4BDYA

Pfv intasome with inhibitor xz-89
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
total genus 110
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bdyA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4bdyA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4bdyA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4bdyA03
4CJKA 4I2QA 2ETJA 4E7HA 2DTUA 1UA1A 4OVLA 4B9NA 1TL3A 4CGJA 4FJIA 3RTVA 1RBSA 3IRXA 4ELTA 3Q1JA 3H6ZA 3OQ5A 4M42A 3VN5A 3OYMA 2X78A 3L2UA 3S3OA 2G8UA 3HK2A 1HJRA 1N5YA 1S9EA 3LP3A 4BDYA 1JLEA 1FXXA 4JRPA 4JLHA 3QEWA 4YFUA 3SUNA 4RW9A 2HHTA 2R58A 1WJSA 1IH7A 3LGLA 1X9SA 4FLVA 4OLAA 4KV8A 4CIGA 1T7PA 3DLGA 5M9OA 3DRRA 1NKCA 5HBMA 4FJHA 3DMJA 4KHYA 3OS0A 1UA0A 3DRPA 3OYKA 4O44A 3LP0A 5HRNA 4FLXA 3E9GA 3ULDA 2ZD1A 2A1SA 4N41A 5KE2A 1ZBUA 3CFOA 2VG7A 4KTWA 4DFPA 4CESA 3TARA 1REVA 4BACA 3ZSZA 4C5HA 3KLGA 4DMNA 4LH4A 4DSFA 1RI0A 4E7KA 2XY8A 4E1NA 3HVTA 2PYLA 5KE3A 2ATQA 4FJGA 1HNVA 4M41A 4EDUA 4DFJA 3AVGA 2PQWA 2EX3A 3B6PA 4KHSA 3UIQA 1XWLA 3SUQA 4EP4A 3CM6A 4HCCA 2B8AA 3K2PA 4QW2A 4DSJA 4AHTA 2LSNA 3LZJA 3VQAA 1CZBA 3SCXA 4C5GA 3AVHA 4CHQA 3FC3A 3TWHA 2HHXA 4B9VA 4W5QA 3JSMA 1JXEA 1WNSA 2FHDA 4CEBA 3O3HA 4FJ7A 3V9UA 3PX0A 3V1OA 2BANA 4CJWA 4R5PA 3QLHA 4FJ8A 2P5OA 2DFEA 1TK8A 2QK9A 3L42A 1S9GA 4PA1A 4BDPA 3KKSA 3SJJA 4DF4A 3LX7A 2E6NA 3KLEA 3P1GA 4B3OA 5C6SA 4W5OA 3ISNC 1WAJA 1HYSA 2Q3SA 2LDMA 1RT2A 4CJTA 5J26A 3RR7A 3THVA 2RF2A 4YNQA 3L2QA 4GVMA 2KQ2A 1B9DA 4Z4FA 1D8YA 2YKNA 2G8KA 2O4XB 3AA2A 1YVUA 2FBYA 4DSKA 4IUQA 1R0AA 4MQ3A 4CIEA 1BCOA 4BDZA 3BGRA 3V9WA 2X6SA 4CEFA 2HMIA 2JLEA 3OYEA 5KTQA 2B6AA 4GY5A 1KFDA 4CJUA 3SPZA 4EZ6A 1RTDA 3AO4A 5JS2A 5CY4A 5KI6A 2VG5A 4HCZA 3MXMA 1BCMA 2CKKA 3ZSRA 2RHIA 3MEUA 3AVAA 2RHZA 4IG3A 4CEZA 3DLHA 3QIOA 4PWDA 3RMCA 1SKRA 1C0UA 4IUPA 4DTPA 1TAQA 2EQJA 2F5KA 3NH1A 1SL2A 4CECA 3MXJA 4E1MA 3FDRA 1IKYA 1KTQA 2P1JA 1XHXA 5C0MA 3QINA 4QOZB 4N4IA 3E9FA 2OYQA 1U4BA 3KK1A 4DSLA 4KI4A 2Z1GA 4HHTA 3QEXA 1FKOA 2YNHA 2HHSA 2HB5A 1SV5A 5HRPA 1RNHA 1OYXA 1KVAA 4RG8A 4FJXA 2YNIA 3NF8A 5CZ1A 4Z4HA 3LAKA 4F3OA 3ME9A 4F3TA 3HPHA 2GV9A 4LSNA 5HP1A 4F8RA 5KCHA 5FDLA 2EQMA 1KVCA 4DQPA 4JS5A 4DFMA 2R5AA 3QIPA 4CF8A 1BIZA 2HVIA 4DTMA 1LWFA 2R57A 2EQUA 1S1TA 1A5VA 4ID5A 3ASMA 4C8NA 3LWLA 4ZTFA 2X6NA 2F8TA 2F8SA 3U6FA 3MP6A 2E6MA 1X9MA 4A4FA 2EHGA 3LP2A 4CHPA 4HTUA 3QESA 4B9XA 4CHOA 3LH0A 3K57A 2KTQA 4E19A 4B8CA 1J54A 4C8KA 2VWKA 3CG7A 1RT1A 1SKSA 4FJLA 1C1BA 1NOYA 4CFCA 3PFSA 4AHSA 1BI4B 3SQ2A 1NK8A 3F73A 3MEAA 4OJRA 4TSXA 4M3XA 1JLAA 2Z1JA 1TGOA 5E41A 3DLBA 3V9SA 2QKBA 4DF8A 2DIGA 3C4SA 4B9TA 1HYZA 1NJYA 4KAZA 4OGEA 1B92A 4IBNA 1TKDA 1C0MA 4M3UA 4A4EA 4QQDA 3U3YA 4KPYA 1I39A 3AVNA 2OPSA 1I3AA 3AVMA 3M8RA 4BD3A 4FW2A 3ZSYA 3VQ8A 2GF7A 1WJRA 4FLYA 4CEEA 2PZSA 1JLQA 3MP8A 4DTOA 5DMRA 4RW8A 2D5RA 4CF2A 2E5QA 2GBZA 1JLFA 3OYFA 4CJPA 1RBRA 3L2WA 4RW4A 1RDBA 4ID1A 5C25A 4FLZA 1LAWA 1ITGA 3C95A 3VQ7A 4B9SA 4H8KA 4FU6A 2A1RA 2X4XA 2W42A 3ITHA 1K6YA 2XO7A 3VQPA 4FLUA 3RMAA 2KW4A 2JTFA 3NTKA 3DOKA 4IUUA 3S9HA 4IKFA 3FEOA 3SI6A 4AHCA 3NTHA 3V4IA 3OA6A 2XK0A 2OZSA 2VG6A 3RMDA 3PO4A 4NYFA 4FM2A 3NGIA 4HCBA 3LLRA 3IAYA 3OYBA 2RKIA 1KFSA 4KRFA 4CGHA 3LP1A 3AA5X 4KB0A 1JL1A 3LANA 1MU2A 4J2AA 4F2RA 2ITGA 1VSHA 2IS3A 4DTUA 4FL6A 1RTHA 2QKKA 4JRQA 4N4GA 4E7JA 1NJWA 3O3GA 3QJ6A 3C94A 3LALA 2OPRA 4H4OA 3V1QA 4DU1A 4K8XA 4EP5A 2DFHA 1VK0A 3DLEA 4ZTJA 3M9QA 3NH0A 2HNYA 2ZQBA 5FRMA 1TKTA 1C1CA 3AO2A 3WNEA 4N56A 1WSGA 1SSFA 3CYMA 3DLRA 1CXUA 2G8VA 1RCHA 4E7LA 1VSJA 3CQ8A 1S5JA 3SYZA 3SD4A 4O4GA 4DTRA 3HP9A 3OS1A 4C5EA 2GUIA 2HHWA 4C5IA 3NGZA 4DSEA 4J2DA 4GMJB 3V9ZA 4FVMA 3WNFA 2G3RA 3AO1A 2HVHA 5IAYA 3CEYA 3NGYA 3TAMA 2RN2A 4UQGA 3MEWA 3AVCA 3ZT2A 1BL3A 1WSJA 3H08A 1U48A 4F4KA 2Z1HA 3PUFA 4CEOA 1X1PA 3KLHA 4PUOA 4IUVA 2RI2A 3NHGA 4W5NA 3OYCA 2L3RA 3HXMA 1YT3A 1VSKA 1RT5A 2RI3A 3PNWC 5C42A 2Z1IA 3QEPA 4DLGA 4J2EA 4AH9A 3QKJA 1JKHA 1QHTA 5FRNA 3IG1A 3C6UA 2EKOA 1WLJA 4E89A 3VQ4A 4L8RB 3SQ4A 2R7YA 3AVIA 1HYVA 3QNOA 2WACA 3NFAA 3SUOA 5KH6A 2X4YA 3OYIA 5FROA 4Z4IA 3LDSA 4FK0A 5KGXA 2GFUA 2O4GA 2RPIA 5JS1A 4CJ3A 3OYHA 3T3FA 2DFFA 2YNGA 2DIQA 2RHUA 1EP4A 3ZSXA 3SQ0A 2IAJA 3TI0A 2YKMA 3DLKA 3OMGA 4OKJA 2L8DA 3MO8A 1Q9XA 1RILA 4O55A 3QERA 2YHAA 4X34A 3MEDA 1NJXA 5J2QA 4CGIA 3G0ZA 1NK4A 3MEEA 3HPGA 1MHNA 4PY5A 1ZBFA 3AVLA 4CIFA 2RHXA 4CHZA 3AVJA 4OGCA 1IKWA 5J2NA 4QVZA 5KCOA 4RW7A 1RBUA 1GOAA 2KZMA 1SL1A 5J2PA 3TAQA 1VSFA 4Q5WA 2BIVA 1DTQA 3U3GA 4K8ZA 2K3YA 4DQSA 4DTSA 1RT3A 3BDLA 1LAVA 3TAPA 4DG1A 2MWOA 3ZT4A 4DQQA 4FZXC 2IDOA 3O3FA 3OYAA 1G15A 2LRQA 5DK5A 4M3TA 1Z26A 1ZBIA 4I9QA 3DLMA 4DFKA 1TVRA 4CRIA 2QQRA 3S6WA 4FJKA 4I7FA 4C8MA 1HPZA 3NBPA 1H3ZA 4WE1A 3HSTB 3KIOA 3KUFA 2XY7A 2FBTA 3FLGA 4PLIA 2NUBA 3AV9A 1JLGA 1T03A 3EY1A 1BISA 2R5MA 1F21A 3M8QA 3L3VA 1A5WA 3JYTA 4OKKA 4Z4EA 4CK1A 1RDDA 1NK7A 3NAEA 2O4IA 3V1RA 3DM2A 3OMCA 1IKVA 1DLOA 3L8BA 4NCGA 3CM5A 3OJSA 1D9FA 4FJJA 4QQGA 4DS5A 3QEVA 3B6OA 1KSPA 4CGFA 1NOZA 1WAFA 3F70A 4KHUA 1OZ2A 1J5OA 3T19A 1L5UA 4DS4A 4II1A 3G10A 4HUFA 