4BD4A

Monomeric human cu,zn superoxide dismutase, loops iv and vii deleted, apo form, mutant h43f
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
109
structure length
109
Chain Sequence
b'ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLFGFHVHGAGGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKAGAGAGSRLASGVIGIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Global Structural Motions from the Strain of a Single Hydrogen Bond.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 15
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2012-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4bd4A00
1COBA 1OZTG 2AQQA 2GBTA 3SODB 1YAIA 1AZVA 3L9EA 3GTTA 1IBHA 2WWOA 1SXCA 4BD4A 4L05A 3HFFA 1SDAB 1PTZA 1SPDA 2XJLA 3ECUA 2V0AA 3CQQA 2AEOA 2JCWA 3HW7A 3QQDA 3LTVA 1IBBA 2LU5A 1E9QB 3GTVA 3H2PA 3PU7A 5KBLA 1F18A 2VR7A 2R27A 3K91A 3KM1A 3GZQA 1HL5A 3T5WA 2AF2A 4FF9A 1JCVA 4U4IA 4OH2A 1JK9B 2ZKWA 1OALA 1E9OB 2WKOF 3F7LA 2E46A 1Z9PA 3S0PA 3KH3A 1F1DA 2GBVA 3CE1A 3L9YA 5KBKA 1DSWA 1SXBA 4A7TA 1E9QA 2VR6A 2Z7ZA 3GZPA 2WYZA 2ZKXA 1SXSA 1UXLA 1N19A 3ECVA 4BCYA 2ZKYA 1OAJA 1HL4A 2AQSA 2WZ0A 3GZOA 1BA9A 1E9PB 1QUPA 2WKOA 2VR8A 1JK9A 2C9VA 2XJKA 1OEZW 1E9OA 1FUNA 1SXAA 2C9UA 3KM2A 1ESOA 1RK7A 4A7SA 1DO5A 1SRDA 2APSA 1B4TA 1L3NA 1MFMA 1N18A 3H2QA 1SOSA 2C9SA 4MCNA 1EQWA 1P1VA 4N3TA 1E9PA 4A7VA 5CU9A 1IBFA 1YSOA 1B4LA 3KBEA 1XTLA 2AQNA 1SDYA 2Z7WA 3HOGA 2GBUA 2AQRA 3GQFA 3QQDB 2AQTA 1EJ8A 2K4WA 1SXNA 2WWNA 4OJAA 1XTMA 3KH4A 2NNXA 4A7GF 3MKGA 2Z7UA 4MCMA 1F1AA 1TO4A 2JLPA 2WZ6A 2AQPA 2WYTA 1PZSA 3F7KA 2E47A 2Z7YA 3CQPA 4BCZA 3RE0A 1IBDA 4A7GA 1UXMA 1CB4A 1XSOA 1S4IA 1TO5A 2SODB 3KBFA 1Q0EA 1F1GA 1U3NA 2ZOWA 1KMGA 1SXZA 3ECWA 4B3EA 3MNDA 1IB5A 2WZ5A 4N3UA 5KBMA 4A7QA 1BZOA 4A7UA 1OZUA 1YAZA 2Q2LA 1CBJA 1Z9NA 1PU0A
chains in the Genus database with same CATH superfamily
4P04A 5DA4A 4C56D 1V10A 3BPNC 5BJTB 4JRYB 3MTXA 1QNZH 3EDJA 5CEZH 1NSNH 1U8PA 2Z8SA 3BVVA 5CZXD 4X6BB 4XNBA 1XF2A 3BHBA 2QEJA 5BZDA 1UWXH 3DSFL 4S2SB 4YMPA 3QUXD 4QOKE 1MQKL 5EU4A 4IKKA 3FU9A 4NXKA 1QNIA 3NABL 3T2OA 3UYPA 4YHNB 3ZHLA 4GY4A 2C9RA 1KTBA 2IGLA 4MCZB 1TIUA 2R23A 4B9KC 4K94H 3LPFA 3BSZA 4Z3IA 1OANA 2ZE0A 2LOEA 3IMRA 5MEOA 2IXQB 3KPNB 3PL6C 5I16B 4BFKA 3G5XB 1A2YA 4R90H 2WXPA 4LMQE 1H6TA 3CFDB 1HH9A 3K72B 4KY1H 1OGSA 4OAWA 1RZ8B 3FCSB 3HC3H 4E68A 1FO0L 5EU7E 1P0SE 4KGJA 5FGBC 4TRPL 1ZV2A 4WI6A 5D96B 4M6NL 4Y1AA 4S1DC 3QQ9C 3IGUA 3H9SD 5A7BA 3HUJA 3O45A 2VITA 4IDLA 4Q0XH 1A6AB 4XAKE 4PGEA 4HSQA 1JZ3A 4KKRA 4HP5A 2QADB 2ADGA 3U46B 1KBKA 1PVHA 3GSRB 4JAMA 1NEZA 2NQCA 3GSNL 3P30H 3VH8B 3P77B 5KYWA 1H19A 5C3TA 2IDUA 3PJSB 4ZT1A 4P5TA 5AW4B 4OIIL 3U1PA 2VERA 1XXDC 2F7IA 5F9WB 3NSXA 4XC3H 4CC4A 1JL8A 2NY1D 2VH5L 4OIBA 2D9QB 3N41B 1KCSL 2WWNA 1EGJL 3QFDB 5F88A 3C6LC 3KH4A 1W8OA 4JVWA 4N2CA 5IBTH 1EHLH 4WW2C 2V6HA 1OQXA 2WXMA 3TEUA 4XVTH 5D7HA 4FI7A 4XB7A 2LVCA 4Z5RB 2HG0A 4K7PY 4MD0A 3QDGA 4UINL 2IBZY 4JFDD 1IGJA 3DGGA 1HC1A 4J3TA 1CFMA 4MA7H 3K6OA 2B5IB 2XWTB 3H7BB 2XXMB 5CGYC 4GAYA 4OFYD 3O3AA 3P11L 2UXTA 5HP5A 4MMZA 3UTZA 5T5FL 1SXZA 1K3ZA 2AJSH 3TIEB 5E08H 3RIFF 1JHTA 4MHHI 3UZQB 2J1WA 5B3SB 2RB8A 3BC9A 4F8QA 5ETUB 1J9SA 4NM4H 4WWID 1HEHC 3AQZA 2VXTH 3G5ZB 4NC1E 5LGYA 3DURB 1NC4B 3QJHB 4KMQA 3X1FA 4Y5VC 4X5WA 3TA3B 4HAKA 1IGIL 1LO4H 1W2KT 2Z92B 2WAHA 1HWHB 3EBAA 2IPTH 1JWSA 4YXHH 4HIQA 5C8JA 3SJVE 4FN0A 4F9PA 3UBXI 1ND0A 3ZIMA 4RFOL 1ZVNA 3RPBA 4PRNB 5F0MB 4M7LL 3LZOA 3WY2A 3C12A 4JFEB 3I02B 4BZ2H 2C7UA 3IN0A 3F7PC 1TFHA 3S8GB 3T0BA 5JW4M 1EIBA 1UURA 2MCPL 4G72B 3L9RB 3VUAA 3SPGA 1NM4A 1RZ7L 2EH8H 2GSIB 2YUZA 2EE2A 1BVLA 3I50L 2B59A 4NKIH 3VGFA 2VOTA 1DTUA 4S1DD 3QQ9D 3PV6A 2GKIA 4NP4H 1BQLH 3BUQA 2FATL 1NFIB 3MBEC 2ATPB 2UZXB 4Y9CA 4GO8A 3VI3B 3L4ZA 2Q5BA 3RWIB 2OP4L 4X7TA 1DQDL 3Q8FA 1YEJL 2FO8A 1MRCL 4BFGA 4XC1H 1CG9A 3WIHL 1XSJA 2V17H 4E41A 2HRPL 2AXGA 2Q3XA 4XCFH 2FUQA 4KRPC 2XZCH 3AT8A 5D2NC 4R7XA 2R56L 5D7JB 4PJHF 2VXQH 3KNBB 2A6DA 3LKNB 2WLZA 4AW4A 3HE6D 2HH0L 4RCAA 2ZQKA 1IM9B 3L3KB 3ZKXC 3C6LD 1RIUH 4B5ZA 2DQHH 4BKLB 4HMCA 4UZSA 3RY6A 3R1GL 3V8CA 5LGJA 5DUML 1HCVA 4W9DC 5JR1L 1A7PH 1M7IA 1AZCA 1FJ1A 3CN1A 1TTCA 3NIGB 4WKXA 5DZPA 1VEPA 5LCVA 3HBZA 2PETA 3KYMA 3U9PH 2B4CL 2BS8A 3KLAA 2NY7L 4PWHA 3NEOA 3GF8A 1AIZA 4MB4A 4XNMA 5DD3L 5ID1A 4RVBA 2CO4A 4UTBH 5CGYD 1F3RB 2E47A 2OCFD 4J8RA 5F7LB 4LL4A 1DL7H 2H6PB 5I9QC 4ODWB 4XP4H 5CN3A 4PBVC 2Y7MA 2E0PA 4LLQA 4NERA 2V2WA 4TV3A 1T3FA 1U4EA 5DZLA 5IUCA 6FABL 1CU4H 3ESVF 4ZODA 1IKFH 1VFOA 5CJQL 1ZHNA 3EJSA 3HN3A 4ZYKB 3KPPB 5A16A 2X4NA 1ML0A 5PAZA 1NIBA 4IGBC 3ZTJH 1U8KB 3MRQB 4R26H 3VXOB 3MOQA 5CN1A 2D31B 4H1LH 4N0FB 1OHZA 4YS4A 3C2AL 2VW6A 5AW8B 2E86A 3OGCA 4MJIB 3PDOB 1YNLH 4YHLH 4ZO7A 5IVOA 4K9EC 4AY0A 3QYNA 1A4BA 3E3QE 2IPKB 2ENQA 3GFUA 2ZOKB 1ILSA 2XVKA 4XP9L 1R47A 4OZHA 2WZPA 1NLDL 5KYUA 1I9IH 5HJBA 1U36A 2X7LA 3C5ZB 3ILPB 3O6LL 4EIUA 3BESR 4M5YL 4PTTA 4IKIA 3T0EB 5M7QA 1A6VL 1WBZB 4LLVB 3DTXA 4N68A 3GZKA 1W6WA 2CUMA 2EDYA 3MBED 5HJDA 2BO0A 4XCEA 1EA9C 2FJFB 3QO0A 3S3BB 1X5IA 4AE0A 3EIFA 5I18L 2XKUA 3I6LE 3P0VL 