4BDYA

Pfv intasome with inhibitor xz-89
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
molecule keywords INTEGRASE
total genus 110
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bdyA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4bdyA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4bdyA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4bdyA03
3PMTA 3HYFA 3O3HA 3AO4A 4HUGA 5KCHA 2EQKA 1S1WA 4AHSA 3V9ZA 1C1AA 4E3SA 1NK4A 4FM1A 1JXBA 3SPYA 1KVCA 4E7HA 3KLIA 1QSYA 1WJQA 4M3ZA 1HQUA 1KSPA 1RT2A 3ZSRA 3NTIA 4O4GA 3SPZA 5JS2A 4LSNA 4DTJA 1IKXA 4B9TA 1HNIA 5KH6A 3CYMA 1XWLA 3V9XA 2XY6A 2OPPA 3NTKA 4OGCA 1X9MA 4CGIA 3OYEA 4HUFA 4DTUA 4C5GA 1HYZA 4LD6A 1LW0A 4FK0A 3V1QA 3SV3A 3V9SA 4M3RA 3TAQA 1RTJA 2RN2A 4DTSA 3NFAA 4FJ9A 5FRNA 4X34A 1DTQA 1RBTA 2BANA 2ATQA 3VQAA 3VQ8A 3K58A 4FJJA 4JRQA 4Z4IA 3P83D 2HNZA 4XIUA 1TK5A 2CKKA 4F4KA 3LALA 3OYLA 4CJLA 5JS1A 3SUNA 1K6YA 2HW3A 3LDSA 2YV0X 5C25A 2VWJA 3ZSXA 4CE9A 2XO7A 3THVA 2OPRA 4FVMA 4JLHA 1L3TA 2B5JA 1TAUA 1G15A 3C94A 4CEEA 1NOZA 2XY7A 2RHUA 1KLMA 3OYMA 1I3AA 3SJJA 4RW4A 3O3GA 4DFKA 1X9SA 1SKWA 1C1BA 1FXXA 2XRIA 3LP1A 2X6NA 4ELUA 4BD3A 3DLEA 5D3GA 1TKDA 1RT3A 2RJDA 4NYFA 1REVA 1VSIA 1ZBUA 2FBYA 4CJEA 4FLWA 1T03A 3ULDA 3NGYA 1ZBHA 3L3VA 4KHNA 5FDLA 4KO0A 4MQ3A 2BIVA 4ID1A 4CGGA 3OMCA 1N6QA 4KREA 3V1OA 2PYLA 3RR7A 2G8WA 4Z0UA 3RRGA 2E6NA 4N4HA 1KFDA 4E1NA 1LV5A 4B9WA 1QHTA 2VG5A 4BWMA 4EZ6A 3PNWC 3MP1A 4BWJA 1ZYQA 3AA4A 2G3RA 5KE2A 1CZBA 2RI3A 4Z4CA 3PY8A 2DIQA 4H4MA 4BDYA 1NK6A 1BQMA 1W0HA 4TSXA 4FJKA 3HK2A 4CIFA 3U6FA 5D6XA 2E4LA 4EP4A 4HTUA 4CJ3A 1UOCA 3BDPA 1RDAA 3O4QA 3OYCA 3AO2A 1S9GA 3VQCA 3LZIA 1X9WA 2RO0A 3ASMA 3QEVA 1Q9YA 4J2DA 3ASKA 1NJYA 1SL0A 4N47A 1XHXA 1ITGA 2ZQBA 3VQ5A 1U4BA 1S9EA 3OYHA 4FJGA 2DFFA 3K5LA 1WAJA 2RHIA 4IUQA 2YNGA 1VSHA 2ETJA 4RG2A 1JLAA 2HQXA 4IFVA 2GBZA 1HMVA 4EDUA 3DLRA 3TWHA 4N41A 3MEUA 5C42A 3ZEHA 5SWMA 3META 4CFDA 4W5OA 3SYZA 1S1TA 4DU3A 5I3UA 2G8VA 2P5OA 3K59A 4PL6A 3DLGA 2RKIA 4N4IA 1FKPA 1DLOA 1BI4B 4ZTJA 3U3GA 4FL6A 2D5RA 1WLJA 2P5GA 3OYNA 1RT1A 4F3TA 4KRFA 4AHCA 3QIOA 3DMJA 1HYSA 3HSTB 1NKBA 4FJNA 3MP8A 4DTPA 2LRQA 3AO3A 2O4IA 2KFNA 1JXEA 5C24A 4EZ9A 3NGIA 4HHTA 3MEVA 2X35A 5CZ1A 3KK3A 3QIPA 1EX4A 3P8DA 5J2NA 4JS5A 1NK5A 1BIZA 4AHUA 5I42A 2MWPA 1H3ZA 4DWIA 3L2WA 3VQQA 4FXDA 3B6PA 2EQUA 2D0CA 1JLFA 4CK2A 3KTQA 5J26A 3ZSVA 4IUTA 3LPUA 1VSDA 3OYAA 3DLMA 3LZJA 1Y97A 4DFMA 3NH2A 5C6SA 1GOAA 3L8BA 3OS1A 3P5JA 4IBNA 2EFIA 4KHUA 4QQ6A 1YTUA 2F8SA 4C5HA 2FBXA 2GF7A 2EHGA 3G10A 3ZT1A 1CXUA 1UA1A 2LVMA 1J5OA 4C8KA 3MEDA 4I7FA 4FCYA 3SNNA 4FJLA 1O1WA 4Q5VA 1T7PA 1J53A 1HQEA 3VN5A 4J2EA 2M16A 1B92A 1EP4A 3S3OA 5C0MA 2I5JA 3LAKA 2IAJA 2FBTA 4I9LA 1RILA 1L5UA 1VSLA 3EAEA 4C5IA 1SL1A 1D9DA 1BIUA 2M1HA 2P1JA 4IKFA 1EKEA 4B8CA 2LDMA 3V1RA 4CJUA 5J2PA 1ZBLA 1TK0A 2YNFA 1HNVA 2VG7A 3T19A 5KI6A 3ZT3A 5KRSA 1NOYA 4R5PA 4ID5A 4FJXA 3AV9A 4DSJA 4NCBA 3M8RA 4HVJA 1R0AA 4B9XA 1VSMA 2Y1JA 2YNHA 3KKRA 4OPJA 1VSJA 1L3UA 1D9FA 4Y1CA 1NJWA 4I9QA 3TAFA 3DM2A 1S1UA 4UC4A 1TV6A 3OY9A 1VSFA 1C6VA 3OYJA 3C6TA 3ZSZA 4CIGA 3L42A 2P51A 4UQGA 4QW2A 3EY1A 4ELVA 4M3YA 4CEQA 3AO5A 2IG0A 4DMNA 3DRSA 4DQPA 3NF9A 5KTQA 2HHWA 4KHWA 4DG1A 3DLHA 2LCCA 4M45A 3NH0A 3KLEA 2HHQA 4CJRA 2X4XA 3MEEA 2VYTA 1MHNA 4OKKA 3KIOA 3TAMA 1QTMA 3VQ9A 3DOLA 3LANA 3LPTA 3I8DA 4DLEA 1QSSA 4Q0BA 1KLNA 3S6WA 3MEAA 2HNDA 3LWLA 1GOBA 1RCHA 1LWCA 4CJWA 1RTDA 3LX7A 1FKOA 4KPYA 1WJRA 3KLFA 3V6DA 2DIGA 1S6PA 3NHGA 4K8ZA 3E9FA 4FLUA 1J9AA 2WACA 4B9VA 4FJ8A 2Q3SA 1ASWA 2X74A 3IRXA 5KGWA 3RMBA 3QEXA 4KI6A 4QQGA 4BE2A 4DQQA 2DY4A 1Q8IA 2LTOA 4PQUA 1I39A 2L89A 3S3NA 3QINA 4NYNA 2IOCA 3HP6A 3SV4A 2HVHA 2OYQA 1LWEA 3JYTA 2LSNA 3L2QA 1JLGA 1S6QA 3AVLA 4NS5A 3K2PA 1YT3A 2JZ2A 5M9OA 4W5RA 1IKYA 3MXJA 2Z1GA 1XNIA 2YRVA 1B9DA 1RTHA 2X6SA 4E7KA 3QLHA 2XY5A 1NK0A 4RW6A 4B9NA 4N76A 3CQ8A 3DB4A 4KAZA 3QNOA 1RT7A 3A2FA 4Z4GA 3P1GA 5HRNA 2P0KA 1W9HA 1BQNA 3LP3A 4AHTA 4DLGA 1FK9A 4W5QA 2HHSA 4PY5A 4KB0A 1KVAA 1Z26A 4IURA 3AVFA 3DOKA 4KTWA 4RW9A 1TK8A 2G8UA 4FJIA 3OS2A 2QQSA 5KRTA 4A4FA 3HXMA 2BE2A 1JLCA 1NJXA 2G8FA 4M3XA 4PLIA 3EYZA 3FC3A 3OMGA 2O4XA 4JRPA 3AVJA 2W42A 5CIUA 1BCMA 2QQRA 4DQSA 1JLEA 1LAVA 1IKVA 4OGEA 4CJPA 1NK8A 4B9UA 2HHUA 4LH5A 2IC3A 2QXFA 4MFBA 4OLAA 5HRPA 3ZCMA 2G8KA 3KJVA 3RR8A 4CESA 3HVTA 3AVBA 2DTUA 4KTZA 4FK4A 4M3UA 4CGDA 3LYIA 2YHAA 4BE1A 3QKJA 4OVAA 5DK5A 1JL1A 3CFOA 1S1XA 3L2RA 1JLBA 3DI6A 4LY7A 3U3YA 5HROA 2NLUA 3I0RA 4E89A 5D6WA 1SKSA 4PWDA 1YVUA 5EU7A 3OYBA 2O4GA 2Z1IA 3PV8A 3L2VA 1TKTA 3T3FA 5J39A 3QETA 5D6YA 3NAEA 4C8OA 2XY8A 3F73A 2ITGA 2YNIA 2BKDN 1BL3A 3K5NA 5FRMA 1KHCA 3V4IA 1S1VA 4RW8A 3HM9A 3L3UA 3S9HA 5FROA 2BUDA 2KTQA 4G1QA 1BGXT 5E41A 1SKRA 4CK1A 2JLEA 4W5NA 2HVIA 3OQ5A 2HHVA 1NJZA 4I2PA 2RJEA 3NTHA 2GUIA 3MECA 1UA0A 4K8XA 2EQJA 4II1A 1WSIA 2OPSA 4GVMA 4C8NA 3KLHA 1NKEA 2PQWA 4FJ5A 4O5BA 2M0OA 1C0UA 1S5JA 3QO9A 2YKMA 4IG0A 4CJVA 4ZHRA 4HCZA 1EETA 5KCOA 3QEWA 4M41A 1N27A 4FJ7A 4F3OA 1QE1A 1RTIA 4FLVA 4A4HA 4CERA 4CGHA 3CM5A 2DAQA 2KZMA 1JL2A 1RT4A 