3KKRA 1LWCA 4ELVA 1NJZA 2FC0A 3DI6A 3HT3A 4GW6A 2MWPA 4AILC 1YTUA 1C6VA 4HVJA 1W9HA 3OB9A 5KRTA 4IUTA 1BGXT 5IN1A 1U04A 3QO9A 1O1WA 4IFYA 3TANA 3LWMA 3PX4A 1TKZA 1BHLA 1TKXA 4AHUA 1NK9A 4DTJA 2ZE2A 3DB3A 4ZHRA 4LH5A 3OJUA 4DQIA 4NYNA 1WJQA 2XHBA 1KLNA 3PMIA 1U45A 4PQUA 1VRUA 4PL6A 4OPKA 1S1VA 4B9LA 1WSFA 3MEGA 3L3UA 3VQEA 3M8SA 4DSIA 4QQ6A 2G8WA 4QCLA 1RTJA 3ZCMA 3V9XA 2BUDA 1QE1A 2K3XA 3ZSQA 1HQUA 1NK5A 2EQKA 1BQMA 4FM0A 3HM9A 1OI1A 1ZBHA 5KGWA 3A2FA 3OVNA 1VSMA 2I5JA 4CCHA 4B9WA 4NZGA 3NF7A 3RR8A 4QAGA 4FCYA 4LD6A 2B4JA 5C24A 3QNNA 2OZMA 4CJ5A 3ZSVA 1TK0A 5I42A 4IG0A 1T05A 4Y1CA 4A4GA 4AHRA 1HRHA 2XY5A 3EZ5A 1XHZA 3V81A 3SUPA 4DU3A 3DYAA 5HROA 4CF1A 3SV4A 4FK2A 1U47A 1RT7A 2JGUA 3VQBA 1OZ3A 3OYJA 3LAMA 3FFIA 2RJFA 1ZBLA 5D6WA 3P83D 3QIIA 4CJLA 1W0HA 1LW0A 1NKEA 5D6XA 1NKBA 1L3SA 2FBVA 1QSLA 3TABA 3UWNA 4CK2A 1HNIA 3NH2A 4N76A 3SPYA 4FLTA 3V6DA 4CEDA 2B5JA 4CJRA 3DOLA 4ELUA 4N5SA 4RG2A 3TAEA 4EZ9A 3META 5J1EA 3KK3A 3OY9A 1B9FA 5K14A 4JS4A 1FKPA 4CFAA 4CFDA 4OKEA 1Z25A 1WSIA 5D3GA 3M8PA 4M3ZA 4DU4A 4CJFA 3NTIA 5HRRA 2YRVA 3VA0A 2AJQA 3O4NA 3MECA 4BWJA 2HNDA 4CF9A 3ZEHA 4J2BA 1LW2A 5T7BA 2JZ2A 3PMTA 4FYDA 4OPJA 4N4HA 4UC4A 3PO5A 3VQQA 1EKEA 3PX6A 3ASKA 3S3MA 2FBXA 2E4LA 2EFIA 4Q5VA 2QXFA 2KFNA 4M3WA 2LVMA 2WOMA 4KREA 2F96A 3WNHA 1FK9A 2D0AA 4L59A 2IGIA 4Z02A 3ZT0A 3NF6A 1DTTA 2BKDN 2HHVA 5I3UA 2YHBA 3QBYA 4CFBA 1EXQA 3OYNA 4FM1A 4FW1A 5D6YA 1TV6A 2RJEA 2DY4A 1L3UA 4Z4GA 1SUQA 2LCCA 1CZ9A 1JXBA 4MFBA 3H8ZA 3SQ1A 2Y1JA 4XIUA 3P8DA 1J53A 1RDAA 4CJ4A 4DTXA 3KLFA 3HJFA 3ZSWA 1GOBA 3RMBA 5CYQA 4BE2A 2NLUA 1T8EA 3I8DA 1KCFA 1LWEA 4H4MA 2RJCA 3KTQA 2BE2A 4CERA 1KRPA 3KJVA 4B8AB 2RI5A 3RRGA 4B9UA 5J39A 2X4WA 3MXIA 1XC9A 1XNIA 1GOCA 2Y1IA 4LY7A 1SKWA 1JLBA 1RDCA 3S3NA 4OVAA 4G1QA 4CHYA 3ZT3A 4KB1A 1YTAA 4CJQA 2P5GA 3NE6A 4FZZA 2DAQA 1EX4A 2G8HA 4KHQA 3I0RA 1WSEA 3VQ5A 3KK2A 1QTMA 3L2RA 2O4XA 3KD1E 1XI1A 5CIUA 1QSYA 1NK6A 3LGFA 3AO3A 4IURA 1VRTA 4FXDA 2D9TA 3C6TA 3HVRA 3K58A 1QSSA 3PY8A 2IC3A 1RBTA 3OYGA 1S1XA 3VQDA 1CLQA 1RTIA 4E7IA 3AVFA 2D0CA 2RJDA 1WGSA 1UAXA 3ZT1A 2HQEA 2M16A 3K59A 3TAGA 3VQ6A 4IFVA 3MAQA 1UWBA 1Q9YA 1N27A 4KI6A 2KZZA 1D5AA 5HRSA 5CYMA 1SL0A 4FJNA 2PY5A 1TAUA 3VA3A 2XDPA 3VQCA 1VSLA 2YV0X 2XRIA 3HL8A 3I0SA 4NCBA 1KVBA 1QS4A 3L2VA 4KKOA 1N6QA 3GOXA 4M45A 3K5OA 4CJVA 4DWIA 4C8LA 2HHUA 3TAFA 1BIUA 2KFZA 3E01A 2G8FA 4O0IA 3NDKA 3CFRA 1TL1A 3AA4A 1QQCA 2XY6A 1VSEA 2LTOA 4W5TA 4FJ9A 4E0DA 3EAEA 5KRSA 4B08A 4LD0A 2BDPA 2RHYA 3K5MA 2QQSA 1IO2A 4CHNA 1IG9A 3HP6A 1ZYQA 2GFAA 1U49A 3LZIA 2G8IA 1HMVA 1IKXA 4FJMA 3VQ9A 4KO0A 1WN7A 1L3TA 2M0OA 1KHCA 2OA8A 4I2PA 4E3SA 1ASUA 4A4HA 4NS5A 4DTNA 4DQRA 3K5LA 2PYJA 5EU7A 1Q8IA 4Q0BA 3OYLA 3AO5A 4AHVA 4KTZA 4FZYA 4BE0A 3ALYA 2HNZA 1LV5A 2IOCA 3AVBA 3KLIA 2D0BA 3HYFA 3RRHA 2BGGA 2E6LA 1S1UA 4CJEA 1L3VA 4N47A 2VYTA 4Z4CA 3NF9A 3P5JA 5CZ2A 4HUGA 1RBVA 3LYIA 1S1WA 4Z0UA 2OPQA 3OYDA 4CGGA 4NCAA 1ASWA 1D9DA 1G5VA 2X35A 1BI4A 1ASVA 3NCIA 4M3RA 1WSHA 4LSLA 3DB4A 4ICLA 1C1AA 3BDPA 4M3YA 3ZSOA 3MEVA 3IS9A 1A5XA 3K5NA 4F2SA 1S6QA 3D45A 3T1AA 1VSIA 1X9WA 3RWUA 4CGDA 1NK0A 2HW3A 3QETA 3LPTA 3SZ2A 1S6PA 4CEQA 1RT6A 4IDKA 4O5BA 4O0JA 4CK3A 3CFPA 2P0KA 3DRSA 3TR8A 4B9MA 4CF0A 1KLMA 3AA3A 3SNNA 4RW6A 4CJSA 3MP1A 3PV8A 4KFBA 2HQXA 2OPPA 4W5RA 1JL2A 1VSDA 4KTQA 4KHNA 4FLWA 1BQNA 3UT1A 4BE1A 4I9LA 3WNGA 3O4QA 4FJ5A 2P51A 4FK4A 1Y97A 2IG0A 3NNQA 2L89A 2VWJA 3SV3A 1EETA 1C0TA 4DLEA 3EYZA 4OLBA 4BWMA 1HQEA 3HPOA 3F9KA 4HUEA 3AVKA 4PLLA 1RT4A 2X74A 3QEIA 3O8VA 1J9AA 4Y1DA 2HHQA 1JLCA 4CE9A 3P8HA 3KD5E 4KHWA 3D0PA 3LPUA 1TK5A 4C8OA 3HO1A 1UOCA 2YNFA 5SZTA 2WONA 5HLFA 5J2MA 3OS2A 1CXQA 4CEAA 5SWMA 2M1HA 2RO0A
chains in the Genus database with same CATH superfamily
3WQTA 2DL5A 2BW3A 1YIJQ 3VTHA 5ICFA 5KYWB 3F6OA 2D0OA 4B9NA 4K25A 3GBQA 4FJIA 1RBSA 3IRXA 4MTDA 4ELTA 5DCFA 3OQ5A 4M42A 1UFMA 4A69C 1YWOA 3SDGA 5CVIA 3L2UA 4BBSJ 3H1QA 4OWRB 2KRMA 4PKGA 3HK2A 4YIFA 4AMCA 5BPNA 2JS2A 2VC0A 1YJWQ 3WG9A 3LP3A 4M78E 5DTDA 4CC4B 3E0JB 1JLEA 3IKMA 5F2RA 3QEWA 2I5UA 4B3MK 4YFUA 2NVYJ 2X6XA 3SUNA 1M9SA 2R58A 4I02A 2M7AA 3WXLA 1X9SA 4FLVA 1YN8A 2AZSA 2LBFA 1TW3A 1NLOC 3CF5L 4MFDA 2F6CA 1FYNA 4KHYA 3JCMc 1XGOA 2OTLT 3OYKA 1VQKT 1IW7F 2A08A 3MMYB 4EM2A 1UHSA 3ZMTA 4EJTA 1R0BG 3H0HA 2EQRA 1ZBUA 3A5MC 3L7WA 5LY3A 2QWRA 3BUZB 3VS7A 3IHUA 4KTWA 3I71A 3CWTA 3A5ZB 4YDUC 3TARA 3O8MA 1ULYA 4KBOA 3HB9A 4M77E 4FE7A 4LG0B 2OF7A 4BI3A 2NOFA 2CSQA 4JRIA 2PBIA 2XY8A 1Z91A 1QVTA 4NB4A 1EWRA 3I3LA 2VV5A 1HNVA 4G6QA 4EDUA 4F92B 3AVGA 1OX8A 1ENHA 2HS5A 4JJBA 2F48A 1A5JA 1BM9A 2DTRA 3CO7C 2PMZA 4JX5A 1UG1A 4CCOA 2J7IA 1SEMA 2FZKB 3LZJA 3VQAA 2GXAA 2PJRB 1VQ5I 4ZNXA 3OBYA 2WY8Q 3F8BA 2XAFA 4CHQA 3RCOA 2V1QA 1JKRC 1WJFA 1JHHA 2RQUA 5LJ5h 3G6ET 3QOPA 4A5MA 1EA3A 1LB2A 1CQTA 1E4FT 4CEBA 4B8XA 5ICCA 1RAAB 2BANA 4M75F 1YQKA 3R0JA 1DKGD 5HK0A 1MMDA 2OTLQ 2XGCA 3A8MB 1VQKQ 4BDPA 3VYUB 4F17A 3KKSA 3SJJA 2RMOA 1A6QA 2LQNA 4FYYB 9ANTA 1QVGM 1W7PD 1I5ZA 4PFOA 2YHTA 3CCSN 3C65A 1QQJA 4CJTA 4RLFA 3HPWA 1HU0A 3G71I 4M75G 4JRKA 