1X9RA 1KJ2L 2YO3A 3W0WA 2MPVA 3ECVA 3FB6B 3FAWA 3VFWB 4DCQA 4NZUL 4KNSA 1KULA 3V7AG 5DYOB 2EDRA 3CVHL 5F3HB 2JKTM 4PJ7E 4NJ9L 1F3JA 5FO8B 1JGDA 3HNSH 4KRPD 1JWMA 3AGWA 3A22A 1NCWH 2OCCB 2NW3B 3O0RH 3KCPA 4NO2A 3BZFA 1I1YA 4GJTB 4NN5B 2A6JB 2QZQA 4Z7OF 4HPYH 4LCCA 2GJ6A 1BXVA 5F1NA 4JO8A 3LX9A 4JQIH 3O6FA 4PJ8A 2XNAB 1HXYB 4P2QB 2FCBA 1Z2KA 3RUGB 2YXVA 3AADB 3F04A 4XPFH 3DUUB 5DJCB 5SWZA 4DKTA 4HVBA 1X9QA 3ZIYA 2ZF8A 2F7QA 3UBHA 3LNFA 1E5AA 4NO5A 4ECNA 4QTFA 4YSRA 2UX7A 5GGSB 4Z7WA 4F80A 4Z3FA 3BP6B 3BRDA 3SGEH 4ZDHB 2BH0A 2QSQA 2P8LB 4PN6A 3GIZH 1K4CB 4B9IA 3FSVA 3UTQA 2FLBT 1WC7B 3PFQA 3LNGA 5FLUA 4B50A 3MCKA 3MOAH 5KYXB 3O4OC 3EZJB 5FLVA 1GZPB 4PEEA 1CFSA 1IGCL 2CO1A 1NIDA 2AV7B 2GJPA 2FT7A 3LKOB 1GY1A 1KSRA 3EDDA 2OM5A 4UDTA 2VR9A 4BZ1A 4KZDL 2AS5M 4E5XG 2F6AA 2QHRH 4M1DL 4UM8A 2WP3O 4Z77B 5H35A 2MCMA 3ZE1E 1BFOB 3DK0A 3SY6A 1TTRA 3GMOA 4W93A 5E6YA 1D5IH 3P4MB 2XPYA 2B3IA 2OMUA 3KR3H 1MDAA 3NEXA 2E4FA 3S36H 2X6AA 5BUAA 4JRXB 1U93A 7FABL 1JG9A 4IGBD 3REWA 1QWNA 4X9YA 1YEDA 1S3KH 3IJ8A 1N59B 5ABDE 3BP7B 3QIBA 4A66A 5BUGA 4JGNA 3KL5A 3FDWA 4MJ5B 4X4YB 5GS2D 3VFNB 2QSTA 4ES9A 4OD1H 2CGZA 4WUUB 1A1OB 1HAWA 4A1RA 1FNGA 4X0KA 5FDWA 4G8GD 4O2CA 1ZGLM 2GAZA 1DEEB 1A4CA 1X5ZA 3E7JA 1TZGL 4FL4C 4XNXH 1MCWW 1EZSA 4Y89A 4OD3L 4ZMYA 3L45A 3MV7E 4TKWA 2EDDA 3ZTNH 4PCTA 3BIKB 5IFAL 3RFZC 4KK5C 2EXYC 4AEHL 1MIMH 1P6AB 1MWAB 4X8JA 3KE0A 2ZKWA 1YECL 3FTWA 1LEIB 3D39B 3QWNA 3ZE2B 4JRWA 1KIUA 1LXMA 3HI1A 3P9LA 1H3XA 1AQDA 1VPOL 2J5LC 3DTDA 2E7CA 2HRGA 1AXSB 2JF1A 1RL1A 4PP2B 1IAIL 4Y4FB 3QPQC 1F3DH 1VZGA 4CN6A 3JV4A 4FQLL 1O6SA 1BQ5A 1UOLA 3HRZC 4PRPD 1DUZA 1J8HB 3K1KC 2ZYSA 4HEPG 1ZAGA 4PV8A 4XHQA 5J3HC 3ZT6A 1E30A 4NO3B 5B38G 3U79A 5IBUG 3WOVA 5BS0A 1AGCB 4NZJA 5CM1A 1HOEA 3N85H 2BPBA 5ADPL 2BNQE 3I6GB 3LS5H 5F97E 2APSA 1U58A 2B1HH 4UQ3B 4HU2A 4GPVA 4Z5RA 4Q9CA 1BFTA 1LO3L 2X40A 5CILL 3MLYL 4JN1H 1DBAH 4RMSA 3MRKA 2YQBA 1MHCB 1D9KC 3IRCA 4ZW6A 5AZ2H 2SEBA 2ZXAA 1BQUA 3D25A 4NN6B 4H20L 2DQFB 1E4KC 4GLRH 1XH1A 3KLQA 2ZXBA 3G5YA 1ZT4B 4ODUA 3KPRA 1IM3B 4A7GF 2R8SH 3B5HA 4QRSB 4KMTL 5IQ7L 3MBXH 3DJZA 3I6SA 3PDDA 4JDEB 4F8OA 1JI2A 4X6DF 1L7IH 1RFDH 2H1PL 3QDJB 2DDQL 1ETB1 1WD8A 4M5TA 2E7MA 4IQHA 4MXWL 2B1AH 2NT1A 4DAGH 3ZHDA 4PG2C 2OK0H 2G2NA 4W9IC 3VTTA 4LHUA 5LBSA 3FRPG 2ZWSA 2JELL 3RTLA 4CVXB 4XX1G 3QB7C 3BWUC 1S4IA 5I15L 4XNZB 1U8LA 5C0FB 1KYFA 2BDNL 1I4FB 1DJWA 3WI9A 2EYSB 3FFOA 3FQUA 3L5HA 3MNDA 4L8BB 3ME0A 1UACL 4DP1X 1JXDA 5DS1A 3EJUA 4XRCB 4WJKB 5TH2A 2WXGA 4OZ4A 4JS7A 3IJ7A 1WFTA 1F4HA 5F0PB 4ALAH 3JSSA 2RALA 1A6UH 4P2YA 1L5GA 2TSAA 1I7UB 4F1SA 3ARWA 5LWYH 4NQVB 3H0TA 3PF2A 1HHJB 5E4AA 5DZNA 2W9DL 5D2LF 4KK5D 2EXYD 1KIQA 2RAMA 4N2DA 5E2JA 3DBXA 2DQJL 2NNAB 4EI6B 1JE6A 4X4XA 1Y0LB 3TT1L 3GZQA 1CD1A 3BAEH 3QUYA 1C12A 2BHZA 2QR0A 4NEHB 3NAAH 5CIPA 5TTRA 1I1RA 5TJWK 5T1LA 1CDJA 3JYCA 5IJVB 3TBWB 4J27A 4QY8B 1CQYA 3QPQD 1Z9PA 4D9RE 5E00B 2PCYA 2YBRB 3MCYA 1XDTT 7CGTA 3WFEH 2UZYB 3AXLA 4OCXH 3O4LD 4FGMA 2CKBH 4GXVH 2ESVE 4WHTA 4X7SL 1Q94A 2WYZA 2ZKXA 4LVOB 1MHPL 5J3HD 4KRNA 4LSTH 4NQUA 4PRID 3V9FA 2LLNA 3SDAB 3ZHNA 5J9PA 1WZAA 3TLRA 4MRCA 4PJHA 2XJKA 4UQ2B 2IH3A 3SYCA 3ORJA 4YE4H 3GMNB 5KVGL 3X3GL 3OXRB 3DNKA 4QLWA 3RX7A 4JHAH 1QPPA 2PW2A 2BCKA 4OI8A 3CG8A 4YQXH 4UI2A 4V1DD 1XSIA 1QQDA 4N26A 4OZGE 2BFVL 4EOWH 1D9KD 2F5BL 1N64H 1FAIH 2Z93A 3TF7C 3AAZA 5FW7A 2HPTA 3MRHA 5I1CH 5BZWB 4YEFA 2AJ3A 4YX2L 1OW0C 4JZNB 3IVKB 1T20B 1VGEL 3GM8A 4NAMA 4NYLB 3INUL 5D1XE 1QW9A 1G9NL 4WFEE 1SXNA 3R06B 3UROR 2VQTA 3L4CA 4JM2F 5CLWA 1FPTL 2A0LC 1JPGB 4DTGL 4AM0A 1NCNA 2FBRA 4FNPA 4PJ6A 4LNRA 1Z5HA 4QWWC 4K3HA 3D51A 3VFRA 3FU8A 1K4DB 1UT2A 3HPLA 3VXUB 3TGXA 1CXLA 3DSFH 1AQHA 4OLYL 2J8UB 1MQKH 2R1XA 2X2YA 3NABH 5IZ7A 4MZIA 1T1ZB 1ETZB 3S35L 3BPLC 3RL2A 1IVTA 1CF1A 1AYOA 2O30A 1V27A 5KVFE 2FSEB 3GXUB 2A83A 1ZS8B 1QRNB 5FK9B 2COQA 2OAAA 1JUFB 1Z9MA 2RQEA 4ZW8A 5C2UB 1RVFL 4P2OA 1NCIA 3KEDA 2VMCA 3LZRA 3SCMC 1FO0H 5DFTA 3QJRB 3QZWA 4TRPH 3LNIA 2Y1VA 3VXSD 5J6HB 3UEZA 4M6NH 2F5AL 3RWCB 4WW1A 1PW3A 3IWVA 4FI8A 3V0HA 1UJ3C 3CDGB 3PJNA 3VFUB 4OY9A 3OF6D 4WWOA 1ZK5A 5EOQL 2YPLE 4BHUA 1A3RL 3V5KB 4ONOA 3QXTA 1U8QB 5HHXL 3WTYA 1JCVA 1U3JA 4ACPA 3GSNH 1JK9B 4ONHA 1DQKA 3PQYD 4YZFF 2X4TA 4TVPD 3M07A 4LEBA 4L9LC 2QFRA 1AOHA 2W65B 3MV9E 3T6VA 5J1AB 4MQSB 4OIIH 5BRZB 4JFFD 5I23A 5C0BB 4PJ9C 5CP3H 3ZLQC 1IAKB 1R75A 3MRPA 2VH5H 3MACL 5LHDA 1KCSH 1EGJH 1H15B 2E5EA 2EADA 3FUKA 4UIKL 3X11A 2IIJA 3BLPX 3S4SB 3V5HA 2Y0SA 5FUCC 2R39A 3X3FL 5IV2B 5L6YL 2ZX9A 1WZKA 1FNLA 3V10A 3AB0B 3PP3K 5FYJD 3EKCA 4B9CA 2J5WA 1FC1A 3KZ8A 4UINH 4UT9A 4R97C 1OP5K 1W8EA 1YN7B 5D70L 1FFPA 3TCTA 4HOXA 3FT1A 5C0DA 4Y7OC 1YUHA 2EC9U 2QQKL 2DYPB 3P11H 3PWNB 5T3XL 3OV6A 4BQ6A 2VNCA 5T5FH 3VG9B 4L4TD 1WO2A 5ICXB 1Z32X 2A0LD 3BP5A 3QIUB 5FGSA 4Z7UB 3GXIA 1RJYA 2K4WA 4NSKB 5FO9B 3UBXB 1DLHA 4QWWD 5IB3A 3GMMA 3RWFB 1Y1DA 3UG4A 1F4AA 4NRYA 4JO1L 1KB5B 1KBBA 1W72B 1VIWA 4JFQB 3VFTA 4EXPX 2BMKA 1PZSA 1XGTB 1T22A 5EU7C 1CGXA 5J11B 4X6FB 2G3NA 3KXFE 1XAUA 4WGVB 2X88A 2GABA 4RFOH 3MV8D 4HJ1A 3T71A 4EAEA 2YN5A 4M7LH 3AW5A 5TPWL 