4BDYA

Pfv intasome with inhibitor xz-89
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
molecule keywords INTEGRASE
total genus 110
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bdyA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4bdyA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4bdyA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4bdyA03
3HJFA 4IG3A 4H4MA 3QEIA 5CZ2A 1W9HA 2FBXA 1S9GA 3HP6A 1NK8A 1NJXA 4J2AA 4CEQA 2HNDA 1L3TA 1J54A 4E7JA 1UA1A 4X34A 4B3OA 5J2QA 5CYMA 2A1RA 1RT2A 2JLEA 2HHXA 3VQ8A 4CJTA 4CF1A 4CK2A 2E4LA 3V1QA 4B9UA 2X35A 3CYMA 4HCBA 1S9EA 4E7HA 2RHZA 2QK9A 2FBYA 3EZ5A 4CJ5A 1SKRA 2EX3A 3DMJA 2HHQA 3I0RA 3AO2A 5FDLA 1WSGA 3DRSA 2XY7A 3HPGA 3PX0A 2PY5A 2RJDA 3M9QA 1JLGA 1OYXA 2FC0A 4OJRA 4C8MA 1L5UA 4CCHA 3MEEA 4FJHA 1N27A 3AA5X 5J39A 3DRRA 4BE2A 1RT3A 3PX6A 1L3UA 4B9VA 1RI0A 5IAYA 1WSEA 3LANA 4Y1CA 3LGLA 4B8CA 2G8KA 3TAPA 2QQSA 1NK7A 4EDUA 2XY5A 3P1GA 3S3OA 1XNIA 2GFUA 4CHOA 2E6NA 3AA3A 1TKZA 2HB5A 3RMDA 4N47A 2QQRA 1KVCA 4ZHRA 2EQKA 2L3RA 3VQ6A 4OKEA 3VQCA 3E9FA 3QNOA 1Q9YA 2KZMA 4W5NA 1OZ3A 1NK0A 1EXQA 2ZE2A 3M8RA 2KFNA 3UWNA 4FJJA 4CHQA 3SJJA 4M3WA 3ZSXA 1D8YA 4NCGA 2FBVA 4NS5A 3M8PA 1BQNA 1SL2A 3S3NA 1ASUA 3PNWC 3WNGA 4LSNA 1NKEA 5KTQA 1WSHA 3AO5A 3KKSA 4N76A 5FROA 3LPUA 3OYLA 2FHDA 4DLEA 4FLXA 3MEVA 1BIUA 3NE6A 1SV5A 4FJXA 1WAFA 4H8KA 4ELTA 1O1WA 4CF9A 3OQ5A 4JRQA 4Z02A 3OYKA 5D6YA 4AHUA 4QQGA 4IG0A 4A4GA 4KFBA 4FJLA 3E9GA 4NYFA 4O0JA 3QNNA 3SV4A 1KLMA 1TKTA 4Z4EA 1JXBA 4KHYA 4I9QA 1WJSA 2HW3A 1CXUA 3QO9A 1G5VA 4BDPA 2RI3A 1JL2A 3ZSRA 3LDSA 4Y1DA 2QKBA 1RTDA 1Y97A 3RTVA 3P8HA 1SKWA 3LWLA 1JXEA 3OMGA 1HQEA 1HRHA 3C95A 3V1RA 1KFDA 3MP1A 1TL1A 1UOCA 4N5SA 1TKDA 3HP9A 2O4XA 2FBTA 4OLAA 2YV0X 5IN1A 3IG1A 2D9TA 1Q8IA 3S9HA 2PYLA 1JL1A 2BIVA 1QQCA 2VG6A 1TK0A 4DQIA 2RHUA 2L89A 1Z25A 4B9LA 1C1CA 4PWDA 3AVBA 1HQUA 2IOCA 2GBZA 3AVFA 1FK9A 3T19A 3TAFA 4IFYA 3D0PA 4F8RA 2YNGA 2YKNA 5HRPA 2GFAA 3SPYA 4QQDA 3NAEA 5D3GA 4OPKA 1VK0A 4CEEA 4CK3A 3MEWA 1BI4B 2R5AA 2YNHA 3LZJA 4RW7A 4CGFA 4QAGA 5HRRA 1QE1A 3NDKA 1GOAA 4FCYA 2X4YA 2IG0A 2OZMA 3OA6A 4IDKA 2M0OA 4H4OA 3VQ5A 4CJRA 3K2PA 4NCBA 3H6ZA 2OZSA 3NTKA 3LH0A 3JYTA 3K5LA 3ASKA 2W42A 3TAGA 1IG9A 4ELUA 3MEAA 4FLVA 4FJIA 4BE1A 1IKXA 4CEAA 4I9LA 4YNQA 4EZ9A 1S1VA 3V9ZA 2PQWA 1RILA 1RT1A 3ZSVA 5KE3A 4CGIA 3HXMA 4AILC 4QW2A 2DFHA 3VA0A 2WACA 4DSIA 3OVNA 4Q5VA 4IKFA 3DOKA 4HTUA 4JS4A 1X9WA 3PY8A 4F3TA 1JLAA 4IBNA 1T8EA 1I39A 1DLOA 4IURA 3MEGA 4LSLA 3VQ9A 1N6QA 2PZSA 3TWHA 3LP1A 5C24A 4F4KA 2XY6A 1U49A 3MXIA 4DSEA 2DIQA 4TSXA 3OY9A 1DTQA 3T1AA 1OI1A 3FEOA 4RW4A 1R0AA 1B9FA 1LWFA 1BHLA 1WJQA 1GOBA 4ID5A 4Z0UA 4HHTA 2RJCA 2E6LA 4FZYA 3PO5A 4FJKA 2IAJA 1BI4A 3E01A 4LY7A 4OKJA 1NK4A 3PV8A 3CG7A 3ZSWA 4DFJA 1IKVA 1CXQA 1S6QA 4IUVA 4FLTA 1YTAA 4RW8A 3SD4A 1VSLA 3KD1E 3RRHA 4PLIA 3GOXA 4DTJA 2K3XA 3CEYA 3JSMA 3LZIA 4NCAA 1FKOA 3IS9A 1NK9A 4J2EA 1JLCA 4M3RA 4DS5A 1FKPA 2HVIA 3V9XA 1S1XA 3RMBA 4QOZB 1C6VA 2DY4A 3ALYA 3ZEHA 4DLGA 4FZZA 1XWLA 4OVLA 5C0MA 1JLFA 3SUOA 2OPPA 3TI0A 1KTQA 5KGXA 4DWIA 4DTMA 4DG1A 4BD3A 1D9DA 1UA0A 4FJMA 3NF7A 2X6NA 5KI6A 3QJ6A 4A4FA 4FJ8A 2Z1HA 3CM6A 1SSFA 4W5OA 3MAQA 2RHYA 4BWMA 3OS2A 4JRPA 3QBYA 4L59A 1KSPA 2EFIA 3NTHA 1KVBA 3HVTA 3OYAA 3O4NA 4KKOA 3RMAA 2YNFA 4KHWA 3SV3A 4FK0A 3K5MA 2CKKA 3BGRA 4AHRA 3O3FA 1SL1A 4FVMA 2QXFA 1QTMA 4FJGA 4CEDA 5J1EA 3NCIA 1REVA 3AV9A 1TVRA 4K8ZA 2KFZA 4C5EA 1S6PA 2HHVA 2YNIA 4FL6A 4FLUA 2RJFA 3B6OA 3VA3A 5KCOA 3P8DA 3KLFA 4FK4A 2AJQA 3DB3A 1C0TA 4FLWA 4DQSA 2KQ2A 4J2BA 4CHYA 3AVNA 4DTXA 4QQ6A 4CJLA 3M8SA 2D0CA 3P5JA 1QHTA 3KK1A 1RT4A 4HUEA 2VG7A 3SQ4A 1VSJA 4M3ZA 4CGHA 3MECA 4B9NA 4IUQA 1WSJA 4FJNA 3NTIA 3NGYA 3L42A 5FRNA 1RBRA 3QINA 4DF8A 2G8VA 5SZTA 2RI5A 3VQBA 3DLGA 4CE9A 3VQPA 3U3GA 2KW4A 4CGDA 1CZBA 2NUBA 3ZSQA 3NF8A 4W5TA 3H8ZA 3ZT3A 3EAEA 4HCCA 1C1AA 3QKJA 1D5AA 5M9OA 3L2VA 3AVJA 1BISA 4IFVA 4O55A 4CIGA 1X1PA 4DSFA 3OYCA 4CJFA 1IH7A 1RBUA 1WN7A 2LRQA 3KUFA 4C8KA 2JTFA 3LGFA 4IUPA 1KVAA 1Z26A 3FLGA 3MP8A 4FM1A 2Y1IA 4ELVA 4DTOA 1ZBUA 3SYZA 3ISNC 4N4GA 3HYFA 2HHSA 1JLEA 4EP4A 1MHNA 4RW9A 4O0IA 4DF4A 3RMCA 5I3UA 4DS4A 3LP3A 3V9SA 1U4BA 3MXJA 1L3SA 4B9TA 3K5OA 1VRUA 1RCHA 3THVA 4M41A 4DSJA 1HYZA 3DLKA 4CFDA 4KTQA 2IC3A 3KLHA 3OJUA 1JKHA 3KJVA 5CZ1A 1S5JA 3I8DA 3HVRA 5SWMA 5J2PA 3ZSYA 4Z4FA 3OYEA 1U47A 4CJKA 4KB0A 4M3TA 4LH4A 1RDAA 1WGSA 1SUQA 4CJ4A 2BANA 1GOCA 1RDDA 4CJSA 3RWUA 4F2SA 4DTUA 4CJEA 3QIOA 1KCFA 2LDMA 3I0SA 2YHAA 3O3HA 4F3OA 1G15A 4DU4A 3OYFA 2R57A 4LD0A 1EP4A 3WNFA 4E19A 3SQ2A 4GW6A 3V1OA 3OYBA 1NJYA 1WJRA 1NKCA 4UC4A 2HNYA 3KD5E 4M42A 1VSIA 3KLIA 1RTIA 2RPIA 3QERA 2OYQA 2P0KA 3F70A 2BE2A 2RO0A 4AHTA 1NJWA 3DLMA 4LD6A 4DTNA 3TAEA 4Z4HA 1EKEA 4CFAA 3QEVA 3OB9A 4OLBA 5HRSA 2O4XB 1BL3A 4E1MA 2X78A 4W5RA 3BDLA 2HNZA 4FW1A 4DMNA 4CEZA 3SUQA 3K57A 4DU1A 1TAUA 4CRIA 2OPRA 3QEWA 1ZYQA 1QS4A 1ASVA 2RJEA 2KZZA 2F96A 2OPSA 2VG5A 4CF0A 1KHCA 2MWOA 1S1UA 4PQUA 3QETA 4UQGA 4E3SA 5J26A 1WNSA 2RN2A 4CK1A 1J53A 1TGOA 5HP1A 4DSLA 4KRFA 1NOZA 3S3MA 4FU6A 4CIEA 1XHZA 