3JB9D 2DLLA 1G4DA 3IHOA 2DKGA 3THVA 2SRCA 3H9GA 2AO9A 3GNFB 1D8YA 4N4OB 3AA2A 5J6XA 3I9V2 3DCFA 2RAEA 3W0LA 1IGQA 4IFEA 3S32A 1BCOA 4DQ8A 1NU0A 2HMIA 3A1YA 5LJ3f 5KTQA 4CJUA 1IB8A 4FVUA 2E1MB 2VUBA 3BTCA 3O1BA 1RTDA 2O8CB 1HW5A 4ENKA 2DYSH 2DK5A 5JS2A 3UKRA 3BF1A 5CY4A 5KI6A 2NRVA 4HCZA 1D8KA 4OMNA 3S93A 3G6EQ 2L5QA 2HKOA 2W0ZA 4E6KG 1IN5A 4CZZA 2HPIA 1WNLA 2K9GA 4OIPF 3AVAA 2XDDA 3DLHA 4L6V5 2CV0A 3RKYA 1QWFA 4J9IA 3KFVA 3REBB 3HUGB 1TAQA 7AT1B 2XI9A 3BOQA 1HF0A 4DQ2A 1X1AA 4QOZB 2K40A 4K2EA 2OYQA 1UHFA 1U4BA 4B1VA 4BJTA 1UGVA 2E5ZA 2R5ZB 1FKOA 2ZJQF 2DO3A 3O9UA 3GNGA 4RWTA 2JPSA 3FXRA 3CMAI 3EG9B 3RESA 3B6CA 4GXOA 1NGDA 4Y0WA 4H5WA 1W5CC 5J3LA 4F3TA 2XICA 4CCNA 1OCRH 3H3UA 4X62K 1WLPB 4M3DA 5FDLA 2NXNB 2EQMA 2R5AA 1VQ7T 2L02A 3FRNA 2MGQA 4RAYA 1KD1U 2HVIA 3KLOA 5D5UB 4DTMA 2R57A 1TT5B 2EQUA 1WA7A 1NBWA 1M2VA 1QKXA 2F8TA 2CQ7A 1YWPA 3DAWA 1NGGA 4Q4ZF 1AZGB 2EHGA 3ZETB 3CUQA 1RUWA 4ISFA 2HNHA 2E36A 3BG7A 2KTQA 4E19A 5GAGP 3H0FA 5AT1B 1XSDA 5AQNA 1M3HA 2JZYA 3LDLA 4FJLA 1I50J 4QSHA 2E8AA 4CFCA 3N97A 1A0NB 1BI4B 2EWNA 2NS7A 5GJVB 3IKVA 3MEAA 2VN2A 1ETWA 2M02A 4A4KA 2PEXA 4C0DC 2RQWA 2M9HA 2VVKA 3H3OB 5DD4A 3WE3A 4YIIA 2QKLB 4XMYA 3LWIA 1OPCA 5E41A 1FBSA 3ZLJA 2QKBA 3EFSA 1VQ5N 1IHVA 1G83A 1WBBA 4RA2A 2K9MA 1HYZA 4UUVA 4KAZA 1UTIA 1N6AA 4M75C 3HYIA 4M3UA 1OKJA 3REOA 2LQ8A 4A4EA 2KMTA 2N8GA 2CP0A 4PNOA 4B1YB 1I39A 2F5TX 1VQ7Q 1KO9A 3TO7A 2Q0UA 2DERA 3WE2A 3OW2P 2JRMA 1WJRA 2GF7A 2Y2ZA 5EGOB 1HJOA 4CEEA 3S2WA 1BA1A 2PZSA 2CP2A 1JLQA 4DTOA 5B1BH 4HT9A 2QKMB 1E2XA 2D5RA 3A5OC 4CF2A 2Y4XA 3BTLA 2DA5A 4CJPA 2K6DA 3WTTC 1RBRA 2F5FA 4JKCA 1EH7A 2HDWA 4XTXA 2OV7A 4E4HA 3VQ7A 4B9SA 1WEFA 2DJNA 4C3JJ 4CC3A 2STWA 2JTFA 2WY7Q 3JAME 3PIPL 4IKFA 3HG9A 1K8AO 2E1NA 4AHCA 3V4IA 5KN8A 3MFKA 4OOIA 3JAMZ 4F9OA 3PO4A 1Q7YU 4FM2A 2KIFA 3ZGKA 3T1YK 4CGHA 3E19A 4NQWA 1JL1A 3LANA 2W00A 3G71Q 4A2BA 3M1EA 2E7WA 1Q1VA 3LDQA 3QICA 3KFWX 4N0BA 3T8TA 2O61A 2HMAA 3JB9H 3RIRA 1IBKK 2QKKA 1JRIA 4N4GA 1QZ5A 2KIQA 5F04A 3C0CA 5LHIA 3C94A 3NVKA 3SHFA 1LPQA 2H3JA 5F0XA 2BW3B 3FGUA 5GAMj 2FX0A 3QU6A 4HVWA 4U0WA 4OMOA 2DW4A 3A5LC 4RCBA 4RGXA 2R3SA 1SD7A 2HQRA 4DV1K 3ZMSA 5FRMA 5EG0A 2D8JA 1FX7A 2EIJH 4XH4A 5CKHA 3WNEA 3GFLA 4N56A 2O8DA 1PP7U 4C8QA 1SSFA 3L4QA 2XF7A 1X3UA 2G8VA 2RGVA 4KIBA 1K61A 1K9MO 1S3XA 1USSA 4RM3A 1JI8A 1ZUUA 2JT1A 1YW9A 1VSJA 3CQ8A 1MNDA 1VQMN 1OVQA 5FPEA 1B59A 2O8XA 4B1ZA 3CMAN 2FL7A 3H3NO 5F6FA 3CCEN 5EXWA 2R7TA 3OS1A 1IDZA 3CJRB 2FBKA 1OYIA 2LBFB 1OFCX 5DDGA 1UHMA 4ELYC 2ASOA 1FLIA 3NGZA 3B73A 2WV0A 2CGJA 3AO1A 3KE2A 3SFIA 2DOFA 2RKHA 2Y90A 3DBRB 3O5BA 4GLKA 4DW6A 3RPUA 3PUBA 3ASOH 4JKGA 3FXKA 5BRFA 3H08A 1U1TA 4M7XA 1BR2A 2QGGA 2Z1HA 3LH5A 3PUFA 1Q82U 1R5GA 4C8QG 4P9FA 1ETOA 1LWYA 1TP4A 4IUVA 4J9DA 2VQEK 3VF6A 2GTOA 5LJVA 3HXMA 1YT3A 1VSKA 3A2KA 3PFIA 5C42A 4JI6K 3Q7CA 5LRRA 2JTMA 3K1MA 1KQSA 3QEPA 1LOTB 1G3WA 2CH0A 4JK7A 3QKJA 3CUQC 1BW5A 3CCVT 5HS7A 4X0GA 2E5NA 2RF0A 2BY2A 5FRNA 2HKXA 3JCMg 3KHYA 3CVSA 3HKSA 4JX6A 2QASA 1PRLC 1SFXA 4MO4A 2A05A 3VQ4A 1G59A 2YXYA 2LC2A 2M34A 1M2OA 5GAN3 2A3SA 4A3DJ 1BOTO 2XUBA 3E66A 4B3AA 3AAPA 3RKQA 1T0HA 2PUOB 4KN7X 4KBMB 2EJFA 1QZZA 3CCRI 2GGRA 3NFAA 4KGZB 1HPMA 5M1NA 3O9SA 1MSFC 2QI2A 3L1PA 3BR0A 1LEAA 4KH4A 2Q36A 1IG7A 1YJ9I 2HBPA 1AWXA 2NS0A 3FMRA 5JS1A 1ABOA 1VQNI 4BC3A 2YNGA 4ESBA 1VQ9T 3SQ0A 5EEHA 4L5GA 1OCPA 3GEZA 2IAJA 2EJRA 4F91B 3CZ6A 3VUBA 5AQYA 4HQMA 2FA5A 1N3AA 2ISZA 3HTSB 4LD9K 2UXXA 1RILA 4O55A 4A3GJ 3FB9A 1TWCJ 2YHAA 5LHHA 2V6EA 3T7ZA 2Q2EA 2COBA 4IRHA 3G0ZA 1ZSZC 1NK4A 1HBXG 5K5QA 4F93B 3MEEA 3BDUA 3HPGA 3SDZA 2RQQA 3CCQI 1TTHB 5HVQC 3R61A 4WYBA 4XOTA 1X1BA 2X4JA 1T6CA 2IW5A 3VSLA 3BG3A 3FE1A 2CW0F 1M90C 3MWTA 5B3SH 2Z9OA 1MBJA 1RDWX 1ZGAA 4OGCA 1N8RO 3ZX3A 1HD3A 1NYGA 3TMOA 1VQ5A 5AQKA 2QQAA 2Q1ZB 1RBUA 3MN9A 3A5NC 1S7OA 2KZMA 2TRTA 3O08A 3F72A 1KU7A 3A8YA 3TAQA 2E41A 2H3EB 2BIVA 3HZJA 2ZAEA 3QBXA 1WGXA 4BYYA 1T39A 4G7OF 1D1AA 2K3YA 4H0YB 3UKRB 4K8ZA 4DTSA 1RT3A 1X6BA 3O6WA 4DG1A 3HC7A 5AIPA 2EILH 1FMWA 1NE8A 1OH6A 2A07F 4IEEA 4K11A 3O3FA 1ATNA 3OYAA 1HYOA 2LMJA 1FOYA 1ZBIA 2FRYA 1TOVA 3DLMA 1P6RA 1VQ9Q 2XAHA 1KYZA 1X27A 1JUPA 1I1GA 1OU9A 4CRIA 3OW2M 2MCNA 1M27C 5F0FA 1QVFA 3DBLB 3G71A 3JRGA 4C8MA 4F7UA 2I5WA 5B1AH 3NBPA 3MKDA 2HXOA 1SPKA 1HUXA 3EDPA 1Z1DA 3KUFA 4DOWA 5GANe 2FBTA 3AKZA 4AIJA 3BZCA 4CGZA 4PLIA 1PUFA 1T03A 3EGDA 2IIMA 2R5MA 1F21A 4J9FA 2XF6A 1S3JA 2YHYA 2XKOA 4CCKA 4OKKA 3ERED 2HL3A 4XICA 4HNUA 1MNEA 4OMLA 2FSJA 4NUBA 3DM2A 1VQ4I 3L8BA 4DYCA 1XJWB 4NCGA 4MNUA 2DZ9A 3CM5A 3OJSA 1D9FA 3WTWC 4OMYA 4FJJA 4QQGA 4DS5A 3QEVA 4KMUX 4CGFA 4KHUA 3K1PA 2BUPA 1ZHIA 2KZGA 5LJ5g 2XPWA 3GLLA 3M07A 3T19A 3VSKA 3QB0A 3MMVA 2CP7A 4JHDA 4M7DA 3GTQJ 2D6FA 1M2VB 3TGNA 5EF6A 1UUEA 4PFPA 2KIMA 5DCMA 1NJZA 4IXCA 3FR0A 4BBRJ 3DI6A 1JT0A 2ENMA 3JRIA 2FEIA 3F8FA 2KROA 1O75A 1M1FA 3EGUA 1PVEA 3QJYA 4AILC 1YTUA 2VE8A 3P38A 5HDNA 1EZZB 1W9HA 1STZA 2ME0A 2AKKA 4BRPA 4BROA 4M7DF 1OCCH 1BGXT 1U04A 1R9TJ 5H6QA 2FB7A 1K79A 4O3MA 1O1WA 1I6XA 2DTHA 5AQGA 5GINA 2NVXJ 4PKHA 2JS0A 