4BDOA

Crystal structure of the gluk2 k531a-t779g lbd dimer in complex with kainate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
250
structure length
242
Chain Sequence
RSLIVTTILEEPYVLFKKLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSAPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKIGIAILQLQEEGKLHMMKEKWWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
publication title Correlating Efficacy and Desensitization with Gluk2 Ligand-Binding Domain Movements.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal transport
total genus 77
structure length 242
sequence length 250
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4bdoA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4bdoA02
4LATA 3M3FA 1WVJA 4OERA 1MXXA 3I6VA 1D9VA 1SW5A 5FHNA 3MVZA 1LBBA 3B7DA 4G8NA 1XOCA 2NWJA 1H45A 1B3LA 1YAEA 2PYYA 2DXRA 2ESNA 3VDFA 2ALUA 1TWYA 2NXOA 2V3TA 3TEPA 4RPOA 1R9QA 3TTRA 3KSXA 2QMWA 4U2RA 1MPDA 1BKAA 1FTOA 5TPAA 2Z8DA 1DTGA 3OO7A 2OLBA 1MY4A 2Y84A 5DYHA 3VV5A 4O3CA 1B2HA 3HHFA 3FATA 3C36A 2A5SA 5L9SA 1FTJA 3MZBA 2B65A 4YKKA 4H5FA 4DLDA 5ELVA 3M3LA 1FQDA 2H99A 2A5TA 5A5XA 2OK2A 2ONRA 3Q26A 2XXIA 3SEUA 1VFDA 3CSGA 3ZKLA 3T93B 2VP1A 2B3BA 2O51A 1QW0A 4GVOA 3EHTA 1MQHA 2Q8JA 1NMUA 3N6UA 4G68C 4IO7A 4LA9A 1FTLA 1BIYA 3KEIA 2QS1A 3UN6A 4KHZE 1BLFA 3IOUA 3VLUA 4Z0IA 3KBRA 1ZJLA 1JVXA 3VE1B 2Q9TA 4QFLA 3BKIB 3TTKA 5AA2A 4U1OA 2XD2A 4OETA 4H1XA 1JEVA 1US4A 3FV2A 3KFMA 3KGCA 2RF1A 3MP1A 2DWHA 1OQHA 4NWCA 2HAUA 4F39A 1I69A 2QSXA 5KCJA 1Y3QA 1D9YA 2UVJA 3MQ9A 1PC3A 4XTCQ 3ILTB 5HBCA 1Q35A 4PQJA 2XXTA 4KYEA 2F34A 1P1OA 1LFGA 3HSTA 1B1HA 4RPNA 1O64A 1FQFA 5FHOA 1MY3A 3GZGA 3SDFA 4Q8RA 3UIFA 3MPKA 1JNFA 2F36A 2I3VA 1CB6A 1LGBC 1FQEA 2F7BA 4YB7A 3K4UA 3T9VA 1H43A 3OEKA 4R2BA 3LSLA 3MZ1A 3KOTA 4GXSB 3S4UA 4MLQA 3HN0A 2F35A 3H6TA 3K2DA 3HCQA 4U21A 1LFHA 4GF8A 1MPCA 3N26A 4G77A 1T0KA 4P11A 1B0HA 3RQTA 3LSWA 3KSJA 4BLAA 3D4CA 4NF8A 5EHSA 4YZZA 2OCUA 4OWDA 3ILUB 5I56A 4GXAA 5I58A 2H9BA 4MF3A 3H4ZA 1KWHA 4YU0A 1Y1MA 4NF5B 4F3GA 5H8NA 2ONSA 5I84A 3CVGA 3VVDA 3TFLA 1B52A 3ZKKA 4RNSA 3RTWB 3OO9A 2OBGA 1AOVA 3C34A 4RXLA 1DSNA 4DIGA 1PEBA 3O6IA 3BBRA 2E1SA 4MBPA 3FZVA 1MY1A 1VSOA 4H0WA 3TTMA 2QS3A 3W15C 4Q0CA 2Y7WA 3R7XA 4G8HA 5ICQA 2VD3A 4WXJA 4YKJA 5CI5A 4FAJA 1B5HA 3MJNA 3PU5A 2DSFA 3KJ7A 1MH4A 2ZYNA 2XXRA 5HPQA 1IUDA 2O84X 4ZEBA 4M1VA 2XHDA 1MQJA 4U4SA 5EHMA 2I58A 5H8QA 2H4IA 1HSLA 1PB7A 2AL5A 5CBSA 5CMCA 3FGSA 3B6WA 4FATA 4LQ2A 3TCHA 4F1UA 4UACA 4PE5B 5TPAB 2RCAA 3TKDA 2B3FA 2HXWA 4GL8A 4R73A 1IQ7A 1L5TA 1MG1A 2LAOA 5I2NA 4E0XA 1N3XA 3FVOA 1ANFA 3MC2A 4GWOA 1JW1A 4EUOA 1P1WA 1O63A 2OWTA 3AXFA 4G4PA 1B7UA 4H8JA 3C35A 2PX1A 4PFUA 3IOVA 4BDLA 3GBAA 2A5TB 3PV0E 1MM6A 5A5XB 4EQBA 3B6QA 3EF7A 4PFTA 4Z7EA 1AL3A 3C9HA 4KCCA 1USYE 1JEUA 1P99A 3QXMA 2REJA 4KCDA 3GBBA 4IO4A 3O6HA 1GR2A 2DVCA 3O28A 5JK4A 4R6KA 2ZNTA 3U8QA 3WAFA 3CG1A 2F78A 1EZOA 4ELPA 5AA2B 5DTBA 3VXBA 5IAIA 2R6GE 1WODA 2I48A 1IXIA 3IB1A 3LSFB 3CR9A 3HV1A 4U22A 2ZXTA 1NH8A 2DQVA 2OWSA 1M5EA 1II5A 2DE3A 3EPEA 4TQUQ 4WEPA 3W9VA 5KCJB 4IGTA 1NNPA 1UQWA 2GHAA 4EDPA 4ZECA 3TDJA 2XD3A 3MVYA 3PPNA 2V25A 4QSDA 3SETA 4F18A 4ZEDA 1S50A 3FVKA 3JV9A 4JSDA 3RPWA 3RN8A 1M5FA 4JXIA 1D3KA 4JWYA 4I62A 3MVWA 2E0SA 1FQAA 4RJZA 4RY1A 3OO6A 4TLLB 4AQ4A 2Z8FA 2Y7PA 5JTYA 4ELQA 5I59A 1UTHB 3EHSA 3LSXA 2O1MA 4EQ9A 4ZEIA 4AB6A 1NNTA 2ZNSA 2D3IA 4R75A 3G3KA 1JW5A 5DVFA 3V8XB 3PPQA 3JYRA 3K0VA 3FUZA 4RYAA 4NF8B 4NEDA 2UYEA 1N04A 1XC1A 5J1DA 4ONYA 4XKRA 1IEJA 5I58B 5I56B 3DLNA 1N7XA 1B05A 1Z7NE 2NUVA 5H8NB 3C32A 4WKMA 1I6BA 1QKBA 1N84A 4RK9A 4DDDA 1LSTA 1P1NA 2F6GA 5H8SA 1XVXA 4RA1A 2GHBA 3CFZA 4FJPA 1MRPA 3S9LC 2O69A 1Y4TA 3QAXA 1QUKA 1Y1ZA 4KI0E 3H03A 4F22A 2DXYA 5BWJA 4IO5A 2ONKE 3G3JA 1A40A 1A55A 3IO4A 4LVQA 1DPPA 3MAMA 1FQCA 2RC7A 1YCJA 1B0LA 1LAFE 3IJOB 2ZYMA 4EF2A 1DPEA 1OVBA 1XHYA 1MQDA 1YPNA 4X9TA 1ZBMA 1SI1A 4IY6A 3OEMA 3E9XA 2DE4A 1OVTA 1O7TA 3V5AA 4OFLA 5H8QB 3TMGA 1JW4A 4F31B 4C0RA 2X7PA 5KDTA 1B3GA 4ZS9A 1Q1KA 2KLFA 1N3WA 3IORA 3GLBA 1MM7A 3IK6B 1OLCA 2XXWA 3V89B 2WKYA 1ZIUA 4F1VA 1N7WA 5I2NB 2DOJA 2UVGA 4FORA 1MXUA 3USDA 3LUYA 5CMBA 1SDXA 2Q2CA 2F5XA 4XIGQ 3VVFA 1H3DA 2ZNUA 2CMOA 4OYVA 2F97A 4GOTA 2DYXA 3V83A 4NTLA 3FXUA 4P0GA 1TFDA 3K00A 4G2ZA 2ANJA 3IX1A 4DXCA 4I1DA 3FVNA 1LBCA 4ZDMA 1MXWA 4F2OA 1DMBA 3MVXA 5HM4B 3I3VA 4F3SA 4N07A 5CBRA 2XXXA 3PUVE 4N13A 4LZ5A 3E3KA 1IXGA 3E13X 1IITA 3F11A 4QFKA 5BUUA 3QUFA 3KN7A 5I57A 1UTHA 3O66A 3T96B 2I6EA 1NNKA 4C1UA 3D4GA 4JSOA 3GXAA 4IO6A 2GRVA 2Y7IA 2DWIA 4KQPA 3KG2A 1B3EA 1PDAA 1UIVA 5AA3A 5DVIA 4YAHX 4QFPA 4LUBA 4U23A 2FA7A 4FIMA 4U4XA 3MP6A 2XX8A 2IEEA 1EZ9A 4R74A 4MFIA 3K1PA 4KR5A 3TQWA 3FJ7A 3SESA 2QJEA 3MUQA 3UORA 1SW4A 4IO3A 5ICTA 2FNCA 4LZ7A 2Q88A 4DCXA 1BP5A 4DE8A 3K1NA 4OXVA 1SD3A 1LB8A 3FV1A 5DVJA 5AA2D 4BDRA 1H44A 1Y3NA 3PGFA 1CE2A 1M5CA 3U92A 4LP2B 3TTNA 1HSJA 1MXYA 4PP0A 4N6PA 2ZYKA 3MZ9A 5JTYB 4OZ9A 2O1LA 3HHGA 5I59B 2F7AA 3PD9A 4F29A 4DXBA 3ODBA 4KPTA 2PT1A 2UYFA 3I5OA 2HEUA 4GRKA 4R2FA 3FD3A 4BDNA 2V93A 3PMXA 1B40A 3PUZE 4ZEFA 3TZAA 1LCFA 1XS5A 2YJPA 2QPQA 3THIA 4POXA 3LBSA 3BFTA 3RT6B 3SKPA 4FEDA 4BDQA 1US5A 3MBPA 1R9LA 1QKAA 4OFOA 2VHAA 1HSEA 3RGYA 3TPAA 2XXUA 1GV8A 1NKXA 3RNNA 1VR5A 1URDA 1LAHE 2HFBA 1WDNA 2W7YA 3L6GA 2XXVA 5I2KA 2UVIA 1OLAA 1B5JA 4EF1A 3IL1B 2XX7A 1NL5A 2D5WA 2V3UA 2XXHA 3TTLA 3O6GA 5ISUA 1MPBA 3TUSA 1F9BA 5K2YA 4ZEKA 3OSRA 1BTJA 3LR1A 3BFUA 3OOAA 3TCGA 4BDOA 4JDFA 4OFJA 2GFEA 3U1OA 4DCYA 4EXLA 3SEVA 1M5DA 1S7YA 4GIZA 3TYHA 2XX9A 3Q25A 2V3QA 4HCWA 3T22A 1ZKBA 2XXQA 4JBZA 4U1ZA 3SEYA 4QFNA 3M3KA 1QJMA 3DP8A 4IO2A 4O3AA 4R6YA 3EQ1A 2FYIA 1MQIA 2O68A 3OMBA 3K02A 3O29A 5KDTB 5DEXA 4HW8A 3O97A 3Q28A 3E4RA 3PPRA 2XXPA 3Q29A 2G29A 2DWJA 4MH5A 3S2VA 5IKBA 3VLVA 4HS7A 3TCFA 5FTHA 4DXUA 2YPNA 1QVSA 4IGRA 1LLSA 4OEVA 1B6HA 2RC9A 3G3FA 4OTEA 1SW1A 1ELJA 4G68A 3QIMA 2D21A 4NF6A 3CIJA 4ELRA 1B9JA 4ZZAA 5L9OA 2ZYOA 3OSQA 3VLWA 2CZLA 3RT8A 1OQGA 4YB5A 3QSLA 2Q2AA 3PMVA 4R9FA 4ESWA 4X48A 4TLMB 5DT6A 1ZLQA 4FEBA 1TXFA 1A8EA 3ONMA 3SEWA 1GVCA 4XKPA 5I57B 3LC8A 5L8DA 3UA8A 3CSBA 3FXRA 2I3WA 5CC2A 4FE8A 4R6HA 4MLVA 3C31A 4X1DA 1B4ZA 3WAEA 3N6TA 3G3GA 1XT8A 1Z7ME 3VVEA 3PMWA 2I4BA 3PUXE 4GD5A 3DM0A 4O3BA 4ECFA 5M2VA 4H65A 4HCYA 3DP6A 1PB9A 3FJMA 1MS7A 2HZLA 2I0CA 1XVYA 4G8MA 1J1NA 4R72A 1IIWA 2Z22A 4OEUA 1PBQA 1B51A 3CFLA 1ZMGA 1FTMA 3IOWA 4IY5A 3EHUA 5AE4A 4PETA 5CRYA 3K6UA 4QSEA 2Y7RA 2Y7KA 1DTZA 3U94A 3FJGA 2O7UA 1OIBA 2I4CA 4GL0A 3CFXA 2AL4A 3K1MA 1MQGA 1LCTA 5K2XA 5H8FA 4PFYA 2AYSA 1LAXA 3A3UA 2IA4A 4GQOA 1NNFA 3MW0A 4QSCA 1MY2A 2VD2A 1S9TA 3KJTA 3M8UA 3EN3A 4M4GA 4GFRA 1VFEA 1POY1 3H06B 1B3HA 4RK2A 1MY0A 3A09A 3IO6A 4GLIA 1A7LA 1URSA 4ISUA 5F1QA 4NF4A 2H5YA 3B6TA 3T9XB 5FHMA 1IXCA 4OMBA 2QMXA 1N0TA 1AH5A 2PT2A 3G7WA 2F7CA 5CM6A 5LOMA 3TAJA 3K01A 1SI0A 1IXHA 3R26A 2HQ0A 1MDP1 3CI8A 4QF9A 3O9PA 4EQ7A 1A99A 2ABHA 5AA1A 4OHNA 2X7QA 3U93A 3RY3A 4Q30B 3ZS6A 4TOZA 3ZSFA 4K3FA 3PD8A 1GGGA 1FW0A 5I2KB 3R6UA 4YKIA 1Y4CA 1UTBA 4YKPA 1QUIA 1OMPA 4H6DA 5FTIA 3HO7A 4NE4A 1ATGA 5L9MA 2G93A 3DP4A 1N76A 2DVZA 1B1XA 1PB8A 2VOZA 4KD5A 2YLNA 1AIVA 2THIA 2HZKA 3K6WA 1POTA 2PBWA 4I8CA 1A8FA 4YICA 4LQ5A 4H8IA 1B7ZA 1I6AA 2Z23A 4OENA 5AA4A 4R9GA 1JETA 2R71A 2UVHA 1MXZA 4YMAA 2PMSA 4P0IA 3Q27A 4PFWA 1B58A 4POWA 5TU0A 4ZZEA 1VE4A 3KZGA 5F7VA 4I9DA 3DELB 1NFTA 4QRZA 3VXCA 2QL3A 5CMKA 3KN8A 3A3CA 4H5GA 5DEXB 1QULA 3IJXB 1RYOA 5TP9B 1URGA 3KOSA 3UP9A 1FCKA 1EU8A 1TT1A 3MPLA 2ZMBA 1FTKA 4BDMA 4F3PA 4Q5TA 3SEXA 1JVYA 3QK6A 3QYTA 5B7DA 4YMBA 1SQYA 3OENA 2F6PA 4AB5A 4G68B 4FECA 3N94A 5H8HB 4NF6B 2V84A 3C33A 4WEDA 3RUMA 1B7HA 4UA8A 3IAZA 1QUJA 1TFAA 4XKQA 2H25A 1B32A 1SYIA 4X1BA 2I49A 3OO8A 4YB6A 1M5BA 5B70A 1LB9A 4KYDA 2NVUB 3G3HA 2UXAA 1H76A 2P0SA 5CMMA 4ELOA 2HCAA 2OZZA 2RC8A 1GTKA 3PPPA 2DP8A 2RKMA 4EXKA 2VGQA 2OJTA 1B3FA 2GH9A 3PUWE 3FASA 3FXQA 3N5LA 1ZU0A 3H6UA 3TQLA 1JQFA 1LAGE 1Y3PA 3IB2A 2R9JA 3HPIA 4OESA 3RTFB 1LFIA 1FQBA 2PVUA 2X26A 1PBPA 4F1YA 3FVGA 4XKNA 3IB0A 2RCBA 2O6AA 2Q89A 1DOTA 4OQOA 3C4MA 2P2AA 2RINA 3K6VA 4ZE8A 1MH3A 3PUYE 1MDQA 3P7IA 4C1TA 1Y20A 1SYHA 3CG3A 5H8FB 3SERA 2Z8EA 1A54A 3H7MA 4LZ8A 4IB2A 1I6QA 1P1QA 2H98A 2P1SA 4KYSA 1SVXB 4JB7A 4L17A 4THIA 3OELA 4QHQA 4NF4B 3RLFE 1YTVA 4H67A 2AIXA 2M8CA 1IZ1A 2F8DA 5JEIA 2XXYA 3QUJA 3H6VA 4OVJA 3IOTA 5TP9A 3UGWA 3S9EA 1AMFA 2BJJX 4ESXA 3G3IA 3OD7A 1B4HA 4KFQA 4NWDA 4JWOA 1ZTYA 5KZTA 4NMYA 3T66A 1RKMA 1R1NA 2NOOA 3U72A 1D4NA 2QRYA 5H8HA 1RYXA 3ECRA 1UTBB 1NH7A 2QS2A 3T9UA 4XXUA 1EZPA 1SW2A 3MP8A 3CRBA 3MWBA 1R6ZA 1UIUA 3K6XA 5ITOA 3KN3A 1P1UA 3H6WA 2HAVA 1Y9UA 4JWXA 4NF5A 3L6HA 4F2QA 4F19A 3JZJA 2DE2A 3TODA 1USYH 1B46A 2DWAA 2QS4A 2DS9A 5AA4B 3H3GA 4E0WA 4ZE9A 3W9WA 1EH3A 4HTGA 3S9MC 4ND9A 2I0BA 3IR1A 5EYFA 3VFJA 4QFOA 3T9HB 1MXVA 1B5IA 4DZ1A 2REGA 3UK4A 1SBPA 3PPOA 3FIRA 4F3BA 5ITPA 3TELA 3S9NC 2O7IA 3OXNA 3O2AA 4LONB
