APTA 2ZT9C 3C5ZD 3P2BA 3FCBA 3VRJA 5FPIA 3P4OA 3MUGA 1YEDA 2FT8A 2WKOA 3TWCL 3BGMA 5FCUH 4I3RL 2DI9A 3C9NA 4KTEL 1R3JB 3B1TA 1OLZA 3EDDA 4F37F 4R96A 4HHGA 2QSVA 2AXJA 2CLRB 4OR1A 1CGXA 4AW4A 2WNKA 2VJ8A 1JGUH 5D70H 5F7EH 1CF8H 4NI6A 1RP8A 3HC2A 1P7QA 1TSRA 2BHZA 3FSZA 4WU7B 3Q05A 1AACA 5JHMA 3GI8L 5E6IC 2D4DA 2GUOA 1IKNC 2O5YL 4IEFB 1FVDB 2IFFH 3KR3L 3QDHA 4OY9A 4X6CA 5EO1B 1NC2A 4HXAH 4NWTL 4B60A 4Q7DA 1RZ7L 4ZMAT 4OFDA 4TLUA 2C9PA 3OKEB 4KC3B 1RUKL 2DI7A 3ARYA 2OCJA 2OJEA 2WXPA 4RZCB 2DBLH 1M6OB 1MNNA 1CO1A 4QXWA 3ESUF 4JFUA 4A04A 4P5SA 1JTTA 4JHZA 3HNTL 3HW7A 4L05A 4Y9EA 1LEGA 3C6LB 1MCQA 1N0XH 4P3DB 2BOCA 4MS8D 1NQBA 3DOSB 2G5BA 3O2WL 5DEZA 4AEEA 4BQ9A 1YNTB 2R8SL 4NLAA 4FJZA 1KGCD 2PXYC 5DRWB 3E7JA 3DX2A 3HPLB 3IGKA 2DI8A 3I75A 3ZDZE 4Z7IA 3IFLH 3DXAA 1KB9J 5JR1H 5E99H 3WDJA 4H8WH 2GT9B 1MQ8A 3MRKA 2DS4A 3JT2A 5GGVY 2C3VA 4UQCA 1RKRA 4LVHB 1OF2B 4C56E 1ACZA 2BP3A 4Y2OA 1C1EL 1GY2A 2R39A 4OH2A 2YEZA 4YDVA 5I75C 4OGZA 2WJ7A 3FUIA 4UT6A 3ISWA 2G2RA 3FRPA 3S3BB 1QBMH 2H26B 1U4FA 1T20B 2VXTH 2WBWB 3T2OA 1U8PB 3QZWG 3ARFC 4R90H 1X4YA 3VFTB 4HOMA 5T33H 1MY5A 1Z32X 1LO3L 2P5WA 4LEOB 5HVFB 3RHWK 3CN1A 3FOMA 4YHNA 1SEQH 1OQXA 2A6DB 2LLNA 4XMPL 2CHNA 4X80H 5KSAA 5EULV 1KIPA 5IB2B 2FJHB 2F54E 2NYYC 2OA9A 1A7RL 4JO5A 3S88H 4MMZA 3QYMA 2HRPH 1IKFH 4K3JL 4B5ZA 4N5ED 1XCWA 5LG1A 3D4ZA 3HZYA 3UAAA 4V33A 2F8OA 2X4TB 2OYPA 2OZ4A 1FAIL 4WEUD 4TS6A 4NN5C 1NMBL 4Z3IA 3L17A 1G1YA 2AI0L 4WWPA 3TBWA 1CL7L 1YEHL 1KTRL 5KBKA 3PL6D 1OCRB 1MHPL 1XGZA 4WCYH 4HPHA 4PCYA 2FATH 3WFHA 1D5IL 4PY7A 2XN9A 3QQXA 2PCFA 4PJIF 3DROB 5ECGA 1NCOA 4V11A 2EAEA 3W11C 1XSIA 3K8MA 2ADGB 1F3JB 1RMFL 2YQBA 4K73A 3V0VA 1T89A 1RUAH 5CJOL 3MYZA 4RMQA 3BW9B 2W65B 3O9WD 4PG2A 4K7PY 1KCUL 3MJWA 