4BR9A 4AHUA 1OPLA 4DTJA 1MA9B 3DB3A 2CS7A 2ZE2A 4ZHRA 3FX3A 3CMAA 2CSOA 2HF3A 3L9FA 3O2PE 1NGHA 1KLNA 3J80K 4XNFA 1TUUA 1ZH5A 1VRUA 3SWNC 2OA4A 1YS6A 4JKEA 3VYRB 4M7DG 1S1VA 3H0IA 3WU0A 3OSVA 4B9LA 5B66C 3DF8A 1WSFA 1NH3A 1QVGS 5D8KB 5AQWA 3ZQQA 3I4PA 1U5SA 1YJ9N 5ILVA 3QYBA 3BQZA 2VJ4A 5M3MJ 5L8RE 1KAYA 2MH9A 3V9XA 4BVOA 3A8OB 2BUDA 3EG2A 1HQUA 2UWMA 2Q0OA 1SVMA 1NK5A 4AYBN 3QSUA 2DTZA 5KPZA 4ZYDA 2QK0A 1WZ2A 4A5AA 1O7LA 2I10A 1VHXA 5BR9A 4A3JJ 2ZFWA 4ZJZA 4W1UA 2COZA 2ASMA 2PZ1A 3QNNA 1KU2A 3CCRQ 4NOYA 4BQNA 3CCQN 4DU3A 2V26A 2RB6A 5HROA 5EDNA 1IXCA 1OULA 2IPQX 1RT7A 2JGUA 1VQNQ 1B9MA 4XRFA 1XGNA 2ZJQL 4RAGA 3VPZA 4KGXB 3R60A 4L5IA 2KRHA 2ZSHB 2J5PA 1I6HJ 4V19S 1LW0A 1WHMA 5F1RA 2IS1A 1NKBA 4RLQA 1L3SA 4D5CA 3UKUA 5E8IA 1UGSB 1QSLA 1IBLK 1GXPA 3AARA 1BYMA 3M4YA 5FW9A 4XLPF 4NQWB 4EQQA 4IHTA 3J7YJ 1EBMA 3DOLA 1PDNC 4RG2A 5IYCJ 3J80O 2HTSA 4O8UA 2QM1A 2H6CA 2QA4I 1FSHA 1QCNA 4CD1A 3J7AY 1AEYA 1ETKA 1FKPA 4IDHA 4JKHA 4QPOA 2UXNA 1RZ4A 4KIGA 1Z25A 1PWTA 5CR2A 4K41A 4M3ZA 2QW9A 4CJFA 5HRRA 2F5VA 2NOIA 4A63B 5ECAA 5EG0B 2HNDA 2K5IA 3CBPA 4CF9A 4CZLA 2ELKA 4DGWB 1LW2A 3S16J 5IP9J 3JSPA 3THXA 2O8DB 1VYTA 4C8QB 1Q86O 4LK1F 2DT5A 3GL1A 3CJNA 1ZQ1A 3HXLA 1HJDA 4YG2F 3TCJA 4UC4A 1TWAJ 2BE7D 4OMQA 4XBFA 2X3XD 1SRLA 4BY6C 2FEZA 3C2GA 4A2UA 2DN0A 1NYFA 2Q97A 1N75A 2JW4A 2HQHA 1UZCA 2XGXA 1P59A 3EPZA 2QXFA 4XTWA 2KFNA 3T69A 2WOMA 3VMFB 4RTUA 3MN7A 4BY7J 3J7ZO 4KREA 3WNHA 1WJEA 2XKOC 3PL8A 2IGIA 4Z02A 1YW8A 1IN8A 4XTVA 5I3UA 3TOBA 5DPKA 1POGA 1ZLKA 3QBYA 2CDTA 1EXQA 1U8RA 2X9HA 4FM1A 1M1GA 4BS9A 5E3MA 1NGCA 3N5BB 4FW1A 1TV6A 1EQYA 1KQJA 3CCST 1L3UA 1K0SA 5IP7J 3CHWA 2LCCA 4WTOB 4I76A 2JTEA 4UY8I 2Y1JA 3P8DA 3TDZC 2L4AA 2VQGA 2PLYA 3C3WA 2V9KA 1FEXA 4M7DC 5AQZA 4DTXA 3KLFA 3MZYA 3JRDA 3ZL7C 3FZHA 5CCAA 2ECZA 2NLUA 3KTUA 1T8EA 1T95A 1UB9A 4EPCA 2V9VA 1KCFA 5IYBJ 4PJMA 2BE2A 3GLXA 3QP6A 4J9EA 3DEEA 1KRPA 1DU6A 1KQ1A 2A68F 3DV8A 4UV9A 2VT3A 2KAFA 2BZYA 2I7NA 4BI8B 4XLAA 3AG1H 1XC9A 2AXTC 2BXZA 1Y0MA 2Y1IA 4RS8A 1XDUA 1JLBA 4MHGA 2VPRA 3WT0A 3OS5A 2VQLA 1E6GA 1AWWA 4CHYA 4JK9A 4BRLA 3TVTA 4CJQA 4FZZA 5D7UA 5DUIA 3NQOA 2JA5J 2HQNA 3H5RA 3CMEN 3RSNA 3HZ6A 3VQ5A 3L2RA 2O4XA 5HL7L 4P55A 2NVUB 1DIZA 1XI1A 2FO0A 3M4OJ 1V5FA 2DA4A 2UZKA 1NK6A 1FTTA 4M3EA 2HVSA 3FXOA 1Q81U 3GTJJ 1M90O 1QSSA 2HFHA 3X24B 2LKPA 1KC8O 3PY8A 3KNTA 1WI7A 1B3QA 2Q2EB 2A61A 1NHAA 3GWZA 1ZSGA 2BYVE 3IQLA 1FPQA 2EIMH 1HNXK 4EATA 1UAXA 2JNGA 2QQBA 2M16A 2AQFA 2RD1A 2H8WA 3TAGA 4IHSA 2HQAA 1GXQA 3E2UA 2J05A 2XRNA 1D5AA 2BE9B 2KE9A 2ID3A 2NOLA 3DKMA 1TAUA 3FIFA 2YV0X 3KP5A 1QHAA 2XRIA 3VEWA 2BV6A 3O6BB 2NOZA 3R6NA 1KVBA 1AHDP 4KDPA 3CCRA 4QIWN 3GTGJ 1I8FA 3K10A 2CP3A 4DWIA 5CKBA 4C8LA 2HYJA 1AWCA 2VXZA 2X4HA 2A3LA 4OMMA 1BIUA 5L3DA 3F0ZA 4JZ4A 1T3LA 3K70C 1QGPA 3FMQA 1FYKA 1WVRA 1UAAA 1W36D 3CFRA 1YJ9A 3Q0WA 2EFOA 2ZPFB 4ETSA 5KPTA 3AA4A 1VQNA 2C0TA 3M7GA 1LFUP 4AYBA 1D09B 4E0DA 3EAEA 2Y69H 4B08A 2BDPA 3RPQA 3PIOA 2RHYA 1U2VA 2ZBKA 2IEKA 2QSFX 4C0FA 3E1YA 5GANf 1BJZA 1WOQA 2QA4N 1S22A 1O3QA 3WU2C 5KHDA 1J6ZA 3CMMA 2DEUA 1TWHJ 5M1OA 5FJ8J 1BA0A 3DTIA 1PSFA 4F7UB 3PIOF 3U8XA 2YWWA 2BTFA 3VQ9A 2WB1N 4DBQA 2OA8A 3ASNH 1QZEA 5FFXA 5C4XJ 3G4ST 4U7DA 1ASUA 1Y71A 4A4HA 5LJ3g 1PUFB 1FOXA 4C0GA 2PYJA 3H46O 2R7XA 4BH9A 4CD3A 2M1BA 1FBQA 1X69A 1YO5C 1X2MA 3FHNA 5J40A 4QPQA 2KSSA 5LGTA 3ALYA 3O4WA 2QF7A 2IOCA 3HYFA 3OWTA 1S1UA 4CJEA 1L3VA 2CFXA 3H1CA 2YSQA 5A0GA 3H9NA 3NF9A 3P5JA 4OPHA 4PGGA 1SKUB 1SSHA 3CCMT 1ZN2A 3UPUA 3D7SB 1LE8B 2UUBK 1OX9A 5CQXA 2OPQA 4CGGA 3F8MA 2NVTJ 1ASWA 1ZXOA 5LEJA 1D9DA 1UE9A 4Q48A 4NO7A 1KFZA 1JJ2S 2X35A 1QBJA 4MLHA 5FWCA 1LDKB 4PJOA 4C9YA 1RKWA 3HTRA 1WSHA 4GV3A 4JHDB 4M7DB 1VQPI 2OJED 4ICLA 2MI6A 2O31A 1KU9A 4HX8A 3BDPA 4DR5K 1XOVA 1A5XA 1ETYA 3FDYA 4EIKA 3E97A 3CQZJ 2I8DA 4QS9A 1VSIA 4LB6B 4XRSG 3TSWA 3RWUA 4CGDA 1WKMA 4IX7A 2MSYA 2KI7A 4XEIA 1K7AA 1BA5A 4ELZC 4CEQA 1U6ZA 3S15J 4DYQA 4LDUA 4WFAL 4DV7K 4FWPA 3OL3A 3DBHB 2LX7A 2QGUA 2C06A 1KQ0A 1GLLO 2EIFA 1E7OA 3LSKA 3SZTA 1N36K 2Z1DA 4EJUA 3G4SQ 1BUPA 2JMAA 3IV5A 2XAJA 3BJAA 1M3QA 2ZXWH 4CJSA 1IREB 4CCLA 3JW4A 3D7EO 2CUJA 3KYLA 4P5OA 4I0AA 3I56T 1W5SA 1VQ4A 2HSTA 4KHNA 4KITB 2A5WA 2D0PA 3UT1A 4I9LA 1IV8A 4YOVA 2E88A 1MGQA 4FK4A 3IRRA 4BXFA 2AIRB 1FYMA 3CCMQ 4G7ZF 4PL8A 2ACJA 2EYZA 2RHKA 2DXTA 4YFXF 2WTUA 4DOZA 4DLEA 3B02A 2L9RA 3L2CA 3HPOA 3Q0VA 5LFAA 4XAXB 4HUEA 5J8FA 4PLLA 5KN9A 2OANA 5GTIC 3O8VA 4Y1DA 2J06A 4EJVA 4CE9A 2VBYA 2DQRA 3LPUA 4UVBA 4XLFA 1JO8A 1ZBSA 5HOOA 3X28B 1FNNA 1WCMJ 3ULQB 5L23A 1X2QA 4B1XB 2ZGYA 2WONA 5HLFA 1S29A 2AP1A 5J2MA 5GMKi 4FSXA 4J19A 2DJQA 4QT7A 1VQMT 2MW8A 2JK3A 4PJLA 2BEOA 5L3EA 2M1HA 2OAWA 3CCET 2D4WA 4CJKA 4I2QA 4WFBL 2KY9A 2VOPA 1M4ZA 1EJ9A 1YTYA 3PGGA 4F7ZA 4BUPA 4AIAA 2ISYA 3I56Q 5EVZA 2X51A 2DXCA 4R56A 3VN5A 4M63C 3UKUB 1VQLI 2XD0A 1K8AU 4WK8F 1R00A 3GYHX 2G8UA 2K5FA 4MZPA 4OB0B 2LR8A 1S9EA 3RNJA 1BI0A 1ITYA 1NJIU 3FKIJ 4E70A 3A4CA 2XPUA 1XD7A 2R5YA 2HCKA 4JRPA 4CO8A 3J8AA 3M8FA 5IXFA 1VQ8Q 1KG5A 2QWOA 3CD6T 1IN7A 3JRZA 3JCMe 3M5RA 2DRKA 