4BDYA

Pfv intasome with inhibitor xz-89
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
molecule keywords INTEGRASE
total genus 110
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bdyA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4bdyA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4bdyA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4bdyA03
4B9WA 5DMRA 4HCCA 4GMJB 2Z1IA 4DTNA 4II1A 3LP2A 1OZ2A 3LAKA 3S9HA 5HRPA 1XI1A 4B9SA 2WOMA 3VQ9A 3QIOA 5HLFA 4CJLA 4CEFA 1A5WA 2EQUA 4IDKA 4KFBA 3FFIA 4JS4A 4W5NA 1UAXA 3C6TA 5FROA 3ME9A 3VA0A 4C8NA 3RRGA 4Q0BA 1RBRA 5CYMA 4PWDA 4IUUA 1J54A 1O1WA 1VSKA 3LGLA 2RHIA 2DFFA 3V1QA 4FLXA 3U6FA 3ISNC 1L5UA 3QNNA 1IG9A 3K58A 4QQDA 1H3ZA 2Z1JA 3OYEA 4OVAA 1SKWA 4B9TA 3P8HA 3H6ZA 2KFZA 3VQ7A 1FXXA 4OLAA 2RN2A 3VQBA 4CJFA 4DSLA 1QHTA 4X34A 4FJ5A 1EXQA 2EQKA 4QQ6A 4RW7A 2HHVA 4AILC 1LW0A 4KI4A 3OJSA 3THVA 1ZBFA 3PNWC 3ZSWA 1B9FA 3ZT0A 4CJQA 4FZXC 1RTIA 3AVMA 2GBZA 5CIUA 3META 3LANA 3C95A 3OY9A 1TKXA 3LPUA 3HL8A 4CHNA 3SZ2A 4UC4A 4CGHA 3NTKA 3OYIA 4R5PA 4ZTFA 4IURA 4CECA 1YTAA 3HPHA 2X74A 1C1CA 1BISA 3OYDA 1WJQA 3K5OA 4B9VA 2HHQA 2YKMA 4B9LA 4KHYA 4J2BA 4O55A 1BL3A 2RJDA 3AO4A 1BI4A 3NGZA 1QTMA 1DLOA 4CHQA 2RJFA 5JS2A 4FLTA 3OYKA 3DOLA 1BQMA 3SUPA 4E0DA 1TVRA 3TR8A 1OZ3A 4IG3A 4O4GA 3VQ6A 4ID1A 2ZD1A 4OPKA 3OYMA 3M8RA 3JYTA 4BDPA 3SQ0A 1KCFA 4ELUA 4IFYA 3EYZA 4UQGA 1XWLA 2LRQA 3DOKA 2X4YA 4KO0A 4QVZA 4OKKA 4JRPA 3LZIA 1NKBA 3BDPA 4F2RA 1X9WA 1TL3A 1KVBA 3ZSRA 4FZZA 1JLGA 1CZ9A 1S1VA 4KTQA 4Z4HA 4PL6A 1HMVA 3WNHA 3O4NA 1IKYA 3SJJA 2RKIA 1NOZA 1NKCA 2G8HA 3NF9A 3SPYA 2OYQA 1IH7A 5DK5A 4DQQA 3L3UA 4FJKA 2B4JA 2LSNA 2HQXA 3DM2A 1QSLA 4DLGA 3V81A 3VQ8A 3KD5E 2D0BA 4OGCA 2KZMA 2BE2A 4DSKA 4FLUA 2PZSA 5KCOA 4F3TA 4BDYA 4AHTA 2G8KA 3ZSOA 2D9TA 3EZ5A 4M3RA 4W5TA 1YVUA 