3T1AA 3O3FA 3SQ1A 4IFYA 1OZ2A 1BISA 1RDBA 2X78A 3DYAA 3NF6A 4CIEA 1XI1A 2HB5A 1TAQA 3HVRA 3HPGA 1KTQA 1WSFA 2RF2A 4RW7A 4DF4A 4B3OA 3QBYA 4PA1A 4KV8A 4H8KA 4M3WA 3NF7A 3RMDA 1U47A 5HBMA 4FK2A 1RBRA 4LD0A 4DU1A 1WNSA 4FM0A 1JKHA 1BHLA 1WGSA 3KUFA 4A4EA 4ZTFA 2Z1JA 5KE3A 3GOXA 5CY4A 4M42A 1BCOA 1QQCA 1UWBA 3AO1A 1CLQA 4L59A 4DFPA 2A1RA 1LW2A 1DTTA 3DB3A 4KFBA 4AHRA 4B9SA 2K3YA 2KQ2A 4FJMA 1SL2A 3AVAA 5SZTA 1X1PA 4CK3A 4DSKA 1TVRA 2D0BA 4WE1A 3MP6A 3QEPA 3HJFA 2XDPA 2IGIA 3HPOA 1G5VA 1C1CA 4CEFA 3VQ4A 3TANA 3DRRA 1TKXA 2OPQA 2PY5A 4CHQA 4HCBA 4B9LA 3KLGA 3QIIA 4DSFA 3S3MA 1CXQA 5J2QA 2F8TA 2RHZA 3EZ5A 3NNQA 4FU6A 4LSLA 5CZ2A 3CFPA 3SCXA 3LGFA 3RMAA 1OZ3A 1OI1A 3SQ4A 1SUQA 3B6OA 4CF9A 4CCHA 1A5XA 1LWFA 2IS3A 3DRPA 3HPHA 1XHZA 1WSEA 2Z1HA 4N56A 4O0IA 1U48A 4CEDA 2R7YA 3VQBA 1WSGA 3VA0A 4KHSA 1ZBIA 2RPIA 1TL1A 1KRPA 3PX0A 4DTNA 4CFAA 4DQIA 2G8IA 3OYFA 2VWKA 4I2QA 1WAFA 3K5MA 4E7IA 1HPZA 4FLYA 3CM6A 4DTRA 2B8AA 3AA5X 3ALYA 3OVNA 3WNEA 4AH9A 4CF8A 4DSIA 3O4NA 2OZSA 1VRTA 3QESA 4CHNA 3ZSQA 4CEBA 4FW1A 5J2MA 1C0MA 3RRHA 2NUBA 3MXMA 3OJSA 1D8YA 1TGOA 3BGRA 3KD1E 3IAYA 2WONA 4F2RA 3LWMA 4DTXA 4Q5WA 3D0PA 4F8RA 1NKCA 3HO1A 1U49A 3BDLA 3AVNA 4IUVA 2R57A 4B08A 3WNGA 5HP1A 2MWOA 1IH7A 1T05A 4NCGA 3C6UA 3OB9A 1QSLA 2E6LA 2QKKA 3I0SA 1C0TA 5HRSA 2XHBA 3OYDA 4IUUA 4KKOA 4CJKA 1RNHA 4C8LA 4QCLA 4O0JA 4PUOA 3D45A 1B9FA 3KK2A 3CEYA 3M8SA 3PMIA 1D5AA 1UAXA 4DU4A 3SQ0A 4FM2A 1ZBFA 3H8ZA 3LH0A 4C8MA 2E6MA 3F70A 3QEIA 3SQ2A 4CF1A 4IUPA 4GMJB 3OYGA 3TARA 3M9QA 2R5MA 4C5EA 3ITHA 3VQDA 4DTMA 5DMRA 1J54A 3PX6A 3TAPA 2G8HA 2RHYA 3FEOA 3ZT2A 1RBUA 4CEZA 2Y1IA 2KFZA 3KD5E 1QS4A 4EP5A 2WOMA 1WJSA 4YNQA 3HT3A 4F2SA 3OYKA 4DS5A 1SSFA 4E7LA 2HHXA 3QJ6A 5K14A 3ISNC 1TL3A 2IDOA 5HRRA 3TI0A 4QQDA 4O44A 4JS4A 4FZXC 3E9GA 4FYDA 1OYXA 1HRHA 1IKWA 1L3VA 4Z4HA 2X4WA 3ZSOA 2RJFA 3PO5A 1GOCA 4Z02A 2B6AA 4A4GA 4Z4FA 2R58A 4QVZA 2HNYA 3M8QA 3WNHA 1TKZA 4DQRA 2D9TA 1KCFA 4CJQA 3SUQA 1U04A 3AVMA 3AA2A 3PO4A 3NGZA 3VQPA 3IS9A 3DLBA 2PYJA 4B9MA 4FZZA 4RG8A 4FW2A 4CJFA 3O8VA 3OS0A 1WN7A 4CF2A 3RTVA 2KW4A 4DFJA 4OKEA 4OKJA 1XC9A 3LGLA 1U45A 3DLKA 4IDKA 1NK7A 3VQEA 2HHTA 2RHXA 4E7JA 3H08A 3LAMA 4AHVA 4B8AB 3SI6A 4CFBA 4DS4A 1N5YA 3SUPA 3AVGA 2OZMA 4CHZA 4CJTA 4CJ4A 2F5KA 4OVLA 4J2BA 4N4GA 4DF8A 3MEGA 3AVIA 3KKSA 3M8PA 4KHQA 2EKOA 1JLQA 4CECA 4CRIA 1RBVA 3MEWA 5HLFA 1KFSA 3FFIA 3QERA 3NCIA 4CHYA 4BACA 3C95A 3P8HA 3FDRA 1EXQA 3ZT4A 2YHBA 2GV9A 2D0AA 4QAGA 4E1MA 4FLXA 3V9WA 2ZE2A 3AVKA 1BI4A 1VK0A 4ICLA 3UIQA 2EQMA 2GFUA 3AA3A 3NDKA 3RMCA 2BDPA 1WSHA 3MAQA 1Q9XA 4KB1A 3VA3A 3SD4A 2FC0A 4GW6A 3ME9A 1F21A 4CEAA 3QNNA 4CHPA 4FJHA 2B4JA 1HYVA 5T7BA 4N5SA 3AVCA 4CEOA 3LP2A 3HL8A 2OA8A 4FLTA 4BDPA 1IO2A 2A1SA 1RI0A 2XK0A 4CGJA 3K57A 2HMIA 4OLBA 1RT6A 4CJSA 3C4SA 2HQEA 1NK9A 4GY5A 4LH4A 2L3RA 4IG3A 4DSEA 4KHYA 2QK9A 2E5QA 2R5AA 1ASVA 1MU2A 3NBPA 4Y1DA 3V81A 1L3SA 2KZZA 2RI5A 3MXIA 1T8EA 1WSJA 2VG6A 1KVBA 5KGXA 2RJCA 2RI2A 5IAYA 3MO8A 3SUOA 3V9UA 1RT5A 5CYMA 4CFCA 1YTAA 4E19A 2QKBA 4E0DA 3KK1A 4BDZA 4KTQA 3CFRA 2GFAA 4HUEA 3FLGA 3Q1JA 2K3XA 1VRUA 2FBVA 4W5TA 1A5WA 2AJQA 4FZYA 1VSEA 4HCCA 4PLLA 2JTFA 1RDDA 3HP9A 1RBSA 5J1EA 1IG9A 4J2AA 4BE0A 4CGFA 4NZGA 3NF8A 3TABA 3TAGA 3LLRA 2BGGA 1Z25A 3TAEA 3PX4A 3RWUA 1CZ9A 3NE6A 3UT1A 4QOZB 2EX3A 4FLZA 2DFEA 3VQ7A 3L2UA 4O55A 3ZT0A 3OJUA 4DTOA 2JGUA 2X4YA 3CG7A 3G0ZA 4CJ5A 3JSMA 3K5OA 4ELTA 1VSKA 3IG1A 3SZ2A 4L8RB 2ZD1A 3ZSWA 3F9KA 4AILC 2DFHA 4OPKA 4H4OA 2FHDA 2L8DA 1LAWA 3AVHA 3VQ6A 4M3TA 3LP0A 4OJRA 3WNFA 4CF0A 4NCAA 1ASUA 4KI4A 3H6ZA 1RDCA 4DSLA 1HJRA 3UWNA 3TR8A 3PUFA 2PZSA 4Z4EA 3PFSA 5IN1A 2YKNA 4YFUA 5CYQA 3ZSYA 3OYIA 1SV5A 3E01A 2F96A 1A5VA 2O4XB 3OA6A 4CHOA 3NH1A
chains in the Genus database with same CATH superfamily
2VPRA 2Q2EB 2L9NA 2Z9OA 4FM1A 1KVCA 1B7TA 4CYCB 2STWA 2QDYB 1ODDA 1BN5A 2IVWA 1VQOT 2ZXJA 1NK3P 3J80Z 2GELA 4NDLA 3QO3A 3BCBA 3THWB 3Q5FA 2I2LA 2JSCA 2DXBA 3SV3A 1HKSA 3OIPA 3IRRA 3X25B 4Z4IA 4EM0B 1J59A 1N9RA 2JT4A 5KK1A 5DM6F 1GCPA 3SDBA 3AKZA 3EO3A 3GBTA 3LDSA 2FNPA 2YJEA 1M4ZA 1G15A 5L3EA 2EZIA 1UHSA 2YT6A 3OW2M 1DPUA 3VS2A 2QYOA 1TKDA 1XQHA 3GZ5A 1HF0A 1R00A 4XL9A 1VZ0A 4Z0UA 3CTAA 4B9WA 4M74A 5DUIA 2Y69H 2K4BA 3BR6A 4B43A 4BRAA 3JRIA 2I7PA 3U6FA 1GLJO 4HTUA 4JJBA 2H8HA 4JI1K 1RDAA 4AYBA 1NG2A 5IHNA 4GYIA 2BHYA 3RYPA 3EKSA 3QAHA 2L01A 3K5LA 2A69F 2IS2A 2V1UA 1G2HA 2RHIA 2F5VA 2ETJA 3JCMf 4N41A 3WGHA 1JJ2S 4KJZA 5J47A 3CCVT 1KYZA 4NLBA 5H1SQ 3DFGA 2EYWA 4ZTJA 1ZH5A 2JOYA 3AAFA 3F8NA 3LQQA 1MDMA 4ANJA 3R6MA 1Q86U 5J2NA 1EX4A 1JKQC 1FWZA 5J26A 2M0MA 1TS9A 2C0IA 4IUTA 4RTZA 1WVRA 4DYCA 5A2QO 1P7IA 3ML6A 3BR5A 1TOVA 2ENMA 3MEDA 2A28A 2M16A 1MJ9A 4I9LA 2A6TA 1XB4A 2JHJA 2YS9A 1LDDA 1RILA 2VIXA 1KGSA 2FL7A 3DWLE 3LSMA 2K7AA 5ERIA 4C92C 4ID5A 1KQJA 5JLXA 5FWCA 2YHYA 1VSMA 4L9NA 1KG5A 2CW8A 3B6CA 3I53A 1W7PD 4EAHD 2A6EF 3PJRA 5GP9A 2A40A 4YOYA 1HDDC 4PGGA 3OH9A 3GP8A 3P8BB 1M1KC 1XSDA 2V51B 3CCRA 2IVPA 4FLUA 1YF5L 2DEQA 1KC8C 5FLVA 4DOWA 4Y4RA 5LJ5d 1KD1O 5CVVA 2LSNA 5ILSA 3VS1A 2QWLA 3J81Z 2CO5A 2XY5A 