4OLAA 3GDQA 4KUMA 4KV8A 2P5LC 2QG9B 2YJEA 2ZKZA 3QZ5B 1T7PA 1ZTRA 4C8QD 4Y52J 4MDBA 5HBMA 1VQ6I 4CBWA 1UA0A 4B47A 4O44A 4PKCC 5H6RA 4FLXA 3E9GA 3ULDA 2E7XA 2A1SA 4JKDA 2DYIA 2DCEA 4N41A 3THXB 1REPC 2ZPIB 2HF4A 5GAOm 4UV8A 4CESA 4BACA 5CKDA 3M0UA 3I54A 5DD8A 4DK9A 3I5RA 4C5HA 3I55T 2BY3A 3KLGA 1Y0UA 2NRWA 3W3CA 4JI3K 3I0XA 2ZF5O 4XLEA 2YG9A 4BQAA 4XONA 1RI0A 4KJZA 3D5RC 2QQ9A 2PYLA 5C0YA 1J75A 4AVPA 4H0OA 1K9MU 1KC8R 2WADA 2RQPA 2BE5F 1HKTA 2EX3A 3L00A 1YRNA 4KHSA 4H4KC 4CZEA 3DKYA 4M6XA 1A6IA 2O6GE 2GOMA 3UIQA 2XRLA 3VYSB 3SBTA 4EP4A 1U3OA 3CM6A 3PSIA 2QEXT 5L3FA 1ATRA 3K2PA 2QA4A 4AHTA 1CZBA 3MKYB 2EYYA 2NOBA 1ACIA 3SCXA 4C5GA 3AVHA 5AFUH 1VQPN 4BL0B 2O2OA 2QCOA 4B09A 3FC3A 2EV6A 3TWHA 3OIQA 3CD6Q 4YOTA 4LNPA 1LNWA 1ESVA 2HTJA 1JXEA 4AFQC 3HOWJ 3O3HA 4ZYGA 4FJ7A 3V1OA 5BS6A 5DEQA 2P5OA 2VGMA 5LEKA 2TDXA 1ARKA 2LREA 2WC2A 4JJDA 5BN9A 2QK9A 4L9VA 2VC1A 2XKPA 1S9GA 2K7AA 4PA1A 3EFOA 1YHQI 3LX7A 2E6NA 3W6KB 1GCPA 1W5TA 1E3OC 3TREA 4E9EA 2XF5A 2XVCA 1X9JA 2H27A 4DR4K 2G0EA 1JXMA 4FETA 2LVSA 1AWJA 3I55Q 5J26A 1PP8F 2RF2A 4JOMA 3BR1A 5CK9A 4AF1A 5FKMA 3CXCP 2O0YA 3PVLA 2O4XB 2DL3A 2FBYA 3HHGA 4A54A 4HXJA 3PSFA 4CIEA 2DMOA 4IRIA 2JUFA 3N4MA 3V9WA 2X6SA 5E3NA 3DU6A 2QEXQ 2B6AA 4GY5A 3ZQHA 5KYYA 3HOYJ 3CVTA 1SFOJ 1O3TA 3SPZA 3LW5E 5AZJB 4AFUC 1FTZA 2FXUA 1YQAA 4EZ6A 2NLXA 1M1KR 3OIOA 2VC8A 3BFMA 3TO9A 3CCMA 4Q5SF 2C0IA 3B8AX 1U9OA 4BY9C 3JCMV 1BCMA 1XTAA 1OH5A 2H6BA 1IF1A 4LC9B 2E5LK 2RHZA 3OW2A 4CEZA 3OMYA 4S04A 2PVOB 1X3ZB 1C0UA 3P7NA 5DM7F 2CZ1B 4IUPA 3VGLA 2JWTA 3ESWB 4E9FA 2D1HA 5LJ5e 4UVCA 2F5KA 3NH1A 1LDJA 4P96A 5JHFA 3MXJA 4E1MA 1ON1A 1N78A 1GLBG 2P1JA 2ZZDA 4N0AA 4N4IA 1KD1O 2DD4A 2C6YA 3E9FA 4FWQA 4JPBW 1C0GA 2KQWA 5E84A 2RM4A 1YI2I 1VQLN 4DSLA 2DM1A 3TSZA 5JLWA 4HHTA 2HVRA 4A93J 4ZGJB 1R23A 4ENMA 3LSPA 1SV5A 5HRPA 1OYXA 1KVAA 1JJ8C 3M8EA 1U2VB 2MYSA 2HKQB 3FZVA 1SHFA 1RACB 3M0QA 1YQLA 1LWVA 3SHWA 3I56A 2KXDA 4BQLA 2DOEA 4RBOA 4F3OA 1E6HA 3TU4K 1JCGA 5CVUA 2L9SA 4LSNA 1D0ZA 4JS5A 4LN2A 3RQIA 2FNPA 5JHUA 2E35A 3MKWB 3RSEA 1BIZA 2Y30A 1M1KC 2LK2A 1VQ6N 2LMDA 2ZJRF 4WWCA 4XH5A 3VS0A 4FYVB 2CH4A 1VQ8A 3FXLA 3JCMJ 2B86A 3CCUT 3QDKA 2AHQA 4ID5A 5AQSA 4CJ7A 3WXIA 4ZTFA 3GX4X 3UKGA 2VWFA 3U6FA 3MP6A 1YIOA 4IIOA 1AHJB 2CV2A 2X0LA 1VRLA 1QKWA 3ZQIA 2LC4A 4HTUA 4LF9K 3M4GA 3E3VA 1PSEA 1Q1HA 4CHOA 4PSWA 3LH0A 4X9DA 1JEGA 4MMKA 4RGRA 2I0NA 4JI0K 2JHJA 4IEIA 1UJ0A 1DP7P 1QLYA 1LEBA 4IOCL 1NOYA 2DBMA 5IYDJ 4MZTA 4BR0A 5L3BA 3SQ2A 4HW0A 2CREA 4PJOB 4OJRA 2KEAA 3VF4A 1J7KA 1R4MB 3CPWP 1LWWA 2V7ZA 2IAIA 2Z1JA 5EOYA 2XROA 1TS9A 4JKBA 3VS6A 3V9SA 1X19A 1MBKA 2CGKA 5K7ZA 3QU3A 2DIGA 1FZPB 3DXKB 2VJ5A 2ZCWA 3TEDA 4OGEA 1I27A 1B92A 1SD4A 2XSJC 3CUOA 3S1RJ 2Q0RA 5K5RA 1C0MA 2XAQA 1RAFB 3U3YA 1NG7A 5DM7R 5AQHA 4UUTA 5HLGA 1MMGA 4MZMA 2A6AA 4JNEA 4BD3A 5M1QA 1T44A 2KKZA 4FLYA 1SG5A 3BWGA 2WV1A 3CD6A 3NWTA 3CCUQ 1YHQN 3EH1A 2E5QA 2GBZA 1Q7YO 3KZBA 4OMZA 2JJ9A 3OYFA 4EJOA 3H3VK 1OEBA 2P9UA 4YOUA 4CBXA 1TQIA 2F5EA 2Z3YA 4RMNA 3CC4T 2IVPA 5FU7C 4FLZA 3CWSA 1LAWA 2VKVA 4FU6A 2D1KA 2W42A 4AG2C 5A0LA 2DMQA 2GM4A 1GVDA 1K6YA 1PRMC 5FKLA 1LMZA 2HHHK 1B07A 2EA4A 2M0MA 2M4KA 3E5XA 3NRVA 3GXOA 3OOPA 4A3FJ 1VQPA 3A0IX 4FWMA 1EO1A 3SI6A 3NMZC 2EFWA 2P7CB 5KQDA 2P81A 1PD1A 2VG6A 3RMDA 2EH3A 2ZXHA 4NYFA 3UATA 4FT8A 1OV3A 3NGIA 2LKXA 4HCBA 4J9BA 1VIFA 1KFSA 4KRFA 1Z7LA 3AA5X 4OFAA 2MC4A 3VENA 2YRDA 2IVNA 5EEGA 1H9TA 1NLPC 3MDQA 4C92D 2DPPB 3RR6A 4F2RA 1UGRB 4WCGA 3X26B 3LFKA 1WHJA 2IS3A 3LMMA 1R0CB 1HLVA 1I1SA 5AQFA 2FVUA 4QLCU 2V7FA 4HA8A 1PJRA 3UR3C 1IAWA 4LUDA 2F2WA 1NJWA 2WAEA 1USTA 3H45C 5HNFA 2CT4A 1GBRA 2VE9A 3J7AO 1UELB 2EB7A 4GKKK 1WB9A 4LFUA 4DU1A 2MA3A 1R4NB 4CXFA 4EP5A 2DFHA 1U06A 1VK0A 3VS1A 3EE9A 4A62A 3E9LA 4OFEA 2HNYA 1TKTA 4G12A 2GX9A 3VS2A 2BVLA 2UYTA 2ECBA 4OIQF 4JK8A 3VFZA 4A5NA 1U84A 1WSGA 1YBYA 1YI2N 4AIDA 3CC4Q 4N0AC 2QGFB 4GV9A 3KZZA 2GWRA 2JRTA 3CXCM 1RCHA 1JGGA 1RLQC 2R5YB 4AG1C 4E7LA 4CVNE 1YFHA 2GCXA 5K5OA 3TOAA 3SYZA 2HBWA 1WQ2A 2HXIA 5KK1A 1H641 3SD4A 4O4GA 1HC8A 3I0WA 4AC0A 1HSTA 2GUIA 3A03A 4C5IA 4RUGA 3CWUA 2NWMA 4DSEA 4UNOA 3ZQFA 4GMJB 3V9ZA 1MUYA 3AL0C 2PVDB 5GAMd 1EH6A 2DDAA 5JVHL 3TAMA 2RN2A 2K9QA 3MEWA 1P4WA 1V4RA 4HSBA 4LXCA 2DA1A 3TL4X 1WSJA 5GAN4 1U48A 4F4KA 4MIMA 1W4MA 4UB6C 5FKNA 2W6LA 4A59A 2LOOA 3OBWA 1QU3A 4AI4A 2V1NA 1IXRC 2HGCA 5C15A 4BRFA 2A0FB 2RI2A 3CC7T 3NHGA 1XSXA 3OYCA 3WHCA 1TYQA 2L3RA 2NYXA 2ID6A 4OAZA 5GAMf 4C2TA 2OQGA 3MWPA 3G7ZA 2JG6A 5CHIA 2FSKA 1SMYF 3KK7A 1O3RA 4DJAA 5LBQA 3F3XA 5AQIA 3CMET 2Z1IA 5FLXK 4J9CA 5LJ3j 4JI2K 4DLGA 4J2EA 2ASPA 2J4RA 4AH9A 1YRNB 2WBMA 1QHTA 1N9SA 2XAUA 1OPKA 4F7UE 4M7AF 1WLJA 2JWLA 3KWGA 3S6IA 3CC2T 4PJ0C 3BE3A 3SQ4A 3COAC 1NG6A 3V4GA 1WI3A 1Z3YA 1Z9QA 3LA2A 4H0TB 1YJNN 3PE0A 4CI0C 3PNTA 1NPRA 1WHLA 2ZGZA 5EJCA 2DPUA 2YCHA 1AVZC 3F5TA 5HLTA 1T08B 3OYIA 1I07A 1EWQA 3HOSA 4Z4IA 1C6VX 1VQ6A 1N32K 2VBZA 2O4GA 3I33A 1P90A 3IH2A 2ZNZA 1ZREA 1IRFA 2EFQA 1RGIA 2K9NA 3LSRA 1WXTA 3C0BA 4GCVA 3ZX0A 5ED4A 1K73O 4XLNF 4CJ3A 2RH2A 1EP4A 1QHHD 4HT8A 2BHYA 2DJIA 