3AVNA 4Y1CA 3QETA 3T1AA 1RCHA 3I8DA 5J1EA 1C1AA 2IS3A 4FLVA 2B6AA 3AA4A 1CXQA 2L8DA 4K8XA 3ZSXA 2I5JA 4HUFA 4CRIA 2GF7A 4DU1A 1QSYA 3PFSA 4O5BA 3VQQA 4C8OA 4F2SA 3OYHA 1BQNA 3MXJA 5HROA 1D9DA 3VA3A 3TI0A 1NK4A 2OZSA 2JGUA 1G5VA 3WNGA 3DB3A 1C1BA 4FVMA 1JXEA 1KVCA 4CEBA 1LWEA 1Z26A 3SV4A 4FJXA 3VQAA 4N4IA 4CF8A 2LTOA 3IS9A 4B9XA 4DSJA 2ETJA 4IUPA 3PX0A 3L2QA 1MHNA 4RW4A 3QO9A 1TAUA 2R5AA 1EX4A 2HNDA 4RW9A 4BE0A 1NK6A 2HW3A 2R57A 2RO0A 3QNOA 4DTJA 2BUDA 3RR7A 1MU2A 1L3SA 1LV5A 2HHWA 5CY4A 1RT2A 1ITGA 4DFKA 2WACA 5CYQA 2E6NA 1DTQA 3VN5A 4FJMA 4WE1A 2BKDN 2JLEA 3P5JA 3SD4A 4O0IA 3O3GA 2DIGA 4CJ5A 4FM1A 2XY6A 2G8UA 4OGEA 3ZT4A 4KTZA 3NF6A 2FHDA 2K3YA 3NNQA 1OYXA 3FLGA 4KTWA 4CIFA 4TSXA 3AO2A 1X9SA 1WNSA 3V1RA 4MFBA 3ZSZA 4CJWA 2GFAA 1W0HA 3G0ZA 3NBPA 3DLHA 4CGGA 1S6QA 1NOYA 3V9WA 3QBYA 2E6MA 1B9DA 1BIUA 2MWOA 1GOCA 4GVMA 5D3GA 2KW4A 5I3UA 4DQPA 4CEOA 1Q9YA 2XY8A 2RPIA 3CFOA 3F9KA 4DS5A 1U48A 1WSHA 5KE3A 2FBYA 4ZTJA 4E1MA 3L3VA 3M8QA 2HVHA 1VSHA 4IBNA 1JLEA 2RI2A 1QQCA 3NDKA 4DSFA 3MAQA 2D5RA 2IC3A 3GOXA 3KIOA 1LW2A 2P51A 3ZSQA 3KLEA 1D8YA 3P83D 4FJ7A 4CEDA 3OYBA 1LWFA 1XC9A 1ZBHA 3SUQA 4DTOA 2P5OA 4C5IA 2Z1HA 3D45A 3CM6A 4LH4A 1VSIA 3EY1A 4C5EA 3M8PA 4CFAA 3TABA 3NE6A 4FW2A 4JS5A 4FZYA 2JZ2A 3LGFA 2D0CA 1C0TA 3ZT3A 3KUFA 1RDDA 4HCBA 5IN1A 3V9XA 4CFDA 3V1OA 2XDPA 3HJFA 3AVAA 3LWMA 4N47A 1X1PA 2XY7A 1ZYQA 1NJYA 1TK5A 1RTHA 2A1SA 4CEZA 3HO1A 3B6PA 4FYDA 4ID5A 3LP3A 4FLWA 2HQEA 5HRSA 3EAEA 3MO8A 3WNEA 2LVMA 4GW6A 4NYFA 2P5GA 1S9GA 2G8FA 3DYAA 2QKKA 5SWMA 3K5LA 3LPTA 4OVLA 4EZ6A 4CJ4A 2G8IA 3I0RA 1T7PA 4K8ZA 2RHUA 2OPSA 1CZBA 3DI6A 1FKPA 3AA3A 4BWMA 3T19A 3KK2A 3NGIA 4PQUA 3TAEA 4BE2A 3KLGA 4OKEA 5I42A 3L42A 2DTUA 4N56A 4B3OA 3L2RA 4CJUA 2YV0X 4AH9A 4CK2A 1SKRA 4C8LA 4CE9A 3RMDA 3MP1A 1L3TA 5FRMA 4FK2A 1TGOA 3DRRA 4I7FA 3IG1A 