4BDWA

The structure of the fni-egf tandem domain of coagulation factor xii in complex with holmium
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
83
structure length
83
Chain Sequence
EKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQACRTNPCLHGGRCLEVEGHRLCHCPVGYTGPFCDVDTAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Fni-Egf-Like Tandem Domain of Coagulation Factor Xii Solved Using Siras.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords COAGULATION FACTOR XIIA HEAVY CHAIN
total genus 17
structure length 83
sequence length 83
ec nomenclature ec 3.4.21.38: Coagulation factor XIIa.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF00039 fn1 Fibronectin type I domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4bdwA00
1EPHA 4NGAL 4X8SL 3N8VA 1AUTL 2AYLA 1XKAL 1ATEA 2P28B 1KLOA 1WHFA 2RHPA 3OLUA 2FLGA 3FFGL 2MGPA 4YT7L 2WG4B 1YUFA 1TLEA 1JBUL 1LPZA 2MHPA 1NQLB 1CCVA 4AQTA 1URKA 4BTUA 1CVWL 2GD4A 1QFKL 2FLRL 1L5GB 5L2ZL 3ENSA 3N8ZA 4RUTA 1XFEA 3IJEB 3NJPC 2RNLA 1IOEL 2BQ7A 2WPHE 4BDXA 3HS7A 4O1ZA 3LTFB 1EPIA 4TGFA 1Z6EL 3QCWA 2WYGB 3KQDL 1EPJA 1P0SL 1KLIL 1IQKL 3DEMA 2YGOA 2W2NE 1NFUB 3EGFA 3HO4A 1EAIC 1W7XL 3HS5A 2FLBL 2K2SB 2Y7XB 1HREA 5KN5C 3KRKA 1FFMA 3TBDA 3SW2A 1FE2A 3SOBB 1PFXL 4D0EA 4E1GA 1CEJA 5I46L 1IQHL 1ATAA 4X8UL 5EGMB 3V64C 1XDTR 2XC5L 1G1TA 2KV4A 3SOVA 1ATDA 1EQHA 1EMOA 2BOXA 1G2LB 1B9WA 1KSNB 2W2OE 4BTTA 1RFNB 3HO5A 2J94B 4LORA 3GCWE 4COXA 3PGHA 1PGEA 4Y7AB 4Z6AL 5CISA 3LN1A 2Y5FL 3CENL 3MQEA 4XBMA 1HZ8A 3HPTA 1IQML 1GK5A 1Z6CA 4RS0A 3MDLA 1YO8A 2H9EL 1PXXA 3N8YA 2D1JB 2BMGA 3N8YB 1U8CB 4ZXXL 1DX5I 4Y7BB 3LAQA 3K9XA 2WFTA 4RRXA 4Z0KB 3KK6A 1IJQA 3RR3A 2M74A 3NTGA 1NT0A 2PUQL 2BOKL 4MMZB 5K0HB 5JVYA 4RRZA 1HRFA 4CUEA 3F6UL 4PH9A 3M36L 1FAKL 1SZBA 1IQLL 1FSBA 1IQGL 2Y7ZB 4NG9L 2WPKE 2XBWL 4CUDA 1G1QA 1EQGA 1MOXC 5IKTA 1HT5A 5CKMA 3HO3A 3BPSE 1IQJL 2ADXA 2P16L 3OLTA 1P9JA 5IKQA 3BT1A 2KB9A 4M10A 2P26A 2W2QE 4X8VL 2VVCK 2Y80B 5L30L 2MGRA 3QH0A 1IVOC 1I0UA 4ZAEB 2WFXB 2WG3C 1WHEA 2FD6A 1IGZA 1TPGA 1G2MB 2TGFA 1PRHA 2WPME 4XL1A 3HS6A 6COXA 1IQIL 5JVZA 4BDWA 1O5DL 2G00L 4A7IA 2VVUL 1EMNA 1G1RA 3M37L 2Y82B 3QMOA 2XBYL 3U73A 5CKNA 5KIRA 2W3IB 3CS7L 1C5MF 1HCGB 1HAEA 3NT1A 1DQBA 1FJSL 2B7DL 4X8TL 2P93L 1APQA 1MQ6L 5JBBE 1DDXA 1F0SB 2OYEP 1CQEA 3KQCL 1F7MA 2VWLL 3LN0A 2P3UA 5JB9E 2NPRA 2FZZL 1NFYB 3ZYIB 5COXA 4CUFA 2EI7B 3ELAL 1JV2B 1EGFA 1HAFA 4YT6L 4OTYA 3V65B 3POYA 5IKRA 2VWMK 4Y6DB 3ASIA 4D0FA 2J38B 2EI8B 1NFXB 1MQ5L 2J34B 3LTGD 2PR3B 4ISIL 3TZIA 1K37A 2J95B 4BXWA 2UWOB 2EI6B 5IKVA 1PTHA 2UWLB 3CA7A 4CSYA 5JW1A 5F1AA 2KL7A 1DVAL 3FBYA 2J4IB 1ATBA 2P94L 2Y81B 1NZIA 3GCXE 3KL6B 4ZHAB 1NPEB 3KCGL 3Q3KB 2Q1JB 3F1SB 5JB8E 3TK6B 1COUA 1ADXA 3LC3B 4D90A 4Y79B 4C16A 2XC4L 5FDQA 1HT8A 3R05A 2BQ6A 1N1IA 1FF7A 1M1XB 2JKHL 4JYUL 2J2UB 3N8XA 1KLJL 4RRWA 1EZQB 1DIYA 2YGPA 4O02B 3H5CB 1HJ7A 4JYVL 3TK5B 4M11A 1HX2A 1YUGA 3ZYGA 4BTIA 2XC0L 2BOHA 2Y5HL 1UZPA 1W8BL 2P95L 