2D0HA 1DVFC 2R29A 4MNGE 4MMXA 2NLJB 2QFPA 4Y4HA 5F96L 2X4OA 2GVYA 4JJ5A 3SCMD 2NY3B 4IJ3B 3VFSA 1QEXA 2J57A 2MCPH 4ESKA 3DETC 3FQRA 3CMOL 1RZ7H 2WXNA 3P4NA 4WGKA 4WU5B 3ZKQD 1FAKT 3I50H 3FQWA 4AENA 5F3BB 4AGNA 2XI9A 1MAML 2WSDA 1XB8A 4S1SL 5GS1A 3TBTB 2FATH 2E56A 1SJHB 1BF5A 1ZD6A 4YDJB 2OP4H 4W70A 1FZJB 2G3XA 3L2LA 1DQDH 4LBEB 5IJKC 4QYAA 3QBTB 1YEJH 1MRCH 4AQAA 3GTVA 3PWPA 5E5MA 4HWNA 3SYAA 5IHBA 1AQKL 1ZV9A 3WIHH 4KO7A 5IMOB 4WO4B 1WFOA 2FRGP 2HRPH 2PWHA 4D0CB 4AXWA 1ORQA 4MX7B 1ZIAA 1NCHA 5SWSB 1JIBA 1VADA 1ZVHA 3ESPA 3WFCL 2NYYC 4J6RL 3SO5A 4N8VA 3WY3A 4M61B 3S5ZA 3LN5B 4YSOA 1NGZA 1FL5A 1KB5L 1G7QA 4PJ9D 4PD4K 1I8MB 1M4KA 5LBGA 1KTDB 1ZGLA 1CICB 1YCSA 1CLOL 3NCBB 1G7JB 5F93C 2QELA 4ABVA 5DC4B 2EUVA 5EO9B 3GUTB 5DUMH 5H94B 2P7TB 5IFHL 2OLDA 3Q48A 4NRXA 5I2IB 5JR1H 2DV6A 1AS7A 3WXWL 2B4CH 2NY7H 4QRQA 5DD3H 5JW5B 3G6JE 4NC1C 1IGFL 2X1QA 3ARVA 2VW7A 3DO7B 2YUXA 2HJLB 2VUOA 1ICTA 4AEEA 1QSVA 2VLJB 4QOKD 4BIKA 2D2OA 4LFHG 1A9EA 2XTJE 1JTPA 2XIDA 4N86A 4ZRGA 1MKFA 1PFCA 5HYSA 3U48A 4GG6E 1IKNC 3NCCB 3FQ1A 1FORL 1U8HA 5GS3A 1I3RB 3ILDA 4X6DA 1VEOA 6FABH 5CJQH 4AEIL 1FVCA 1OGAE 1FVDB 1A6PA 1H3GA 1TQUA 2QKIA 2V5TA 2WUBL 4PY8J 3AG3B 2AXFB 1F8TL 3U4EB 1ZHLB 2WJ5A 3DPBB 3F8UB 1SY6H 2FWOB 1YPZB 4AIOA 4JE4B 5D71L 5AVXB 3N55A 1AS6A 4U6VL 3RGVA 3C2AH 5HYJB 5ANME 2DD8L 3J07A 3IDMB 1FNEA 3RIKA 1QO3B 4ENZA 5K9OA 2X2UA 4FFZA 4XAKD 2OA9A 4F2ME 4ZQKA 4XP9H 4JKNA 1NLDH 1UZ6E 3DETD 4LHJB 3O6LH 3VRLF 4M5YH 1JZIA 4AITA 3N41F 1A6VH 4AYSA 5AYTA 5BO1L 5C0CB 1DUYB 2JCCE 1ZVSA 1NCUA 4GXUM 5D2LA 5EBWA 3TA4D 1QTPA 1Y1UA 2J3SA 5I18H 1KBPA 5FW6A 5LO7A 1ZWIB 3IU3B 3P0VH 1E5YA 1ZTMA 3CQFA 3DX9A 1KJ2H 2A9DA 2BNRA 2ITCB 3GXMA 4D9QE 3DX7B 3QQ4A 3CLEL 2WO3B 3GGWA 4NZUH 3DUHA 4OQTL 3EUUA 3VWJC 3CVHH 3ETTA 4NJ9H 2L04A 4UV7L 5B1JC 3EFOB 1XEDA 3PIQB 1BWWA 2AAVA 4YSAA 2NYYD 4KK6C 5C08A 3UXFA 2J2ZA 3FU0A 1HL5A 3LNDA 4WFHE 5IVNA 2V2XA 4Q2ZB 5LG6A 4WK4B 4HK0A 4B9ZA 5FYLL 3DV4A 5JOEA 2OW6A 3B37A 4LCVA 3DX6B 1S6NA 3TWCL 1RUKL 2YZ8A 4LOUC 3ZDXE 4NN7B 2X3CA 1P84K 4IMLA 4D0BA 1KELL 1ACCA 1WEJL 4E9VA 2FJSA 1FFQA 1B6DA 3LEXA 2NQ3A 4HKJB 3WCYA 2X70B 3MLSL 3VGDA 2XWJA 1ZPLA 3DHMA 1CVSC 2CWRA 3Q3GB 1R3HB 2W81C 4Z7AA 4Y7MA 4HJIA 4YR6B 1VHPA 2I7SA 1JXGA 3RHWK 3WKYA 2EUWA 1JRHI 1TYJA 3C9NB 1T04B 1ZE3C 4PLOB 1M6OB 4KFZC 5BUPA 1IGCH 2HUEA 1AGEB 5F9JB 3UPCA 4ZS7L 3QE5A 3EJRA 3SJVD 4KZDH 2ZWLT 4M1DH 1YN6B 4B9FA 4GQPH 4JM2A 4GRLB 1S7RA 3EJQA 2UY6A 5K9KA 2BCMA 4G8FB 1CT8B 4LVHC 1RLBA 3E3QC 7FABH 4BFIB 3GHEL 3B5GA 2E6JA 4KKLC 3VI3F 3E80A 4GIOA 3P2BA 1FGNH 1I75A 4JGJA 4HAGA 1UKSA 3HG4A 3TVMB 4X4ZA 4FI6A 1P5VA 2ZWKA 2PO6C 2XZZA 4R7NB 1H8LA 4GMTL 4TNEA 3D33A 4OQ1A 2OYMA 4ZTPL 1VFAA 3BO8B 2X3AA 5KSAC 3VMNA 3FB7B 1RHHA 4KO9A 2BP0B 1EAPB 3VD5A 4OD3H 3VA6A 2VDLL 1WSST 5IFAH 4U6TA 5EO0A 4AEHH 1N2RB 1QG3A 3CCHA 3APCA 1HE7A 1BLNB 1QPXA 1YECH 2HUHA 3LQMA 3IFLL 1FA4A 1NA8A 3QHFL 2YWZA 3QVAA 4K3JL 4NT6B 3NIGF 1PLGL 1VPOH 3OAUL 5FHBL 5HDRA 1XR8A 2QQQA 3WTTA 1IAIH 1OE1A 1A7QH 1SEQH 2BNUB 3ELQA 1AXIB 3VWJD 2NTFA 4B53A 4FQLH 3BZ4A 3T0XA 2ARJQ 3I9IA 1MN4A 3NJJA 4Z6AT 3LXBA 4KK6D 2BIIA 3DI3B 4FNRA 1BD2B 2WLMA 3ZZ1A 2X89A 3VQ1C 1KB9K 2CXKA 1UB5B 5IVZA 1HI6A 1TPXB 2WBKA 3HAEG 3SE6A 1FWXA 5DZOA 1DBJL 1S5HA 2QVMA 3MRJB 5ADPH 3F12B 1EEYB 1L6ZA 4FHBD 4YHYB 4XPAH 2F53B 4LDLB 4YLQT 1LO3H 4C55A 4XB8A 4LOUD 3SGDH 4X99A 3TM6A 3HZKB 3MLYH 3QUMB 4IBTA 2GUOB 1URIA 4AOFA 1WHOA 1UHVA 1SN0A 3L9YA 4GH7B 4HAFA 4OF0A 1HYRC 5EU6A 1BXUA 3HB3B 4H20H 1W9XA 3QXAB 4IBLT 1LMIA 4AIEA 1M7DA 4DK3A 2WXHA 2X0WA 2K7QA 4NUJB 1OB0A 2VL4A 3BDYL 4H8UA 1IE4A 3MI6A 4KMTH 5IQ7H 5C1MB 3TO2B 3SPVB 3W39B 4OKDA 1PG7L 1IC4L 4JL2A 1AO7B 2DDQH 2HJFB 2XWEA 5FYKH 3BSGA 5IW6B 5B1CA 2GTWA 4MXWH 5E9AA 3Q44A 1AKJD 1T4WA 3WHXB 1TVBA 2JELH 4H25A 4IOSA 4LEOA 3VXQB 2ZUUA 4Q97A 5I15H 2GCYA 2ZG3A 4MNHB 5I1JL 1RV6X 1WCQA 2BDNH 4KKLD 3UAJA 3KWUA 2A9CA 3C6SB 4TSAL 3TWYA 4B9JA 3GLDA 4RGNB 2OCJA 2VMJA 4JN2B 2Y72A 3S97C 1USQA 1UACH 3X14A 3VU1A 1K3IA 4GOSA 2VYRE 2PO6D 4GG8A 2XICA 4CL7A 4AYFB 1AVAA 1FFNB 4CU6A 3D3VE 3CDCA 3I6LD 3MQIA 5KSAD 2LHAA 3U1QA 3VXME 2NCEA 4M6ML 1PBYA 2ZG2A 2CLZA 5LN4A 4JKKA 2IDFA 3HG0A 2W9DH 3WKML 4LSRL 1HNGA 3O6KL 4OGQC 4UT7L 2MCAA 2VDKB 5DEZA 2DQJH 4AVJA 4YSTA 4FQ1L 3FONB 3TT1H 3RUGF 2ZOWA 1YY8A 2DI8A 1RZGB 4OZHE 2X6BA 4RRPM 4UNUA 1S7QA 5IY5B 5K59E 4FHKA 1JV2B 8FABB 2YKKA 2ZTBA 1L0PA 3FH5A 3D0LB 3OG6B 3LKRB 4JE0A 1HQRA 3MNVB 3OWEA 4ADGA 4NPYB 1P4BL 3QI9C 3RDTB 4EN3B 4X7SH 4I85A 1MHPH 4U1LB 5AVYB 3D87B 1R3LB 1PY9A 5E0FA 1CR9L 3RWEA 4TPRL 5H4YA 3H2PA 4UOW0 2F2HA 4MXQC 5KVGH 3X3GH 1J12A 1QP1A 4OUUA 1FSKB 4J3OC 1FG2A 1I1AA 2AITA 2NW2A 2VMFA 4RNRA 4DW2L 1PG7X 4JRYA 2BFVH 2WV3A 5CWSB 4Z7NB 2F5BH 3L5JA 3LKQB 5GQBA 3KG5A 2FYYA 1G0XA 4K5OA 5FAAA 4NC2B 4UILL 5EWIL 3KH3A 3CE1A 4X6BA 4X4KA 4LAJH 4E9YA 1CGUA 2F58L 3DXAE 4YX2H 2GIXA 4LQ1A 4Z76A 4NDMB 3C60B 1VGEH 4YHNA 3I75B 4K5NA 2YMTA 5F7DB 3ZX1A 1G9NH 4MCZA 3T2QA 1BZ9A 2CNZA 4UOW1 4Z7WE 1FPTH 2TRYA 1OO2A 4JDTL 4DTGH 5DDHB 2DLIA 1QLEB 5I16A 4LSSL 3G5XA 1DCEA 5ABZA 2X87A 3DROA 5E8PA 4DPRA 3FCSA 1MELA 5DZ9A 1SOKA 2Y2TA 4IOFC 