2VYTA 3DMJA 1VSDA 4DU4A 1NJXA 2X78A 1RBTA 3HSTB 1J9AA 1N27A 5C6SA 3QESA 3PO5A 1VSFA 2RJCA 2XK0A 4RG8A 4BE1A 2R5MA 1S1TA 1KFSA 4CHOA 3PX4A 3HXMA 3OMCA 1EP4A 3AA2A 2HNYA 2VG6A 5KRTA 5KTQA 3P8DA 1FKOA 3SPZA 1QSSA 1J53A 2XHBA 4KI6A 3HVRA 3ZEHA 3OYLA 3H8ZA 4QW2A 3OYCA 2M1HA 4EP5A 1GOAA 2GV9A 1NK8A 3NCIA 3SUNA 2RI3A 3K5NA 1N5YA 1IKVA 3G10A 1C0UA 3L2UA 3MXMA 4DSEA 2IG0A 5KH6A 3PX6A 2L3RA 3B6OA 2F96A 2WONA 1K6YA 3A2FA 3OYJA 4KHNA 3S3OA 2HMIA 3NAEA 4PY5A 3CG7A 1HNIA 2DFEA 5C42A 4KHUA 2RHYA 4LD0A 1U47A 4LD6A 4AHCA 4A4EA 2YNGA 2PQWA 3MEEA 5SZTA 1KTQA 1S6PA 1NK9A 2Y1JA 1X9MA 4E7HA 3AO3A 1LWCA 4F3OA 5CZ1A 2HHSA 2B5JA 3MECA 2X4WA 4RW6A 3SI6A 3AA5X 4KB1A 4C8KA 1WSGA 4N4HA 4CK3A 5HRRA 1BIZA 3KK3A 2DFHA 1S9EA 4FK4A 3VQ4A 2DIQA 2G8WA 4B9UA 3AVJA 2HHTA 2PY5A 1RT5A 2LCCA 1SL0A 2HB5A 5JS1A 3MEVA 3OVNA 3LDSA 3QJ6A 1VSMA 4CEEA 1HYSA 2XRIA 5J2NA 1WJSA 2EHGA 2IDOA 1HYZA 3O4QA 3ZT2A 2A1RA 1UWBA 1HQEA 4FJNA 1IO2A 2QKBA 4FXDA 2GFUA 1SSFA 2EKOA 1KLMA 1RBSA 3DLKA 3PV8A 2K3XA 4M3ZA 3MEWA 3ULDA 3MP8A 1U45A 1RDCA 4M45A 4DSIA 1RT3A 3OS0A 3SYZA 3HP9A 2M0OA 3NTIA 4CGJA 2G3RA 4CFCA 4B08A 4ZHRA 1SKSA 3Q1JA 1WN7A 2AJQA 2VG7A 4Z0UA 3VQDA 1EKEA 4EP4A 4W5RA 1Q9XA 1RTJA 2L89A 3KKRA 1SV5A 4JRQA 4LSNA 4A4GA 3UWNA 4HUGA 1WSIA 1L3VA 4IFVA 4FJHA 1SL2A 2BDPA 3OYNA 1RT6A 3CM5A 3AVIA 1TK8A 2QQSA 5HP1A 2HHUA 1T8EA 4Z4FA 1NK0A 4CHZA 3LWLA 4DMNA 4BDZA 3FDRA 1QS4A 4CF2A 3QEVA 4DS4A 2O4XB 4NS5A 2QXFA 2QK9A 1WAFA 4IUTA 5J2QA 4FU6A 1KSPA 2RJEA 4B8CA 5T7BA 3NH2A 1EETA 2MWPA 2ZQBA 2IOCA 1BHLA 3QEIA 2RI5A 4CEAA 1UOCA 3KLIA 3ZT1A 4Q5VA 3V6DA 4DFPA 1LAVA 3JSMA 2JTFA 5J39A 4J2EA 4N41A 3OYAA 1KRPA 4M3WA 4FCYA 4QQGA 3NHGA 4E89A 3DB4A 3F73A 3BGRA 2FBTA 4CFBA 2R7YA 1UA0A 4HVJA 2KQ2A 4B8AB 4B9NA 3L2VA 1XNIA 3O8VA 4AHSA 4CIEA 1ASWA 3K5MA 4QAGA 1J5OA 3DLBA 4FW1A 2EQMA 4ELTA 1IKXA 