4BDOA

Crystal structure of the gluk2 k531a-t779g lbd dimer in complex with kainate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
250
structure length
242
Chain Sequence
RSLIVTTILEEPYVLFKKLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSAPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKIGIAILQLQEEGKLHMMKEKWWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Correlating Efficacy and Desensitization with Gluk2 Ligand-Binding Domain Movements.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal transport
molecule keywords GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
total genus 77
structure length 242
sequence length 250
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4bdoA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4bdoA02
2UVIA 2Z23A 4Q0CA 1B9JA 2RC9A 5AA4A 3CRBA 5ICQA 3OMBA 1FTJA 4YB5A 2F36A 1B1HA 3RTFB 4F3BA 4KCDA 4POWA 5H8HB 5I84A 1I69A 1NFTA 1Y1MA 1DTGA 2I3WA 4KYEA 5LOMA 4FORA 1HSLA 2NVUB 3CSGA 1MXUA 3UN6A 5KDTA 4MLQA 2QS4A 5DEXB 3SEXA 1QULA 4JSDA 5J1DA 4GF8A 4ZS9A 3S9NC 4DCYA 4JB7A 4R73A 3WAFA 4KFQA 1YCJA 4EF2A 4F39A 4AB5A 4LUBA 4IO6A 1MQDA 1N3WA 3MP8A 5IAIA 3OENA 1I6QA 3IOTA 4OZ9A 3Q25A 1B4HA 3S9EA 3TTKA 1OVTA 1JVXA 4BDMA 1F9BA 2E1SA 3O29A 1B51A 4GL8A 4DXUA 1AL3A 3K1MA 2I58A 3FVNA 1EZ9A 1Y4TA 3SKPA 1P99A 4RY1A 3TCFA 2DE3A 2XD2A 2OZZA 3OELA 3FXUA 2CMOA 2QSXA 1IXCA 1CE2A 3C4MA 1NH7A 3MVYA 3ZKKA 2BJJX 1SDXA 1XVXA 3D4GA 3HN0A 3OO7A 1B7ZA 1IIWA 2GHBA 3H03A 4P0GA 4OFOA 4F18A 5CBSA 3ZKLA 5H8NA 4F22A 3KJTA 4H6DA 1BKAA 3SERA 3BBRA 1R9LA 1DPEA 2XXHA 1IXIA 1MDQA 2W7YA 1H76A 3HO7A 1GVCA 2HAVA 1ZBMA 3TODA 4GD5A 2PBWA 3T22A 1H43A 5CMKA 1MRPA 4TLMB 3CVGA 3IOVA 2D21A 2RC8A 5TP9A 1H45A 1HSEA 2QMXA 3LUYA 3MAMA 5F1QA 3V89B 1Y3PA 1ELJA 4F19A 1Q35A 5TU0A 3C32A 3FVOA 3LSLA 1MPDA 5ICTA 4BDNA 2FA7A 4LONB 1MY4A 3PUXE 3FJMA 4O3AA 4ZEDA 1O7TA 1SD3A 5BWJA 1EZOA 2HEUA 1WVJA 1P1WA 1RKMA 3PMVA 2O6AA 1UTHA 2PYYA 1B3EA 3B6QA 3VLWA 3IO6A 1LFHA 1YTVA 2VD2A 2XXRA 3CFLA 4QSCA 4EQBA 4M1VA 5I59A 4THIA 3IORA 3CG1A 4H65A 2Q8JA 1B5IA 4I9DA 3C9HA 5AE4A 2F6PA 3FV1A 4H8IA 4R2FA 4EF1A 2AL4A 4QFKA 4OQOA 3E4RA 4ZDMA 1FCKA 4LP2B 1Q1KA 3UP9A 2O68A 1LB9A 2V3UA 3CR9A 3MPKA 2REJA 4GXAA 4M4GA 5FHOA 1MY1A 4G4PA 4OWDA 4DIGA 2LAOA 1FQCA 1OQHA 4F31B 2XX8A 1LAHE 2I3VA 4R2BA 3IJXB 3TTLA 1B2HA 2KLFA 3KFMA 4IB2A 3RTWB 4ZE9A 3IJOB 3HHFA 1UTHB 3TUSA 3QUJA 1VE4A 4NEDA 3K02A 2O84X 1HSJA 3GBAA 4HTGA 3RQTA 3U94A 1N04A 1XS5A 4H8JA 3TQLA 4JBZA 5AA2D 1IEJA 3EHSA 3GXAA 1UTBB 4RXLA 1GR2A 4DDDA 5I2KA 1MQJA 3RT8A 3PUZE 3USDA 3K2DA 4EQ7A 3UORA 1B3GA 3LSFB 3HHGA 1MXXA 4OFJA 4XIGQ 5HM4B 3S9MC 1LCTA 1PBQA 4BLAA 3KEIA 4JWYA 2P0SA 1UIVA 4DLDA 4YMAA 2I4CA 2DSFA 3PV0E 3DP8A 3ZS6A 2AYSA 3PPRA 3TEPA 1H44A 3T9VA 4HCYA 5TP9B 3G3HA 3OEMA 4K3FA 2XX7A 3VE1B 3PGFA 1NNKA 3MP1A 3H6UA 4FEBA 1Y1ZA 1A40A 3O66A 4GOTA 2HCAA 5M2VA 3N94A 1MY0A 4GL0A 5TPAA 3KOSA 2I0CA 3R7XA 5AA3A 4P0IA 3T93B 3FV2A 1N76A 2DE2A 3QYTA 1D9VA 3K6UA 1NNPA 2NUVA 5H8FA 1UIUA 1RYOA 4PETA 4U4SA 1CB6A 3PUYE 3T66A 4OYVA 4NF8B 5A5XA 1FTLA 1SVXB 2R9JA 2ZXTA 3B6TA 3IK6B 4BDQA 3OXNA 4GRKA 2H9BA 4X9TA 1A7LA 3K1NA 4BDOA 4OXVA 4ELOA 1B4ZA 4WEPA 3SESA 3P7IA 3MVXA 2XXYA 2I4BA 2YLNA 4NF5B 1BLFA 2HAUA 3FZVA 4PFUA 3CIJA 4I1DA 4R74A 4XKPA 5FHNA 3S2VA 3SEVA 5AA2B 5CM6A 3C35A 2Z8FA 3PMWA 5KCJA 3MP6A 4AB6A 1PB9A 1LAFE 4ZZAA 4PP0A 4TLLB 3OD7A 3G3KA 4DXBA 1FW0A 1URGA 3QK6A 3GBBA 2OCUA 1EZPA 1SW5A 2O7IA 4ZEBA 3VVEA 4MBPA 1N7WA 2Q88A 4IY6A 3FATA 2Q9TA 4EDPA 4ELPA 2Y84A 4TQUQ 3PPPA 3U72A 2P2AA 2DWAA 1GGGA 3EPEA 3OSQA 2I49A 3B6WA 1MM7A 3C33A 4EXKA 1MY2A 4F3PA 4LZ7A 4YMBA 3QSLA 4Z7EA 4U22A 4Q5TA 4ND9A 2ONKE 1Z7ME 1Y3NA 1I6AA 1ANFA 3VFJA 3CFZA 4RPOA 2F7CA 2ALUA 4G77A 1DMBA 4QF9A 5H8QA 4GIZA 4IO2A 3V8XB 2GHAA 2OWSA 4R6HA 1QKAA 2PMSA 3KSXA 1MS7A 3DM0A 2HQ0A 5L8DA 3W9WA 4RA1A 3VVDA 4G68B 5ELVA 3VXCA 1YPNA 5HPQA 2Z8EA 3A09A 3IX1A 5H8FB 4QSEA 5ISUA 5CMBA 1O64A 3K0VA 4G68C 4NF4A 4QFNA 4EUOA 4UACA 2F78A 2ZNTA 2RF1A 3Q28A 3RT6B 4HW8A 4DZ1A 4YB6A 1OQGA 5ITPA 1IXGA 3VXBA 3FJ7A 2Q2AA 3O97A 4YICA 5KDTB 3CSBA 4IO3A 4NWDA 3THIA 3FGSA 2XXTA 1NH8A 1WDNA 4FEDA 3QIMA 5FTHA 5H8QB 3H4ZA 3U93A 4IO7A 4QSDA 4FIMA 5AA2A 4FAJA 1XOCA 1B3LA 1QVSA 4ESWA 2D5WA 3O9PA 1ZMGA 2YJPA 4KPTA 4OMBA 4RPNA 3ILUB 2O1MA 1GTKA 3MZ9A 3O6GA 1MXZA 4LA9A 2Y7PA 4GLIA 1N0TA 2UVJA 3IAZA 3M3FA 4MH5A 3VDFA 2G93A 2GRVA 2ONRA 4F1UA 1A99A 2DXRA 2RC7A 2AL5A 2RINA 2V84A 3FD3A 1FTOA 1PEBA 3MPLA 4IGTA 4XTCQ 1FQAA 2O51A 3MJNA 3EN3A 3HSTA 3OO8A 4GXSB 2B65A 2ONSA 3FIRA 4KYSA 2DE4A 4RK9A 4TOZA 5EYFA 3KBRA 4BDRA 1P1UA 1B0HA 2PX1A 3KN7A 4X48A 3OO6A 4H1XA 1OLCA 4Q8RA 1MQIA 2WKYA 3DLNA 4IY5A 2QS2A 2A5SA 3IOWA 1JNFA 1NKXA 1B3HA 3RLFE 3W9VA 1PB7A 2UVGA 1IITA 3T9XB 3CG3A 1US4A 4H0WA 5I57A 3KSJA 1FQEA 3L6HA 1POTA 4NF4B 3G7WA 4KD5A 5H8NB 3MWBA 1B32A 2XXUA 3K4UA 3TQWA 5I2NB 1B58A 1S7YA 1N84A 1MDP1 1USYE 3G3IA 3MQ9A 4EXLA 2HZLA 4F2OA 3M3LA 3M8UA 4O3CA 4ZEKA 3H6TA 2YPNA 4HS7A 3CI8A 1B3FA 1P1OA 4OETA 3PUVE 1NNFA 1USYH 1VR5A 2D3IA 4OFLA 4AQ4A 3T9HB 2UVHA 4QFPA 4C0RA 3GLBA 4E0XA 4I62A 1R1NA 4WEDA 3O2AA 1XC1A 3BFTA 3Q27A 3PPNA 1B0LA 1LAGE 3QAXA 4YKJA 1Y4CA 3B7DA 3V5AA 2XXQA 1URSA 2NWJA 1TFAA 2IA4A 4KYDA 4XXUA 4FJPA 5I58B 1Z7NE 5JEIA 1JW4A 3H6WA 1XT8A 4QFOA 3WAEA 4QHQA 1R6ZA 4IO5A 5DTBA 4YKKA 3RGYA 1JVYA 5DVIA 3RNNA 2RCAA 2FYIA 3KN8A 3GZGA 5DT6A 3LSXA 1B1XA 1T0KA 4XKNA 3LR1A 4G68A 4POXA 4F3SA 3R6UA 4JDFA 4X1BA 2DOJA 4R9FA 4R75A 2I6EA 1MH4A 3A3CA 1BTJA 1B5HA 4G2ZA 3PPOA 5DYHA 3IL1B 4WXJA 2QPQA 4JSOA 2NOOA 4E0WA 2H98A 3W15C 4NMYA 4QRZA 1P1QA 1UTBA 1IQ7A 2F97A 4ESXA 3FUZA 3JZJA 3ILTB 3SEUA 4MLVA 5B70A 3V83A 1B7HA 1SI0A 2NXOA 3OO9A 3TZAA 3IR1A 4F3GA 2Y7RA 1N3XA 3H7MA 1YAEA 3MBPA 4KI0E 2QJEA 4R6YA 4YAHX 5CRYA 3TPAA 4LVQA 3TAJA 1MH3A 4U2RA 3KJ7A 1FQDA 1URDA 3OEKA 1VFEA 4ZECA 3TYHA 2O69A 3IB0A 3MC2A 2OJTA 3E13X 2DWIA 1JEUA 3K6WA 5DEXA 5ITOA 3TTRA 2V3TA 1ATGA 2ANJA 5IKBA 3TDJA 2VOZA 1A8EA 3OOAA 3PMXA 4OVJA 1QKBA 2DWJA 3LC8A 5H8SA 1Y9UA 2DYXA 1JW1A 3D4CA 3EF7A 4NE4A 4F1VA 2ZYOA 1FTKA 2IEEA 5EHSA 1MY3A 3MZ1A 4I8CA 4DCXA 5CC2A 4O3BA 1LB8A 3K1PA 3DELB 3MZBA 2P1SA 5I56A 4ZEFA 4ISUA 1P1NA 1UQWA 4P11A 1NNTA 4ONYA 3UK4A 2A5TA 1QUIA 3N6UA 1POY1 4C1UA 3UGWA 2B3BA 3Q26A 1D9YA 1PDAA 1SBPA 3FASA 1M5BA 4PE5B 4PFWA 1JEVA 4GVOA 2PT1A 2R71A 3K6XA 1AOVA 4XKRA 2XHDA 4N6PA 4RK2A 4OENA 1LAXA 1QUJA 1OIBA 2H4IA 4MFIA 4PFYA 5JTYB 5A5XB 4H5GA 3HPIA 3ODBA 1FTMA 1MG1A 1ZJLA 3IB2A 3E9XA 3MW0A 5F7VA 3T9UA 2REGA 1DOTA 2H25A 3E3KA 1S9TA 1B46A 1LCFA 4R72A 2THIA 2DQVA 4LZ5A 4G8NA 1LGBC 1FQBA 2GFEA 3SEYA 4F1YA 4ZEIA 5KCJB 2UXAA 1VSOA 5L9SA 5KZTA 1SYHA 3PPQA 4ELQA 1LBCA 3KOTA 1A8FA 3FVGA 1ZLQA 2I48A 3C36A 4OEVA 1B6HA 3PD9A 2X7QA 1II5A 3EQ1A 4N13A 3VVFA 3ECRA 1BIYA 3N5LA 3RY3A 2H5YA 3Q29A 4R6KA 1SW2A 3U92A 2V93A 3PD8A 4NF5A 4U21A 2XXIA 3TMGA 1DSNA 1OVBA 3AXFA 2PVUA 1NL5A 1GV8A 4ELRA 1SW4A 3TFLA 3A3UA 3N26A 4U1OA 3BKIB 4H5FA 1M5FA 3TCHA 3IO4A 4KCCA 4F2QA 1LBBA 2A5TB 3DP6A 4C1TA 4QFLA 4NF6A 4JWOA 2ZNUA 3G3FA 2HZKA 5FHMA 4ZE8A 1WODA 4KHZE 1D4NA 1ZU0A 4YB7A 1TT1A 4NTLA 4YKIA 1N7XA 3VLUA 2XXVA 4DXCA 1S50A 1KWHA 2ESNA 1MXVA 2PT2A 3M3KA 1XHYA 4FE8A 4UA8A 4PQJA 2F7BA 1MQGA 1IUDA 1ZIUA 2ZYKA 3FJGA 4OEUA 3UIFA 1JETA 2F34A 3K00A 3SDFA 3TCGA 5CBRA 5L9OA 4R9GA 1L5TA 2XXXA 2F5XA 5DVJA 4DE8A 3C31A 2G29A 5EHMA 1MPBA 5AA4B 4Q30B 1QJMA 2Y7WA 3G3GA 5CI5A 5JTYA 5I59B 2UYFA 1QW0A 1A54A 1M5CA 1A55A 4HCWA 4LQ5A 4OTEA 5DVFA 5I2KB 2R6GE 3TELA 3TKDA 3QXMA 2CZLA 3LBSA 3ZSFA 1BP5A 1OMPA 2F35A 1EU8A 3CFXA 3KZGA 4KR5A 5BUUA 4KQPA 3S9LC 4F29A 2I0BA 4BDLA 1ZKBA 1B52A 1EH3A 2XXWA 2DVZA 1R9QA 4LQ2A 5L9MA 4ZZEA 3SEWA 4ECFA 3IOUA 5AA1A 2HXWA 2VP1A 4FATA 2E0SA 5I2NA 5K2YA 1D3KA 1DPPA 4FECA 5CMCA 3UA8A 2V3QA 2QS3A 2M8CA 3H6VA 1B40A 3PUWE 4EQ9A 5I57B 2RKMA 1B5JA 3MVWA 2FNCA 2DP8A 1IXHA 1TXFA 2X7PA 1Y20A 1B05A 1M5EA 2QL3A 1VFDA 1MXYA 2XD3A 2Q89A 1SYIA 3O28A 3R26A 4NWCA 1O63A 1RYXA 1AH5A 1XVYA 3OSRA 3SETA 1AIVA 3H3GA 1I6BA 4RNSA 1H3DA 5TPAB 4JWXA 1SW1A 2X26A 5CMMA 4G8HA 3PU5A 1ZTYA 3H06B 5H8HA 1LLSA 1PC3A 3S4UA 1NMUA 3IB1A 2ABHA 2O1LA 2Y7KA 3HCQA 4YKPA 1AMFA 3FVKA 2F8DA 3LSWA 4NF8A 2XX9A 4Z0IA 1MXWA 3C34A 2DXYA 3JV9A 1LFIA 2DS9A 3O6IA 4IO4A 1M5DA 1TFDA 4N07A 4OHNA 4WKMA 3VV5A 4L17A 1PBPA 1US5A 2OBGA 3EHUA 2HFBA 3I3VA 5B7DA 4PFTA 2AIXA 1LSTA 2B3FA 3ONMA 4RYAA 3U8QA 3HV1A 1PB8A 1Y3QA 2H99A 2VGQA 3I5OA 2Z8DA 4OESA 4X1DA 3MUQA 3RUMA 3K01A 4OERA 3TTNA 2OK2A 2Q2CA 3KGCA 3KG2A 2VD3A 2ZNSA 1JW5A 3N6TA 2RCBA 2QS1A 2F6GA 2ZYMA 3I6VA 3KN3A 3O6HA 3QUFA 2ZMBA 4NF6B 4RJZA 5FTIA 3JYRA 3U1OA 4GFRA 1TWYA 1QUKA 2ZYNA 1JQFA 1OLAA 1J1NA 2VHAA 3EHTA 4MF3A 4YZZA 1FQFA 4G8MA 4U23A 1LFGA 4U1ZA 2OLBA 3DP4A 1SI1A 3VLVA 2GH9A 2O7UA 2QMWA 3G3JA 3L6GA 3MVZA 4GWOA 4YU0A 5I58A 3RN8A 2XXPA 2DVCA 4JXIA 4LATA 2DWHA 3K6VA 3T96B 3RPWA 5K2XA 3FXQA 2F7AA 4LZ8A 3F11A 1IZ1A 2OWTA 2QRYA 2Y7IA 1DTZA 1MQHA 2Z22A 1SQYA 3BFUA 4IGRA 3TTMA 2V25A 4XKQA 4H67A 5JK4A 4GQOA 5HBCA 1MPCA 2UYEA 1B7UA 1MM6A 5I56B 3FXRA 4U4XA