3TEYA 3AREB 5DC2A 4GYBA 2XKSA 2YJQA 3H2QA 3L4XA 3ZE2F 1I8KB 4ZMLA 4K5MA 3S35H 4XVJL 3MV7D 1KTJA 4FZ8L 2V3EA 2VLME 3X1GA 1XGZA 3RTQC 1G9MC 5HJGA 1RCYA 4AKPA 4HBQA 1A6AA 2R2BB 3TN0A 5E1QA 2E76C 3R7RA 3ZQXA 1BZ7A 4YO0B 3NCMA 4X8XA 2AABL 1RVFH 5CP7A 3UYOD 1HEZA 2J7LA 3KPSE 1I8LC 3GSRA 2AHIA 4HS6B 5E4EB 3U4AA 3PUUA 2G4GA 1EK3A 4UNIA 4OSUL 1BQHA 3P77A 1CLZL 1ZPUA 1T7ZA 3PJSA 3OQ3B 2NY6C 5C07D 1N0LA 2F5AH 5EDXA 2W0KA 4NKOB 3BUBA 3NJNA 3ISYA 4RMWA 2AXHA 2OZ4L 1SFHA 5EOQH 3S3JA 4BH7B 2UWEB 4FQXC 1GH7A 5L4MA 1A3RH 1QTYT 2BNQD 3UCQA 3II1A 4AWJC 5HHXH 3IN2A 5AVVB 3U9WA 4X8GA 5MEQB 1ZT7A 4NUQA 3QI9D 4OT1L 1RSFA 3Q9PA 2P24A 4K71C 5IMLB 3SYOA 3H7BA 3NFPA 1NC2D 3MACH 1SXCA 2A9BA 3HHRB 5E51A 3T8VA 3IBEA 4ZMXA 3DMMB 1AZUA 4MXQD 3AJ7A 3NFNB 3RZCC 1JHKL 4BQBA 2LU5A 4J3OD 5KN5A 2N7BA 1TVDA 3X3FH 5D1XC 2RGSA 5L6YH 5BS0E 2DH3A 1L9QA 4JFHD 4P23C 3H42L 2OL3L 3G5ZA 4ZW3A 2ICWB 2WW8A 1GYUA 3FF7A 5F3FA 2L8AA 1NC4A 3DURA 3ML9A 4BKSC 4BA8A 1XAKA 5D70H 4I9XA 5C0IA 3PABA 4HT1L 1I8UA 2VZTA 1IEAB 2QQKH 5T3XH 1C16A 3QRFM 1L9MA 1FL3B 1AZBA 2XBZA 5I5MA 3QORB 4KKBD 5I1KL 4HDIA 5FKPB 4DP8X 2P8PB 4UM9A 1CTMA 4PRNA 2V9TA 2EQDA 3I02A 3GWJA 4KKCC 5F0LB 3DWTA 4JO1H 2L3BA 2RFXB 5I17A 1RK7A 3QNYB 4YGVB 1AHWC 1TU2B 3D5OF 1BFSA 1KBGL 3RTQD 1NFDB 1NKGA 3QRGL 2ATPA 2UZXA 3VI3A 2V9QA 4KNQA 4S0TD 1IBFA 5TPWH 3ZO0A 2H1XA 4IRSA 4NGHL 1NEZG 3WGVB 3GJFH 4I1RA 4Y1TA 5F96H 1DZ0A 4D9RD 3IPBA 3IS0X 2OJ1A 1IC7L 4EUPH 4OLVL 3O3EB 5DQ9B 3CMOH 4FMKA 4NKDA 3WIIH 4APQB 2NY6D 3SHSA 2QSVA 1YC7A 3LKNA 1MAMH 2ESVD 2FQGA 2ZJSL 2VZVA 3QNXB 4FFYL 4HWZB 2KLSA 3L3KA 3B83A 1CYGA 3I3DA 3OD3A 2NSQA 5IG7B 4F8NA 4FQXD 4BKLA 3EUDA 4M7JL 3ZKMC 2CHDA 2VLKE 1IV8A 3GSUB 3CK0L 1UGKA 1LEKA 2NY0C 4NP9A 4YDIL 4MAYC 5E5RB 3WFCH 2B08A 4J6RH 3OMNB 4X9BA 2CDGB 4QRRA 4GINA 4ZFFB 3X17A 1UD2A 1TQWA 1KB5H 2VSCA 2Z4QA 2MFNA 4HGMA 2ZIDA 1PEWA 3QGVA 3FU6A 2D3NA 1J0JA 2JK5B 4OGYL 4P5KB 3RVWC 5DTFB 3CFTA 3T8XB 4D9LL 1MUJA 3RZCD 1CLOH 4KHXL 4AQ1B 1NM9A 2H6PA 3CZGA 9CGTA 5LGKA 5D1XD 4J5VA 1QSFE 5IFHH 1CZ8L 1E4JA 3E6HB 3MREB 4EMZA 4L4VE 2CA4A 2A1WH 5DHVB 1BWMA 2J8UF 1GGCL 4QHNB 3WFBL 4JO3L 3GB7B 2AJUL 4X7FC 5GGSY 1IGFH 1R17A 1EJOL 2YMXL 3MODL 3VD3A 1E4WL 3SDYL 1MVYA 5GHWL 1OLLA 2A4CA 3GHPA 2WK2A 4ABQA 1U8KA 4N8CL 3VXOA 3CZEA 1E9OB 3HA0A 3CN0A 3V0AC 2QGBA 3TBVB 2WXJA 2AK4B 1OQOA 3FRPB 4MJIA 4DK5A 2GIYA 3PDOA 1FORH 3CFKB 4ZXBB 1ACZA 4KKCD 2IPKA 2WSPA 4AQOA 2ZOKA 5CJXC 4OV6F 1YEHL 4C83B 2WUBH 3BAJA 5H37H 3WUWA 4CJ1A 3C5SB 1KJVB 2Y25A 1UWEL 3PG2A 1F8TH 5KZCB 1RUPL 3T0EA 2AAAA 1WBZA 1H6FA 2MQ3A 1I3GL 4KKNA 3C5XA 2AQ3A 5D71H 1NICA 5DD6B 5BCAA 5EIQA 4U6VH 4HZLB 4DT2A 2E7HA 5DQDL 2DD8H 1CLVA 3N04A 1I85C 3OVUB 3UTSE 3FB6A 4YSSA 3LPPA 2R69L 4Q6IC 4J1UB 4LCIL 4M8QB 5F3HA 5BXFB 4XVOA 1ODUA 1WS7A 3KBEA 1QASA 3GLEA 2Z7WA 3EJJX 1S7WB 3BJ91 2GT9B 3BVDB 4ZI8A 4RQQB 5AVUB 4JHUA 3EYOB 3V95A 2A6JA 4HWBL 4ZTOL 3MV9D 4BXVA 2A7BA 1XGQB 2WZAA 3K81A 4YGAB 2GFBB 2XNAA 3L3OB 3IJEB 4P2QA 1G1OA 4QHUB 3GUFA 3RUGA 3ULUL 3CLEH 4OQTH 3ZKMD 4JANA 4FKHA 4NWTL 1K8IB 4L3FA 1QBLL 4IW4C 3P9MA 4UV7H 5FGCB 1D5MA 2NY0D 4MAYD 4NZTL 4ZSOB 3BP6A 2ID5A 4ZDHA 2W9EH 2KBGA 2XZQL 3F7VB 3RKPA 4BRJA 5JHAA 2PPEA 4X8CA 3VFMB 4DKFL 4L3EB 1FFOB 2VWEE 4I48A 3RVWD 4Z7UF 3KAAA 1RJLA 5FYLH 5DMIL 5KYXA 1CLYL 3PP4L 4H8PA 2Q2LA 1GZPA 1BIIA 2AV7A 3QYCA 3TWCH 1RUKH 1GOGA 4I4WA 4BJLA 2PTVA 4M93C 4ODXB 3AT9A 4U0RB 2XTJC 1KELH 1WEJH 3E2HB 4TN9A 2ICWJ 1BFOA 4B27A 3OSKA 3K2IA 4HOWA 5JQHC 3MLSH 3P4MA 3F65A 5C0AA 4K23L 4Z7OE 3JZYA 3M46A 4RMQA 2MH4A 2NX5A 4YPJA 2FO4B 3FF8A 3GBLA 5CEXB 1AR2A 1R3IH 4K8RL 1T7XA 5TGBA 3IPFA 3D12B 1N59A 1XF4B 3FTUA 3VXPB 4XN1A 2BZ7A 3N1MC 3UGXA 3RB7A 1YQVL 4WLCA 4X4YA 5FECA 5I0XA 1GPOL 3EFFA 4ZS7H 5ACLA 1PX4A 3VQ2C 1HJBC 3KXFD 4FA7B 2FL5B 4LDEB 2ILLA 3VTMA 2CO7A 4F37K 1GGYA 4TNVK 4XVSL 4XXCA 1GYWA 2AJZB 4JQXA 3BVNA 2MTAA 5ID0A 4LLYB 4YHPB 2P45B 2BOBB 1TEFA 4AYBA 1CD0A 3GHEH 1ZY9A 3BIKA 2VDPL 2K7PA 3BZEB 2IANB 3WDHA 3QUZB 1MWAA 2NCMA 2A9ML 5IESL 1FF5A 3ARYA 5GXBB 2X2JA 1H3WM 4MD5B 1CF8L 3BGFB 1RLWA 3ULVF 4Z8FL 5BVJB 4IBVA 4U0QB 1AXSA 4GMTH 5D1ZC 4AZUA 4W9CC 4ZTPH 2J44A 4D7BA 3F85A 3QDME 1JRHL 3MRGA 4WI0A 5MI0C 2CCVA 3P69A 4Y19A 4MJJA 2Q76A 3JWNG 4HHAB 3HLKA 2VDLH 3WYRA 4PY7B 2GK2A 3QAQA 2EE6A 2VC2B 3BT2L 1B2YA 1IQWL 2F15A 1M57B 4TM9A 2LAGB 3IFLH 1CFVL 2X5PA 3CXDL 3Q05A 3QHFH 1EJ8A 4K3JH 4MDIB 4UANA 1P69B 2PTTB 1PLGH 3OAUH 5G4MA 5GS2H 5FHBH 4TL5A 2B7DT 3DO3A 4ZUVB 1JYWA 2IWFA 1AD9A 1BZEA 2H0PA 3IJ9A 4IRZL 1XD1A 2Q3ZA 3QJOA 3T2LA 1NBZB 2OYKA 2J20A 2UZPA 3MRCB 3SDXB 2HKFL 4F7TB 1MHCA 1J5HA 5E5LA 2PYEE 3DRQB 1CPUA 3NCFB 4P3WA 4CC4C 4BK4A 1ZKAA 2DQFA 1K9TA 2N4IA 1IU1A 1TJXA 2DLHA 1DBJH 3KWWA 4QRSA 3POCA 5HHMD 3VD2A 4JR9L 1FYHB 1Z5LB 1S7TB 4C4UA 4JDEA 4Z7VB 5CLXA 3RU8L 4X83A 2OMYB 4ZMVA 2NUTB 2XTJD 4HIEA 3AY2A 1YEIL 4NZFA 5JIKA 4JRFA 1VACB 5I75B 1CXEA 3U2JA 4K3DL 5DC9B 1KY7A 3DX1A 4CVXA 4WIQA 1UA3A 4YOKA 1C7TA 1JNNL 1YPZF 4JFYB 3RWJB 1DSYA 3I3EA 5L0QB 2P1YA 1OGAD 5C0FA 2CA3A 3BDYH 1I4FA 3WHE1 3EXLA 1VKXB 4L8BA 1E9QB 1FNSL 3BD3A 3PU7A 1PG7H 1VFBB 3QCVL 1IC4H 3K8LA 5I1DB 1FNHA 5FW8A 4XRCA 