chains in the Genus database with same CATH superfamily
4LATA 3M3FA 1WVJA 4OERA 1MXXA 3I6VA 1D9VA 1SW5A 5FHNA 3MVZA 1LBBA 3B7DA 4G8NA 1XOCA 4PDDA 2NWJA 1H45A 1B3LA 1YAEA 2PYYA 2DXRA 2ESNA 3VDFA 2ALUA 1TWYA 2NXOA 2V3TA 3TEPA 4RPOA 1R9QA 3TTRA 3KSXA 2QMWA 4U2RA 1MPDA 3U65A 1BKAA 1FTOA 5TPAA 2FVZA 2Z8DA 1DTGA 3OO7A 2OLBA 4AS4A 5EQ7A 1MY4A 2Y84A 1LEVA 5DYHA 3VV5A 4OVTA 4O3CA 1B2HA 3HHFA 3FATA 3C36A 2A5SA 5L9SA 1FTJA 3MZBA 2B65A 4YKKA 4H5FA 4DLDA 5ELVA 3M3LA 1FQDA 4UABA 2H99A 2A5TA 5A5XA 2OK2A 1FSAA 2ONRA 3Q26A 2B4MA 5EQAA 1FPBA 2XXIA 1IMBA 3SEUA 4MNPA 1VFDA 3CSGA 3ZKLA 3T93B 2VP1A 2B3BA 2O51A 1QW0A 4GVOA 3EHTA 1MQHA 1LBZA 2Q8JA 3EKIA 2WEFA 1NMUA 3N6UA 4G68C 4IO7A 1DK4A 2HPGA 4PGNA 4LA9A 2FBPA 1FTLA 5LTCA 1BIYA 3KEIA 2QS1A 3UN6A 4KHZE 1BLFA 3IOUA 4P47A 4Z0IA 3VLUA 3KBRA 1ZJLA 4X04A 1JVXA 3ROJA 3VE1B 2Q9TA 4QFLA 3BKIB 3TTKA 5AA2A 1FBFA 2VPOA 4U1OA 2XD2A 4OETA 4H1XA 1JEVA 1US4A 4AS5A 3B50A 3FV2A 3KFMA 1DBZA 3KGCA 2RF1A 5EQ8A 3MP1A 2DWHA 1OQHA 4NWCA 4N8GA 2HAUA 4F39A 1I69A 2QSXA 5KCJA 2ZZWA 4NN3A 1Y3QA 4PBHA 1D9YA 2UVJA 3MQ9A 1PC3A 4XTCQ 3ILTB 2FIXA 5HBCA 2CEYA 1Q35A 4PQJA 2XXTA 4KYEA 2F34A 1P1OA 1LFGA 3HSTA 1B1HA 4RPNA 1O64A 1FQFA 5FHOA 1MY3A 5EYHA 3GZGA 3SDFA 4Q8RA 3UIFA 3MPKA 4I3EA 1JNFA 2F36A 2I3VA 1CB6A 1LGBC 1FQEA 2F7BA 2ZZVA 4H45A 4OANA 3K4UA 4YB7A 3T9VA 1H43A 3OEKA 4R2BA 1FPJA 3LSLA 3MZ1A 1NV5A 3KOTA 3A29A 4GXSB 3S4UA 5DW8A 1FBEA 4MLQA 3HN0A 2F35A 3BIHA 4PGPA 3H6TA 3K2DA 3HCQA 4U21A 1LFHA 4GF8A 1MPCA 3N26A 4G77A 1T0KA 2HXRA 4P11A 4PDHA 1B0HA 3RQTA 3LSWA 3KSJA 4BLAA 3D4CA 4NF8A 5EHSA 4YZZA 1RDZA 2OCUA 4OWDA 4MX6A 3ILUB 4N6DA 5I56A 3KC0A 4GXAA 5I58A 2H9BA 2B4LA 4MF3A 3H4ZA 1KWHA 4YU0A 1Y1MA 4NF5B 4F3GA 5H8NA 2ONSA 5I84A 1G0HA 3CVGA 3VVDA 3TFLA 1B52A 3ZKKA 4RNSA 3RTWB 3OO9A 2OBGA 1AOVA 3C34A 4X8RA 4RXLA 1DSNA 4DIGA 1PEBA 3O6IA 3BBRA 2E1SA 4IR8A 4MBPA 3FZVA 4QXDA 1MY1A 1VSOA 4H0WA 3TTMA 2QS3A 3W15C 4Q0CA 2Y7WA 3R7XA 4G8HA 5ICQA 2VD3A 4WXJA 4YKJA 1BK4A 1IMCA 1JP4A 5CI5A 4FAJA 1B5HA 3MJNA 3PU5A 2DSFA 3KJ7A 4MNCA 1MH4A 2ZYNA 2XXRA 4PF8A 5HPQA 1IUDA 2O84X 4ZEBA 4M1VA 2XHDA 1MQJA 4U4SA 5EHMA 2I58A 5H8QA 2H4IA 1HSLA 1PB7A 2AL5A 5CBSA 5CMCA 4PFIA 3FGSA 3B6WA 4FATA 4LQ2A 3TCHA 4F1UA 4UACA 4PE5B 5TPAB 2RCAA 3TKDA 2B3FA 2HXWA 4GL8A 4R73A 1IQ7A 1L5TA 1MG1A 2LAOA 2XWOA 5I2NA 4E0XA 1N3XA 3FVOA 2F3BA 1ANFA 3MC2A 4GWOA 1JW1A 4EUOA 1QGXA 1P1WA 1O63A 2OWTA 3AXFA 4G4PA 4PFBA 1B7UA 4H8JA 3C35A 4XFEA 2PX1A 2CZHA 4PFUA 3IOVA 4BDLA 3GBAA 4MMPA 2A5TB 3PV0E 1MM6A 5A5XB 2XA5A 4EQBA 3B6QA 3EF7A 4PFTA 4Z7EA 1AL3A 2HHMA 3RYDA 3C9HA 4KCCA 1USYE 1JEUA 1P99A 3QXMA 2REJA 4KCDA 3GBBA 4IO4A 3O6HA 1GR2A 2DVCA 4XF5A 3MSTA 3O28A 3KBZA 5JK4A 5FBPA 4R6KA 2ZNTA 1FPEA 3U8QA 3WAFA 1NUWA 2F78A 3CG1A 4PCDA 1EZOA 4ELPA 2XWKA 4PBQA 5AA2B 5DTBA 3VXBA 5IAIA 2R6GE 1WODA 1XI6A 4MJOA 2I48A 1IXIA 3IB1A 3LSFB 3CR9A 3HV1A 4U22A 2ZXTA 1NH8A 2DQVA 1INPA 2OWSA 1M5EA 1II5A 2DE3A 3EPEA 2XXKA 4TQUQ 4WEPA 3W9VA 5KCJB 4IGTA 1NNPA 4MEVA 1UQWA 2CZIA 2GHAA 4EDPA 4ZECA 1RDXA 3TDJA 2XD3A 3MVYA 3PPNA 2V25A 4QSDA 3SETA 4F18A 4N6KA 3CHGA 4ZEDA 1S50A 3FVKA 3JV9A 2OWZA 4JSDA 3RPWA 3RN8A 1M5FA 4JXIA 1EYIA 1D3KA 4JWYA 4I62A 3MVWA 2E0SA 1IMFA 1FQAA 4RJZA 4RY1A 3OO6A 4TLLB 4AQ4A 4MCOA 1NV4A 2Z8FA 2Y7PA 5JTYA 4ELQA 1FJ9A 5I59A 1UTHB 3EHSA 3LSXA 5J16A 2O1MA 4EQ9A 4ZEIA 4AB6A 1NNTA 3ISPA 2ZNSA 4N8YA 2D3IA 4R75A 3G3KA 1JW5A 4PF6A 5DVFA 1IMDA 3V8XB 3PPQA 3IFAA 3JYRA 3K0VA 3FUZA 4RYAA 1K9YA 4NF8B 4NEDA 2UYEA 1N04A 1XC1A 5J1DA 4ONYA 4XKRA 1IEJA 5I58B 5I56B 3DLNA 1N7XA 1B05A 1Z7NE 2NUVA 5H8NB 5IGAA 3C32A 4WKMA 1I6BA 1QKBA 1N84A 4RK9A 5IZ3A 4DDDA 1LSTA 1P1NA 1FPKA 2F6GA 5H8SA 1XVXA 2WYPA 4RA1A 2GHBA 3CFZA 2OX3A 4FJPA 1MRPA 3S9LC 2O69A 1Y4TA 3QAXA 1QUKA 1NI9A 1Y1ZA 4KI0E 3H03A 4F22A 2DXYA 2QVRA 4I3YA 2P3VA 5BWJA 4IO5A 2ONKE 3G3JA 1A40A 1A55A 3IO4A 3IFCA 4LVQA 1DPPA 3MAMA 1FQCA 2RC7A 4GWZA 1YCJA 1B0LA 1LAFE 3IJOB 2ZYMA 4EF2A 1DPEA 1OVBA 3NOHA 1XHYA 1MQDA 1YPNA 4X9TA 1ZBMA 1SI1A 2PFYA 4IY6A 4LN5A 4P8BA 3OEMA 3E9XA 2DE4A 2FHYA 1OVTA 1O7TA 3V5AA 4OFLA 4GWXA 5H8QB 1VDWA 3TMGA 1NUXA 1JW4A 4F31B 4C0RA 2X7PA 5KDTA 1B3GA 4ZS9A 1Q1KA 2KLFA 1N3WA 3IORA 3GLBA 1MM7A 3IK6B 1OLCA 2XXWA 3V89B 2WKYA 1ZIUA 4F1VA 3BIGA 1N7WA 5I2NB 2DOJA 2UVGA 3B8BA 4FORA 1MXUA 3USDA 3LUYA 4GX4A 5CMBA 1SDXA 2Q2CA 2F5XA 4XIGQ 3VVFA 1H3DA 2Q74A 1FRPA 2ZNUA 2CMOA 4OYVA 2F97A 2XWIA 4GOTA 2DYXA 3V83A 4NTLA 3FXUA 4FBPA 4P0GA 1TFDA 2WYKA 3K00A 5EYGA 4G2ZA 2ANJA 3IX1A 4DXCA 4I1DA 3FVNA 4N81A 1LBCA 4ZDMA 1MXWA 4F2OA 1DMBA 3MVXA 5HM4B 3I3VA 4F3SA 4N07A 5CBRA 2XXXA 4JVIA 3PUVE 4N13A 4LZ5A 2XWVA 3E3KA 1IXGA 3E13X 1IITA 3F11A 1LBYA 4QFKA 5BUUA 3QUFA 3KN7A 5I57A 1UTHA 3O66A 4DI4B 3T96B 1G0IA 4GWSA 4NQ8A 2I6EA 1NNKA 4C1UA 3D4GA 4JSOA 1IMEA 3GXAA 2FIEA 3T0JA 4IO6A 2DDKA 2GRVA 2Y7IA 2DWIA 4KQPA 3KG2A 1B3EA 1PDAA 1UIVA 5AA3A 5DVIA 4YAHX 4QFPA 4LUBA 4PE3A 4U23A 2FA7A 4FIMA 4U4XA 5IZ1A 3MP6A 1FBDA 4PAFA 2XX8A 2IEEA 1NV0A 1EZ9A 4R74A 4MFIA 3K1PA 4KR5A 3TQWA 3FJ7A 3SESA 2QJEA 3MUQA 2BJIA 3UORA 1SW4A 4IO3A 5ICTA 2FNCA 4HXVA 4LZ7A 2Q88A 4GX6A 4DCXA 1BP5A 4DE8A 3K1NA 4HE0A 4OXVA 1SD3A 1LB8A 3FV1A 5DVJA 5AA2D 4BDRA 1H44A 1Y3NA 3PGFA 1CE2A 1M5CA 3U92A 4G61A 4LP2B 5ET7A 3TTNA 1HSJA 1MXYA 3HFUA 4PP0A 3SZPA 1FPLA 4N6PA 2ZYKA 3MZ9A 5JTYB 4OZ9A 3T1BA 2O1LA 3HHGA 5I59B 2F7AA 4P56A 3PD9A 4F29A 4DXBA 3ODBA 4KPTA 2PT1A 2UYFA 3I5OA 1YZ0A 2HEUA 4GRKA 4R2FA 3FD3A 1AWBA 4BDNA 3FXBA 3KC1A 2V93A 3PMXA 2QVUA 1B40A 3PUZE 4ZEFA 3TZAA 1LCFA 1XS5A 2YJPA 2QPQA 3THIA 4POXA 3LBSA 3BFTA 3RT6B 3SKPA 5I5PA 4FEDA 4BDQA 1US5A 1EYJA 3MBPA 1R9LA 5IZ3B 1QKAA 4OFOA 3D1RA 2WBDA 2VHAA 4JVDA 1HSEA 3RGYA 3TPAA 2XXUA 1GV8A 1NKXA 3RNNA 1VR5A 1URDA 1FPDA 1LAHE 2HFBA 1WDNA 2W7YA 3L6GA 2XXVA 5I2KA 2UVIA 1OLAA 1B5JA 4EF1A 2VPNA 3IL1B 1SPIA 1FBHA 2XX7A 1NL5A 2D5WA 2V3UA 2XXHA 3TTLA 4O8MA 3O6GA 1FPFA 5ISUA 1FBGA 2V4CA 2R8TA 1DCUA 1MPBA 3TUSA 1F9BA 5EQ9A 5K2YA 1D9QA 4ZEKA 3OSRA 1BTJA 3LR1A 3BFUA 3OOAA 3TCGA 4BDOA 4JDFA 4OFJA 2Q8MA 5IZZA 2GFEA 3U1OA 4DCYA 4EXLA 3SEVA 2L5VA 1M5DA 1S7YA 4GIZA 3TYHA 2XX9A 3Q25A 2V3QA 4NGUA 4HCWA 3T22A 1ZKBA 2XXQA 4JBZA 4U1ZA 3SEYA 4QFNA 3M3KA 4R6YA 1QJMA 3DP8A 4IO2A 4O3AA 3EQ1A 2Y5KA 2FYIA 1MQIA 2O68A 3OMBA 3K02A 1FTAA 3O29A 5KDTB 5DEXA 4OVQA 4HW8A 3O97A 3Q28A 3E4RA 3PPRA 2XXPA 3Q29A 2G29A 2DWJA 4MH5A 3S2VA 5A5LA 5IKBA 3VLVA 4PTKA 4HS7A 3TCFA 5FTHA 4DXUA 2YPNA 1QVSA 4IGRA 1LLSA 4OEVA 1B6HA 2RC9A 3G3FA 4OTEA 1SW1A 1ELJA 4G68A 3QIMA 2D21A 4NF6A 1LBXA 3CIJA 4ELRA 4GWYA 1B9JA 1FJ6A 1NV2A 4ZZAA 5L9OA 2ZYOA 1YXIA 3LV0A 3OSQA 3VLWA 4P9KA 2CZLA 3RT8A 1FPGA 1OQGA 4YB5A 3QSLA 2Q2AA 3PMVA 4P1LA 4R9FA 4ESWA 4X48A 4TLMB 5DT6A 1ZLQA 2Y5LA 4FEBA 1TXFA 1A8EA 3ONMA 3SEWA 1GVCA 4XKPA 5I57B 3LC8A 5L8DA 3UA8A 3CSBA 4OVRA 3FXRA 2I3WA 4MAGA 5CC2A 1EYKA 4FE8A 4R6HA 4MLVA 4O7MA 3C31A 4X1DA 1B4ZA 4N4UA 3WAEA 1NUYA 3N6TA 3G3GA 1XT8A 1Z7ME 3VVEA 3PMWA 2I4BA 3PUXE 4GD5A 3DM0A 4O3BA 1K9ZA 4ECFA 4P3LA 5M2VA 4H65A 4HCYA 1KA1A 3DP6A 1PB9A 3FJMA 1MS7A 2HZLA 2I0CA 1XVYA 4G8MA 1KA0A 1J1NA 4R72A 1IIWA 2Z22A 2MKZA 4GX3A 4OEUA 1PBQA 1B51A 3CFLA 1ZMGA 1FTMA 3IOWA 4IY5A 3EHUA 5AE4A 4PETA 5CRYA 3K6UA 4QSEA 2Y7RA 2Y7KA 1DTZA 3U94A 3E78A 3FJGA 2O7UA 1OIBA 4OVSA 2I4CA 4GL0A 3CFXA 2AL4A 3K1MA 1MQGA 1LCTA 5K2XA 5H8FA 4PFYA 2AYSA 1LAXA 3A3UA 2IA4A 4GQOA 3MYUA 1NNFA 3MW0A 4QSCA 1MY2A 2VD2A 2WBBA 1S9TA 3KJTA 3M8UA 3EN3A 4M4GA 4GFRA 1VFEA 1POY1 3H06B 1B3HA 4RK2A 1MY0A 3A09A 3IO6A 4PAIA 4GLIA 1A7LA 3RPLA 1URSA 4ISUA 5F1QA 4NF4A 2H5YA 3B6TA 3T9XB 1NV6A 5FHMA 1IXCA 4OMBA 1LBWA 2QMXA 1N0TA 1AH5A 2PT2A 3G7WA 2F7CA 5CM6A 5LOMA 3TAJA 3K01A 1SI0A 1IXHA 3R26A 4MIJA 4JVCA 2HQ0A 1MDP1 3CI8A 4QF9A 3O9PA 4EQ7A 1A99A 2ABHA 5AA1A 1FBCA 2QVVA 4OHNA 2X7QA 3U93A 3RY3A 2CZKA 4Q30B 3ZS6A 2ZZXA 4TOZA 1Q9DA 3ZSFA 4K3FA 4N15A 3PD8A 5F24A 1GGGA 1FW0A 5I2KB 3R6UA 4YKIA 1Y4CA 1UTBA 4YKPA 1QUIA 1OMPA 4H6DA 