4DSKA 4RG8A 2XK0A 2ITGA 4CFCA 3HT3A 3OYJA 2R5MA 5HRNA 1VSMA 4OPJA 2BUDA 3HO1A 1WAJA 3CFOA 2GV9A 3QEXA 2M1HA 3QLHA 5E41A 3PX4A 4L8RB 1TL3A 4KAZA 3AVCA 4B08A 4I7FA 2LVMA 2WOMA 3WNEA 3DB4A 1I3AA 3SQ0A 3SUNA 4GY5A 2E6MA 4C5HA 1BIZA 2ETJA 3LAKA 4Q0BA 1T03A 4A4HA 1HNVA 1IO2A 2EQMA 1ZBHA 3OYDA 4C5IA 1RDBA 2G8FA 3AVIA 3DLBA 2G8HA 4N41A 4CEBA 2E5QA 3LP0A 2F5KA 2Z1JA 4NYNA 4E1NA 4B9MA 3O8VA 3RR7A 3AO4A 1WSIA 4FM2A 3IAYA 4K8XA 4F2RA 4MQ3A 3CFRA 4CIFA 1KFSA 2RHIA 2WONA 1WSFA 1QSLA 1TKXA 4KHSA 5D6WA 4N4IA 1TAQA 3ZT1A 3SQ1A 1ZBLA 1JLQA 1D9FA 3SPZA 3L2UA 3DRPA 3AVHA 3AVKA 3O4QA 4KTZA 4CHPA 1A5WA 3SZ2A 3NGIA 3QESA 1HYSA 2B8AA 2X6SA 1RTJA 4ZTFA 3NBPA 3UT1A 2YKMA 3QIPA 4LH5A 3V81A 5DK5A 2NLUA 3IRXA 3HM9A 1SL0A 2OPQA 2M16A 1HJRA 1VRTA 2P51A 3MEUA 1HPZA 3OYMA 3C94A 4XIUA 4FLZA 4FJ7A 4KI6A 3KIOA 3NH1A 4Q5WA 4C8OA 4AHVA 4KTWA 5CIUA 2D0AA 3NF6A 3DLHA 3A2FA 2RF2A 3B6PA 3DLEA 1EX4A 1XC9A 3LWMA 4O5BA 4CJQA 2Y1JA 3L3VA 1T7PA 3HPHA 3L3UA 2B4JA 4O4GA 4HVJA 4FJ5A 3LYIA 3ZT0A 3NH0A 3ULDA 1LWCA 4DQQA 2VWKA 5HROA 2BKDN 4E7KA 3MEDA 3U6FA 4FM0A 4KHQA 4CJWA 1LV5A 4KPYA 1HMVA 1RBSA 2LSNA 3KLGA 4FXDA 1CLQA 4BWJA 4BDYA 4CJPA 2EQUA 3NH2A 3TANA 4ZTJA 3OYGA 2O4IA 3L2WA 1H3ZA 2G8UA 2XDPA 2Z1GA 1KRPA 1BQMA 1B92A 2MWPA 2XO7A 4CF8A 1X9MA 4B9SA 3EYZA 2JGUA 3HL8A 2VYTA 3ME9A 1EETA 1NOYA 4KREA 3ITHA 4B8AB 4M3YA 4MFBA 4NZGA 1RBVA 2IS3A 4GMJB 4CHZA 2X4WA 3CQ8A 2HMIA 4CGJA 4DTRA 4CGGA 3VQQA 4PY5A 2D5RA 4G1QA 4GVMA 3V6DA 2GF7A 4WE1A 3H08A 4PL6A 1BCOA 2QKKA 2YHBA 3C6TA 3FFIA 3PMIA 4HUFA 3DOLA 3OYIA 1JLBA 3L2RA 2R58A 3VN5A 3MO8A 4DTPA 4Z4IA 5J2NA 2RHXA 1YT3A 1U04A 3AVGA 5KRSA 5CYQA 4OKKA 5KCHA 3RR8A 3ZT2A 3PMTA 3S6WA 4DQPA 1MU2A 2HHUA 4JLHA 1ZBFA 4KHUA 3LALA 4ID1A 1J5OA 4C8LA 2ATQA 1VSEA 4QVZA 2EQJA 4N56A 1SKSA 1C0MA 4DFPA 3LAMA 2RI2A 3AVMA 3G10A 4CF2A 3K59A 2R7YA 4KI4A 2IGIA 5KH6A 4AHCA 2DFEA 2OA8A 1NJZA 2K3YA 5KRTA 1LW2A 4HUGA 3V4IA 4CESA 2KTQA 2DAQA 4PLLA 1RDCA 4CECA 5CY4A 3VQ4A 3O3GA 3KLEA 3F73A 4FLYA 3SI6A 1C0UA 1QSSA 2P1JA 2G3RA 5J2MA 4HCZA 4BACA 3META 1NKBA 1YVUA 4KV8A 4Z4GA 4CERA 4CJ3A 5HBMA 4DU3A 1RNHA 1U48A 1RT6A 5K14A 4E7IA 3NFAA 5DMRA 1FXXA 3L2QA 1C1BA 3TR8A 3VQEA 1A5VA 3TABA 1TK8A 1DTTA 3AVLA 1RBTA 1TK5A 3QIIA 5I42A 3KKRA 5EU7A 1HYVA 4OVAA 4BE0A 2B5JA 3PO4A 2A1SA 2HQXA 2XY8A 4M3XA 4CHNA 1U45A 3HK2A 5C42A 3U3YA 5JS1A 4O44A 3NGZA 3ZSOA 1LWEA 2XRIA 1NK6A 2X74A 5C6SA 4ICLA 4YFUA 3AO3A 2DTUA 4B9WA 1RTHA 5C25A 3PUFA 5KE2A 3ZT4A 4B9XA 4FZXC 5FRMA 3D45A 3L8BA 1N5YA 3MP6A 1RT5A 4BDZA 3TAQA 3ZCMA 1UAXA 2Z1IA 1TV6A 1LAVA 3C6UA 1OZ2A 2LTOA 3BDPA 3OS0A 4A4EA 1B9DA 4AHSA 3DLRA 2EKOA 4M45A 1BCMA 4CJVA 1NK5A 3F9KA 4QCLA 3OYNA 3LX7A 1IKWA 1ASWA 1J9AA 4E89A 2DIGA 4C8NA 2P5GA 1ZBIA 3RRGA 3SUPA 4Z4CA 4J2DA 3QEPA 3T3FA 1S1WA 3ZSZA 3VQAA 3VQ7A 1X9SA 4EZ6A 3MXMA 2XHBA 2L8DA 2HHTA 4FJ9A 4PUOA 3LLRA 4DQRA 2JZ2A 1VSFA 4R5PA 1VSKA 1ITGA 1W0HA 2GUIA 4KO0A 3DM2A 1XHXA 3AA4A 4OGCA 4FYDA 3ASMA 1F21A 1UWBA 1HNIA 2O4GA 4FK2A 2P5OA 2HHWA 2Q3SA 3PFSA 2ZQBA 4CEFA 3EY1A 1L3VA 1LW0A 2DFFA 2I5JA 3KK2A 4CJUA 3DYAA 5D6XA 5T7BA 1VSHA 3V9WA 2PYJA 4IUTA 1BGXT 3AO1A 4II1A 3DI6A 2BGGA 1KLNA 2G8IA 5KGWA 4I2QA 1LAWA 4EP5A 3KK3A 3CFPA 3NF9A 2B6AA 4OGEA 3AVAA 4I2PA 1XI1A 3HSTB 4PA1A 3AA2A 4M3UA 2VWJA 1VSDA 4DFKA 2X4XA 4CEOA 2HVHA 3FC3A 3C4SA 3Q1JA 3K5NA 1Q9XA 3G0ZA 1T05A 3UIQA 4KHNA 1A5XA 3VQDA 2LCCA 3SNNA 5HLFA 3OYHA 4C5GA 1QSYA 3NNQA 2BDPA 3P83D 3WNHA 4E0DA 2HQEA 4W5QA 3CM5A 4JS5A 2G8WA 3LPTA 1YTUA 3OMCA 5JS2A 3OJSA 4N4HA 4RW6A 1WLJA 2D0BA 3V9UA 4FW2A 2ZD1A 4DTSA 4E7LA 4DFMA 2IDOA 4RG2A 3TAMA 3HPOA 1S1TA 2YRVA 2EHGA 3SCXA 1IKYA 3K58A 3TARA 1RT7A 2RKIA 3LP2A 3NHGA 3KTQA 1K6YA 2F8SA 3M8QA 4CFBA 3OS1A 4IUUA 1CZ9A 4AH9A 3FDRA 2F8TA 4KB1A
chains in the Genus database with same CATH superfamily
4IG3A 4YELA 5CZ2A 4XKCA 4YORA 2F69A 1KC8C 2HNDA 2COWA 4XOTA 4X34A 5KPTA 3FBIB 4IHVA 4CJTA 3SK3A 3R4KA 3G4SQ 4BRKA 1KZHA 1IAWA 3VKIA 4A0ZA 3ATVA 2PY5A 2RPNA 4CCOA 5BRHA 5J39A 1L3UA 4PK4A 3QU3A 1UHSA 3VERA 2O2OA 4EDUA 3TSQA 2JHJA 4A12A 2XD0A 3RMDA 2R93J 5LFAA 3CTAA 3GL1A 2ZE2A 4LFBK 2VCPA 2KP6A 3S3NA 1P92A 3PNWC 4M6XA 4CCKA 1ASUA 4LSNA 3CO6C 3ABUA 2VQCA 3VYHB 2WADA 1X1AA 3BTLA 2LREA 1KQSS 3CW7A 3LDQA 1BC8C 2VPRA 1KLMA 4X66K 4C92A 1ZLJA 2VBZA 1EWRA 3RUXA 1TL1A 3KCCA 4MEYF 3S9HA 2E71A 2JTEA 4M7AA 1TUUA 3O80A 3IQLA 4Q47A 4TV7A 2GFAA 2DEUA 4M7AG 1XGNA 1IGQA 3LDPA 4JKCA 5EEHA 2HQHA 4CGFA 2LYCA 2VJ4A 2XHKA 4EVIA 4ESJA 4JV5K 4OX9K 5FW9A 4AUXA 1NGHA 1WHJA 1BA1A 4DZJA 1NYFA 5GAOn 2MH2A 5JHFA 1X1BA 2DM1A 2K5IA 2IEKA 5L8RE 1VF9A 1ONVA 2QKLB 5MLCQ 2L4MA 1FOXA 2R7OA 4C0DB 1W0TA 3J7AY 4C9YA 3M07A 4XORA 2E1MB 1M90O 4DR5K 3GNFB 1WJFA 1WJQA 4HHTA 4Z6YA 3VJPA 3JRZA 4ZDLA 3GOXA 2Q36A 2ZGWA 3GG4A 3A1PA 1BI2A 4M3RA 2JMCA 1TUYA 1MIJA 5KI6A 5AQTA 3IDHA 2CT3A 2RC4A 1K79A 3I5RA 4XNFA 3RMAA 1R71A 1WFWA 3DEUA 3CC7Q 1AEYA 1AHDP 5J1EA 3NCIA 4FOIA 3VA3A 5KCOA 1C0WA 3L7WA 4JYAK 3DB3A 1APLC 2D0NA 2LBFA 1RADB 4BRFA 4M3ZA 3JCMJ 4IL6C 4JI5K 1VQ5A 2RNGA 3Q0UA 2OFKA 1KU3A 5KPZA 1S7EA 4NL2A 2NNWA 2RD1A 1SANA 2VV5A 2MAMA 3PSFA 3KUFA 3RMQA 