1I5OB 2MSYA 1PSEA 1FK9A 4PY5A 2ECBA 2M34A 3EYZA 4B4CA 3JCMc 2XKOA 2GTDA 3K4JA 4M6XA 2QQRA 3OS5A 4JJCA 2W4SA 3T9NA 3KJVA 2WAFA 2HXOA 3HOTA 3S1NJ 4A2BA 4UHTA 3D6RA 1OH8A 2P5LC 3VYUB 3A0BC 5CQEA 5CVRA 4FWOA 1OQKA 2XY8A 4RMOA 2WV0A 4KUIA 5BNGA 4EM2A 3K5NA 1SKUB 1Y39A 5HDNA 1VQ4Q 3L2CA 1VTNC 2PQWA 5J1UA 1K9MU 4I99C 4CJ7A 1N27A 3KYDB 1ZRCA 3ER0A 1RT4A 5M1FA 1VQMT 4YRVA 1OZ2A 4AFSC 3CXCM 3K2AA 1KTQA 1REPC 1O57A 3KUFA 4A4EA 3DPLC 3H1VX 1R9TJ 1Z9CA 5CY4A 3H6EA 4DFPA 2DZ9A 5H20A 4CK3A 5AQHA 3BG3A 5D8LB 1MBGA 1G5VA 1C1CA 4UVAA 2PY5A 1NGJA 3KLGA 4DSFA 4A6DA 2ZJQL 4FU6A 4XTXA 1FP2A 3SCXA 5I9EB 2R92J 1KIKA 2NRRA 3KBGA 4OIQF 2CW0F 2XAHA 2GXAA 1KQ8A 3HHGA 2BOLA 5HS8A 4PHTX 3G0QA 3TQ7P 3M0RA 5GAOm 1AKHB 2VXZA 3D5LA 1TGOA 1NKCA 2VB6A 2LT4A 3PVLA 3I56I 3CQTA 3WNGA 1IH7A 3G4SN 5EEGA 1OQYA 4O0JA 1UG2A 3O80A 2XV4S 3TP0A 4IL6C 3N0UA 1CKBA 4M75A 2CH4A 2LOOA 3JB9J 3PUBA 2G8HA 2RHYA 4MDXA 4BR4A 2E5LK 3KD5E 2O8EA 3FMQA 1JBMA 3HT3A 2IJLA 5J8CA 4QWQA 2R7FA 5E1ZB 4QQDA 4FZXC 5LL6Z 2QGGA 2R7UA 3M0TA 2HNYA 2D1KA 3DP7A 1PP8F 4OKEA 3U9ZA 1Y8QB 1OV3A 4B8AB 4LD9K 2ED1A 1TNSA 3AVGA 2NNWA 2STTA 2NNYA 1M90R 2O8BB 1WHLA 2CUBA 4FWSA 3P8HA 4YIRX 3SDZA 1HSJA 4KYWA 3RKXA 2NOFA 4BDPA 3DLAA 5LRSA 2A1SA 4O5FA 3O8GA 2EJ9A 2RKHA 3RKYA 2KZZA 4AYBN 4LF8K 2RI5A 5CKBA 9ATCB 2DJNA 3BG5A 4DBFA 3Q1JA 5LJ5g 1FC3A 1T0JA 4HCCA 1ZRFA 1R59O 3CCEQ 1IV8A 4LFCK 1TW2A 5EF6A 5EY4A 3UT1A 2YI1A 2E71A 2WBNA 4DTOA 3F6OA 8AT1B 2ZD1A 1JHFA 4YPHA 3ZMDA 2Z33A 5B1BH 4EJUA 1U2VA 1HJRA 5GAEP 3ZQIA 1S3JA 5CYQA 1U3EM 3PMTA 2NS0A 4EW4A 3AO4A 4H0YB 3V9ZA 5JS1A 1JXBA 4BRMA 3SPZA 5JS2A 5GTHC 5KH6A 2EV6A 4HUFA 4FWMA 4M3FA 1KSWA 2LTPA 1LW0A 4M3RA 1RTJA 4EV0A 1G8XA 1ZA1B 2QDLA 2LC2A 1DEJA 1L3TA 3OSSC 3I56A 1OPCA 4RW4A 1SKWA 5LEKA 5KYXA 2J4RA 5HKCA 2FPFA 1X2QA 1NJIC 3RSEB 1T03A 1GLFO 3L3VA 3CC4T 4KNYA 4G12A 4AQYK 2N8GA 1LV5A 2M7BA 1WI9A 3CVSA 4YOTA 4BR9A 3GTJJ 4C3HJ 4PJOD 4IO9F 3TEEA 3BCAA 1LNXA 2A7YA 2RB6A 1BQMA 2XPVA 1KO9A 4M75F 3BDPA 1UAAA 3QYHB 1NJIU 2MBFA 1XHXA 3VQ5A 4JI3K 1QCOA 4LFUA 1ZUKA 3VW4A 1JQQA 4IUQA 4IHYA 1XDUA 3OL3A 3MFKA 5LGUA 5A0GA 5GMKe 1BA0A 2W57A 1SFEA 1BI4B 1VQ7N 3M4YA 5AQQA 3W6VA 3ID6A 2P4TA 5CZ1A 1M3BA 5I42A 2KFNA 4CK2A 3UB5A 3ROUA 1U0JA 1Y97A 1H9TA 1YTUA 4KHUA 4HAMA 2J6FA 1J5OA 2XUBA 1WI3A 3CC2A 3A2KA 4L5EA 2EYZA 3SAFA 4B8CA 1IZ6A 1MPGA 3VF4A 3AG1H 4J9CA 3OW2P 4I9QA 2LCLA 4CIGA 1VF9A 4QW2A 4C23A 1VOMA 3DLHA 5E8IA 1MHNA 1QSSA 2QI2A 1U1SA 1YJNT 1RTDA 3VFZA 2XDVA 4FJ8A 2Q3SA 4DQQA 1Q8IA 2JA8J 2KFDA 4OMFB 2VXEA 1K7AA 5E3LA 2YRVA 1B9DA 4M7YA 3A5MC 3P1GA 3J7AP 3LP3A 3KZBA 1BR2A 2Y0SN 4KFCA 3G6ET 3WTUC 1O3TA 3FM5A 2G8FA 3LDOA 1T3SA 2FU4A 2KK4A 4DQSA 3S1MJ 2EPFA 3RKQA 4OP0A 1Q81R 3NVMA 2PVDB 2YSRA 1Q81O 3QKJA 1A35A 4RCBA 2LMDA 1BDGA 1EA3A 4B6MA 4GNIA 1YVUA 2FSKA 3INZA 1PKTA 4JEPA 1AHDP 2BE5F 4C8QF 5C0YA 4NL2A 3A8GB 2JHNA 1SKRA 1BGXT 5E41A 4XLNF 2JLEA 3QRFF 2GUIA 5GADP 4GVMA 4II1A 1U84A 3W2VA 1C0UA 2JN6A 4BRHA 3I35A 3I0TA 1BKBA 2JPSA 3J7AY 3GE1A 1WJ5A 1S9HA 1TUGB 1Y0UA 3I9QA 3VESA 4GFBA 4B3OA 4C8QB 2UYTA 1U47A 2NRWA 4M9SA 2DW4A 4L18B 3VEYA 2DQRA 1LW2A 3DEWA 1BU6O 4B9SA 1YNZA 2O9SA 3BG6A 2KRHA 1TVRA 3HJFA 3BR3A 1VQMN 1VQPQ 2V75A 4M73A 2Q31A 1QVUA 1UB9A 2HOTA 4BUPA 4C2TA 4C8QE 1OZ3A 3QXEB 3QSUA 1I50J 3LL7A 4OINF 2DFIA 1RRQA 3RERA 1LCKA 2E60A 1HSQA 2RPIA 2FD5A 2KR3A 5LHGA 2UV1A 3CM6A 1H89C 3HTSB 5JFRA 2KROA 3VRZA 4IZZA 5E1XA 5GAOr 2RE2A 2JN0A 5CQXA 2L9RA 4E4HA 3O1WA 1Z91A 3BY6A 1W36D 2R7DA 2VWFA 4M7DB 3RJPA 1WHKA 4G7OF 3HTVA 4IHTA 5D5WB 2X1CA 5FD5A 2ED0A 4KIBA 3H8ZA 4C8MA 3ZQHA 1N3AA 4C5EA 3VQDA 1OPLA 3T1YK 5DUKA 1FMVA 3TTDA 3CDIA 3QP6A 1NHAA 1SSFA 3V7SA 3HOVJ 3ISNC 2IDOA 1SHGA 2K3PA 4FYDA 1R0CB 4WX9A 3NARA 1X2KA 1ZRDA 4MTEA 4FW2A 1YI2N 3RTVA 3R9PA 1NU0A 2HHTA 5K7ZA 4JKDA 1TQMA 1XMXA 5GAMj 2QG9B 2YG8A 4LF4K 3MEWA 1BBYA 1U8BA 1VQOQ 2IIRA 2P4RA 3QU6A 3VUZA 2WY8Q 3ZT4A 2ADUA 5DLOA 2W85A 3CPEA 2JRMA 2OAWA 2FC0A 4FJHA 1F21A 2ZB9A 4XH5A 3HL8A 3Q0UA 2XK0A 1WQWA 4CJSA 3CCQT 1MUYA 1NPRA 2W25A 4IG3A 1YITN 4A69C 1W36C 2LNVA 1NBWA 4CZEA 4CBXA 1NZ9A 3FMRA 4KTQA 5KCMA 3CMET 3FF5A 4M7AE 1A5WA 1WH7A 3KP5A 4BE0A 3TABA 2RV8A 3Q9SA 4HTLA 1WQ2A 5LLQA 1UGPB 2YX6A 4AG1C 4L8RB 1M2OA 1AOJA 1BWFO 1NG6A 3QBWA 2P0QA 2VC0A 1IRZA 4KI4A 1CF7A 1T6SA 2YX7A 1Y07A 1B3QA 2UWMA 1H0MA 2CP2A 3VPRA 3HYIA 2E70A 1YG2A 3S41A 1A5VA 1K0SA 4CBUA 1MMSA 1YRNA 2EAYA 3F8BA 1JKPC 1DU0A 2Q8KA 3BOQA 5FB2A 4J6XA 5E3OA 3ZSRA 4AUXA 1ZSGA 1IBLK 2RN8A 3CJ1A 8ATCB 2JA5J 5A0LA 2FSNA 4C5GA 2DA9A 2UUZA 3B8AX 5IT9O 3AG3H 3HEFA 1QVGM 4DTSA 4FJ9A 2R7TA 3THKA 2M7AA 2HNZA 4O6JA 3CCUT 2LQWA 5M3MJ 4H5TA 2VWJA 4CE9A 3H35A 2H6BA 1KC8R 3C7NB 1GBQA 2H3JA 2X9HA 1X9SA 2F6CA 3MN6A 3OSGA 1ZBHA 4EMKA 1MNDA 5HNHA 4BWMA 4CI6A 2CDTA 2DCEA 3LSKA 2OBPA 1R5GA 2DKGA 1ZXOA 4BDYA 4OIPF 2NUPB 2VUBA 5F2RA 1X9WA 2GEMA 1UFFA 3QEVA 1E3PA 1KQSA 5C2FA 2NUTB 1S5LC 2QWNA 3L09A 1JJ6C 3T69A 1RI9A 3G1OA 3A5OC 2WWYA 4CO8A 4N4IA 4ME7A 3M54A 2JSPA 3E1YA 4EZ9A 3CZ6A 4DHYA 1NK5A 2VQCA 2EQUA 3KTQA 2CMPA 2V9KA 1VSDA 4UY8O 5D8KB 1YN8A 4MO7A 2F8SA 3JCMP 2YR2A 3JSPA 4D5FA 