1KD1R 3FKJA 2VQHA 2RK1A 3EFOB 3PFYA 5D6EA 4M78A 1JE8A 4PUSA 3OMGA 4OKJA 4BXXJ 1S8NA 2L8DA 3VEZA 1Q9XA 3QERA 2WUSA 5FU7B 2CGPA 2L2OA 5J2QA 4CSWA 1GLCG 1T3VA 1QZYA 2EYWA 2OD5A 2O88A 1NK2P 1KK7A 2IPOB 4EV0A 1YIJI 3CC7Q 1JU5C 1MHNA 1N34K 3BP8A 1BBYA 4Z8AA 4M78F 3D4VA 2CH5A 5GAN7 4XTYA 5AJ3K 2YR2A 3CMEQ 3FHFA 2BXYA 4HDUA 1FT9A 2M8GX 1NGBA 1IKWA 5J2NA 3H35A 3TSPA 3DU5A 1BG3A 2JMWA 2RK2A 4JLGA 1YJWI 5EG2A 2GZWA 3GMEA 4IJNA 3OL4A 4BRMA 3CC2Q 4Z88A 5KYYB 1SL1A 5FLXO 1D4XA 3CPWM 2XC7A 3H41A 4M78G 4HWIA 4H03B 1DTQA 4HSRA 5BNGA 4XU3A 2VBWA 4GLMA 2E4HA 1J0RA 3M0SA 1LAVA 3TAPA 2OPTA 5LJ5f 2MWOA 1R58A 1M90U 3ZT4A 1R5ID 1R1UA 4FZXC 4K0KK 3PIPA 4M77F 1WRJA 2H1LA 3U9ZA 1YHQA 5GIPA 4J83A 4HRIA 5GMKj 3W2WA 4I9QA 2ZSIB 3O3KA 4F14A 4I01A 2EFPA 1TVRA 2QQRA 2HYFA 1TUYA 5BQTA 3M55A 4EHTA 3S6WA 1FC3A 2E2QA 3LSJA 2QZ8A 1AOJA 4HX7A 3JSOA 2LQWA 5KYXA 3I59A 3HL2A 4FWOA 1HPZA 1H3ZA 3HSTB 4M77G 2PBDA 4B1UB 5GAGJ 4C30A 3JRHA 2HPMA 1I5LA 4O5FA 3FLGA 4XKCA 1LFPA 5AZIA 1PHTA 4YIRX 1JLGA 2EK5A 4C3IJ 1A5WA 2X6WA 4PGHA 4DV0K 1RDDA 1RRSA 4YDUA 4ZC3A 3NAEA 2R7QA 2R0QC 2LY9A 2D8HA 3TQNA 4U7BA 4FYXB 4M6VA 2DK3A 4C92E 3FBNB 3ONQA 3GTPJ 3MAJA 4CCJA 1SAXA 4LB5A 1P7IA 2W84A 3BJOA 1AA7A 1LJ9A 5J8CA 1D5YA 3F70A 4OMPA 2V1XA 1J5OA 1ERDA 2LCSA 4DS4A 5CQGA 2FPFA 3OV8A 4HUFA 1LWCA 2KGTA 4ELVA 2OTLI 4RM2A 4CZJA 1VQKI 3WVEB 3QHSA 3RMQA 2K79A 3EG1A 3FISA 4GW6A 2ZPBB 1YP5A 3A0HC 2CH6A 4LF5K 1NGFA 3VEVA 3OB9A 2DE0X 4J6XA 4PJOD 2EYQA 1LCKA 1YI2A 1QNTA 4HF1A 4M7AC 3BY5A 1KQ9A 1SFUA 3PX4A 3I53A 1NK9A 1J2XA 4UNFA 4A0XA 3CTAA 5GAN5 1WSUA 4DQIA 1UECA 3B6AA 4D8KA 1Z05A 1LKXA 2KDZA 2XB5A 2M8EA 3S17J 8ATCB 1QQMA 4N9IA 2Q8KA 4PQUA 4PL6A 3X25B 5GAEP 1KA8A 1ORNA 1B72A 3NGPA 1R59O 4M9SA 1OJLA 1X4PA 3MEGA 4GGGA 4AM3A 3L3UA 3MN5A 2QXLA 4DSIA 5F27A 3JSCA 4XQFA 2GA2A 1IZ6A 4QCLA 2WFBA 3Q9SA 3G6EI 2DDBA 1IGUA 3C7NA 2OFIA 4DEXA 4BR5A 1V1CA 1QE1A 1GV2A 3CMYA 2EQKA 1BQMA 2D45A 3FJ5A 2G9WA 4BKXA 4FM0A 5KGWA 2VUMJ 3A2FA 3OVNA 4B9WA 2D1VA 5DM7L 3QG1A 2FMLA 1ZGWA 1NM7A 4OIOF 3GW2A 2K4JA 3ZOBA 2DA9A 2P9UB 1Q82R 2JHNA 5C24A 2QDLA 1S72T 4M78C 2OZMA 3LSMA 1MBFA 3ZSVA 2WAFA 1YIJN 5KVRA 4M7AE 1GXIE 3BDDA 4Y1CA 3SZPA 4A4GA 2BOLA 1PU6A 2I7PA 3PVQA 3SUPA 4XN3A 5HKCA 4AQYK 2MD0A 1FOWA 5HLIA 4KRTA 2HVQA 4FK2A 3PM1A 2GAUA 3VQBA 4UY8O 2QWMA 2ELJA 3FFIA 5AQUA 3LDPA 1SFEA 2RJFA 1BOBA 1OCZH 3C2HA 1YJWN 1OYWA 2FE3A 2E10A 3HJEA 2M87A 3DXMA 4M74A 3RKXA 5GAOn 3GTOJ 2LY1A 2DFIA 1W6XA 5GAMh 1RIOH 1HNIA 3NH2A 2AKLA 3HKZN 3SPYA 4FLTA 3V6DA 2B5JA 4M77C 2VWBA 2LH9A 4B44A 1OOTA 4CJRA 1GRIA 2ZJRL 4N5SA 3META 2JMCA 1SAUA 1V5GA 1RETA 2JVVA 3BY7A 4JQFA 3OY9A 5LL6Z 1B9FA 5K14A 1JQQA 2CGHA 4JS4A 3JRCA 4J7IA 1N77A 2BH1A 4CFAA 4CFDA 3D5LA 1V5EA 4G7HF 2M0YA 4LUEA 3JTHA 3WG7H 1AU7A 4B1WB 1NNEA 1NEGA 4DU4A 1QZ6A 4IHVA 2YRVA 2HNIA 2M5WA 2PU9B 4BWJA 4JI1K 2MIOA 1Q82C 4K43A 4HVVA 1LFBA 4P9UA 1S72Q 1DP3A 1C0FA 5MLCQ 4E9GA 3RVCA 4OPJA 5C3EJ 3DP7A 3S3MA 1NG9A 4N9HA 2ZO4A 5CJ9A 3OSSC 5CKEA 3MKLA 5AQXA 1ZARA 4ZYHA 3WTVC 2UU9K 3SEQA 1NWKA 1U9NA 4ZZLA 1RL2A 4M3WA 4ANJA 6PAXA 4A6DA 5E20A 5F64A 2D0AA 3A8HB 4L59A 1TSFA 2DAOA 1K1ZA 1TW2A 4G6TB 5AQPA 2HHVA 3THKA 3TTCA 2XIDA 2JN0A 1HOMA 4CFBA 5D6YA 1C0WA 3ZXSA 1TWFJ 4RTWA 2DY4A 1VQ7I 2IP2A 2E2NA 4YORA 4EVIA 1SUQA 5JVGL 1HSQA 3HOVJ 2O8EA 2DZCA 1JXBA 3H8ZA 2OTLN 4BRGA 4DV3K 1WXBA 1TYQB 2O8FB 2HAXA 1G3TA 2VJJA 3DJCA 4NNJA 5DLQE 1RDAA 3ZMVA 1MWKA 3IL2A 4CJ4A 4BRIA 3HJFA 4D1QA 4M75A 2F1LA 4BHBA 4UXNA 3BC8A 3D1NI 1NMDA 1TNTA 2RJCA 3KTQA 4RGUA 1TTYA 2DYBA 3HOUJ 3I5SA 4CERA 1IDYA 4DR7K 4B8AB 3CDIA 2EGCA 3EYIA 1Q81O 5F1XA 1V55H 1UEBA 2X4WA 4C23A 1ZR2A 4ESFA 1YQRA 4LY7A 1RDCA 3FSPA 3S3NA 2M9UA 2NUPA 1OLTA 2OUMA 3CF2A 3ZT3A 3CCJT 3PO2J 4KB1A 1KG7A 1B6AA 2P5GA 1YS7A 4DB3A 4ASNA 1BO5O 1WSEA 2E20A 3NHNA 2KLOA 2IGKA 3HI0A 2F2XA 5LD2C 3ID6A 3KD1E 5CIUA 3JB9F 1U3EM 2EKHA 5EEAA 1GFCA 2ESWA 1BWFO 4B3XA 3AO3A 3N4QA 4IHWA 4YOYA 4FXDA 2D9TA 3C6TA 3EN9A 4WFNL 4BNCA 3UA7A 2XG8D 3V7RA 4PJOE 2IS4A 1CLQA 3AVFA 2M45A 2DK8A 1WGSA 3ZT1A 4WXDA 2L0AA 4JN4A 1VQLT 1YFNA 3FBIB 2WSCE 1JKPC 2BY1A 4RB3C 2V75A 1DQUA 4EJWA 2CMPA 3D2EA 3VQ6A 4IFVA 3JB9G 1UWBA 1Q9YA 4L0ZB 2E6ZA 2F9TA 3WTSC 5M5XJ 4KISA 1ZG5A 4FYWB 3FXUA 2LP5A 3VA3A 5IXBA 3VQCA 1YAGA 3HL8A 1RI9A 2FBIA 1QS4A 4KKOA 4JX4A 4BR7A 3HBLA 2XPVA 2KFZA 3E01A 1WEGA 1YW7A 4FWKA 3FHZA 5AQRA 3ABTA 2NUZA 2XY6A 1K4US 4BGAA 2LTOA 2JA6J 1XMXA 3CCJQ 5BPLA 4W5TA 2ROLA 3THWA 2FJ1A 5KAIC 2ESHA 4YEJA 5KRSA 2QM3A 1O13A 3M1FA 1RR8C 3K5MA 3JXUA 2Z99A 3CJTB 5E8GA 5DYMA 2O9LA 4CHNA 5DLOA 1IG9A 4JYAK 3T0YA 1GUUA 3EQLF 3DFGA 2G7HA 2E70A 3V7CA 1YIJA 2PMUA 3DTEA 3HM5A 3DPLC 5KYXB 3I59B 4KO0A 2GBYA 1L3TA 3UNGC 2R7OA 1BDGA 4I2PA 3KEOA 1YITT 2MAMA 2AQEA 4FWLA 5ICGA 3SMSA 1DT9A 3DLLF 4WQ4A 5EU7A 2L3DA 1M3AA 1YJWA 3P9IA 3AO5A 3M57A 4AHVA 2AS5F 1AKHA 2BY0A 3L4IA 4KTZA 1BKBA 3ZFJA 1FN7A 2D0BA 3RRHA 4RAFA 3U9DA 2ZPGB 1YQMA 2VPLA 4H5RA 3HKZA 2JVHA 4HUGA 3LYIA 3HRMA 2K9SA 4E7ZA 2IXSA 2V9PA 2LG4A 2ZXIA 3H0DA 1V76A 3OYDA 3TBIA 3MHXA 5F0HA 1G5VA 4FWRA 2J6KA 1D5VA 2TCTA 5E1WA 4ENNA 2DVJA 1VIEA 1WH5A 