3UA7A 4M7DB 3AG3H 2XKPA 4NO7A 2HHSA 3LSRA 4M3DA 3K4BA 2IC3A 5LJ5h 1ZG1A 5C4XJ 3OYEA 3BZCA 1WGSA 5LHHA 1KIKA 3SMPA 4CJEA 3FB9A 4F3OA 1G15A 2R57A 1EP4A 2L7MP 1VQ6N 1V5GA 3FXQA 4CD3A 2Q1NA 4GGGA 4M72A 3OB9A 2HOTA 4CVNE 3BDLA 3ASNH 3LNQA 1AOJA 2CQ7A 2D45A 1P4XA 4RAZA 3RERA 4UQGA 1O57A 2R7RA 1NOZA 3GZ5A 1ATRA 1IJWC 5E1ZB 1XHZA 3HYIA 4L9TA 1Q82C 2F9TA 4YTLA 3CERA 1BBYA 2Q31A 2E6MA 3J7ZI 2ZPEB 3LAPA 4DV5K 3PUBA 4NYNA 3ZEUB 1KQJA 4MQ3A 1PUFA 1KFSA 1VQ8Q 4L3QA 2SRCA 5D6WA 4N4IA 1I1GA 3SQ1A 3EFOB 3NGIA 3IRXA 3EG3A 3E7LA 4AHVA 3E66A 2VC1A 3U1KA 3LWMA 1NTCA 4D1QA 3ZT0A 4GCVA 5IP9J 5LJ5e 1NGJA 4DR1K 3CC2Q 5IHIA 4BDYA 2W4SA 2L9VA 1M1GA 3ZMTA 1N8RO 1LUJB 3CD6Q 3DJCA 1EETA 4UY8O 3SXYA 4XQ3A 4UNFA 1VQON 1F1BB 2PJRB 1W5SA 3FJPA 1YW8A 3S14J 1XD7A 2HHUA 5AZJB 5I2SA 3VEYA 3KFWX 4L9NA 4LD5A 1JB0E 1NJZA 2NRAC 4W1UA 3EUAA 1YO5C 2QSGX 3HHHA 1BOTO 2TRTA 4ZYAA 1YVUA 2G7HA 3BR6A 1KU7A 1B3QA 1X58A 1M1KC 4KUMA 2DA5A 3H9NA 4AMCA 2VYPA 2ZNYA 5LL6S 2CP7A 3SWNB 2F4OB 2K7AA 3ZT4A 2C0OA 1ZXOA 3CMEI 4KUDK 1J7KA 4W97A 2ZJQF 2V7ZA 3G4SN 4XH1A 1W7PD 2OZ6A 4A4KA 4A5BA 2YUNA 2RDPA 2P9PA 2GUIA 3ASMA 1F21A 2K7LA 3GLLA 2LX9A 2QAZA 3G1OA 2EWSA 4NUBA 1VSHA 2R5YA 1O9SA 1O7LA 4I2QA 3D2EB 3DTKA 2KEAA 2JPSA 4M3UA 3O4WA 3SAHA 1A5XA 5B5EC 3VS3A 3VQDA 5GAN4 3P83D 1P7JA 4JI3K 1YTUA 2Y0SA 2M34A 1JI8A 4E7LA 2IDOA 3WXIA 5KYXB 3VODA 1UELB 5FU7C 4IUUA 3FDRA 3C18A 3ZN0A 2C06A 2FBXA 3D1NI 1NJXA 3PVLA 1MW7A 4B3OA 3THWA 3KZIC 2XGDA 3VQ8A 1Y0NA 2CWEA 3O9UA 5HCKA 1SKRA 2EX3A 2ZPHB 1OYXA 2IS1A 2JA5J 3ZBDA 3JSOA 4J00A 4FWSA 5HNFA 1MNMC 3FXMA 1CGPA 4N47A 1B72A 3D2FA 2EQKA 3CQTA 1H8KA 2FO0A 1D8YA 1KD1R 2NNNA 1K73U 3L9FA 4XN3A 3O1WA 2XPUA 3CF5L 4FSVA 3MEXA 5EJCA 2ZZDA 2HOAA 3JREA 4I09A 3OYKA 4O8UA 4NOYA 4HNTA 3BCAA 4Z4EA 3VS5A 4A5NA 1PKSA 4Y17A 1U9OA 2O31A 3X24B 3CMYA 2ID3A 3WHCA 4BRNA 5D8KB 4F9OA 2VQLA 2VG6A 1TK0A 2NUZA 2VXEA 3IKVA 4PFPA 4F8RA 2XF7A 3SPYA 1K8AR 1AU7A 2EJGA 2FPFA 4M3EA 1QHGA 3MEWA 3QMLA 5K5RA 4LC9B 3NDKA 4XL9A 3FM5A 4Y0WA 2OZMA 3M5AA 5M1PA 1QHHD 1IG9A 4J9GA 3GMEA 3WE3A 3BE3A 1YOVB 1IRGA 3MZHA 3M0UA 3H0HA 4K0KK 1HNXK 4JS4A 2I0NA 1VQ4I 3VOVA 3IH4A 1T8EA 4IZZA 2Z0WA 2Z16A 2XY6A 1OULA 4H0VB 2OCEA 4AFQC 1OI1A 1XSVA 1R5HA 1R5GA 5JLXA 1CXQA 1GFDA 1VSLA 1PVSA 2K3XA 3I55A 2A5XA 1Y64A 3SWNC 1KC8R 3O9SA 3M8JA 2YS9A 4CCJA 4J2EA 1M3HA 1N9RA 3ZEHA 2FQ3A 2FVUA 3RKYA 5E3NA 2QK0A 2X6NA 4AIKA 4W5OA 1EH7A 1ZUUA 1BW5A 1BJAA 2FSJA 2YNFA 4YOWA 1TWAJ 1SRMA 4TVRA 3G6EN 5JI6A 2BE7D 2YUPA 2QYZA 5FFZA 3QWYA 4FK4A 2RQWA 1RACB 4HLYA 3JCMW 4U67L 4I0AA 1CSKA 2W40A 4CW7B 2Z33A 1YQAA 4RTWA 2VUMJ 4HCCA 3QKJA 4BU2A 2HYFA 2V1UA 2LRQA 4CZFA 2IP2A 1UB9A 3KPHA 1EQYA 2Y1IA 4DTOA 2KXDA 1XCVA 3OSGA 1RABB 2FG0A 1L3SA 2P9LA 4X6AJ 4A2UA 1EIFA 3SAFA 2VJIA 2HI3A 3KJVA 3HVRA 2LMDA 3OW2P 1X3WB 1U47A 4OF1A 3CCVQ 1SMTA 1VIEA 4KH1B 4PJOD 2LDMA 1MMGA 3I0SA 2EZLA 1PUEE 3E6CC 1D0XA 1KD1U 2M02A 1IHWA 1YG2A 4BAYA 2GOXB 3T9NA 3KLIA 3DLMA 4LD6A 3JTHA 1SRLA 4CFAA 2LLKA 3RVCA 1TAUA 1IBLK 2I7NA 1YXQA 1PC0A 2F2XA 3RKWA 4HBLA 1T3SA 2DERA 4WTOB 3HT3A 2HBJA 4FT4A 5LRRA 2Q2RA 1HNVA 1IO2A 1ZBHA 2DPDA 3MD2A 1WSIA 4JKFA 3SDBA 3G7ZA 3BR0A 3ZT1A 1S72N 4U87A 3CCRQ 1CF7B 3L2UA 3O4QA 1XDSA 2QWPA 3NBPA 4JX5A 2VQEK 1B6AA 4LUDA 4D7MA 2QBYB 2RV8A 3HHGA 3V7CA 1HU0A 4A3MJ 1UEBA 2Y1JA 1LJOA 4FJ5A 2GQVA 4R1HA 4II2A 1M8MA 4KYWA 2YHYA 4XEIA 3NH2A 3BG6A 2FLOA 2D1VA 2FSKA 2IS2A 4CH7A 4FQGA 4XKVA 4NZGA 2DBMA 1P4AA 2A6AA 3IH7A 2XG8D 1TTYA 2CW7A 3KP3A 3FFIA 1IZ6A 5J2NA 4CSWA 1N3AA 2ASOA 5DCMA 2BW3B 3NMUA 5LJ3f 3JB9G 2NS7A 1VQKT 1N32K 5CKHA 1JKQC 2VE8A 4HUGA 2JTMA 4PLLA 3VQ4A 5EY4A 1ATSA 5HBMA 3HO1A 3HRGA 2EBPA 4DCHA 1SD4A 5IYCJ 3UPUA 5JLWA 3URGA 3ML6A 5FWBA 4O44A 2QENA 4JK8A 5C6SA 4LLGF 5FPEA 5CPRB 4HX8A 3ZCMA 2ECBA 5EX5A 3LQQA 1KAXA 1J0RA 1HK9A 4Z4CA 3CCRT 1YF5L 3CCSQ 4HWIA 1FWZA 2VONA 3A8YA 4EZ6A 4HYEA 2E5LK 3PO3J 4PUOA 4DQRA 3VF2A 1YITA 3RKQA 4V19K 1MJ9A 1W70A 1YIJT 2VIXA 4MLEA 1NGIA 2KT8A 3FZVA 2BGGA 2G8IA 4PDKA 3NF9A 4M78A 3GX4X 3VB2A 3G0ZA 4V2GA 5LGTA 3SNNA 3MMYB 3SYTA 2BDPA 1JCFA 4HOBA 3JRIA 1I81A 2DMNA 4XU3A 2V8JA 3BZ6A 2D0BA 1R1UA 5HY6A 3TARA 5IH2A 3KTQA 3CMET 1RKTA 2MSYA 4G94A 4F3QA 3HZ6A 1UCRA 1S9GA 5BREA 3MCPA 2PMUA 2LT1A 1HCRA 3H9GA 5D5VB 4HQMA 3M9QA 1L5UA 3JCMV 2O8EB 1XMXA 2DXUA 1NGDA 1GLDG 3J81E 2CSOA 4DQ8A 2HZDA 2VBWA 3R60A 1A35A 4JHDA 3VEPA 3KVGA 2HB5A 1WQWA 4W5NA 1E2XA 2OJ2A 1ON1A 1TQIA 3AGRA 4G6DA 2FRYA 5KTQA 2R7FA 2RB6A 4WQ4A 3NE6A 1M1KR 3CCLA 4P5OA 3MKZA 4RAYA 1BOBA 4RTFD 1M1KO 4KHYA 4BDPA 1N6AA 1W4SA 3CXCA 2QKBA 4H4KC 2F7TA 5F6FA 3OMGA 3G73A 4HF1A 3MP1A 2VKHA 4N5SA 2FSNA 2O8BA 4II3A 4X65K 3JV3A 1JL1A 3R3LA 1QQCA 3JB9H 2ICWG 2E65A 1LVKA 2YNGA 3EEQA 3WEEA 1VNDA 3DXMA 3O5ZA 4CK3A 2DMQA 2WC2A 2YNHA 1XGOA 3SDZA 5HRRA 1V3FA 3L4IA 2KZVA 4LN2A 2DZCA 3H6ZA 4Y28E 2CT4A 4GYGA 3AGKA 4FJIA 5J3BA 2NNYA 2FXAA 4I02A 3CCMI 3OHRA 5A2QO 2B0LA 3DOKA 4CC2A 2RREA 3SHWA 3Q7BA 1ZSZA 2A61A 2D1XA 2FZGB 4JI7K 4BY1J 4TSXA 1V29B 4C3JJ 1DTQA 2XPWA 5IP7J 3MVPA 4FWKA 3PV8A 2QEXA 1CQTA 3GVAA 2PQ8A 2DU9A 3EG1A 4ENKA 4A0XA 2WA0A 1J75A 3UKRA 3QRFF 