1I7ZB 4PGBB 4C55A 4J8RB 2X2YA 3SDXE 3ZE1E 4ICXA 2ZUVA 3LMJH 4U6YB 3AC0A 3FDWA 1YUKB 3S5ZA 2HLEB 3CDYA 3KXFE 1DN2A 4JAMB 4HPOL 4FYSA 1R1CA 2O6PA 2EJ1A 2DQGL 3CFQA 3V5KB 4DGUA 4ZMNA 3T0EA 3WEBA 1BVZA 4K94C 1KJ2L 1IQWL 2NDFA 3C8HA 3M1BB 4IRZL 1KGUA 5IW6B 5ISZE 4AXWB 3QW9A 4MB3A 5IF0B 1U8HB 3QR2A 2LHAA 3GMQB 3OGCA 4F7TB 4L4TD 5DD1L 2X0VA 2C3GA 4M1DH 1BZ7A 5D5MA 3UZVB 3F7YB 1I1AD 5F97E 1MZZA 4YFLI 2EYRA 5DLML 4NO0D 1Z3RA 2CJUH 1Q0XH 1KCSH 2GTZB 4GQPH 4HHAB 4W93A 5E5MA 3PAYA 5CEZD 3HB3C 2ZOUA 3I6LD 2ORBL 3TNMA 4WO0A 1NKOA 5EU5B 2K4AA 3P3YA 4U7SA 1NWOA 3L3HA 4HJJL 1DVFA 4QI3A 1UT2A 4GKSA 5HJ3A 5F8RC 3LS5L 1A02N 2ZXBA 2OTWB 5ERWA 3KPSD 2ZJSL 3IXTB 1OT1A 1MCIA 2VXQH 3WYRA 3U6RB 1U8NA 4Y1AA 4P4RB 5ES4B 4R7NA 4FXKC 4PWGA 4QRPE 5EOQH 2LV4A 4J3OC 1QWUA 4LCYB 4HWZB 2A6IA 2J8UE 2WVVA 4FQ2L 2QKIA 2OMYB 1D5MB 1RY7B 1HL8A 4LSTL 3TZVD 5L4JA 5HYIA 1R5WB 5JIMA 3MNWA 5AAPA 1SVZA 4O9HH 5EH1A 1YYLH 5AVRB 1K2DA 4IBTA 1L5GA 3NN8A 1ZTMA 4I48B 1IFGA 4H1LA 2V3EA 3AADB 3HN5A 5C1MB 5AOMA 4MD0B 1XF3A 5E1HB 1JWMB 4IRJD 1WAEA 1AO7A 1H5BB 3WSQL 4I0CC 2YD5A 4ANXA 1QVOA 2PCPA 3CUPA 4GLRH 4I88A 3RVXC 4OLUL 1NDGB 3OAZH 3CDCA 3GZOA 4XPFH 3KPPB 4BQBA 1QG3A 1H15A 2NCMA 3OHXA 2CJSA 5TE6H 2QJDA 1QPXA 3DOHA 4OCXH 3C6EA 5F8QC 3IM1A 1TFHA 3N1MC 1BM3H 1XCQB 4L37A 3ZDXE 2ZX7A 5E4OA 1ASPA 4NUMA 1QRNB 4JFHD 1A6WL 4HEPA 3QSKB 1JWUA 1AXSA 1TNNA 3B2VH 3G5VB 3P3UA 3IDNA 1FH5L 3BO8A 4JE0A 3AAZB 3SPCA 5GZNA 1UWXK 3MPCA 4B9ZA 1U4EA 4N22A 1BLNB 4UU9B 4AQZA 4PJCE 3KLKA 1PPIA 1UXWB 4R84A 1CDJA 3T08A 1W80A 3Q7JA 2VR7A 3HR5A 4MJIE 2OJZL 2EDNA 4NC1E 1N64L 5BVJA 4C4BA 4GUPB 2M8XA 1T22A 1V54B 2W0FB 4DCQA 5DMGD 2ZG2A 2F15A 3E6FB 2CWRA 1EHLH 3UTSD 2R0LL 1BD2D 1X7TA 3KPNB 3VXTA 2ZOLB 4AW7A 1T6BX 1PIFA 2NLJB 5IEKA 