2E34A 4M3RA 2HEQA 4ILHA 3JREA 4JLIA 2QWQA 4YFNF 4LSLA 2IGNA 1T56A 4MDWA 1VQ7N 3ZSOA 4NXNK 3MEVA 2ZJ2A 3LWFA 2DPNA 2VQFK 4F2SA 1J09A 5FD5A 3D45A 1X9WA 1NK0A 5JI6A 3QETA 3QZ9B 4V2SA 2OZUA 3CJ9A 3VOVA 2GOXB 6AT1B 3ZQLA 3HOZJ 3VDXA 4O5BA 5D6FA 2JSPA 1GCQC 4CK3A 1KQSS 1ORKA 3ZEUA 2K4BA 5AONA 1SRMA 4NDLA 3TR8A 3HSFA 2HL5C 3QWYA 4CF0A 3BPVA 1G3YA 1YITQ 3FM3A 5TGTA 1R49A 2P8TA 4KFBA 2B9SA 5AQLA 2NYSA 3CCVI 3F0CA 3KP7A 4M3GA 1H0MA 3KP6A 2DFUA 5D5WB 1ZSZA 2LJ1A 4EMKC 4FLWA 5FKKA 1BQNA 1B72B 1XPXA 2O5RA 2O8BA 2QTXA 4F16A 3I35A 4FJ5A 1GFDA 3K4BA 2NOGA 3QDFA 2F69A 2JXBA 3IH7A 1FWZA 2DEQA 3NNQA 3KBGA 1F4KA 1OH8A 4FX4A 4QS7A 1S1NA 2O7OA 1EETA 2X1CA 1RADB 4OMFB 4CW7B 1R1VA 1IV6A 3C7NB 1KG4A 3VS5A 3GIBA 4BWMA 2OTLA 2E3IA 1GHCA 3G71N 1Q18A 3F9KA 4M71A 1VQKA 2DT7B 3G1MA 2YX6A 4IHXA 1MMAA 3MN6A 1SZ2A 5CVVA 2EINH 3MEXA 1JLCA 2DT6A 2PX9A 3E5UA 3WODF 4ISGA 1Y7XA 3OGDA 4ZDPA 4KHWA 1VQ9I 3D0PA 2F9WA 1T0JA 1CZAN 3BCBA 2EV5A 1N5ZA 2HDDA 4DV5K 2RQVA 4Z2YA 3RZOJ 5CAIA 1NJIO 3I0TA 5GTHC 2HQ5A 4QWQA 2CQNA 1MH3A 2PUKB 1CXQA 3TQ7P 4CEAA 4KMFA 4PKIA 1QCFA 2R7WA 3TTDA 1XQOA 3CCLT 4GVEA 4E7HA 3JCMb 2YLBA 3VYTB 2M0CA 1ZA2B 2LT4A 2L3QA 3HGGA 2DTUA 1UA1A 4OVLA 4JYKA 1RLPC 1TL3A 4CGJA 3K4CA 4NLCA 4M9XA 4QKUA 3Q1JA 3H6ZA 3DXMB 1VOMA 3F8NA 4JI4K 1V3FA 3OYMA 2X78A 1PKSA 3F8CA 1GVJA 2ZB9A 1P4XA 3FM5A 4LD5A 3E7LA 3CXCA 2UXDK 5JLFA 4HF0A 3JRAA 4HQEA 3F21A 3VEPA 3G6EA 1TUDA 1VUBA 1WFWA 3CJ1A 4U87A 2KDSA 4JLHA 1Z0XA 1XGSA 5TISC 2HHTA 3K4MA 1WJSA 2OTJT 1NMNA 2L7MP 4CIGA 2J5OA 3DLGA 3AG3H 3CCJA 4J6YA 5HS8A 3DMJA 3ENBA 1HDDC 1TG0A 3F10A 1QVFS 4IIMA 2CUZA 4PIIA 1KZHA 3OS0A 2A6TA 4CYCA 5BPIA 3M59A 2HMPA 2M3AA 4BU2A 2OX7A 1V54H 2RV8A 4LF8K 1I1JA 3CFOA 2VG7A 4CZMA 1H89C 1WX6A 2P0QA 4EM1A 1YJNT 4IRGA 4DFPA 3P31A 2OCEA 3C18A 4GFBA 4HSTA 3FWEA 3VS4A 3ELKA 1GDTA 3Q0UA 4LH4A 5LRSA 2JSCA 5E3OA 4DSFA 4WQ4C 4FHTA 4EW0A 1OQKA 3CCLQ 1XCVA 2OU2A 3NFCA 4AFSC 1Z67A 4E1NA 3HVTA 5KE3A 2ATQA 2DMPA 4JJCA 3H6EA 4FJGA 4M41A 3ZN0A 1T2KA 4DFJA 4OAYA 3LOCA 1FMKA 3B6PA 3CDHA 3LSTA 1PNJA 2L9VA 1IC8A 1JT6A 4EW4A 1XWLA 3SUQA 1RAGB 5GMKm 1R8OB 2B8AA 4G8XA 2LSNA 2EZLA 4C0DB 1W97L 2O8EB 1T6SA 3H5AA 3ABUA 3VYHB 3SWNA 3KYDB 2HOSA 2HHXA 4KNYA 3O9RA 4OB2B 2OTJQ 5FPNA 3JSMA 3QRFF 2FHDA 2MMPA 2M30A 5CPRB 4M75B 1IRZA 3QLHA 3ZQ7A 1KYWA 2P0WA 4A57A 2QWWA 4H0XB 3IRQA 3QOEA 2H09A 4D5FA 1TK8A 3WXKA 4DZJA 1VQOT 2R7VA 4B3OA 5C6SA 1CKAA 4BGDA 1QW1A 2JWKA 3FK6A 4LDXA 1WBDA 3M9AA 3QDRB 4PJNA 4J01A 2Y0MA 4YRVA 4Y91A 4RTZA 3QWXX 3REAB 2NUPB 1W2BA 4WCEL 3CLOA 2RN7A 3RR7A 5GANj 4UOBA 3HFOA 4YNQA 3L2QA 3S2HJ 4GVMA 2KQ2A 5E1XA 1YITA 2YKNA 4LJZF 2Y0SA 4DSKA 3LCNA 1YG2A 2F7TA 1R0AA 1VQ7A 5GAMg 1CSKA 4CEFA 3CPWA 4NB5A 5DY9A 3OYEA 3J7ZI 1KFDA 1E3HA 1K73U 1WJ5A 2E2PA 2FZCB 1DUXC 4CZIA 4LFCK 3CCVQ 2X48A 3AO4A 4E7SA 3I8BA 4XOPA 1VQ9N 3IAS2 2MABA 1BK2A 4EVVA 1U5TA 5AQJA 4WXCA 3G0QA 3D2EB 2W10A 2NRXA 4XR6A 2YRCA 3ZSRA 3MEUA 4IG3A 4PWDA 1IRXA 1SKRA 4BC2A 4NLBA 1G6NA 2ZPHB 1UG0A 5FFZA 5L3CA 2R93J 1GT0C 2DL4A 4DTPA 1KJWA 1M8VA 1VQOQ 4G9YA 1XB4A 2DXBA 2EQJA 1SL2A 4CECA 3PLAA 3P4IA 4KT6A 2RQTA 3EUKL 2LCLA 2KP6A 5C0MA 2A6HF 2QTDA 2K7LA 1R7JA 3EG9A 3G1JA 3KK1A 2Y9YA 1S9HA 4KI4A 2UXBK 1GLAG 2KT1A 2VL8A 4IL6C 2Z1GA 1ZRDA 2YNHA 2HB5A 1Z7UA 1RNHA 4RG8A 4FJXA 3AG4H 2IVMA 5TRDA 2CV1A 1PG5B 2WSEE 2D1XA 3NF8A 1ON2A 5CZ1A 1BU1A 4Z4HA 3EE8A 2F4MB 3LAKA 1MJBA 1QVGP 5K1YA 2STTA 2GQIA 1KVCA 2PAVA 4DQPA 4DFMA 4LE9A 3R3LA 3QIPA 1OU8A 4G9ZA 4HEA2 3OSGA 2KQRA 4RTFD 4GYIA 1HQCA 4JJNK 3ZETA 1YLFA 1KAZA 5EY4A 3R1XA 1WI9A 3F22A 1A5VA 5IT9K 4CHUA 3CCYA 2PFBA 2LYCA 2E5KA 3LWLA 2DMUA 1AKHB 2CWEA 1HKCA 1X9MA 4A4FA 1IV0A 3LP2A 3RZDJ 3I4NJ 1MBEA 4PHTX 3AT1B 2CUEA 5CKFA 2E1HA 4KH6A 4FWSA 1J54A 4C8KA 2VWKA 3CG7A 4LDYA 3GTLJ 1RT1A 1SKSA 1BL0A 1C1BA 4PL7A 1R1TA 3CUQB 3V42A 1EH8A 5BRDA 2VGNA 3H3ZA 3F73A 4EGYA 1K8AR 4X64K 4M3XA 3SB2A 2PN6A 5GMKl 1TGOA 3DLBA 5BPMA 4HYEA 4DF8A 3AAQA 2DRMA 1RPWA 3HSRA 5GAHP 1JCFA 4RTTA 4ZDOA 4XSXF 4Z6YA 3HTVA 3FZMA 4IBNA 1CGPA 3CCSI 4QQDA 3QYEA 2V8JA 2FF6A 3I9QA 2BZTA 3WU1B 2XGEA 1I3AA 3ZEUB 2OFKA 3ROUA 1OKRA 3M8RA 3ZSYA 3CCRN 2HZYA 2E1ZA 1JUMA 4R1HA 1T33A 3MP8A 4CI6A 1XMQK 3PNYA 2DTOA 4RW8A 1L0OC 4WF9L 1JLFA 2COMA 3KX2A 1VQNN 3K4KA 2WSFE 1ZSZB 1RDBA 2VIXA 1JXOA 4H5NA 2O8BB 5C25A 5LL6S 4H8KA 3EYYA 5IT9O 2X4XA 3VUZA 3TU5A 3ITHA 4DV2K 4FLUA 4GKJK 3PNVA 2KW4A 1JTXA 1LJOA 1WQWA 5KYNA 1K9MR 1XC3A 2KK4A 2V1RA 2EQIA 3FEOA 3QPTA 4FISA 3NTHA 2JT4A 4DUYK 1H1VA 4C1NI 2OZSA 1K8AC 1K8KA 4L18B 4HNTA 2KKOA 2GA1A 2L3PA 3TEEA 1UHWA 1E3PA 2HYGD 5HDKA 1QPIA 2RPNA 2W85A 2LP0A 2J6FA 3CQTA 3KP2A 2NUTA 3CWAA 3EUHA 3A01A 2NRTA 4DTUA 3F2KA 1XC5A 3O1WA 1XN7A 4JRQA 3CIPA 3BCAA 4E7JA 2NNNA 3QJ6A 2RNJA 2E60A 3CQYA 3K9JA 3LALA 1BI3A 1TUCA 2OPRA 3DLLL 1U5TC 4J5YA 3CCVA 1Z9ZA 2NRHA 1YCSB 5LHGA 4ZTJA 1G2HA 3QYGB 2UUZA 4AUXA 3M9QA 2ZQBA 2QWLA 1YCYA 3ZYYX 4B24A 3O9QA 1E3MA 1U0JA 2MC3A 3FFKB 3AO2A 4O6JA 3V8LA 3QWLA 4WQ5A 4GY2B 1IN6A 4RB2C 1CXUA 1BB9A 1VQOA 2LKSA 1ZR4A 1VI0A 4DBRA 1S5JA 4IQ4A 1K9MC 1YXQA 3O8HA 2CUBA 3KEQA 1X3WB 1ZA1B 3HP9A 5JFRA 