3CWAA 5E79C 2D6FA 3OS2A 1QA6A 3CI5A 2EKHA 4A3IJ 1OCRH 4ZDOA 4AHRA 3O3FA 2HPIA 1S72T 2VKNA 2YG8A 3SHFA 2D2WA 5KK1A 2EFNA 4FL6A 4EW4A 4JKAA 2V6EA 2CUJA 1IRXA 2KQ2A 3CCVA 4DTXA 3QZ5B 3CBMA 5GAEJ 5A0DA 2IPOB 4B9NA 1TWFJ 4FJNA 2G8VA 5F1RA 4EJOA 2L3DA 3I33A 4BRHA 5M9OA 3AVJA 1VYUA 4CJFA 1RBUA 2NRXA 1RAHB 1Z26A 3ZCOA 4EPCA 3QPLA 4EM1A 3F6VA 4O0IA 4FPBA 1ZBJA 5GAGJ 3FK6A 3TO6A 1VQOQ 1FMKA 2K9SA 2ZXHA 2AKKA 2ZPFB 1IHVA 2YHAA 2QUFA 3CC2N 1RKWA 1NKCA 2HNYA 1NGBA 1SEUA 1TUCA 5AQFA 3K70C 4A69C 1W4MA 4OINF 3F70A 5BNGA 3VESA 4Z4HA 2P5VA 2E12A 3COAC 1G2HA 3W2VA 3WTVC 1UJYA 1MDUB 1XDUA 4M77E 1ASVA 5LJVA 1QPIA 2NOZA 2DOEA 1HKBA 1P90A 4CIEA 1S72A 3QEXA 2DNUA 4YDUC 1MMSA 2TCTA 4M7YA 3KZZA 2JUGA 1XOVA 1BIZA 2AIRB 4ORZA 1FYKA 3CUQC 4JI6K 1SPKA 4B22A 3TGNA 2FRHA 3A8MB 2ZKZA 5GINA 1YRNB 1R0BG 4KIGA 3AVKA 1HYSA 4V19S 3V81A 1WQ2A 3M4OJ 2NUTB 2CZ7B 5AT1B 5FLXO 3DBLB 3FZHA 2X1CA 4XOPA 2DA1A 2W85A 5IT9Z 2P6TA 3RPQA 4CJQA 1MGTA 1T7PA 2ECZA 2JMAA 4HVJA 4DQQA 4DGWB 3FMSA 1UJ8A 1DKGD 3FZLA 2EQUA 2M8EA 1T38A 3M3YJ 1H3ZA 2G8UA 1JTYA 3C3WA 3VF6A 2F5VA 4A3DJ 4GMJB 1NKUA 3QAHA 4MHGA 1JT0A 1WBBA 2H8HA 4M77C 4A3KJ 2KIUA 3VV0A 2PN6A 2FUG2 3T1BA 3SMSA 1MDMB 2OTJA 3CJ1A 2RNJA 2A5YB 1T8IA 2MI6A 2V1QA 4C8QF 3SFIA 4BRMA 4IVNA 4MGRA 5CY4A 1QSSA 3N4MA 4FSXA 2V52B 1NKBA 1GCQA 5JLHA 1U48A 3DWLE 1FXXA 2R5ZA 1Q7YO 4XR6A 1FY7A 5I42A 1MA9B 2E64A 4B21A 4QS8A 5DM7L 4H5WA 3BEXA 5IOYA 4YFUA 4F7UF 2AXLA 3DQVC 2MCNA 2ME6A 2IXSA 4DUYK 1FIPA 1T95A 2KXCA 4F55A 3OS0A 2VODA 2P0WA 4G7ZF 1D5VA 1FBQA 3T3FA 4BJTA 1HJDA 4ANJA 1P6RA 3TL4X 4J9DA 2HHWA 1RI9A 2HF4A 2PYJA 4WK8F 4DV6K 3N5BB 3G71N 3C2HA 4J7FA 1YJ9I 1HD3A 1Y0MA 3P38A 2HVHA 5IYDJ 2J5PA 3W6KB 3SLCA 5AIQA 4BI4A 2WFBA 2F4IA 2HQEA 2DL4A 1WI3A 2YR2A 1YJ9Q 3HKZN 1FX7A 4N4HA 2HMAA 5EEGA 4OOIA 2L9RA 3CP8A 4IQ4A 1MBEA 1M1KU 4WXCA 5ERIA 2ZJ2A 1VOMA 1FBSA 2WBNA 4DV7K 4EV0A 2KQRA 3M1FA 1C0GA 2CMPA 1Y6IA 3QWXX 4OMMA 3HTRA 1MDMA 3RZOJ 3AA5X 1K9MO 5GANh 4LF9K 1RT3A 3HDDA 3TP3A 2UUCK 2QQSA 1WZ2A 3E1YA 5CQXA 1U9NA 2A68F 3U9GA 4P9UA 1OV3A 3I58A 2DLLA 4ZHRA 1XTAA 5E3LA 3CUQB 2ZPGB 4M3WA 2X4HA 2EIKH 3RYPA 1YX5A 4FHTA 1QWFA 2FHDA 2EV6A 2PVOB 2QEXI 4H8KA 4FYXB 3DPLC 5GAN3 1YN8A 1YS6A 4FASD 3H0GJ 1SG5A 2I5UA 4JI4K 2E1YA 3BJ6A 5JVHL 1NEBA 4LFCK 1D1BA 3LWLA 2G0EA 4ON0A 1Z9CA 1TH7A 4BR0A 3ZQ7A 3VRYA 3LL7A 3ZEUA 4MQVA 4DQIA 5IXBA 4PWDA 3KBGA 3AVFA 4A3BJ 4KGXB 4M7AB 1V4RA 1IN8A 3CWSA 5F04A 4B1ZA 3CCVI 2VQFK 1D8JA 1QE1A 4JJDA 4FM4B 1SD6A 3T8RA 4I2OA 2L5QA 3CCJI 2GWKA 1USTA 2W1OA 3BTJA 2ZXWH 4M6YA 1XC3A 2PFUA 4CEAA 2PQWA 3HXMA 6PAXA 1LNWA 3A8GB 2QXLA 4A54A 3DXKB 4M77G 2PI0A 2YXYA 4Z8AA 4L0ZB 1WX6A 2E4HA 4RB3C 1Q82R 5FWCA 4IIMA 3SFZA 2IAJA 3E01A 1ABQA 4OKJA 4Q48A 3ZSWA 4LB5A 2NYSA 4LMYA 4IUVA 5DY9A 4IHSA 4NBQA 1I5ZA 4C2MJ 5GAMh 1T0FC 4D5CA 2JHNA 2DXIA 4ENNA 5F0FA 3G71T 5JMVA 3NF7A 2DFIA 1U3EM 1NJIU 4DYCA 5M3FJ 1KSPA 2MD5A 2DDAA 4QS9A 5LJ5f 1RUNA 1F5TA 2NUTA 1I6XA 2QGUA 1JHHA 5CHIA 3KLFA 3HGYA 3HZJA 1GLJO 2QEXQ 3JB9I 3M8SA 3CC7I 4CCMA 3F9MA 3MECA 4IUQA 1RBRA 3RZDJ 3E9PA 1U5TC 1TW3A 3H5AA 3U3GA 1I1SA 4QPOA 3RR6A 2ZBKA 3L2VA 3AFHA 3DLLA 3CCMT 1G4DA 4M78G 2EGEA 4YIIA 3BDDA 3TPQA 3LA3A 5F1XA 4RW9A 2CGHA 4M75D 1LCKA 1KG5A 4BRQA 2JWTA 5GJWB 3O1BA 1MH4A 1S5JA 2GBYA 1T56A 1D8KA 4J01A 5SWMA 3KWIA 4F7UE 1X6GA 2BY3A 5KHDA 4C0FA 3O3HA 2PEXA 4J8FA 1FIAA 1RLQC 4C1NI 2LJ1A 4UVCA 3FLCO 1HKCA 3AARA 1S8NA 4U88A 4DMNA 3SUQA 3BCBA 4CEZA 4A6EA 1B72B 3D2FB 1UB4A 3EHQA 4HV5A 1J59A 5J26A 2W41A 1WNSA 5DUIA 1J53A 1EO1A 2XK0A 3OYJA 4EHUA 2EINH 1QCNA 4IOAF 4KAZA 3DWLA 4RTVA 4EMKC 2XB5A 4MNUA 2A3SA 4LE9A 1UHMA 3DLBA 3E97A 2VKVA 1X75C 2RGVA 3EE8A 2O9VA 2BW3A 4A3FJ 1NGGA 3AO4A 3IAYA 4CBWA 3UKUB 4H03B 3FHFA 4KTZA 5M5XJ 3W3DA 3UF4A 5DK5A 1HJRA 3MEUA 4JK9A 3OYMA 2CUBA 2XB0X 4V2SA 4M3FA 2FXUA 2W6LA 4A0YA 4B1RA 1M2OA 1R49A 2GXBA 1DT9A 1LWCA 1I94K 4RB1A 4R56A 2JWKA 4D8DA 4KPYA 2K2MA 2COBA 1J5EK 2TDXA 3M1CA 1VQ7Q 3VENA 1N36K 3DP7A 3L2WA 1H9GA 1BQMA 3THXA 3EYZA 1SD7A 4YOQA 4CHZA 4JD2A 4PY5A 2H94A 1ORKA 4J6XA 3JCMQ 4HUFA 4AQYK 4CC7A 1QVTA 3JB9J 4BYYA 4BXXJ 3QJYA 4XSZF 3MMVA 2CH6A 4LG0A 1ZBFA 4KHUA 4FVUA 1VQ9N 1VSEA 1IBKK 3QYHB 1C0MA 5LHGA 2HL5C 2RI2A 4JKBA 3HOUJ 1CZAN 1B8IA 2NUPA 1K8AU 1LNXA 3HSEA 1YUWA 3O9RA 3JRGA 1T0HA 2CG4A 3FDYA 2HDAA 2DBKA 3TR8A 2VXFA 1YJWI 4JRIA 5EU7A 3E19A 4ZN3A 3C0BA 5C25A 4XTZA 1N5YA 3MP6A 1HA8A 1UAXA 4RS8A 3EH1A 3DBHB 4RM3A 2JT1A 2ISZA 2EKOA 1X69A 2M1BA 1ASWA 2Q0OA 5EZGA 4S05A 5CVUA 3VS7A 4E6KG 4JI8K 2A5WA 4FYDA 2E1HA 1HSJA 2O4GA 1WEGA 2VGNA 2XDVA 4CJUA 1YHQT 1KLNA 2OD5A 5GAGP 4M4ZA 2Z3YA 3NWTA 1BIBA 2VLAA 2ZD1A 2BTFA 1Z1DA 2XIGA 3GTGJ 4ME7A 1LVAA 3MN9A 1K4US 4GRIA 2HZTA 4M75F 3W2WA 1YJWQ 1S5LC 2W24A 2C6YA 3HOZJ 1WHMA 1ZHIA 1M3QA 5GAMj 4E7SA 2EYQA 2HHXA 2IA0A 2CU7A 3TU4K 5BPNA 4BXUA 1HNWK 3J8AA 2XY7A 5F0XA 2RM4A 1HPMA 1J3TA 4D0PA 3K4MA 2BGCA 3MN2A 3G4SI 1IZ1A 2QQRA 2KZMA 4AIAA 2X6WA 1O3SA 1XNQK 3NQOA 1QRYA 1NKEA 1W5CC 5FROA 1YQMA 3HGGA 5AQZA 4FLXA 1HXDA 4ELTA 2MW8A 4HQEA 4K41A 3VTIA 1ZG3A 2DA6A 3RCOA 2I7PA 3QNNA 3J81K 1XMOK 1VQNA 3QO9A 2RI3A 5FD5A 