2QQBA 4J9IA 1VSLA 3EAEA 4C5IA 2P1JA 5KYWB 2L5QA 2RQRA 1VQ9Q 4I01A 2OQGA 2RNGA 2E2OA 3KKRA 4J2DA 2Q0RA 5GAN5 5KAIC 4MEXF 4FYVB 1UGQB 1Z21A 4AVPA 2QQ8A 1KK7A 1JHHA 2NXNB 4RCHA 2A68F 4RGRA 4M78E 1KLNA 5GAN7 2HNDA 1P9QC 2UUAK 2HPIA 5TGTA 4G6TB 4U0YA 3T7ZA 2VBZA 1NM1A 3IFRA 1AZEA 1R1VA 2I10A 1I0CA 2JZ2A 3VRYA 5IY5H 2X6SA 2LP0A 3CWUA 3DOKA 4M72A 5TKWA 1PD1A 2W42A 1K8KB 1YJ9A 1LAVA 2MFZA 2G8KA 2ZGWA 3CESA 2GM4A 4BEHA 1VQLI 3CFOA 3C3WA 4ZH4F 1TKTA 3QETA 4QKUA 4C8OA 3FB9A 3O6WA 1BW6A 3E97A 1OLTA 1KHCA 3S9HA 2BUDA 2DL4A 1VQLN 3QYGB 3HFNA 1E3MA 2LR8A 4R79A 4FJ5A 5CKHA 3HO1A 1LCUA 2NUZA 1HSTA 4HCZA 5GAOp 3LWHA 4A4HA 3CM5A 2XKOC 4IFYA 1U45A 1XI1A 2ZM6K 2JTEA 4A3FJ 3CXCS 1WSFA 4A3KJ 3G73A 1YITA 1GXPA 2M1BA 2H1LA 3CCUQ 3VMFB 4RDUA 1JKRC 2VGNA 4B9QA 3KCCA 4WF2A 1NYFA 2ECZA 1QQNA 5KE3A 4LNPA 1KQSS 1ZUUA 4BY6B 2LF7A 4KFBA 4JI8K 4DSKA 2CG4A 3QEPA 4QS8A 4CEFA 1YIJT 3UE5A 4BHCA 1J7KA 4J8FA 4CHQA 3EHRA 2LX7A 1BJZA 3ERED 2CV2A 1B8IB 1A5XA 3HJEA 1U48A 1WSEA 4N56A 3VEPA 4CEDA 2R7YA 3OIOA 2FSWA 3PX0A 3JB9G 3WEEB 4I2QA 1J5EK 2CS3A 2LMJA 3TSZA 2OZSA 4CHNA 5C12A 3MXMA 2NVUB 3LWMA 1R5HA 1XCVA 3P31A 4DTXA 2CJJA 2IRFG 3E9OA 3FE1A 1CSKA 1OR7C 4WF9L 1FYNA 3NRVA 3QJYA 1MSEC 2CH6A 1UAXA 4KRFA 3IRQA 2IS1A 3GTGJ 1G2BA 4D9JA 5J4YA 4HPQA 4F2SA 5K14A 3FXJA 3A03A 4L9JA 1Y0MA 4O44A 4KISA 1L3VA 3PO5A 4H5RA 3ZSOA 3HI0A 3UKUB 4Z4FA 5IYBJ 1JT6A 3C7NA 4FX0A 2RQPA 4OMNA 1KCFA 4PL7A 5L3CA 3CCJN 1SVOA 3BPXA 3DLKA 1RR7A 1UHWA 1OISA 1W4MA 1V55H 4CFBA 4DS4A 2CGLA 4OVLA 1XS9A 2EZHA 4KHQA 1X2NA 3PIOA 2UXXA 4YG2F 3FIFA 1Y8RB 4RTXA 3JRBA 2DLPA 3SAHA 1K8AO 1A04A 4KB1A 2V7ZA 4EVIA 3HKZA 4E47A 1FYLA 4KICA 3QYFA 3DLLF 3V81A 1GL5A 1KVBA 3C65A 2A61A 1JJ8C 2DPPB 3J7YP 3IP4B 3NVKA 5HL7L 5GANe 4WXDA 3WU1B 4ISEA 2ZSHB 4R8HA 3PO2J 1S6LA 1J6ZA 1ILYA 2MD0A 2O61A 2EIJH 3OTOK 2EX3A 2NAZA 1K79A 3KXTA 1QVTA 4CJ5A 2GX9A 4ZYEA 1ZGJA 2P5KA 1VYTA 2FHDA 2DU9A 3WNFA 1QHHD 3DQVC 1BK2A 2P4WA 2DA6A 3NEUA 4HSBA 3CC4N 2J06A 1Y7XA 5AQTA 3N5NX 3KEYA 3ZN1A 3IH3A 2YRCA 1S1WA 4HUGA 1C1AA 3TSPA 4EHUA 3M3ZA 2V1NA 1KD1U 3DKYA 4ZYHA 4C2UA 3CXCA 2OPPA 3NTKA 4GDFA 1Z1DA 4FK0A 2R0QC 2VXFA 4BR2A 4JHDA 4XIUA 2NRTA 2I0NA 4A62A 2M0YA 2CQKA 3UNGC 3LFUA 2OTLN 4BROA 3KWGA 1B34B 2XRIA 2X6NA 3DLEA 2QENA 2BXZA 3C6HA 3MN7A 1N6QA 2LVSA 3SWNA 4E1JA 2EH3A 1YJ9N 2R7RA 2G3RA 1JT0A 4LUDA 1MDUB 1W0TA 5L3DA 2MC4A 1UOCA 4A5AA 1SL0A 2VJIA 3R6SA 3OYHA 3EE8A 4GV9A 5GMKi 2GQIA 2NRXA 1OKJA 1KQ2A 1V54H 5I3UA 2KY9A 4AM6A 2P5OA 4AD9A 2HMPA 3DLGA 2NYSA 1FKPA 1X6OA 3JRDA 3HZJA 2FB7A 1MGQA 1NGEA 3MDQA 2QQAA 2W7NA 1SZ2A 4OIOF 1FMKA 2CQQA 3MP8A 3TPQA 4FSSA 5C24A 3A8MB 2MWPA 4JYKA 3OYAA 3LZJA 3L4IA 5C6SA 4IDHA 3N05A 5F0CA 2FOKA 2EFIA 1DPRA 2QGFB 3U9GA 5CKEA 5H6RA 3ZT1A 4C8KA 4G94A 1QVFP 1T38A 4BUGA 2I5JA 5GAN3 3CD6I 3JRCA 2E36A 4CZMA 1VQ4N 3T19A 2KKZA 4UXNA 3DTIA 4NCBA 2UXNA 3JAMO 3SZGA 1X1CA 3K59A 1TV6A 4O8UA 2LQKA 3TAFA 4EW0A 1TWCJ 2VKNA 2DOFA 1VQ4I 1T2KA 1QQOA 3THXA 4OKKA 1IXSB 4DLEA 3I8DA 3E5XA 1ABQA 3CJBA 2DYSH 1S6PA 3CWAA 1WJCA 4I0AA 4RAGA 3IRXA 4JI6K 4ESRA 1ZR4A 5GJWB 2LKPA 3M8FA 2XPUA 1ETOA 3S3NA 4UUTA 3OV8A 4C9YA 2YLCA 4PGHA 1M1KR 3CCJA 2E3HA 4RTYA 1W6XA 1W9HA 3AVFA 2DMNA 4A2UA 2G8UA 2QQSA 1RACB 2ZGYA 3K7AJ 3OMGA 2LH9A 4JRPA 5D6EA 2B7EA 3LWFA 3H0IA 2TDXA 4MFBA 1WBDA 3IH7A 4CESA 3HHHA 1TT0A 2EYXA 4OMQA 4BE1A 1VQ6N 4LY7A 3BP8A 2ITGA 4IRHA 3TU5A 2M30A 1ZG1A 3FK7A 1RL2A 3SFMA 4W5NA 2CGKA 1ETVA 5FW9A 4IG0A 3ZMUA 2P9IB 1NGBA 1IGUA 1QE1A 4FLVA 3TTFA 4BXUA 5AQNA 2CQNA 4PUSA 2QEXN 3T1AA 1BISA 4MTDA 2QWQA 1J09A 1YJNA 2EGEA 3C1DA 4LE9A 4QT7A 3EN9A 1BHLA 4X62K 4H0PA 4ZJZA 2X85A 2JA7J 1VQ5I 1T08B 4J9EA 1SC7A 4HLXA 2FE3A 2NVXJ 3DB3A 4B3MK 3JCMX 3DF8A 1SL2A 1D0YA 4KULA 4C30A 1UHCA 1VQ5N 1Q7YO 3S3MA 3EGDB 4YDUA 5LY3A 4B22A 3LGFA 1SUQA 1LWFA 2NOZA 2HZDA 1YO5C 1ZTRA 2L0KA 3PM1A 4XLAA 1T0FA 4WYBA 1UDLA 5AQMA 4JBAA 2BH1A 4BRQA 1KA8A 4Y17A 4M3DA 4DTRA 4CZJA 3ZPLA 1ZQ3P 5E26A 1VRTA 2R7QA 1U6GA 4BRLA 5HLIA 3KD1E 3PSIA 1QZ6A 1WJEA 2EZKA 4S0HB 5LJ3j 3LDLA 3A01B 2E6LA 4PUOA 1VQ8T 3D45A 4FM2A 4GMJB 1K0XA 2JS0A 4DTMA 1WZ2A 1IDZA 3ZT2A 4ZYAA 1EWQA 4UNFA 4LF9K 2KDSA 1W7PA 4BI4A 2O8BA 1S22A 1NGIA 2X4WA 4Z02A 3RQ4A 2R58A 4QVZA 4F7UA 3WTZA 1Q82O 1VQNT 2EBPA 4M7AD 2F5KA 1SFOJ 4AIHA 5DCFA 4DF8A 3LSIA 2C0OA 2EKOA 1M30A 5HLFA 3FFIA 2YUPA 4C0FA 2UZKA 1ATRA 1R4MB 3SBGA 5FLXO 2GFUA 3AA3A 1G4DA 2DJQA 1O13A 3M07A 1RUNA 4RA2A 5H2FC 3VB2A 4EMHA 1P4XA 2KP6A 3E7LA 2QUFA 3CLOA 4LH4A 4JKGB 2IS6A 1AWCA 2K9SA 1N36K 2ZJRF 2JA2A 5KGXA 2M2EA 4DV1K 5CYMA 3ABKH 3E6CC 1UJ8A 1LNWA 1YX5A 5FD6A 1JUMA 2AJQA 5GAMe 1X01A 1RDDA 3SMSA 4J2AA 2JM9A 2EQIA 2GBYA 2W48A 4RKUE 4KITB 3CDHA 1NMDA 3BY7A 2IGMA 4DA4A 2ZJQF 2CZ6B 2BHZA 4FT8A 2DNUA 4IWVA 2VKEA 4BS9A 1RDWX 2L8DA 4CC2A 4PDKA 3U9DA 2P0WA 3WU2C 2XIDA 4FPAA 2VE9A 3TMOA 2QA4A 2YKNA 3OYIA 4IEIA 1KD1R 2E35A 2FSJA 1IHVA 4YY3K 3GZ6A 1K73U 3IKVA 1HQUA 3GOIA 1KAZA 4LSNA 2W82A 1X75C 3M1FA 3CMEN 1KFZA 2R4GA 3V9SA 3TAQA 2KIQA 2XGEA 1QQMA 3JTGA 1DTQA 3N5BB 3CC4Q 3VQAA 3H92A 2UXDK 4NC6A 3LALA 3SUNA 3MKZA 2XGCA 2OAUA 1P8ZA 2B5JA 4UUSB 3C94A 