1N7DA 4ZH8B 2W3KB 1TOZA 3ZYJB 3N8WA 1LMJA 2WPIE 1CVUA 1APOA 1IOXA 1G1SA 2BZ6L 1IQNL 4XLWA 2VJ3A 2CJIB 1JL9A 2VVVL 3CFWA 1UZQA 4JZEL 1BF9A 3LC5B 5L2YL 1NFWB 3N8WB 3SOQA 2P3FL 1X7AL 4OTJA 2OYUP 2WYJB 2P3TA 1CCFA 4RRYA 2RA0L 4MMYB 1UZKA 1LQDA 2XBVL 1ZAQA 2W2PE 4MMXB 1XKBA 2W86A 1OB1C 1FAXL 4G1MB 4LMFA 2I9AA 3LIWB 4YZUB 3TH3L 2XBXL 2W26B 1EBVA 1CX2A 4Y71B 2BOUA 2BQWA 1YGCL 5JBAE 1A3PA 1F0RB 3FCSB 1YUKB 1IGXA 3U7UG 2W2ME 3BT2A 1LPKA 1F7EA 1IQEL 1V3XB 1UZJA 2VH0B 3C9AC 4Z0LA 2I9BA 1K36A 1IP0A 3Q7DA 1Q4GA 1IQFL 5E8DA 2WPLE 2K2TA 2Y5GL 2VH6B 2F9BL 5CKQA 4JZFL 2BO2A 2DDUA 2WPJE 1WU1B 2VWOL 2VWNL 3P5BL 5JBCE 2PHBB 4NA9L 1LPGA 4FM5A 4BXSA 1U67A 1KIGL 4JZDL 4ISHL 2UWPB 2P3FN 4ZXYL 3TGFA 4Y76B 5F19A 1EPGA 1J9CL 3KQEL 2Y38A 3NTBA 3KQBL 3GISX 3IITB 1L3YA
chains in the Genus database with same CATH superfamily
1EPHA 4NGAL 4X8SL 3N8VA 1AUTL 2AYLA 1XKAL 1ATEA 2P28B 1KLOA 1WHFA 2RHPA 3OLUA 2FLGA 3FFGL 2MGPA 4YT7L 2WG4B 1YUFA 1TLEA 1JBUL 1LPZA 2MHPA 1NQLB 1CCVA 4AQTA 1URKA 4BTUA 1CVWL 2GD4A 1QFKL 2FLRL 1L5GB 5L2ZL 3ENSA 3N8ZA 4RUTA 1XFEA 2BT7A 3IJEB 3NJPC 2RNLA 1IOEL 2BQ7A 2WPHE 4BDXA 3HS7A 4O1ZA 3LTFB 1EPIA 4TGFA 1Z6EL 3QCWA 2WYGB 3KQDL 1EPJA 1P0SL 1KLIL 1IQKL 3DEMA 2YGOA 2W2NE 1NFUB 3EGFA 3HO4A 1EAIC 1W7XL 3HS5A 2FLBL 2K2SB 2Y7XB 1HREA 5KN5C 3KRKA 1FFMA 3S6XA 3TBDA 3SW2A 1FE2A 3SOBB 1PFXL 4D0EA 4E1GA 1CEJA 5I46L 1IQHL 1ATAA 4X8UL 5EGMB 3V64C 1XDTR 2XC5L 1G1TA 2KV4A 3SOVA 1ATDA 1EQHA 1EMOA 2BOXA 1G2LB 1B9WA 1KSNB 2W2OE 4BTTA 1RFNB 3HO5A 2J94B 4LORA 3GCWE 4COXA 3PGHA 1PGEA 4Y7AB 4Z6AL 5CISA 3LN1A 2Y5FL 3CENL 3MQEA 4GU3A 4XBMA 1HZ8A 3HPTA 1IQML 1GK5A 1Z6CA 4RS0A 3MDLA 1YO8A 2H9EL 1PXXA 3N8YA 2D1JB 2BMGA 3N8YB 1U8CB 4ZXXL 1DX5I 4Y7BB 3LAQA 3K9XA 2WFTA 4RRXA 4Z0KB 3KK6A 1IJQA 3RR3A 2M74A 3NTGA 1NT0A 2PUQL 2BOKL 4MMZB 5K0HB 5JVYA 4RRZA 1HRFA 4CUEA 3F6UL 4PH9A 3M36L 1FAKL 1LK9A 1SZBA 1IQLL 1FSBA 1IQGL 2Y7ZB 4NG9L 2WPKE 2XBWL 4CUDA 1G1QA 1EQGA 1MOXC 5IKTA 1HT5A 5CKMA 3HO3A 3BPSE 1IQJL 2ADXA 2P16L 3OLTA 1P9JA 5IKQA 3BT1A 2KB9A 4M10A 2P26A 2W2QE 4X8VL 2VVCK 2Y80B 5L30L 2MGRA 3QH0A 1IVOC 1I0UA 4ZAEB 2WFXB 2WG3C 2VRSA 1WHEA 2FD6A 1IGZA 1TPGA 1G2MB 2TGFA 1PRHA 2WPME 4XL1A 3HS6A 6COXA 1IQIL 5JVZA 4BDWA 2H9EC 1KKEA 1O5DL 2G00L 4A7IA 2VVUL 1EMNA 1G1RA 3M37L 2Y82B 3QMOA 2XBYL 3U73A 5CKNA 5KIRA 2W3IB 3CS7L 1C5MF 1HCGB 1HAEA 3NT1A 1DQBA 1FJSL 2B7DL 4X8TL 2P93L 1APQA 1MQ6L 5JBBE 1DDXA 1F0SB 2OYEP 2HOXA 1CQEA 3KQCL 1F7MA 1V1HA 2VWLL 3LN0A 2P3UA 5JB9E 2NPRA 2FZZL 1NFYB 3ZYIB 5COXA 4CUFA 2EI7B 3ELAL 1JV2B 1EGFA 1HAFA 4YT6L 4OTYA 3V65B 1V1IA 3POYA 5IKRA 2VWMK 4Y6DB 3ASIA 4D0FA 2J38B 2EI8B 1NFXB 1MQ5L 2J34B 2WZPP 3LTGD 2PR3B 4ISIL 3TZIA 1K37A 2J95B 4BXWA 2UWOB 1LMMA 2EI6B 5IKVA 1PTHA 2UWLB 3CA7A 4CSYA 5JW1A 5F1AA 2KL7A 1DVAL 3FBYA 2J4IB 1ATBA 2P94L 2Y81B 1NZIA 3GCXE 3KL6B 4ZHAB 1NPEB 3KCGL 3Q3KB 2Q1JB 4A94C 3F1SB 5JB8E 3TK6B 1COUA 1ADXA 3LC3B 4D90A 4Y79B 4C16A 2XC4L 5FDQA 1HT8A 3R05A 2BQ6A 1N1IA 1FF7A 1M1XB 2JKHL 4JYUL 2J2UB 3N8XA 