4IG0A 4OKJA 4KRFA 4GY5A 3VQ5A 3VQEA 5FDLA 1HRHA 4CERA 1LAWA 2GUIA 3DRSA 1JLQA 4W5QA 4DQRA 3CEYA 3C4SA 3NGYA 5HBMA 2F8SA 2KFNA 1TKTA 1NK5A 1TV6A 4DU3A 1N6QA 2YKNA 5IAYA 2Y1IA 4I9LA 4DWIA 3M9QA 3MEDA 3SUOA 2HHXA 1Q8IA 1WSEA 1UA1A 2QQRA 3SV3A 1FK9A 3HT3A 5HRNA 4Z4GA 3AO5A 4H8KA 2NLUA 3AVBA 3AVKA 5K14A 3DLMA 1ASUA 4CIGA 4OPJA 2VWJA 3RWUA 3MEAA 2EX3A 4OJRA 4DTXA 4DTRA 4DTMA 4AHUA 3NH0A 1Z25A 4HUEA 3QERA 3OQ5A 4NZGA 1HPZA 3TAFA 4M3YA 2KTQA 1TAQA 1KVAA 1U04A 1A5VA 1JLFA 3OYFA 1Y97A 3S3MA 3ASMA 3KLFA 4KREA 3QKJA 1RBVA 1REVA 3HP6A 4I2QA 4EZ9A 1SUQA 4E19A 1RILA 4FJIA 1D5AA 2Q3SA 4QOZB 2HVIA 4Q5WA 3QLHA 3TAMA 4E7KA 2F5KA 1VSEA 2ATQA 3QINA 4CJRA 3TWHA 3QEWA 1WGSA 1VK0A 3V4IA 4KHWA 1CXUA 5D6YA 2EQJA 3SQ4A 4FM0A 1L3UA 1VRTA 2YNHA 1RDAA 3OS1A 1GOBA 5M9OA 3OYGA 2B8AA 3QIPA 4CJKA 3RMBA 4C5HA 5KCHA 4FM2A 3LP1A 1I39A 2P0KA 2R58A 1JL1A 3ZCMA 3AVGA 4H4OA 4LH5A 4PLLA 4DTPA 4OLBA 4BD3A 3PY8A 3L2WA 4HTUA 1QE1A 4H4MA 4LY7A 4CCHA 3SNNA 5KRSA 4J2AA 2KZZA 4CJSA 4A4HA 4KB0A 4PA1A 4FJLA 4DFJA 4FL6A 3HPGA 4FJGA 2HNZA 2OPQA 2E6LA 2EFIA 1RT7A 3PMTA 3KKSA 4DTUA 1ZBUA 3K2PA 3RR8A 3LLRA 3AVFA 3TAQA 4CJTA 4PUOA 3PUFA 3NH1A 3OMGA 3BDLA 2W42A 2D0AA 4N76A 3HPOA 4FJ9A 4HHTA 1R0AA 3LALA 5J2MA 4W5OA 1BCMA 3LP0A 4FJ8A 4KAZA 2OA8A 3FEOA 3OS2A 1RDBA 4YNQA 3TAGA 4LSLA 3MXIA 1U49A 4F8RA 1CLQA 2ZE2A 1NJZA 3MEGA 3CFPA 1B92A 2OPPA 2OPRA 2X6NA 3ZSVA 3OJUA 3T3FA 3VQCA 1RI0A 3L8BA 4C5GA 5CZ2A 2XY5A 1KLNA 5J2PA 2FC0A 4DF8A 1NJWA 3NF7A 4HCZA 2O4XA 4O0JA 2PYLA 1KHCA 3O3HA 3QEXA 1TL1A 3HVTA 4M41A 4Y1DA 4AHRA 2PYJA 1C6VA 1C0MA 2ITGA 4DQSA 1NKEA 1HNVA 2IGIA 1JXBA 3KK1A 3PO4A 5J26A 2CKKA 3DRPA 4NCBA 3P1GA 4M3TA 2BGGA 5C24A 5D6XA 4N5SA 3H08A 3SQ1A 4DG1A 2E4LA 2BANA 2VWKA 3ASKA 4CK1A 5C0MA 1W9HA 5E41A 3K57A 3KD1E 1XHXA 1VSLA 4F4KA 3TARA 4M3UA 4IUQA 4DTSA 2DY4A 1HJRA 3QEPA 4L59A 