2YAHA 2R2EB 4C4KO 4FJ6A 2E7LA 1EZSA 2EEBA 4PS4L 3TEUA 1VERA 5F3FA 4EN3B 3QUML 4MYPA 1QFWI 4GI9A 4KY1H 3UIZA 3V9EA 2FJSA 3JV6B 3WEAA 3ZMRA 1HXMB 3CCHB 4ZDHB 4RZKA 4Z7QE 2BHFA 3DTXA 1EFQA 3MRQA 4M48H 4TYUA 4XPBL 2H0FA 2NXYC 2SODB 3CFMA 4TNGA 2FD6H 4BDVA 4FTVA 4U0QB 1CMOA 5LNDA 2YZ1A 1SHXA 1T21A 3MLXL 4JQXA 2O61A 4FNRA 1LK2A 4G6AC 1DSWA 4FQLL 1HKLL 1H6UA 1VGKA 1WWWX 2HXAA 3BPOC 4JPWH 4P46B 1G43A 3GBNH 2FEEI 3IJEB 1CDHA 4CSPA 2H9GA 2MEJB 5CNHA 2C1OB 1RD6A 4MQXD 3JBG7 3ZQ9A 4A6YA 4PG9A 3FQ2A 4XN1A 3U1QA 1RVFL 4GUCA 1A3ZA 3EOBB 5EMYA 2NY6C 4MDJA 1J8RA 3SYAA 1AIZA 1ZGLP 2HFEB 3MV8A 3OKNA 1F86A 2HJLB 4XNYL 2UUDH 3HMXA 2FWSA 3AREA 3BVNA 4NUJA 5FXCH 2FUQA 4YXHH 4OD1H 3C2AL 2RHEA 3LOWA 1FNGA 1MI5D 4PEEA 1G7LA 3M45A 4JFPB 2JI1A 5L2KE 4NB7A 1F1DA 1GS7A 3ELAT 1OAJA 1KFAH 4X6BB 3OJMB 2K0RA 4QXUL 1ZT1B 5EU6E 1BVKB 5BV7C 3FCSA 2W0LA 1IILE 5IVZB 2OTUA 2WBJC 4LCWE 5CCHE 5DFVC 2I9TB 5I1JH 3LNIA 1BZDA 1L3NA 1FPTH 1SLUA 2CRMA 4H7VA 1M42A 4YHLH 2ENSA 2QEJA 3ULUL 1LDPH 1H3GA 3G5XB 4M5YL 4JPSA 1ZK9A 1GRWA 3MR9B 4GFXA 4HIPA 2J57A 4IU3A 2XG4A 3GSRB 2J5LB 4IGBD 5I1KL 4P2RD 5CWSB 5IESH 1OAUH 4LDEB 4DTGL 4Y16D 2ZKHL 3ESMA 3Q8CA 1QUNB 2HKHH 2DLIA 2NMSA 3IJYB 4FFVD 3SZ6A 4AH2A 3WHXB 3QRGL 4PJFA 1CXHA 5CF3A 2UXFA 1DVSA 1VGEL 5T1MB 4GG8B 4E2OA 3S7GA 4N2FA 3L9BA 3X2QB 4NQDB 2JIXB 3WTXA 4KROC 4AVJA 3GMRA 2PO6D 2YD9A 2DQ6A 3LRSB 1SXCA 3GHEL 1QA9A 2IPKA 3IF1A 2OK0L 4HJ0D 1ORSA 1AFVL 4WWKC 3PJSA 2E46A 3DURB 4UF7C 4HKXA 2NNCA 5GJSH 1QOKA 1QSFE 2Y72A 1EXGA 4ALAL 1M7IB 4K9EC 5MP6H 3NSJA 3UCQA 5DZJA 2C7FA 3PP4H 3MNVB 3BH9B 4FKEA 2BCKA 1S7TB 3P9WB 4NEHB 1SHSA 3QUHA 5C0JA 5DZLA 2Z8SA 2V5YA 5AOZA 3QIUD 3MRMA 5ICXA 4XBEL 2J88H 3DIVA 5EBMA 3LRLA 2J1XA 4LT7A 2IANE 4LAJH 3UYRL 2HJFB 3OGOE 