1KLJL 4RRWA 1EZQB 1DIYA 1QIUA 2YGPA 3H5CB 4O02B 1HJ7A 4JYVL 3TK5B 4M11A 1HX2A 1YUGA 3ZYGA 4BTIA 2XC0L 2BOHA 2Y5HL 1UZPA 1W8BL 2P95L 1N7DA 2KNIA 4ZH8B 2W3KB 1TOZA 3ZYJB 3N8WA 1LMJA 2WPIE 1CVUA 2BSFA 1APOA 1IOXA 1G1SA 2BZ6L 1IQNL 4XLWA 2VJ3A 2CJIB 1JL9A 2VVVL 3CFWA 1UZQA 4JZEL 1BF9A 3LC5B 5L2YL 2YGQA 1NFWB 3N8WB 3SOQA 2P3FL 1X7AL 4OTJA 2OYUP 2WYJB 2P3TA 1CCFA 4RRYA 2RA0L 4MMYB 1UZKA 1LQDA 2XBVL 1ZAQA 2W2PE 4MMXB 2HORA 1XKBA 2W86A 1OB1C 1FAXL 4G1MB 4LMFA 2I9AA 3LIWB 4YZUB 3TH3L 2XBXL 2W26B 1EBVA 1CX2A 4Y71B 2BOUA 2BQWA 1YGCL 5JBAE 1A3PA 1F0RB 3FCSB 1YUKB 1IGXA 3U7UG 2W2ME 3BT2A 1LPKA 1F7EA 1IQEL 4GU4A 1V3XB 1UZJA 2VH0B 3C9AC 4Z0LA 2I9BA 1K36A 1IP0A 3Q7DA 1Q4GA 1IQFL 5E8DA 2WPLE 2K2TA 2Y5GL 2VH6B 2F9BL 5CKQA 4JZFL 2BO2A 2DDUA 2WPJE 1WU1B 2VWOL 2VWNL 3P5BL 5JBCE 2PHBB 4NA9L 1LPGA 4FM5A 4BXSA 1U67A 1KIGL 4JZDL 4ISHL 2UWPB 2P3FN 4ZXYL 3TGFA 4Y76B 5F19A 1EPGA 1J9CL 3KQEL 2JJLA 2BT8A 2Y38A 3NTBA 3KQBL 3GISX 3IITB 1L3YA
chains in the Genus database with same CATH topology
1EPHA 4NGAL 4X8SL 3N8VA 1AUTL 2AYLA 1XKAL 1ATEA 2P28B 1KLOA 1WHFA 2RHPA 3OLUA 2FLGA 3FFGL 2MGPA 4YT7L 2WG4B 1YUFA 1TLEA 1JBUL 1LPZA 2MHPA 1NQLB 1CCVA 4AQTA 1URKA 4BTUA 1CVWL 2GD4A 1QFKL 2FLRL 1L5GB 5L2ZL 3ENSA 3N8ZA 4RUTA 1XFEA 3IJEB 3NJPC 2RNLA 1IOEL 2BQ7A 2WPHE 4BDXA 3HS7A 4O1ZA 3LTFB 1EPIA 4TGFA 1Z6EL 3QCWA 2WYGB 3KQDL 1EPJA 1P0SL 1KLIL 1IQKL 3DEMA 2YGOA 2W2NE 1NFUB 3EGFA 3HO4A 1EAIC 1W7XL 3HS5A 2FLBL 2K2SB 2Y7XB 1HREA 5KN5C 3KRKA 1FFMA 3S6XA 3TBDA 3SW2A 1FE2A 3SOBB 1PFXL 4D0EA 4E1GA 1CEJA 5I46L 1IQHL 1ATAA 4X8UL 5EGMB 3V64C 1XDTR 2XC5L 1G1TA 2KV4A 3SOVA 1ATDA 1EQHA 1EMOA 2BOXA 1G2LB 1B9WA 1KSNB 2W2OE 4BTTA 1RFNB 3HO5A 2J94B 4LORA 3GCWE 4COXA 3PGHA 1PGEA 4Y7AB 4Z6AL 5CISA 3LN1A 2Y5FL 3CENL 3MQEA 4XBMA 1HZ8A 3HPTA 1IQML 1GK5A 1Z6CA 4RS0A 3MDLA 1YO8A 2H9EL 1PXXA 3N8YA 2D1JB 2BMGA 3N8YB 1U8CB 4ZXXL 1DX5I 4Y7BB 3LAQA 3K9XA 2WFTA 4RRXA 4Z0KB 3KK6A 1IJQA 3RR3A 2M74A 3NTGA 1NT0A 2PUQL 2BOKL 4MMZB 5K0HB 5JVYA 4RRZA 1HRFA 4CUEA 3F6UL 4PH9A 3M36L 1FAKL 1SZBA 1IQLL 1FSBA 1IQGL 2Y7ZB 4NG9L 2WPKE 2XBWL 4CUDA 1G1QA 1EQGA 1MOXC 5IKTA 1HT5A 5CKMA 3HO3A 3BPSE 1IQJL 2ADXA 2P16L 3OLTA 1P9JA 5IKQA 3BT1A 2KB9A 4M10A 2P26A 2W2QE 4X8VL 2VVCK 2Y80B 5L30L 2MGRA 3QH0A 1IVOC 1I0UA 4ZAEB 2WFXB 2WG3C 1WHEA 2FD6A 1IGZA 1TPGA 1G2MB 2TGFA 1PRHA 2WPME 4XL1A 3HS6A 6COXA 1IQIL 5JVZA 4BDWA 2H9EC 1O5DL 2G00L 4A7IA 2VVUL 1EMNA 1G1RA 3M37L 2Y82B 3QMOA 2XBYL 3U73A 5CKNA 5KIRA 2W3IB 3CS7L 1C5MF 1HCGB 1HAEA 3NT1A 1DQBA 1FJSL 2B7DL 4X8TL 2P93L 1APQA 1MQ6L 5JBBE 1DDXA 1F0SB 2OYEP 1CQEA 3KQCL 1F7MA 2VWLL 3LN0A 2P3UA 5JB9E 2NPRA 2FZZL 1NFYB 3ZYIB 5COXA 4CUFA 2EI7B 3ELAL 1JV2B 1EGFA 1HAFA 4YT6L 4OTYA 3V65B 3POYA 5IKRA 2VWMK 4Y6DB 3ASIA 4D0FA 2J38B 2EI8B 1NFXB 1MQ5L 2J34B 2WZPP 3LTGD 2PR3B 4ISIL 3TZIA 1K37A 2J95B 4BXWA 2UWOB 1LMMA 2EI6B 5IKVA 1PTHA 2UWLB 3CA7A 4CSYA 5JW1A 5F1AA 2KL7A 1DVAL 3FBYA 2J4IB 1ATBA 2P94L 2Y81B 1NZIA 3GCXE 3KL6B 4ZHAB 1NPEB 3KCGL 3Q3KB 2Q1JB 4A94C 3F1SB 