3RMAA 1RT4A 4CHYA 2X35A 3LH0A 3DLGA 3O3FA 1S5JA 2X4XA 4ICLA 1VRUA 2M16A 4CF9A 3CFRA 3U3GA 1JLBA 4CJVA 3PMIA 5D6WA 3RTVA 4Z4IA 4EDUA 4CESA 5KE2A 3K59A 3LX7A 4E3SA 4KHSA 4N4GA 1D9FA 3S6WA 2XO7A 1A5XA 4DQIA 2YHAA 3CQ8A 2Z1GA 1F21A 1WAJA 2YHBA 4M42A 4J2DA 3MEUA 1ZBIA 3HK2A 2YRVA 4CJEA 2NUBA 4A4FA 3AO1A 4DLEA 3MP6A 4RW8A 3S3NA 3KLHA 1RT1A 1JLAA 1G15A 2YNFA 3ZSYA 4CHPA 1DTTA 5KGXA 4E7JA 3VQPA 4RG2A 1KFDA 1T05A 2G8VA 3CYMA 1SL1A 3NF8A 4Z02A 3KTQA 4B9MA 1JKHA 3LZJA 3KJVA 4PLIA 3C94A 3LYIA 2YNIA 4QCLA 2RHZA 5FRNA 4BWJA 1WLJA 4CJPA 3UT1A 1T03A 3WNFA 1WSJA 2DAQA 2FBXA 3ITHA 4NCGA 1TK0A 3I0SA 1JL2A 2RF2A 4FLYA 1ASVA 1JLCA 3AVCA 3HYFA 4CF0A 3AVLA 3E9FA 4DFMA 4DF4A 4Z4EA 3U3YA 3SCXA 3UIQA 1NK7A 4KHQA 5C25A 3NFAA 2OZMA 3FC3A 1TKDA 4FJJA 4M3XA 2IAJA 4YFUA 1YT3A 1ZBLA 3E01A 5KI6A 4L8RB 1WJRA 4BACA 1S1WA 2P1JA 3LAMA 3C6UA 5EU7A 4O44A 2LDMA 4I2PA 1BI4B 3M8SA 3DLRA 4KV8A 3F70A 3AV9A 1OI1A 2RHXA 4AHVA 4CJ3A 3RMCA 4XIUA 3V9UA 3RRHA 1U4BA 4IUVA 4FLZA 3OA6A 4E7IA 2O4GA 2X6SA 1RBUA 1HYVA 4JLHA 4C8MA 4KPYA 1YTUA 4NCAA 1BGXT 2F8TA 4CGFA 4I9QA 1S1XA 1XHZA 4FK0A 3OB9A 1VSJA 3E9GA 4ELVA 4MQ3A 1TKZA 3AVHA 2O4IA 1I3AA 1IKWA 3IRXA 2BIVA 4G1QA 3QIIA 4NYNA 4KKOA 4E1NA 3V9ZA 4CGIA 3V9SA 3TAPA 4IKFA 1BCOA 1HQUA 5KGWA 4CF1A 1RTDA 3IAYA 2VG5A 4CEQA 2FBVA 4Z4CA 3TANA 1RNHA 3D0PA 2E5QA 1S1UA 3DLEA 3ALYA 3HM9A 4E7LA 3NTHA 3SQ2A 4CGDA 1WSFA
chains in the Genus database with same CATH superfamily
1SVOA 5CJ9A 4AYBA 3ABMH 3QIOA 4ASNA 3S41A 2ECBA 2EQUA 2V79A 2HHXA 4DOVA 2HOTA 4C8QF 3ML6A 1ZQ3P 3IRQA 5LJ3j 1R77A 3VERA 1YYVA 4UUTA 4X34A 2K2VA 5JHFA 4KBMB 3TSZA 1PCXA 2XROA 1C1CA 2ZXIA 3OWTA 1VQ7A 1ACIA 2DLLA 1TVRA 1MJ9A 4O4GA 4IEEA 4B1XB 2BZTA 5D4RA 1GLFO 1CGPA 2PUOB 3TL4X 1S1VA 1UHFA 4LDWA 1NOZA 1W36C 1MDMB 2CW0F 3CUOA 2P9SA 1HYOA 4XLNF 4IO9L 3WUHA 1BA5A 4F3TA 