2WOYA 3FT3B 4XBMA 1TZ8A 3C8HA 1IIIA 1QFWH 3MOBL 4PJXB 1I7UA 2Z8VC 5A2FA 2Q10A 1WIOA 4HG4K 4V2CB 1S2EA 1KCBA 1T1XB 2EUZA 1OCWL 5HHOE 1G4RA 5I1JH 1IKOP 4F9PC 2HA1A 4TSAH 3CSGA 3K6FA 4AMKL 4N8UA 3CSPA 1XGYL 5F71A 4HCRA 1KXVA 4L9DA 3OKEB 4QCIB 4L8SC 5A2IH 4OGAC 1TF4A 4KROC 1N3NB 2ARWA 4RETB 1T5WA 1W0WB 5D1ZD 3L95A 3FYEB 5GISL 2RHEA 2YBRA 5CCGE 4M6MH 1AIFB 5DO8A 4ZAKC 3U4BL 3US0A 2CLRB 5E8OA 4LSRH 2ORBH 3O6KH 4UT7H 3VGAB 2ZUXA 3O9WB 3NCWA 3SDAA 4JFZL 5LN8A 4FQ1H 4I7ZC 2X6MA 3F7YB 3MJ6A 5AOJA 3S8FB 4P8QA 4UQ9A 2EDMA 1GSKA 2F54A 4L8CB 3LD8C 5JQ6L 2O6FA 1UT9A 4OD2B 4KKQA 4OFVA 5IB5A 5JOFB 5TQ0L 2K3HA 1P4BH 2J56A 3PNWA 3V4PA 1QABA 4WK0B 5C0EA 3L3GB 5FM8A 5F9AC 1R0AL 5A7EA 2ZSVB 3SPJA 4Z7IA 1A9VA 2K8QA 3IVKA 1R5VA 1CR9H 2WLYA 1T20A 4FKEA 1P6WA 3CHQA 4TPRH 5J12C 1AP2B 5DEFA 4NYLA 3SKMA 3R06A 2K70A 1L0XA 1M1XB 3LIZL 3K71A 2BXZA 3B56A 4XN7A 1TOXA 4DW2H 1C9SA 3ZZQA 2JV6A 3HR5B 4PCSA 1D3CA 4LHUG 3TZVA 2N7AA 5DS8B 1K4DA 5EWIH 1JN6B 3VXUA 1KENL 2F58H 4KKPA 1WV7T 2B8OT 4MA1C 4PMFA 5DVMA 1CS6A 1T1ZA 2AMUA 3RPIA 4MWFB 4Y5YA 4J7RA 3D85B 1JP5A 4JDTH 5CD3A 5DD0L 5ECJE 1E27A 1QRNA 1D7DA 5FK9A 4LSSH 1JUFA 1T6VN 4A2LA 3CDFA 4M7KL 1EERB 1NMBH 2RH0A 2CJSA 4WI8A 5E70A 1TCRB 2YS4A 4KTYA 1MCFA 4K55A 1WZ1L 4CMMB 4NQCA 4XVJH 4N4YB 5CF3A 4FZ8H 5KBKA 1G0YR 1HILB 2HZHA 2A4ZA 4O2FB 3VFUA 4JPKL 3CXHK 4OGAD 4NOBA 4KROD 2VRKA 3S5LB 5E6RB 1OV8A 2VR5A 1KPUA 2WQUA 2AABH 3V5KA 4GW1B 1U8QA 2ZZUT 1BA9A 2YLHA 1WS8A 2F7RA 1JK9A 3VSUA 4MNQA 4ZAKD 4R4FL 4OSUH 1KGCD 1MCPL 1FUNA 2DQCL 2O6EA 3QK0A 2XN9E 4YPGB 1DVYA 1NBVL 5J1AA 1XIWC 2W65A 4PJAB 2EYTA 1IL1B 4POZC 5C0BA 5L2JA 1IAKA 2C8NA 4KY2A 2EDQA 5HHPB 1N18A 1AY1L 4G6FD 4QEGA 5IROC 3QDAA 1EBAA 3STZA 5KOMC 1RZKL 2OZ4H 4H26B 2APVA 3G04B 4GRWH 1XCTB 3FSZA 4QO1B 4IIZA 4W9JC 2UXGA 5IV2A 1DQQB 1R6VA 2E3VA 1USZA 3D0VB 4NKMB 2IFFL 4PI0A 3WS3B 3GMQB 4NBZB 3AQDA 3RG1C 3WNKA 5JOPE 4OT1H 1GCFA 3D18B 3O6FC 1JGEB 4TQ8A 1PNCA 2DYPA 3PWNA 2C9PA 2CSPA 4UAOB 3VXRB 3BP4B 1JHKH 4ZG1A 5ICXA 1EFXB 1UQSA 1I9EA 1J0IA 1T5XB 3QIUA 4Z7UA 1CFNB 4PJGA 3Q06A 2J8HA 4X0NA 3H42H 3KJ4C 4NSKA 4YZFE 2OL3H 5FA4B 5FO9A 3RX9A 4UTCA 2J72A 4AC2A 3V6OE 3DX3A 3SO3B 4YC2C 2MCG1 1TFPA 1W72A 1T0MB 5D7LB 4JFQA 2HFTA 3BAYA 5ELIA 3R0MA 2ICES 1T66D 4C56B 4J3UA 2IBBA 1WAEA 3P3RA 2ITFA 5D1QB 4KKAC 2BY1A 2FD6L 5I1KH 4OCRL 1P6FA 4L48A 3V0EA 4QRUB 3GXFA 5KSUA 1FYTA 1GMIA 1WA0X 1A0QH 2F74A 2PPCA 2P43B 3Q13A 1DANT 3L4VA 4KUZL 3LPWA 1PZBA 4LLMB 3SDCC 3T9WA 3WFHB 3VXTB 3D3VD 3VXMD 3NVQA 2NY4C 3GXPA 5K5YA 3JV0A 2DIAA 3PWLB 2XV6B 5F3BA 4WU5A 5AW2B 2K8MA 4QHLB 3NSDA 2RIKA 2NXZB 4FAAB 1QBAA 2APBA 3FCGA 3QRGH 3TBTA 5JPNC 1UOWA 5E9DE 4YDJA 4QNPF 4WQOA 1FZJA 2VE6B 4JG1L 5IMOA 4NLHA 1FFTB 3G5VB 4WO4A 3STBA 1M2VB 4D0CA 1CDBA 4PRHA 5SWSA 5A6LA 3IAPA 1JVKA 2BSSB 4OLVH 4UOZA 1XIWD 1CDCA 5BV7L 3VXNB 1MI5E 4M61A 4GAJL 3LN5A 4POZD 2VN5A 2AEPL 3HVNA 4OKVB 4YDNA 1NFKA 3PAVA 5F7EL 3U30C 3RIFK 2ZJSH 1I8MA 1KTDA 4FFYH 1HKFA 5CSZA 5IROD 3C5JB 1CK0H 1CICA 3FT2B 4M7JH 1WJ3A 4Z7NF 4GAAA 5D6DC 2P7TA 2HXAA 3JXAA 4KBPA 5ENWA 5EG6C 1T1WA 4EDXB 5I2IA 1P1VA 1U8OB 5GGRB 3CK0H 4P46B 5IVXB 4GQRA 4W6XB 3HS0B 4YDIH 4CVWA 2NY1B 4H0GA 3MRNB 4LOVA 4WTZA 5C09B 1Q38A 4BSWB 3VSVA 2FJUB 1HDMB 5JW5A 4MDJB 4NQSB 4N1EA 1S7VB 3O6FD 5JHLA 1AR1C 3DO7A 1I31A 3CFEA 4OGYH 3H6JA 3DXAD 4P5MA 3OHXB 4D9LH 4BZ2A 4KHXH 3BPCB 4M8VA 1INDL 1JDDA 2YARA 4YE0A 4YXLL 4XCCL 3NOIA 4RGMB 1CZ8H 4G42B 4ZUUB 2D2CC 3O41B 1R3KB 4KRLB 1GGCH 1I3RA 3KBPA 2BVQB 3WFBH 1E8WA 3NG5A 2E4TA 2FJGB 4JO3H 2W94A 1A22B 4G6KL 1ZXQA 1WZLA 2W0LA 2AJUH 2IV9A 4H7VA 4YWGL 5T1JA 1MW0A 2YMXH 4FXKC 3MODH 1FZKB 1E4WH 2HVKB 2R2HB 4KX7A 5GHWH 2AXFA 5MEND 3U4EA 1GYVA 4JGMA 3DPBA 4N8CH 5D72L 2C3GA 1YPZA 4U49A 1ZLVK 4N3UA 4KKAD 1ZA3A 4ODSL 3P73B 2ZCHL 2Z31C 2XHNA 1WP6A 3HNTL 2VLMD 1HCFX 1G1YA 3IDMA 2EH7L 1EXUB 1AZVA 1DBML 2Y1AA 5G5DA 4EI5C 2WTPA 3HR6A 3U0PA 2YD2A 4PB9L 2H3XC 5DFAA 3SDCD 3UPRB 1YEHH 5I73B 4HXAL 2NY4D 1XGPA 3KPSD 3QEHB 5GSRA 3ARFA 3APFA 3ABGA 1UWEH 4L0ZA 1RUPH 1RIVL 2P8MA 3O2WL 1YMHB 1I3GH 4TTGA 1PZAA 4TSCH 5C0CA 2UWEF 4DPCX 4HIHB 3LSOB 3WIFB 2YD4A 2FHFA 1D5BB 2VKWA 5DQDH 3THML 2EZ0C 2XG5B 2MIZA 3FTZA 2ITCA 5B1BB 3UO1L 1I7ZA 2ZUWA 3DX7A 3L1FA 4K73A 2R69H 4GBXB 3U6RB 4UQAA 4LCIH 1O6VA 4UTBA 5HYEA 4EDWL 3OR7B 4WI5A 1YO4A 1TKWB 3IMVA 1OL0A 2BWDA 5AOIA 1B3IA 4M4PA 4N8VG 1QSEA 2XA8H 2M2DA 3BFWA 3DHJA 4LLWB 5HVGB 4K94C 5EUOA 4HWBH 5C6TL 5IQLA 4ZTOH 3IDJB 4ETQB 1XL6A 4RDBA 4B3VA 2J6EA 1BVKB 4W6WB 5LQBH 3NCJL 3DX6A 1HHHB 3ULUH 1T2JA 1G7HB 4U1MB 1A4JB 4NWTH 2WINB 1QBLH 5T1KD 2DICA 1BFVL 3HE6B 5BS0D 5DYFA 3VRLE 3IKCB 4NZTH 3HE7B 1GYCA 2X70A 1ID5I 4HFWB 4XH2A 5GZOC 5CCJA 2XZQH 3B9EA 3MJ9L 3PP3H 3VFGL 1AR1D 4DKFH 4TUOB 4WW2B 1R3HA 1OP5H 3LXAA 2R1YA 3Q0HA 1N4XL 5DMIH 1CLYH 1T04A 3PP4H 4M00A 4RFEB 5AW6B 3V79C 1HU8A 2GPZA 1BBJB 3TV3H 5HYSG 1AGEA 3FTXA 1CMOA 1OCZB 4LK4A 5HGHA 4GP5B 2YGPA 4ZMOA 3LZFL 2CRZA 4GRLA 5SWQB 5CHNB 5CJ8A 3VVWA 5B4MC 5T3ZE 2O5XL 3B1TA 4G8FA 4PQXA 1IBDA 1PKQB 2NNFA 4K23H 3V4LA 3WMPA 3SN6N 3UAAA 1SVCP 1NFDF 4WNSA 2ZG1A 1TTBA 4LRNL 5TE7L 2COVD 2YIHA 3VM5A 5TF0A 3CZUB 1Q9LB 2BY0A 