5JB8E 3TK6B 1COUA 1ADXA 3LC3B 4D90A 4Y79B 4C16A 2XC4L 5FDQA 1HT8A 3R05A 2BQ6A 1N1IA 1FF7A 1M1XB 2JKHL 4JYUL 2J2UB 3N8XA 1KLJL 4RRWA 1EZQB 1DIYA 2YGPA 4O02B 3H5CB 1HJ7A 4JYVL 3TK5B 4M11A 1HX2A 1YUGA 3ZYGA 4BTIA 2XC0L 2BOHA 2Y5HL 1UZPA 1W8BL 2P95L 1N7DA 2KNIA 4ZH8B 2W3KB 1TOZA 3ZYJB 3N8WA 1LMJA 2WPIE 1CVUA 1APOA 1IOXA 1G1SA 2BZ6L 1IQNL 4XLWA 2VJ3A 2CJIB 1JL9A 2VVVL 3CFWA 1UZQA 4JZEL 1BF9A 3LC5B 5L2YL 2YGQA 1NFWB 3N8WB 3SOQA 2P3FL 1X7AL 4OTJA 2OYUP 2WYJB 2P3TA 1CCFA 4RRYA 2RA0L 4MMYB 1UZKA 1LQDA 2XBVL 1ZAQA 2W2PE 4MMXB 1XKBA 2W86A 1OB1C 1FAXL 4G1MB 4LMFA 2I9AA 3LIWB 4YZUB 3TH3L 2XBXL 2W26B 1EBVA 1CX2A 4Y71B 2BOUA 2BQWA 1YGCL 5JBAE 1A3PA 1F0RB 3FCSB 1YUKB 1IGXA 3U7UG 2W2ME 3BT2A 1LPKA 1F7EA 1IQEL 1V3XB 1UZJA 2VH0B 3C9AC 4Z0LA 2I9BA 1K36A 1IP0A 3Q7DA 1Q4GA 1IQFL 5E8DA 2WPLE 2K2TA 2Y5GL 2VH6B 2F9BL 5CKQA 4JZFL 2BO2A 2DDUA 2WPJE 1WU1B 2VWOL 2VWNL 3P5BL 5JBCE 2PHBB 4NA9L 1LPGA 4FM5A 4BXSA 1U67A 1KIGL 4JZDL 4ISHL 2UWPB 2P3FN 4ZXYL 3TGFA 4Y76B 5F19A 1EPGA 1J9CL 3KQEL 2Y38A 3NTBA 3KQBL 3GISX 3IITB 1L3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EPH A;  4NGA L;  4X8S L;  3N8V A;  1AUT L;  2AYL A;  1XKA L;  1ATE A;  2P28 B;  1KLO A;  1WHF A;  2RHP A;  3OLU A;  2FLG A;  3FFG L;  2MGP A;  4YT7 L;  2WG4 B;  1YUF A;  1TLE A;  1JBU L;  1LPZ A;  2MHP A;  1NQL B;  1CCV A;  4AQT A;  1URK A;  4BTU A;  1CVW L;  2GD4 A;  1QFK L;  2FLR L;  1L5G B;  5L2Z L;  3ENS A;  3N8Z A;  4RUT A;  1XFE A;  3IJE B;  3NJP C;  2RNL A;  1IOE L;  2BQ7 A;  2WPH E;  4BDX A;  3HS7 A;  4O1Z A;  3LTF B;  1EPI A;  4TGF A;  1Z6E L;  3QCW A;  2WYG B;  3KQD L;  1EPJ A;  1P0S L;  1KLI L;  1IQK L;  3DEM A;  2YGO A;  2W2N E;  1NFU B;  3EGF A;  3HO4 A;  1EAI C;  1W7X L;  3HS5 A;  2FLB L;  2K2S B;  2Y7X B;  1HRE A;  5KN5 C;  3KRK A;  1FFM A;  3TBD A;  3SW2 A;  1FE2 A;  3SOB B;  1PFX L;  4D0E A;  4E1G A;  1CEJ A;  5I46 L;  1IQH L;  1ATA A;  4X8U L;  5EGM B;  3V64 C;  1XDT R;  2XC5 L;  1G1T A;  2KV4 A;  3SOV A;  1ATD A;  1EQH A;  1EMO A;  2BOX A;  1G2L B;  1B9W A;  1KSN B;  2W2O E;  4BTT A;  1RFN B;  3HO5 A;  2J94 B;  4LOR A;  3GCW E;  4COX A;  3PGH A;  1PGE A;  4Y7A B;  4Z6A L;  5CIS A;  3LN1 A;  2Y5F L;  3CEN L;  3MQE A;  4XBM A;  1HZ8 A;  3HPT A;  1IQM L;  1GK5 A;  1Z6C A;  4RS0 A;  3MDL A;  1YO8 A;  2H9E L;  1PXX A;  3N8Y A;  2D1J B;  2BMG A;  3N8Y B;  1U8C B;  4ZXX L;  1DX5 I;  4Y7B B;  3LAQ A;  3K9X A;  2WFT A;  4RRX A;  4Z0K B;  3KK6 A;  1IJQ A;  3RR3 A;  2M74 A;  3NTG A;  1NT0 A;  2PUQ L;  2BOK L;  4MMZ B;  5K0H B;  5JVY A;  4RRZ A;  1HRF A;  4CUE A;  3F6U L;  4PH9 A;  3M36 L;  1FAK L;  1SZB A;  1IQL L;  1FSB A;  1IQG L;  2Y7Z B;  4NG9 L;  2WPK E;  2XBW L;  4CUD A;  1G1Q A;  1EQG A;  1MOX C;  5IKT A;  1HT5 A;  5CKM A;  3HO3 A;  3BPS E;  1IQJ L;  2ADX A;  2P16 L;  3OLT A;  1P9J A;  5IKQ A;  3BT1 A;  2KB9 A;  4M10 A;  2P26 A;  2W2Q E;  4X8V L;  2VVC K;  2Y80 B;  5L30 L;  2MGR A;  3QH0 A;  1IVO C;  1I0U A;  4ZAE B;  2WFX B;  2WG3 C;  1WHE