1SMYF 2ZNYA 2KAFA 4FLVA 2DERA 3ZSXA 3PFSA 3OYHA 1T8IA 1AOYA 2V26A 3DF8A 2XDBA 1C1BA 4AVPA 4KGZB 2M0YA 3CCLQ 3VQAA 2BY0A 3FX3A 1BC7C 1TG0A 5CVUA 2ISYA 2DXCA 3H35A 2HHWA 3RR7A 1G2HA 4KJZA 2FF6A 2VJIA 2K3YA 4KTWA 2ZPGB 3QUIA 1I0CA 3V9WA 5DTDA 3PFYA 2BZ8A 4XTWA 2IS1A 5F0CA 4XLAA 2QQ8A 4G6TB 4AIKA 2ECCA 5CR4A 2QW9A 2OAUA 1ACMB 2DL3A 1HDPA 2DRKA 3EFRA 2D0CA 4KMFA 4DV6K 2L4MA 2LX7A 5I2MA 4D5CA 3V1OA 1P90A 2A6HF 1RC9A 4IPAA 1ZSGA 2A08A 3HZJA 1YHQQ 3I55A 1J6ZA 5DCMA 1IRGA 4M78D 3O08A 2OPSA 2M2EA 1LCUA 1CZBA 1QHHD 2P9UB 3J8AA 1IV8A 4B3SK 3B02A 1S1NA 4PJOD 4KH1B 4LDVA 2DTUA 3EGDB 3RPUA 3CC2Q 2CH6A 3U1KA 1UFMA 3OIPA 1PP8F 3B6AA 3NGPA 1NJXA 5C6SA 3F72A 4ZYEA 2XK0A 1B72A 5D8KB 2UXDK 1VQOI 3T1BA 5TRDA 3ZEHA 3T0YA 1M9SA 1NK8A 5C44J 2IGOA 2QGFB 2RI3A 3VTIA 3SUNA 2ZCWA 2DMOA 5KH6A 4A2BA 3QOPA 3E9LA 1RRSA 3CG7A 2DFEA 4YY3K 5HK0A 1AOJA 2F5EA 3BUZB 3MEEA 3O8GA 4LD9K 1UHWA 2HHSA 5CZ1A 4Z88A 4BC2A 5HOOA 4YOQA 3PE0A 3ZXSA 1KQJA 2QQ9A 4FK4A 3U4LA 5DM7R 2O5RA 4PJNA 2WC2A 4FJNA 5IT9O 3M3YJ 2D0OA 2F7TA 1RBSA 1U6GA 3PVQA 1FPQA 4B08A 4UUSA 1QNTA 2QM3A 3JTHA 1HDDC 3VGKA 3CCQT 4HUGA 4KMUX 4IFVA 1UG0A 1NNEA 5IH2A 3TSQA 2LTPA 2EV6A 5FKLA 2OTJI 1NK0A 1NJIO 2VBYA 1QS4A 2E70A 1MUNA 5FWCA 1HD3A 1SFUA 3R6SA 2OTJQ 1I3QJ 2MWPA 4M74A 4CEAA 3MK6A 3WXLA 4M77C 2OTLA 4E89A 4CFBA 3O8VA 1N25A 1J5OA 2P7VB 4BXFA 3G4SN 4GY5A 4CBWA 4PJOG 5F1RA 3BDUA 2JXBA 4DU3A 4DWIA 1WVRA 2D2WA 3REBB 5HS9A 1AKHA 4OPJA 5F04A 4GLKA 3MEAA 4DTMA 4XQFA 3ZX3A 5FLXO 5D6EA 4XRMA 1JLFA 3CETA 3MAJA 4KIGA 4EZ9A 2ZPEB 1RILA 2KQWA 4OFHA 1ETYA 4PFPA 5D6YA 1JJ6C 1UGRB 1EWQA 2HGCA 4D5FA 3ZCMA 4OAZA 4PLLA 4EV0A 1JJ2A 2VL8A 4F7UF 4PA1A 5E3LA 2E6LA 2WBNA 3VOEA 5IP9J 1WEGA 3QWYA 4F9OA 1D0YA 1RI7A 4FJ9A 4ITVA 1HNXK 3PIPA 1BCMA 3BZCA 1UHMA 3MJXA 3CFPA 1X01A 2QQAA 1YJNT 1RI0A 5TISC 1VIEA 3D2FA 3I4NJ 1E3PA 