chains in the Genus database with same CATH superfamily
5AA4A 4PDHA 4YB5A 4F3BA 4POWA 1NFTA 4KYEA 2PCRA 1MXUA 1QULA 4ZS9A 4QXDA 1FPKA 3WAFA 4AB5A 3OENA 1B4HA 1OVTA 1F9BA 3O29A 3KC0A 3TCFA 2XD2A 2OZZA 3FXUA 3MVYA 3HN0A 1IIWA 3H03A 4OFOA 1NV6A 1BKAA 3SERA 3BBRA 1IXIA 3ROJA 4GD5A 2PBWA 2D21A 2RC8A 1HSEA 2QMXA 1Q35A 3C32A 5ICTA 1MPDA 2FA7A 1MY4A 3FJMA 4ZEDA 1SD3A 3PMVA 2O6AA 2XXRA 2HXRA 3FV1A 2AL4A 1K9ZA 4LP2B 2O68A 1LB9A 2V3UA 4GXAA 1IMFA 2QFLA 4M4GA 3LUZA 1NUZA 4DIGA 2LAOA 4P1EA 3TTLA 2KLFA 4I3EA 4ZE9A 3IJOB 1VE4A 1XS5A 5AA2D 4JBZA 3GXAA 1GR2A 3USDA 4O94A 4NQ8A 1FBGA 1FJ9A 1MXXA 3HHGA 3KEIA 2P0SA 4PAIA 3DP8A 3ZS6A 3PPRA 1NUXA 2XX7A 3MP1A 1Y1ZA 1A40A 4P0IA 2DE2A 4GWZA 5IZ3A 1RYOA 4PETA 3PUYE 1FTLA 4X9TA 4WEPA 1RDYA 3SESA 2Y5LA 3P7IA 2I4BA 2HAUA 3CIJA 4I1DA 5CM6A 2Z8FA 3PMWA 1PB9A 3QK6A 1EZPA 4P56A 2Q9TA 3D1RA 4KXPA 4LZ7A 4YMBA 2ONKE 1Y3NA 1ANFA 4RPOA 2ALUA 2OWZA 4GIZA 3V8XB 2OWSA 1QKAA 3KSXA 3DM0A 2WBDA 5L8DA 3W9WA 3VXCA 2Z8EA 5ISUA 4MMPA 1O64A 4G68C 4NF4A 4PBQA 4HW8A 4DZ1A 3FJ7A 2Q2AA 5KDTB 2KQZA 3QIMA 5H8QB 3H4ZA 5IM2A 3MYUA 4QSDA 1B3LA 1QVSA 4ESWA 2D5WA 4KPTA 1ZMGA 4HE1A 3MZ9A 4LA9A 2Y7PA 4GLIA 1N0TA 3IAZA 2VT5A 2G93A 4PFRA 2RC7A 2RINA 2V84A 3MPLA 4DI3D 3MJNA 4TOZA 4NG7A 2PX1A 3KN7A 3IOWA 3RLFE 1NKXA 2UVGA 1IITA 3CG3A 4NF4B 3G7WA 1B32A 2P3VA 2XXUA 3K4UA 4HE0A 5I2NB 1N84A 1MDP1 2HZLA 3CI8A 4OETA 1NNFA 2D3IA 3GLBA 3BIHA 3O2AA 5EQ9A 2Q8MA 1D9QA 1URSA 4KYDA 4XXUA 4P8BA 3H6WA 5EQAA 3T1BA 4IO5A 3RGYA 2RCAA 5DT6A 4XKNA 3R6UA 4JDFA 4X1BA 2DOJA 4R75A 3PPOA 2QPQA 2NOOA 1P1QA 3ILTB 3V83A 2NXOA 1MH3A 1FQDA 5L9SA 3IB0A 2OJTA 3E13X 2DWIA 5IKBA 3PMXA 3FXBA 1FBDA 1Y9UA 3EF7A 3D4CA 2ZYOA 1FTKA 5EHSA 1MY3A 4G61A 4O3BA 1LB8A 2P1SA 4ZEFA 4MNIA 4P11A 1FBFA 4XEQA 1M5BA 2XHDA 4RK2A 4OENA 1KA1A 4MFIA 4H5GA 1IMAA 2DQVA 5ET8A 4G8NA 4ZEIA 3PPQA 4ELQA 1LBCA 3KOTA 3FVGA 4NHBA 4P47A 3N5LA 2H5YA 3U92A 4U21A 3TMGA 1RDXA 3AXFA 3TFLA 3A3UA 3N26A 1M5FA 3IO4A 1LBBA 5I5PA 4NF6A 4JWOA 4O8MA 5DW8A 4KHZE 4YB7A 1TT1A 4NTLA 4YKIA 4DXCA 1NV4A 1KWHA 4PQJA 2F7BA 1IUDA 2ZYKA 1JETA 3K00A 1L5TA 4DE8A 1MPBA 2Y7WA 2UYFA 5DVFA 2CZHA 2CZLA 2CEXA 1BP5A 1OMPA 4KR5A 2XXWA 1R9QA 4LQ2A 3SEWA 3IOUA 2HXWA 2VP1A 2E0SA 5CMCA 3UA8A 5I57B 2FNCA 1FBHA 1TXFA 2X7PA 1M5EA 1VFDA 2Q89A 1SYIA 3OSRA 1SW1A 2X26A 3PU5A 1ZTYA 2O1LA 4GBVA 2Y7KA 2PFYA 4YKPA 4NF8A 3JV9A 1LFIA 1DK4A 1M5DA 1PBPA 5B7DA 2AIXA 3ONMA 3U8QA 2H99A 2VGQA 2OK2A 2VD3A 3O6HA 2ZYMA 2F6GA 4N6KA 4YZZA 3MVZA 2QMWA 2FHYA 2XXPA 4LATA 5K2XA 3FXQA 4LZ8A 4GX6A 3TTMA 2Y7IA 3BFUA 1SQYA 2V25A 5JK4A 4H67A 1B7UA 3FXRA 4U4XA 2Z23A 1B9JA 4N6DA 5I84A 1I69A 1DTGA 1NUWA 5LOMA 5I7IA 3CSGA 3UN6A 5KDTA 4MLQA 2QS4A 5DEXB 3SEXA 5J1DA 4GF8A 3S9NC 5J16A 4DCYA 4JB7A 2CZKA 4KFQA 4F39A 3B8BA 4IO6A 3TTKA 2GQ1A 4DXUA 2I58A 3ZKKA 4F18A 1B7ZA 5CBSA 5H8NA 1DPEA 2XXHA 2HAVA 1H43A 3MAMA 5F1QA 3RPLA 3LSLA 3PUXE 1EZOA 1UTHA 2PYYA 1B3EA 3FBPA 2VD2A 3CFLA 5I59A 2XWVA 3CG1A 4H65A 2Q8JA 1B5IA 3C9HA 4QFKA 4NF0A 1Q1KA 5FHOA 1MY1A 4G4PA 1FQCA 1OQHA 4F31B 4R2BA 3IJXB 1B2HA 4NEDA 1HSJA 3U94A 3TQLA 3EHSA 1MQJA 3RT8A 4EQ7A 3UORA 1B3GA 5HM4B 3S9MC 1UIVA 2I4CA 3PV0E 2AYSA 3TEPA 4HCYA 1IMBA 5TPAA 1MY0A 1CNQA 3KBZA 3KOSA 2F3DA 2I0CA 3R7XA 5AA3A 1KZ8A 1N76A 3QYTA 3K6UA 5H8FA 2NUVA 5A5XA 4OYVA 4NF8B 4GWUA 1YYZA 3IK6B 4BDQA 3K1NA 1B4ZA 2YLNA 4R74A 3FZVA 1LBZA 3S2VA 3RPLB 3C35A 1IMEA 5KCJA 4AB6A 1LAFE 4JVIA 4PP0A 4ZZAA 4TLLB 3GBBA 2OCUA 1SW5A 2O7IA 4ZEBA 1N7WA 4EDPA 3PPPA 2DWAA 1GGGA 3OSQA 3C33A 3IFAA 2BJIA 4MJOA 1Z7ME 3CFZA 5H8QA 1MS7A 4G68B 5ELVA 3A09A 4UACA 2ZNTA 2RF1A 3RT6B 1OQGA 3VXBA 3A29A 1WDNA 5FTHA 1K9YA 4IO7A 5AA2A 2O1MA 1GTKA 1FPDA 2JJKA 3M3FA 3VDFA 2GRVA 4LN5A 2AL5A 1PEBA 3GYYA 3EN3A 3KBRA 1OLCA 2QS2A 3W9VA 3T9XB 5I57A 1POTA 5H8NB 1S7YA 3MQ9A 4F2OA 3M8UA 3H6TA 1B3FA 3PUVE 2B4MA 2B4LA 4E0XA 1R1NA 4WEDA 1XC1A 1B0LA 3QAXA 4JVCA 2NWJA 4FJPA 5JEIA 4N15A 1JW4A 2FVZA 4QFOA 3KN8A 1B1XA 3LR1A 4G68A 4POXA 4PFIA 4F3SA 5DYHA 1IQ7A 3JZJA 4F3GA 3TZAA 3IR1A 1N3XA 1YAEA 4YAHX 2QJEA 3TPAA 1FPGA 2P3NA 4LVQA 1URDA 4ZECA 2O69A 5ITOA 3TTRA 3TDJA 2VOZA 1A8EA 4OVJA 2DYXA 1QGXA 3MZ1A 4I8CA 5ET7A 5I56A 4ISUA 1NI9A 4ONYA 1QUIA 1POY1 3Q26A 1D9YA 4RXLA 1SBPA 4GVOA 2PT1A 2R71A 3NOHA 4PGNA 1LAXA 4PFYA 2H4IA 5A5XB 1FTMA 1ZJLA 3IB2A 3MW0A 2REGA 4ELPA 4H46A 4F1YA 1LGBC 1FTAA 4OANA 4N13A 3BIGA 3RY3A 4R6KA 1SW2A 1YXIA 2V93A 1FPLA 4GBWA 1SW4A 3BKIB 1XI6A 4F2QA 2A5TB 4X04A 3DP6A 2HZKA 4ZE8A 1WODA 3VLUA 4FE8A 3LV0A 1XHYA 4UA8A 4MAGA 1ZIUA 3UIFA 2QVRA 5L9OA 2CZIA 4R9GA 2XXXA 2F5XA 5AA4B 3G3GA 5CI5A 5I59B 4OTEA 1NV7A 4HCWA 5I2KB 2R6GE 3LBSA 3S9LC 5I3SA 4F29A 1ZKBA 1B52A 3ISPA 5AA1A 5I2NA 5K2YA 4EQ9A 2M8CA 1B40A 2RKMA 1B5JA 3MVWA 1B05A 3THIA 4NWCA 1MXYA 1IMDA 1FPJA 3O28A 3R26A 1RYXA 1XVYA 1AH5A 4N8GA 5TPAB 4G8HA 1PC3A 3S4UA 2ABHA 3FVKA 2XX9A 1MXWA 4WKMA 1US5A 2OBGA 3EHUA 2HFBA 1LSTA 4RYAA 3HV1A 1Y3QA 4OESA 2Z8DA 4OERA 3TTNA 2Q2CA 1JW5A 2RCBA 4RJZA 3QUFA 4NF6B 3IFCA 3JYRA 1QUKA 2VPOA 1LBXA 1JQFA 2ZYNA 2VHAA 3EHTA 1LFGA 4U1ZA 4YU0A 2O7UA 1JP4A 1LBWA 3RN8A 2OX3A 4IGRA 2OWTA 2QRYA 4GQOA 1MPCA 2UVIA 4Q0CA 5LTCA 3CRBA 3OMBA 1FTJA 2FIEA 5H8HB 2I3WA 1Y1MA 1HSLA 2NVUB 4JSDA 4R73A 1YCJA 3MP8A 4OZ9A 3S9EA 1JVXA 1B51A 4GL8A 4I40A 1AL3A 3K1MA 1EZ9A 1Y4TA 3SKPA 4RY1A 2DE3A 3OELA 2QSXA 1IXCA 1CE2A 3C4MA 2BJJX 1XVXA 3D4GA 4P0GA 2QVVA 1IMCA 4F22A 3KJTA 1EYJA 1MDQA 2W7YA 1H76A 2XWIA 1GVCA 1ZBMA 3T22A 4XF5A 3IOVA 1H45A 3LUYA 1Y3PA 5TU0A 3FVOA 5BWJA 2HEUA 2XWOA 3VLWA 1LFHA 4MX6A 1FBPA 4M1VA 4THIA 3IORA 4I9DA 5AE4A 4H8IA 4EF1A 5IZZA 3E4RA 4N4UA 4ZDMA 3CR9A 2REJA 4OWDA 2XX8A 1LAHE 2I3VA 1G0HA 1UTHB 1DCUA 3K02A 3GBAA 4HTGA 4H8JA 1IEJA 1UTBB 4AS4A 3PUZE 3B50A 1LCTA 1PBQA 4BLAA 4DLDA 3T9VA 3OEMA 4MEVA 4K3FA 4GWSA 3VE1B 3PGFA 1NNKA 3O66A 2HCAA 3N94A 4GL0A 4PF6A 3T93B 3FV2A 1NV2A 1NNPA 4U4SA 5FBPA 1SVXB 3B6TA 3OXNA 4GRKA 2WEFA 4OXVA 4ELOA 4XKPA 3SEVA 4PCDA 5AA2B 1FSAA 2F3BA 2WX9A 4UABA 4MNCA 4IY6A 3FATA 2Y84A 4MNPA 3U72A 3EPEA 3B6WA 1MM7A 1MY2A 3QSLA 4U22A 2F7CA 4G77A 1DMBA 4QF9A 4IO2A 2MKZA 1FPBA 4RA1A 3VVDA 1YPNA 4QSEA 4MHFA 3K0VA 4QFNA 4EUOA 5ITPA 1IXGA 4YICA 4NWDA 3FGSA 2XXTA 5F24A 4N17A 4FIMA 4N81A 4FAJA 1XOCA 3O9PA 4OMBA 3ILUB 4MH5A 2UVJA 4F1UA 2XWKA 1A99A 1FTOA 2HPGA 3HSTA 5EYFA 2B65A 2ONSA 5I58A 1B0HA 4X48A 3OO6A 4H1XA 4Q8RA 1MQIA 4IY5A 2A5SA 1B3HA 1PB7A 4H0WA 1FQEA 4IR8A 4HXVA 3MWBA 2CEYA 1B58A 1USYE 4OVQA 4O3CA 3HFUA 4ZEKA 2YPNA 4PC9A 1LBVA 1VR5A 4QFPA 2V4CA 1NV3A 1FBEA 3PPNA 1LAGE 1Y4CA 3V5AA 2XXQA 1TFAA 5I58B 4HE2A 3WAEA 5DTBA 4YKKA 4PDDA 2I6EA 3A3CA 1BTJA 1B5HA 4G2ZA 4O7IA 4QRZA 2F97A 4ESXA 1FPFA 3SEUA 5B70A 1RDZA 2Y7RA 3H7MA 3MBPA 5IZ3B 4U2RA 3TYHA 5EYGA 2V3TA 2ANJA 5H8SA 3RNNA 3OOAA 4F1VA 2IEEA 4DCXA 3DELB 3MZBA 1P1NA 3N6UA 4O7MA 3UGWA 4PFWA 3K6XA 4XKRA 1QUJA 4NN3A 2XXKA 3HPIA 5ESYA 1MG1A 4X8RA 3E9XA 5F7VA 2VPNA 2THIA 3SEYA 5KZTA 1FJ6A 1A8FA 1ZLQA 4OEVA 3PD9A 3ECRA 4NF5A 4AS5A 2XXIA 4PTKA 1OVBA 2PVUA 1GV8A 4ELRA 4XFEA 4C1TA 1ZU0A 2XXVA 3U65A 1MQGA 3FJGA 5CBRA 3TCGA 5DVJA 3C31A 4Q30B 1QJMA 1QW0A 1A54A 4OA4A 3QXMA 2ZZVA 3ZSFA 2F35A 3CFXA 5BUUA 4BDLA 1EH3A 2DVZA 5ET6A 4ZZEA 4MIJA 4FATA 4GWWA 4GX4A 1D3KA 1FPIA 2V3QA 3PUWE 3KC1A 1IXHA 1Y20A 2QL3A 2XD3A 4R9FA 3SETA 1AIVA 1O63A 3H3GA 1I6BA 4RNSA 5CMMA 3H06B 5H8HA 1YZ0A 1LLSA 1NMUA 3HCQA 1AMFA 3LSWA 2DS9A 4OHNA 3VV5A 1TFDA 4PFTA 2B3FA 1PB8A 4X1DA 3K01A 3KGCA 3KG2A 2ZNSA 3N6TA 3TQWA 3KN3A 3I6VA 5FTIA 2ZMBA 1TWYA 1OLAA 1J1NA 4MF3A 1FQFA 4G8MA 1SI1A 3G3JA 3L6GA 2DVCA 3T96B 3RPWA 2WYPA 3F11A 1IZ1A 3QMFA 1MQHA 5HBCA 5I56B 2RC9A 5ICQA 2F36A 1B1HA 3RTFB 3MSTA 4KCDA 4FORA 4PFBA 4GWYA 4EF2A 4FBPA 4LUBA 1MQDA 1N3WA 5IAIA 1I6QA 3IOTA 3Q25A 4BDMA 2E1SA 5EQ8A 4N91A 3FVNA 4PF8A 1P99A 2CMOA 1NH7A 1SDXA 3OO7A 2GHBA 4JVDA 2HHMA 3ZKLA 4H6DA 2FBPA 1R9LA 3HO7A 3TODA 5CMKA 1MRPA 4TLMB 3CVGA 5TP9A 3V89B 