1FLIA 2KRHA 2M0MA 5D5XB 1LFUP 2CP3A 1YJ9N 5J47A 1FT9A 4NNJA 3HP9A 3IG1A 3R0AA 5I9EB 3TQ7P 3OSSC 2KT1A 1NGNA 1FK9A 2DT5A 2XAUA 3IHOA 3JB9F 4M7DA 3RPUA 1YYVA 2DJIA 1X3NA 2YUOA 1QVFM 3EGUA 1Z6RA 4ISFA 3V4GA 1BIAA 4FLVA 3I59B 2H8WA 1V4TA 3VEOA 4HVVA 3G1MA 2P4TA 4F4KA 1U49A 2F9WA 4GYIA 3B02A 2ESWA 3E3VA 4Z0UA 1KU9A 2Y69H 4FJKA 4FYYB 1FTTA 4ZNXA 1E4FT 3GZNB 1IKVA 3NPFA 5J4VA 1EZZB 3HM8A 5D6FA 3NFCA 4XRSA 2OTJQ 4A93J 4BBSJ 2NRHA 3ALYA 4LJZF 1TYQB 1KC8O 1KTQA 5KGXA 1VQMN 1S3XA 1QP3A 4ELZC 4HT9A 2K2VA 4BWMA 4L59A 1WHLA 1XS9A 4MFDA 2IIMA 4FK0A 4E4HA 5FJ8J 3A98A 1KU2A 1UHCA 4FLUA 2PLYA 2CQXA 2NXNB 2ROTA 2KROA 4CHYA 1ZSZB 2GM4A 1ZG5A 1RPWA 2CYYA 2P81A 3UR3C 4EW0A 4MZTA 4ZH4F 2B86A 2DY4A 2LOOA 3GNGA 4KICA 5D4RA 2QZ8A 5CKTA 2DODA 1ZBUA 1HSQA 5EG0B 2F4MB 1G59A 1WCMJ 3LP3A 3V9SA 1GDTA 1HYZA 1UHFA 1RNLA 3KLHA 4M3GA 4BRDA 3B73A 1ZR4A 4M7AF 4B1XB 2VI6A 1OPCA 2ELKA 2A36A 1RDDA 3FHGA 3EH2A 1WOQA 3MZ8A 1KCFA 2GA1A 2Y4YA 3QU6A 5FKLA 5E3OA 4C23A 2Y9YA 2BH1A 1QZ5A 2GA2A 5CKEA 4CI0C 4E1MA 3CJBA 1S6LA 3JCUC 4NXMK 2Q0UA 2CGPA 3MKYB 1WUAA 1XQHA 1D4XA 2VG5A 2CFXA 5CVJA 2RN2A 1R1VA 4CK1A 1ETWA 2AP1A 2RE2A 2O8FB 1VSMA 2VWBA 4OU0A 5E41A 3IUOA 2LVMA 1T2KA 2JZYA 3DPTA 3DB4A 5HDNA 3CCRI 3CPWM 3QQAA 2E8AA 2EFOA 4GV6A 3KP2A 4J9EA 3D5LA 1CKBA 2DL8A 2H3JA 4DR6K 3RR7A 3FIFA 5C12A 8AT1B 1VQPN 2DMUA 3DTEA 1RAAB 4CHPA 3QYFA 1YRNA 4IHTA 1HPZA 4XIUA 3SAGA 1LPQA 4DIQA 1AKHB 2LZ6B 4EMGA 3EPZA 2QTDA 3A2FA 4WCGA 2MGQA 4OFAA 1WWXA 2JA2A 1CLQA 2YHXA 4MEXF 2WY8Q 4F14A 2VPLA 4MTDA 2XDPA 2P9UA 1HLVA 1VQ6I 1X9JA 1YIOA 2CSIA 2VYTA 4KREA 3ITHA 1RBVA 1X6BA 2P0QA 4PJOA 2E41A 5HS8A 1JLBA 3VN5A 3MO8A 5IT9E 4Z4IA 4A5AA 1S1NA 4PJOG 4EFHA 3RR8A 3CCQT 5L3EA 4DQPA 3RESA 1DIZA 4N4NB 4LDXA 1K4TA 1RUOA 2KRFA 1A31A 5K1YA 3IKMA 3H3ZA 2UXDK 5ICGA 2KTQA 4FLYA 4HCZA 1MPGA 2B7EA 2M0YA 3F8BA 5E8GA 1NJIR 4E7IA 3X2QH 1RESA 4JK7A 2MMPA 4YOXA 3EE9A 5AQKA 3FR0A 4NC7A 1VQKI 2A1SA 1FBUA 4CHNA 5KQDA 3S17J 4XU0A 4BY9C 1LWEA 2MLGA 2HKQB 4B9WA 1OCCH 3TAQA 2RVCA 1BC7C 2MABA 2PVGB 2LY2A 1LAVA 2YPRA 2W7NA 2H8RA 3BDPA 4U0WA 4AHSA 3H3UA 1ZELA 3GTOJ 4PL8A 4C8NA 3TTDA 4JK1X 3NGPA 3LLRA 4R5PA 4CZEA 2JWLA 3QDFA 2O8DB 4AYBN 1RI7A 2HD0A 2FBHA 3CCET 1NM1A 4BREA 1DPUA 4II1A 3TOBA 5IWAK 2BVLA 2OCCH 3ID8A 3CMEA 1KFZA 5HDGA 2LCCA 5CYVA 5IHNA 3GP8A 1JXMA 4GLMA 2HVQA 2HDWA 3WTWC 2M3AA 3DKXA 4J9BA 2ISYA 2ENMA 4LK0F 1WYXA 1K8KB 1LKXA 3KP6A 1YNZA 2XROA 4UV8A 2AK5A 1PNJA 1JT6A 4E70A 3EZ5A 4PJOF 5FDLA 2UZKA 2JA7J 1P7IA 1VQNQ 5AQPA 4WFNL 4BE2A 1VQPT 3IMXA 1MGQA 1XNIA 3AA3A 2RQVA 5GANd 3M8RA 3UKRB 3UWNA 3ID6A 4QPQA 4NCGA 2DJQA 1NH3A 4LF5K 4JYKA 4AM7A 2CQNA 2FJ1A 1R36A 5CAIA 4PJLA 1SSHA 4LXCA 4RKUE 1IXSB 3MEVA 1X4OA 3LSJA 5D6EA 3GEZA 4HSBA 2LKPA 2X1DA 1JJ2P 3H5NA 3QG1A 3CBOA 3M58A 4A4GA 3MK6A 2XAHA 1JXBA 4I98B 1O3TA 1MSEC 3V1RA 4S0HB 2A0FB 2QM3A 4LG0B 3JRBA 4YFXF 2O4XA 4NQWA 3HOXJ 1UGVA 1YCSB 1HQUA 2GBZA 4OMOA 3JCMb 2YKNA 3TSUA 1IBMK 2DLPA 2CUFA 3FXUA 4GNIA 2Y0MA 4QAGA 5H2FC 4YG2F 3C12A 2MPXC 4GV9A 1VQNN 2BE5F 4EZ9A 3VYUB 3ELKA 3VYSB 5KE3A 3FXOA 2X3XD 4DSIA 1FSHA 3FFKB 2P9KB 4DV2K 1QBJA 1AWWA 1RGIA 3BROA 3VQ9A 1CKAA 1HQCA 3G0QA 1E6GA 3OSVA 2R7WA 2CJJA 1X1DA 1LWFA 1JGGA 3N4QA 1MWMA 1ULYA 2MBFA 2V9KA 4MDXA 3KD1E 3C6AA 2NRVA 4DS5A 2J7IA 2QW9A 4FZZA 1E3OC 5IHKA 4DWIA 2W00A 3K9JA 4FJ8A 3DTIA 4B8XA 1OPKA 2Z1HA 2Z5UA 1CF7A 3A5MC 1UG0A 4M78E 1YW9A 1ORPA 5LD2C 5AQOA 1K83J 2LY9A 2CKKA 1RDUA 5F0CA 1OU9A 1PU7A 3CDIA 2H09A 5KAIC 4KHPK 5AIPA 3OBYA 3CMEN 1QHAA 1S22A 4XTWA 4F7UG 2D0CA 1ZC6A 3WQTA 4XRMA 4DF8A 3RPUD 4FE7A 2F4VK 3ABLH 2AZVA 4QKUA 5AZIA 1OH6A 5DM7F 3OMYA 3EKUA 4CYCA 5C2FA 5GAMg 4NQWB 2EWNA 3GF5A 3TCJA 4MO4A 4YIFA 5HLHA 2UV1A 3IV5A 3S2HJ 4EA4A 2CDTA 1T44A 2MC4A 2V1RA 3HOWJ 4MO7A 4U7BA 1UGRB 1PJRA 4KISA 2A3ZA 4DTUA 2E1MC 4HA8A 1YCYA 4PJMA 2XIDA 2KIQA 5CCAA 3SZPA 1RR8C 2HVRA 3BLYA 3L09A 4BQNA 1RTIA 1QKWA 2YUSA 2PX9A 2BE2A 2I10A 2OBPA 2V75A 1AKHA 3AT1B 1JJ2A 4B3AA 4FW1A 2HS5A 3WU0A 3QETA 1VQLQ 2W25A 2YCHA 3VETA 1H92A 4XTXA 3ROUA 5TGTA 4AM6A 3FMRA 2Z9OA 3FSPA 3QLHA 2E1NA 4EM0B 3VEVA 4G6QA 4CO8A 3TW6A 2O9LA 2KRCA 4DBHA 1ZR2A 5A0LA 4JNEA 2FPDA 1M3CA 1SHFA 4RLFA 3LQRA 3SZ2A 3JAMZ 1RTJA 4LD9K 1PSFA 1SL0A 5GAOr 2NLUA 4ZJZA 4ZGJB 1Y96A 5KN9A 3H0IA 4Q5WA 4Q4ZF 3B6PA 1XC9A 4JAXA 1TUDA 3FRNA 3L3VA 5H1SQ 1AWJA 1E3MA 4ILGB 3VFZA 3FIWA 1WBDA 5CQYA 3GO5A 1NOYA 3HL8A 2JGUA 1UDLA 4JBAA 3GCMA 2GF7A 2IVNA 1BCOA 4X64K 2NS8A 5KYWA 1KQ2A 1SFEA 2XHCA 1U04A 1VQ9T 3PMTA 4C2UA 2DA9A 1FN7A 1M90C 1WXTA 4HTLA 4XLPF 1WEIA 4BKXA 3GLXA 1B1BA 1P8ZA 2YRCA 3V4IA 2DL7A 3MKDA 1BB9A 5IYBJ 1D09B 5BS6A 4CERA 1IN7A 1TOVA 1RT6A 4DUZK 1M5Q1 2XF5A 3TSPA 2K5CA 4ZZLA 1OCOH 3PO4A 2YX7A 2ZXIA 3U3YA 4M77D 1WJBA 2X74A 3KWGA 2L7ZA 2RAEA 2DJNA 4HSTA 1GLFO 3M5RA 1B9DA 2ADUA 1WDXA 2AQFA 3LX7A 1JCEA 1VQNT 1IDZA 1B59A 3VQ7A 2JZ2A 3VS4A 3KEYA 2DTZA 1DEJA 2OTLQ 3HJEA 1LE8A 2KAFA 2B9SA 1ERDA 2DFFA 2DD4A 3I56T 3A01A 3PTAA 5FKOA 5KGWA 1HW2A 2B6AA 3AVAA 5AQGA 3JRFA 1Y1VJ 1ORNA 3K4LA 4MFEA 3QSUA 3CLQA 2PZ1A 5B3SH 3ABTA 5JS2A 1L3LA 1BJZA 5FLMJ 3K58A 1K6YA 4A57A 3CIPA 1U1TA 