5FTIA 3HO7A 4NE4A 1ATGA 5I3SA 5L9MA 2G93A 3DP4A 4NHBA 1N76A 2DVZA 1B1XA 1PB8A 2VOZA 4KD5A 1KZ8A 2YLNA 1AIVA 2THIA 2HZKA 3K6WA 4NX1A 1POTA 2PBWA 5LDZA 4I8CA 1A8FA 4YICA 4LQ5A 4H8IA 1B7ZA 1I6AA 2Z23A 4OENA 4GWUA 5AA4A 4R9GA 4HE1A 1JETA 2R71A 2UVHA 1MXZA 4YMAA 2PMSA 4P0IA 3Q27A 4PFWA 1B58A 4POWA 5TU0A 4ZZEA 1VE4A 3KZGA 5F7VA 4I9DA 1CNQA 3QMFA 3DELB 1NFTA 4QRZA 1NV7A 3VXCA 2QL3A 4N17A 5CMKA 4NAPA 3KN8A 3A3CA 4H5GA 5DEXB 1QULA 3IJXB 1RYOA 5TP9B 1URGA 3KOSA 4I40A 4O7IA 3UP9A 1FCKA 1EU8A 4MNIA 2PFZA 1TT1A 4GWWA 3MPLA 2ZMBA 1FTKA 4HE2A 4BDMA 4F3PA 4Q5TA 3SEXA 4QBAA 1JVYA 3QK6A 3QYTA 5ET5A 5B7DA 4YMBA 1SQYA 3OENA 2F6PA 4AB5A 3FBPA 4G68B 4FECA 3N94A 5H8HB 4NF6B 2V84A 3C33A 1YYZA 4WEDA 3RUMA 1B7HA 5ET6A 4UA8A 3IAZA 1QUJA 1TFAA 4N91A 4XKQA 2H25A 2GQ1A 1B32A 1SYIA 2WX9A 4X1BA 2I49A 3OO8A 4YB6A 1M5BA 5B70A 2QFLA 1LB9A 4O94A 4KYDA 2NVUB 1FBPA 3G3HA 2UXAA 1H76A 2P0SA 5CMMA 4ELOA 1RDYA 2HCAA 2OZZA 2RC8A 4P1EA 1GTKA 3PPPA 2DP8A 2RKMA 4KXPA 4EXKA 2VGQA 2OJTA 1B3FA 2GH9A 3PUWE 3FASA 3FXQA 3LUZA 3N5LA 1ZU0A 3H6UA 3TQLA 1JQFA 4PAKA 1LAGE 1Y3PA 3IB2A 4OVPA 5IM2A 2P3NA 2R9JA 4OESA 3HPIA 4MHFA 3RTFB 1LFIA 1FQBA 1NV1A 2PVUA 2X26A 1PBPA 3GYYA 5ESYA 4F1YA 3FVGA 4XKNA 3IB0A 2RCBA 2O6AA 2Q89A 1DOTA 4OQOA 3C4MA 2P2AA 2RINA 3K6VA 4ZE8A 1MH3A 5ET8A 4GBWA 3PUYE 1MDQA 3P7IA 4C1TA 1Y20A 1SYHA 2CEXA 3CG3A 5H8FB 1IMAA 3SERA 2Z8EA 1A54A 3H7MA 4XEQA 4LZ8A 5T3JA 4IB2A 1I6QA 1P1QA 2H98A 2P1SA 1NV3A 4KYSA 1SVXB 4JB7A 4L17A 4THIA 3RPLB 3OELA 4QHQA 4NF4B 3RLFE 1YTVA 4H67A 2AIXA 2M8CA 1IZ1A 2F8DA 5JEIA 2XXYA 3QUJA 3H6VA 4OVJA 3IOTA 5TP9A 3UGWA 4NG7A 3S9EA 1AMFA 2BJJX 4ESXA 4OA4A 3G3IA 4DI3D 3OD7A 1B4HA 4KFQA 4NWDA 4H46A 4JWOA 1ZTYA 5KZTA 4NMYA 2VT5A 3T66A 4PFRA 1RKMA 1R1NA 2NOOA 3U72A 1D4NA 2QRYA 2F3DA 5H8HA 1RYXA 3ECRA 1UTBB 1NH7A 4GBVA 2QS2A 3T9UA 4XXUA 1EZPA 1SW2A 3MP8A 3CRBA 4NF0A 3MWBA 1R6ZA 1UIUA 3K6XA 5ITOA 1NUZA 3KN3A 2KQZA 1P1UA 3H6WA 2HAVA 1Y9UA 4JWXA 4NF5A 3L6HA 4F2QA 1LBVA 4F19A 3JZJA 2DE2A 3TODA 3PTYA 1USYH 1B46A 2DWAA 2QS4A 2DS9A 5AA4B 2JJKA 3H3GA 4PC9A 4E0WA 4ZE9A 2KR0A 3W9WA 1EH3A 4HTGA 3S9MC 4ND9A 1FPIA 2I0BA 3IR1A 5EYFA 3VFJA 4QFOA 5I7IA 3T9HB 1MXVA 1B5IA 4DZ1A 2REGA 3E79A 3UK4A 1SBPA 2PCRA 3PPOA 3FIRA 4F3BA 5ITPA 3TELA 3S9NC 2O7IA 3OXNA 3O2AA 4LONB
chains in the Genus database with same CATH topology
4LATA 3M3FA 1WVJA 4OERA 1MXXA 3I6VA 1D9VA 1SW5A 5FHNA 3MVZA 1LBBA 3B7DA 4G8NA 1XOCA 2NWJA 1H45A 1B3LA 1YAEA 2PYYA 2DXRA 2ESNA 3VDFA 2ALUA 1TWYA 2NXOA 2V3TA 3TEPA 4RPOA 1R9QA 3TTRA 3KSXA 2QMWA 4U2RA 1MPDA 1BKAA 1FTOA 5TPAA 2Z8DA 1DTGA 3OO7A 2OLBA 1MY4A 2Y84A 5DYHA 3VV5A 4O3CA 1B2HA 3HHFA 3FATA 3C36A 2A5SA 5L9SA 1FTJA 3MZBA 2B65A 4YKKA 4H5FA 4DLDA 5ELVA 3M3LA 1FQDA 2H99A 2A5TA 5A5XA 2OK2A 2ONRA 3Q26A 2XXIA 3SEUA 1VFDA 3CSGA 3ZKLA 3T93B 2VP1A 2B3BA 2O51A 1QW0A 4GVOA 3EHTA 1MQHA 2Q8JA 1NMUA 3N6UA 4G68C 4IO7A 4LA9A 1FTLA 1BIYA 3KEIA 2QS1A 3UN6A 4KHZE 1BLFA 3IOUA 3VLUA 4Z0IA 3KBRA 1ZJLA 1JVXA 3VE1B 2Q9TA 4QFLA 3BKIB 3TTKA 5AA2A 4U1OA 2XD2A 4OETA 4H1XA 1JEVA 1US4A 3FV2A 3KFMA 3KGCA 2RF1A 3MP1A 2DWHA 1OQHA 4NWCA 2HAUA 4F39A 1I69A 2QSXA 5KCJA 1Y3QA 1D9YA 2UVJA 3MQ9A 1PC3A 4XTCQ 3ILTB 5HBCA 1Q35A 4PQJA 2XXTA 4KYEA 2F34A 1P1OA 1LFGA 3HSTA 1B1HA 4RPNA 1O64A 1FQFA 5FHOA 1MY3A 3GZGA 3SDFA 4Q8RA 3UIFA 3MPKA 1JNFA 2F36A 2I3VA 1CB6A 1LGBC 1FQEA 2F7BA 4YB7A 3K4UA 3T9VA 1H43A 3OEKA 4R2BA 3LSLA 3MZ1A 3KOTA 4GXSB 3S4UA 4MLQA 3HN0A 2F35A 3H6TA 3K2DA 3HCQA 4U21A 1LFHA 4GF8A 1MPCA 3N26A 4G77A 1T0KA 4P11A 1B0HA 3RQTA 3LSWA 3KSJA 4BLAA 3D4CA 4NF8A 5EHSA 4YZZA 2OCUA 4OWDA 3ILUB 5I56A 4GXAA 5I58A 2H9BA 4MF3A 3H4ZA 1KWHA 4YU0A 1Y1MA 4NF5B 4F3GA 5H8NA 2ONSA 5I84A 3CVGA 3VVDA 3TFLA 1B52A 3ZKKA 4RNSA 3RTWB 3OO9A 2OBGA 1AOVA 3C34A 4RXLA 1DSNA 4DIGA 1PEBA 3O6IA 3BBRA 2E1SA 4MBPA 3FZVA 1MY1A 1VSOA 4H0WA 3TTMA 2QS3A 3W15C 4Q0CA 2Y7WA 3R7XA 4G8HA 5ICQA 2VD3A 4WXJA 4YKJA 5CI5A 4FAJA 1B5HA 3MJNA 3PU5A 2DSFA 3KJ7A 1MH4A 2ZYNA 2XXRA 5HPQA 1IUDA 2O84X 4ZEBA 4M1VA 2XHDA 1MQJA 4U4SA 5EHMA 2I58A 5H8QA 2H4IA 1HSLA 1PB7A 2AL5A 5CBSA 5CMCA 3FGSA 3B6WA 4FATA 4LQ2A 3TCHA 4F1UA 4UACA 4PE5B 5TPAB 2RCAA 3TKDA 2B3FA 2HXWA 4GL8A 4R73A 1IQ7A 1L5TA 1MG1A 2LAOA 5I2NA 4E0XA 1N3XA 3FVOA 1ANFA 3MC2A 4GWOA 1JW1A 4EUOA 1P1WA 1O63A 2OWTA 3AXFA 4G4PA 1B7UA 4H8JA 3C35A 2PX1A 4PFUA 3IOVA 4BDLA 3GBAA 2A5TB 3PV0E 1MM6A 5A5XB 4EQBA 3B6QA 3EF7A 4PFTA 4Z7EA 1AL3A 3C9HA 4KCCA 1USYE 1JEUA 1P99A 3QXMA 2REJA 4KCDA 3GBBA 4IO4A 3O6HA 1GR2A 2DVCA 3O28A 5JK4A 4R6KA 2ZNTA 3U8QA 3WAFA 3CG1A 2F78A 1EZOA 4ELPA 5AA2B 5DTBA 3VXBA 5IAIA 2R6GE 1WODA 2I48A 1IXIA 3IB1A 3LSFB 3CR9A 3HV1A 4U22A 2ZXTA 1NH8A 2DQVA 2OWSA 1M5EA 1II5A 2DE3A 3EPEA 4TQUQ 4WEPA 3W9VA 5KCJB 4IGTA 1NNPA 1UQWA 2GHAA 4EDPA 4ZECA 3TDJA 2XD3A 3MVYA 3PPNA 2V25A 4QSDA 3SETA 4F18A 4ZEDA 1S50A 3FVKA 3JV9A 4JSDA 3RPWA 3RN8A 1M5FA 4JXIA 1D3KA 4JWYA 4I62A 3MVWA 2E0SA 1FQAA 4RJZA 4RY1A 3OO6A 4TLLB 4AQ4A 2Z8FA 2Y7PA 5JTYA 4ELQA 5I59A 1UTHB 3EHSA 3LSXA 2O1MA 4EQ9A 4ZEIA 4AB6A 1NNTA 2ZNSA 2D3IA 4R75A 3G3KA 1JW5A 5DVFA 3V8XB 3PPQA 3JYRA 3K0VA 3FUZA 4RYAA 4NF8B 4NEDA 2UYEA 1N04A 1XC1A 5J1DA 4ONYA 4XKRA 1IEJA 5I58B 5I56B 3DLNA 1N7XA 1B05A 1Z7NE 2NUVA 5H8NB 3C32A 4WKMA 1I6BA 1QKBA 1N84A 4RK9A 4DDDA 1LSTA 1P1NA 2F6GA 5H8SA 1XVXA 4RA1A 2GHBA 3CFZA 4FJPA 1MRPA 3S9LC 2O69A 1Y4TA 3QAXA 1QUKA 1Y1ZA 4KI0E 3H03A 4F22A 2DXYA 5BWJA 4IO5A 2ONKE 3G3JA 1A40A 1A55A 3IO4A 4LVQA 1DPPA 3MAMA 1FQCA 2RC7A 1YCJA 1B0LA 1LAFE 3IJOB 2ZYMA 4EF2A 1DPEA 1OVBA 1XHYA 1MQDA 1YPNA 4X9TA 1ZBMA 1SI1A 4IY6A 3OEMA 3E9XA 2DE4A 1OVTA 1O7TA 3V5AA 4OFLA 5H8QB 3TMGA 1JW4A 4F31B 4C0RA 2X7PA 5KDTA 1B3GA 4ZS9A 1Q1KA 2KLFA 1N3WA 3IORA 3GLBA 1MM7A 3IK6B 1OLCA 2XXWA 3V89B 2WKYA 1ZIUA 4F1VA 1N7WA 5I2NB 2DOJA 2UVGA 4FORA 1MXUA 3USDA 3LUYA 5CMBA 1SDXA 2Q2CA 2F5XA 4XIGQ 3VVFA 1H3DA 2ZNUA 2CMOA 4OYVA 2F97A 4GOTA 2DYXA 3V83A 4NTLA 3FXUA 4P0GA 1TFDA 3K00A 4G2ZA 2ANJA 3IX1A 4DXCA 4I1DA 3FVNA 1LBCA 4ZDMA 1MXWA 4F2OA 1DMBA 3MVXA 5HM4B 3I3VA 4F3SA 4N07A 5CBRA 2XXXA 3PUVE 4N13A 4LZ5A 3E3KA 1IXGA 3E13X 1IITA 3F11A 4QFKA 5BUUA 3QUFA 3KN7A 5I57A 1UTHA 3O66A 3T96B 2I6EA 1NNKA 4C1UA 3D4GA 4JSOA 3GXAA 4IO6A 2GRVA 2Y7IA 2DWIA 4KQPA 3KG2A 1B3EA 1PDAA 1UIVA 5AA3A 5DVIA 4YAHX 4QFPA 4LUBA 4U23A 2FA7A 4FIMA 4U4XA 3MP6A 2XX8A 2IEEA 1EZ9A 4R74A 4MFIA 3K1PA 4KR5A 3TQWA 3FJ7A 3SESA 2QJEA 3MUQA 3UORA 1SW4A 4IO3A 5ICTA 2FNCA 4LZ7A 2Q88A 4DCXA 1BP5A 4DE8A 3K1NA 4OXVA 1SD3A 1LB8A 3FV1A 5DVJA 5AA2D 4BDRA 1H44A 1Y3NA 3PGFA 1CE2A 1M5CA 3U92A 4LP2B 3TTNA 1HSJA 1MXYA 4PP0A 4N6PA 2ZYKA 3MZ9A 5JTYB 4OZ9A 2O1LA 3HHGA 5I59B 2F7AA 3PD9A 4F29A 4DXBA 3ODBA 4KPTA 2PT1A 2UYFA 3I5OA 2HEUA 4GRKA 4R2FA 3FD3A 4BDNA 2V93A 3PMXA 1B40A 3PUZE 4ZEFA 3TZAA 1LCFA 1XS5A 2YJPA 2QPQA 3THIA 4POXA 3LBSA 3BFTA 3RT6B 3SKPA 4FEDA 4BDQA 1US5A 3MBPA 1R9LA 1QKAA 4OFOA 2VHAA 1HSEA 3RGYA 3TPAA 2XXUA 1GV8A 1NKXA 3RNNA 1VR5A 1URDA 1LAHE 2HFBA 1WDNA 2W7YA 3L6GA 2XXVA 5I2KA 2UVIA 1OLAA 1B5JA 4EF1A 3IL1B 2XX7A 1NL5A 2D5WA 2V3UA 2XXHA 3TTLA 3O6GA 5ISUA 1MPBA 3TUSA 1F9BA 5K2YA 4ZEKA 3OSRA 1BTJA 3LR1A 3BFUA 3OOAA 3TCGA 4BDOA 4JDFA 4OFJA 2GFEA 3U1OA 4DCYA 4EXLA 3SEVA 1M5DA 1S7YA 4GIZA 3TYHA 2XX9A 3Q25A 2V3QA 4HCWA 3T22A 1ZKBA 2XXQA 4JBZA 4U1ZA 3SEYA 4QFNA 3M3KA 1QJMA 3DP8A 4IO2A 4O3AA 4R6YA 3EQ1A 2FYIA 1MQIA 2O68A 3OMBA 3K02A 3O29A 5KDTB 5DEXA 4HW8A 3O97A 3Q28A 3E4RA 3PPRA 2XXPA 3Q29A 2G29A 2DWJA 4MH5A 3S2VA 5IKBA 3VLVA 4HS7A 3TCFA 5FTHA 4DXUA 2YPNA 1QVSA 4IGRA 1LLSA 4OEVA 1B6HA 2RC9A 3G3FA 4OTEA 1SW1A 1ELJA 4G68A 3QIMA 2D21A 4NF6A 3CIJA 4ELRA 1B9JA 4ZZAA 5L9OA 2ZYOA 3OSQA 3VLWA 2CZLA 3RT8A 1OQGA 4YB5A 3QSLA 2Q2AA 3PMVA 4R9FA 4ESWA 4X48A 4TLMB 5DT6A 1ZLQA 4FEBA 1TXFA 1A8EA 3ONMA 3SEWA 1GVCA 4XKPA 5I57B 3LC8A 5L8DA 3UA8A 3CSBA 3FXRA 2I3WA 5CC2A 4FE8A 4R6HA 4MLVA 3C31A 4X1DA 1B4ZA 3WAEA 3N6TA 3G3GA 1XT8A 1Z7ME 3VVEA 3PMWA 2I4BA 3PUXE 4GD5A 3DM0A 4O3BA 4ECFA 5M2VA 4H65A 4HCYA 3DP6A 1PB9A 3FJMA 1MS7A 2HZLA 2I0CA 1XVYA 4G8MA 1J1NA 4R72A 1IIWA 2Z22A 4OEUA 1PBQA 1B51A 3CFLA 1ZMGA 1FTMA 3IOWA 4IY5A 3EHUA 5AE4A 4PETA 5CRYA 3K6UA 4QSEA 2Y7RA 2Y7KA 1DTZA 3U94A 3FJGA 2O7UA 1OIBA 2I4CA 4GL0A 3CFXA 2AL4A 3K1MA 1MQGA 1LCTA 5K2XA 5H8FA 4PFYA 2AYSA 1LAXA 3A3UA 2IA4A 4GQOA 1NNFA 3MW0A 4QSCA 1MY2A 2VD2A 1S9TA 3KJTA 3M8UA 3EN3A 4M4GA 4GFRA 1VFEA 1POY1 3H06B 1B3HA 4RK2A 1MY0A 3A09A 3IO6A 4GLIA 1A7LA 1URSA 4ISUA 5F1QA 4NF4A 2H5YA 3B6TA 3T9XB 5FHMA 1IXCA 4OMBA 2QMXA 