1GLLO 1TQIA 2RHUA 3QICA 1OVQA 4DCHA 3FZMA 1IDYA 1RT3A 2KMTA 1GBRA 2J5OA 2ME0A 3JCMJ 3D4VA 5K5QA 3LM9A 3JCMQ 1PU6A 4M77D 1G99A 5KE2A 3QHSA 5HY6A 1JEGA 4CIFA 3JTHA 4ZDOA 4OMZA 3O4QA 1OH6A 1Q9YA 2HEOA 4FSVA 2FMLA 4F55A 1GRIA 4FJGA 4AM7A 4CZFA 5AQOA 3PNTA 4FSXA 5KYXB 4BVOA 4CUGA 2AHQA 2KJCA 2DOEA 1A5JA 2MW8A 1W7PB 2QEXA 4AHCA 2ME6A 1TYQB 1M1FA 1O3QA 4JS5A 4DWIA 4AHUA 3PL8A 4PJMA 5IXBA 5GADJ 3NWTA 4BAYA 1HBXG 3WXMB 1QVGA 3C0CA 1Y71A 1K4TA 2E2IJ 2MI6A 1CXUA 2O8KA 4I7FA 4FJLA 1XQSC 2XRLA 2ROLA 2PQ8A 5C0MA 4XN0A 3KP3A 3RR6A 1ZGAA 1B9NA 1ETQA 4CSWA 3CCQQ 1ORNA 3DBHB 1HDPA 2HTSA 1Q81C 4UUSA 1IXRC 3TVTA 3I9V2 3L42A 2XC7A 1YW7A 3DRSA 1W4SA 1MBFA 3SFZA 4E6RA 3GF2A 4MLHA 4FQGA 4EMSA 1VQ5A 2OTJA 3DOLA 2ID3A 5HS9A 2GXGA 2OANA 1I81A 3U23A 1MKMA 4FETA 1HXDA 1MH3A 3EPZA 3GCMA 4PSXA 2MLKA 2OF7A 3MKDA 3SXYA 2K3BA 3QINA 3HP6A 2EB7A 4KGVB 4V19S 3WTVC 5BN8A 4DR5K 1C0GA 1XNIA 3CJRB 1IZ1A 4FM4B 4XSZF 2WY7Q 2HU9A 3FXKA 4ENMA 1YITQ 2HHSA 3E9LA 2PMUA 4YDUC 3OS2A 2P9LA 4U7BA 2DERA 4F52A 2XMFA 1U6ZA 1G3WA 4ZC3A 4A2AA 2DYRH 5HOOA 4BRNA 2ZXWH 2MMPA 2YHAA 3CBPA 5M1PA 1IV6A 3DI6A 4H5NA 1WHGA 1T33A 2R7SA 4E89A 1T6CA 1F36A 2FOWA 1WHUA 5ICEA 1YJWQ 3GL1A 2BKDN 4OAZA 1LOJA 3ZQCA 1N3CA 4LUEA 3Q9VA 3HM9A 1YI2Q 3EUHC 5EGOA 2RJEA 2COWA 3MECA 4DOZA 5M1NA 4DV0K 3L00A 1VQOA 4M41A 2O8FA 1VQKI 5KPTA 2WSCE 3CCSI 4R55A 5KN9A 4DF4A 2VJ4A 2M9UA 2CZ7B 4DU1A 2LSOA 4A93J 2HDAA 3E6DA 1N77A 1YOVB 2DXUA 1N8RC 5I21A 2EFNA 3PE0A 3TREA 3HPOA 2IS4A 4AFUC 3QIIA 5DY9A 2WUSA 1RLQC 1DKGD 1X4PA 3F0CA 2Z1HA 2IEKA 4CH7A 3RDIA 1NGAA 2JM8A 5HLHA 4BRCA 1F9NA 2W24A 4DTNA 2COBA 4CZKA 4ZN1A 4DSIA 4ENNA 3UR3C 1LJ9A 3V4GA 2KAFA 2A3LA 5FPMA 3ULEA 1JCEA 2PEXA 4F8RA 3KP2A 1SPKA 1M1KO 2X48A 2NOJB 1WFWA 3OW2A 2L4AA 1W1WE 2OUMA 2HQ5A 4FWKA 5EOYA 1D5AA 1N5ZA 1FBUA 3EHQA 3SQ2A 1SD5A 3F70A 2QYZA 1KG7A 4CF1A 3VWBA 2HBWA 1RBUA 4CEZA 2Y1IA 3TO7A 2OAZA 1QS4A 3DXKA 1WJSA 1YQLA 4E7LA 1TL3A 1OU8A 1VQ8A 5F04A 1IJJA 2MH2A 1O4XA 2A41A 3AVMA 1FMWA 1SEUA 2VONA 1GFCA 1YWOA 3VENA 4AM3A 1N5YA 3AAPA 2Q36A 1QCNA 4N4GA 5EC7A 3UKRA 1VQNQ 4BACA 2IPOB 3NGPA 2E1OA 2M4KA 1WSHA 1Q9XA 2VT3A 2PBDA 3LP2A 1X1DA 3C4SA 3ABMH 4KT5C 2WC2A 3CMYA 3E9PA 5IT9Z 2DL3A 2KLOA 4DNCA 2QSHX 1Z05A 4HUEA 1VSEA 2PMZN 3HBLA 4XRMA 1V3FA 2X6YA 3EE9A 2LNBA 3IQLA 4IXAA 2OTJQ 4BKXA 3T8TA 1D3BB 1ZLJA 3JSMA 3E19A 2CH4W 1LAWA 5F0FA 4M3TA 3LP0A 5F64A 3RMQA 1VQKN 4UY8I 2KGTA 4J9HA 2D6FA 3WG9A 3FHGA 4BGBA 4D5CA 2D0OA 4XH1A 1YUWA 5LJ3f 4CHOA 4BREA 2AHJB 1E7OA 1OYYA 2Z1DA 3MAJA 3BE3A 4JKCA 4BJTA 4M3ZA 1RT2A 3H9GA 3DKXA 5FU7C 1LPLA 3ONQA 2QA4T 4CGIA 3SZTA 2ZXHA 2LJ1A 2RQWA 1A6IA 2EPDA 3IMXA 3CBMA 1OFCX 4RTVA 4DEXA 3G4SA 1E3HA 4I98B 1QA6A 3N4PA 2MF2A 1VYVA 3PIOF 4CGZA 5AQFA 3DWLA 2CZ1B 5C25A 3UKRB 2ZKZA 3K1NA 1BOBA 3MWTA 1PSFA 2HVSA 4U87A 2XY7A 1VQ7Q 2HBMA 3SJJA 1JTXA 4DV3K 3CCLN 4B23A 1X3UA 4HT8A 4BXXJ 4ID1A 1XNRK 4E1NA 1S72N 4A0ZA 3THXB 2DBKA 2Y90A 3J7ZI 2LQ8A 3WVEB 1R49A 4TSXA 4I6MB 2FQ4A 4IIMA 1QVPA 2VC1A 1P7JA 2VJ5A 1WI7A 5KN8A 3UPUA 3CCMA 2V1DA 2AQFA 3REAB 2FPDA 4ILHA 2DD5A 1KXPA 1N8RU 2YNGA 2AO9A 4EDUA 4L5JA 2YJFA 4A5BA 3MEUA 5SWMA 3L1PA 3SYZA 4PL6A 2RKIA 2LX9A 1DLOA 2M9HA 4Y52J 3KZZA 5I11A 1USTA 4AMCA 2MGQA 3MEVA 5J40A 2X35A 3MJXA 2YHTA 1IB8A 3VQQA 3WGIA 3U8XA 2QM3A 3ABUA 2WADA 5JHUA 4Q48A 4F17A 4DFMA 5FKMA 3OS1A 2QTXA 1BO5O 4XRSA 1ABOA 2PG4A 3V8KA 1YYVA 2EWSA 4Q5VA 3LAJA 3VN5A 4J83A 4J2EA 1LDKB 4W1UA 4PJOF 2QWRA 4BC4A 5HK0A 3MX2A 1NG7A 3GMEA 2DTHA 1TK0A 2J7IA 4HVJA 1M1EB 2OD5A 2LDUA 4CEQA 2E8AA 2EQRA 2QTVA 3ZMTA 2BW3A 5IYCJ 3HTRA 1YX3A 1MUZA 2HD0A 3TO6A 2EVRA 3CC7N 4XU1A 2OJED 4CJWA 3TDUC 5A0DA 1QMCA 2MK5A 3HOYJ 5LJ3h 2L7ZA 2IGOA 1LFPA 5GJVB 3T8RA 4H0TB 4RTWA 2HVHA 4PJNA 3JYTA 1JLGA 3THYB 1GV5A 1IKYA 3D5RC 3CCUA 1RT7A 2Z5UA 1BQNA 2P81A 2ZJPF 3IC7A 1ZUYA 3CPWA 3BTCA 1KVAA 4KTWA 4Z8AA 1YVNA 1KAYA 4M7AA 1XC5A 1FYMA 4D8KA 2HHUA 4OGEA 5DPKA 4IIOA 2RD1A 2DTUA 1R1TA 4ENJA 3I55Q 3K4LA 1UJ0A 1HPMA 3VEZA 5ADXH 5LMNK 4MQ9F 3MQ0A 1SKSA 1CGPA 2OV7A 2EJGA 3WQUA 3CCJQ 2CQ7A 2A05A 2QZ8A 4DYQA 4ZYGA 2KLAA 4I6ZA 1H641 3CD6A 3NTHA 2F5FA 3RDVA 4XLEA 3RUXA 2KYBA 3QO9A 4M6YA 4FJ7A 1HD3A 1FZPB 3WXJA 5FU6C 2FEZA 4CGHA 2XRNA 1J3TA 2NRAC 2FZGB 1RETA 1WEFA 4P5NA 4PJLA 2IIMA 1BI2A 3TGNA 1EQYA 1SF9A 3QPSA 1ZG3A 2HS5A 4JZ4A 2QBYA 3RPQA 3MMVA 1TWFJ 2PX9A 4RWTA 1DTTA 4EJZA 3M0QA 2E10A 3ULEB 5GAHJ 4WE1A 1XNQK 1JU5C 1FY7A 1TKXA 3CC2N 2P9NA 2KT0A 4NQWB 2VQFK 2HBLA 2KRSA 1LQ1A 5DLQE 3KWIA 4F7UG 1UB4A 4O0IA 1WEGA 4JI2K 4X0GA 4ILJA 1S3XA 1WSGA 4LN2A 4AIJA 1IHWA 4A5MA 3QP5A 2ZGZA 1PRMC 3E6MA 4PK4A 2C6YA 3K4BA 1E6HA 3W2WA 4KGXB 4BXFA 4AI5A 4Q4ZF 5KYWA 4HF1A 1D8YA 2OQRA 2JPCA 4KN7X 3BDLA 2NVTJ 3J81E 4IUVA 5M5YJ 3VPZA 3ZQGA 5HRSA 3VV0A 2HPMA 3KK2A 1Q86C 2VN2A 4AFZC 3M8JA 3QEIA 2HWVA 1QVFS 2CYYA 3IH4A 3CJTB 4HLYA 3ZQFA 5DMRA 4ZZDA 3RTRA 3HHTB 1G83A 4EP5A 4ISGA 4OB3B 4DS5A 2E1NA 4CD1A 4KH5A 2HGCA 1FSHA 2HBJA 4JAXA 1WHJA 1HCRA 4DZPA 1U04A 3NGZA 1IBMK 4NB4A 1MMGA 1LOTB 4BY7J 1XC9A 1NK7A 4KBOA 1FOYA 3AVIA 3I33A 1KFSA 2RQQA 4CRIA 1RBVA 1IN5A 1IO6A 3AG2H 3I4PA 2DTOA 3RI4A 5I2MA 