3IP4B 1TKDA 2BIVA 3O3KA 5D5WB 3MDQA 2BBYA 1ZAOA 5L3BA 1JXOA 4CZHA 1USSA 2MD0A 1R8OB 2WAEA 1TQMA 4PGGA 2X35A 3OW2A 4HCBA 2RHZA 5LEKA 1W7AA 3EYIA 5GAMd 2LQNA 2O61A 2OZUA 1IREB 2LNVA 2DQRA 5CKDA 3ZETB 1WSEA 2XY5A 1YQLA 4GDFA 2GFUA 4WFBL 1TKZA 1GLNA 2CP0A 3VQCA 5HLGA 1SVOA 3SJJA 1OJLA 4KRTA 2CW0F 4AF1A 2BZTA 4A6DA 2NVQJ 3WTYC 1NLPC 4AD9A 2E5NA 2Y2ZA 3KLOA 4JRQA 3A8LB 2NRZA 3KLNA 2RK1A 5EOYA 1CXUA 3IRRA 1TP4A 5A2QK 5I22A 1SKWA 1JXEA 1HRHA 3I59A 2JOYA 3J7AF 4KFCA 2E7XA 2CZ1B 1N8RU 2DOFA 1VA7A 1C1CA 3AVBA 4CCNA 1TSFA 4AI5A 4CZCA 4J19A 3HIFA 5DCMB 1IRZA 3JW4A 2IPQX 4QTRA 2EGCA 1EH6A 4A2AA 4FTHA 3MEAA 1HOMA 4BE1A 2STTA 4OFEA 1JTXA 2E2OA 1WJDA 1XSXA 4M78F 2ELJA 4K42A 4HTUA 3LWHA 1TBXA 2DA4A 3JCMd 2NVYJ 2HBLA 2KKZA 3QWLA 4C92G 2ZAEA 3ZQIA 5FLXZ 4M71A 1BHLA 3FXKA 3MWTA 2DW4A 1VYVA 1W7PA 1NK4A 3H9QA 2QWQA 1A36A 3HTUA 1NU0A 4NCAA 2P4RA 3D7EO 3RMBA 1JUSA 1VQKN 2V9PA 1WI9A 2O01E 2BZXA 3GZ6A 2VQHA 3KYLA 1FSEA 3LSIA 2JVVA 2ME0A 2EZHA 1UGPB 4BEHB 1BWFO 2HGCA 1Y7XA 1GV5A 1NBEB 2ZJPF 4B3TK 4GVEA 1KHIA 4FVMA 4FJGA 5IXFA 5FU6C 1A04A 4K8ZA 1WHHA 4XH5A 1WHKA 1LDDA 2AJQA 4LOCA 2HQNA 5FPDA 1W2BS 2HQAA 1F36A 5FLXE 1YJWA 3KYCB 1NK3P 3ZX2A 2RI5A 4CYCB 2FF3B 2EPFA 2CH0A 5CQEA 1OH7A 1P4WA 4FOEA 3LGFA 2KDZA 4RGRA 2A08A 4EP4A 3M0RA 2QWNA 1MBGA 2HBMA 1HKTA 3MXJA 3G6EA 2DI3A 1VRUA 2OAUA 4M41A 2J6OA 4VUBA 3CMAA 3E5QA 2A37A 2KR3A 3ZSYA 4Z4FA 1I8FA 2BANA 3RWUA 5AONA 2L2PA 3P39A 1F1ZA 3WXJA 1NJYA 4M42A 4QLCU 3F21A 4EMHA 3DFGA 2P0KA 4PJ0C 2P5LC 2DE0X 1BN5A 4H0OA 3TREA 3FKIJ 4W5RA 5D5UB 3E9LA 2OPRA 3QEWA 4HRIA 1ZYQA 4HVUA 4AFSC 2OPSA 2F96A 4CF0A 1KHCA 1X2KA 3TP0A 2DD5A 1Q81C 3SEZA 4KT0E 5HP1A 2ZWHA 1VUBA 4FU6A 4DSKA 3R0JA 2GV9A 2RQPA 5J3LA 4C5HA 2YG9A 2WWYA 4WXHA 1BL0A 1OX8A 3VGLA 3LDOA 2YSRA 1WSFA 4RAFA 1E3HA 2GBQA 1X4PA 1XMAA 2WUSA 3AVHA 1F9NA 3UT1A 5HS7A 2OPQA 1VQKA 5M3MJ 4A63B 2OX7A 4O5BA 1IUYA 2B4JA 1S7OA 3LSKA 3X28B 1F4KA 1QQNA 2HSEB 1RC9A 4UUVA 4BWJA 1RL2A 2OC6A 3QP5A 5ICEA 1SKUB 2XO7A 4B9SA 4NDLA 4M3YA 3I55I 1FMVA 2IS3A 3M56A 2L9NA 2XMFA 3DBRB 1YTYA 1NLOC 5LL6Z 2ZMEB 2OUMA 1NG9A 4KMUX 4PHTX 1YIJQ 1OR7C 2W0ZA 4JX4A 1PDNC 5GMKi 1J5YA 4WQ5C 2M5WA 1LWWA 4DOZA 1VQOI 4CBXA 4QVZA 2EQJA 5KCMA 3LAMA 3AVMA 5AQWA 3WXKA 2IGIA 3FGUA 4FWRA 2DAQA 3FISA 4KN7X 4IPAA 1RRSA 4CJ3A 4XLAA 3THYA 4ENJA 5K14A 2NWMA 1IXCA 1RBTA 4DZPA 3CMAI 3CJTB 2JA6J 2X85A 3I71A 2E3HA 1MZBA 2V1NA 4ICLA 2XRLA 5FU6B 4FZXC 5F64A 3S1RJ 1K73O 2EILH 1O75A 4BG8A 3JCMX 2ZGYA 2HAXA 3DLRA 2WV0A 3HBLA 3D5SC 1GBQA 3HFOA 3PIOA 1VSFA 4NC6A 2AZSA 1OQKA 1UWBA 1YJ9A 4B9QA 3Q0VA 1SFXA 1N8RR 4JUVA 5T7BA 3E9OA 3AO1A 5LJ3e 1VQ6T 4F91B 3CFPA 1YE9A 2LG4A 1U2VB 3HSTB 2P8TA 3FJ5A 2L54A 3K5NA 1UG1A 4HG2A 2FZKB 1YJNT 2XDDA 3KX2A 1Q86R 2O8EA 1MNDA 5LJ3d 5M1OA 4EIAA 2P6SA 5CHZA 2ABLA 4P96A 5H6QA 1G2BA 2GAUA 3W0LA 3QEIA 4RGXA 3REAB 2L4AA 1W9HA 4Z89A 1W7PB 5M1NA 4J2AA 3J81O 4M7XA 4E7JA 2LF8A 1MMDA 4HX4A 5CYMA 2JNGA 1TW2A 4H0TB 4CK2A 4CZGA 2FBYA 3S1QJ 3PE0A 2IA1A 1VQ8N 3DRSA 3VS6A 4Z88A 5KYXA 4C0DC 3CWUA 5GAN2 1N27A 4M7DE 3DRRA 2NOHA 1OOTA 3T7ZA 2DJZA 1HLUA 3S3OA 4I01A 3CCUA 1K6OA 1M90R 4V2FA 4BJ6C 1J6ZA 3VQ6A 4OWRB 4BR5A 3J7AO 4B6MA 4AU7A 2UXCK 4MDWA 2KFNA 3C7NA 2K9MA 5LJ5g 2DMPA 4OAYA 1RIOH 4ILJA 2L3PA 3ISPA 3AO5A 2L3SA 3M9AA 4NLBA 2M8GX 4BQQA 1N33K 4OPHA 1JKPC 4UUTA 5TRDA 5J4YA 4O0JA 2J4RA 4M7AD 2KI7A 1JL2A 2O3FA 3OOPA 4KH5A 3K0SA 3C95A 2Y30A 4BNCA 1VAZA 3VEXA 2QGGA 4EA5A 2FBTA 4IWVA 4KMFA 1NG2A 1Q8IA 2DXCA 4B47A 3HBTA 4IFYA 4DJAA 2C0IA 3WTZA 2W57A 4OPKA 3E2UA 3LZJA 3EG9B 2RHKA 3K9TA 4UUSA 1VQ4Q 1VQ4N 3CCLQ 5GTIC 2LJ3A 4ATOA 3AAQA 2W42A 1KYZA 1AWOA 5DUKA 4DA4A 1NHAA 3FXJA 2E36A 4QW2A 1JUMA 1P2FA 3JCMg 2DPPB 1YJNI 4AC0A 3PQJA 1GXQA 2PZSA 2D1HA 3EUHA 5C24A 2MG4A 2EYZA 1JJ6C 1Q7YU 1WXUA 1B9FA 1POGA 4C1NK 1ETQA 2XVCA 3OIPA 4B3XA 3CG7A 5LLQA 1YTAA 3VUZA 1PCXA 1G6NA 3LZIA 3OYYA 4KBMB 3M0SA 4E9GA 5FKMA 5AQQA 2OPPA 1TL8A 3CCST 1XQSC 4AG2C 4DG1A 4Z2YA 3DPUA 4RTYA 4A4FA 2LBFB 1A0NB 5C44J 2LMJA 4JRPA 2L7FP 5CVIA 2EVRA 3OTOK 2ZFUA 2JSPA 4P1WA 1RDWX 4CJLA 4HAMA 4EEFG 1RT4A 2B63J 3CO7C 2JN0A 4MIMA 2H1LA 1X2MA 3F72A 1PYVA 2DTRA 1R00A 3HUGB 2OI3A 3Q7CA 3EAEA 1D5AA 2DKGA 1X1PA 4O8KA 5K7ZA 1Q82U 3GFLA 1A6QA 1YHQI 2IVWA 1YI2Q 5GANf 1IC8A 2KYBA 1DUXC 3JRCA 4DSJA 4K2EA 1DU0A 4YIRX 3J81Z 2KDOA 1PWTA 1OMIA 4J9FA 5DCFA 2XASA 3THKA 3M7GA 2H3EB 5HDKA 3QHSA 3I55T 2PFBA 3LH5A 3HC7A 2COMA 4G6TB 4RDUA 4PSWA 1KQ0A 5KYUB 2NRRA 1IV8A 3IAM2 2OYQA 3CD6I 2RO0A 4FWMA 1EH8A 2O88A 4ENMA 4CC3A 5DM6F 1A5JA 4JZ4A 3AG4H 4AYBA 2PUOB 2HR3A 3I53A 3K1NA 2DYRH 5B1BH 1KG2A 3I0TA 3I56A 3S3MA 2ED1A 2KISA 2R5MA 4P5NA 2AHQA 4ITVA 2WAQA 1GBRA 4YY3K 2L3QA 1YJNN 1I3AA 1M3BA 1XJWB 1LOJA 1VQPI 2OJED 3SUNA 3LAKA 1XC5A 1KQSP 4RWTA 2QWLA 3DKWA 4UXNA 2RMOA 5BN8A 4HNUA 2F5KA 3MHXA 4CIFA 5J40A 1T3LA 1TKXA 4KHSA 3GUDA 3M0QA 4XTYA 1N75A 1H1VA 4YOYA 2WSCE 1YHQA 5GMKl 1VRTA 1FC3A 3CVSA 2MLKA 3DLHA 3VOEA 2GTJA 4OMLA 2CGJA 2GQIA 3LYIA 4KHQA 4ZTJA 1B92A 4CF8A 2QQ8A 3H1QA 3BR1A 4LK1F 4GVMA 1IV0A 4PL6A 1YWOA 4JOMA 1IV6A 1VQ7T 1ENHA 4OKKA 4BVOA 3ZT2A 4DBQA 1PRMC 1KG1A 