4XAWH 3ZKXC 2MOVA 4ZPTA 5TK2A 2ATPA 1JMXA 5D7LA 1RZPA 5ALCH 4R0LA 5KW9H 4NJAH 4AOFA 1UADC 3B5TA 4IRSD 3FC8A 1KUMA 1N68A 3MV7D 4WZ9A 2W1NA 4ZO7A 2GEEA 1J1XL 2CO7A 2DM7A 5I23A 1J9TA 1G0DA 3GI9L 1D3CA 3LN5A 1XXDC 1WWBX 3WTYA 1OE2A 2HFFB 2GK0A 3E2HB 4JDEA 1YPZF 1EWHA 4IK7A 5BW7A 5FK9B 2QHRL 3DX6B 3L6FB 1S9VA 3E1F1 4XXDA 1NANI 4ZFQA 3WNNA 1FQ9C 2YSSA 3DYMA 5IZ7A 5JORA 4G5AA 3NA9L 4PBXA 5LUMA 1GC1L 4TF4A 3MRRB 3LKRA 3HMWL 4BK5A 1BJ1J 1TMCB 1PFCA 3JWDH 3UAFA 4TOYL 3E0GA 1MRDH 2F7PA 1KULA 3QB7C 1U2CA 3LXUX 3M8OL 3OLEA 3QAQA 4QY8B 3PWUA 4HUCA 3DTDA 4NQSB 5IB1B 3QQ4B 4OLXL 4E9VA 1X5IA 1QFPA 2JELL 4XNZB 1O6VA 1CICB 3C6LC 3BKML 5LQBH 1SM3H 3CZLA 5A6IA 1PNDA 2DM4A 2VQUA 2WCPA 3EUDA 1XL6A 2EUWA 4LB8A 1I4FB 4DEWA 2XCMC 4XHQA 2PW2B 2YSTA 3LIZH 3QZMA 4NBYB 4TL5A 4U1KB 2BWIA 4O2EA 3QCVL 4PJHB 4HBCH 3EYSL 2A9NH 3P1VA 3V6FB 3PNWA 3JVGA 1HVXA 1SXZA 4KH2A 3KPQB 3VXSB 3T1WA 1U6AH 4JJ5B 4LSSH 3ECBB 1E5CA 1NLDH 3IMUA 4P8QA 2QZ5A 3BZDA 4YSTA 1NSNH 1AMYA 4GYBA 1CD1B 1XWVA 1PF3A 1D6EB 6FABL 3L4XA 1K8IA 2B59B 4H8WC 2R0WL 3Q2LA 1MIML 3C5ZA 4DN3H 2UVEA 4K7FB 4JO2L 4KAQH 4FFWD 3QK0A 1LHZA 4MZ3A 4XCEA 3VRJB 4JO8A 3P4OB 4W9EC 3MUGB 1YEDB 1NPNA 3BGMB 3NIFB 4H26A 2P5EE 3HE6D 3C9NB 2XBDA 4EI5C 2BP0A 3KWWB 1U41A 3RUGE 3B9DA 5DEGA 4Z7NE 1XMWA 2VMCA 1RZKH 3K2MC 1IBYA 2JB6A 4TQPA 5CGMA 2AEQL 2IDFA 1E50A 4F91B 3BP6A 4GSXA 2D03H 3NJFA 5HVWA 4OFQA 3D9AL 1WWCA 2MCG1 4YXKL 1P7QB 3QUYC 2WNWA 3NZHH 3D18A 4FFYL 1SN2A 4ZMVA 4A7VA 2GUOB 4ADIA 2DYRB 3S3JA 2WXKA 2LU4A 2W88A 1PTZA 3OVUB 4LPTA 4X6CB 1I53A 1NC2B 2VLJD 3QFJE 5DJ0A 5E1AA 1IQDA 3GBLA 4NP4H 4P99A 4IIQA 3QHFL 4HEMA 2DWXA 5AW8B 3WLBA 3WAKA 2OJEB 4BFBD 5CS7A 3BKYH 5DQDH 2WINA 5IV2A 3HVNA 4PVLA 4M02A 1TJIH 3LZOA 3T3ME 1WPCA 3HBQA 4ZZFA 2HT3D 