1S7EA 1TWGJ 3VW4A 2VXFA 3IUCA 1VQ9A 1KG6A 1PCXA 1SVOA 2E2IJ 3H36A 4J2DA 1IXDA 1F1BB 1FY7A 3GOIA 3WNFA 4CYCB 5IAYA 4EMSA 3VOEA 4UQGA 3AVCA 1TXQA 2COWA 1BL3A 2VASA 1HR0K 4OB3B 3LA3A 3BQYA 3GG4A 1VQ4N 1JGSA 3VGMA 5GPCA 1X1PA 1ORPA 2YDLA 2W25A 4PUOA 4B6MA 2DX1A 4A53A 3G4SI 3E6CC 4W5NA 2FYKA 3IFRA 3UE5A 1AZEA 4J9GA 2P5VA 1BC8C 3UF4A 1RT5A 4JKGB 4Q47A 4S0HB 3PNWC 4CBUA 2KT0A 3ATVA 2LY2A 3QFUA 2F4IA 1KAXA 3T8RA 3U2RA 1IHWA 4HPQA 1YUWA 3OHRA 2JA8J 5ELZA 1Y1VJ 2IA2A 5C12A 3MQ0A 1NGJA 2Z33A 2CZ6B 1N8RR 4NHJA 4L8RB 2R7DA 3VJPA 3CCMI 5FD6A 2G7UA 3LDOA 3F9MA 5AR0A 4M75D 1HYVA 5I11A 3BG9A 2WACA 2JQ7A 3HSCA 1X6OA 3DWLE 3SUOA 5KH6A 3SWNB 1U2WA 3RDVA 5FROA 1DJ7B 5CVRA 2E1OA 5KGXA 2GFUA 3F23A 4CC2A 2FUG2 1KHIA 2LF7A 3SK3A 1SAZA 2RPIA 4BRNA 2JPCA 3T3FA 1T98A 2DFFA 3MJXA 2RHUA 4Y92A 3ZSXA 3EFRA 3G73A 2O01E 1KG1A 5LJ3d 1X1DA 2YKMA 1F1ZA 1QP2A 1TLHB 4IOCF 4B23A 3DLKA 3HEFA 4KUDK 2F5DA 3HRTA 1MSEC 5M1KA 4PSXA 2X9DA 2ECCA 4BC4A 1MUDA 1X1CA 4LIVA 2L01A 1ETXA 3KZYA 1W4SA 3CJQB 2EZIA 2QSHX 1QMCA 3ZMUA 3QXEB 4JUVA 3AVLA 3BLYA 1NKUA 2MG4A 4I98B 5IOYA 2IVOA 2L0KA 1HKGA 3LM9A 3I56I 4M72A 4BHPA 5IHIA 3CCSQ 5JR3A 4DKWA 3P8BB 3ZP5A 5IHNA 2CGLA 1MW7A 1XMAA 1S7AA 3AVJA 4O5VA 4LDVA 4LF4K 4QVZA 3EH2A 2E2HJ 5H1SQ 1N8RC 2CP6A 3P9KA 3GF5A 4MDAA 2DOAA 1MD0A 4O8KA 1VQ8I 3ULRB 4Q5WA 4HAMA 1PYVA 3A02A 4DR3K 5HY6A 5IP6A 3ENHA 1JJ2P 4DQSA 2F4VK 1Y1WJ 2KRCA 1RAIB 1U5TB 1N39A 1SANA 1N3CA 1G15A 4BGBA 4HCKA 4A3KJ 2ZFUA 2LRQA 1HW2A 3CPFA 4M3TA 3MVPA 1Z26A 4A6EA 1ETVA 3T5XA 3SXYA 2JTVA 4IOAF 2NOEA 4AT1B 3NWSA 2QWPA 3V8JA 2HBLA 4OP0A 2EFNA 3EUHC 4EMHA 1Z6TA 3P39A 1SVLA 2FU4A 2VBXA 4KH1B 4I7FA 3BEXA 3S1QJ 1VQMI 1K76A 4WE1A 4ESJA 2F5CA 3CCEI 5DV5A 2XY7A 5AFUA 2VKDA 5D8LB 3AV9A 4UB8C 5CKTA 3BG5A 3EY1A 5EYRA 4BVPA 2K27A 2LDUA 2M4GA 2P9IA 4CK1A 4PCQA 2BHZA 3FZLA 3ZBDA 1PUEE 4BY6B 2RC4A 2P4TA 2PMHA 4WQ5C 3OMCA 1IKVA 3C6HA 3EGDB 4DEYA 4L9JA 3KEYA 4XRSA 3BR2A 2JM8A 4IJAA 3CD6I 3G1OA 1VQ5T 3B6OA 1KSPA 1QHGA 4LOCA 5IWAK 1NOZA 4RKUE 3QYFA 1WAFA 2PI0A 2V7YA 1OZ2A 4Y7NJ 4BY1J 2R7SA 1L5UA 1RESA 3KP4A 2VJIA 4II1A 3OA9A 3GFIA 3G10A 2P9NA 1K9AA 2DODA 3VWBA 3BT9A 4OX9K 3T9NA 2X6YA 2JVGA 3VPRA 2FC0A 3LA7A 4LDWA 2AA4A 1OCTC 3W6VA 2XIGA 3G4SN 3DQVC 1KQ8A 1UHCA 5TKYA 1NGIA 3GBTA 2O8KA 5GP9A 2Q2RA 2JM9A 4F52A 2MLKA 3TW7A 3SLCA 5KRTA 4IUTA 3AGKA 3KLNA 2P4WA 5IN1A 1NPPA 3R6SA 3M56A 4G6DA 2DLPA 5DCMB 2A69F 5BOXA 3I55I 4IFYA 1D1BA 2W82A 3JCMW 3TANA 3LL7A 1TQMA 1NZ9A 2E65A 1TKZA 4F04B 2CO5A 3G71T 4XLHA 2W24A 2OC6A 4BHCA 2VCPA 2VLAA 1IZ1A 1IRGA 4NYNA 2L2PA 4Y15A 2XHBA 3K6GA 3EKSA 2HOTA 2DJZA 1I4K1 3CCMN 2VB6A 1U45A 2P9PA 3NPFA 1HDPA 3LM2A 4Y13A 2GNCA 4HLYA 2QEXI 5JLHA 4EA4A 3M6GA 3QFPA 1R71A 2CUDA 4BQQA 2DVEA 2QYZA 3SYTA 3IAM2 2CU7A 3M8SA 3TTFA 4QQ6A 4FIBA 3S8PA 1NBEB 2Y4YA 2G8WA 1KONA 1KG3A 3IUOA 2VT2A 4JBAA 3ZCMA 1VQ5Q 2FBHA 1XGMA 4BJ6C 1TC3C 2V6CA 4KA4A 3HSEA 4BAYA 2L54A 3NAUA 3X2QH 4AWXB 1I3QJ 1OI1A 2KXCA 1ZBHA 2CP5A 1VSMA 2I5JA 4CCHA 1PM3A 4MO7A 3RR8A 3LSIA 5E3LA 4QAGA 3ATUA 4LD6A 1G99A 4CJ5A 2X85A 5AN4A 1B4AA 2H56A 5I42A 1TK0A 1T05A 3K4NA 1Y8QB 3MN2A 4LG3A 1HRHA 4BRKA 3U1KA 2XY5A 3GTKJ 3W2VA 3BROA 4DYRA 3V81A 1Q86R 3CLQA 3DYAA 1WDXA 5IPAA 2BGCA 3SV4A 1U47A 3I56N 4M75E 1XMKA 3LAMA 3FK7A 3UA6A 3JCUC 4RAZA 5D6WA 3LL3A 2GTDA 2QLZA 1XG7A 5CQYA 1K8KB 2EAYA 1X43A 2D0QB 1NLVA 5D6XA 3RBBB 1W70A 3BR3A 1VQ8N 2IRFG 2R4GA 4JK1X 3CCSA 2YUOA 3VU3C 3CMAT 1Y96A 3CQXA 2XMFA 3EG3A 3TABA 4EJYA 3IP4B 4N76A 2PJPA 2Q1NA 4MEYF 4E6RA 2EW3A 2FG0A 4CEDA 1MH4A 3SEZA 3JCMX 1YOVB 2NUTB 3A01B 4ELUA 1W36C 2XSDC 3TAEA 4OIRF 4EZ9A 3VODA 5J1EA 4UUSA 1ZQ3P 5E79C 1X01A 2QQ8A 2DA3A 3E5QA 1VZ0A 3OW2S 2K5CA 4OF1A 3P9CA 3JRBA 3GFJA 3DEUA 5IT9E 1JCEA 1PVSA 4Z89A 1WSIA 3M8PA 2A40A 3I58A 1Z21A 1MKMA 1MDMA 2AJQA 3GCMA 3RYRA 3MECA 3K69A 5CVJA 1DGWY 5IT9Z 4J2BA 3GO5A 2JPBA 2Z16A 2JZ2A 1LQ1A 1UGPB 4C8QF 3S41A 1I5OB 4FYDA 1X58A 1EKEA 3SAGA 1Q86C 5HCKA 4XK8E 2ZJPF 1HXDA 4KGVB 2K4YA 3WEEA 3MD2A 4RTVA 4V2GA 1PC0A 1SD5A 2FRWA 8AT1B 2F96A 1WH7A 1H9GA 4LLLA 1BI2A 3URGA 4H0PA 3NF6A 2W40A 1VQMQ 2YHBA 3HRUA 3CD6N 4FX0A 2JN6A 1ZG1A 3CMAQ 3PO3J 3CCEQ 1JJ2M 5LJ3h 2WWYA 2HBJA 3G3ZA 2OZ6A 3RPUD 3J80E 1WJAA 1M90R 1TUGB 3UDCA 2W7NA 3R2XC 1CZ9A 3WUHA 4QTRA 3SQ1A 2DL7A 1WJBA 2VXDA 1D3YA 5BMZA 3FXJA 5GAMe 3J80Z 4BRQA 3CCUI 1J53A 1V29B 3TKYA 5E1ZB 3HIFA 3DXJF 1K78A 5B5EC 2CSIA 1DPRA 2V8IA 3VV0A 4PJJA 1Y64A 1IN4A 5JVTA 1X4OA 5CYQA 2WTEA 4AIKA 3DEWA 4B9QA 1KG2A 4DV6K 1RAEB 3JRFA 1LWEA 1JXSA 4H4MA 3I55N 3BTIA 4B4CA 1X75C 4DR6K 2X1EA 1TU0B 3AGRA 2RI5A 1ZELA 2CG4A 1ZK8A 2EV0A 4YTLA 5LJ5j 3KVGA 3KYCB 1LPLA 3AY9A 1XNIA 1B8IA 4RB0A 3AAFA 3K7AJ 4G1QA 4JI7K 1EFNA 4WF2A 3NMUA 2QTVA 4KUIA 3NE6A 2QEXN 1YX3A 2DAQA 2DI3A 1W0UA 2L7KA 4B3TK 2G8HA 4ILJA 3GTMJ 1P92A 3I0RA 2EPDA 4W97A 1QTMA 3F6VA 2Z5UA 4EJZA 3AFHA 1VNDA 3R6MA 1HKQA 1S6LA 4JAXA 2RQRA 3LGFA 2YI1A 4BRAA 3S14J 3HHHA 3G4SA 3MK6A 3TSQA 1WHHA 3OYGA 1S1XA 1I81A 4A3LJ 4GRIA 3LFUA 1KC8C 3RKWA 2DTIA 3C7JA 4E7IA 1RTIA 4B48A 2RJDA 2UXCK 2HQEA 4KH0B 1TL8A 1T0FA 3WHBA 3EL2A 4X66K 3K59A 4EAHD 4B43A 2KIUA