4M73A 1J5OA 4YOUA 4D9JA 3IKTA 4XLHA 5FU7B 3ZRGA 1VQ8T 4XLFA 2A6TA 2OA8A 3TKYA 2NAZA 1RR7A 1T6CA 2Y31A 2M30A 4KV8A 1VQ5I 4Z4GA 1W36C 4CESA 3L2QA 1E6HA 1OCPA 2QLZA 1FJLA 3QIIA 2GWJA 1NJIO 1S72I 2AS5F 2DK3A 2Y90A 3QXEB 3KE2A 3HK2A 5JS1A 1D3BA 1WZOA 4M78D 4RTUA 2OA4A 5K7HA 2E2HJ 2JA8J 4B9XA 3D45A 3L8BA 2R0QC 3K4CA 2CSQA 3K4NA 3EG0A 3CC2T 3HRTA 1N34K 2KIFA 4C3IJ 1K7AA 2E20A 4QCLA 4BI3A 2YLBA 1EWQA 3NARA 3IC7A 1QVGS 2YUQA 2RNAA 1VTNC 3MWPA 3I56N 2I5WA 1I4K1 5D6XA 5GIPA 3L1AA 3CJ7A 2K3FA 3OIQA 5LY3A 1ZK8A 1V1CA 1HJOA 4DFKA 2X4XA 3CF2A 5GAN8 2QGFB 3NNQA 4G7OF 3WTUC 1TS9A 1Z3YA 2OTJN 4DBRA 1WLJA 1D1AA 1WIEA 4IXAA 2JTVA 2M4KA 4M75C 1R22A 2IJLA 3CCJA 5M5WJ 4A3EJ 3LW5E 2EYYA 1W5TA 4DR7K 3ZQGA 4PGHA 5LJ5d 3V1QA 4CJ5A 1NPRA 3DMJA 4MDAA 2HHQA 1WVRA 3VEZA 3MEEA 2R3SA 1ZQ3P 2HCKA 2M0CA 3P9IA 3PX6A 5IAYA 3MX5A 1VQ4T 2OV7A 3FX3A 4XN0A 4C8QG 1FMWA 2L3RA 3QNOA 4OKEA 2E5KA 2MOXA 2BY2A 5EG0A 3ZSXA 9ATCB 2DFUA 2FBVA 3T8TA 3M8PA 2ZC2A 3LFKA 4HT8A 2FF4A 3MN7A 4O5FA 1QW1A 3AAPA 4L9JA 1K9AA 1J09A 3FXLA 4J83A 3PIPF 1JJ8C 2XF6A 2PBIA 4NYFA 1VQMI 1GFCA 2M4GA 1G5VA 2ZPIB 3ZSRA 3U9DA 4HZFA 3A1YA 4PJOE 4BY7J 1HQEA 2EIFA 2K40A 4BUPA 5FB2A 2RH2A 2EAYA 1O3QA 8ATCB 5CKBA 2O5RA 4JN4A 5GAN7 1QGPA 3S6IA 3L6QA 1MJAA 3BY5A 2IOCA 2O8CA 3T19A 3LM2A 3LSHA 2H1KA 4OFHA 4CZMA 2WY7Q 4CEEA 1VQ6A 2JW4A 4CZKA 4J7IA 2FMYA 1QVPA 2FPEA 2OZSA 4F16A 3LH0A 4M6VA 5AQSA 2NLXA 4OB1B 1NGFA 3V9ZA 1RAIB 3A0HC 4M77A 4EJZA 1JKOC 4NHJA 1OX9A 1DGWY 2GGRA 1Q86C 3IUCA 1TWHJ 3ZMUA 3V8LA 4IBNA 3VEWA 2LSOA 4N9IA 2VBYA 4CJ7A 5EEAA 3EFOA 2NRTA 4XSXF 4H5VA 5HKCA 2JK3A 3CCLI 3CCSA 3TO9A 1ZKGA 1IJJA 2NVTJ 2LC2A 3CMAT 2P4WA 3PO5A 2KQWA 4M75A 4PUSA 3P7NA 3JSMA 2YJEA 3QUIA 4KUIA 2ESHA 4KH0B 3IS9A 1FW6A 1JLCA 3G25A 1QNTA 1PHTA 5AR0A 3I64A 5DS9A 5CLSA 4ZN1A 2IA2A 4HF0A 1AZGB 5FD6A 2RHYA 1B9NA 1TWBA 1ACIA 1YQRA 1RAEB 4MTEA 3SV3A 3HOYJ 2I8DA 1SFUA 4CZLA 1QTMA 3VUBA 2WSFE 2YNIA 2ZO4A 2IGMA 3B6OA 1SFKA 1WA7A 3M59A 1X1CA 1KD1C 5GP9A 4A3LJ 2HTSA 2WV1A 2QA4N 4LNPA 4BS9A 3DLGA 2FNPA 4JI1K 2K4BA 4ZYEA 1BISA 5LBQA 2ZJRF 3PIPA 4EJVA 4M74A 3DAWA 4IUPA 1VQ9I 4FM1A 2M7AA 3HYFA 1T08B 4NC8A 2NZTA 4XAXB 1RCHA 3CQXA 3GXOA 3E1SA 3NVMA 1NK2P 3CCRN 3H3NO 4CJKA 3A5LC 3EUKL 3QBWA 3QIOA 4GKKK 2KFDA 5LGUA 4JKEA 2FSWA 4LD0A 3WNFA 3OYBA 4M7DF 2BZYA 5F0HA 1QPMA 2WSEE 4DV3K 3DLLL 5KYYB 1KAYA 4K43A 1VQMT 1VQOA 4KH6A 1WHGA 3JAME 3S8PA 2HNZA 3WXMB 4CRIA 1K1ZA 1P9QC 2MWOA 4PQUA 1U78A 3K0LA 1T39A 2IVMA 2NOFA 1UGSB 4N9HA 4RG8A 2QDLA 2QCOA 1U6GA 5DM7R 2M1HA 4A59A 3K1MA 3PX4A 2WOMA 3Q9VA 5LEJA 4HLXA 2JVGA 1YI2N 4Q0BA 4BQLA 1Z9QA 4J9HA 1XGSA 3E5UA 3OYDA 5BRDA 4AVZA 3THXB 2E5QA 4F04B 3S15J 2BXZA 3CFRA 3ABMH 2RHIA 5AQUA 5E20A 1S72Q 1E4GT 4EGYA 1HF0A 1U6ZA 4IQJA 5GAHP 3SQ2A 3IWZA 1IN6A 2KYMA 1HX1A 4LH5A 1H3HA 3ULQB 2J6FA 2V51B 4FLZA 4L18B 4DQ2A 3T1HK 2IVPA 1IN4A 3F10A 2OAZA 1YIJI 2CW8A 1NE8A 4CGZA 2YU9J 2RK2A 1V5FA 1YJ9T 4OO1J 3FM3A 5ICCA 1NLVA 4DYQA 1BYMA 5FKNA 4R0KA 2RA2A 3CUOA 4CGJA 4KITB 2Y48A 3V6DA 2K4YA 3C6TA 1VQOT 2RQRA 1I5OB 1YFNA 4DTPA 4QT7A 4H5TA 1QKXA 1T0FA 4OMZA 3VYTB 2X3WD 1HR0K 2VJJA 1SKSA 4DEYA 4WF9L 3G10A 4DOWA 2MFZA 2K3YA 5JVGL 4BHPA 3F73A 1NNEA 3I5UA 1W97L 1FP1D 4BACA 5KYWB 2QYOA 4FT8A 3CC7A 1TWCJ 3DEWA 4OVAA 5J1UA 4LDYA 1JGSA 3LOCA 3NGZA 1Y8QB 2E19A 3W6JB 2NUPB 3QZ9B 1YJWT 2GXGA 1NMNA 5CKFA 4C2TA 2VGMA 3G4ST 3AHUA 1M2VA 3UDCA 2UYTA 2DIGA 3VQAA 1HW1A 1XMKA 2L8DA 2HEOA 2BHYA 3AA4A 2CQKA 5EYRA 1UFMA 3CXCS 1KXPA 2ZQBA 3EY1A 2V1DA 3AL0B 3DXJF 3TEDA 3F8CA 3SFMA 2KY9A 1GXPA 2LQKA 4BRPA 2YHWA 2KKOA 4EJUA 3D5RC 3DCFA 4ZYDA 3AA2A 3FC3A 3LSGA 3H0FA 5HLFA 3CZ6A 1OEBA 4E0DA 3PNYA 1R6RA 1HSTA 3P9KA 3CM5A 2XGEA 4DB3A 3OJSA 2KGTA 1NG6A 4FW2A 3C2BA 1S1TA 1WRJA 4CFBA 2XI9A 3OS1A 2ROLA 4H4MA 4B48A 3GIBA 1DP3A 2FEZA 4X1VA 5IT9K 1WXBA 3JTGA 2EFPA 2QWWA 4BUGA 3PO2J 1RI0A 5GAOl 3LANA 3FK7A 1BDGA 4A53A 1BA0A 4Q5SF 2KMUA 4IOXA 1Q9YA 3K4KA 5EGOA 3BW1A 1OZ3A 1D0YA 2EIJH 2F5FA 5AQNA 2LC4A 1VQKQ 2E3IA 1WAFA 2NOGA 3CMAN 4AHUA 1BR4A 4BRIA 1OYIA 3QYBA 1LFPA 3BG7A 4OLAA 5LMUK 3CDLA 4PNOA 4I6ZA 5CR2A 3GTKJ 3VPRA 2V9VA 1HKSA 2EIMH 1QQOA 3K2ZA 3IWFA 3EGDA 3D0PA 3HL2A 2DILA 1M27C 1BA5A 4BL0B 5FO5A 1VI0A 2A6HF 5IT3A 3HRUA 4EJTA 4JQFA 2X4YA 3OA6A 3VQ5A 3NTKA 4RCHA 2ZCFB 1IG7A 5K7FA 3H41A 3VA0A 4BQOA 1QU3A 2R5YB 1Q81R 4BC5A 3TW7A 1W2BP 3HM5A 4WF2A 4A5MA 1JCGA 4KBOA 1N6QA 5A2QE 1Q86U 3LP1A 4BHCA 3K1PA 1OH8A 3ULEA 3JAMO 1TTHB 3V42A 1ZLKA 1R0AA 4L0YB 4ID5A 3NVKA 1U3OA 3HFNA 1BI1A 4FZYA 2FNAA 1BI4A 2IGKA 4LY7A 4C3HJ 3K2AA 3QODA 2IBDA 2Y4XA 1FKOA 2FF6A 2Z99A 3U2RA 4BGBA 2QTXA 1S1XA 1VQLN 3FF5A 4QOZB 3CJRB 4JD2B 1LOTB 1XWLA 3SUOA 3NWSA 1KA8A 4QVDA 2WB1N 4FJMA 3QJ6A 1SSFA 2FOKA 2QSHX 1MD0A 2H3GX 4KA4A 3G6ET 1N3CA 4CEDA 4HKEA 3OR2C 2F2VA 2QVOA 3HRSA 1HBXG 1VSJA 1RRJA 2LTPA 5FRNA 4H0XB 1ETOA 3FZKA 4XLEA 4X0GA 4O55A 2M9HA 1LDKB 4OMQA 3J7YJ 1Z67A 3MWMA 1Q82O 1KVAA 3FLGA 4FETA 2D8HA 3X20B 4MDBA 1KG3A 4YFNF 2QM1A 1ZA2B 4CBUA 1MHNA 4MO5A 1GCQC 2P5KA 4DS4A 4B9TA 5AJ3K 3THVA 4MLOA 4KTQA 5J2PA 3FZFA 4CJ4A 5A2QZ 4J9IA 3F8NA 2HEQA 2BZ8A 3H3VK 5GANe 1VQ9Q 3HG9A 