5HXMA 2Z31D 4KNTA 1KTLB 1GPOH 1DN2A 5BW7A 1YJDL 5LNGA 3NZUA 3VQLA 3VJ6B 5GGTL 2FB4L 5I71B 4LBAA 4GSXA 4EI5D 4XVSH 2IAMB 5IQ9B 3BO8A 1AFVL 4KK8C 2XYBA 4AEFA 3FB7A 3QHTC 5IFJB 5GRZA 4B6ZA 2I85A 3HZYB 3O3BB 4FJ6A 1T83C 2VDPH 4OCMC 5DHMC 1OPGL 4O02B 1W15A 2QLYA 4JFEE 2A9MH 5IESH 1JJUA 1BLNA 4UF7C 2JXMA 2PR9A 5TDOB 1CF8H 1MLCB 3B9KC 2DWEB 2EZ0D 4NT6A 5DA0B 1BBDL 1P7KB 3L4TA 2BNUA 1JRHH 5EC2B 3T3MB 3RI5F 4HA1A 3A4AA 4IIQB 3GD1C 5C2BL 3MBEB 2VLKD 2X4UB 1HINL 4NAQA 3MO1A 1PQZB 3VI3E 1BD2A 4LCWA 1XCWA 3F01A 3BT2H 1OGPA 1UB5A 3ZK0A 4A7TA 1S9YB 2WGXA 1IQWH 1JNLL 3WD5L 1CDYA 3DV6B 3MRJA 1SF5A 1CFVH 3CXDH 4PJIA 4X2UA 4Z9KB 4Y1SA 1PNDA 5D4JA 3CHXA 4PRDA 1SEBA 4NUGL 3D07A 1WE5A 1NAKL 3AY4C 5DCCA 2R9HC 3MXWL 2VWEC 1HH6B 4KRPB 5CZRA 1X7SA 4NQXB 3DPDA 1BOYA 4IRZH 3TPUB 3HZKA 1F4XL 3KYAA 3QUMA 4FJYA 2GUOA 1WFUA 1SJEB 2HKFH 4MJ6B 1QSFD 3DVGA 2YAMA 3L6FA 4CSTA 5I1AB 4L4VD 4I3RL 1CXIA 4GS7B 5GZOD 2OS7A 3IS1X 2FGWH 4JY6B 1MFMA 5I8OL 1J05B 3DA0A 3N40P 3ULUF 1W8NA 1XH3A 4LZKA 4TMPA 3QARA 2ZKHL 3ARBD 3B1UA 4JR9H 1IZKA 1JFQL 5DD5L 1WT5C 4KX8A 1OGTB 1U8PB 1CURA 3RU8H 4C59B 4DP0X 2HJFA 2WCGA 5MP6H 1H5BC 2OTWA 1G6RL 2QDWA 5BZDB 5C0JB 1YEIH 1RKRA 3UYPB 4LPXA 3L1OL 3LY6A 4K3DH 3QG7L 5B4MD 1KJMB 2DM7A 1JNNH 2R23B 5IGXL 4Z78B 1OSPH 5AKSA 4MNHA 3SKOB 3NPSB 3AROA 4UNTA 4LO9A 5T1MB 2IWEA 2W60B 3RVVC 1FNSH 5HJ3B 1MCHA 3QCVH 4JN2A 1D5ZB 1GGBL 2J21A 1KBWA 2Q7NA 4U7SA 5EZPA 4OAWB 1QWUA 3JYBA 1V7ML 3TO4C 1FFNA 3GKZA 2X9ZA 1HK6A 4IGBB 3VSTA 3MOBH 4KK8D 1ZSHA 1TETL 2WVUA 2EIMB 3IJSB 3UTSD 2DJMA 3HUJB 1VCAA 1OCWH 2VITB 4FNLH 1A25A 1TXKA 1Q9WB 4CSPA 4PGEB 4AMKH 4RSVA 1XGYH 2JQZA 2BK8A 3FONA 1ACYH 1WLHA 3B9KD 4JAMB 2PCFA 1NEZB 2VDMB 3E8UL 3IE4A 3LMJL 4NO0A 4AV0A 4DQAA 1UXSA 3LDBC 3OZKA 8FABA 3TBBA 5KYWB 1CYXA 2Y7OA 3BUYA 4Z3GA 5E95B 4LOEA 5GISH 3D0LA 2VDOB 1THAA 2EC8A 4IMKC 4G7VL 3MNVA 4Y2LA 2WJ7A 4KXAA 3U4BH 2OI9C 3HFML 4BHUI 5DO2C 3RDTA 1KZQA 4C54A 2K4AA 4U1LA 5GS1C 3DRTB 1R3LA 2LU4A 4AUYA 1NTDA 4JFZH 2LTQC 4LU5L 4QYOB 2BSDA 1EHNA 3I2CL 4IU3A 5EF2A 4JUTA 2R9HD 4WDIB 1O9ZA 4MD0B 3QDGB 2XXFA 1IGJB 3DGGB 1AZRA 3FT4B 5JQ6H 1OAJA 4IBZA 2CDEB 3WU1A 3ZBMA 5CWSA 5TQ0H 4GAYB 3ZY7A 3CFUA 3BPOC 5FCSH 1CE6A 4MMZB 4AT6B 3WJLA 3DK2A 1R0AH 3RUGE 1C8QA 2NY5C 4A7SA 4NDMA 3C60A 4P5SA 5F7DA 4FQIL 3DYMA 2ZNXA 2ZUQB 5C6PB 3FPYA 3LIZH 4A2EA 3IXTA 5DDHA 3QA3A 4DUXA 1SQ2N 2BW5A 3IDYC 5HY9B 5I6XB 1MNUL 3IEAA 1JWSB 3UAEA 4HD5A 3WNLA 1ZEAL 1T2XA 2NNXA 1KENH 4CVUA 3PGDB 4MASA 2AV1A 4CKVX 3HMWL 1I8KA 3CJJA 3RVVD 3EH2A 3B5TA 3IAGC 2X6CA 1PZ2A 3TBCA 3IGAB 2N0KA 4TF4A 2WAQA 5JHDA 3WJJC 5DD0H 3TOPA 5JXEC 5EEXA 1RZPA 2QSCL 2R2BA 3TO4D 2XDHA 4JRXE 2FWSA 5IMMA 4V33A 1XSOA 4M7KH 2B59B 1LO5B 4KOCA 3QDMD 3WO3B 4WUUE 3NUKA 4OZIF 1WZ1H 4BFBD 4Y2DA 4XX5A 3ZXAC 4B97A 2AW2A 1LHZA 2GYSA 4NKOA 1RZIB 1A7BA 4EPSA 5EA0L 3AABA 2HX9A 1EO7A 1TNMA 3H9HB 2AXGB 1KOAA 4JPKH 2CO3A 4JZJC 5DURD 5EZOL 3SDXF 4BH7A 4AX3A 2UWEA 1BJ1J 5KSVA 4ZMNA 2V5RA 1UOKA 5F6IC 2V0AA 2A6DB 2AEOA 4RISL 2CUIA 2HTKC 1YMMB 4R4FH 2B9BA 1MCPH 3D39E 3PGFL 2DQCH 3ZE2E 3MGTB 1A6TB 4LRIC 4L5FL 1B9KA 1KN2L 1NBVH 2O26U 4WV1C 3FUEA 2I9TB 2NXYC 2J5LB 4MSWB 3V52L 2VLRE 3LJ3A 2PYED 5IMLA 4XNQB 5FOJA 2O1AA 4YFLI 2C7FA 3BZ5A 4Z7VF 3VE0B 1AY1H 1FJ1B 4G8EB 2D9CA 2Y06L 3B3BA 3DMMA 1RZKH 3KYMB 2BIPA 1O7DE 3HRZB 1J8HE 2AJVL 3KLAB 3NFNA 4P4RB 4N0RA 1FVEB 4XNMB 4JVUA 2X9WA 5ID1B 4M48H 2EAEA 5IHUL 2ZCLL 3H8NA 4ZNEE 1WGOA 4PRIB 3JTBA 2IFFH 2ICWA 1PLBA 3NEEA 1S9VB 4J8RB 4JFUA 2NPLX 2X12A 2O6PA 3U7AA 2XWBB 3RGBA 1Q72L 3CDYA 5K1NA 1IEAA 2VDRL 4PWJA 4OR1A 4LLQB 3VQMA 2AMGA 4JMNA 1ESOA 2JJVA 5ISZA 3SDDC 1T3FB 3TL5A 1B9ZA 3QORA 1SRDA 1XH2A 3HVDA 1MHEA 4ZNCD 1F45A 1CDUA 4PJXF 5DJXA 2P8PA 5FKPA 2M83A 3CFCL 4L1SA 4PGDB 1T0NB 2EE3A 4LIQE 3OLDA 4QJ5B 4GKZB 3S37L 4JREB 2YQ2A 1UEMA 1Q0YH 4WSJA 1NDGB 4S11A 3CZFB 3QDJE 3F3HA 3ARDC 4CGUB 3MLPA 2FWUA 3CPUA 5HHOD 4BQCA 3US9A 5AFAA 4J2XA 3HNVL 2N1KA 1F1AA 2FD6H 2VABB 3LV3A 4PR5A 4OCRH 1CDHA 5JXED 3H4FA 4JM2C 4ZOAA 4OZFH 1KN4L 1KGYE 1V54B 3P3TA 2XUWA 4JO2L 3RVXC 5HHQA 2C5DC 3QWRD 4KUZH 2JTYA 1BQHG 5KVGE 2Q3AA 2AGJL 3BEWB 1L0QA 4K2UL 2J88L 2WXFA 3QXUA 4APQA 3ABMB 5AKRA 1X5FA 4KMLB 4BCXA 3QNXA 1RAMA 2VQ1A 1F6LL 4TLTA 1A21A 5IG7A 3VW3L 1JWMB 3ZUCA 1LL1A 4HETA 5E4IA 1JOIA 4JG1H 5AUMB 3T6XA 3KCPB 3VXSB 4NO2B 3VSQA 1O7SA 4JGUA 1JI1A 4G1EB 2HTKD 5FUOL 2A74C 4LCCB 1XMEB 4RAHA 5EC1B 3ECUA 5F1NB 1RK1A 4WSKA 1XL4A 4PJ8B 1UOVA 3AWGA 2CDGA 2QHLA 2NXYD 3DX2A 1ET8A 4PJEB 2ZWNA 4GAJH 4ZFFA 2D3VA 2AEPH 4W4OA 3MN8A 4RGOL 4YK4C 4NX0A 5DR5L 1E50A 1ID2A 1LLAA 1U3HA 4P5KA 4WHCA 4ALAC 3APMA 5DTFA 2KT6A 3PQYB 4G6JL 1AG6A 4H0HB 5ECGA 4ZX4A 2IDTA 5LXGL 2X4QB 3TONA 3CIQA 3KYKL 4ETYA 1GS8A 4JFFB 4I13B 1PIFA 4K7PX 4WENB 4LLDA 2HLAB 4QHNA 1JZFA 4ZPTB 2J71A 3GZPA 2PABA 1BVZA 1EX0A 3ZKNC 3GB7A 5F6HJ 4KUCF 2UV3A 2OSLB 5FF6B 2APXA 3V6OC 1HL4A 2LR4A 4FFVC 4I2XE 1HESA 2X1PA 1NGYA 1QUPA 3AQYA 3X1EA 4UM8B 4TLUA 2RQ8A 3SDDD 1E9OA 1MCJA 4YVUA 3V9CA 5BQ7A 1INDH 3DVFA 3GMOB 3TBVA 2Q8BL 2AK4A 4XCCH 4YXLH 1TVHA 4LT7A 4NQEE 3PHOB 2DQ6A 4PJFB 4J23A 3O8XC 4XOEA 3CU7A 5EOCH 3EH4B 1KTCA 4TVSa 4OW6A 