1N0TA 1AH5A 2PT2A 3G7WA 2F7CA 5CM6A 5LOMA 3TAJA 3K01A 1SI0A 1IXHA 3R26A 2HQ0A 1MDP1 3CI8A 4QF9A 3O9PA 4EQ7A 1A99A 2ABHA 5AA1A 4OHNA 2X7QA 3U93A 3RY3A 4Q30B 3ZS6A 4TOZA 3ZSFA 4K3FA 3PD8A 1GGGA 1FW0A 5I2KB 3R6UA 4YKIA 1Y4CA 1UTBA 4YKPA 1QUIA 1OMPA 4H6DA 5FTIA 3HO7A 4NE4A 1ATGA 5L9MA 2G93A 3DP4A 1N76A 2DVZA 1B1XA 1PB8A 2VOZA 4KD5A 2YLNA 1AIVA 2THIA 2HZKA 3K6WA 1POTA 2PBWA 4I8CA 1A8FA 4YICA 4LQ5A 4H8IA 1B7ZA 1I6AA 2Z23A 4OENA 5AA4A 4R9GA 1JETA 2R71A 2UVHA 1MXZA 4YMAA 2PMSA 4P0IA 3Q27A 4PFWA 1B58A 4POWA 5TU0A 4ZZEA 1VE4A 3KZGA 5F7VA 4I9DA 3DELB 1NFTA 4QRZA 3VXCA 2QL3A 5CMKA 3KN8A 3A3CA 4H5GA 5DEXB 1QULA 3IJXB 1RYOA 5TP9B 1URGA 3KOSA 3UP9A 1FCKA 1EU8A 1TT1A 3MPLA 2ZMBA 1FTKA 4BDMA 4F3PA 4Q5TA 3SEXA 1JVYA 3QK6A 3QYTA 5B7DA 4YMBA 1SQYA 3OENA 2F6PA 4AB5A 4G68B 4FECA 3N94A 5H8HB 4NF6B 2V84A 3C33A 4WEDA 3RUMA 1B7HA 4UA8A 3IAZA 1QUJA 1TFAA 4XKQA 2H25A 1B32A 1SYIA 4X1BA 2I49A 3OO8A 4YB6A 1M5BA 5B70A 1LB9A 4KYDA 2NVUB 3G3HA 2UXAA 1H76A 2P0SA 5CMMA 4ELOA 2HCAA 2OZZA 2RC8A 1GTKA 3PPPA 2DP8A 2RKMA 4EXKA 2VGQA 2OJTA 1B3FA 2GH9A 3PUWE 3FASA 3FXQA 3N5LA 1ZU0A 3H6UA 3TQLA 1JQFA 1LAGE 1Y3PA 3IB2A 2R9JA 3HPIA 4OESA 3RTFB 1LFIA 1FQBA 2PVUA 2X26A 1PBPA 4F1YA 3FVGA 4XKNA 3IB0A 2RCBA 2O6AA 2Q89A 1DOTA 4OQOA 3C4MA 2P2AA 2RINA 3K6VA 4ZE8A 1MH3A 3PUYE 1MDQA 3P7IA 4C1TA 1Y20A 1SYHA 3CG3A 5H8FB 3SERA 2Z8EA 1A54A 3H7MA 4LZ8A 4IB2A 1I6QA 1P1QA 2H98A 2P1SA 4KYSA 1SVXB 4JB7A 4L17A 4THIA 3OELA 4QHQA 4NF4B 3RLFE 1YTVA 4H67A 2AIXA 2M8CA 1IZ1A 2F8DA 5JEIA 2XXYA 3QUJA 3H6VA 4OVJA 3IOTA 5TP9A 3UGWA 3S9EA 1AMFA 2BJJX 4ESXA 3G3IA 3OD7A 1B4HA 4KFQA 4NWDA 4JWOA 1ZTYA 5KZTA 4NMYA 3T66A 1RKMA 1R1NA 2NOOA 3U72A 1D4NA 2QRYA 5H8HA 1RYXA 3ECRA 1UTBB 1NH7A 2QS2A 3T9UA 4XXUA 1EZPA 1SW2A 3MP8A 3CRBA 3MWBA 1R6ZA 1UIUA 3K6XA 5ITOA 3KN3A 1P1UA 3H6WA 2HAVA 1Y9UA 4JWXA 4NF5A 3L6HA 4F2QA 4F19A 3JZJA 2DE2A 3TODA 1USYH 1B46A 2DWAA 2QS4A 2DS9A 5AA4B 3H3GA 4E0WA 4ZE9A 3W9WA 1EH3A 4HTGA 3S9MC 4ND9A 2I0BA 3IR1A 5EYFA 3VFJA 4QFOA 3T9HB 1MXVA 1B5IA 4DZ1A 2REGA 3UK4A 1SBPA 3PPOA 3FIRA 4F3BA 5ITPA 3TELA 3S9NC 2O7IA 3OXNA 3O2AA 4LONB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAT A;  3M3F A;  1WVJ A;  4OER A;  1MXX A;  3I6V A;  1D9V A;  1SW5 A;  5FHN A;  3MVZ A;  1LBB A;  3B7D A;  4G8N A;  1XOC A;  2NWJ A;  1H45 A;  1B3L A;  1YAE A;  2PYY A;  2DXR A;  2ESN A;  3VDF A;  2ALU A;  1TWY A;  2NXO A;  2V3T A;  3TEP A;  4RPO A;  1R9Q A;  3TTR A;  3KSX A;  2QMW A;  4U2R A;  1MPD A;  1BKA A;  1FTO A;  5TPA A;  2Z8D A;  1DTG A;  3OO7 A;  2OLB A;  1MY4 A;  2Y84 A;  5DYH A;  3VV5 A;  4O3C A;  1B2H A;  3HHF A;  3FAT A;  3C36 A;  2A5S A;  5L9S A;  1FTJ A;  3MZB A;  2B65 A;  4YKK A;  4H5F A;  4DLD A;  5ELV A;  3M3L A;  1FQD A;  2H99 A;  2A5T A;  5A5X A;  2OK2 A;  2ONR A;  3Q26 A;  2XXI A;  3SEU A;  1VFD A;  3CSG A;  3ZKL A;  3T93 B;  2VP1 A;  2B3B A;  2O51 A;  1QW0 A;  4GVO A;  3EHT A;  1MQH A;  2Q8J A;  1NMU A;  3N6U A;  4G68 C;  4IO7 A;  4LA9 A;  1FTL A;  1BIY A;  3KEI A;  2QS1 A;  3UN6 A;  4KHZ E;  1BLF A;  3IOU A;  3VLU A;  4Z0I A;  3KBR A;  1ZJL A;  1JVX A;  3VE1 B;  2Q9T A;  4QFL A;  3BKI B;  3TTK A;  5AA2 A;  4U1O A;  2XD2 A;  4OET A;  4H1X A;  1JEV A;  1US4 A;  3FV2 A;  3KFM A;  3KGC A;  2RF1 A;  3MP1 A;  2DWH A;  1OQH A;  4NWC A;  2HAU A;  4F39 A;  1I69 A;  2QSX A;  5KCJ A;  1Y3Q A;  1D9Y A;  2UVJ A;  3MQ9 A;  1PC3 A;  4XTC Q;  3ILT B;  5HBC A;  1Q35 A;  4PQJ A;  2XXT A;  4KYE A;  2F34 A;  1P1O A;  1LFG A;  3HST A;  1B1H A;  4RPN A;  1O64 A;  1FQF A;  5FHO A;  1MY3 A;  3GZG A;  3SDF A;  4Q8R A;  3UIF A;  3MPK A;  1JNF A;  2F36 A;  2I3V A;  1CB6 A;  1LGB C;  1FQE A;  2F7B A;  4YB7 A;  3K4U A;  3T9V A;  1H43 A;  3OEK A;  4R2B A;  3LSL A;  3MZ1 A;  3KOT A;  4GXS B;  3S4U A;  4MLQ A;  3HN0 A;  2F35 A;  3H6T A;  3K2D A;  3HCQ A;  4U21 A;  1LFH A;  4GF8 A;  1MPC A;  3N26 A;  4G77 A;  1T0K A;  4P11 A;  1B0H A;  3RQT A;  3LSW A;  3KSJ A;  4BLA A;  3D4C A;  4NF8 A;  5EHS A;  4YZZ A;  2OCU A;  4OWD A;  3ILU B;  5I56 A;  4GXA A;  5I58 A;  2H9B A;  4MF3 A;  3H4Z A;  1KWH A;  4YU0 A;  1Y1M A;  4NF5 B;  4F3G A;  5H8N A;  2ONS A;  5I84 A;  3CVG A;  3VVD A;  3TFL A;  1B52 A;  3ZKK A;  4RNS A;  3RTW B;  3OO9 A;  2OBG A;  1AOV A;  3C34 A;  4RXL A;  1DSN A;  4DIG A;  1PEB A;  3O6I A;  3BBR A;  2E1S A;  4MBP A;  3FZV A;  1MY1 A;  1VSO A;  4H0W A;  3TTM A;  2QS3 A;  3W15 C;  4Q0C A;  2Y7W A;  3R7X A;  4G8H A;  5ICQ A;  2VD3 A;  4WXJ A;  4YKJ A;  5CI5 A;  4FAJ A;  1B5H A;  3MJN A;  3PU5 A;  2DSF A;  3KJ7 A;  1MH4 A;  2ZYN A;  2XXR A;  5HPQ A;  1IUD A;  2O84 X;  4ZEB A;  4M1V A;  2XHD A;  1MQJ A;  4U4S A;  5EHM A;  2I58 A;  5H8Q A;  2H4I A;  1HSL A;  1PB7 A;  2AL5 A;  5CBS A;  5CMC A;  3FGS A;  3B6W A;  4FAT A;  4LQ2 A;  3TCH A;  4F1U A;  4UAC A;  4PE5 B;  5TPA B;  2RCA A;  3TKD A;  2B3F A;  2HXW A;  4GL8 A;  4R73 A;  1IQ7 A;  1L5T A;  1MG1 A;  2LAO A;  5I2N A;  4E0X A;  1N3X A;  3FVO A;  1ANF A;  3MC2 A;  4GWO A;  1JW1 A;  4EUO A;  1P1W A;  1O63 A;  2OWT A;  3AXF A;  4G4P A;  1B7U A;  4H8J A;  3C35 A;  2PX1 A;  4PFU A;  3IOV A;  4BDL A;  3GBA A;  2A5T B;  3PV0 E;  1MM6 A;  5A5X B;  4EQB A;  3B6Q A;  3EF7 A;  4PFT A;  4Z7E A;  1AL3 A;  3C9H A;  4KCC A;  1USY E;  1JEU A;  1P99 A;  3QXM A;  2REJ A;  4KCD A;  3GBB A;  4IO4 A;  3O6H A;  1GR2 A;  2DVC A;  3O28 A;  5JK4 A;  4R6K A;  2ZNT A;  3U8Q A;  3WAF A;  3CG1 A;  2F78 A;  1EZO A;  4ELP A;  5AA2 B;  5DTB A;  3VXB A;  5IAI A;  2R6G E;  1WOD A;  2I48 A;  1IXI A;  3IB1 A;  3LSF B;  3CR9 A;  3HV1 A;  4U22 A;  2ZXT A;  1NH8 A;  2DQV A;  2OWS A;  1M5E A;  1II5 A;  2DE3 A;  3EPE A;  4TQU Q;  4WEP A;  3W9V A;  5KCJ B;  4IGT A;  1NNP A;  1UQW A;  2GHA A;  4EDP A;  4ZEC A;  3TDJ A;  2XD3 A;  3MVY A;  3PPN A;  2V25 A;  4QSD A;  3SET A;  4F18 A;  4ZED A;  1S50 A;  3FVK A;  3JV9 A;  4JSD A;  3RPW A;  3RN8 A;  1M5F A;  4JXI A;  1D3K A;  4JWY A;  4I62 A;  3MVW A;  2E0S A;  1FQA A;  4RJZ A;  4RY1 A;  3OO6 A;  4TLL B;  4AQ4 A;  2Z8F A;  2Y7P A;  5JTY A;  4ELQ A;  5I59 A;  1UTH B;  3EHS A;  3LSX A;  2O1M A;  4EQ9 A;  4ZEI A;  4AB6 A;  1NNT A;  2ZNS A;  2D3I A;  4R75 A;  3G3K A;  1JW5 A;  5DVF A;  3V8X B;  3PPQ A;  3JYR A;  3K0V A;  3FUZ A;  4RYA A;  4NF8 B;  4NED A;  2UYE A;  1N04 A;  1XC1 A;  5J1D A;  4ONY A;  4XKR A;  1IEJ A;  5I58 B;  5I56 B;  3DLN A;  1N7X A;  1B05 A;  1Z7N E;  2NUV A;  5H8N B;  3C32 A;  4WKM A;  1I6B A;  1QKB A;  1N84 A;  4RK9 A;  4DDD A;  1LST A;  1P1N A;  2F6G A;  5H8S A;  1XVX A;  4RA1 A;  2GHB A;  3CFZ A;  4FJP A;  1MRP A;  3S9L C;  2O69 A;  1Y4T A;  3QAX A;  1QUK A;  1Y1Z A;  4KI0 E;  3H03 A;  4F22 A;  2DXY A;  5BWJ A;  4IO5 A;  2ONK E;  3G3J A;  1A40 A;  1A55 A;  3IO4 A;  4LVQ A;  1DPP A;  3MAM A;  1FQC A;  2RC7 A;  1YCJ A;  1B0L A;  1LAF E;  3IJO B;  2ZYM A;  4EF2 A;  1DPE A;  1OVB A;  1XHY A;  1MQD A;  1YPN A;  4X9T A;  1ZBM A;  1SI1 A;  4IY6 A;  3OEM A;  3E9X A;  2DE4 A;  1OVT A;  1O7T A;  3V5A A;  4OFL A;  5H8Q B;  3TMG A;  1JW4 A;  4F31 B;  4C0R A;  2X7P A;  5KDT A;  1B3G A;  4ZS9 A;  1Q1K A;  2KLF A;  1N3W A;  3IOR A;  3GLB A;  1MM7 A;  3IK6 B;  1OLC A;  2XXW A;  3V89 B;  2WKY A;  1ZIU A;  4F1V A;  1N7W A;  5I2N B;  2DOJ A;  2UVG A;  4FOR A;  1MXU A;  3USD A;  3LUY A;  5CMB A;  1SDX A;  2Q2C A;  2F5X A;  4XIG Q;  3VVF A;  1H3D A;  2ZNU A;  2CMO A;  4OYV A;  2F97 A;  4GOT A;  2DYX A;  3V83 A;  4NTL A;  3FXU A;  4P0G A;  1TFD A;  3K00 A;  4G2Z A;  2ANJ A;  3IX1 A;  4DXC A;  4I1D A;  3FVN A;  1LBC A;  4ZDM A;  1MXW A;  4F2O A;  1DMB A;  3MVX A;  5HM4 B;  3I3V A;  4F3S A;  4N07 A;  5CBR A;  2XXX A;  3PUV E;  4N13 A;  4LZ5 A;  3E3K A;  1IXG A;  3E13 X;  1IIT A;  3F11 A;  4QFK A;  5BUU A;  3QUF A;  3KN7 A;  5I57 A;  1UTH A;  3O66 A;  3T96 B;  2I6E A;  1NNK A;  4C1U A;  3D4G A;  4JSO A;  3GXA A;  4IO6 A;  2GRV A;  2Y7I A;  2DWI A;  4KQP A;  3KG2 A;  1B3E A;  1PDA A;  1UIV A;  5AA3 A;  5DVI A;  4YAH X;  4QFP A;  4LUB A;  4U23 A;  2FA7 A;  4FIM A;  4U4X A;  3MP6 A;  2XX8 A;  2IEE A;  1EZ9 A;  4R74 A;  4MFI A;  3K1P A;  4KR5 A;  3TQW A;  3FJ7 A;  3SES A;  2QJE A;  3MUQ A;  3UOR A;  1SW4 A;  4IO3 A;  5ICT A;  2FNC A;  4LZ7 A;  2Q88 A;  4DCX A;  1BP5 A;  4DE8 A;  3K1N A;  4OXV A;  1SD3 A;  1LB8 A;  3FV1 A;  5DVJ A;  5AA2 D;  4BDR A;  1H44 A;  1Y3N A;  3PGF A;  1CE2 A;  1M5C A;  3U92 A;  4LP2 B;  3TTN