2YRDA 1VQLA 4OAZA 2W48A 3KHYA 4UC4A 1UECA 1O3RA 3QERA 1KG7A 1PU6A 4DTNA 5ADXA 2NVUB 1SD5A 2UUAK 3LA7A 1MBKA 1QVGA 5HRSA 2XSJC 3HSBA 2E7WA 4C8QB 4UOBA 5DTDA 4HX7A 3SBTA 4E9EA 1ZGJA 3BJOA 4DSLA 4L6V5 4KRFA 2AKLA 4EM2A 2X6XA 3RSEB 3M4GA 4LDWA 1K61A 1YS7A 1YBYA 5H20A 3WNEA 3BG5A 4UHTA 4C5IA 2KJBA 1UFFA 5AQMA 2P0PA 1TAQA 2O6GE 4PFOA 2WB1A 5CJ9A 2I2LA 3RJPA 2M87A 1R4NB 1E7OA 1M90U 3A8OB 4AVPA 1ETVA 1JBMA 1S9HA 1EX4A 4O4GA 4BB7A 3CHWA 3BOQA 3QICA 3MEDA 4FM0A 1LV5A 5F27A 3GFMA 4CJPA 1SFOJ 3GDQA 3R61A 4N0AC 2P9NB 2HMIA 2X4WA 1V54H 4DTRA 3CJ9A 2D5RA 4ZC3A 4RGSA 1XX5A 2Q1ZB 1QVFS 3D6RA 3J80O 1MH3A 3L2RA 2RHXA 1O13A 5CYQA 4JKHA 1XQOA 3I55Q 1X19A 4JLHA 5GTHC 1GXIE 1R9TJ 2W82A 3F2KA 1MWKA 2O8DA 4OIPF 1K76A 3I9QA 1GLLO 2HNIA 3DKMA 4KGZB 4JKGB 3U4LA 3HB9A 2DF6A 3KZYA 1QQMA 2FE3A 2VUBA 3O3GA 4B23A 1AA7A 5AQLA 3PIOL 1XCBA 2OQGA 5DMRA 1A5VA 4DR4K 3AVLA 1HYVA 3OH9A 3CCLN 4BE0A 1Y07A 2ZJRL 4U7DA 4M3XA 1JJ2M 2XRIA 2OPTA 3IH3A 3ZOBA 1XG7A 1QO0D 1RT5A 1FJGK 4BDZA 3CCUI 5LMNK 3IRQA 3C6UA 3BR2A 2LTOA 3CCQA 3THYB 4A4EA 3F9KA 4M9ZA 2RF0A 2UU9K 1J9AA 1IKWA 5EF6A 1K73R 4J2DA 1S1WA 1X9SA 1MNEA 5IY5H 3K70D 4BRCA 1VSKA 4JJNK 1W0HA 3DM2A 3CC7N 1XHXA 3OSFA 2QA4I 3LSTA 2P5OA 4CEFA 1G99A 1U0JA 2K57A 4GY2B 2EZKA 9ANTA 1TNSA 2PJPA 4L5JA 5BPDA 1NGEA 5EG2A 1MBJA 3OS5A 5DDGA 2CV2A 3ABKH 1M1FA 3H35A 3I56Q 1T33A 4AIDA 3MQ0A 2GQQA 1BR2A 4HV6A 3GBTA 7AT1B 5ILVA 3PGGA 4AH9A 1CZ9A 1B34B 1MUYA 3HJFA 2VASA 4MLHA 3A03A 3H9JA 4EHTA 1WLPB 2K5FA 1TZLA 2KIMA 5IPAA 2F5EA 5K5OA 4CF1A 2E4LA 3DV8A 4YOTA 1ZGAA 1N25A 1QZEA 1U8BA 3F6OA 3TDUC 3HPGA 3CMEQ 4OJRA 2W04A 2CYZB 3M1EA 4FJHA 2K9NA 5FKKA 3TOAA 2L02A 3OIOA 5GJVB 3LGLA 4JJCA 1U06A 4B8CA 3TAPA 3I4PA 4C8QE 1Y71A 5I21A 2E6NA 1GLAG 4FE4A 3ZQCA 4IHWA 1KC8U 4XBFA 2XKOA 4NS5A 1SL2A 3WNGA 2QA4Q 3SZTA 4A3JJ 2M45A 1WSHA 3KKSA 4XIDA 3N4PA 4ILHA 4FJXA 4M75E 3GW2A 1Q86O 1D0ZA 2KLAA 5ILSA 4JEPA 1Z3XA 1LEAA 3E0JB 3J7YP 3R6MA 3RTVA 5AQHA 3ECHA 2DDBA 5EC7A 3C0CA 3CD6T 2PYLA 1D1CA 5JLFA 3MX2A 3ULEB 4B9LA 3FHNA 1OQYA 1I6HJ 2STWA 1MMAA 1U5TB 3CCQN 2AO9A 3J80Z 4FCYA 5E84A 2IG0A 4CJRA 4NCBA 1R58A 4E47A 4ELUA 1GCPA 4B3RK 2DFHA 2ZJQL 4A61A 4R55A 1YITT 3A01B 5BPLA 5J1YA 2V8KA 3MEGA 3BZKA 5BPMA 1I5LA 3BTIA 1LJ9A 3L2CA 5C2DA 1UAAA 3NMZC 1YJNQ 2RJCA 4C0ZA 4UVAA 1OU8A 4Y33A 4ISGA 4AM3A 4KHWA 3ERMA 3CEYA 3U8XA 2DCEA 3BG9A 1NK9A 1FP2A 5B8HA 2R7QA 2HOEA 4UB8C 3DXKA 3K7AJ 3VW4A 1Z7UA 4KT5C 2HU9A 3D0SA 3I8BA 4GV3A 1F43A 2P9IB 1ODDA 2CS3A 3KP5A 2OTJI 3ULRB 2KMTA 2CV1A 4LB6B 2XC7A 1V4SA 2D1KA 5F1JA 4IOCL 4CC4B 2ZPBB 2KFZA 1VZ0A 2HXIA 4XICA 1MMNA 4FLWA 2LRDA 2EH3A 4WXDA 5CVVA 3TTFA 2DAOA 1K8AO 4Y4RA 2ZB9A 1OPLA 3QINA 3WG9A 2JT4A 4W5TA 2H6BA 1Z7LA 4XM3A 1FYNA 4UY8I 3WGHA 1JUPA 1UMQA 3CC4I 4WCEL 1I07A 5GAN6 2IRFG 5AQVA 1V76A 1WJAA 3A5ZB 1HDDC 1G3WA 1XGMA 3DLKA 2ASMA 1JKHA 3RDVA 3OW2S 2W03A 2O8BB 4X9CA 2Q0RA 4RTZA 4LF6K 1C6VX 2BXYA 3CF5F 2Q2EA 3A2KA 4E19A 4CI6A 4BI8B 3B6CA 2ZF5O 1YW7A 2YX4A 1EKEA 1EV7A 3TMOA 3B8AX 4OLBA 3OGDA 2E1CA 4CZIA 4B3SK 1GT0C 2EFQA 2AXTC 5EZHA 1REPC 3CCLT 1BW6A 1WJCA 1ETXA 2R5ZB 4FPAA 2E70A 4GFBA 4LLLA 2DPUA 2P9KA 1M3AA 4LF7K 4RMOA 1OISA 1DPRA 3MFKA 2DYIA 1NEGA 4BC4A 3V7RA 1RDBA 2P9NA 4FSSA 3CVTA 2GZWA 1E17A 3OA9A 2K4JA 3H1VX 5GMKe 5I11A 4CUGA 2K85A 4QIWN 3GBQA 1WI7A 2JS2A 3QIPA 3HHTB 5GIOA 3VU3C 4AFZC 2M16A 1MKMA 1U8RA 1LDJA 5E3MA 3CCUQ 3NH1A 4C8OA 2GELA 1V55H 5ICFA 3L00A 2VWKA 4E7KA 4CJWA 3UKUA 4F17A 4DR2K 3OYGA 3FWEA 5BR8K 2MWPA 4OIOF 3BY7A 2BY0A 5HLTA 4CGGA 2EQIA 1T6DA 1I50J 1QVFP 3R9PA 2JG6A 2X1EA 1TT0A 1BG3A 4B1YB 2FBIA 5GANj 1YT3A 1XPXA 4E7ZA 3JR9A 4FWQA 4RA2A 3FMQA 5AFUH 3BP8A 3HRMA 3MKWB 2EK5A 2KE9A 3KP7A 4O5VA 2QI2A 4C92E 5KH6A 1QVUA 1LW2A 2HDCA 2VJ5A 3HOSA 4ESBA 2Q2EB 3K4JA 1VQPQ 4IRGA 1Y0UA 3TABA 1Y39A 3O08A 3F8FA 3KKRA 2DX1A 1JRIA 5TKYA 3WGIA 2L7KA 1WB9A 3PUFA 5FRMA 1IUFA 4IO8A 3J80K 2CO5A 2E6ZA 1YX3A 2DBBA 3OYNA 3IL2A 5J8CA 2HVSA 3LDNA 4PKIA 3ZMZA 4XK8E 3QEPA 3ZSZA 4OPAA 2R7SA 5C0YA 1KD1O 3HEFA 3OR1C 4KO0A 4OGCA 1ON2A 3O2PE 2A40A 3PFSA 2D4WA 1GHCA 4FWOA 1PD0A 4IO9L 2CREA 2GUPA 4U0YA 4IUTA 1BGXT 4NXNK 1ZRDA 2UXXA 4CICA 4OGEA 1RETA 3KK7A 4I2PA 1XI1A 2VWJA 5C4JJ 3I0XA 1LMZA 3EGXB 5AQYA 2G8WA 3OMCA 1Z21A 2JVHA 3V9UA 3GTJJ 2Y0SN 2DK5A 5ED4A 3SCXA 1MBFA 1YITN 1X6OA 1EFNA 1BU6O 4JI0K 1BI0A 2D0QB 4FWLA 3REOA 3WTSC 4K25A 1IO6A 2A1RA 1LPLA 2HNHA 1BM9A 1P59A 1AD5A 5M1KA 3ZX0A 5M5YJ 2AA4A 3PX0A 2KBTA 1JLGA 4C8MA 1MUNA 4Y1CA 2G8KA 3P1GA 1IGUA 1H89C 2CQQA 4PJNA 1KVCA 4IFEA 1OVYA 4BBRJ 1KQ1A 4N0AA 4U0VA 3A5NC 3FZMA 2LY1A 5GAEP 1C0FA 4N76A 4OIQF 2Z1DA 5HL7L 4PKCC 1O1WA 4G8XA 1R0CB 3LAJA 4FJLA 4QQGA 5BOXA 2O8KA 3LDSA 2MF2A 3P8HA 1MSFC 5TKWA 1UOCA 1Z05A 5CO7A 1KAZA 3W2AA 1X2QA 1ETKA 5KPRA 2VT3A 1JXSA 1RAFB 2EQRA 2E10A 3PIOF 2E2NA 2QWRA 5A0GA 2RN7A 2DRKA 4DR3K 5D3GA 2QA4A 2GEMA 1IGNA 1OYWA 1OCTC 2MK5A 4H5NA 5HS9A 3CQZJ 3TSWA 2HL3A 4NLCA 1DDNA 4YNQA 4M78C 3CCRA 1BOAA 3PVQA 3M54A 1OKJA 2WACA 4M9XA 1Y96B 1YI2I 1YHQQ 1TQPA 2Q97A 3RMSA 2CZ6B 1DLOA 2XHIA 3IH2A 1S7AA 2MYSA 4AG1C 3M0TA 2GOMA 2DTOA 4J6YA 1A6IA 1KQ8A 4JZ3A 3ENBA