1FPEA 4GX3A 2PFZA 1ELJA 4F19A 4BDNA 4LONB 4O3AA 1O7TA 1WVJA 1P1WA 1RKMA 3B6QA 3IO6A 1YTVA 4EQBA 4QSCA 5EYHA 2F6PA 4R2FA 5T3JA 4OQOA 1FCKA 1NV5A 3UP9A 3MPKA 4I3YA 1VDWA 3KFMA 4IB2A 3RTWB 3HHFA 3TUSA 3QUJA 2O84X 3RQTA 1N04A 4DDDA 5I2KA 1EYIA 3K2DA 3LSFB 4OFJA 4XIGQ 4JWYA 4YMAA 2DSFA 1H44A 5TP9B 3G3HA 4PAFA 3H6UA 4FEBA 4GOTA 5M2VA 4P3LA 1D9VA 5EQ7A 1UIUA 4OVRA 1CB6A 1NV1A 2R9JA 2ZXTA 2H9BA 1A7LA 4BDOA 2KR0A 4N8YA 3MVXA 2XXYA 5IGAA 4NF5B 1BLFA 5FHNA 4PFUA 1Q9DA 3MP6A 3OD7A 3G3KA 4DXBA 1FW0A 1URGA 3EKIA 3VVEA 4MBPA 2Q88A 4TQUQ 2P2AA 2I49A 4EXKA 4F3PA 4Z7EA 4Q5TA 4ND9A 1I6AA 3VFJA 1INPA 2GHAA 4PBHA 4R6HA 2PMSA 4DI4B 2WBBA 2HQ0A 1FBCA 4NX1A 5HPQA 3IX1A 5H8FB 5CMBA 2F78A 3Q28A 2FIXA 4YB6A 3O97A 3CSBA 4IO3A 4OVSA 1NH8A 4FEDA 3U93A 1FRPA 2YJPA 4RPNA 2R8TA 3O6GA 1MXZA 1AWBA 2ONRA 2DXRA 3FD3A 4IGTA 4XTCQ 1FQAA 2O51A 3OO8A 4GXSB 3FIRA 4RK9A 4KYSA 2DE4A 4BDRA 1P1UA 2WKYA 3DLNA 1JNFA 1US4A 3KSJA 3L6HA 4KD5A 2ZZWA 4EXLA 3G3IA 3M3LA 4HS7A 1P1OA 1USYH 2WYKA 4AQ4A 4OFLA 4C0RA 3T9HB 2UVHA 4I62A 3BFTA 3Q27A 1NUYA 4YKJA 3B7DA 4PE3A 2IA4A 1Z7NE 1LEVA 1XT8A 4QHQA 1BK4A 1R6ZA 4NGUA 1JVYA 5DVIA 2FYIA 3GZGA 3LSXA 1T0KA 4OVPA 3E78A 1MH4A 4NAPA 3IL1B 4WXJA 3RYDA 4JSOA 4E0WA 2H98A 3W15C 4NMYA 1UTBA 3FUZA 4H45A 4MLVA 1B7HA 1SI0A 3OO9A 4QBAA 4KI0E 4R6YA 5CRYA 3TAJA 2ZZXA 3KJ7A 3OEKA 1VFEA 3MC2A 5DEXA 3K6WA 1JEUA 2QVUA 1ATGA 4ECFA 4OVTA 3LC8A 1QKBA 1EYKA 2DWJA 1JW1A 4NE4A 1DBZA 5CC2A 1G0IA 3K1PA 1UQWA 1NNTA 3UK4A 2A5TA 4C1UA 2B3BA 4PE5B 1PDAA 3FASA 3T66A 1AOVA 1JEVA 4N6PA 5JTYB 1OIBA 4PGPA 2L5VA 3ODBA 3T9UA 1DOTA 4R72A 5IZ1A 2H25A 3E3KA 1S9TA 1B46A 1LCFA 4LZ5A 2GFEA 1FQBA 5KCJB 2UXAA 1VSOA 1SYHA 4MCOA 2I48A 3C36A 1B6HA 3T0JA 5LDZA 2X7QA 1II5A 3EQ1A 3VVFA 1BIYA 3Q29A 3PD8A 1DSNA 1NL5A 4U1OA 4H5FA 3TCHA 4KCCA 2Q74A 1NV0A 4QFLA 2ZNUA 3G3FA 5FHMA 1D4NA 4PAKA 1N7XA 1S50A 2PT2A 2ESNA 1MXVA 3M3KA 4OEUA 2F34A 3SDFA 5ET5A 2G29A 5EHMA 5JTYA 5A5LA 4LQ5A 1M5CA 1A55A 3TELA 3TKDA 3PTYA 1EU8A 3KZGA 4P1LA 4KQPA 2Y5KA 2I0BA 5L9MA 1KA0A 1DPPA 4FECA 2QS3A 3SZPA 3H6VA 2DP8A 1LBYA 1SPIA 2DDKA 1H3DA 4JWXA 3IB1A 4P9KA 2F8DA 4Z0IA 3C34A 2DXYA 3E79A 4IO4A 3O6IA 4N07A 4L17A 3I3VA 3I5OA 3MUQA 4GWXA 3RUMA 2XA5A 2QS1A 3U1OA 3CHGA 4GFRA 4U23A 2OLBA 3DP4A 3VLVA 2GH9A 4GWOA 4JXIA 2DWHA 3K6VA 2F7AA 1DTZA 2Z22A 4XKQA 2UYEA 1MM6A
chains in the Genus database with same CATH topology
2UVIA 2Z23A 4Q0CA 1B9JA 2RC9A 5AA4A 3CRBA 5ICQA 3OMBA 1FTJA 4YB5A 2F36A 1B1HA 3RTFB 4F3BA 4KCDA 4POWA 5H8HB 5I84A 1I69A 1NFTA 1Y1MA 1DTGA 2I3WA 4KYEA 5LOMA 4FORA 1HSLA 2NVUB 3CSGA 1MXUA 3UN6A 5KDTA 4MLQA 2QS4A 5DEXB 3SEXA 1QULA 4JSDA 5J1DA 4GF8A 4ZS9A 3S9NC 4DCYA 4JB7A 4R73A 3WAFA 4KFQA 1YCJA 4EF2A 4F39A 4AB5A 4LUBA 4IO6A 1MQDA 1N3WA 3MP8A 5IAIA 3OENA 1I6QA 3IOTA 4OZ9A 3Q25A 1B4HA 3S9EA 3TTKA 1OVTA 1JVXA 4BDMA 1F9BA 2E1SA 3O29A 1B51A 4GL8A 4DXUA 1AL3A 3K1MA 2I58A 3FVNA 1EZ9A 1Y4TA 3SKPA 1P99A 4RY1A 3TCFA 2DE3A 2XD2A 2OZZA 3OELA 3FXUA 2CMOA 2QSXA 1IXCA 1CE2A 3C4MA 1NH7A 3MVYA 3ZKKA 2BJJX 1SDXA 1XVXA 3D4GA 3HN0A 3OO7A 1B7ZA 1IIWA 2GHBA 3H03A 4P0GA 4OFOA 4F18A 5CBSA 3ZKLA 5H8NA 4F22A 3KJTA 4H6DA 1BKAA 3SERA 3BBRA 1R9LA 1DPEA 2XXHA 1IXIA 1MDQA 2W7YA 1H76A 3HO7A 1GVCA 2HAVA 1ZBMA 3TODA 4GD5A 2PBWA 3T22A 1H43A 5CMKA 1MRPA 4TLMB 3CVGA 3IOVA 2D21A 2RC8A 5TP9A 1H45A 1HSEA 2QMXA 3LUYA 3MAMA 5F1QA 3V89B 1Y3PA 1ELJA 4F19A 1Q35A 5TU0A 3C32A 3FVOA 3LSLA 1MPDA 5ICTA 4BDNA 2FA7A 4LONB 1MY4A 3PUXE 3FJMA 4O3AA 4ZEDA 1O7TA 1SD3A 5BWJA 1EZOA 2HEUA 1WVJA 1P1WA 1RKMA 3PMVA 2O6AA 1UTHA 2PYYA 1B3EA 3B6QA 3VLWA 3IO6A 1LFHA 1YTVA 2VD2A 2XXRA 3CFLA 4QSCA 4EQBA 4M1VA 5I59A 4THIA 3IORA 3CG1A 4H65A 2Q8JA 1B5IA 4I9DA 3C9HA 5AE4A 2F6PA 3FV1A 4H8IA 4R2FA 4EF1A 2AL4A 4QFKA 4OQOA 3E4RA 4ZDMA 1FCKA 4LP2B 1Q1KA 3UP9A 2O68A 1LB9A 2V3UA 3CR9A 3MPKA 2REJA 4GXAA 4M4GA 5FHOA 1MY1A 4G4PA 4OWDA 4DIGA 2LAOA 1FQCA 1OQHA 4F31B 2XX8A 1LAHE 2I3VA 4R2BA 3IJXB 3TTLA 1B2HA 2KLFA 3KFMA 4IB2A 3RTWB 4ZE9A 3IJOB 3HHFA 1UTHB 3TUSA 3QUJA 1VE4A 4NEDA 3K02A 2O84X 1HSJA 3GBAA 4HTGA 3RQTA 3U94A 1N04A 1XS5A 4H8JA 3TQLA 4JBZA 5AA2D 1IEJA 3EHSA 3GXAA 1UTBB 4RXLA 1GR2A 4DDDA 5I2KA 1MQJA 3RT8A 3PUZE 3USDA 3K2DA 4EQ7A 3UORA 1B3GA 3LSFB 3HHGA 1MXXA 4OFJA 4XIGQ 5HM4B 3S9MC 1LCTA 1PBQA 4BLAA 3KEIA 4JWYA 2P0SA 1UIVA 4DLDA 4YMAA 2I4CA 2DSFA 3PV0E 3DP8A 3ZS6A 2AYSA 3PPRA 3TEPA 1H44A 3T9VA 4HCYA 5TP9B 3G3HA 3OEMA 4K3FA 2XX7A 3VE1B 3PGFA 1NNKA 3MP1A 3H6UA 4FEBA 1Y1ZA 1A40A 3O66A 4GOTA 2HCAA 5M2VA 3N94A 1MY0A 4GL0A 5TPAA 3KOSA 2I0CA 3R7XA 5AA3A 4P0IA 3T93B 3FV2A 1N76A 2DE2A 3QYTA 1D9VA 3K6UA 1NNPA 2NUVA 5H8FA 1UIUA 1RYOA 4PETA 4U4SA 1CB6A 3PUYE 3T66A 4OYVA 4NF8B 5A5XA 1FTLA 1SVXB 2R9JA 2ZXTA 3B6TA 3IK6B 4BDQA 3OXNA 4GRKA 2H9BA 4X9TA 1A7LA 3K1NA 4BDOA 4OXVA 4ELOA 1B4ZA 4WEPA 3SESA 3P7IA 3MVXA 2XXYA 2I4BA 2YLNA 4NF5B 1BLFA 2HAUA 3FZVA 4PFUA 3CIJA 4I1DA 4R74A 4XKPA 5FHNA 3S2VA 3SEVA 5AA2B 5CM6A 3C35A 2Z8FA 3PMWA 5KCJA 3MP6A 4AB6A 1PB9A 1LAFE 4ZZAA 4PP0A 4TLLB 3OD7A 3G3KA 4DXBA 1FW0A 1URGA 3QK6A 3GBBA 2OCUA 1EZPA 1SW5A 2O7IA 4ZEBA 3VVEA 4MBPA 1N7WA 2Q88A 4IY6A 3FATA 2Q9TA 4EDPA 4ELPA 2Y84A 4TQUQ 3PPPA 3U72A 2P2AA 2DWAA 1GGGA 3EPEA 3OSQA 2I49A 3B6WA 1MM7A 3C33A 4EXKA 1MY2A 4F3PA 4LZ7A 4YMBA 3QSLA 4Z7EA 4U22A 4Q5TA 4ND9A 2ONKE 1Z7ME 1Y3NA 1I6AA 1ANFA 3VFJA 3CFZA 4RPOA 2F7CA 2ALUA 4G77A 1DMBA 4QF9A 5H8QA 4GIZA 4IO2A 3V8XB 2GHAA 2OWSA 4R6HA 1QKAA 2PMSA 3KSXA 1MS7A 3DM0A 2HQ0A 5L8DA 3W9WA 4RA1A 3VVDA 4G68B 5ELVA 3VXCA 1YPNA 5HPQA 2Z8EA 3A09A 3IX1A 5H8FB 4QSEA 5ISUA 5CMBA 1O64A 3K0VA 4G68C 4NF4A 4QFNA 4EUOA 4UACA 2F78A 2ZNTA 2RF1A 3Q28A 3RT6B 4HW8A 4DZ1A 4YB6A 1OQGA 5ITPA 1IXGA 3VXBA 3FJ7A 2Q2AA 3O97A 4YICA 5KDTB 3CSBA 4IO3A 4NWDA 3THIA 3FGSA 2XXTA 1NH8A 1WDNA 4FEDA 3QIMA 5FTHA 5H8QB 3H4ZA 3U93A 4IO7A 4QSDA 4FIMA 5AA2A 4FAJA 1XOCA 1B3LA 1QVSA 4ESWA 2D5WA 3O9PA 1ZMGA 2YJPA 4KPTA 4OMBA 4RPNA 3ILUB 2O1MA 1GTKA 3MZ9A 3O6GA 1MXZA 4LA9A 2Y7PA 4GLIA 1N0TA 2UVJA 3IAZA 3M3FA 4MH5A 3VDFA 2G93A 2GRVA 2ONRA 4F1UA 1A99A 2DXRA 2RC7A 2AL5A 2RINA 2V84A 3FD3A 1FTOA 1PEBA 3MPLA 4IGTA 4XTCQ 1FQAA 2O51A 3MJNA 3EN3A 3HSTA 3OO8A 4GXSB 2B65A 2ONSA 3FIRA 4KYSA 2DE4A 4RK9A 4TOZA 5EYFA 3KBRA 4BDRA 1P1UA 1B0HA 2PX1A 3KN7A 4X48A 3OO6A 4H1XA 1OLCA 4Q8RA 1MQIA 2WKYA 3DLNA 4IY5A 2QS2A 2A5SA 3IOWA 1JNFA 1NKXA 1B3HA 3RLFE 3W9VA 1PB7A 2UVGA 1IITA 3T9XB 3CG3A 1US4A 4H0WA 5I57A 3KSJA 1FQEA 3L6HA 1POTA 4NF4B 3G7WA 4KD5A 5H8NB 3MWBA 1B32A 2XXUA 3K4UA 3TQWA 5I2NB 1B58A 1S7YA 1N84A 1MDP1 1USYE 3G3IA 3MQ9A 4EXLA 2HZLA 4F2OA 3M3LA 3M8UA 4O3CA 4ZEKA 3H6TA 2YPNA 4HS7A 3CI8A 1B3FA 1P1OA 4OETA 3PUVE 1NNFA 1USYH 1VR5A 2D3IA 4OFLA 4AQ4A 3T9HB 2UVHA 4QFPA 4C0RA 3GLBA 4E0XA 4I62A 1R1NA 4WEDA 3O2AA 1XC1A 3BFTA 3Q27A 3PPNA 1B0LA 1LAGE 3QAXA 4YKJA 1Y4CA 3B7DA 3V5AA 2XXQA 1URSA 2NWJA 1TFAA 2IA4A 4KYDA 4XXUA 4FJPA 5I58B 1Z7NE 5JEIA 1JW4A 3H6WA 1XT8A 4QFOA 3WAEA 4QHQA 1R6ZA 4IO5A 5DTBA 4YKKA 3RGYA 1JVYA 5DVIA 3RNNA 2RCAA 2FYIA 3KN8A 3GZGA 5DT6A 3LSXA 1B1XA 1T0KA 4XKNA 3LR1A 4G68A 4POXA 4F3SA 3R6UA 4JDFA 4X1BA 2DOJA 4R9FA 4R75A 2I6EA 1MH4A 3A3CA 1BTJA 1B5HA 4G2ZA 3PPOA 5DYHA 3IL1B 4WXJA 2QPQA 4JSOA 2NOOA 4E0WA 2H98A 3W15C 4NMYA 4QRZA 1P1QA 1UTBA 1IQ7A 2F97A 4ESXA 3FUZA 3JZJA 3ILTB 3SEUA 4MLVA 5B70A 3V83A 1B7HA 1SI0A 2NXOA 3OO9A 3TZAA 3IR1A 4F3GA 2Y7RA 1N3XA 3H7MA 1YAEA 3MBPA 4KI0E 2QJEA 4R6YA 4YAHX 5CRYA 3TPAA 4LVQA 3TAJA 1MH3A 4U2RA 3KJ7A 1FQDA 1URDA 3OEKA 1VFEA 4ZECA 3TYHA 2O69A 3IB0A 3MC2A 2OJTA 3E13X 2DWIA 1JEUA 3K6WA 5DEXA 5ITOA 3TTRA 2V3TA 1ATGA 2ANJA 5IKBA 3TDJA 2VOZA 1A8EA 3OOAA 3PMXA 4OVJA 1QKBA 2DWJA 3LC8A 5H8SA 1Y9UA 2DYXA 1JW1A 3D4CA 3EF7A 4NE4A 4F1VA 2ZYOA 1FTKA 2IEEA 5EHSA 1MY3A 3MZ1A 4I8CA 4DCXA 5CC2A 4O3BA 1LB8A 3K1PA 3DELB 3MZBA 2P1SA 5I56A 4ZEFA 4ISUA 1P1NA 1UQWA 4P11A 1NNTA 4ONYA 3UK4A 2A5TA 1QUIA 3N6UA 1POY1 4C1UA 3UGWA 2B3BA 3Q26A 1D9YA 1PDAA 1SBPA 3FASA 1M5BA 4PE5B 4PFWA 1JEVA 4GVOA 2PT1A 2R71A 3K6XA 1AOVA 4XKRA 2XHDA 4N6PA 4RK2A 4OENA 1LAXA 1QUJA 1OIBA 2H4IA 4MFIA 4PFYA 5JTYB 5A5XB 4H5GA 3HPIA 3ODBA 1FTMA 1MG1A 1ZJLA 3IB2A 3E9XA 3MW0A 5F7VA 3T9UA 2REGA 1DOTA 2H25A 3E3KA 1S9TA 1B46A 1LCFA 4R72A 2THIA 2DQVA 4LZ5A 4G8NA 1LGBC 1FQBA 2GFEA 3SEYA 4F1YA 4ZEIA 5KCJB 2UXAA 1VSOA 5L9SA 5KZTA 1SYHA 3PPQA 4ELQA 1LBCA 3KOTA 1A8FA 3FVGA 1ZLQA 2I48A 3C36A 4OEVA 1B6HA 3PD9A 2X7QA 1II5A 3EQ1A 4N13A 3VVFA 3ECRA 1BIYA 3N5LA 3RY3A 2H5YA 3Q29A 4R6KA 1SW2A 3U92A 2V93A 3PD8A 4NF5A 4U21A 2XXIA 