A;  1HSJ A;  1MXY A;  4PP0 A;  4N6P A;  2ZYK A;  3MZ9 A;  5JTY B;  4OZ9 A;  2O1L A;  3HHG A;  5I59 B;  2F7A A;  3PD9 A;  4F29 A;  4DXB A;  3ODB A;  4KPT A;  2PT1 A;  2UYF A;  3I5O A;  2HEU A;  4GRK A;  4R2F A;  3FD3 A;  4BDN A;  2V93 A;  3PMX A;  1B40 A;  3PUZ E;  4ZEF A;  3TZA A;  1LCF A;  1XS5 A;  2YJP A;  2QPQ A;  3THI A;  4POX A;  3LBS A;  3BFT A;  3RT6 B;  3SKP A;  4FED A;  4BDQ A;  1US5 A;  3MBP A;  1R9L A;  1QKA A;  4OFO A;  2VHA A;  1HSE A;  3RGY A;  3TPA A;  2XXU A;  1GV8 A;  1NKX A;  3RNN A;  1VR5 A;  1URD A;  1LAH E;  2HFB A;  1WDN A;  2W7Y A;  3L6G A;  2XXV A;  5I2K A;  2UVI A;  1OLA A;  1B5J A;  4EF1 A;  3IL1 B;  2XX7 A;  1NL5 A;  2D5W A;  2V3U A;  2XXH A;  3TTL A;  3O6G A;  5ISU A;  1MPB A;  3TUS A;  1F9B A;  5K2Y A;  4ZEK A;  3OSR A;  1BTJ A;  3LR1 A;  3BFU A;  3OOA A;  3TCG A;  4BDO A;  4JDF A;  4OFJ A;  2GFE A;  3U1O A;  4DCY A;  4EXL A;  3SEV A;  1M5D A;  1S7Y A;  4GIZ A;  3TYH A;  2XX9 A;  3Q25 A;  2V3Q A;  4HCW A;  3T22 A;  1ZKB A;  2XXQ A;  4JBZ A;  4U1Z A;  3SEY A;  4QFN A;  3M3K A;  1QJM A;  3DP8 A;  4IO2 A;  4O3A A;  4R6Y A;  3EQ1 A;  2FYI A;  1MQI A;  2O68 A;  3OMB A;  3K02 A;  3O29 A;  5KDT B;  5DEX A;  4HW8 A;  3O97 A;  3Q28 A;  3E4R A;  3PPR A;  2XXP A;  3Q29 A;  2G29 A;  2DWJ A;  4MH5 A;  3S2V A;  5IKB A;  3VLV A;  4HS7 A;  3TCF A;  5FTH A;  4DXU A;  2YPN A;  1QVS A;  4IGR A;  1LLS A;  4OEV A;  1B6H A;  2RC9 A;  3G3F A;  4OTE A;  1SW1 A;  1ELJ A;  4G68 A;  3QIM A;  2D21 A;  4NF6 A;  3CIJ A;  4ELR A;  1B9J A;  4ZZA A;  5L9O A;  2ZYO A;  3OSQ A;  3VLW A;  2CZL A;  3RT8 A;  1OQG A;  4YB5 A;  3QSL A;  2Q2A A;  3PMV A;  4R9F A;  4ESW A;  4X48 A;  4TLM B;  5DT6 A;  1ZLQ A;  4FEB A;  1TXF A;  1A8E A;  3ONM A;  3SEW A;  1GVC A;  4XKP A;  5I57 B;  3LC8 A;  5L8D A;  3UA8 A;  3CSB A;  3FXR A;  2I3W A;  5CC2 A;  4FE8 A;  4R6H A;  4MLV A;  3C31 A;  4X1D A;  1B4Z A;  3WAE A;  3N6T A;  3G3G A;  1XT8 A;  1Z7M E;  3VVE A;  3PMW A;  2I4B A;  3PUX E;  4GD5 A;  3DM0 A;  4O3B A;  4ECF A;  5M2V A;  4H65 A;  4HCY A;  3DP6 A;  1PB9 A;  3FJM A;  1MS7 A;  2HZL A;  2I0C A;  1XVY A;  4G8M A;  1J1N A;  4R72 A;  1IIW A;  2Z22 A;  4OEU A;  1PBQ A;  1B51 A;  3CFL A;  1ZMG A;  1FTM A;  3IOW A;  4IY5 A;  3EHU A;  5AE4 A;  4PET A;  5CRY A;  3K6U A;  4QSE A;  2Y7R A;  2Y7K A;  1DTZ A;  3U94 A;  3FJG A;  2O7U A;  1OIB A;  2I4C A;  4GL0 A;  3CFX A;  2AL4 A;  3K1M A;  1MQG A;  1LCT A;  5K2X A;  5H8F A;  4PFY A;  2AYS A;  1LAX A;  3A3U A;  2IA4 A;  4GQO A;  1NNF A;  3MW0 A;  4QSC A;  1MY2 A;  2VD2 A;  1S9T A;  3KJT A;  3M8U A;  3EN3 A;  4M4G A;  4GFR A;  1VFE A;  1POY 1;  3H06 B;  1B3H A;  4RK2 A;  1MY0 A;  3A09 A;  3IO6 A;  4GLI A;  1A7L A;  1URS A;  4ISU A;  5F1Q A;  4NF4 A;  2H5Y A;  3B6T A;  3T9X B;  5FHM A;  1IXC A;  4OMB A;  2QMX A;  1N0T A;  1AH5 A;  2PT2 A;  3G7W A;  2F7C A;  5CM6 A;  5LOM A;  3TAJ A;  3K01 A;  1SI0 A;  1IXH A;  3R26 A;  2HQ0 A;  1MDP 1;  3CI8 A;  4QF9 A;  3O9P A;  4EQ7 A;  1A99 A;  2ABH A;  5AA1 A;  4OHN A;  2X7Q A;  3U93 A;  3RY3 A;  4Q30 B;  3ZS6 A;  4TOZ A;  3ZSF A;  4K3F A;  3PD8 A;  1GGG A;  1FW0 A;  5I2K B;  3R6U A;  4YKI A;  1Y4C A;  1UTB A;  4YKP A;  1QUI A;  1OMP A;  4H6D A;  5FTI A;  3HO7 A;  4NE4 A;  1ATG A;  5L9M A;  2G93 A;  3DP4 A;  1N76 A;  2DVZ A;  1B1X A;  1PB8 A;  2VOZ A;  4KD5 A;  2YLN A;  1AIV A;  2THI A;  2HZK A;  3K6W A;  1POT A;  2PBW A;  4I8C A;  1A8F A;  4YIC A;  4LQ5 A;  4H8I A;  1B7Z A;  1I6A A;  2Z23 A;  4OEN A;  5AA4 A;  4R9G A;  1JET A;  2R71 A;  2UVH A;  1MXZ A;  4YMA A;  2PMS A;  4P0I A;  3Q27 A;  4PFW A;  1B58 A;  4POW A;  5TU0 A;  4ZZE A;  1VE4 A;  3KZG A;  5F7V A;  4I9D A;  3DEL B;  1NFT A;  4QRZ A;  3VXC A;  2QL3 A;  5CMK A;  3KN8 A;  3A3C A;  4H5G A;  5DEX B;  1QUL A;  3IJX B;  1RYO A;  5TP9 B;  1URG A;  3KOS A;  3UP9 A;  1FCK A;  1EU8 A;  1TT1 A;  3MPL A;  2ZMB A;  1FTK A;  4BDM A;  4F3P A;  4Q5T A;  3SEX A;  1JVY A;  3QK6 A;  3QYT A;  5B7D A;  4YMB A;  1SQY A;  3OEN A;  2F6P A;  4AB5 A;  4G68 B;  4FEC A;  3N94 A;  5H8H B;  4NF6 B;  2V84 A;  3C33 A;  4WED A;  3RUM A;  1B7H A;  4UA8 A;  3IAZ A;  1QUJ A;  1TFA A;  4XKQ A;  2H25 A;  1B32 A;  1SYI A;  4X1B A;  2I49 A;  3OO8 A;  4YB6 A;  1M5B A;  5B70 A;  1LB9 A;  4KYD A;  2NVU B;  3G3H A;  2UXA A;  1H76 A;  2P0S A;  5CMM A;  4ELO A;  2HCA A;  2OZZ A;  2RC8 A;  1GTK A;  3PPP A;  2DP8 A;  2RKM A;  4EXK A;  2VGQ A;  2OJT A;  1B3F A;  2GH9 A;  3PUW E;  3FAS A;  3FXQ A;  3N5L A;  1ZU0 A;  3H6U A;  3TQL A;  1JQF A;  1LAG E;  1Y3P A;  3IB2 A;  2R9J A;  3HPI A;  4OES A;  3RTF B;  1LFI A;  1FQB A;  2PVU A;  2X26 A;  1PBP A;  4F1Y A;  3FVG A;  4XKN A;  3IB0 A;  2RCB A;  2O6A A;  2Q89 A;  1DOT A;  4OQO A;  3C4M A;  2P2A A;  2RIN A;  3K6V A;  4ZE8 A;  1MH3 A;  3PUY E;  1MDQ A;  3P7I A;  4C1T A;  1Y20 A;  1SYH A;  3CG3 A;  5H8F B;  3SER A;  2Z8E A;  1A54 A;  3H7M A;  4LZ8 A;  4IB2 A;  1I6Q A;  1P1Q A;  2H98 A;  2P1S A;  4KYS A;  1SVX B;  4JB7 A;  4L17 A;  4THI A;  3OEL A;  4QHQ A;  4NF4 B;  3RLF E;  1YTV A;  4H67 A;  2AIX A;  2M8C A;  1IZ1 A;  2F8D A;  5JEI A;  2XXY A;  3QUJ A;  3H6V A;  4OVJ A;  3IOT A;  5TP9 A;  3UGW A;  3S9E A;  1AMF A;  2BJJ X;  4ESX A;  3G3I A;  3OD7 A;  1B4H A;  4KFQ A;  4NWD A;  4JWO A;  1ZTY A;  5KZT A;  4NMY A;  3T66 A;  1RKM A;  1R1N A;  2NOO A;  3U72 A;  1D4N A;  2QRY A;  5H8H A;  1RYX A;  3ECR A;  1UTB B;  1NH7 A;  2QS2 A;  3T9U A;  4XXU A;  1EZP A;  1SW2 A;  3MP8 A;  3CRB A;  3MWB A;  1R6Z A;  1UIU A;  3K6X A;  5ITO A;  3KN3 A;  1P1U A;  3H6W A;  2HAV A;  1Y9U A;  4JWX A;  4NF5 A;  3L6H A;  4F2Q A;  4F19 A;  3JZJ A;  2DE2 A;  3TOD A;  1USY H;  1B46 A;  2DWA A;  2QS4 A;  2DS9 A;  5AA4 B;  3H3G A;  4E0W A;  4ZE9 A;  3W9W A;  1EH3 A;  4HTG A;  3S9M C;  4ND9 A;  2I0B A;  3IR1 A;  5EYF A;  3VFJ A;  4QFO A;  3T9H B;  1MXV A;  1B5I A;  4DZ1 A;  2REG A;  3UK4 A;  1SBP A;  3PPO A;  3FIR A;  4F3B A;  5ITP A;  3TEL A;  3S9N C;  2O7I A;  3OXN A;  3O2A A;  4LON B; 
#chains in the Genus database with same CATH topology
 4LAT A;  3M3F A;  1WVJ A;  4OER A;  1MXX A;  3I6V A;  1D9V A;  1SW5 A;  5FHN A;  3MVZ A;  1LBB A;  3B7D A;  4G8N A;  1XOC A;  4PDD A;  2NWJ A;  1H45 A;  1B3L A;  1YAE A;  2PYY A;  2DXR A;  2ESN A;  3VDF A;  2ALU A;  1TWY A;  2NXO A;  2V3T A;  3TEP A;  4RPO A;  1R9Q A;  3TTR A;  3KSX A;  2QMW A;  4U2R A;  1MPD A;  3U65 A;  1BKA A;  1FTO A;  5TPA A;  2FVZ A;  2Z8D A;  1DTG A;  3OO7 A;  2OLB A;  4AS4 A;  5EQ7 A;  1MY4 A;  2Y84 A;  1LEV A;  5DYH A;  3VV5 A;  4OVT A;  4O3C A;  1B2H A;  3HHF A;  3FAT A;  3C36 A;  2A5S A;  5L9S A;  1FTJ A;  3MZB A;  2B65 A;  4YKK A;  4H5F A;  4DLD A;  5ELV A;  3M3L A;  1FQD A;  4UAB A;  2H99 A;  2A5T A;  5A5X A;  2OK2 A;  1FSA A;  2ONR A;  3Q26 A;  2B4M A;  5EQA A;  1FPB A;  2XXI A;  1IMB A;  3SEU A;  4MNP A;  1VFD A;  3CSG A;  3ZKL A;  3T93 B;  2VP1 A;  2B3B A;  2O51 A;  1QW0 A;  4GVO A;  3EHT A;  1MQH A;  1LBZ A;  2Q8J A;  3EKI A;  2WEF A;  1NMU A;  3N6U A;  4G68 C;  4IO7 A;  1DK4 A;  2HPG A;  4PGN A;  4LA9 A;  2FBP A;  1FTL A;  5LTC A;  1BIY A;  3KEI A;  2QS1 A;  3UN6 A;  4KHZ E;  1BLF A;  3IOU A;  4P47 A;  4Z0I A;  3VLU A;  3KBR A;  1ZJL A;  4X04 A;  1JVX A;  3ROJ A;  3VE1 B;  2Q9T A;  4QFL A;  3BKI B;  3TTK A;  5AA2 A;  1FBF A;  2VPO A;  4U1O A;  2XD2 A;  4OET A;  4H1X A;  1JEV A;  1US4 A;  4AS5 A;  3B50 A;  3FV2 A;  3KFM A;  1DBZ A;  3KGC A;  2RF1 A;  5EQ8 A;  3MP1 A;  2DWH A;  1OQH A;  4NWC A;  4N8G A;  2HAU A;  4F39 A;  1I69 A;  2QSX A;  5KCJ A;  2ZZW A;  4NN3 A;  1Y3Q A;  4PBH A;  1D9Y A;  2UVJ A;  3MQ9 A;  1PC3 A;  4XTC Q;  3ILT B;  2FIX A;  5HBC A;  2CEY A;  1Q35 A;  4PQJ A;  2XXT A;  4KYE A;  2F34 A;  1P1O A;  1LFG A;  3HST A;  1B1H A;  4RPN A;  1O64 A;  1FQF A;  5FHO A;  1MY3 A;  5EYH A;  3GZG A;  3SDF A;  4Q8R A;  3UIF A;  3MPK A;  4I3E A;  1JNF A;  2F36 A;  2I3V A;  1CB6 A;  1LGB C;  1FQE A;  2F7B A;  2ZZV A;  4H45 A;  4OAN A;  3K4U A;  4YB7 A;  3T9V A;  1H43 A;  3OEK A;  4R2B A;  1FPJ A;  3LSL A;  3MZ1 A;  1NV5 A;  3KOT A;  3A29 A;  4GXS B;  3S4U A;  5DW8 A;  1FBE A;  4MLQ A;  3HN0 A;  2F35 A;  3BIH A;  4PGP A;  3H6T A;  3K2D A;  3HCQ A;  4U21 A;  1LFH A;  4GF8 A;  1MPC A;  3N26 A;  4G77 A;  1T0K A;  2HXR A;  4P11 A;  4PDH A;  1B0H A;  3RQT A;  3LSW A;  3KSJ A;  4BLA A;  3D4C A;  4NF8 A;  5EHS A;  