1BX2A 5EBGA 4G6KH 1C7SA 3QIBB 5I8KL 1UUSA 2YD7A 3AM8C 4YWGH 4C83A 2G0LA 3ARDD 1X5JA 4MGXA 4X0KB 1HHGB 3AUVA 5D72H 1RUML 3CFJA 5DRZA 2B15A 4ODSH 1LP9B 4MA8L 3ZOAA 3WIHA 2ZCHH 3QPXL 4I89A 3U2IA 4AYID 5AVZB 4HK3N 1KY6A 3HNTH 4OJCA 3RVXD 2EH7H 2J8UE 5F44A 1DBMH 2HVBA 3CVIH 3LH8A 4DERA 4HOZA 5HYFA 3A67H 3OKKB 3BPLB 1WVZA 4PJAF 4HXAH 4JMXA 3HAEH 2PR4L 1OAKH 1KIUB 3Q43A 3HI1B 1RIVH 5DI8B 3FMGL 3O2WH 4RQQA 4C4KT 5AB1A 2XN9D 2C3HA 3GRWH 4F7CB 1DVTA 3BKCH 4EVNA 1FG9C 3IFNL 2X9YA 2GFBA 5CSBA 1B88A 1DQVA 3THMH 4BZ1L 1GZHA 4RMBA 3QR1A 4Y5XC 1N7MH 3L3OA 3SCMB 3NDYE 3VRJA 3D4GA 3IJEA 3ALXA 1SGKA 4P4KC 4QHUA 4R5TA 4PV8B 3UO1H 3Q01A 1MCWM 4TLSA 1U95B 1AANA 2L7EA 3H4HA 5SV4A 4PGJA 4EDWH 3QHZH 2IWKA 1K8IA 4L3AA 4PIRF 5D5MA 4N6RB 1QLRB 1UJ3B 4AV4A 4OLXL 1OSZB 4AK2A 2H45A 1CD9B 1MWOA 1Z9LA 1KXQE 2NY2B 3F7VA 3FO2A 1PJWA 3Q5OA 2X4SA 5C6TH 4P0DA 5JOPD 5AW0B 3VFMA 1FFOA 2X4RB 3CVCA 2ZXEB 4PS8A 1YYCA 4NZRL 4G9DA 3NCJH 1IUZA 3DOSB 4L9LB 2QVKA 2OX5A 4OLZL 5BRZE 4ODXA 5DHYA 5I26A 4EF3A 3BISA 4PJ9B 1KXTB 3G5YB 4F7EB 4N0CC 1KFAL 3C75A 4ODUB 3IF1B 5AOKA 1Z0NA 1SY6A 2PKDA 1GGUA 3MJ8B 4HWEL 3ZKND 3MJ9H 3VFGH 4FFVD 2FO4A 2EKSB 1PMYA 2X05A 2BWQA 1N4XH 4U2ZA 1XF4A 2CLVA 4XXDB 4XXWA 4YDZA 4R97B 1YRKA 3PWUA 4N2AA 1X6NA 1MY7A 2FIKA 2FL5A 4ZQTA 2VAAB 3LZFH 2O4EA 3M1OA 1MCEA 3O8XD 4ZUWA 7PCYA 5KVMC 2ZP0T 1UA7A 3FOMA 3CLWA 3TT3L 2O5XH 2XYCA 3ME0B 3P0YL 4QOKB 4XMZA 3WUWG 4N24A 4NHCL 4Z7UE 3GSWA 3WTSA 2BZDA 1A7NL 3F62A 1NKOA 2DWTA 1J0YA 4LRNH 5IK3A 3QUZA 1AG0A 5TE7H 3VWKA 4H8QA 3Q2VA 2FVNA 5AKVA 3V7MA 3QW9A 4MD5A 3N06B 4X5QA 5GGTH 3TBYA 5E9DD 1DEDA 1OT4A 1AFVH 2Z35B 3DBXB 4FQHA 1WAAA 4R3SA 1A9BA 4X4XB 5B8CC 5D96C 4HHAA 1BAFL 1CD1B 2OSXA 2X0VA 1OPGH 5CIPB 3ARPA 4GIAA 2UY7A 3T65A 1MI5D 3C8KB 3KW7A 4OZIA 4MDIA 1N10A 4ELDA 5JDSB 1ZJBA 1UXMA 1ZV5A 2PTTA 4ZZKA 3MKKA 1BBDH 6PAZA 4P4KD 4DN3L 5IVXF 3IDIA 3SE4A 3MLTA 3T2PA 2I60L 3GMRB 3GKWL 4G71B 4Z23A 5E6IA 2I32A 2EDOA 4F7TA 4FG6C 2ICEA 5C2BH 1HINH 3DRQA 3CVBA 1CBJA 2F08A 4W9GC 4ODVL 5F9WC 4OCYL 2EDLA 4F92B 1JNLH 3GM0A 3QXVA 1DQLH 1X3DA 2CD0A 1BMGA 4KNUA 2VO5A 4ERSL 1XFPA 3ULVE 4P2RA 4YN3A 1P7QA 4NUGH 2J1XA 3ZT5A 1NAKH 5SWSE 1Z5LA 1S7TA 3MXWH 4KK9C 5JHBA 4Z7VA 5BO0D 2UYLA 4E9QA 4PHZA 2Q6WB 2OMYA 1F4XH 2AJ3B 1Z3RA 4N0CD 5FFGA 1VACA 1CC3A 3FQTB 4B9YA 2CRIA 5IEKA 1XB6A 4I3RH 2B5IC 1UWGL 2N0MA 1LEGA 5I8OH 1A1MB 3UDWA 3SQBA 1CVRA 3FC8A 1C1EL 2D7NA 2F1EA 1V3KA 2GBVA 2ZKHH 4HUWB 2X4PA 2KERA 3WY4A 1E9QA 3VMOA 1JFQH 5DD5H 4N25A 4P99A 3RILA 5I1DA 5EEZA 3V0IA 2CMRL 1J0ZA 1G6RH 1N19A 2OR7A 2XBTA 3EZ8A 3NTCL 2X10A 3L1OH 3TA3C 4PJXA 5FEBA 4M62L 2VLJE 2BVPB 4FNQA 3UZEA 4DPAX 1BIHA 1T1XA 3UIYA 3CTTA 3WDJA 4GQZA 4LKCA 2A83B 2EDJA 3K3QA 1R46A 3MA7B 3SJVB 1LK3H 2YD8A 3G9AB 5AVRB 2BINA 1JF1B 2LU7A 1GGBH 1W91A 3VA2C 4MXVF 3OKEA 4I1PA 1V7MH 2B4CC 3L4WA 4OCSL 4PVNA 1N3NA 4KC3B 4N0YL 1MFEL 1W0WA 4OBSA 1EXHA 1TNNA 3FHQA 5FYLE 1TETH 2JMRA 2VTFA 1HWGB 1JV5A 3ECBB 1AS8A 2H41A 5J6SA 5HYJE 1ZLDA 1QR1A 4GI6A 4PCKA 2ENJA 1KGIA 5D7IE 4H44C 1E67A 1KIRB 1EPFA 3R4DA 2ZAGA 3ZR6A 3IGFA 5EU5A 3E8UH 3LMJH 3ZE0F 1RU9L 4QR7A 4BCZA 4G83A 3F64A 4L8CA 1NEPA 1TZOA 2R51A 5C0CE 2W0PA 4G7VH 5D7JC 5JOFA 3HFMH 2P26A 1NWPA 3JTSA 1TENA 4WW2F 3RNQB 4B3EA 1J5OL 3L3GA 4I87A 3UP6A 3X11B 2ZSVA 2V3FA 3EJZC 5ALBL 1CXFA 1UXWB 3QJQB 1PL3A 4LU5H 1JPSL 3I2CH 5J5EA 4IKNA 4WUKL 3MXVL 4KK9D 4TSBL 2WWOA 1M1XA 4XCYB 3L3JB 2EO1A 1FFPB 4TQHA 5C0DB 2BP8B 4NQDA 1YUHB 5L8LB 3HR5A 2PF6A 4MFHA 1MCOL 5DS8A 4KV5F 3B2VL 1JN6A 1YNKL 3QRBA 2WLHA 4N1HB 2JB6A 3II3A 3BP5B 3NBNA 4JQVC 3NZ8B 4FQIH 4CNIB 1DLHB 3IFOB 2JKJA 5AVWB 4NCC2 3NJXA 3D85A 3ZZSA 4J4PD 4NRYB 4UYQA 3TIDA 3UJIL 1NC4D 4AQEA 3KLSA 3QDHA 2CG9X 1WZMA 3VFTB 1KUMA 3TA3D 3MZGB 3GNML 1MNUH 3OKOB 3OC8A 2R15A 4LCUB 4DIXA 2HPOA 1ZEAH 3ZDYB 2VZ3A 4YHML 1ONQB 1TCRA 3G6DL 3LXCA 3KDMB 2P5ED 3HMWH 4CMMA 4DP9X 1A6ZB 2J25A 3F58L 3Q8BA 2Z64C 3FT0A 4G5ZL 4MMXB 3DKHA 1OOAA 1Q1PA 1PZDA 3H55A 4AVIA 4JFED 2X4OB 4JJ5B 3VFSB 3T3MF 1FHGA 2QSCH 4FXGA 2KMWA 4LVHB 4LSDA 3S5LA 4UT9L 4WAFA 2LGNA 5EF1A 1J10A 5CMAB 3BSHA 3C5ZC 4PMEA 3RQ3A 1SDYA 3QG6B 4G11A 4YPGA 3BH9B 4G6ML 5HVFB 1UM4L 2PO6B 4QRAA 4PJAA 2WQVA 1IL1A 5FGRA 3N42B 3PWPB 5E5MB 4ODTL 5EA0H 5HHPA 4M1GL 4R5XA 2DL2A 1GZQA 4Q14A 4N20A 4RA3A 5EZOH 2FLMA 3FU7A 3L9BA 3SYQA 4AXWB 1VADB 3SD5A 1IT9L 3G04A 1VERA 4QO1A 3CSYA 3BVXA 4N8VB 1S5IH 2UVFA 3CQPA 4RISH 1AXTL 1NGZB 3BRGC 4WU7B 3D0VA 3LS4L 5D7JD 4KDVA 3PGFH 3GMQA 1NIEA 3CUPB 1ZGLB 2AZUA 4L5FH 1KN2H 3S5YA 1YEWA 4L4JA 3V52H 3EJZD 2VLLA 1IM9D 4HBCL 5GS0L 1TJMA 1TQCC 5EFIB 3EH1A 4NRXB 2XVGA 2Y06H 2PXYC 3MR9B 3BP4A 4JJHA 3WFDL 4Q74A 2AJVH 2R29L 1I1AB 2DQTL 4OVUA 5JIQA 1EFXA 2CKNA 1U2CA 1UZ8A 2BM3A 2EKJA 2OMBA 2FBOJ 2ZCLH 4K7FA 5IHUH 2Y9RT 2P5WE 2XXCB 4KWUA 2OXGA 5DC0A 1SPDA 1VSCA 5GGRY 1V55B 1NOLA 1IAOB 2F53E 1A9EB 3UX9B 1T0MA 1Q72H 3ARTA 4JW3A 5D7LA 4HPHA 2VDRH 1EUUA 3RL1B 5HYSB 2VR7A 5I0VA 4C56A 1U8HB 2B0SL 2RCSL 5C71A 3N43B 4K7PH 3CFCH 1MJ7L 1QFPA 3S7GA 3K7UA 3ZE1B 1CDIA 3DSNB 3HUJF 3VDCA 3FCTB 3IWUA 2GK0B 5L2KB 3MLXL 3QUXA 1A66A 5AAWA 3VO0A 4FQJL 3ALWA 4AUUA 3ARGD 3DYPA 3S37H 3WFHA 