3TMGA 1DSNA 1OVBA 3AXFA 2PVUA 1NL5A 1GV8A 4ELRA 1SW4A 3TFLA 3A3UA 3N26A 4U1OA 3BKIB 4H5FA 1M5FA 3TCHA 3IO4A 4KCCA 4F2QA 1LBBA 2A5TB 3DP6A 4C1TA 4QFLA 4NF6A 4JWOA 2ZNUA 3G3FA 2HZKA 5FHMA 4ZE8A 1WODA 4KHZE 1D4NA 1ZU0A 4YB7A 1TT1A 4NTLA 4YKIA 1N7XA 3VLUA 2XXVA 4DXCA 1S50A 1KWHA 2ESNA 1MXVA 2PT2A 3M3KA 1XHYA 4FE8A 4UA8A 4PQJA 2F7BA 1MQGA 1IUDA 1ZIUA 2ZYKA 3FJGA 4OEUA 3UIFA 1JETA 2F34A 3K00A 3SDFA 3TCGA 5CBRA 5L9OA 4R9GA 1L5TA 2XXXA 2F5XA 5DVJA 4DE8A 3C31A 2G29A 5EHMA 1MPBA 5AA4B 4Q30B 1QJMA 2Y7WA 3G3GA 5CI5A 5JTYA 5I59B 2UYFA 1QW0A 1A54A 1M5CA 1A55A 4HCWA 4LQ5A 4OTEA 5DVFA 5I2KB 2R6GE 3TELA 3TKDA 3QXMA 2CZLA 3LBSA 3ZSFA 1BP5A 1OMPA 2F35A 1EU8A 3CFXA 3KZGA 4KR5A 5BUUA 4KQPA 3S9LC 4F29A 2I0BA 4BDLA 1ZKBA 1B52A 1EH3A 2XXWA 2DVZA 1R9QA 4LQ2A 5L9MA 4ZZEA 3SEWA 4ECFA 3IOUA 5AA1A 2HXWA 2VP1A 4FATA 2E0SA 5I2NA 5K2YA 1D3KA 1DPPA 4FECA 5CMCA 3UA8A 2V3QA 2QS3A 2M8CA 3H6VA 1B40A 3PUWE 4EQ9A 5I57B 2RKMA 1B5JA 3MVWA 2FNCA 2DP8A 1IXHA 1TXFA 2X7PA 1Y20A 1B05A 1M5EA 2QL3A 1VFDA 1MXYA 2XD3A 2Q89A 1SYIA 3O28A 3R26A 4NWCA 1O63A 1RYXA 1AH5A 1XVYA 3OSRA 3SETA 1AIVA 3H3GA 1I6BA 4RNSA 1H3DA 5TPAB 4JWXA 1SW1A 2X26A 5CMMA 4G8HA 3PU5A 1ZTYA 3H06B 5H8HA 1LLSA 1PC3A 3S4UA 1NMUA 3IB1A 2ABHA 2O1LA 2Y7KA 3HCQA 4YKPA 1AMFA 3FVKA 2F8DA 3LSWA 4NF8A 2XX9A 4Z0IA 1MXWA 3C34A 2DXYA 3JV9A 1LFIA 2DS9A 3O6IA 4IO4A 1M5DA 1TFDA 4N07A 4OHNA 4WKMA 3VV5A 4L17A 1PBPA 1US5A 2OBGA 3EHUA 2HFBA 3I3VA 5B7DA 4PFTA 2AIXA 1LSTA 2B3FA 3ONMA 4RYAA 3U8QA 3HV1A 1PB8A 1Y3QA 2H99A 2VGQA 3I5OA 2Z8DA 4OESA 4X1DA 3MUQA 3RUMA 3K01A 4OERA 3TTNA 2OK2A 2Q2CA 3KGCA 3KG2A 2VD3A 2ZNSA 1JW5A 3N6TA 2RCBA 2QS1A 2F6GA 2ZYMA 3I6VA 3KN3A 3O6HA 3QUFA 2ZMBA 4NF6B 4RJZA 5FTIA 3JYRA 3U1OA 4GFRA 1TWYA 1QUKA 2ZYNA 1JQFA 1OLAA 1J1NA 2VHAA 3EHTA 4MF3A 4YZZA 1FQFA 4G8MA 4U23A 1LFGA 4U1ZA 2OLBA 3DP4A 1SI1A 3VLVA 2GH9A 2O7UA 2QMWA 3G3JA 3L6GA 3MVZA 4GWOA 4YU0A 5I58A 3RN8A 2XXPA 2DVCA 4JXIA 4LATA 2DWHA 3K6VA 3T96B 3RPWA 5K2XA 3FXQA 2F7AA 4LZ8A 3F11A 1IZ1A 2OWTA 2QRYA 2Y7IA 1DTZA 1MQHA 2Z22A 1SQYA 3BFUA 4IGRA 3TTMA 2V25A 4XKQA 4H67A 5JK4A 4GQOA 5HBCA 1MPCA 2UYEA 1B7UA 1MM6A 5I56B 3FXRA 4U4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UVI A;  2Z23 A;  4Q0C A;  1B9J A;  2RC9 A;  5AA4 A;  3CRB A;  5ICQ A;  3OMB A;  1FTJ A;  4YB5 A;  2F36 A;  1B1H A;  3RTF B;  4F3B A;  4KCD A;  4POW A;  5H8H B;  5I84 A;  1I69 A;  1NFT A;  1Y1M A;  1DTG A;  2I3W A;  4KYE A;  5LOM A;  4FOR A;  1HSL A;  2NVU B;  3CSG A;  1MXU A;  3UN6 A;  5KDT A;  4MLQ A;  2QS4 A;  5DEX B;  3SEX A;  1QUL A;  4JSD A;  5J1D A;  4GF8 A;  4ZS9 A;  3S9N C;  4DCY A;  4JB7 A;  4R73 A;  3WAF A;  4KFQ A;  1YCJ A;  4EF2 A;  4F39 A;  4AB5 A;  4LUB A;  4IO6 A;  1MQD A;  1N3W A;  3MP8 A;  5IAI A;  3OEN A;  1I6Q A;  3IOT A;  4OZ9 A;  3Q25 A;  1B4H A;  3S9E A;  3TTK A;  1OVT A;  1JVX A;  4BDM A;  1F9B A;  2E1S A;  3O29 A;  1B51 A;  4GL8 A;  4DXU A;  1AL3 A;  3K1M A;  2I58 A;  3FVN A;  1EZ9 A;  1Y4T A;  3SKP A;  1P99 A;  4RY1 A;  3TCF A;  2DE3 A;  2XD2 A;  2OZZ A;  3OEL A;  3FXU A;  2CMO A;  2QSX A;  1IXC A;  1CE2 A;  3C4M A;  1NH7 A;  3MVY A;  3ZKK A;  2BJJ X;  1SDX A;  1XVX A;  3D4G A;  3HN0 A;  3OO7 A;  1B7Z A;  1IIW A;  2GHB A;  3H03 A;  4P0G A;  4OFO A;  4F18 A;  5CBS A;  3ZKL A;  5H8N A;  4F22 A;  3KJT A;  4H6D A;  1BKA A;  3SER A;  3BBR A;  1R9L A;  1DPE A;  2XXH A;  1IXI A;  1MDQ A;  2W7Y A;  1H76 A;  3HO7 A;  1GVC A;  2HAV A;  1ZBM A;  3TOD A;  4GD5 A;  2PBW A;  3T22 A;  1H43 A;  5CMK A;  1MRP A;  4TLM B;  3CVG A;  3IOV A;  2D21 A;  2RC8 A;  5TP9 A;  1H45 A;  1HSE A;  2QMX A;  3LUY A;  3MAM A;  5F1Q A;  3V89 B;  1Y3P A;  1ELJ A;  4F19 A;  1Q35 A;  5TU0 A;  3C32 A;  3FVO A;  3LSL A;  1MPD A;  5ICT A;  4BDN A;  2FA7 A;  4LON B;  1MY4 A;  3PUX E;  3FJM A;  4O3A A;  4ZED A;  1O7T A;  1SD3 A;  5BWJ A;  1EZO A;  2HEU A;  1WVJ A;  1P1W A;  1RKM A;  3PMV A;  2O6A A;  1UTH A;  2PYY A;  1B3E A;  3B6Q A;  3VLW A;  3IO6 A;  1LFH A;  1YTV A;  2VD2 A;  2XXR A;  3CFL A;  4QSC A;  4EQB A;  4M1V A;  5I59 A;  4THI A;  3IOR A;  3CG1 A;  4H65 A;  2Q8J A;  1B5I A;  4I9D A;  3C9H A;  5AE4 A;  2F6P A;  3FV1 A;  4H8I A;  4R2F A;  4EF1 A;  2AL4 A;  4QFK A;  4OQO A;  3E4R A;  4ZDM A;  1FCK A;  4LP2 B;  1Q1K A;  3UP9 A;  2O68 A;  1LB9 A;  2V3U A;  3CR9 A;  3MPK A;  2REJ A;  4GXA A;  4M4G A;  5FHO A;  1MY1 A;  4G4P A;  4OWD A;  4DIG A;  2LAO A;  1FQC A;  1OQH A;  4F31 B;  2XX8 A;  1LAH E;  2I3V A;  4R2B A;  3IJX B;  3TTL A;  1B2H A;  2KLF A;  3KFM A;  4IB2 A;  3RTW B;  4ZE9 A;  3IJO B;  3HHF A;  1UTH B;  3TUS A;  3QUJ A;  1VE4 A;  4NED A;  3K02 A;  2O84 X;  1HSJ A;  3GBA A;  4HTG A;  3RQT A;  3U94 A;  1N04 A;  1XS5 A;  4H8J A;  3TQL A;  4JBZ A;  5AA2 D;  1IEJ A;  3EHS A;  3GXA A;  1UTB B;  4RXL A;  1GR2 A;  4DDD A;  5I2K A;  1MQJ A;  3RT8 A;  3PUZ E;  3USD A;  3K2D A;  4EQ7 A;  3UOR A;  1B3G A;  3LSF B;  3HHG A;  1MXX A;  4OFJ A;  4XIG Q;  5HM4 B;  3S9M C;  1LCT A;  1PBQ A;  4BLA A;  3KEI A;  4JWY A;  2P0S A;  1UIV A;  4DLD A;  4YMA A;  2I4C A;  2DSF A;  3PV0 E;  3DP8 A;  3ZS6 A;  2AYS A;  3PPR A;  3TEP A;  1H44 A;  3T9V A;  4HCY A;  5TP9 B;  3G3H A;  3OEM A;  4K3F A;  2XX7 A;  3VE1 B;  3PGF A;  1NNK A;  3MP1 A;  3H6U A;  4FEB A;  1Y1Z A;  1A40 A;  3O66 A;  4GOT A;  2HCA A;  5M2V A;  3N94 A;  1MY0 A;  4GL0 A;  5TPA A;  3KOS A;  2I0C A;  3R7X A;  5AA3 A;  4P0I A;  3T93 B;  3FV2 A;  1N76 A;  2DE2 A;  3QYT A;  1D9V A;  3K6U A;  1NNP A;  2NUV A;  5H8F A;  1UIU A;  1RYO A;  4PET A;  4U4S A;  1CB6 A;  3PUY E;  3T66 A;  4OYV A;  4NF8 B;  5A5X A;  1FTL A;  1SVX B;  2R9J A;  2ZXT A;  3B6T A;  3IK6 B;  4BDQ A;  3OXN A;  4GRK A;  2H9B A;  4X9T A;  1A7L A;  3K1N A;  4BDO A;  4OXV A;  4ELO A;  1B4Z A;  4WEP A;  3SES A;  3P7I A;  3MVX A;  2XXY A;  2I4B A;  2YLN A;  4NF5 B;  1BLF A;  2HAU A;  3FZV A;  4PFU A;  3CIJ A;  4I1D A;  4R74 A;  4XKP A;  5FHN A;  3S2V A;  3SEV A;  5AA2 B;  5CM6 A;  3C35 A;  2Z8F A;  3PMW A;  5KCJ A;  3MP6 A;  4AB6 A;  1PB9 A;  1LAF E;  4ZZA A;  4PP0 A;  4TLL B;  3OD7 A;  3G3K A;  4DXB A;  1FW0 A;  1URG A;  3QK6 A;  3GBB A;  2OCU A;  1EZP A;  1SW5 A;  2O7I A;  4ZEB A;  3VVE A;  4MBP A;  1N7W A;  2Q88 A;  4IY6 A;  3FAT A;  2Q9T A;  4EDP A;  4ELP A;  2Y84 A;  4TQU Q;  3PPP A;  3U72 A;  2P2A A;  2DWA A;  1GGG A;  3EPE A;  3OSQ A;  2I49 A;  3B6W A;  1MM7 A;  3C33 A;  4EXK A;  1MY2 A;  4F3P A;  4LZ7 A;  4YMB A;  3QSL A;  4Z7E A;  4U22 A;  4Q5T A;  4ND9 A;  2ONK E;  1Z7M E;  1Y3N A;  1I6A A;  1ANF A;  3VFJ A;  3CFZ A;  4RPO A;  2F7C A;  2ALU A;  4G77 A;  1DMB A;  4QF9 A;  5H8Q A;  4GIZ A;  4IO2 A;  3V8X B;  2GHA A;  2OWS A;  4R6H A;  1QKA A;  2PMS A;  3KSX A;  1MS7 A;  3DM0 A;  2HQ0 A;  5L8D A;  3W9W A;  4RA1 A;  3VVD A;  4G68 B;  5ELV A;  3VXC A;  1YPN A;  5HPQ A;  2Z8E A;  3A09 A;  3IX1 A;  5H8F B;  4QSE A;  5ISU A;  5CMB A;  1O64 A;  3K0V A;  4G68 C;  4NF4 A;  4QFN A;  4EUO A;  4UAC A;  2F78 A;  2ZNT A;  2RF1 A;  3Q28 A;  3RT6 B;  4HW8 A;  4DZ1 A;  4YB6 A;  1OQG A;  5ITP A;  1IXG A;  3VXB A;  3FJ7 A;  2Q2A A;  3O97 A;  4YIC A;  5KDT B;  3CSB A;  4IO3 A;  4NWD A;  3THI A;  3FGS A;  2XXT A;  1NH8 A;  1WDN A;  4FED A;  3QIM A;  5FTH A;  5H8Q B;  3H4Z A;  3U93 A;  4IO7 A;  4QSD A;  4FIM A;  5AA2 A;  4FAJ A;  1XOC A;  1B3L A;  1QVS A;  4ESW A;  2D5W A;  3O9P A;  1ZMG A;  2YJP A;  4KPT A;  4OMB A;  4RPN A;  3ILU B;  2O1M A;  1GTK A;  3MZ9 A;  3O6G A;  1MXZ A;  4LA9 A;  2Y7P A;  4GLI A;  1N0T A;  2UVJ A;  3IAZ A;  3M3F A;  4MH5 A;  3VDF A;  2G93 A;  2GRV A;  2ONR A;  4F1U A;  1A99 A;  2DXR A;  2RC7 A;  2AL5 A;  2RIN A;  2V84 A;  3FD3 A;  1FTO A;  1PEB A;  3MPL A;  4IGT A;  4XTC Q;  1FQA A;  2O51 A;  3MJN A;  3EN3 A;  3HST A;  3OO8 A;  4GXS B;  2B65 A;  2ONS A;  3FIR A;  4KYS A;  2DE4 A;  4RK9 A;  4TOZ A;  5EYF A;  3KBR A;  4BDR A;  1P1U A;  1B0H A;  2PX1 A;  3KN7 A;  4X48 A;  3OO6 A;  4H1X A;  1OLC A;  4Q8R A;  1MQI A;  2WKY A;  3DLN A;  4IY5 A;  2QS2 A;  2A5S A;  3IOW A;  1JNF A;  1NKX A;  1B3H A;  3RLF E;  3W9V A;  1PB7 A;  2UVG A;  1IIT A;  3T9X B;  3CG3 A;  1US4 A;  4H0W A;  5I57 A;  3KSJ A;  1FQE A;  3L6H A;  1POT A;  4NF4 B;  3G7W A;  4KD5 A;  5H8N B;  3MWB A;  1B32 A;  2XXU A;  3K4U A;  3TQW A;  5I2N B;  1B58 A;  1S7Y A;  1N84 A;  1MDP 1;  1USY E;  3G3I A;  3MQ9 A;  4EXL A;  2HZL A;  4F2O A;  3M3L A;  3M8U A;  4O3C A;  4ZEK