A;  2FD6 A;  1IGZ A;  1TPG A;  1G2M B;  2TGF A;  1PRH A;  2WPM E;  4XL1 A;  3HS6 A;  6COX A;  1IQI L;  5JVZ A;  4BDW A;  1O5D L;  2G00 L;  4A7I A;  2VVU L;  1EMN A;  1G1R A;  3M37 L;  2Y82 B;  3QMO A;  2XBY L;  3U73 A;  5CKN A;  5KIR A;  2W3I B;  3CS7 L;  1C5M F;  1HCG B;  1HAE A;  3NT1 A;  1DQB A;  1FJS L;  2B7D L;  4X8T L;  2P93 L;  1APQ A;  1MQ6 L;  5JBB E;  1DDX A;  1F0S B;  2OYE P;  1CQE A;  3KQC L;  1F7M A;  2VWL L;  3LN0 A;  2P3U A;  5JB9 E;  2NPR A;  2FZZ L;  1NFY B;  3ZYI B;  5COX A;  4CUF A;  2EI7 B;  3ELA L;  1JV2 B;  1EGF A;  1HAF A;  4YT6 L;  4OTY A;  3V65 B;  3POY A;  5IKR A;  2VWM K;  4Y6D B;  3ASI A;  4D0F A;  2J38 B;  2EI8 B;  1NFX B;  1MQ5 L;  2J34 B;  3LTG D;  2PR3 B;  4ISI L;  3TZI A;  1K37 A;  2J95 B;  4BXW A;  2UWO B;  2EI6 B;  5IKV A;  1PTH A;  2UWL B;  3CA7 A;  4CSY A;  5JW1 A;  5F1A A;  2KL7 A;  1DVA L;  3FBY A;  2J4I B;  1ATB A;  2P94 L;  2Y81 B;  1NZI A;  3GCX E;  3KL6 B;  4ZHA B;  1NPE B;  3KCG L;  3Q3K B;  2Q1J B;  3F1S B;  5JB8 E;  3TK6 B;  1COU A;  1ADX A;  3LC3 B;  4D90 A;  4Y79 B;  4C16 A;  2XC4 L;  5FDQ A;  1HT8 A;  3R05 A;  2BQ6 A;  1N1I A;  1FF7 A;  1M1X B;  2JKH L;  4JYU L;  2J2U B;  3N8X A;  1KLJ L;  4RRW A;  1EZQ B;  1DIY A;  2YGP A;  4O02 B;  3H5C B;  1HJ7 A;  4JYV L;  3TK5 B;  4M11 A;  1HX2 A;  1YUG A;  3ZYG A;  4BTI A;  2XC0 L;  2BOH A;  2Y5H L;  1UZP A;  1W8B L;  2P95 L;  1N7D A;  4ZH8 B;  2W3K B;  1TOZ A;  3ZYJ B;  3N8W A;  1LMJ A;  2WPI E;  1CVU A;  1APO A;  1IOX A;  1G1S A;  2BZ6 L;  1IQN L;  4XLW A;  2VJ3 A;  2CJI B;  1JL9 A;  2VVV L;  3CFW A;  1UZQ A;  4JZE L;  1BF9 A;  3LC5 B;  5L2Y L;  1NFW B;  3N8W B;  3SOQ A;  2P3F L;  1X7A L;  4OTJ A;  2OYU P;  2WYJ B;  2P3T A;  1CCF A;  4RRY A;  2RA0 L;  4MMY B;  1UZK A;  1LQD A;  2XBV L;  1ZAQ A;  2W2P E;  4MMX B;  1XKB A;  2W86 A;  1OB1 C;  1FAX L;  4G1M B;  4LMF A;  2I9A A;  3LIW B;  4YZU B;  3TH3 L;  2XBX L;  2W26 B;  1EBV A;  1CX2 A;  4Y71 B;  2BOU A;  2BQW A;  1YGC L;  5JBA E;  1A3P A;  1F0R B;  3FCS B;  1YUK B;  1IGX A;  3U7U G;  2W2M E;  3BT2 A;  1LPK A;  1F7E A;  1IQE L;  1V3X B;  1UZJ A;  2VH0 B;  3C9A C;  4Z0L A;  2I9B A;  1K36 A;  1IP0 A;  3Q7D A;  1Q4G A;  1IQF L;  5E8D A;  2WPL E;  2K2T A;  2Y5G L;  2VH6 B;  2F9B L;  5CKQ A;  4JZF L;  2BO2 A;  2DDU A;  2WPJ E;  1WU1 B;  2VWO L;  2VWN L;  3P5B L;  5JBC E;  2PHB B;  4NA9 L;  1LPG A;  4FM5 A;  4BXS A;  1U67 A;  1KIG L;  4JZD L;  4ISH L;  2UWP B;  2P3F N;  4ZXY L;  3TGF A;  4Y76 B;  5F19 A;  1EPG A;  1J9C L;  3KQE L;  2Y38 A;  3NTB A;  3KQB L;  3GIS X;  3IIT B;  1L3Y A; 
#chains in the Genus database with same CATH topology