4YZZ A;  1RDZ A;  2OCU A;  4OWD A;  4MX6 A;  3ILU B;  4N6D A;  5I56 A;  3KC0 A;  4GXA A;  5I58 A;  2H9B A;  2B4L A;  4MF3 A;  3H4Z A;  1KWH A;  4YU0 A;  1Y1M A;  4NF5 B;  4F3G A;  5H8N A;  2ONS A;  5I84 A;  1G0H A;  3CVG A;  3VVD A;  3TFL A;  1B52 A;  3ZKK A;  4RNS A;  3RTW B;  3OO9 A;  2OBG A;  1AOV A;  3C34 A;  4X8R A;  4RXL A;  1DSN A;  4DIG A;  1PEB A;  3O6I A;  3BBR A;  2E1S A;  4IR8 A;  4MBP A;  3FZV A;  4QXD A;  1MY1 A;  1VSO A;  4H0W A;  3TTM A;  2QS3 A;  3W15 C;  4Q0C A;  2Y7W A;  3R7X A;  4G8H A;  5ICQ A;  2VD3 A;  4WXJ A;  4YKJ A;  1BK4 A;  1IMC A;  1JP4 A;  5CI5 A;  4FAJ A;  1B5H A;  3MJN A;  3PU5 A;  2DSF A;  3KJ7 A;  4MNC A;  1MH4 A;  2ZYN A;  2XXR A;  4PF8 A;  5HPQ A;  1IUD A;  2O84 X;  4ZEB A;  4M1V A;  2XHD A;  1MQJ A;  4U4S A;  5EHM A;  2I58 A;  5H8Q A;  2H4I A;  1HSL A;  1PB7 A;  2AL5 A;  5CBS A;  5CMC A;  4PFI A;  3FGS A;  3B6W A;  4FAT A;  4LQ2 A;  3TCH A;  4F1U A;  4UAC A;  4PE5 B;  5TPA B;  2RCA A;  3TKD A;  2B3F A;  2HXW A;  4GL8 A;  4R73 A;  1IQ7 A;  1L5T A;  1MG1 A;  2LAO A;  2XWO A;  5I2N A;  4E0X A;  1N3X A;  3FVO A;  2F3B A;  1ANF A;  3MC2 A;  4GWO A;  1JW1 A;  4EUO A;  1QGX A;  1P1W A;  1O63 A;  2OWT A;  3AXF A;  4G4P A;  4PFB A;  1B7U A;  4H8J A;  3C35 A;  4XFE A;  2PX1 A;  2CZH A;  4PFU A;  3IOV A;  4BDL A;  3GBA A;  4MMP A;  2A5T B;  3PV0 E;  1MM6 A;  5A5X B;  2XA5 A;  4EQB A;  3B6Q A;  3EF7 A;  4PFT A;  4Z7E A;  1AL3 A;  2HHM A;  3RYD A;  3C9H A;  4KCC A;  1USY E;  1JEU A;  1P99 A;  3QXM A;  2REJ A;  4KCD A;  3GBB A;  4IO4 A;  3O6H A;  1GR2 A;  2DVC A;  4XF5 A;  3MST A;  3O28 A;  3KBZ A;  5JK4 A;  5FBP A;  4R6K A;  2ZNT A;  1FPE A;  3U8Q A;  3WAF A;  1NUW A;  2F78 A;  3CG1 A;  4PCD A;  1EZO A;  4ELP A;  2XWK A;  4PBQ A;  5AA2 B;  5DTB A;  3VXB A;  5IAI A;  2R6G E;  1WOD A;  1XI6 A;  4MJO A;  2I48 A;  1IXI A;  3IB1 A;  3LSF B;  3CR9 A;  3HV1 A;  4U22 A;  2ZXT A;  1NH8 A;  2DQV A;  1INP A;  2OWS A;  1M5E A;  1II5 A;  2DE3 A;  3EPE A;  2XXK A;  4TQU Q;  4WEP A;  3W9V A;  5KCJ B;  4IGT A;  1NNP A;  4MEV A;  1UQW A;  2CZI A;  2GHA A;  4EDP A;  4ZEC A;  1RDX A;  3TDJ A;  2XD3 A;  3MVY A;  3PPN A;  2V25 A;  4QSD A;  3SET A;  4F18 A;  4N6K A;  3CHG A;  4ZED A;  1S50 A;  3FVK A;  3JV9 A;  2OWZ A;  4JSD A;  3RPW A;  3RN8 A;  1M5F A;  4JXI A;  1EYI A;  1D3K A;  4JWY A;  4I62 A;  3MVW A;  2E0S A;  1IMF A;  1FQA A;  4RJZ A;  4RY1 A;  3OO6 A;  4TLL B;  4AQ4 A;  4MCO A;  1NV4 A;  2Z8F A;  2Y7P A;  5JTY A;  4ELQ A;  1FJ9 A;  5I59 A;  1UTH B;  3EHS A;  3LSX A;  5J16 A;  2O1M A;  4EQ9 A;  4ZEI A;  4AB6 A;  1NNT A;  3ISP A;  2ZNS A;  4N8Y A;  2D3I A;  4R75 A;  3G3K A;  1JW5 A;  4PF6 A;  5DVF A;  1IMD A;  3V8X B;  3PPQ A;  3IFA A;  3JYR A;  3K0V A;  3FUZ A;  4RYA A;  1K9Y A;  4NF8 B;  4NED A;  2UYE A;  1N04 A;  1XC1 A;  5J1D A;  4ONY A;  4XKR A;  1IEJ A;  5I58 B;  5I56 B;  3DLN A;  1N7X A;  1B05 A;  1Z7N E;  2NUV A;  5H8N B;  5IGA A;  3C32 A;  4WKM A;  1I6B A;  1QKB A;  1N84 A;  4RK9 A;  5IZ3 A;  4DDD A;  1LST A;  1P1N A;  1FPK A;  2F6G A;  5H8S A;  1XVX A;  2WYP A;  4RA1 A;  2GHB A;  3CFZ A;  2OX3 A;  4FJP A;  1MRP A;  3S9L C;  2O69 A;  1Y4T A;  3QAX A;  1QUK A;  1NI9 A;  1Y1Z A;  4KI0 E;  3H03 A;  4F22 A;  2DXY A;  2QVR A;  4I3Y A;  2P3V A;  5BWJ A;  4IO5 A;  2ONK E;  3G3J A;  1A40 A;  1A55 A;  3IO4 A;  3IFC A;  4LVQ A;  1DPP A;  3MAM A;  1FQC A;  2RC7 A;  4GWZ A;  1YCJ A;  1B0L A;  1LAF E;  3IJO B;  2ZYM A;  4EF2 A;  1DPE A;  1OVB A;  3NOH A;  1XHY A;  1MQD A;  1YPN A;  4X9T A;  1ZBM A;  1SI1 A;  2PFY A;  4IY6 A;  4LN5 A;  4P8B A;  3OEM A;  3E9X A;  2DE4 A;  2FHY A;  1OVT A;  1O7T A;  3V5A A;  4OFL A;  4GWX A;  5H8Q B;  1VDW A;  3TMG A;  1NUX A;  1JW4 A;  4F31 B;  4C0R A;  2X7P A;  5KDT A;  1B3G A;  4ZS9 A;  1Q1K A;  2KLF A;  1N3W A;  3IOR A;  3GLB A;  1MM7 A;  3IK6 B;  1OLC A;  2XXW A;  3V89 B;  2WKY A;  1ZIU A;  4F1V A;  3BIG A;  1N7W A;  5I2N B;  2DOJ A;  2UVG A;  3B8B A;  4FOR A;  1MXU A;  3USD A;  3LUY A;  4GX4 A;  5CMB A;  1SDX A;  2Q2C A;  2F5X A;  4XIG Q;  3VVF A;  1H3D A;  2Q74 A;  1FRP A;  2ZNU A;  2CMO A;  4OYV A;  2F97 A;  2XWI A;  4GOT A;  2DYX A;  3V83 A;  4NTL A;  3FXU A;  4FBP A;  4P0G A;  1TFD A;  2WYK A;  3K00 A;  5EYG A;  4G2Z A;  2ANJ A;  3IX1 A;  4DXC A;  4I1D A;  3FVN A;  4N81 A;  1LBC A;  4ZDM A;  1MXW A;  4F2O A;  1DMB A;  3MVX A;  5HM4 B;  3I3V A;  4F3S A;  4N07 A;  5CBR A;  2XXX A;  4JVI A;  3PUV E;  4N13 A;  4LZ5 A;  2XWV A;  3E3K A;  1IXG A;  3E13 X;  1IIT A;  3F11 A;  1LBY A;  4QFK A;  5BUU A;  3QUF A;  3KN7 A;  5I57 A;  1UTH A;  3O66 A;  4DI4 B;  3T96 B;  1G0I A;  4GWS A;  4NQ8 A;  2I6E A;  1NNK A;  4C1U A;  3D4G A;  4JSO A;  1IME A;  3GXA A;  2FIE A;  3T0J A;  4IO6 A;  2DDK A;  2GRV A;  2Y7I A;  2DWI A;  4KQP A;  3KG2 A;  1B3E A;  1PDA A;  1UIV A;  5AA3 A;  5DVI A;  4YAH X;  4QFP A;  4LUB A;  4PE3 A;  4U23 A;  2FA7 A;  4FIM A;  4U4X A;  5IZ1 A;  3MP6 A;  1FBD A;  4PAF A;  2XX8 A;  2IEE A;  1NV0 A;  1EZ9 A;  4R74 A;  4MFI A;  3K1P A;  4KR5 A;  3TQW A;  3FJ7 A;  3SES A;  2QJE A;  3MUQ A;  2BJI A;  3UOR A;  1SW4 A;  4IO3 A;  5ICT A;  2FNC A;  4HXV A;  4LZ7 A;  2Q88 A;  4GX6 A;  4DCX A;  1BP5 A;  4DE8 A;  3K1N A;  4HE0 A;  4OXV A;  1SD3 A;  1LB8 A;  3FV1 A;  5DVJ A;  5AA2 D;  4BDR A;  1H44 A;  1Y3N A;  3PGF A;  1CE2 A;  1M5C A;  3U92 A;  4G61 A;  4LP2 B;  5ET7 A;  3TTN A;  1HSJ A;  1MXY A;  3HFU A;  4PP0 A;  3SZP A;  1FPL A;  4N6P A;  2ZYK A;  3MZ9 A;  5JTY B;  4OZ9 A;  3T1B A;  2O1L A;  3HHG A;  5I59 B;  2F7A A;  4P56 A;  3PD9 A;  4F29 A;  4DXB A;  3ODB A;  4KPT A;  2PT1 A;  2UYF A;  3I5O A;  1YZ0 A;  2HEU A;  4GRK A;  4R2F A;  3FD3 A;  1AWB A;  4BDN A;  3FXB A;  3KC1 A;  2V93 A;  3PMX A;  2QVU A;  1B40 A;  3PUZ E;  4ZEF A;  3TZA A;  1LCF A;  1XS5 A;  2YJP A;  2QPQ A;  3THI A;  4POX A;  3LBS A;  3BFT A;  3RT6 B;  3SKP A;  5I5P A;  4FED A;  4BDQ A;  1US5 A;  1EYJ A;  3MBP A;  1R9L A;  5IZ3 B;  1QKA A;  4OFO A;  3D1R A;  2WBD A;  2VHA A;  4JVD A;  1HSE A;  3RGY A;  3TPA A;  2XXU A;  1GV8 A;  1NKX A;  3RNN A;  1VR5 A;  1URD A;  1FPD A;  1LAH E;  2HFB A;  1WDN A;  2W7Y A;  3L6G A;  2XXV A;  5I2K A;  2UVI A;  1OLA A;  1B5J A;  4EF1 A;  2VPN A;  3IL1 B;  1SPI A;  1FBH A;  2XX7 A;  1NL5 A;  2D5W A;  2V3U A;  2XXH A;  3TTL A;  4O8M A;  3O6G A;  1FPF A;  5ISU A;  1FBG A;  2V4C A;  2R8T A;  1DCU A;  1MPB A;  3TUS A;  1F9B A;  5EQ9 A;  5K2Y A;  1D9Q A;  4ZEK A;  3OSR A;  1BTJ A;  3LR1 A;  3BFU A;  3OOA A;  3TCG A;  4BDO A;  4JDF A;  4OFJ A;  2Q8M A;  5IZZ A;  2GFE A;  3U1O A;  4DCY A;  4EXL A;  3SEV A;  2L5V A;  1M5D A;  1S7Y A;  4GIZ A;  3TYH A;  2XX9 A;  3Q25 A;  2V3Q A;  4NGU A;  4HCW A;  3T22 A;  1ZKB A;  2XXQ A;  4JBZ A;  4U1Z A;  3SEY A;  4QFN A;  3M3K A;  4R6Y A;  1QJM A;  3DP8 A;  4IO2 A;  4O3A A;  3EQ1 A;  2Y5K A;  2FYI A;  1MQI A;  2O68 A;  3OMB A;  3K02 A;  1FTA A;  3O29 A;  5KDT B;  5DEX A;  4OVQ A;  4HW8 A;  3O97 A;  3Q28 A;  3E4R A;  3PPR A;  2XXP A;  3Q29 A;  2G29 A;  2DWJ A;  4MH5 A;  3S2V A;  5A5L A;  5IKB A;  3VLV A;  4PTK A;  4HS7 A;  3TCF A;  5FTH A;  4DXU A;  2YPN A;  1QVS A;  4IGR A;  1LLS A;  4OEV A;  1B6H A;  2RC9 A;  3G3F A;  4OTE A;  1SW1 A;  1ELJ A;  4G68 A;  3QIM A;  2D21 A;  4NF6 A;  1LBX A;  3CIJ A;  4ELR A;  4GWY A;  1B9J A;  1FJ6 A;  1NV2 A;  4ZZA A;  5L9O A;  2ZYO A;  1YXI A;  3LV0 A;  3OSQ A;  3VLW A;  4P9K A;  2CZL A;  3RT8 A;  1FPG A;  1OQG A;  4YB5 A;  3QSL A;  2Q2A A;  3PMV A;  4P1L A;  4R9F A;  4ESW A;  4X48 A;  4TLM B;  5DT6 A;  1ZLQ A;  2Y5L A;  4FEB A;  1TXF A;  1A8E A;  3ONM A;  3SEW A;  1GVC A;  4XKP A;  5I57 B;  3LC8 A;  5L8D A;  3UA8 A;  3CSB A;  4OVR A;  3FXR A;  2I3W A;  4MAG A;  5CC2 A;  1EYK A;  4FE8 A;  4R6H A;  4MLV A;  4O7M A;  3C31 A;  4X1D A;  1B4Z A;  4N4U A;  3WAE A;  1NUY A;  3N6T A;  3G3G A;  1XT8 A;  1Z7M E;  3VVE A;  3PMW A;  2I4B A;  3PUX E;  4GD5 A;  3DM0 A;  4O3B A;  1K9Z A;  4ECF A;  4P3L A;  5M2V A;  4H65 A;  4HCY A;  1KA1 A;  3DP6 A;  1PB9 A;  3FJM A;  1MS7 A;  2HZL A;  2I0C A;  1XVY A;  4G8M A;  1KA0 A;  1J1N A;  4R72 A;  1IIW A;  2Z22 A;  2MKZ A;  4GX3 A;  4OEU A;  1PBQ A;  1B51 A;  3CFL A;  1ZMG A;  1FTM A;  3IOW A;  4IY5 A;  3EHU A;  5AE4 A;  4PET A;  5CRY A;  3K6U A;  4QSE A;  2Y7R A;  2Y7K A;  1DTZ A;  3U94 A;  3E78 A;  3FJG A;  2O7U A;  1OIB A;  4OVS A;  