A;  3H6T A;  2YPN A;  4HS7 A;  3CI8 A;  1B3F A;  1P1O A;  4OET A;  3PUV E;  1NNF A;  1USY H;  1VR5 A;  2D3I A;  4OFL A;  4AQ4 A;  3T9H B;  2UVH A;  4QFP A;  4C0R A;  3GLB A;  4E0X A;  4I62 A;  1R1N A;  4WED A;  3O2A A;  1XC1 A;  3BFT A;  3Q27 A;  3PPN A;  1B0L A;  1LAG E;  3QAX A;  4YKJ A;  1Y4C A;  3B7D A;  3V5A A;  2XXQ A;  1URS A;  2NWJ A;  1TFA A;  2IA4 A;  4KYD A;  4XXU A;  4FJP A;  5I58 B;  1Z7N E;  5JEI A;  1JW4 A;  3H6W A;  1XT8 A;  4QFO A;  3WAE A;  4QHQ A;  1R6Z A;  4IO5 A;  5DTB A;  4YKK A;  3RGY A;  1JVY A;  5DVI A;  3RNN A;  2RCA A;  2FYI A;  3KN8 A;  3GZG A;  5DT6 A;  3LSX A;  1B1X A;  1T0K A;  4XKN A;  3LR1 A;  4G68 A;  4POX A;  4F3S A;  3R6U A;  4JDF A;  4X1B A;  2DOJ A;  4R9F A;  4R75 A;  2I6E A;  1MH4 A;  3A3C A;  1BTJ A;  1B5H A;  4G2Z A;  3PPO A;  5DYH A;  3IL1 B;  4WXJ A;  2QPQ A;  4JSO A;  2NOO A;  4E0W A;  2H98 A;  3W15 C;  4NMY A;  4QRZ A;  1P1Q A;  1UTB A;  1IQ7 A;  2F97 A;  4ESX A;  3FUZ A;  3JZJ A;  3ILT B;  3SEU A;  4MLV A;  5B70 A;  3V83 A;  1B7H A;  1SI0 A;  2NXO A;  3OO9 A;  3TZA A;  3IR1 A;  4F3G A;  2Y7R A;  1N3X A;  3H7M A;  1YAE A;  3MBP A;  4KI0 E;  2QJE A;  4R6Y A;  4YAH X;  5CRY A;  3TPA A;  4LVQ A;  3TAJ A;  1MH3 A;  4U2R A;  3KJ7 A;  1FQD A;  1URD A;  3OEK A;  1VFE A;  4ZEC A;  3TYH A;  2O69 A;  3IB0 A;  3MC2 A;  2OJT A;  3E13 X;  2DWI A;  1JEU A;  3K6W A;  5DEX A;  5ITO A;  3TTR A;  2V3T A;  1ATG A;  2ANJ A;  5IKB A;  3TDJ A;  2VOZ A;  1A8E A;  3OOA A;  3PMX A;  4OVJ A;  1QKB A;  2DWJ A;  3LC8 A;  5H8S A;  1Y9U A;  2DYX A;  1JW1 A;  3D4C A;  3EF7 A;  4NE4 A;  4F1V A;  2ZYO A;  1FTK A;  2IEE A;  5EHS A;  1MY3 A;  3MZ1 A;  4I8C A;  4DCX A;  5CC2 A;  4O3B A;  1LB8 A;  3K1P A;  3DEL B;  3MZB A;  2P1S A;  5I56 A;  4ZEF A;  4ISU A;  1P1N A;  1UQW A;  4P11 A;  1NNT A;  4ONY A;  3UK4 A;  2A5T A;  1QUI A;  3N6U A;  1POY 1;  4C1U A;  3UGW A;  2B3B A;  3Q26 A;  1D9Y A;  1PDA A;  1SBP A;  3FAS A;  1M5B A;  4PE5 B;  4PFW A;  1JEV A;  4GVO A;  2PT1 A;  2R71 A;  3K6X A;  1AOV A;  4XKR A;  2XHD A;  4N6P A;  4RK2 A;  4OEN A;  1LAX A;  1QUJ A;  1OIB A;  2H4I A;  4MFI A;  4PFY A;  5JTY B;  5A5X B;  4H5G A;  3HPI A;  3ODB A;  1FTM A;  1MG1 A;  1ZJL A;  3IB2 A;  3E9X A;  3MW0 A;  5F7V A;  3T9U A;  2REG A;  1DOT A;  2H25 A;  3E3K A;  1S9T A;  1B46 A;  1LCF A;  4R72 A;  2THI A;  2DQV A;  4LZ5 A;  4G8N A;  1LGB C;  1FQB A;  2GFE A;  3SEY A;  4F1Y A;  4ZEI A;  5KCJ B;  2UXA A;  1VSO A;  5L9S A;  5KZT A;  1SYH A;  3PPQ A;  4ELQ A;  1LBC A;  3KOT A;  1A8F A;  3FVG A;  1ZLQ A;  2I48 A;  3C36 A;  4OEV A;  1B6H A;  3PD9 A;  2X7Q A;  1II5 A;  3EQ1 A;  4N13 A;  3VVF A;  3ECR A;  1BIY A;  3N5L A;  3RY3 A;  2H5Y A;  3Q29 A;  4R6K A;  1SW2 A;  3U92 A;  2V93 A;  3PD8 A;  4NF5 A;  4U21 A;  2XXI A;  3TMG A;  1DSN A;  1OVB A;  3AXF A;  2PVU A;  1NL5 A;  1GV8 A;  4ELR A;  1SW4 A;  3TFL A;  3A3U A;  3N26 A;  4U1O A;  3BKI B;  4H5F A;  1M5F A;  3TCH A;  3IO4 A;  4KCC A;  4F2Q A;  1LBB A;  2A5T B;  3DP6 A;  4C1T A;  4QFL A;  4NF6 A;  4JWO A;  2ZNU A;  3G3F A;  2HZK A;  5FHM A;  4ZE8 A;  1WOD A;  4KHZ E;  1D4N A;  1ZU0 A;  4YB7 A;  1TT1 A;  4NTL A;  4YKI A;  1N7X A;  3VLU A;  2XXV A;  4DXC A;  1S50 A;  1KWH A;  2ESN A;  1MXV A;  2PT2 A;  3M3K A;  1XHY A;  4FE8 A;  4UA8 A;  4PQJ A;  2F7B A;  1MQG A;  1IUD A;  1ZIU A;  2ZYK A;  3FJG A;  4OEU A;  3UIF A;  1JET A;  2F34 A;  3K00 A;  3SDF A;  3TCG A;  5CBR A;  5L9O A;  4R9G A;  1L5T A;  2XXX A;  2F5X A;  5DVJ A;  4DE8 A;  3C31 A;  2G29 A;  5EHM A;  1MPB A;  5AA4 B;  4Q30 B;  1QJM A;  2Y7W A;  3G3G A;  5CI5 A;  5JTY A;  5I59 B;  2UYF A;  1QW0 A;  1A54 A;  1M5C A;  1A55 A;  4HCW A;  4LQ5 A;  4OTE A;  5DVF A;  5I2K B;  2R6G E;  3TEL A;  3TKD A;  3QXM A;  2CZL A;  3LBS A;  3ZSF A;  1BP5 A;  1OMP A;  2F35 A;  1EU8 A;  3CFX A;  3KZG A;  4KR5 A;  5BUU A;  4KQP A;  3S9L C;  4F29 A;  2I0B A;  4BDL A;  1ZKB A;  1B52 A;  1EH3 A;  2XXW A;  2DVZ A;  1R9Q A;  4LQ2 A;  5L9M A;  4ZZE A;  3SEW A;  4ECF A;  3IOU A;  5AA1 A;  2HXW A;  2VP1 A;  4FAT A;  2E0S A;  5I2N A;  5K2Y A;  1D3K A;  1DPP A;  4FEC A;  5CMC A;  3UA8 A;  2V3Q A;  2QS3 A;  2M8C A;  3H6V A;  1B40 A;  3PUW E;  4EQ9 A;  5I57 B;  2RKM A;  1B5J A;  3MVW A;  2FNC A;  2DP8 A;  1IXH A;  1TXF A;  2X7P A;  1Y20 A;  1B05 A;  1M5E A;  2QL3 A;  1VFD A;  1MXY A;  2XD3 A;  2Q89 A;  1SYI A;  3O28 A;  3R26 A;  4NWC A;  1O63 A;  1RYX A;  1AH5 A;  1XVY A;  3OSR A;  3SET A;  1AIV A;  3H3G A;  1I6B A;  4RNS A;  1H3D A;  5TPA B;  4JWX A;  1SW1 A;  2X26 A;  5CMM A;  4G8H A;  3PU5 A;  1ZTY A;  3H06 B;  5H8H A;  1LLS A;  1PC3 A;  3S4U A;  1NMU A;  3IB1 A;  2ABH A;  2O1L A;  2Y7K A;  3HCQ A;  4YKP A;  1AMF A;  3FVK A;  2F8D A;  3LSW A;  4NF8 A;  2XX9 A;  4Z0I A;  1MXW A;  3C34 A;  2DXY A;  3JV9 A;  1LFI A;  2DS9 A;  3O6I A;  4IO4 A;  1M5D A;  1TFD A;  4N07 A;  4OHN A;  4WKM A;  3VV5 A;  4L17 A;  1PBP A;  1US5 A;  2OBG A;  3EHU A;  2HFB A;  3I3V A;  5B7D A;  4PFT A;  2AIX A;  1LST A;  2B3F A;  3ONM A;  4RYA A;  3U8Q A;  3HV1 A;  1PB8 A;  1Y3Q A;  2H99 A;  2VGQ A;  3I5O A;  2Z8D A;  4OES A;  4X1D A;  3MUQ A;  3RUM A;  3K01 A;  4OER A;  3TTN A;  2OK2 A;  2Q2C A;  3KGC A;  3KG2 A;  2VD3 A;  2ZNS A;  1JW5 A;  3N6T A;  2RCB A;  2QS1 A;  2F6G A;  2ZYM A;  3I6V A;  3KN3 A;  3O6H A;  3QUF A;  2ZMB A;  4NF6 B;  4RJZ A;  5FTI A;  3JYR A;  3U1O A;  4GFR A;  1TWY A;  1QUK A;  2ZYN A;  1JQF A;  1OLA A;  1J1N A;  2VHA A;  3EHT A;  4MF3 A;  4YZZ A;  1FQF A;  4G8M A;  4U23 A;  1LFG A;  4U1Z A;  2OLB A;  3DP4 A;  1SI1 A;  3VLV A;  2GH9 A;  2O7U A;  2QMW A;  3G3J A;  3L6G A;  3MVZ A;  4GWO A;  4YU0 A;  5I58 A;  3RN8 A;  2XXP A;  2DVC A;  4JXI A;  4LAT A;  2DWH A;  3K6V A;  3T96 B;  3RPW A;  5K2X A;  3FXQ A;  2F7A A;  4LZ8 A;  3F11 A;  1IZ1 A;  2OWT A;  2QRY A;  2Y7I A;  1DTZ A;  1MQH A;  2Z22 A;  1SQY A;  3BFU A;  4IGR A;  3TTM A;  2V25 A;  4XKQ A;  4H67 A;  5JK4 A;  4GQO A;  5HBC A;  1MPC A;  2UYE A;  1B7U A;  1MM6 A;  5I56 B;  3FXR A;  4U4X A; 
#chains in the Genus database with same CATH topology
 5AA4 A;  4PDH A;  4YB5 A;  4F3B A;  4POW A;  1NFT A;  4KYE A;  2PCR A;  1MXU A;  1QUL A;  4ZS9 A;  4QXD A;  1FPK A;  3WAF A;  4AB5 A;  3OEN A;  1B4H A;  1OVT A;  1F9B A;  3O29 A;  3KC0 A;  3TCF A;  2XD2 A;  2OZZ A;  3FXU A;  3MVY A;  3HN0 A;  1IIW A;  3H03 A;  4OFO A;  1NV6 A;  1BKA A;  3SER A;  3BBR A;  1IXI A;  3ROJ A;  4GD5 A;  2PBW A;  2D21 A;  2RC8 A;  1HSE A;  2QMX A;  1Q35 A;  3C32 A;  5ICT A;  1MPD A;  2FA7 A;  1MY4 A;  3FJM A;  4ZED A;  1SD3 A;  3PMV A;  2O6A A;  2XXR A;  2HXR A;  3FV1 A;  2AL4 A;  1K9Z A;  4LP2 B;  2O68 A;  1LB9 A;  2V3U A;  4GXA A;  1IMF A;  2QFL A;  4M4G A;  3LUZ A;  1NUZ A;  4DIG A;  2LAO A;  4P1E A;  3TTL A;  2KLF A;  4I3E A;  4ZE9 A;  3IJO B;  1VE4 A;  1XS5 A;  5AA2 D;  4JBZ A;  3GXA A;  1GR2 A;  3USD A;  4O94 A;  4NQ8 A;  1FBG A;  1FJ9 A;  1MXX A;  3HHG A;  3KEI A;  2P0S A;  4PAI A;  3DP8 A;  3ZS6 A;  3PPR A;  1NUX A;  2XX7 A;  3MP1 A;  1Y1Z A;  1A40 A;  4P0I A;  2DE2 A;  4GWZ A;  5IZ3 A;  1RYO A;  4PET A;  3PUY E;  1FTL A;  4X9T A;  4WEP A;  1RDY A;  3SES A;  2Y5L A;  3P7I A;  2I4B A;  2HAU A;  3CIJ A;  4I1D A;  5CM6 A;  2Z8F A;  3PMW A;  1PB9 A;  3QK6 A;  1EZP A;  4P56 A;  2Q9T A;  3D1R A;  4KXP A;  4LZ7 A;  4YMB A;  2ONK E;  1Y3N A;  1ANF A;  4RPO A;  2ALU A;  2OWZ A;  4GIZ A;  3V8X B;  2OWS A;  1QKA A;  3KSX A;  3DM0 A;  2WBD A;  5L8D A;  3W9W A;  3VXC A;  2Z8E A;  5ISU A;  4MMP A;  1O64 A;  4G68 C;  4NF4 A;  4PBQ A;  4HW8 A;  4DZ1 A;  3FJ7 A;  2Q2A A;  5KDT B;  2KQZ A;  3QIM A;  5H8Q B;  3H4Z A;  5IM2 A;  3MYU A;  4QSD A;  1B3L A;  1QVS A;  4ESW A;  2D5W A;  4KPT A;  1ZMG A;  4HE1 A;  3MZ9 A;  4LA9 A;  2Y7P A;  4GLI A;  1N0T A;  3IAZ A;  2VT5 A;  2G93 A;  4PFR A;  2RC7 A;  2RIN A;  2V84 A;  3MPL A;  4DI3 D;  3MJN A;  4TOZ A;  4NG7 A;  2PX1 A;  3KN7 A;  3IOW A;  3RLF E;  1NKX A;  2UVG A;  1IIT A;  3CG3 A;  4NF4 B;  3G7W A;  1B32 A;  2P3V A;  2XXU A;  3K4U A;  4HE0 A;  5I2N B;  1N84 A;  1MDP 1;  2HZL A;  3CI8 A;  4OET A;  1NNF A;  2D3I A;  3GLB A;  3BIH A;  3O2A A;  5EQ9 A;  2Q8M A;  1D9Q A;  1URS A;  4KYD A;  4XXU A;  4P8B A;  3H6W A;  5EQA A;  3T1B A;  4IO5 A;  3RGY A;  2RCA A;  5DT6 A;  4XKN A;  3R6U A;  4JDF A;  4X1B A;  2DOJ A;  4R75 A;  3PPO A;  2QPQ A;  2NOO A;  1P1Q A;  3ILT B;  