 1EPH A;  4NGA L;  4X8S L;  3N8V A;  1AUT L;  2AYL A;  1XKA L;  1ATE A;  2P28 B;  1KLO A;  1WHF A;  2RHP A;  3OLU A;  2FLG A;  3FFG L;  2MGP A;  4YT7 L;  2WG4 B;  1YUF A;  1TLE A;  1JBU L;  1LPZ A;  2MHP A;  1NQL B;  1CCV A;  4AQT A;  1URK A;  4BTU A;  1CVW L;  2GD4 A;  1QFK L;  2FLR L;  1L5G B;  5L2Z L;  3ENS A;  3N8Z A;  4RUT A;  1XFE A;  2BT7 A;  3IJE B;  3NJP C;  2RNL A;  1IOE L;  2BQ7 A;  2WPH E;  4BDX A;  3HS7 A;  4O1Z A;  3LTF B;  1EPI A;  4TGF A;  1Z6E L;  3QCW A;  2WYG B;  3KQD L;  1EPJ A;  1P0S L;  1KLI L;  1IQK L;  3DEM A;  2YGO A;  2W2N E;  1NFU B;  3EGF A;  3HO4 A;  1EAI C;  1W7X L;  3HS5 A;  2FLB L;  2K2S B;  2Y7X B;  1HRE A;  5KN5 C;  3KRK A;  1FFM A;  3S6X A;  3TBD A;  3SW2 A;  1FE2 A;  3SOB B;  1PFX L;  4D0E A;  4E1G A;  1CEJ A;  5I46 L;  1IQH L;  1ATA A;  4X8U L;  5EGM B;  3V64 C;  1XDT R;  2XC5 L;  1G1T A;  2KV4 A;  3SOV A;  1ATD A;  1EQH A;  1EMO A;  2BOX A;  1G2L B;  1B9W A;  1KSN B;  2W2O E;  4BTT A;  1RFN B;  3HO5 A;  2J94 B;  4LOR A;  3GCW E;  4COX A;  3PGH A;  1PGE A;  4Y7A B;  4Z6A L;  5CIS A;  3LN1 A;  2Y5F L;  3CEN L;  3MQE A;  4GU3 A;  4XBM A;  1HZ8 A;  3HPT A;  1IQM L;  1GK5 A;  1Z6C A;  4RS0 A;  3MDL A;  1YO8 A;  2H9E L;  1PXX A;  3N8Y A;  2D1J B;  2BMG A;  3N8Y B;  1U8C B;  4ZXX L;  1DX5 I;  4Y7B B;  3LAQ A;  3K9X A;  2WFT A;  4RRX A;  4Z0K B;  3KK6 A;  1IJQ A;  3RR3 A;  2M74 A;  3NTG A;  1NT0 A;  2PUQ L;  2BOK L;  4MMZ B;  5K0H B;  5JVY A;  4RRZ A;  1HRF A;  4CUE A;  3F6U L;  4PH9 A;  3M36 L;  1FAK L;  1LK9 A;  1SZB A;  1IQL L;  1FSB A;  1IQG L;  2Y7Z B;  4NG9 L;  2WPK E;  2XBW L;  4CUD A;  1G1Q A;  1EQG A;  1MOX C;  5IKT A;  1HT5 A;  5CKM A;  3HO3 A;  3BPS E;  1IQJ L;  2ADX A;  2P16 L;  3OLT A;  1P9J A;  5IKQ A;  3BT1 A;  2KB9 A;  4M10 A;  2P26 A;  2W2Q E;  4X8V L;  2VVC K;  2Y80 B;  5L30 L;  2MGR A;  3QH0 A;  1IVO C;  1I0U A;  4ZAE B;  2WFX B;  2WG3 C;  2VRS A;  1WHE A;  2FD6 A;  1IGZ A;  1TPG A;  1G2M B;  2TGF A;  1PRH A;  2WPM E;  4XL1 A;  3HS6 A;  6COX A;  1IQI L;  5JVZ A;  4BDW A;  2H9E C;  1KKE A;  1O5D L;  2G00 L;  4A7I A;  2VVU L;  1EMN A;  1G1R A;  3M37 L;  2Y82 B;  3QMO A;  2XBY L;  3U73 A;  5CKN A;  5KIR A;  2W3I B;  3CS7 L;  1C5M F;  1HCG B;  1HAE A;  3NT1 A;  1DQB A;  1FJS L;  2B7D L;  4X8T L;  2P93 L;  1APQ A;  1MQ6 L;  5JBB E;  1DDX A;  1F0S B;  2OYE P;  2HOX A;  1CQE A;  3KQC L;  1F7M A;  1V1H A;  2VWL L;  3LN0 A;  2P3U A;  5JB9 E;  2NPR A;  2FZZ L;  1NFY B;  3ZYI B;  5COX A;  4CUF A;  2EI7 B;  3ELA L;  1JV2 B;  1EGF A;  1HAF A;  4YT6 L;  4OTY A;  3V65 B;  1V1I A;  3POY A;  5IKR A;  2VWM K;  4Y6D B;  3ASI A;  4D0F A;  2J38 B;  2EI8 B;  1NFX B;  1MQ5 L;  2J34 B;  2WZP P;  3LTG D;  2PR3 B;  4ISI L;  3TZI A;  1K37 A;  2J95 B;  4BXW A;  2UWO B;  1LMM A;  2EI6 B;  5IKV A;  1PTH A;  2UWL B;  3CA7 A;  4CSY A;  5JW1 A;  5F1A A;  2KL7 A;  1DVA L;  3FBY A;  2J4I B;  1ATB A;  2P94 L;  2Y81 B;  1NZI A;  3GCX E;  3KL6 B;  4ZHA B;  1NPE B;  3KCG L;  3Q3K B;  2Q1J B;  4A94 C;  3F1S B;  5JB8 E;  3TK6 B;  1COU A;  1ADX A;  3LC3 B;  4D90 A;  4Y79 B;  4C16 A;  2XC4 L;  5FDQ A;  1HT8 A;  3R05 A;  2BQ6 A;  1N1I A;  1FF7 A;  1M1X B;  2JKH L;  4JYU L;  2J2U B;  3N8X A;  1KLJ L;  4RRW A;  1EZQ B;  1DIY A;  1QIU A;  2YGP A;  3H5C B;  4O02 B;  1HJ7 A;  4JYV L;  3TK5 B;  4M11 A;  1HX2 A;  