2I4C A;  4GL0 A;  3CFX A;  2AL4 A;  3K1M A;  1MQG A;  1LCT A;  5K2X A;  5H8F A;  4PFY A;  2AYS A;  1LAX A;  3A3U A;  2IA4 A;  4GQO A;  3MYU A;  1NNF A;  3MW0 A;  4QSC A;  1MY2 A;  2VD2 A;  2WBB A;  1S9T A;  3KJT A;  3M8U A;  3EN3 A;  4M4G A;  4GFR A;  1VFE A;  1POY 1;  3H06 B;  1B3H A;  4RK2 A;  1MY0 A;  3A09 A;  3IO6 A;  4PAI A;  4GLI A;  1A7L A;  3RPL A;  1URS A;  4ISU A;  5F1Q A;  4NF4 A;  2H5Y A;  3B6T A;  3T9X B;  1NV6 A;  5FHM A;  1IXC A;  4OMB A;  1LBW A;  2QMX A;  1N0T A;  1AH5 A;  2PT2 A;  3G7W A;  2F7C A;  5CM6 A;  5LOM A;  3TAJ A;  3K01 A;  1SI0 A;  1IXH A;  3R26 A;  4MIJ A;  4JVC A;  2HQ0 A;  1MDP 1;  3CI8 A;  4QF9 A;  3O9P A;  4EQ7 A;  1A99 A;  2ABH A;  5AA1 A;  1FBC A;  2QVV A;  4OHN A;  2X7Q A;  3U93 A;  3RY3 A;  2CZK A;  4Q30 B;  3ZS6 A;  2ZZX A;  4TOZ A;  1Q9D A;  3ZSF A;  4K3F A;  4N15 A;  3PD8 A;  5F24 A;  1GGG A;  1FW0 A;  5I2K B;  3R6U A;  4YKI A;  1Y4C A;  1UTB A;  4YKP A;  1QUI A;  1OMP A;  4H6D A;  5FTI A;  3HO7 A;  4NE4 A;  1ATG A;  5I3S A;  5L9M A;  2G93 A;  3DP4 A;  4NHB A;  1N76 A;  2DVZ A;  1B1X A;  1PB8 A;  2VOZ A;  4KD5 A;  1KZ8 A;  2YLN A;  1AIV A;  2THI A;  2HZK A;  3K6W A;  4NX1 A;  1POT A;  2PBW A;  5LDZ A;  4I8C A;  1A8F A;  4YIC A;  4LQ5 A;  4H8I A;  1B7Z A;  1I6A A;  2Z23 A;  4OEN A;  4GWU A;  5AA4 A;  4R9G A;  4HE1 A;  1JET A;  2R71 A;  2UVH A;  1MXZ A;  4YMA A;  2PMS A;  4P0I A;  3Q27 A;  4PFW A;  1B58 A;  4POW A;  5TU0 A;  4ZZE A;  1VE4 A;  3KZG A;  5F7V A;  4I9D A;  1CNQ A;  3QMF A;  3DEL B;  1NFT A;  4QRZ A;  1NV7 A;  3VXC A;  2QL3 A;  4N17 A;  5CMK A;  4NAP A;  3KN8 A;  3A3C A;  4H5G A;  5DEX B;  1QUL A;  3IJX B;  1RYO A;  5TP9 B;  1URG A;  3KOS A;  4I40 A;  4O7I A;  3UP9 A;  1FCK A;  1EU8 A;  4MNI A;  2PFZ A;  1TT1 A;  4GWW A;  3MPL A;  2ZMB A;  1FTK A;  4HE2 A;  4BDM A;  4F3P A;  4Q5T A;  3SEX A;  4QBA A;  1JVY A;  3QK6 A;  3QYT A;  5ET5 A;  5B7D A;  4YMB A;  1SQY A;  3OEN A;  2F6P A;  4AB5 A;  3FBP A;  4G68 B;  4FEC A;  3N94 A;  5H8H B;  4NF6 B;  2V84 A;  3C33 A;  1YYZ A;  4WED A;  3RUM A;  1B7H A;  5ET6 A;  4UA8 A;  3IAZ A;  1QUJ A;  1TFA A;  4N91 A;  4XKQ A;  2H25 A;  2GQ1 A;  1B32 A;  1SYI A;  2WX9 A;  4X1B A;  2I49 A;  3OO8 A;  4YB6 A;  1M5B A;  5B70 A;  2QFL A;  1LB9 A;  4O94 A;  4KYD A;  2NVU B;  1FBP A;  3G3H A;  2UXA A;  1H76 A;  2P0S A;  5CMM A;  4ELO A;  1RDY A;  2HCA A;  2OZZ A;  2RC8 A;  4P1E A;  1GTK A;  3PPP A;  2DP8 A;  2RKM A;  4KXP A;  4EXK A;  2VGQ A;  2OJT A;  1B3F A;  2GH9 A;  3PUW E;  3FAS A;  3FXQ A;  3LUZ A;  3N5L A;  1ZU0 A;  3H6U A;  3TQL A;  1JQF A;  4PAK A;  1LAG E;  1Y3P A;  3IB2 A;  4OVP A;  5IM2 A;  2P3N A;  2R9J A;  4OES A;  3HPI A;  4MHF A;  3RTF B;  1LFI A;  1FQB A;  1NV1 A;  2PVU A;  2X26 A;  1PBP A;  3GYY A;  5ESY A;  4F1Y A;  3FVG A;  4XKN A;  3IB0 A;  2RCB A;  2O6A A;  2Q89 A;  1DOT A;  4OQO A;  3C4M A;  2P2A A;  2RIN A;  3K6V A;  4ZE8 A;  1MH3 A;  5ET8 A;  4GBW A;  3PUY E;  1MDQ A;  3P7I A;  4C1T A;  1Y20 A;  1SYH A;  2CEX A;  3CG3 A;  5H8F B;  1IMA A;  3SER A;  2Z8E A;  1A54 A;  3H7M A;  4XEQ A;  4LZ8 A;  5T3J A;  4IB2 A;  1I6Q A;  1P1Q A;  2H98 A;  2P1S A;  1NV3 A;  4KYS A;  1SVX B;  4JB7 A;  4L17 A;  4THI A;  3RPL B;  3OEL A;  4QHQ A;  4NF4 B;  3RLF E;  1YTV A;  4H67 A;  2AIX A;  2M8C A;  1IZ1 A;  2F8D A;  5JEI A;  2XXY A;  3QUJ A;  3H6V A;  4OVJ A;  3IOT A;  5TP9 A;  3UGW A;  4NG7 A;  3S9E A;  1AMF A;  2BJJ X;  4ESX A;  4OA4 A;  3G3I A;  4DI3 D;  3OD7 A;  1B4H A;  4KFQ A;  4NWD A;  4H46 A;  4JWO A;  1ZTY A;  5KZT A;  4NMY A;  2VT5 A;  3T66 A;  4PFR A;  1RKM A;  1R1N A;  2NOO A;  3U72 A;  1D4N A;  2QRY A;  2F3D A;  5H8H A;  1RYX A;  3ECR A;  1UTB B;  1NH7 A;  4GBV A;  2QS2 A;  3T9U A;  4XXU A;  1EZP A;  1SW2 A;  3MP8 A;  3CRB A;  4NF0 A;  3MWB A;  1R6Z A;  1UIU A;  3K6X A;  5ITO A;  1NUZ A;  3KN3 A;  2KQZ A;  1P1U A;  3H6W A;  2HAV A;  1Y9U A;  4JWX A;  4NF5 A;  3L6H A;  4F2Q A;  1LBV A;  4F19 A;  3JZJ A;  2DE2 A;  3TOD A;  3PTY A;  1USY H;  1B46 A;  2DWA A;  2QS4 A;  2DS9 A;  5AA4 B;  2JJK A;  3H3G A;  4PC9 A;  4E0W A;  4ZE9 A;  2KR0 A;  3W9W A;  1EH3 A;  4HTG A;  3S9M C;  4ND9 A;  1FPI A;  2I0B A;  3IR1 A;  5EYF A;  3VFJ A;  4QFO A;  5I7I A;  3T9H B;  1MXV A;  1B5I A;  4DZ1 A;  2REG A;  3E79 A;  3UK4 A;  1SBP A;  2PCR A;  3PPO A;  3FIR A;  4F3B A;  5ITP A;  3TEL A;  3S9N C;  2O7I A;  3OXN A;  3O2A A;  4LON B; 
#chains in the Genus database with same CATH homology
 4LAT A;  3M3F A;  1WVJ A;  4OER A;  1MXX A;  3I6V A;  1D9V A;  1SW5 A;  5FHN A;  3MVZ A;  1LBB A;  3B7D A;  4G8N A;  1XOC A;  2NWJ A;  1H45 A;  1B3L A;  1YAE A;  2PYY A;  2DXR A;  2ESN A;  3VDF A;  2ALU A;  1TWY A;  2NXO A;  2V3T A;  3TEP A;  4RPO A;  1R9Q A;  3TTR A;  3KSX A;  2QMW A;  4U2R A;  1MPD A;  1BKA A;  1FTO A;  5TPA A;  2Z8D A;  1DTG A;  3OO7 A;  2OLB A;  1MY4 A;  2Y84 A;  5DYH A;  3VV5 A;  4O3C A;  1B2H A;  3HHF A;  3FAT A;  3C36 A;  2A5S A;  5L9S A;  1FTJ A;  3MZB A;  2B65 A;  4YKK A;  4H5F A;  4DLD A;  5ELV A;  3M3L A;  1FQD A;  2H99 A;  2A5T A;  5A5X A;  2OK2 A;  2ONR A;  3Q26 A;  2XXI A;  3SEU A;  1VFD A;  3CSG A;  3ZKL A;  3T93 B;  2VP1 A;  2B3B A;  2O51 A;  1QW0 A;  4GVO A;  3EHT A;  1MQH A;  2Q8J A;  1NMU A;  3N6U A;  4G68 C;  4IO7 A;  4LA9 A;  1FTL A;  1BIY A;  3KEI A;  2QS1 A;  3UN6 A;  4KHZ E;  1BLF A;  3IOU A;  3VLU A;  4Z0I A;  3KBR A;  1ZJL A;  1JVX A;  3VE1 B;  2Q9T A;  4QFL A;  3BKI B;  3TTK A;  5AA2 A;  4U1O A;  2XD2 A;  4OET A;  4H1X A;  1JEV A;  1US4 A;  3FV2 A;  3KFM A;  3KGC A;  2RF1 A;  3MP1 A;  2DWH A;  1OQH A;  4NWC A;  2HAU A;  4F39 A;  1I69 A;  2QSX A;  5KCJ A;  1Y3Q A;  1D9Y A;  2UVJ A;  3MQ9 A;  1PC3 A;  4XTC Q;  3ILT B;  5HBC A;  1Q35 A;  4PQJ A;  2XXT A;  4KYE A;  2F34 A;  1P1O A;  1LFG A;  3HST A;  1B1H A;  4RPN A;  1O64 A;  1FQF A;  5FHO A;  1MY3 A;  3GZG A;  3SDF A;  4Q8R A;  3UIF A;  3MPK A;  1JNF A;  2F36 A;  2I3V A;  1CB6 A;  1LGB C;  1FQE A;  2F7B A;  4YB7 A;  3K4U A;  3T9V A;  1H43 A;  3OEK A;  4R2B A;  3LSL A;  3MZ1 A;  3KOT A;  4GXS B;  3S4U A;  4MLQ A;  3HN0 A;  2F35 A;  3H6T A;  3K2D A;  3HCQ A;  4U21 A;  1LFH A;  4GF8 A;  1MPC A;  3N26 A;  4G77 A;  1T0K A;  4P11 A;  1B0H A;  3RQT A;  3LSW A;  3KSJ A;  4BLA A;  3D4C A;  4NF8 A;  5EHS A;  4YZZ A;  2OCU A;  4OWD A;  3ILU B;  5I56 A;  4GXA A;  5I58 A;  2H9B A;  4MF3 A;  3H4Z A;  1KWH A;  4YU0 A;  1Y1M A;  4NF5 B;  4F3G A;  5H8N A;  2ONS A;  5I84 A;  3CVG A;  3VVD A;  3TFL A;  1B52 A;  3ZKK A;  4RNS A;  3RTW B;  3OO9 A;  2OBG A;  1AOV A;  3C34 A;  4RXL A;  1DSN A;  4DIG A;  1PEB A;  3O6I A;  3BBR A;  2E1S A;  4MBP A;  3FZV A;  1MY1 A;  1VSO A;  4H0W A;  3TTM A;  2QS3 A;  3W15 C;  4Q0C A;  2Y7W A;  3R7X A;  4G8H A;  5ICQ A;  2VD3 A;  4WXJ A;  4YKJ A;  5CI5 A;  4FAJ A;  1B5H A;  3MJN A;  3PU5 A;  2DSF A;  3KJ7 A;  1MH4 A;  2ZYN A;  2XXR A;  5HPQ A;  1IUD A;  2O84 X;  4ZEB A;  4M1V A;  2XHD A;  1MQJ A;  4U4S A;  5EHM A;  2I58 A;  5H8Q A;  2H4I A;  1HSL A;  1PB7 A;  2AL5 A;  5CBS A;  5CMC A;  3FGS A;  3B6W A;  4FAT A;  4LQ2 A;  3TCH A;  4F1U A;  4UAC A;  4PE5 B;  5TPA B;  2RCA A;  3TKD A;  2B3F A;  2HXW A;  4GL8 A;  4R73 A;  1IQ7 A;  1L5T A;  1MG1 A;  2LAO A;  5I2N A;  4E0X A;  1N3X A;  3FVO A;  1ANF A;  3MC2 A;  4GWO A;  1JW1 A;  4EUO A;  1P1W A;  1O63 A;  2OWT A;  3AXF A;  4G4P A;  1B7U A;  4H8J A;  3C35 A;  2PX1 A;  4PFU A;  3IOV A;  4BDL A;  3GBA A;  2A5T B;  3PV0 E;  1MM6 A;  5A5X B;  4EQB A;  3B6Q A;  3EF7 A;  4PFT A;  4Z7E A;  1AL3 A;  3C9H A;  4KCC A;  1USY E;  1JEU A;  1P99 A;  3QXM A;  2REJ A;  4KCD A;  3GBB A;  4IO4 A;  3O6H A;  1GR2 A;  2DVC A;  3O28 A;  5JK4 A;  4R6K A;  2ZNT A;  3U8Q A;  3WAF A;  3CG1 A;  2F78 A;  1EZO A;  4ELP A;  5AA2 B;  5DTB A;  3VXB A;  5IAI A;  2R6G E;  1WOD A;  2I48 A;  1IXI A;  3IB1 A;  3LSF B;  3CR9 A;  3HV1 A;  4U22 A;  2ZXT A;  1NH8 A;  2DQV A;  2OWS A;  1M5E A;  1II5 A;  2DE3 A;  3EPE A;  4TQU Q;  4WEP A;  3W9V A;  5KCJ B;  4IGT A;  1NNP A;  1UQW A;  2GHA A;  4EDP A;  4ZEC A;  3TDJ A;  2XD3 A;  3MVY A;  3PPN A;  2V25 A;  4QSD A;  3SET A;  4F18 A;  4ZED A;  1S50 A;  3FVK A;  3JV9 A;  4JSD A;  3RPW A;  3RN8 A;  1M5F A;  4JXI A;  1D3K A;  4JWY A;  4I62 A;  3MVW A;  2E0S A;  1FQA A;  4RJZ A;  4RY1 A;  3OO6 A;  4TLL B;  4AQ4 A;  2Z8F A;  2Y7P A;  5JTY A;  4ELQ A;  5I59 A;  1UTH B;  