3V83 A;  2NXO A;  1MH3 A;  1FQD A;  5L9S A;  3IB0 A;  2OJT A;  3E13 X;  2DWI A;  5IKB A;  3PMX A;  3FXB A;  1FBD A;  1Y9U A;  3EF7 A;  3D4C A;  2ZYO A;  1FTK A;  5EHS A;  1MY3 A;  4G61 A;  4O3B A;  1LB8 A;  2P1S A;  4ZEF A;  4MNI A;  4P11 A;  1FBF A;  4XEQ A;  1M5B A;  2XHD A;  4RK2 A;  4OEN A;  1KA1 A;  4MFI A;  4H5G A;  1IMA A;  2DQV A;  5ET8 A;  4G8N A;  4ZEI A;  3PPQ A;  4ELQ A;  1LBC A;  3KOT A;  3FVG A;  4NHB A;  4P47 A;  3N5L A;  2H5Y A;  3U92 A;  4U21 A;  3TMG A;  1RDX A;  3AXF A;  3TFL A;  3A3U A;  3N26 A;  1M5F A;  3IO4 A;  1LBB A;  5I5P A;  4NF6 A;  4JWO A;  4O8M A;  5DW8 A;  4KHZ E;  4YB7 A;  1TT1 A;  4NTL A;  4YKI A;  4DXC A;  1NV4 A;  1KWH A;  4PQJ A;  2F7B A;  1IUD A;  2ZYK A;  1JET A;  3K00 A;  1L5T A;  4DE8 A;  1MPB A;  2Y7W A;  2UYF A;  5DVF A;  2CZH A;  2CZL A;  2CEX A;  1BP5 A;  1OMP A;  4KR5 A;  2XXW A;  1R9Q A;  4LQ2 A;  3SEW A;  3IOU A;  2HXW A;  2VP1 A;  2E0S A;  5CMC A;  3UA8 A;  5I57 B;  2FNC A;  1FBH A;  1TXF A;  2X7P A;  1M5E A;  1VFD A;  2Q89 A;  1SYI A;  3OSR A;  1SW1 A;  2X26 A;  3PU5 A;  1ZTY A;  2O1L A;  4GBV A;  2Y7K A;  2PFY A;  4YKP A;  4NF8 A;  3JV9 A;  1LFI A;  1DK4 A;  1M5D A;  1PBP A;  5B7D A;  2AIX A;  3ONM A;  3U8Q A;  2H99 A;  2VGQ A;  2OK2 A;  2VD3 A;  3O6H A;  2ZYM A;  2F6G A;  4N6K A;  4YZZ A;  3MVZ A;  2QMW A;  2FHY A;  2XXP A;  4LAT A;  5K2X A;  3FXQ A;  4LZ8 A;  4GX6 A;  3TTM A;  2Y7I A;  3BFU A;  1SQY A;  2V25 A;  5JK4 A;  4H67 A;  1B7U A;  3FXR A;  4U4X A;  2Z23 A;  1B9J A;  4N6D A;  5I84 A;  1I69 A;  1DTG A;  1NUW A;  5LOM A;  5I7I A;  3CSG A;  3UN6 A;  5KDT A;  4MLQ A;  2QS4 A;  5DEX B;  3SEX A;  5J1D A;  4GF8 A;  3S9N C;  5J16 A;  4DCY A;  4JB7 A;  2CZK A;  4KFQ A;  4F39 A;  3B8B A;  4IO6 A;  3TTK A;  2GQ1 A;  4DXU A;  2I58 A;  3ZKK A;  4F18 A;  1B7Z A;  5CBS A;  5H8N A;  1DPE A;  2XXH A;  2HAV A;  1H43 A;  3MAM A;  5F1Q A;  3RPL A;  3LSL A;  3PUX E;  1EZO A;  1UTH A;  2PYY A;  1B3E A;  3FBP A;  2VD2 A;  3CFL A;  5I59 A;  2XWV A;  3CG1 A;  4H65 A;  2Q8J A;  1B5I A;  3C9H A;  4QFK A;  4NF0 A;  1Q1K A;  5FHO A;  1MY1 A;  4G4P A;  1FQC A;  1OQH A;  4F31 B;  4R2B A;  3IJX B;  1B2H A;  4NED A;  1HSJ A;  3U94 A;  3TQL A;  3EHS A;  1MQJ A;  3RT8 A;  4EQ7 A;  3UOR A;  1B3G A;  5HM4 B;  3S9M C;  1UIV A;  2I4C A;  3PV0 E;  2AYS A;  3TEP A;  4HCY A;  1IMB A;  5TPA A;  1MY0 A;  1CNQ A;  3KBZ A;  3KOS A;  2F3D A;  2I0C A;  3R7X A;  5AA3 A;  1KZ8 A;  1N76 A;  3QYT A;  3K6U A;  5H8F A;  2NUV A;  5A5X A;  4OYV A;  4NF8 B;  4GWU A;  1YYZ A;  3IK6 B;  4BDQ A;  3K1N A;  1B4Z A;  2YLN A;  4R74 A;  3FZV A;  1LBZ A;  3S2V A;  3RPL B;  3C35 A;  1IME A;  5KCJ A;  4AB6 A;  1LAF E;  4JVI A;  4PP0 A;  4ZZA A;  4TLL B;  3GBB A;  2OCU A;  1SW5 A;  2O7I A;  4ZEB A;  1N7W A;  4EDP A;  3PPP A;  2DWA A;  1GGG A;  3OSQ A;  3C33 A;  3IFA A;  2BJI A;  4MJO A;  1Z7M E;  3CFZ A;  5H8Q A;  1MS7 A;  4G68 B;  5ELV A;  3A09 A;  4UAC A;  2ZNT A;  2RF1 A;  3RT6 B;  1OQG A;  3VXB A;  3A29 A;  1WDN A;  5FTH A;  1K9Y A;  4IO7 A;  5AA2 A;  2O1M A;  1GTK A;  1FPD A;  2JJK A;  3M3F A;  3VDF A;  2GRV A;  4LN5 A;  2AL5 A;  1PEB A;  3GYY A;  3EN3 A;  3KBR A;  1OLC A;  2QS2 A;  3W9V A;  3T9X B;  5I57 A;  1POT A;  5H8N B;  1S7Y A;  3MQ9 A;  4F2O A;  3M8U A;  3H6T A;  1B3F A;  3PUV E;  2B4M A;  2B4L A;  4E0X A;  1R1N A;  4WED A;  1XC1 A;  1B0L A;  3QAX A;  4JVC A;  2NWJ A;  4FJP A;  5JEI A;  4N15 A;  1JW4 A;  2FVZ A;  4QFO A;  3KN8 A;  1B1X A;  3LR1 A;  4G68 A;  4POX A;  4PFI A;  4F3S A;  5DYH A;  1IQ7 A;  3JZJ A;  4F3G A;  3TZA A;  3IR1 A;  1N3X A;  1YAE A;  4YAH X;  2QJE A;  3TPA A;  1FPG A;  2P3N A;  4LVQ A;  1URD A;  4ZEC A;  2O69 A;  5ITO A;  3TTR A;  3TDJ A;  2VOZ A;  1A8E A;  4OVJ A;  2DYX A;  1QGX A;  3MZ1 A;  4I8C A;  5ET7 A;  5I56 A;  4ISU A;  1NI9 A;  4ONY A;  1QUI A;  1POY 1;  3Q26 A;  1D9Y A;  4RXL A;  1SBP A;  4GVO A;  2PT1 A;  2R71 A;  3NOH A;  4PGN A;  1LAX A;  4PFY A;  2H4I A;  5A5X B;  1FTM A;  1ZJL A;  3IB2 A;  3MW0 A;  2REG A;  4ELP A;  4H46 A;  4F1Y A;  1LGB C;  1FTA A;  4OAN A;  4N13 A;  3BIG A;  3RY3 A;  4R6K A;  1SW2 A;  1YXI A;  2V93 A;  1FPL A;  4GBW A;  1SW4 A;  3BKI B;  1XI6 A;  4F2Q A;  2A5T B;  4X04 A;  3DP6 A;  2HZK A;  4ZE8 A;  1WOD A;  3VLU A;  4FE8 A;  3LV0 A;  1XHY A;  4UA8 A;  4MAG A;  1ZIU A;  3UIF A;  2QVR A;  5L9O A;  2CZI A;  4R9G A;  2XXX A;  2F5X A;  5AA4 B;  3G3G A;  5CI5 A;  5I59 B;  4OTE A;  1NV7 A;  4HCW A;  5I2K B;  2R6G E;  3LBS A;  3S9L C;  5I3S A;  4F29 A;  1ZKB A;  1B52 A;  3ISP A;  5AA1 A;  5I2N A;  5K2Y A;  4EQ9 A;  2M8C A;  1B40 A;  2RKM A;  1B5J A;  3MVW A;  1B05 A;  3THI A;  4NWC A;  1MXY A;  1IMD A;  1FPJ A;  3O28 A;  3R26 A;  1RYX A;  1XVY A;  1AH5 A;  4N8G A;  5TPA B;  4G8H A;  1PC3 A;  3S4U A;  2ABH A;  3FVK A;  2XX9 A;  1MXW A;  4WKM A;  1US5 A;  2OBG A;  3EHU A;  2HFB A;  1LST A;  4RYA A;  3HV1 A;  1Y3Q A;  4OES A;  2Z8D A;  4OER A;  3TTN A;  2Q2C A;  1JW5 A;  2RCB A;  4RJZ A;  3QUF A;  4NF6 B;  3IFC A;  3JYR A;  1QUK A;  2VPO A;  1LBX A;  1JQF A;  2ZYN A;  2VHA A;  3EHT A;  1LFG A;  4U1Z A;  4YU0 A;  2O7U A;  1JP4 A;  1LBW A;  3RN8 A;  2OX3 A;  4IGR A;  2OWT A;  2QRY A;  4GQO A;  1MPC A;  2UVI A;  4Q0C A;  5LTC A;  3CRB A;  3OMB A;  1FTJ A;  2FIE A;  5H8H B;  2I3W A;  1Y1M A;  1HSL A;  2NVU B;  4JSD A;  4R73 A;  1YCJ A;  3MP8 A;  4OZ9 A;  3S9E A;  1JVX A;  1B51 A;  4GL8 A;  4I40 A;  1AL3 A;  3K1M A;  1EZ9 A;  1Y4T A;  3SKP A;  4RY1 A;  2DE3 A;  3OEL A;  2QSX A;  1IXC A;  1CE2 A;  3C4M A;  2BJJ X;  1XVX A;  3D4G A;  4P0G A;  2QVV A;  1IMC A;  4F22 A;  3KJT A;  1EYJ A;  1MDQ A;  2W7Y A;  1H76 A;  2XWI A;  1GVC A;  1ZBM A;  3T22 A;  4XF5 A;  3IOV A;  1H45 A;  3LUY A;  1Y3P A;  5TU0 A;  3FVO A;  5BWJ A;  2HEU A;  2XWO A;  3VLW A;  1LFH A;  4MX6 A;  1FBP A;  4M1V A;  4THI A;  3IOR A;  4I9D A;  5AE4 A;  4H8I A;  4EF1 A;  5IZZ A;  3E4R A;  4N4U A;  4ZDM A;  3CR9 A;  2REJ A;  4OWD A;  2XX8 A;  1LAH E;  2I3V A;  1G0H A;  1UTH B;  1DCU A;  3K02 A;  3GBA A;  4HTG A;  4H8J A;  1IEJ A;  1UTB B;  4AS4 A;  3PUZ E;  3B50 A;  1LCT A;  1PBQ A;  4BLA A;  4DLD A;  3T9V A;  3OEM A;  4MEV A;  4K3F A;  4GWS A;  3VE1 B;  3PGF A;  1NNK A;  3O66 A;  2HCA A;  3N94 A;  4GL0 A;  4PF6 A;  3T93 B;  3FV2 A;  1NV2 A;  1NNP A;  4U4S A;  5FBP A;  1SVX B;  3B6T A;  3OXN A;  4GRK A;  2WEF A;  4OXV A;  4ELO A;  4XKP A;  3SEV A;  4PCD A;  5AA2 B;  1FSA A;  2F3B A;  2WX9 A;  4UAB A;  4MNC A;  4IY6 A;  3FAT A;  2Y84 A;  4MNP A;  3U72 A;  3EPE A;  3B6W A;  1MM7 A;  1MY2 A;  3QSL A;  4U22 A;  2F7C A;  4G77 A;  1DMB A;  4QF9 A;  4IO2 A;  2MKZ A;  1FPB A;  4RA1 A;  3VVD A;  1YPN A;  4QSE A;  4MHF A;  3K0V A;  4QFN A;  4EUO A;  5ITP A;  1IXG A;  4YIC A;  4NWD A;  3FGS A;  2XXT A;  5F24 A;  4N17 A;  4FIM A;  4N81 A;  4FAJ A;  1XOC A;  3O9P A;  4OMB A;  3ILU B;  4MH5 A;  2UVJ A;  4F1U A;  2XWK A;  1A99 A;  1FTO A;  2HPG A;  3HST A;  5EYF A;  2B65 A;  2ONS A;  5I58 A;  1B0H A;  4X48 A;  3OO6 A;  4H1X A;  4Q8R A;  1MQI A;  4IY5 A;  2A5S A;  1B3H A;  1PB7 A;  4H0W A;  1FQE A;  4IR8 A;  4HXV A;  3MWB A;  2CEY A;  1B58 A;  1USY E;  4OVQ A;  4O3C A;  3HFU A;  4ZEK A;  2YPN A;  4PC9 A;  1LBV A;  1VR5 A;  4QFP A;  2V4C A;  1NV3 A;  1FBE A;  3PPN A;  1LAG E;  1Y4C A;  3V5A A;  2XXQ A;  1TFA A;  5I58 B;  4HE2 A;  3WAE A;  5DTB A;  4YKK A;  4PDD A;  2I6E A;  3A3C A;  1BTJ A;  1B5H A;  4G2Z A;  4O7I A;  4QRZ A;  2F97 A;  4ESX A;  1FPF A;  3SEU A;  5B70 A;  1RDZ A;  2Y7R A;  3H7M A;  3MBP A;  5IZ3 B;  4U2R A;  3TYH A;  5EYG A;  2V3T A;  2ANJ A;  5H8S A;  3RNN A;  3OOA A;  4F1V A;  2IEE A;  4DCX A;  3DEL B;  3MZB A;  1P1N A;  3N6U A;  4O7M A;  3UGW A;  4PFW A;  3K6X A;  4XKR A;  1QUJ A;  4NN3 A;  2XXK A;  3HPI A;  5ESY A;  1MG1 A;  4X8R A;  3E9X A;  5F7V A;  2VPN A;  2THI A;  3SEY A;  5KZT A;  1FJ6 A;  1A8F A;  1ZLQ A;  4OEV A;  3PD9 A;  3ECR A;  4NF5 A;  4AS5 A;  2XXI A;  4PTK A;  1OVB A;  2PVU A;  1GV8 A;  4ELR A;  4XFE A;  4C1T A;  1ZU0 A;  2XXV A;  3U65 A;  1MQG A;  3FJG A;  5CBR A;  3TCG A;  5DVJ A;  3C31 A;  4Q30 B;  1QJM A;  1QW0 A;  1A54 A;  4OA4 A;  3QXM A;  2ZZV A;  3ZSF A;  2F35 A;  3CFX A;  5BUU A;  4BDL A;  1EH3 A;  2DVZ A;  5ET6 A;  4ZZE A;  4MIJ A;  4FAT A;  4GWW A;  4GX4 A;  1D3K A;  1FPI A;  2V3Q A;  3PUW E;  3KC1 A;  1IXH A;  1Y20 A;  2QL3 A;  2XD3 