3AACA 2QGBA 1LEGB 3G08A 4LCUA 4X6DE 3ESNA 2VR4A 2BOCB 3NT0A 4QAMB 3D08A 5HYJE 5E4EC 3OAYH 5DFAA 2G5BB 5LAXA 4FQCH 4BKTC 1BLIA 2A99A 4LE8A 2B77A 4XBPA 1JZ3A 4ZQKA 4OB5H 1B0WA 2EZ0C 3AS3A 4KXCA 1CYXA 2X2IA 1PEZA 1WBZA 3EO1A 1I7RA 3MCYA 1T0OA 2O72A 2BJMH 3I75B 9CGTA 1NTDA 1EHKB 1BREA 3DXAB 2XYBA 5D4HA 1NUGA 2JXMA 4KTGA 5KJRH 4K2UH 4KZDH 2Z3FA 3MRKB 4P2AA 1FO0L 4D9LL 3FN3A 2C3VB 5ESQA 1A5FH 4UT6H 2KPNA 3P30H 4Y2OB 4TM9A 5LBSA 1K72A 1ETB1 5EUOA 4J39A 2PCYA 5I2IA 2I7SA 5L8KB 3APMA 15C8L 4QRFA 1DLHA 2YEZB 3C60D 4YDVB 2H1XA 5E70A 4UV4L 4AITA 2G2RB 3FRPB 3K46A 3KYNA 4A2GA 1P6WA 4I2XE 1MJ8L 1AQHA 5A2KH 1RIUH 4GT0A 1F4HA 3HRZA 4DP7X 4GS7B 1WAAF 3Q9PA 4FA8A 1EGJA 4F92B 4WENB 3CZSA 2P5WB 5E7BA 3W2DL 1FCCA 3FOMB 4YHNB 1DVUA 4KTYA 3JWNG 1KMGA 1FFRA 4NM4H 2GAZA 4U1IA 5IVOA 1OGAD 3DV4A 5KSAB 2ATKA 1KIPB 1GGTA 2QQNL 2ARWA 2F5BL 2YPLA 2DQEH 1CBVH 3NPZB 5DO2C 4MMZB 2F7IA 5TF1H 1U8IA 2OZ4H 1LK3H 5K9JL 1CIUA 5GGRY 4JZNB 5AWNH 2Z31D 3HZYB 4UTBA 3OMIB 1Y6KR 2Z7YA 5C9KA 3K2KA 3PL6A 2IWEA 5C09D 5ILTH 3TBWB 1F00I 5SWSD 4ZG1A 1OK0A 5FIEA 3UTTE 1JG9A 1OALA 2NQDA 1UM5H 2OP4L 4PJBF 2ZXAA 2MPAH 5FW7A 3WFHB 4E9TA 4DF9A 4PY7B 1FVCA 2PCFB 2WY3B 4N8VB 4YH6A 5E4IA 4YHPA 5FW8A 4PREA 5AVWB 2XPYA 1G0XA 3OKYA 1X7QA 4ZT1A 4LIQL 2BY3A 3V0VB 3O9WA 4GQRA 3EJSA 5JZ7D 1KBVA 3REWA 2V17H 1TYEB 1G7JA 2ID5A 4NQXA 1GS8A 5IFHH 1XCXA 4OCWL 5GGTA 1OK8A 3BXNA 2WHVA 4KXZI 5DHXB 4DVRL 3VXQB 1HNGA 5HTSA 1DANT 1UEYA 4B6ZA 1ZGLM 4X6FA 4RMRA 5LO7A 1RFDL 5EEUA 3HI6H 3BZEA 4N0UE 3CHPA 4WFFE 2VZOA 2EVGA 4OSUL 5EZOH 4KKLC 3U7WL 4PV9A 1BQLL 2JKRM 3G6JF 2Y1VA 3QRBA 1AGEA 4HLZH 4LARL 5ID1A 1OAQH 2EABA 3NTCH 1I1AA 3OGCB 3WU1A 5AB9A 3RL1A 5D2NA 5D5MB 4NO0A 1BZ7B 3CHQA 3SKJH 3LNDA 3L1EA 5HPMA 2EYRB 2NY3B 4QOKD 1DLFL