3EHS A;  3LSX A;  2O1M A;  4EQ9 A;  4ZEI A;  4AB6 A;  1NNT A;  2ZNS A;  2D3I A;  4R75 A;  3G3K A;  1JW5 A;  5DVF A;  3V8X B;  3PPQ A;  3JYR A;  3K0V A;  3FUZ A;  4RYA A;  4NF8 B;  4NED A;  2UYE A;  1N04 A;  1XC1 A;  5J1D A;  4ONY A;  4XKR A;  1IEJ A;  5I58 B;  5I56 B;  3DLN A;  1N7X A;  1B05 A;  1Z7N E;  2NUV A;  5H8N B;  3C32 A;  4WKM A;  1I6B A;  1QKB A;  1N84 A;  4RK9 A;  4DDD A;  1LST A;  1P1N A;  2F6G A;  5H8S A;  1XVX A;  4RA1 A;  2GHB A;  3CFZ A;  4FJP A;  1MRP A;  3S9L C;  2O69 A;  1Y4T A;  3QAX A;  1QUK A;  1Y1Z A;  4KI0 E;  3H03 A;  4F22 A;  2DXY A;  5BWJ A;  4IO5 A;  2ONK E;  3G3J A;  1A40 A;  1A55 A;  3IO4 A;  4LVQ A;  1DPP A;  3MAM A;  1FQC A;  2RC7 A;  1YCJ A;  1B0L A;  1LAF E;  3IJO B;  2ZYM A;  4EF2 A;  1DPE A;  1OVB A;  1XHY A;  1MQD A;  1YPN A;  4X9T A;  1ZBM A;  1SI1 A;  4IY6 A;  3OEM A;  3E9X A;  2DE4 A;  1OVT A;  1O7T A;  3V5A A;  4OFL A;  5H8Q B;  3TMG A;  1JW4 A;  4F31 B;  4C0R A;  2X7P A;  5KDT A;  1B3G A;  4ZS9 A;  1Q1K A;  2KLF A;  1N3W A;  3IOR A;  3GLB A;  1MM7 A;  3IK6 B;  1OLC A;  2XXW A;  3V89 B;  2WKY A;  1ZIU A;  4F1V A;  1N7W A;  5I2N B;  2DOJ A;  2UVG A;  4FOR A;  1MXU A;  3USD A;  3LUY A;  5CMB A;  1SDX A;  2Q2C A;  2F5X A;  4XIG Q;  3VVF A;  1H3D A;  2ZNU A;  2CMO A;  4OYV A;  2F97 A;  4GOT A;  2DYX A;  3V83 A;  4NTL A;  3FXU A;  4P0G A;  1TFD A;  3K00 A;  4G2Z A;  2ANJ A;  3IX1 A;  4DXC A;  4I1D A;  3FVN A;  1LBC A;  4ZDM A;  1MXW A;  4F2O A;  1DMB A;  3MVX A;  5HM4 B;  3I3V A;  4F3S A;  4N07 A;  5CBR A;  2XXX A;  3PUV E;  4N13 A;  4LZ5 A;  3E3K A;  1IXG A;  3E13 X;  1IIT A;  3F11 A;  4QFK A;  5BUU A;  3QUF A;  3KN7 A;  5I57 A;  1UTH A;  3O66 A;  3T96 B;  2I6E A;  1NNK A;  4C1U A;  3D4G A;  4JSO A;  3GXA A;  4IO6 A;  2GRV A;  2Y7I A;  2DWI A;  4KQP A;  3KG2 A;  1B3E A;  1PDA A;  1UIV A;  5AA3 A;  5DVI A;  4YAH X;  4QFP A;  4LUB A;  4U23 A;  2FA7 A;  4FIM A;  4U4X A;  3MP6 A;  2XX8 A;  2IEE A;  1EZ9 A;  4R74 A;  4MFI A;  3K1P A;  4KR5 A;  3TQW A;  3FJ7 A;  3SES A;  2QJE A;  3MUQ A;  3UOR A;  1SW4 A;  4IO3 A;  5ICT A;  2FNC A;  4LZ7 A;  2Q88 A;  4DCX A;  1BP5 A;  4DE8 A;  3K1N A;  4OXV A;  1SD3 A;  1LB8 A;  3FV1 A;  5DVJ A;  5AA2 D;  4BDR A;  1H44 A;  1Y3N A;  3PGF A;  1CE2 A;  1M5C A;  3U92 A;  4LP2 B;  3TTN A;  1HSJ A;  1MXY A;  4PP0 A;  4N6P A;  2ZYK A;  3MZ9 A;  5JTY B;  4OZ9 A;  2O1L A;  3HHG A;  5I59 B;  2F7A A;  3PD9 A;  4F29 A;  4DXB A;  3ODB A;  4KPT A;  2PT1 A;  2UYF A;  3I5O A;  2HEU A;  4GRK A;  4R2F A;  3FD3 A;  4BDN A;  2V93 A;  3PMX A;  1B40 A;  3PUZ E;  4ZEF A;  3TZA A;  1LCF A;  1XS5 A;  2YJP A;  2QPQ A;  3THI A;  4POX A;  3LBS A;  3BFT A;  3RT6 B;  3SKP A;  4FED A;  4BDQ A;  1US5 A;  3MBP A;  1R9L A;  1QKA A;  4OFO A;  2VHA A;  1HSE A;  3RGY A;  3TPA A;  2XXU A;  1GV8 A;  1NKX A;  3RNN A;  1VR5 A;  1URD A;  1LAH E;  2HFB A;  1WDN A;  2W7Y A;  3L6G A;  2XXV A;  5I2K A;  2UVI A;  1OLA A;  1B5J A;  4EF1 A;  3IL1 B;  2XX7 A;  1NL5 A;  2D5W A;  2V3U A;  2XXH A;  3TTL A;  3O6G A;  5ISU A;  1MPB A;  3TUS A;  1F9B A;  5K2Y A;  4ZEK A;  3OSR A;  1BTJ A;  3LR1 A;  3BFU A;  3OOA A;  3TCG A;  4BDO A;  4JDF A;  4OFJ A;  2GFE A;  3U1O A;  4DCY A;  4EXL A;  3SEV A;  1M5D A;  1S7Y A;  4GIZ A;  3TYH A;  2XX9 A;  3Q25 A;  2V3Q A;  4HCW A;  3T22 A;  1ZKB A;  2XXQ A;  4JBZ A;  4U1Z A;  3SEY A;  4QFN A;  3M3K A;  1QJM A;  3DP8 A;  4IO2 A;  4O3A A;  4R6Y A;  3EQ1 A;  2FYI A;  1MQI A;  2O68 A;  3OMB A;  3K02 A;  3O29 A;  5KDT B;  5DEX A;  4HW8 A;  3O97 A;  3Q28 A;  3E4R A;  3PPR A;  2XXP A;  3Q29 A;  2G29 A;  2DWJ A;  4MH5 A;  3S2V A;  5IKB A;  3VLV A;  4HS7 A;  3TCF A;  5FTH A;  4DXU A;  2YPN A;  1QVS A;  4IGR A;  1LLS A;  4OEV A;  1B6H A;  2RC9 A;  3G3F A;  4OTE A;  1SW1 A;  1ELJ A;  4G68 A;  3QIM A;  2D21 A;  4NF6 A;  3CIJ A;  4ELR A;  1B9J A;  4ZZA A;  5L9O A;  2ZYO A;  3OSQ A;  3VLW A;  2CZL A;  3RT8 A;  1OQG A;  4YB5 A;  3QSL A;  2Q2A A;  3PMV A;  4R9F A;  4ESW A;  4X48 A;  4TLM B;  5DT6 A;  1ZLQ A;  4FEB A;  1TXF A;  1A8E A;  3ONM A;  3SEW A;  1GVC A;  4XKP A;  5I57 B;  3LC8 A;  5L8D A;  3UA8 A;  3CSB A;  3FXR A;  2I3W A;  5CC2 A;  4FE8 A;  4R6H A;  4MLV A;  3C31 A;  4X1D A;  1B4Z A;  3WAE A;  3N6T A;  3G3G A;  1XT8 A;  1Z7M E;  3VVE A;  3PMW A;  2I4B A;  3PUX E;  4GD5 A;  3DM0 A;  4O3B A;  4ECF A;  5M2V A;  4H65 A;  4HCY A;  3DP6 A;  1PB9 A;  3FJM A;  1MS7 A;  2HZL A;  2I0C A;  1XVY A;  4G8M A;  1J1N A;  4R72 A;  1IIW A;  2Z22 A;  4OEU A;  1PBQ A;  1B51 A;  3CFL A;  1ZMG A;  1FTM A;  3IOW A;  4IY5 A;  3EHU A;  5AE4 A;  4PET A;  5CRY A;  3K6U A;  4QSE A;  2Y7R A;  2Y7K A;  1DTZ A;  3U94 A;  3FJG A;  2O7U A;  1OIB A;  2I4C A;  4GL0 A;  3CFX A;  2AL4 A;  3K1M A;  1MQG A;  1LCT A;  5K2X A;  5H8F A;  4PFY A;  2AYS A;  1LAX A;  3A3U A;  2IA4 A;  4GQO A;  1NNF A;  3MW0 A;  4QSC A;  1MY2 A;  2VD2 A;  1S9T A;  3KJT A;  3M8U A;  3EN3 A;  4M4G A;  4GFR A;  1VFE A;  1POY 1;  3H06 B;  1B3H A;  4RK2 A;  1MY0 A;  3A09 A;  3IO6 A;  4GLI A;  1A7L A;  1URS A;  4ISU A;  5F1Q A;  4NF4 A;  2H5Y A;  3B6T A;  3T9X B;  5FHM A;  1IXC A;  4OMB A;  2QMX A;  1N0T A;  1AH5 A;  2PT2 A;  3G7W A;  2F7C A;  5CM6 A;  5LOM A;  3TAJ A;  3K01 A;  1SI0 A;  1IXH A;  3R26 A;  2HQ0 A;  1MDP 1;  3CI8 A;  4QF9 A;  3O9P A;  4EQ7 A;  1A99 A;  2ABH A;  5AA1 A;  4OHN A;  2X7Q A;  3U93 A;  3RY3 A;  4Q30 B;  3ZS6 A;  4TOZ A;  3ZSF A;  4K3F A;  3PD8 A;  1GGG A;  1FW0 A;  5I2K B;  3R6U A;  4YKI A;  1Y4C A;  1UTB A;  4YKP A;  1QUI A;  1OMP A;  4H6D A;  5FTI A;  3HO7 A;  4NE4 A;  1ATG A;  5L9M A;  2G93 A;  3DP4 A;  1N76 A;  2DVZ A;  1B1X A;  1PB8 A;  2VOZ A;  4KD5 A;  2YLN A;  1AIV A;  2THI A;  2HZK A;  3K6W A;  1POT A;  2PBW A;  4I8C A;  1A8F A;  4YIC A;  4LQ5 A;  4H8I A;  1B7Z A;  1I6A A;  2Z23 A;  4OEN A;  5AA4 A;  4R9G A;  1JET A;  2R71 A;  2UVH A;  1MXZ A;  4YMA A;  2PMS A;  4P0I A;  3Q27 A;  4PFW A;  1B58 A;  4POW A;  5TU0 A;  4ZZE A;  1VE4 A;  3KZG A;  5F7V A;  4I9D A;  3DEL B;  1NFT A;  4QRZ A;  3VXC A;  2QL3 A;  5CMK A;  3KN8 A;  3A3C A;  4H5G A;  5DEX B;  1QUL A;  3IJX B;  1RYO A;  5TP9 B;  1URG A;  3KOS A;  3UP9 A;  1FCK A;  1EU8 A;  1TT1 A;  3MPL A;  2ZMB A;  1FTK A;  4BDM A;  4F3P A;  4Q5T A;  3SEX A;  1JVY A;  3QK6 A;  3QYT A;  5B7D A;  4YMB A;  1SQY A;  3OEN A;  2F6P A;  4AB5 A;  4G68 B;  4FEC A;  3N94 A;  5H8H B;  4NF6 B;  2V84 A;  3C33 A;  4WED A;  3RUM A;  1B7H A;  4UA8 A;  3IAZ A;  1QUJ A;  1TFA A;  4XKQ A;  2H25 A;  1B32 A;  1SYI A;  4X1B A;  2I49 A;  3OO8 A;  4YB6 A;  1M5B A;  5B70 A;  1LB9 A;  4KYD A;  2NVU B;  3G3H A;  2UXA A;  1H76 A;  2P0S A;  5CMM A;  4ELO A;  2HCA A;  2OZZ A;  2RC8 A;  1GTK A;  3PPP A;  2DP8 A;  2RKM A;  4EXK A;  2VGQ A;  2OJT A;  1B3F A;  2GH9 A;  3PUW E;  3FAS A;  3FXQ A;  3N5L A;  1ZU0 A;  3H6U A;  3TQL A;  1JQF A;  1LAG E;  1Y3P A;  3IB2 A;  2R9J A;  3HPI A;  4OES A;  3RTF B;  1LFI A;  1FQB A;  2PVU A;  2X26 A;  1PBP A;  4F1Y A;  3FVG A;  4XKN A;  3IB0 A;  2RCB A;  2O6A A;  2Q89 A;  1DOT A;  4OQO A;  3C4M A;  2P2A A;  2RIN A;  3K6V A;  4ZE8 A;  1MH3 A;  3PUY E;  1MDQ A;  3P7I A;  4C1T A;  1Y20 A;  1SYH A;  3CG3 A;  5H8F B;  3SER A;  2Z8E A;  1A54 A;  3H7M A;  4LZ8 A;  4IB2 A;  1I6Q A;  1P1Q A;  2H98 A;  2P1S A;  4KYS A;  1SVX B;  4JB7 A;  4L17 A;  4THI A;  3OEL A;  4QHQ A;  4NF4 B;  3RLF E;  1YTV A;  4H67 A;  2AIX A;  2M8C A;  1IZ1 A;  2F8D A;  5JEI A;  2XXY A;  3QUJ A;  3H6V A;  4OVJ A;  3IOT A;  5TP9 A;  3UGW A;  3S9E A;  1AMF A;  2BJJ X;  4ESX A;  3G3I A;  3OD7 A;  1B4H A;  4KFQ A;  4NWD A;  4JWO A;  1ZTY A;  5KZT A;  4NMY A;  3T66 A;  1RKM A;  1R1N A;  2NOO A;  3U72 A;  1D4N A;  2QRY A;  5H8H A;  1RYX A;  3ECR A;  1UTB B;  1NH7 A;  2QS2 A;  3T9U A;  4XXU A;  1EZP A;  1SW2 A;  3MP8 A;  3CRB A;  3MWB A;  1R6Z A;  1UIU A;  3K6X A;  5ITO A;  3KN3 A;  1P1U A;  3H6W A;  2HAV A;  1Y9U A;  4JWX A;  4NF5 A;  3L6H A;  4F2Q A;  4F19 A;  3JZJ A;  2DE2 A;  3TOD A;  1USY H;  1B46 A;  2DWA A;  2QS4 A;  2DS9 A;  5AA4 B;  3H3G A;  4E0W A;  4ZE9 A;  3W9W A;  1EH3 A;  4HTG A;  3S9M C;  4ND9 A;  2I0B A;  3IR1 A;  5EYF A;  3VFJ A;  4QFO A;  3T9H B;  1MXV A;  1B5I A;  4DZ1 A;  2REG A;  3UK4 A;  1SBP A;  3PPO A;  3FIR A;  4F3B A;  5ITP A;  3TEL A;  3S9N C;  2O7I A;  3OXN A;  3O2A A;  4LON B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...