A;  4R9F A;  3SET A;  1AIV A;  1O63 A;  3H3G A;  1I6B A;  4RNS A;  5CMM A;  3H06 B;  5H8H A;  1YZ0 A;  1LLS A;  1NMU A;  3HCQ A;  1AMF A;  3LSW A;  2DS9 A;  4OHN A;  3VV5 A;  1TFD A;  4PFT A;  2B3F A;  1PB8 A;  4X1D A;  3K01 A;  3KGC A;  3KG2 A;  2ZNS A;  3N6T A;  3TQW A;  3KN3 A;  3I6V A;  5FTI A;  2ZMB A;  1TWY A;  1OLA A;  1J1N A;  4MF3 A;  1FQF A;  4G8M A;  1SI1 A;  3G3J A;  3L6G A;  2DVC A;  3T96 B;  3RPW A;  2WYP A;  3F11 A;  1IZ1 A;  3QMF A;  1MQH A;  5HBC A;  5I56 B;  2RC9 A;  5ICQ A;  2F36 A;  1B1H A;  3RTF B;  3MST A;  4KCD A;  4FOR A;  4PFB A;  4GWY A;  4EF2 A;  4FBP A;  4LUB A;  1MQD A;  1N3W A;  5IAI A;  1I6Q A;  3IOT A;  3Q25 A;  4BDM A;  2E1S A;  5EQ8 A;  4N91 A;  3FVN A;  4PF8 A;  1P99 A;  2CMO A;  1NH7 A;  1SDX A;  3OO7 A;  2GHB A;  4JVD A;  2HHM A;  3ZKL A;  4H6D A;  2FBP A;  1R9L A;  3HO7 A;  3TOD A;  5CMK A;  1MRP A;  4TLM B;  3CVG A;  5TP9 A;  3V89 B;  1FPE A;  4GX3 A;  2PFZ A;  1ELJ A;  4F19 A;  4BDN A;  4LON B;  4O3A A;  1O7T A;  1WVJ A;  1P1W A;  1RKM A;  3B6Q A;  3IO6 A;  1YTV A;  4EQB A;  4QSC A;  5EYH A;  2F6P A;  4R2F A;  5T3J A;  4OQO A;  1FCK A;  1NV5 A;  3UP9 A;  3MPK A;  4I3Y A;  1VDW A;  3KFM A;  4IB2 A;  3RTW B;  3HHF A;  3TUS A;  3QUJ A;  2O84 X;  3RQT A;  1N04 A;  4DDD A;  5I2K A;  1EYI A;  3K2D A;  3LSF B;  4OFJ A;  4XIG Q;  4JWY A;  4YMA A;  2DSF A;  1H44 A;  5TP9 B;  3G3H A;  4PAF A;  3H6U A;  4FEB A;  4GOT A;  5M2V A;  4P3L A;  1D9V A;  5EQ7 A;  1UIU A;  4OVR A;  1CB6 A;  1NV1 A;  2R9J A;  2ZXT A;  2H9B A;  1A7L A;  4BDO A;  2KR0 A;  4N8Y A;  3MVX A;  2XXY A;  5IGA A;  4NF5 B;  1BLF A;  5FHN A;  4PFU A;  1Q9D A;  3MP6 A;  3OD7 A;  3G3K A;  4DXB A;  1FW0 A;  1URG A;  3EKI A;  3VVE A;  4MBP A;  2Q88 A;  4TQU Q;  2P2A A;  2I49 A;  4EXK A;  4F3P A;  4Z7E A;  4Q5T A;  4ND9 A;  1I6A A;  3VFJ A;  1INP A;  2GHA A;  4PBH A;  4R6H A;  2PMS A;  4DI4 B;  2WBB A;  2HQ0 A;  1FBC A;  4NX1 A;  5HPQ A;  3IX1 A;  5H8F B;  5CMB A;  2F78 A;  3Q28 A;  2FIX A;  4YB6 A;  3O97 A;  3CSB A;  4IO3 A;  4OVS A;  1NH8 A;  4FED A;  3U93 A;  1FRP A;  2YJP A;  4RPN A;  2R8T A;  3O6G A;  1MXZ A;  1AWB A;  2ONR A;  2DXR A;  3FD3 A;  4IGT A;  4XTC Q;  1FQA A;  2O51 A;  3OO8 A;  4GXS B;  3FIR A;  4RK9 A;  4KYS A;  2DE4 A;  4BDR A;  1P1U A;  2WKY A;  3DLN A;  1JNF A;  1US4 A;  3KSJ A;  3L6H A;  4KD5 A;  2ZZW A;  4EXL A;  3G3I A;  3M3L A;  4HS7 A;  1P1O A;  1USY H;  2WYK A;  4AQ4 A;  4OFL A;  4C0R A;  3T9H B;  2UVH A;  4I62 A;  3BFT A;  3Q27 A;  1NUY A;  4YKJ A;  3B7D A;  4PE3 A;  2IA4 A;  1Z7N E;  1LEV A;  1XT8 A;  4QHQ A;  1BK4 A;  1R6Z A;  4NGU A;  1JVY A;  5DVI A;  2FYI A;  3GZG A;  3LSX A;  1T0K A;  4OVP A;  3E78 A;  1MH4 A;  4NAP A;  3IL1 B;  4WXJ A;  3RYD A;  4JSO A;  4E0W A;  2H98 A;  3W15 C;  4NMY A;  1UTB A;  3FUZ A;  4H45 A;  4MLV A;  1B7H A;  1SI0 A;  3OO9 A;  4QBA A;  4KI0 E;  4R6Y A;  5CRY A;  3TAJ A;  2ZZX A;  3KJ7 A;  3OEK A;  1VFE A;  3MC2 A;  5DEX A;  3K6W A;  1JEU A;  2QVU A;  1ATG A;  4ECF A;  4OVT A;  3LC8 A;  1QKB A;  1EYK A;  2DWJ A;  1JW1 A;  4NE4 A;  1DBZ A;  5CC2 A;  1G0I A;  3K1P A;  1UQW A;  1NNT A;  3UK4 A;  2A5T A;  4C1U A;  2B3B A;  4PE5 B;  1PDA A;  3FAS A;  3T66 A;  1AOV A;  1JEV A;  4N6P A;  5JTY B;  1OIB A;  4PGP A;  2L5V A;  3ODB A;  3T9U A;  1DOT A;  4R72 A;  5IZ1 A;  2H25 A;  3E3K A;  1S9T A;  1B46 A;  1LCF A;  4LZ5 A;  2GFE A;  1FQB A;  5KCJ B;  2UXA A;  1VSO A;  1SYH A;  4MCO A;  2I48 A;  3C36 A;  1B6H A;  3T0J A;  5LDZ A;  2X7Q A;  1II5 A;  3EQ1 A;  3VVF A;  1BIY A;  3Q29 A;  3PD8 A;  1DSN A;  1NL5 A;  4U1O A;  4H5F A;  3TCH A;  4KCC A;  2Q74 A;  1NV0 A;  4QFL A;  2ZNU A;  3G3F A;  5FHM A;  1D4N A;  4PAK A;  1N7X A;  1S50 A;  2PT2 A;  2ESN A;  1MXV A;  3M3K A;  4OEU A;  2F34 A;  3SDF A;  5ET5 A;  2G29 A;  5EHM A;  5JTY A;  5A5L A;  4LQ5 A;  1M5C A;  1A55 A;  3TEL A;  3TKD A;  3PTY A;  1EU8 A;  3KZG A;  4P1L A;  4KQP A;  2Y5K A;  2I0B A;  5L9M A;  1KA0 A;  1DPP A;  4FEC A;  2QS3 A;  3SZP A;  3H6V A;  2DP8 A;  1LBY A;  1SPI A;  2DDK A;  1H3D A;  4JWX A;  3IB1 A;  4P9K A;  2F8D A;  4Z0I A;  3C34 A;  2DXY A;  3E79 A;  4IO4 A;  3O6I A;  4N07 A;  4L17 A;  3I3V A;  3I5O A;  3MUQ A;  4GWX A;  3RUM A;  2XA5 A;  2QS1 A;  3U1O A;  3CHG A;  4GFR A;  4U23 A;  2OLB A;  3DP4 A;  3VLV A;  2GH9 A;  4GWO A;  4JXI A;  2DWH A;  3K6V A;  2F7A A;  1DTZ A;  2Z22 A;  4XKQ A;  2UYE A;  1MM6 A; 
#chains in the Genus database with same CATH homology
 2UVI A;  2Z23 A;  4Q0C A;  1B9J A;  2RC9 A;  5AA4 A;  3CRB A;  5ICQ A;  3OMB A;  1FTJ A;  4YB5 A;  2F36 A;  1B1H A;  3RTF B;  4F3B A;  4KCD A;  4POW A;  5H8H B;  5I84 A;  1I69 A;  1NFT A;  1Y1M A;  1DTG A;  2I3W A;  4KYE A;  5LOM A;  4FOR A;  1HSL A;  2NVU B;  3CSG A;  1MXU A;  3UN6 A;  5KDT A;  4MLQ A;  2QS4 A;  5DEX B;  3SEX A;  1QUL A;  4JSD A;  5J1D A;  4GF8 A;  4ZS9 A;  3S9N C;  4DCY A;  4JB7 A;  4R73 A;  3WAF A;  4KFQ A;  1YCJ A;  4EF2 A;  4F39 A;  4AB5 A;  4LUB A;  4IO6 A;  1MQD A;  1N3W A;  3MP8 A;  5IAI A;  3OEN A;  1I6Q A;  3IOT A;  4OZ9 A;  3Q25 A;  1B4H A;  3S9E A;  3TTK A;  1OVT A;  1JVX A;  4BDM A;  1F9B A;  2E1S A;  3O29 A;  1B51 A;  4GL8 A;  4DXU A;  1AL3 A;  3K1M A;  2I58 A;  3FVN A;  1EZ9 A;  1Y4T A;  3SKP A;  1P99 A;  4RY1 A;  3TCF A;  2DE3 A;  2XD2 A;  2OZZ A;  3OEL A;  3FXU A;  2CMO A;  2QSX A;  1IXC A;  1CE2 A;  3C4M A;  1NH7 A;  3MVY A;  3ZKK A;  2BJJ X;  1SDX A;  1XVX A;  3D4G A;  3HN0 A;  3OO7 A;  1B7Z A;  1IIW A;  2GHB A;  3H03 A;  4P0G A;  4OFO A;  4F18 A;  5CBS A;  3ZKL A;  5H8N A;  4F22 A;  3KJT A;  4H6D A;  1BKA A;  3SER A;  3BBR A;  1R9L A;  1DPE A;  2XXH A;  1IXI A;  1MDQ A;  2W7Y A;  1H76 A;  3HO7 A;  1GVC A;  2HAV A;  1ZBM A;  3TOD A;  4GD5 A;  2PBW A;  3T22 A;  1H43 A;  5CMK A;  1MRP A;  4TLM B;  3CVG A;  3IOV A;  2D21 A;  2RC8 A;  5TP9 A;  1H45 A;  1HSE A;  2QMX A;  3LUY A;  3MAM A;  5F1Q A;  3V89 B;  1Y3P A;  1ELJ A;  4F19 A;  1Q35 A;  5TU0 A;  3C32 A;  3FVO A;  3LSL A;  1MPD A;  5ICT A;  4BDN A;  2FA7 A;  4LON B;  1MY4 A;  3PUX E;  3FJM A;  4O3A A;  4ZED A;  1O7T A;  1SD3 A;  5BWJ A;  1EZO A;  2HEU A;  1WVJ A;  1P1W A;  1RKM A;  3PMV A;  2O6A A;  1UTH A;  2PYY A;  1B3E A;  3B6Q A;  3VLW A;  3IO6 A;  1LFH A;  1YTV A;  2VD2 A;  2XXR A;  3CFL A;  4QSC A;  4EQB A;  4M1V A;  5I59 A;  4THI A;  3IOR A;  3CG1 A;  4H65 A;  2Q8J A;  1B5I A;  4I9D A;  3C9H A;  5AE4 A;  2F6P A;  3FV1 A;  4H8I A;  4R2F A;  4EF1 A;  2AL4 A;  4QFK A;  4OQO A;  3E4R A;  4ZDM A;  1FCK A;  4LP2 B;  1Q1K A;  3UP9 A;  2O68 A;  1LB9 A;  2V3U A;  3CR9 A;  3MPK A;  2REJ A;  4GXA A;  4M4G A;  5FHO A;  1MY1 A;  4G4P A;  4OWD A;  4DIG A;  2LAO A;  1FQC A;  1OQH A;  4F31 B;  2XX8 A;  1LAH E;  2I3V A;  4R2B A;  3IJX B;  3TTL A;  1B2H A;  2KLF A;  3KFM A;  4IB2 A;  3RTW B;  4ZE9 A;  3IJO B;  3HHF A;  1UTH B;  3TUS A;  3QUJ A;  1VE4 A;  4NED A;  3K02 A;  2O84 X;  1HSJ A;  3GBA A;  4HTG A;  3RQT A;  3U94 A;  1N04 A;  1XS5 A;  4H8J A;  3TQL A;  4JBZ A;  5AA2 D;  1IEJ A;  3EHS A;  3GXA A;  1UTB B;  4RXL A;  1GR2 A;  4DDD A;  5I2K A;  1MQJ A;  3RT8 A;  3PUZ E;  3USD A;  3K2D A;  4EQ7 A;  3UOR A;  1B3G A;  3LSF B;  3HHG A;  1MXX A;  4OFJ A;  4XIG Q;  5HM4 B;  3S9M C;  1LCT A;  1PBQ A;  4BLA A;  3KEI A;  4JWY A;  2P0S A;  1UIV A;  4DLD A;  4YMA A;  2I4C A;  2DSF A;  3PV0 E;  3DP8 A;  3ZS6 A;  2AYS A;  3PPR A;  3TEP A;  1H44 A;  3T9V A;  4HCY A;  5TP9 B;  3G3H A;  3OEM A;  4K3F A;  2XX7 A;  3VE1 B;  3PGF A;  1NNK A;  3MP1 A;  3H6U A;  4FEB A;  1Y1Z A;  1A40 A;  3O66 A;  4GOT A;  2HCA A;  5M2V A;  3N94 A;  1MY0 A;  4GL0 A;  5TPA A;  3KOS A;  2I0C A;  3R7X A;  5AA3 A;  4P0I A;  3T93 B;  3FV2 A;  1N76 A;  2DE2 A;  3QYT A;  1D9V A;  3K6U A;  1NNP A;  2NUV A;  5H8F A;  1UIU A;  1RYO A;  4PET A;  4U4S A;  1CB6 A;  3PUY E;  3T66 A;  4OYV A;  4NF8 B;  5A5X A;  1FTL A;  1SVX B;  2R9J A;  2ZXT A;  3B6T A;  3IK6 B;  4BDQ A;  3OXN A;  4GRK A;  2H9B A;  4X9T A;  1A7L A;  3K1N A;  4BDO A;  4OXV A;  4ELO A;  1B4Z A;  4WEP A;  3SES A;  3P7I A;  3MVX A;  2XXY A;  2I4B A;  2YLN A;  4NF5 B;  1BLF A;  2HAU A;  3FZV A;  4PFU A;  3CIJ A;  4I1D A;  4R74 A;  4XKP A;  5FHN A;  3S2V A;  3SEV A;  5AA2 B;  5CM6 A;  3C35 A;  2Z8F A;  3PMW A;  5KCJ A;  3MP6 A;  4AB6 A;  1PB9 A;  1LAF E;  4ZZA A;  4PP0 A;  4TLL B;  3OD7 A;  3G3K A;  4DXB A;  1FW0 A;  