2ZJRL 3JRAA 2KISA 1YQRA 2ZE2A 3UIQA 3CD6N 4CCMA 2BDPA 5B5EC 3KNTA 4GW6A 4FYYB 3I3LA 1IO2A 4OLBA 4CCNA 3K57A 1Q1VA 2JS2A 1VQLT 3NFCA 3FZVA 3FJ5A 3NBPA 4OIRF 2DA4A 2HZTA 1ZN2A 3KK1A 2OZUA 4W5TA 1IG9A 3NF8A 4CZHA 3CC2T 3TAGA 3LLRA 3G6EA 3CCRN 2K4JA 1Q95G 1S72Q 3IWFA 2JGUA 3JAMZ 2E2PA 4M7DF 4XOTA 3ZSWA 1GFDA 3X20B 2P9SB 1V76A 3FXLA 1H1VA 2HQNA 3PNVA 5EJCA 3KP7A 2YWWA 3TR8A 4LOCA 5IN1A 3E6BA 1M3AA 1FOWA 4Z6YA 1TQPA 4EM1A 3O3HA 3EFSA 1QSYA 2ESHA 3Q0WA 2FA5A 5IWAK 3CCVI 1MBKA 4LLNA 2UU9K 1X9MA 2FRHA 1YFHA 2QLZA 1QBJA 5HVQC 4XKCA 2YHWA 2BANA 3P83D 2MYSA 1J0RA 3OYLA 4YHHK 1HA8A 2M3AA 2OPRA 2LYCA 4JP0A 2YG9A 1VA7A 3H3NO 2V8IA 2YUQA 3G4ST 2LP5A 3EGXB 3DPTA 2COYA 5M5WJ 4BC2A 1MUDA 4C8QA 5FDLA 4KO0A 2BIVA 5I22A 2RVCA 3K9KA 1SD6A 2DXTA 4J7IA 4L9VA 3PNWC 2NOGA 3AA4A 4ZNXA 2K5FA 5M1OA 4C3IJ 2D0NA 5IT3A 1A6QA 3VGKA 1IG8A 3ASKA 2P6TA 4AVZA 1S9EA 4DB3A 5GAN2 2BBYA 4WQ4A 3X2QH 2CGJA 3F23A 3TWHA 1JLAA 1C0WA 4KUDK 4EFHA 2VBWA 3S14J 2XAFA 5IOYA 2HFHA 3B73A 2ELHA 3CPFA 4HVWA 4X64K 4IXCA 4F92B 5BREA 3QIOA 3HSTB 1V29B 4DTPA 5LFAA 1SAUA 4FWLA 4NQWA 1YJWN 1XSVA 1KQ1A 3ZSVA 1XQOA 3LPUA 2X1EA 3EFOA 3GNFB 4IBNA 3ZL7C 2LKXA 3C12A 2LVMA 1JJ2A 5EGOB 4CZZA 1O1WA 2ZPBB 4NC8A 2VASA 3O2PE 4C0DB 3MWMA 2BY0A 4DQIA 4FE4A 4F16A 1HNVA 5KRSA 2QGUA 3DU6A 1L3UA 2H56A 3BTJA 3ZRGA 2CZ0B 5GAMd 4UQGA 3EY1A 2P51A 1QPIA 4DMNA 4OOIA 2L7FP 4M45A 2CFXA 2VYTA 2P9LB 4M78A 2ESWA 2XKPA 3FMSA 4YFKF 1TWHJ 2QK0A 1JI8A 4B9VA 1ASWA 3CCUI 3SWNC 2EGCA 3GLLA 3OGDA 1KHIA 1I39A 4NYNA 2HEQA 2NLXA 5FPDA 3ZBDA 5FLMJ 3J80O 4XTUA 2CUDA 1I3QJ 4J00A 2Z1GA 2BVMA 4E7KA 3CCLQ 4BGAA 5C10A 4XTYA 4XLFA 1X43A 4M4ZA 1OOTA 2P0KA 1NGGA 4MZPA 2R7OA 4CI0C 2GOXB 3EG9A 1MV0B 2XSJC 3CMMA 1Z6TA 3L1AA 1VQ9N 2X4JA 3EG3A 5AFUH 1FBQA 1LVKA 2L3PA 4HVUA 1ACMB 1JL1A 4WFAL 3I71A 2XROA 1BOTO 5D6WA 4IO9L 5EU7A 3OYBA 4CD3A 5L3GA 3LWIA 1YXQA 1UCRA 1R1UA 1EWRA 2K3FA 1ZR2A 3KLHA 2XGDA 2WFBA 1YW8A 3FK6A 1DGWY 1RTIA 3J7AO 1W0UA 1LEBA 1GHCA 1ZBJA 4N9IA 2LFBA 3HUGA 1JCGA 3VOEA 3PIPA 4L0YB 3TSWA 1SRMA 4ZTFA 4WFBL 2KDOA 4E9FA 3GOXA 1UWBA 1CLQA 4L59A 2V9VA 4FE7A 3RNJA 1QKXA 1SRLA 1WZOA 1X1PA 1ETKA 3K69A 2KMUA 4HYEA 3WTTC 3I59B 3VYSB 3TANA 3EUHA 4B44A 3SEMA 1NKUA 3CMAQ 2P9SA 3MN2A 3OMYA 3B6OA 3BY5A 4IZ9A 1TNTA 3HSFA 5J1RA 3VQBA 4A3GJ 4MO5A 3HOSA 4DUYK 3QPTA 3ALYA 5HK3A 4CF8A 1T98A 5IYDJ 1JXMA 1OYIA 1AWJA 3IWZA 4A63B 2KIFA 4Q5WA 4LLLA 2CV0A 2LY1A 4B08A 5FLXZ 1K61A 1HOMA 1HQCA 1IAWA 5GANf 3E0JB 1HNZK 3FXQA 3K0SA 1ZYRF 4IRIA 2VL8A 2JMCA 3ZQ7A 3JXUA 4YEJA 5AQVA 2H27A 4QS7A 4XK4A 4YNQA 3FFKB 3DBLB 4C0ZA 3JCMe 3UA7A 1IKWA 1MA9B 1Q7YC 4BY6C 2KPMA 4MFDA 2DOAA 3S16J 2M51A 4IDKA 4II3A 3SI6A 1M27C 2FUG2 3A98A 3EFRA 4CECA 1HW5A 4RAZA 4CHYA 4ZGEB 3FDRA 4QSHA 1WPKA 2FZKB 1IW7F 1PYVA 4C0DC 3P39A 2WAQN 3ME9A 3LW5E 4F14A 3KZIC 3I5UA 1NK9A 2HNHA 2QK9A 2HMAA 2CUFA 2FRWA 1XN7A 1K4SA 5K1YA 1ZK8A 1V5EA 3SB2A 2V8JA 1QVFA 2ZCWA 3H5RA 2GFAA 3PT9A 2VUMJ 5M3FJ 2JTFA 2EK5A 2B86A 5BPMA 2V1QA 4B47A 4A54A 1ULYA 1PHTA 4FLZA 1FLIA 5EG2A 1RUOA 1RAFB 4WCGA 1VSKA 3SZ2A 2F5TX 4YOWA 4H4OA 1NJIR 4KT6A 3GLXA 4UUVA 4NL3A 5AZJA 4KIGA 1XPXA 1OPKA 2E5NA 1PDNC 2EV5A 3BFMA 5D5XB 2Y4YA 2EJFA 4JKFA 3CLQA 4E7HA 1Y64A 5ADXA 1FT9A 5DM7F 5LL6S 5FKLA 4IRGA 1IKXA 2PJRB 4BQQA 4DTUA 3KEOA 1H3HA 3OSVA 4YOXA 4XNFA 1QVGP 2BY1A 2ATQA 3JCUC 2KZGA 1EH6A 4Z2YA 2X3XD 5EVZA 1JXSA 1YITT 2D1VA 1N34K 4KT0E 1XGMA 4K0KK 3ZSXA 1LKXA 1ORKA 4CEEA 1WSUA 2NOBA 1X1AA 1PVSA 1L0OC 3HRTA 3EGUA 3CCQI 1T3LA 2BZYA 3FXUA 3GVAA 5D3GA 4BG9A 2LK2A 4CJEA 3FIWA 3BZKA 4XH4A 3K10A 1VQNI 2GQVA 2G8WA 3S32A 1HJOA 4YOVA 2DYBA 4BWJA 3QG1A 1FJLA 4II2A 3BJ6A 4XQFA 3CCVA 1XC3A 5DM6L 4LFBK 2DJZA 1XGNA 4G7ZF 4BG8A 3GTLJ 3CFPA 5BMZA 3C7JA 3SDGA 1HMVA 3G1MA 4W5OA 4CYDA 1O3RA 3A5NC 3IKMA 1NGNA 5CKTA 1GLCG 5KPZA 2NVQJ 4FL6A 2IA2A 3OYNA 1KG6A 4PZJA 1SEMA 3TW6A 3H5NA 4KHYA 2M45A 1IC8A 1BIZA 1ERDA 1YQKA 3G6EI 2MPXC 1RFQA 5LJWA 4PCQA 1WKMA 4JOMA 1VRLA 1VQ6Q 4K25A 2FF3B 4RS8A 3SNNA 4EIAA 3FM3A 1J53A 4PJ0C 4LJZF 2V6CA 1X9JA 2J6KA 3M5AA 3W0LA 1XGSA 3IAYA 2AK5A 5J2PA 1HYOA 3V7CA 2VG7A 1BC8C 4R5PA 4RGXA 3AV9A 2QXLA 4ITVA 3K6GA 1VSJA 4Y1CA 3RZOJ 1GT0C 3AO5A 4XLCA 5JLHA 2NWMA 4PFPA 4FX4A 2ZO4A 2A36A 1YJ9I 2JMAA 4JLGA 4CJRA 3URGA 3Q0VA 2L4MA 4CZGA 3CJCA 1GOBA 1RCHA 3OOUA 4JZ3A 1WDXA 4EMKC 5AQYA 2XF5A 3C2GA 3DEEA 4LFAK 5KGWA 1AKHA 1ZAOA 3RMSA 3QEXA 2VT2A 2K86A 5GAOn 4H0XB 2CSQA 4PQUA 1PJRA 2H3EB 1SVMA 1M90U 2XHBA 4DU4A 3AAQA 4BH9A 4B9NA 5GAHP 5GAMh 3LSHA 3QOEA 2GIZA 3H5AA 1K78B 4DLGA 2QKMB 3CC2Q 2YUNA 1MV3A 5DTDA 2DMUA 3M0PA 5KRTA 2KRCA 4PLIA 2JZYA 3L9FA 4ETSA 3CCLI 1KYWA 3G2BA 4FISA 3F2KA 4RB2C 1ACIA 5HRPA 3ZCMA 2ZCFB 3QPLA 2K7LA 4M3UA 3H3VK 5BR9A 3R61A 1S1XA 1RESA 4PWDA 4HWIA 2VGMA 3L2VA 5D6YA 2HYFA 5JMVA 4UVCA 4A3JJ 3O9RA 1UHFA 3J81K 1X3NA 2K9NA 1WSIA 3FHZA 3CC2I 1BJAA 4N0AC 5DV5A 2YKMA 4KH6A 1Y96B 4HBLA 1Z9QA 2YCHA 1T3VA 1T95A 2KZMA 4ELTA 3V42A 4CIEA 2V79A 3TOAA 2HB5A 2KIUA 4Y3OA 4AIDA 2RF2A 1D09B 3LDPA 1AEYA 1O7FA 1WXBA 3FKIJ 4I02A 5GTIC 5F27A 4OB1B 5E84A 3QB0A 1WGSA 2YU9J 2Z1JA 1R22A 1DGRM 2R7VA 2IPQX 4LDVA 3ZX2A 