3VXTA 4Y4KC 2KZ1B 1YHPA 4KRMB 3RGVB 3W57A 4R7LA 4EIBA 1AO7E 3PWLA 4AQ8A 2NY5L 4WKZB 3WXVL 4QHLA 5F0JB 4TNGA 5AW9B 2FQDA 3HNVH 5AW5B 5AYUL 3OPUA 3EOAA 2AEIT 3R7QA 2C9UA 4JQXC 5B1AB 2ZT9C 1KN4H 4XHJC 5IB4A 1KCKA 5C0GA 4JO2H 1OPOA 2O5ZL 4ZX6A 3OLGA 2OZNA 4L1DA 1B4TA 3G5VA 3C5ZD 4RGNE 1M2VA 3H9SA 2AGJH 1ZRUA 4K2UH 2J88H 3L17A 3ENEA 5GGVL 3MROB 5ICUA 4Q52A 5DSCA 3GGWB 4DN4L 1ZIBA 2BOLA 3FT2A 3KGTA 2OMWB 4Y4FC 3VW3H 1MPAL 3C6EA 2MHAA 2J2ZB 1DJZA 4X5XB 3K6DA 4LDCA 1O7DC 4EDXA 4ZTEA 5C07B 3PLYA 3GSXB 5K9JL 5IVXA 3TXAA 3AFLA 3HS0A 3QAZC 1A02N 3MA9L 3MRNA 2CHXA 2FBJL 4IK6A 1AJ7L 2KH2B 3GJEB 4MDJA 1U30A 2C1OB 4HOMA 2WXKA 4FC3E 4O58L 1S7VA 2BNQB 4RGOH 5EEVA 4AKQA 5DR5H 5J89A 4QPEA 2PXYD 4IMLB 3PREA 3TYGH 4G6JH 5E8EA 3LEXB 3QI9B 3BPCA 4FFZL 3T1WA 5DMYA 4JFDA 4JHVA 1WIUA 2XWJB 2HJKA 3KYKH 4WZ9A 5HGDA 5HHVL 4G42A 4JFTA 4N2FA 4ZUUA 4NN6C 2KUTA 3HJEA 5EDSA 1J48A 2EEBA 4D8OA 1AZNA 3BT0A 4OFYA 1TZAA 3UG5A 5KJRL 4OCWH 3KS0J 2Y24A 4WFGE 1X5KA 2ERJB 4FA6A 3ZKSD 1FZKA 4QAWA 4CDHA 1TJHL 1U42A 1SJXA 2J1YA 4KKZA 1NMCB 1IRAY 5KUMA 4Z7NE 5AB0A 4OJEH 2OSYA 2ROYA 3BZDA 3NIDB 5K9KB 2Q8BH 1CI5A 3A21A 3DYOA 4IRJC 1EXUA 4ISVB 4PJ5E 4DGYL 4QRPE 5J6GB 2E7LC 3PWJA 4JRXD 3SSGA 3X12B 5I8KH 4Y4KD 3BMVA 4I18C 1M9SA 4B60A 2XWDA 3QEHA 2MOVA 3R18A 3U25A 5K33A 1RUMH 2WWKT 4WK2B 5CKGA 4WUUD 4F93B 4GFTB 3ZMNA 1VFAB 3AC0A 3LSOA 3QPXH 4FLRA 3WIFA 4LE8A 1I1CA 1RHHB 4E42A 2XG5A 5DHEA 4XHJD 1BAGA 4W9EC 2B16A 3CC1A 1TMQA 5FGBA 3U6RA 2W9LA 3ILEA 2F1BA 3CCHB 3OR7A 1TKWA 3UC0L 1G1CA 5F7FA 2PR4H 3ILQC 1G9NC 2HG5B 3QEGL 4LLWA 2E6PA 3D39D 3FMGH 4YAQB 1XR8B 2CBOA 4DEUA 4QXUL 2R4RL 3IDJA 4ETQA 4YSEA 2FAUA 2JKNA 3IFNH 1JZ4A 4BZ1H 2VLRD 1BVKA 1RZQA 2X1WL 3IFPB 4Y4FD 5I8CB 1IEHA 5FDYA 2Y7LA 4L29B 1HHHA 4NC0B 1X5GA 2YA1A 3FU3A 1OK8A 1J8HD 4OJAA 2R0KL 5AOLA 2NY6B 1HI6B 3MKGA 4HK3J 4PJBB 3PV7A 4LVOC 4X98B 3CGTA 4WTZG 3HE6A 5TF1L 5I5IA 1BXAA 3IKCA 3S36X 3V7AE 2PP8A 5I6OA 4OLXH 5DUBB 3C6LA 1P4IL 3CN2A 4FQXB 1CFTB 2ZX8A 2C1PB 3M7OA 5FOBB 4X99B 4WW2A 1PIGA 3Q5YA 1Z9SB 2BS9A 2K9FB 3MAWA 3FXIC 1UB6B 2HP4A 4NZRH 4RFEA 3QJFB 5F7WC 5EEWA 1BBJA 2B39A 5EU6B 3KJ6L 1WBXA 4OLZH 5JDJA 1G1KA 1EJ6A 5CEYA 4K71B 5H37A 2ZSWB 1KFAH 5SWQA 1A8ZA 2GC4C 2YFNA 3FO0L 3WNOA 1H6EA 4JZOB 4HWEH 1IM3D 3ZYIA 4UTAA 5D7EA 4HIPA 4QJ3B 2W1NA 4YDKL 1H9VA 1S9XB 5D1XB 2K6YA 5LDSA 1OWRM 3QDJD 1JZ7A 2YD9A 1Q9LA 4YFDB 4WWNA 4A2HA 1KTLA 2DLTA 1OARL 5FWRA 5JW4Q 4K15A 4IRJD 1I9JL 3VJ6A 3WEXB 2GCYB 2KPNA 3PUCA 3BIAX 1GC1C 4MKTA 4F5CA 4O9HL 4ZS6C 4K3EL 1GJUA 1EXGA 2BXYA 3TT3H 5IFJA 2HVJB 3P0YH 3NP4A 3A4DA 3NCXA 3S8WA 3KL3A 1BZQK 4NHCH 3HZYA 3O3BA 2V37A 2VXSL 3DVNA 2E7DA 3V4VB 1A7NH 4N90D 4O02A 2X42A 1F1DA 3JTTB 4ANXA 1IJ9A 5FC9A 1E8XA 5FB8A 3CPLA 2P44B 3EGDA 1MLCA 4YLBA 2DWEA 2CLZB 2EXSA 3WE1A 2EDTA 5DJAA 1UC6A 2F1AA 4PVMA 4XMKL 1TZIB 2RA1A 4HZ1A 3CXFA 4Q56A 5I1GL 4PJEF 4Y9BA 2E9IA 4IIQA 1NFDE 1BAFH 1WFJA 3ILQD 3MBEA 3O3UN 1R33A 4HCIA 1SBSH 4YBLB 5GIRA 5F7UA 1E7VA 2FEDC 4QJ4B 5AL8A 1S7QB 2CHZA 5KYYB 4IK7A 1O9WA 4MLSA 4POYA 3DV6A 3OXSA 1V3MA 4OM1L 3RNKB 1IO4C 1HQRB 3VX0A 3P4OB 4DN3H 1HH6A 5D2NA 4WTQA 5G4OA 4NQXA 3NZSA 2D3LA 2I60H 3GKWH 5AALA 3TPUA 3WNIA 4WI3A 2YAEA 2Q0ZX 3IBOA 5E56A 4ZO6A 3RWEB 4AJWA 1TCMA 3HI6L 5I1AA 3DJ9A 4ODVH 2XQYK 4FTVE 4JY6A 4OCYH 3SBWC 4HJJL 4XN5A 4S1RL 1BOGA 2NW2B 5AOMA 4ERSH 4RNRB 5KVDL 2DWYA 2WLKA 2CK0L 4PJFF 1GGIL 2NY0B 2FYYB 4HCFA 1OGTA 2WNGA 2V7NA 3AB0C 4P06A 1OB1A 5C0JA 1S3RA 3N40F 2WBJD 3H54A 4DP6X 2MQ0A 3B43A 2JKWA 1F11B 4KI5F 4NQED 2IQAA 2ED8A 2IGTA 4UQEA 1KJMA 1XV8A 1ZOXA 1UWGH 3EDKA 4LB8A 3QEQE 4FG2A 5JLZB 1YDPB 1BZ9B 4Z78A 2C9XA 1BJMA 3QXDA 1LP9F 5JW4R 3SKOA 1C1EH 2YA2A 5T1MA 3VG9C 5C6WH 2W60A 1M9WA 1XMWA 4J6IA 3CV5A 3H2WA 4OLEA 5HJ3A 1BQRA 4KTDH 1D5ZA 4PY8I 4XE5B 3ZU8A 3DROB 1IBHA 3WEMA 1MCCA 5E8PB 3WS6C 4U3XA 4MB5A 3CSFA 3SGKC 1ZLVH 3QEUA 4XR8C 4IGBA 2I9LB 2ZPKL 4ZS6D 5AVTB 4B9GA 5I0DA 4YH6A 4M62H 3IJSA 1ECYA 2VR4A 3ULUE 4ADJA 2BERA 4L18A 4YSUA 2ADFL 2AK4E 1AD0A 1Q9WA 3TN0B 4XX1E 5EBLB 4X4MA 1BZ7B 4MJ4A 4RESB 5HVWA 5CP7B 4G8GA 4QUOA 1HEZB 2WQXA 3ASOB 3FL7A 5F1OB 2C9QA 4OCSH 1BQHB 4MNGB 4WJ5A 4N0YH 1MFEH 4Z18A 1FH2A 4FMFA 2H4EA 3NN8B 3HMXA 4MAZA 2NY3C 4WY7L 3CX2A 4DZBB 5L7XL 1E7UA 3FB8A 1N0LB 1R24B 5CSGA 4DFIA 1X5LA 3FU5A 1NFAA 3HKZA 4MYPA 5T3XD 1FBIL 3WN6A 3B7UX 2L7UA 2FEDD 3M45A 4IBYA 3KVPA 3QS2A 2BX5A 3FO1A 5D4QA 3BKML 4UAHA 1HOCA 3DRTA 4FXLA 4Q6IB 3UCRA 5I8EA 4QYOA 4FCAA 1ZT7B 3T1FB 5C92A 1RU9H 3ROOB 3TBSB 1QOKA 3NJFA 4PRPA 4WDIA 3ULVC 4WO4C 1UYWL 2YRLA 3D50A 1DVZA 4CC1A 3FT4A 5TK4A 2P24B 1KXHA 1KT2A 1TQVA 2CDEA 4QF1A 5EULV 4KTGA 1Q9OB 3NFPB 4ADIA 5BRZD 2BIHA 1I7TA 1J5OH 4AT6A 3A5VA 1GMEA 1ZA6A 2JKRM 3QJVB 4MZ2A 1GJWA 2CDFA 5ALBH 5L4FA 5KN5B 1CICC 1JNHB 4MB1A 1JPSH 4WUKH 3PPEA 3MRIA 1B0RA 3ZN6A 2H9GB 3MXVH 1C08A 4ZSOE 5DZJA 2QL1A 1VFUA 3BX7C 1QD0A 5E8OB 3T04D 5C0IB 3KGSA 1CTNA 3PABB 3ZR5A 1G9EA 3CC5A 1DBKL 4U7MA 4XN2A 4L3EE 1MCOH 3C8DA 5HY9A 1CCZA 1C16B 3G6JB 5AB2A 1AAJA 1S9WA 2Z8RA 4LSVL 1ZMYA 5HHMB 2VL5A 3B2VH 3TV8A 1YNKH 4HUXA 3ES6B 1AGBA 4HDIB 3PGDA 3PPSA 1UH4A 4UM9B 2XFGB 1R5IB 2O5NA 3PL6D 4M93B 3E8VA 3D7PA