1YUG A;  3ZYG A;  4BTI A;  2XC0 L;  2BOH A;  2Y5H L;  1UZP A;  1W8B L;  2P95 L;  1N7D A;  2KNI A;  4ZH8 B;  2W3K B;  1TOZ A;  3ZYJ B;  3N8W A;  1LMJ A;  2WPI E;  1CVU A;  2BSF A;  1APO A;  1IOX A;  1G1S A;  2BZ6 L;  1IQN L;  4XLW A;  2VJ3 A;  2CJI B;  1JL9 A;  2VVV L;  3CFW A;  1UZQ A;  4JZE L;  1BF9 A;  3LC5 B;  5L2Y L;  2YGQ A;  1NFW B;  3N8W B;  3SOQ A;  2P3F L;  1X7A L;  4OTJ A;  2OYU P;  2WYJ B;  2P3T A;  1CCF A;  4RRY A;  2RA0 L;  4MMY B;  1UZK A;  1LQD A;  2XBV L;  1ZAQ A;  2W2P E;  4MMX B;  2HOR A;  1XKB A;  2W86 A;  1OB1 C;  1FAX L;  4G1M B;  4LMF A;  2I9A A;  3LIW B;  4YZU B;  3TH3 L;  2XBX L;  2W26 B;  1EBV A;  1CX2 A;  4Y71 B;  2BOU A;  2BQW A;  1YGC L;  5JBA E;  1A3P A;  1F0R B;  3FCS B;  1YUK B;  1IGX A;  3U7U G;  2W2M E;  3BT2 A;  1LPK A;  1F7E A;  1IQE L;  4GU4 A;  1V3X B;  1UZJ A;  2VH0 B;  3C9A C;  4Z0L A;  2I9B A;  1K36 A;  1IP0 A;  3Q7D A;  1Q4G A;  1IQF L;  5E8D A;  2WPL E;  2K2T A;  2Y5G L;  2VH6 B;  2F9B L;  5CKQ A;  4JZF L;  2BO2 A;  2DDU A;  2WPJ E;  1WU1 B;  2VWO L;  2VWN L;  3P5B L;  5JBC E;  2PHB B;  4NA9 L;  1LPG A;  4FM5 A;  4BXS A;  1U67 A;  1KIG L;  4JZD L;  4ISH L;  2UWP B;  2P3F N;  4ZXY L;  3TGF A;  4Y76 B;  5F19 A;  1EPG A;  1J9C L;  3KQE L;  2JJL A;  2BT8 A;  2Y38 A;  3NTB A;  3KQB L;  3GIS X;  3IIT B;  1L3Y A; 
#chains in the Genus database with same CATH homology
 1EPH A;  4NGA L;  4X8S L;  3N8V A;  1AUT L;  2AYL A;  1XKA L;  1ATE A;  2P28 B;  1KLO A;  1WHF A;  2RHP A;  3OLU A;  2FLG A;  3FFG L;  2MGP A;  4YT7 L;  2WG4 B;  1YUF A;  1TLE A;  1JBU L;  1LPZ A;  2MHP A;  1NQL B;  1CCV A;  4AQT A;  1URK A;  4BTU A;  1CVW L;  2GD4 A;  1QFK L;  2FLR L;  1L5G B;  5L2Z L;  3ENS A;  3N8Z A;  4RUT A;  1XFE A;  3IJE B;  3NJP C;  2RNL A;  1IOE L;  2BQ7 A;  2WPH E;  4BDX A;  3HS7 A;  4O1Z A;  3LTF B;  1EPI A;  4TGF A;  1Z6E L;  3QCW A;  2WYG B;  3KQD L;  1EPJ A;  1P0S L;  1KLI L;  1IQK L;  3DEM A;  2YGO A;  2W2N E;  1NFU B;  3EGF A;  3HO4 A;  1EAI C;  1W7X L;  3HS5 A;  2FLB L;  2K2S B;  2Y7X B;  1HRE A;  5KN5 C;  3KRK A;  1FFM A;  3S6X A;  3TBD A;  3SW2 A;  1FE2 A;  3SOB B;  1PFX L;  4D0E A;  4E1G A;  1CEJ A;  5I46 L;  1IQH L;  1ATA A;  4X8U L;  5EGM B;  3V64 C;  1XDT R;  2XC5 L;  1G1T A;  2KV4 A;  3SOV A;  1ATD A;  1EQH A;  1EMO A;  2BOX A;  1G2L B;  1B9W A;  1KSN B;  2W2O E;  4BTT A;  1RFN B;  3HO5 A;  2J94 B;  4LOR A;  3GCW E;  4COX A;  3PGH A;  1PGE A;  4Y7A B;  4Z6A L;  5CIS A;  3LN1 A;  2Y5F L;  3CEN L;  3MQE A;  4XBM A;  1HZ8 A;  3HPT A;  1IQM L;  1GK5 A;  1Z6C A;  4RS0 A;  3MDL A;  1YO8 A;  2H9E L;  1PXX A;  3N8Y A;  2D1J B;  2BMG A;  3N8Y B;  1U8C B;  4ZXX L;  1DX5 I;  4Y7B B;  3LAQ A;  3K9X A;  2WFT A;  4RRX A;  4Z0K B;  3KK6 A;  1IJQ A;  3RR3 A;  2M74 A;  3NTG A;  1NT0 A;  2PUQ L;  2BOK L;  4MMZ B;  5K0H B;  5JVY A;  4RRZ A;  1HRF A;  4CUE A;  3F6U L;  4PH9 A;  3M36 L;  1FAK L;  1SZB A;  1IQL L;  1FSB A;  1IQG L;  2Y7Z B;  4NG9 L;  2WPK E;  2XBW L;  4CUD