2O2OA 1YJ9Q 3MP6A 4Z94A 4LG0B 4H0EA 2P8TA 1U9OA 4MDBA 4M7DE 3SQNA 1YQMA 1ENHA 1QRYA 3FBNB 4U7DA 3PIPF 3RSEA 2ZNYA 2YPRA 3EGXA 1WA7A 3OR1C 2DL5A 1GLDG 4BC3A 4JI0K 4X1VA 4CFAA 2E1MC 2DEUA 1WAFA 2X6WA 3OVNA 1PCXA 1ZBSA 5EEHA 5BQTA 3QESA 2KZVA 1VQ6I 1R77A 2FPEA 1TWGJ 1I1JA 4QPQA 2DF6A 2DL8A 1S7AA 2QWWA 5DS9A 1YS6A 2BEOA 2HOAA 2CH5A 3FZHA 4QCLA 4A6EA 4CJKA 4F93B 2F2VA 3M8SA 4HV6A 4EIKA 3M59A 2P9UA 2ZWHA 2KFZA 1Z67A 4GY2B 2BGCA 3C6AA 3MD2A 5GAEJ 3AG4H 4M75D 2KIMA 4P55A 4G9ZA 3VEWA 2YLBA 5BRHA 1R23A 4C2MJ 3SUQA 3LH5A 4BYYA 1S1NA 4P9UA 3WVDB 4DFJA 4E7ZA 4OKJA 4L6V5 4G6QA 5FWBA 4CJTA 1W5CC 4HDVA 5CVUA 3KKSA 5FFXA 1QWEA 5KAFC 2O88A 1OCPA 3BWGA 2J6OA 2CP6A 3JS6A 1EXQA 2F5CA 3BZCA 4E1MA 1BI4A 4WCEL 1FBSA 3HOUJ 2LT1A 2ICWG 4XR6A 4ZYDA 1HYVA 3J7ZO 3DU5A 4CEOA 3AL0C 1RI0A 1TT5B 5ICFA 2RC4A 3IHOA 2E5QA 3CCVN 1D1BA 2OU2A 1PU8A 5EDNA 3G4SQ 3EL2A 1ZLMA 3V9UA 5GAGJ 4MIMA 1X3MA 2LKSA 1VQ6T 2E6ZA 3CCJT 4IQJA 1A0NB 5CLSA 3ZX0A 2NOIA 2DFUA 1PVEA 2AKLA 4BR0A 3FXOA 3CF2A 4ZGDB 4NXNK 2IA1A 3O1BA 4XICA 2ID6A 2EJRA 1IV0A 2FXUA 1ZA2B 2ZMEB 4N4OB 4V2SA 1EH7A 1OX8A 3FISA 3I5SA 1NK4A 2V26A 3KLIA 2DETA 1UMQA 4JV5K 1AD5A 3JCMh 1T6DA 3CYMA 4UB6C 4IHWA 4BBRJ 3JCMW 5EXWA 3ZYYX 4LD6A 1WJDA 3KLOA 4JK9A 5FRNA 4P9FA 4FJJA 5GAOq 5CVIA 1HKQA 2F2EA 3NMZC 2G7UA 2W10A 3THVA 1VQLA 3ABTA 3EH2A 2FXAA 3OYMA 2PFBA 4JLIA 2LREA 4BD3A 2WBMA 1Y0NA 1ZBUA 2ASOA 4HT9A 2B0LA 3FXRA 3S6IA 4KREA 3OMCA 3DXKB 4GRIA 1Q18A 2OCCH 2O8CB 5GANd 2H94A 2F9WA 1QVFM 4UNOA 3W2AA 1ZYQA 4EA5A 2DIQA 4H4MA 1Z6RA 3P9KA 2HNIA 3GFLA 3BLYA 4RMNA 4CJ3A 3ZEUB 3OYCA 1UE9A 3VQCA 2A42A 3ASMA 1U5TA 4C0GA 3CUQA 1WAJA 4IFVA 2TRTA 4HEA2 5C42A 2DILA 4DYRA 4UV9A 2D5RA 2E1ZA 3THWA 4RM2A 3E5UA 1HYSA 1NKBA 2E1MB 4BRGA 2JWKA 5A2QK 3P8DA 4JRKA 1PRLC 1K8AU 4FXDA 4MZMA 2FJ1A 2O6GE 1KG4A 1YJ9T 4IPAA 3JSCA 1DP7P 1JRIA 2L3QA 1KQ0A 2FBXA 3K1PA 1SAZA 5CQGA 1I1SA 1HQEA 1EP4A 2IAJA 4EA4A 3KE2A 5JR3A 2M1HA 2LDMA 1VQNA 4YIIA 1OJLA 3H46O 4IOCL 3GFJA 5IP9J 4RLFA 4OPHA 4OPJA 4PSWA 3DM2A 2CRGA 4NOYA 2IG0A 4I76A 2Q2RA 4DG1A 1RAEB 2KT8A 4JD2A 1MD0A 3MEEA 3KIOA 1PD0A 4WQ5A 3LPTA 1TUYA 1OMIA 2BZTA 1E3OC 1P90A 1HUXA 3EUAA 1VQ5Q 1J9IA 2GA1A 3JB9H 3E9FA 2K9QA 2AXLA 1M3CA 2HQHA 2X74A 5JI6A 2OFKA 3I55I 1B07A 1D1CA 3H36A 1DP3A 5BN9A 1TBXA 3SV4A 1YT3A 4I0BA 1T7PA 4J8OA 1VQ8I 3JRZA 4ELYC 1MJAA 2OTLQ 2OTLI 4FJIA 4RW9A 4M77B 2M4GA 2QF7A 5FKNA 1FN7A 3GFMA 5CIUA 1JLEA 4PKCC 3QZ5B 3BF3A 2Z99A 3ATUA 4M78C 4JYAK 4IOCF 4KTZA 1X6BA 2D8HA 5FU7B 2RHKA 4KMUX 4OVAA 2OFIA 4E9EA 2K9LA 2NLUA 2V9PA 1XSXA 2M0CA 2HDWA 2M5WA 4GXOA 3FDYA 5LJ5j 1WGXA 3BG7A 4IHXA 2JUFA 3F8FA 4K8XA 4O5BA 4CJVA 1S5JA 3QEWA 2CW7A 1ZSZB 3QUIA 2VBYA 4XMYA 4EJVA 2VKVA 1HKTA 3O4WA 3NF6A 4YTLA 1TAQA 4A57A 3CO7C 3LSPA 3DKWA 2RK1A 2HOEA 2FLOA 1VQ7T 5ELZA 4F91B 4A0XA 2OZ6A 3FX3A 4DKWA 1N8RR 3DRRA 3NMUA 3CJAA 1RAHB 5B1AH 4B3XA 3U1DA 4AT1B 4CCHA 4JI7K 4IOXA 3GX4X 3W3CA 1IXDA 3R0JA 1BA1A 1ZBIA 1WWXA 4OB0B 2E5ZA 2O8CA 2VWKA 3UATA 2P6SA 3CWTA 3WNEA 2HKXA 2XB5A 3LDNA 1ZHFA 2DN0A 2NUBA 5HDKA 4GV6A 2RDPA 5AZJB 3VDXA 3G7ZA 2WONA 3AFHA 1D3YA 3RZDJ 1YCSB 1Q82U 1U49A 3AVNA 3IHUA 4OMMA 1JGGA 2GAUA 2NS8A 5GAMg 1YS7A 4RUGA 3SQ0A 3LH0A 3OYGA 4A3IJ 5KQ8A 4TVRA 1J54A 2LBFB 2XICA 1KQSM 2HHXA 3QJ6A 2M02A 1Q82C 3FWEA 5JHFA 3E9GA 1K83J 3BR0A 3HZ6A 3M8QA 4IO8A 4CCKA 4RB1A 4NXMK 2BE9B 4KA4A 3AA2A 4RG8A 3TAPA 5CK9A 3MCPA 3REOA 3TO9A 3RPUA 3C0BA 4D7MA 1Z3YA 4CJ4A 3ATVA 4J2BA 3MEGA 2JUGA 4DR2K 3CCQA 4RGSA 3NCIA 1U1TA 3TDZC 1RC9A 3HOXJ 5EX5A 4BRKA 2J5PA 2VVKA 1KD1C 3QNNA 5T7BA 4HNUA 4ENKA 4RLQA 3A4CA 4ZN3A 1RT6A 4BRFA 1I6HJ 5E18F 4OMOA 1MZBA 1K8AC 4Y1DA 1L3SA 4XONA 2HVRA 3MXIA 4LF5K 2JUCA 3CMAN 2W6KA 2YUOA 4B09A 1VRUA 2XPWA 2BGGA 4EEFG 3FZKA 5I2SA 2DRMA 2FBIA 3OJUA 4M7DD 2PYJA 1OCTC 2DA5A 5IH2A 4OPKA 3EUKL 4FT4A 4MDWA 2VOPA 3I55T 1RDCA 3KTUA 3CUQC 4RTTA 3PUFA 1VQNN 3PFSA 5KYYA 4LDWA 4N4NB 1P6RA 3E66A 2RNJA 1S72I 4LB6B 2PUOB 1DJ7B 2B63J 3IAM2 1F1ZA 2RPNA 1VQPA 2CGPA 4B9TA 4DTJA 1YTYA 1XWLA 5GANh 1I1GA 1HKGA 4E6KG 3A8OB 4WWCA 3RVCA 1HLUA 1ZC6A 1ZARA 3BJAA 5KVRA 2P9IA 2YV0X 4DR7K 4HX4A 3DCFA 1NLPC 1JO8A 1I3AA 4OF1A 4OFEA 2H09A 4LG3A 4D0PA 3ENHA 4RAFA 3G6EN 3OYYA 1RKTA 3ZR8X 2AT1B 3H0FA 2VG5A 5A2QZ 1N39A 2P84A 5LJVA 3KHYA 3HK2A 4MLEA 4D8DA 4CCLA 2E4LA 1HX1A 2R7ZJ 4Q47A 1CQTA 2RO0A 3IL2A 1YI2T 1EH8A 1U4BA 2XB0X 2DFFA 1XDSA 1ETYA 1AVZC 4Y15A 3N4QA 3DLRA 2NUTA 3GTMJ 2QWPA 1AA7A 4AIKA 1PP7U 4B24A 3ZETA 3WEEA 3CQYA 1W5TA 3VGLA 3CCET 1M1KU 2YU3A 1ZSZA 3FBIB 2PBIA 3CC7I 2NVYJ 3SJHA 4NO7A 3M0UA 2H8RA 1RAAB 3M58A 2HOSA 3P5JA 5D6FA 2KL4A 2O9LA 2F5EA 5C3EJ 2IVNA 2PZ1A 3QPHA 4L0ZB 2EA2A 3FHNA 5KPRA 3N97A 2OPTA 2UXCK 3V1RA 3K70D 2ZJ2A 3ZT3A 1JB0E 2KQRA 1NOYA 3LA2A 1O75A 4B9XA 1S1UA 2DZCA 1C6VA 4ELVA 2OC6A 2P9PA 4HF0A 1KC8O 5AZIA 1QTMA 4NUBA 3MWPA 1U2WA 5GMKm 4JKBA 3RYRA 4C8QC 1J9AA 1SAXA 1OEBA 4MMLA 3MPUB 2L89A 1AZGB 2DRKA 2RGVA 1VQKA 3DV8A 3WTXC 3HM5A 2E88A 1S6QA 1P4WA 1BBZA 4FL9A 3MXJA 2ZXIA 2O8DB 4RW6A 1QWFA 4BVPA 3DB4A 4MO4A 3QNOA 3A2FA 3RQIA 1RR8C 2VQGA 1T8IA 3D2FA 5GAN8 4IURA 1TK8A 2F7TA 3FZLA 3ESWB 5CKDA 1I94K 