1URG A;  3QK6 A;  3GBB A;  2OCU A;  1EZP A;  1SW5 A;  2O7I A;  4ZEB A;  3VVE A;  4MBP A;  1N7W A;  2Q88 A;  4IY6 A;  3FAT A;  2Q9T A;  4EDP A;  4ELP A;  2Y84 A;  4TQU Q;  3PPP A;  3U72 A;  2P2A A;  2DWA A;  1GGG A;  3EPE A;  3OSQ A;  2I49 A;  3B6W A;  1MM7 A;  3C33 A;  4EXK A;  1MY2 A;  4F3P A;  4LZ7 A;  4YMB A;  3QSL A;  4Z7E A;  4U22 A;  4Q5T A;  4ND9 A;  2ONK E;  1Z7M E;  1Y3N A;  1I6A A;  1ANF A;  3VFJ A;  3CFZ A;  4RPO A;  2F7C A;  2ALU A;  4G77 A;  1DMB A;  4QF9 A;  5H8Q A;  4GIZ A;  4IO2 A;  3V8X B;  2GHA A;  2OWS A;  4R6H A;  1QKA A;  2PMS A;  3KSX A;  1MS7 A;  3DM0 A;  2HQ0 A;  5L8D A;  3W9W A;  4RA1 A;  3VVD A;  4G68 B;  5ELV A;  3VXC A;  1YPN A;  5HPQ A;  2Z8E A;  3A09 A;  3IX1 A;  5H8F B;  4QSE A;  5ISU A;  5CMB A;  1O64 A;  3K0V A;  4G68 C;  4NF4 A;  4QFN A;  4EUO A;  4UAC A;  2F78 A;  2ZNT A;  2RF1 A;  3Q28 A;  3RT6 B;  4HW8 A;  4DZ1 A;  4YB6 A;  1OQG A;  5ITP A;  1IXG A;  3VXB A;  3FJ7 A;  2Q2A A;  3O97 A;  4YIC A;  5KDT B;  3CSB A;  4IO3 A;  4NWD A;  3THI A;  3FGS A;  2XXT A;  1NH8 A;  1WDN A;  4FED A;  3QIM A;  5FTH A;  5H8Q B;  3H4Z A;  3U93 A;  4IO7 A;  4QSD A;  4FIM A;  5AA2 A;  4FAJ A;  1XOC A;  1B3L A;  1QVS A;  4ESW A;  2D5W A;  3O9P A;  1ZMG A;  2YJP A;  4KPT A;  4OMB A;  4RPN A;  3ILU B;  2O1M A;  1GTK A;  3MZ9 A;  3O6G A;  1MXZ A;  4LA9 A;  2Y7P A;  4GLI A;  1N0T A;  2UVJ A;  3IAZ A;  3M3F A;  4MH5 A;  3VDF A;  2G93 A;  2GRV A;  2ONR A;  4F1U A;  1A99 A;  2DXR A;  2RC7 A;  2AL5 A;  2RIN A;  2V84 A;  3FD3 A;  1FTO A;  1PEB A;  3MPL A;  4IGT A;  4XTC Q;  1FQA A;  2O51 A;  3MJN A;  3EN3 A;  3HST A;  3OO8 A;  4GXS B;  2B65 A;  2ONS A;  3FIR A;  4KYS A;  2DE4 A;  4RK9 A;  4TOZ A;  5EYF A;  3KBR A;  4BDR A;  1P1U A;  1B0H A;  2PX1 A;  3KN7 A;  4X48 A;  3OO6 A;  4H1X A;  1OLC A;  4Q8R A;  1MQI A;  2WKY A;  3DLN A;  4IY5 A;  2QS2 A;  2A5S A;  3IOW A;  1JNF A;  1NKX A;  1B3H A;  3RLF E;  3W9V A;  1PB7 A;  2UVG A;  1IIT A;  3T9X B;  3CG3 A;  1US4 A;  4H0W A;  5I57 A;  3KSJ A;  1FQE A;  3L6H A;  1POT A;  4NF4 B;  3G7W A;  4KD5 A;  5H8N B;  3MWB A;  1B32 A;  2XXU A;  3K4U A;  3TQW A;  5I2N B;  1B58 A;  1S7Y A;  1N84 A;  1MDP 1;  1USY E;  3G3I A;  3MQ9 A;  4EXL A;  2HZL A;  4F2O A;  3M3L A;  3M8U A;  4O3C A;  4ZEK A;  3H6T A;  2YPN A;  4HS7 A;  3CI8 A;  1B3F A;  1P1O A;  4OET A;  3PUV E;  1NNF A;  1USY H;  1VR5 A;  2D3I A;  4OFL A;  4AQ4 A;  3T9H B;  2UVH A;  4QFP A;  4C0R A;  3GLB A;  4E0X A;  4I62 A;  1R1N A;  4WED A;  3O2A A;  1XC1 A;  3BFT A;  3Q27 A;  3PPN A;  1B0L A;  1LAG E;  3QAX A;  4YKJ A;  1Y4C A;  3B7D A;  3V5A A;  2XXQ A;  1URS A;  2NWJ A;  1TFA A;  2IA4 A;  4KYD A;  4XXU A;  4FJP A;  5I58 B;  1Z7N E;  5JEI A;  1JW4 A;  3H6W A;  1XT8 A;  4QFO A;  3WAE A;  4QHQ A;  1R6Z A;  4IO5 A;  5DTB A;  4YKK A;  3RGY A;  1JVY A;  5DVI A;  3RNN A;  2RCA A;  2FYI A;  3KN8 A;  3GZG A;  5DT6 A;  3LSX A;  1B1X A;  1T0K A;  4XKN A;  3LR1 A;  4G68 A;  4POX A;  4F3S A;  3R6U A;  4JDF A;  4X1B A;  2DOJ A;  4R9F A;  4R75 A;  2I6E A;  1MH4 A;  3A3C A;  1BTJ A;  1B5H A;  4G2Z A;  3PPO A;  5DYH A;  3IL1 B;  4WXJ A;  2QPQ A;  4JSO A;  2NOO A;  4E0W A;  2H98 A;  3W15 C;  4NMY A;  4QRZ A;  1P1Q A;  1UTB A;  1IQ7 A;  2F97 A;  4ESX A;  3FUZ A;  3JZJ A;  3ILT B;  3SEU A;  4MLV A;  5B70 A;  3V83 A;  1B7H A;  1SI0 A;  2NXO A;  3OO9 A;  3TZA A;  3IR1 A;  4F3G A;  2Y7R A;  1N3X A;  3H7M A;  1YAE A;  3MBP A;  4KI0 E;  2QJE A;  4R6Y A;  4YAH X;  5CRY A;  3TPA A;  4LVQ A;  3TAJ A;  1MH3 A;  4U2R A;  3KJ7 A;  1FQD A;  1URD A;  3OEK A;  1VFE A;  4ZEC A;  3TYH A;  2O69 A;  3IB0 A;  3MC2 A;  2OJT A;  3E13 X;  2DWI A;  1JEU A;  3K6W A;  5DEX A;  5ITO A;  3TTR A;  2V3T A;  1ATG A;  2ANJ A;  5IKB A;  3TDJ A;  2VOZ A;  1A8E A;  3OOA A;  3PMX A;  4OVJ A;  1QKB A;  2DWJ A;  3LC8 A;  5H8S A;  1Y9U A;  2DYX A;  1JW1 A;  3D4C A;  3EF7 A;  4NE4 A;  4F1V A;  2ZYO A;  1FTK A;  2IEE A;  5EHS A;  1MY3 A;  3MZ1 A;  4I8C A;  4DCX A;  5CC2 A;  4O3B A;  1LB8 A;  3K1P A;  3DEL B;  3MZB A;  2P1S A;  5I56 A;  4ZEF A;  4ISU A;  1P1N A;  1UQW A;  4P11 A;  1NNT A;  4ONY A;  3UK4 A;  2A5T A;  1QUI A;  3N6U A;  1POY 1;  4C1U A;  3UGW A;  2B3B A;  3Q26 A;  1D9Y A;  1PDA A;  1SBP A;  3FAS A;  1M5B A;  4PE5 B;  4PFW A;  1JEV A;  4GVO A;  2PT1 A;  2R71 A;  3K6X A;  1AOV A;  4XKR A;  2XHD A;  4N6P A;  4RK2 A;  4OEN A;  1LAX A;  1QUJ A;  1OIB A;  2H4I A;  4MFI A;  4PFY A;  5JTY B;  5A5X B;  4H5G A;  3HPI A;  3ODB A;  1FTM A;  1MG1 A;  1ZJL A;  3IB2 A;  3E9X A;  3MW0 A;  5F7V A;  3T9U A;  2REG A;  1DOT A;  2H25 A;  3E3K A;  1S9T A;  1B46 A;  1LCF A;  4R72 A;  2THI A;  2DQV A;  4LZ5 A;  4G8N A;  1LGB C;  1FQB A;  2GFE A;  3SEY A;  4F1Y A;  4ZEI A;  5KCJ B;  2UXA A;  1VSO A;  5L9S A;  5KZT A;  1SYH A;  3PPQ A;  4ELQ A;  1LBC A;  3KOT A;  1A8F A;  3FVG A;  1ZLQ A;  2I48 A;  3C36 A;  4OEV A;  1B6H A;  3PD9 A;  2X7Q A;  1II5 A;  3EQ1 A;  4N13 A;  3VVF A;  3ECR A;  1BIY A;  3N5L A;  3RY3 A;  2H5Y A;  3Q29 A;  4R6K A;  1SW2 A;  3U92 A;  2V93 A;  3PD8 A;  4NF5 A;  4U21 A;  2XXI A;  3TMG A;  1DSN A;  1OVB A;  3AXF A;  2PVU A;  1NL5 A;  1GV8 A;  4ELR A;  1SW4 A;  3TFL A;  3A3U A;  3N26 A;  4U1O A;  3BKI B;  4H5F A;  1M5F A;  3TCH A;  3IO4 A;  4KCC A;  4F2Q A;  1LBB A;  2A5T B;  3DP6 A;  4C1T A;  4QFL A;  4NF6 A;  4JWO A;  2ZNU A;  3G3F A;  2HZK A;  5FHM A;  4ZE8 A;  1WOD A;  4KHZ E;  1D4N A;  1ZU0 A;  4YB7 A;  1TT1 A;  4NTL A;  4YKI A;  1N7X A;  3VLU A;  2XXV A;  4DXC A;  1S50 A;  1KWH A;  2ESN A;  1MXV A;  2PT2 A;  3M3K A;  1XHY A;  4FE8 A;  4UA8 A;  4PQJ A;  2F7B A;  1MQG A;  1IUD A;  1ZIU A;  2ZYK A;  3FJG A;  4OEU A;  3UIF A;  1JET A;  2F34 A;  3K00 A;  3SDF A;  3TCG A;  5CBR A;  5L9O A;  4R9G A;  1L5T A;  2XXX A;  2F5X A;  5DVJ A;  4DE8 A;  3C31 A;  2G29 A;  5EHM A;  1MPB A;  5AA4 B;  4Q30 B;  1QJM A;  2Y7W A;  3G3G A;  5CI5 A;  5JTY A;  5I59 B;  2UYF A;  1QW0 A;  1A54 A;  1M5C A;  1A55 A;  4HCW A;  4LQ5 A;  4OTE A;  5DVF A;  5I2K B;  2R6G E;  3TEL A;  3TKD A;  3QXM A;  2CZL A;  3LBS A;  3ZSF A;  1BP5 A;  1OMP A;  2F35 A;  1EU8 A;  3CFX A;  3KZG A;  4KR5 A;  5BUU A;  4KQP A;  3S9L C;  4F29 A;  2I0B A;  4BDL A;  1ZKB A;  1B52 A;  1EH3 A;  2XXW A;  2DVZ A;  1R9Q A;  4LQ2 A;  5L9M A;  4ZZE A;  3SEW A;  4ECF A;  3IOU A;  5AA1 A;  2HXW A;  2VP1 A;  4FAT A;  2E0S A;  5I2N A;  5K2Y A;  1D3K A;  1DPP A;  4FEC A;  5CMC A;  3UA8 A;  2V3Q A;  2QS3 A;  2M8C A;  3H6V A;  1B40 A;  3PUW E;  4EQ9 A;  5I57 B;  2RKM A;  1B5J A;  3MVW A;  2FNC A;  2DP8 A;  1IXH A;  1TXF A;  2X7P A;  1Y20 A;  1B05 A;  1M5E A;  2QL3 A;  1VFD A;  1MXY A;  2XD3 A;  2Q89 A;  1SYI A;  3O28 A;  3R26 A;  4NWC A;  1O63 A;  1RYX A;  1AH5 A;  1XVY A;  3OSR A;  3SET A;  1AIV A;  3H3G A;  1I6B A;  4RNS A;  1H3D A;  5TPA B;  4JWX A;  1SW1 A;  2X26 A;  5CMM A;  4G8H A;  3PU5 A;  1ZTY A;  3H06 B;  5H8H A;  1LLS A;  1PC3 A;  3S4U A;  1NMU A;  3IB1 A;  2ABH A;  2O1L A;  2Y7K A;  3HCQ A;  4YKP A;  1AMF A;  3FVK A;  2F8D A;  3LSW A;  4NF8 A;  2XX9 A;  4Z0I A;  1MXW A;  3C34 A;  2DXY A;  3JV9 A;  1LFI A;  2DS9 A;  3O6I A;  4IO4 A;  1M5D A;  1TFD A;  4N07 A;  4OHN A;  4WKM A;  3VV5 A;  4L17 A;  1PBP A;  1US5 A;  2OBG A;  3EHU A;  2HFB A;  3I3V A;  5B7D A;  4PFT A;  2AIX A;  1LST A;  2B3F A;  3ONM A;  4RYA A;  3U8Q A;  3HV1 A;  1PB8 A;  1Y3Q A;  2H99 A;  2VGQ A;  3I5O A;  2Z8D A;  4OES A;  4X1D A;  3MUQ A;  3RUM A;  3K01 A;  4OER A;  3TTN A;  2OK2 A;  2Q2C A;  3KGC A;  3KG2 A;  2VD3 A;  2ZNS A;  1JW5 A;  3N6T A;  2RCB A;  2QS1 A;  2F6G A;  2ZYM A;  3I6V A;  3KN3 A;  3O6H A;  3QUF A;  2ZMB A;  4NF6 B;  4RJZ A;  5FTI A;  3JYR A;  3U1O A;  4GFR A;  1TWY A;  1QUK A;  2ZYN A;  1JQF A;  1OLA A;  1J1N A;  2VHA A;  3EHT A;  4MF3 A;  4YZZ A;  1FQF A;  4G8M A;  4U23 A;  1LFG A;  4U1Z A;  2OLB A;  3DP4 A;  1SI1 A;  3VLV A;  2GH9 A;  2O7U A;  2QMW A;  3G3J A;  3L6G A;  3MVZ A;  4GWO A;  4YU0 A;  5I58 A;  3RN8 A;  2XXP A;  2DVC A;  4JXI A;  4LAT A;  2DWH A;  3K6V A;  3T96 B;  3RPW A;  5K2X A;  3FXQ A;  2F7A A;  4LZ8 A;  3F11 A;  1IZ1 A;  2OWT A;  2QRY A;  2Y7I A;  1DTZ A;  1MQH A;  2Z22 A;  1SQY A;  3BFU A;  4IGR A;  3TTM A;  2V25 A;  4XKQ A;  4H67 A;  5JK4 A;  4GQO A;  5HBC A;  1MPC A;  2UYE A;  1B7U A;  1MM6 A;  5I56 B;  3FXR A;  4U4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...