A;  1G1Q A;  1EQG A;  1MOX C;  5IKT A;  1HT5 A;  5CKM A;  3HO3 A;  3BPS E;  1IQJ L;  2ADX A;  2P16 L;  3OLT A;  1P9J A;  5IKQ A;  3BT1 A;  2KB9 A;  4M10 A;  2P26 A;  2W2Q E;  4X8V L;  2VVC K;  2Y80 B;  5L30 L;  2MGR A;  3QH0 A;  1IVO C;  1I0U A;  4ZAE B;  2WFX B;  2WG3 C;  1WHE A;  2FD6 A;  1IGZ A;  1TPG A;  1G2M B;  2TGF A;  1PRH A;  2WPM E;  4XL1 A;  3HS6 A;  6COX A;  1IQI L;  5JVZ A;  4BDW A;  2H9E C;  1O5D L;  2G00 L;  4A7I A;  2VVU L;  1EMN A;  1G1R A;  3M37 L;  2Y82 B;  3QMO A;  2XBY L;  3U73 A;  5CKN A;  5KIR A;  2W3I B;  3CS7 L;  1C5M F;  1HCG B;  1HAE A;  3NT1 A;  1DQB A;  1FJS L;  2B7D L;  4X8T L;  2P93 L;  1APQ A;  1MQ6 L;  5JBB E;  1DDX A;  1F0S B;  2OYE P;  1CQE A;  3KQC L;  1F7M A;  2VWL L;  3LN0 A;  2P3U A;  5JB9 E;  2NPR A;  2FZZ L;  1NFY B;  3ZYI B;  5COX A;  4CUF A;  2EI7 B;  3ELA L;  1JV2 B;  1EGF A;  1HAF A;  4YT6 L;  4OTY A;  3V65 B;  3POY A;  5IKR A;  2VWM K;  4Y6D B;  3ASI A;  4D0F A;  2J38 B;  2EI8 B;  1NFX B;  1MQ5 L;  2J34 B;  2WZP P;  3LTG D;  2PR3 B;  4ISI L;  3TZI A;  1K37 A;  2J95 B;  4BXW A;  2UWO B;  1LMM A;  2EI6 B;  5IKV A;  1PTH A;  2UWL B;  3CA7 A;  4CSY A;  5JW1 A;  5F1A A;  2KL7 A;  1DVA L;  3FBY A;  2J4I B;  1ATB A;  2P94 L;  2Y81 B;  1NZI A;  3GCX E;  3KL6 B;  4ZHA B;  1NPE B;  3KCG L;  3Q3K B;  2Q1J B;  4A94 C;  3F1S B;  5JB8 E;  3TK6 B;  1COU A;  1ADX A;  3LC3 B;  4D90 A;  4Y79 B;  4C16 A;  2XC4 L;  5FDQ A;  1HT8 A;  3R05 A;  2BQ6 A;  1N1I A;  1FF7 A;  1M1X B;  2JKH L;  4JYU L;  2J2U B;  3N8X A;  1KLJ L;  4RRW A;  1EZQ B;  1DIY A;  2YGP A;  4O02 B;  3H5C B;  1HJ7 A;  4JYV L;  3TK5 B;  4M11 A;  1HX2 A;  1YUG A;  3ZYG A;  4BTI A;  2XC0 L;  2BOH A;  2Y5H L;  1UZP A;  1W8B L;  2P95 L;  1N7D A;  2KNI A;  4ZH8 B;  2W3K B;  1TOZ A;  3ZYJ B;  3N8W A;  1LMJ A;  2WPI E;  1CVU A;  1APO A;  1IOX A;  1G1S A;  2BZ6 L;  1IQN L;  4XLW A;  2VJ3 A;  2CJI B;  1JL9 A;  2VVV L;  3CFW A;  1UZQ A;  4JZE L;  1BF9 A;  3LC5 B;  5L2Y L;  2YGQ A;  1NFW B;  3N8W B;  3SOQ A;  2P3F L;  1X7A L;  4OTJ A;  2OYU P;  2WYJ B;  2P3T A;  1CCF A;  4RRY A;  2RA0 L;  4MMY B;  1UZK A;  1LQD A;  2XBV L;  1ZAQ A;  2W2P E;  4MMX B;  1XKB A;  2W86 A;  1OB1 C;  1FAX L;  4G1M B;  4LMF A;  2I9A A;  3LIW B;  4YZU B;  3TH3 L;  2XBX L;  2W26 B;  1EBV A;  1CX2 A;  4Y71 B;  2BOU A;  2BQW A;  1YGC L;  5JBA E;  1A3P A;  1F0R B;  3FCS B;  1YUK B;  1IGX A;  3U7U G;  2W2M E;  3BT2 A;  1LPK A;  1F7E A;  1IQE L;  1V3X B;  1UZJ A;  2VH0 B;  3C9A C;  4Z0L A;  2I9B A;  1K36 A;  1IP0 A;  3Q7D A;  1Q4G A;  1IQF L;  5E8D A;  2WPL E;  2K2T A;  2Y5G L;  2VH6 B;  2F9B L;  5CKQ A;  4JZF L;  2BO2 A;  2DDU A;  2WPJ E;  1WU1 B;  2VWO L;  2VWN L;  3P5B L;  5JBC E;  2PHB B;  4NA9 L;  1LPG A;  4FM5 A;  4BXS A;  1U67 A;  1KIG L;  4JZD L;  4ISH L;  2UWP B;  2P3F N;  4ZXY L;  3TGF A;  4Y76 B;  5F19 A;  1EPG A;  1J9C L;  3KQE L;  2Y38 A;  3NTB A;  3KQB L;  3GIS X;  3IIT B;  1L3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...