4BRCA 4O0JA 1UGVA 1TUUA 3SDZA 3O80A 2ITGA 2DK5A 3TDUC 5D6XA 4YIIA 5E18F 3SQ1A 3ASKA 1HCRA 1HW2A 1RT4A 3DLGA 4M6YA 3K6GA 3PMIA 2O8DA 4EDUA 4WYBA 2XO7A 1PU6A 4AF1A 1U78A 1UFFA 2X9HA 4I0AA 2IS2A 2NUBA 1MMDA 4M6XA 3EH2A 3OIOA 2UXBK 2H6CA 2XGEA 1U2WA 2OD5A 1JJ8C 1NGGA 1Z91A 5HS8A 1ATSA 1VQPQ 1MW7A 2YHXA 3G71Q 3GFLA 4Z02A 4R56A 3JRGA 1GXIE 3CCLN 1OCCH 5CPRB 4PLIA 4A53A 4DBQA 1WSJA 5AZJB 2QA4I 3S1RJ 3VETA 1NEGA 2QTVA 3M1FA 1JLCA 3ECHA 1BM9A 1A6QA 1KEAA 2Z16A 4LB5A 3NFAA 1ETOA 4DV4K 3ZEUA 2P1JA 1RRJA 3FZFA 4O44A 1E3OC 3WXIA 1U4BA 4OIRF 1RADB 3K9JA 4L0YB 3VF6A 2VKDA 4QT7A 5GADP 4AWXB 2NRAC 3SHWA 1U2VB 3V9SA 3TAPA 2MC4A 4Z89A 1HKQA 3D2FB 3BJOA 2L02A 1WSFA 4JI3K 4DCHA 1KZHA 4GMJB 2W0ZA 2Z1IA 3KP3A 3PJRA 3TSPA 4NUBA 5GANd 2EJFA 3A8OB 4IDKA 2FZKB 4BC4A 4A3MJ 3VA0A 2ZGYA 4FLXA 3K58A 1YP5A 5EOYA 3H6ZA 3W6VA 4KH5A 2FQ4A 1MKMA 1ZN2A 3B6CA 2LD5A 1QHTA 4QQ6A 2CGLA 3J7AP 4KI4A 5E20A 2FVUA 2BVLA 2A37A 5CIUA 4JZ3A 4IIOA 2LFBA 4UC4A 3JCMX 4CECA 3HKSA 3K5OA 4G6QA 4GKKK 4IZ9A 3JRBA 1BI4A 5AQRA 1UCRA 4J5YA 3UNGC 3Q0UA 3ZQFA 2P9NA 4F2RA 3CF5L 4FZZA 4KTQA 4PL6A 1OV3A 1A31A 4BQLA 1U6ZA 1B34A 2BYVE 4EMKA 4L9JA 4OGCA 2KZMA 2M3AA 5K7HA 2QKLB 3BR5A 1WBDA 5DLOA 1REPC 3RDIA 1K8AU 2D0NA 3M1EA 3EGXB 1WJAA 3F23A 1PG5B 3CPFA 1XCVA 1QRYA 2W41A 2WY8Q 3DEUA 4CZCA 1P7MA 5GIPA 1K8AC 2VKEA 3JCMh 2R5AA 4EEFG 2P9KB 1LV5A 3VN5A 1HSJA 1QQOA 4KTZA 4BR2A 5EXWA 3B8AX 2XRNA 4GVMA 5FU7C 2JN0A 3S32A 5I3UA 3CJQB 2O8KA 3L3VA 5DS9A 3GOXA 4IOXA 2V52B 5H6RA 4CEDA 3HI0A 5HDGA 3F0ZA 3AAQA 4L3QA 2E7WA 2NVQJ 4CFAA 2KHOA 4DIQA 1WJCA 4FZYA 2FRWA 4MEXF 3LGFA 3H0IA 3GFIA 1I4K1 1IV0A 2P7CB 2AQFA 1BR4A 1KGSA 1RDWX 2GM4A 1BJZA 4KGXB 2E2HJ 4O5FA 2FU4A 4A3BJ 2GTDA 3J7ZI 1KU9A 4MLEA 1QCOA 3VWBA 1JJ2S 1FKPA 2CZ0B 5I42A 3H9GA 3JRAA 5BPMA 2P9IA 4EA5A 4FWRA 4B23A 4I7FA 4CA0A 4IHXA 1ZBXA 