3TU4K 5LGTA 3OIQA 5AIPA 3OSFA 1NK8A 2DT5A 3HSEA 2QXFA 4OLAA 3HVTA 1LMZA 1IN8A 3CCVQ 2O3FA 3H0HA 4PFZA 3PV8A 3ZXSA 3T3FA 3F73A 3O3KA 3I56N 1S1VA 1SG5A 1BUPA 4BQZA 3K4MA 4M7AG 2ZPFB 3SK3A 1FTTA 4BQNA 1NKEA 1ZBXA 2K27A 4RGUA 4KB0A 2W03A 3CVTA 3VS5A 5KCOA 2P9KB 3BR2A 2D1HA 3A01A 1S72A 2DAQA 2XAQA 1YIJN 3HPGA 1SD7A 1K9MR 3HBTA 2VYPA 4PA1A 4KV8A 4H8KA 1M90O 4U88A 3I8BA 4FK2A 1BC7C 5LD2C 4DW6A 2IGKA 3QMLA 3F8CA 3J80E 2HSPA 2A07F 1QVGS 2AQEA 3AVAA 1HW1A 2D0BA 4I6MA 2I5UA 3VQ4A 3SLCA 2DMQA 4BJ5C 3R4KA 3QBXA 2BW3B 2ESNA 3WT0A 2GA2A 1O7LA 1NK0A 3A5LC 2VQHA 4KHSA 3K4KA 1XMQK 2QBYB 1HPZA 4J01A 1B4AA 2VPLA 1XG7A 4OFAA 4AH9A 2XAJA 3O4NA 3ZSQA 1KG3A 2WAEA 1C0MA 1XOVA 4ESJA 1WIEA 2QA4Q 3MX5A 2NOHA 2MIOA 4HG2A 1LPQA 3WE3A 3M53A 3VTIA 3H0DA 2JT1A 3F0ZA 5JVGF 3I0SA 1R71A 3FRNA 1PC0A 4IUPA 1BIAA 2L0AA 1VQPN 1PUFB 2KRFA 3H9JA 5HODA 3VODA 4MFEA 2HDDA 1H8AC 1HRHA 1VAZA 4A4GA 2HBPA 1TKZA 1OYWA 5J3LA 3X28B 1R36A 2XF7A 1VQPI 3TQNA 4M78D 4C8QG 3PQJA 4A3BJ 4A5NA 3CC4I 2ZFUA 3EH1A 1HLVA 2BY2A 3CF5F 4V2FA 4E7JA 1K73R 1VNDA 4HX7A 3SWNB 1LB2A 2P9UB 4M75G 2H1KA 4EPCA 1M8VA 4YOQA 3QERA 1E0EA 1E2XA 3HUGB 1IN4A 2HMIA 1LWYA 2L3RA 4DSEA 2GIVA 1MU2A 3JB9I 3CPWP 4FWNA 2ZF5O 2HBKA 2YX4A 5IAYA 4IF4A 2EFOA 3WHBA 2QWMA 4E0DA 4Y7NJ 2Y0MA 4J5YA 2K3XA 4PLLA 4CGFA 4Z88A 2DPUA 3M8EA 3TAEA 4C92D 3WTWC 2LG4A 3ABLH 4DQ2A 1AWXA 4Q5SF 4O55A 1QHAA 4B1YB 3P9CA 4EHTA 1BU1A 1VIFA 5AONA 1U78A 3H6ZA 4ZZLA 4DSLA 1LWWA 1KQ9A 3OH6A 4AI4A 3I0WA 3ID8A 4YFUA 3ZSYA 2WSEE 3TOBA 3GEZA 4J6WA 5CJ9A 1SL1A 3JB9F 1D9DA 2W40A 1T0FC 4M63C 3HYFA 3CCJI 5KCHA 3QOPA 5M1KA 3H1CA 3BUZB 3HSCA 3NTIA 2GCXA 3DXJF 3FHFA 3OBWA 4GBQA 2KJBA 4WTOB 2EIMH 5GMKl 1HYZA 1OULA 1WHHA 3LNQA 2DLLA 2WB1N 3E1SA 3K58A 2PVOB 1P4AA 4F4KA 4XU2A 1VQPT 5AN4A 4K43A 2DD4A 4J9FA 2UXBK 4K11A 2IW5A 4JLHA 2ITMA 3JAMK 4MDAA 1EZZB 1C1BA 2EWNA 3DBRB 3LP1A 4PNOA 1W2BS 1VQ6A 1WLPB 4XBFA 1VQ4T 3V1OA 4Y28E 3WXLA 2E6NA 2VC8A 2EINH 3A1YA 1TZLA 1CZBA 4Z4CA 2PUKB 3F9MA 5CR2A 4EP4A 1HW2A 3CQZJ 2FYKA 3AO2A 2KBTA 2KDZA 4CZLA 2F4OB 1ITGA 1WFXA 4EGZA 3JCMd 4M7AC 2HVQA 1VSHA 3CETA 2L2PA 2LD5A 2V1XA 5IT9K 4C92E 1JCFA 2DTIA 2E2JJ 2ZPHB 1Y56A 1S7OA 2WTEA 3WODF 3U3GA 3ZQQA 2E2NA 4F3TA 1KAXA 5KYNA 4K41A 2Z0WA 3CPWS 2ELJA 1ZX6A 4X65K 3BQZA 3KK3A 4LDUA 1UGSB 1WJAA 3L2WA 1PU7A 3CCEA 1U06A 1YHQA 5IP7J 5J6XA 4F04B 4C5HA 3J81O 4RCCA 1RGIA 5HCKA 5AQJA 4M7DC 2E2HJ 1B92A 4C1NI 5LRRA 2FBTA 1VFCA 1H92A 3CIPA 2DMPA 2V1RA 1BIUA 1EKEA 4CA0A 4FOEA 1GXIE 4DSJA 2EZLA 3M8RA 2NOLA 1EFNA 3QU3A 2AZVA 4F7UB 4UC4A 4M3YA 4BNCA 2KNBB 4FOIA 4KHWA 3NH0A 2HHQA 4K42A 3TAMA 2DVEA 5LMUK 1LWCA 5D4SA 1WYXA 3UKGA 3RMBA 4QS9A 2ZZDA 5J8FA 4KI6A 3HOZJ 2DY4A 2LTOA 2E20A 2LJ3A 2DDAA 2HCKA 1K9MC 1PUEE 1TC3C 2KYMA 2DO3A 4JRIA 1G3SA 3H3OB 4Z4GA 4W5QA 1KU3A 3CC7T 4FIBA 3LFKA 1OX9A 5LBQA 1X69A 5GIPA 2HF4A 3E3VA 4S05A 3CDLA 3VGMA 5D7UA 2MG4A 3ZX3A 1QQIA 2RQUA 3B6AA 3DLLA 1SVLA 5C15A 2CSOA 3LYIA 1TTYA 1XD7A 1ORPA 1TWAJ 1WRJA 4PJOE 1WJBA 4E2FB 1JLBA 2VCPA 3U3YA 2ISZA 5DM7R 1N9SA 1ZKGA 1PKSA 4JX5A 2MC3A 2K9MA 1IRGA 1Z3XA 2M8EA 3ZGKA 5CR4A 4CC4B 1BOAA 2EQJA 3GZNB 2V4JC 2D5VA 4DV6K 4BU2A 1JXOA 1WJFA 3GTPJ 4CYCA 2H6CA 1ATSA 3PIOL 4JI4K 4M3WA 3NF7A 3RMDA 3IV5A 1JKHA 4M78G 2QTDA 2JQ7A 2CP5A 3SEZA 3CCEN 3HRUA 1F43A 1BI3A 1X1BA 5D5VB 1C0FA 1TUDA 3CW7A 2RNAA 1MW7A 1N25A 2OPQA 2F8TA 4M9XA 4XRSG 5BOXA 4CF9A 3HPHA 1A36A 2IS3A 3DRPA 3CBOA 4EJYA 3HPWA 3VSLA 5FKOA 1JUSA 4M3BA 2G8IA 3OYFA 3ENBA 2JTVA 4B3SK 1M8MA 3R1XA 3BJOA 3S93A 5LEJA 1EBMA 3BGRA 5FFZA 3KX2A 3RSNA 5E3NA 4J6YA 4DOVA 3P4IA 3G6EQ 1XMOK 2X1DA 3QODA 5DM7L 3S17J 4NCGA 1QSLA 3GO5A 2HL3A 1T39A 4C92G 3J7YJ 3CEYA 1IF1A 1M2VB 1YQAA 3KP4A 5M5XJ 1VQMA 1OCOH 5AQSA 2VKHA 1B72A 2MOXA 2HYJA 3EG2A 2PVGB 2IGNA 3TI0A 3CMAI 4PJOB 2RJFA 2HYGD 3VSKA 2P5VA 2GLOA 4DQRA 4JX6A 2D9TA 5EZHA 2XHIA 3HKZN 5A2QE 4MLOA 3MVPA 4R0KA 3A8YA 2E7WA 5EEAA 1QZZA 5AQKA 1QKWA 1ETWA 4B21A 5TKYA 5AQZA 3BZ6A 1W2BP 3HRGA 4DV5K 1M3HA 3FR0A 3C95A 2I5WA 4GKKK 2YHBA 5FO5A 3AVKA 3ULRB 2DL7A 2FO0A 3AVCA 1MDMB 2HDCA 3D2EB 2R5AA 2A6AA 3BEXA 3AHUA 1WSJA 4DGWB 2F1LA 2XU8A 4CFCA 4E19A 2QA4N 2QKBA 2RQTA 3DXMB 4LD5A 3S2WA 3EFOB 1IREB 4BI8B 1LEAA 3HP9A 1ESVA 3A8LB 3CJ9A 1E17A 4E9GA 1Z25A 2A37A 3WUHA 3RWUA 3PFYA 4QOZB 2BY3A 3BTIA 3L2UA 2MCNA 2AKKA 3CCSQ 3G71N 4PJOC 4BBSJ 4M9ZA 1QHGA 1M9SA 1CF7B 3VQ6A 4CF0A 2FZCB 1IJWC 2A6HF 5IOZA 4HQEA 2GTJA 3BPVA 1GLAG 4IJAA 4KMFA 1MNMC 1R8OB 2W6LA 3A0HC 3QYEA 1V4SA 2P5GA 1A31A 1AWWA 3PNYA 3DAWA 1QU3A 1HNWK 3H9QA 4F9OA 2F48A 3GYHX 2EKHA 4OGCA 3M3YJ 2L3SA 1NNEA 5B8HA 4OX9K 3NFAA 2Z3YA 3M56A 3M4GA 3ZOBA 3A8HB 2E19A 4OPAA 2XGXA 4E70A 5KYYB 3G25A 1BG3A 4VUBA 1YLFA 3TP3A 4M77F 1XGOA 2R7WA 5ECAA 4NYFA 2F4IA 3P9IA 1REVA 4FLWA 3REBB 3VS3A 4YFXF 1NG9A 2E1CA 3CPWM 3RR7A 5CPRB 5J1YA 4FT2A 4N4HA 1KFDA 2DODA 1UEBA 4M77E 2ACJA 1IG7A 1TH7A 4XAXB 3LSRA 1NMNA 3PY8A 2MD5A 2W04A 1I8FA 1JJ2M 4EJWA 5CKFA 3TSQA 3RCOA 3G1LA 2QASA 2NS7A 2FG0A 1S9GA 4A0YA 1MNEA 1ZG5A 3I55A 4KHPK 2HQXA 4DU3A 4ESFA 4P96A 4ABZA 1TLHB 2FBHA 2IP2A 5ILUA 1QZ5A 1WLJA 1Y57A 4F3QA 1NGFA 4PJJA 3QWYA