1Q7YO 1SMTA 1M90U 1SHGA 3RIRA 5DM7F 2PU9B 2QYOA 1VQLI 3H8ZA 2JT1A 3JRIA 3HXLA 5LJ5j 1MPGA 5CQYA 2UYTA 1DU6A 3GTQJ 4E2FB 2QTDA 3CC4I 2WONA 3OYJA 1N75A 1R7JA 4LD6A 1XC5A 2A7YA 1Y1WJ 1S6PA 2UUBK 1X69A 4C8KA 4CK3A 3GFMA 5D7UA 5HLGA 3I4MJ 4YTLA 1QMCA 2XHKA 3L7WA 4GO1A 2LCCA 5J1UA 1JKOC 5J2NA 5GAN5 2O8EB 4FT8A 2V1NA 1TUYA 1N36K 3TW7A 1N32K 2QI2A 4ZZDA 4EPCA 4MQVA 1HXDA 4ZHRA 5FU6C 3OH9A 4Z8AA 4YPRA 5LGTA 2MW8A 1JB0E 1ZRFA 1TK8A 1VQ6T 4KICA 3UA6A 1TP4A 1N8RR 3K4MA 3EHQA 1NBEB 4FU6A 1BHLA 1FC3A 4EM0B 2OTLI 4XTVA 2KYBA 1KONA 3GOIA 2V9PA 2FBTA 3VRZA 4EIAA 5D6FA 4B8AB 4B9NA 2EQMA 4BHBA 1YJNA 3SFIA 1TT5B 2V1RA 1SZ2A 2LC2A 2A3SA 2QENA 4DEYA 2A68F 2RQWA 4OJRA 1ZHIA 5LFAA 2ZJPF 3BZKA 4MQ9F 3WTXC 2KLOA 1PSFA 1KG4A 2DLPA 2JUFA 2K9LA 1IGNA 1VRTA 1K8AO 5M1KA 1NGDA 3NEUA 5GAOm 1HW5A 1VQ9I 3PY8A 1SANA 4LY7A 2P6SA 4BC5A 1ZK8A 1KFZA 3PMTA 4K2EA 3GIBA 3K2PA 1OU9A 1E17A 3PUFA 2QWLA 4HHTA 3C2HA 2UUZA 1KG7A 3OW2M 3AY9A 2DOAA 4QWQA 4C0DB 4BJ5C 4F52A 2CUDA 2OPRA 3TPQA 1KLNA 5J2PA 2HQHA 3MKZA 4XK4A 1HNVA 1IW7F 5GAOr 1NJIU 1VQNT 5L3BA 3TBIA 5ILVA 2QA4A 3H08A 5E41A 2X6XA 1P2FA 3TARA 5AQOA 1JBMA 3K10A 3BDDA 3THKA 1EWRA 1KG5A 1JLBA 1IREB 1T2KA 2X3WD 3CBMA 4DLEA 2BV6A 3ZFJA 2MD5A 1UMQA 2OTJN 2F5FA 4DQ2A 5KGXA 1YVNA 1OCPA 1T05A 3D2EB 4XKVA 1EBMA 3C94A 2YNIA 1E0EA 4CYCA 1TBXA 4NC7A 3TEEA 3PTAA 1DP3A 1GCQC 4EA4A 1U2VA 3DQVC 3V8JA 1JCFA 3H3VK 4C92A 1AWCA 3DLRA 1E3MA 1GV5A 1M1KO 1IN5A 3RRHA 3F21A 3EO3A 4C0DC 3MN6A 3SAHA 4LG3A 1G6NA 4YDUA 3FMSA 2K57A 4V2FA 3CCRQ 1S1XA 5IT3A 3F5TA 3FHNA 4M77B 2OUMA 1MNEA 5M1OA 2O61A 2BIVA 2E35A 3JCMg 1YF5L 2FG0A 2WFBA 3D0PA 1XNQK 1B07A 2QZ8A 1Z6RA 3D1NI 1K76A 4M9XA 1TT0A 1J54A 4XH5A 3OA9A 4BJTA 4L5GA 4S04A 4CJFA 1T3VA 1XMOK 4C1NI 3VS1A 3OJSA 3ZSWA 3RKQA 1U5SA 1OPCA 4X66K 3CO7C 2FPFA 1LUJB 3BY7A 5BNGA 1YTAA 2WY7Q 1VNDA 1HSQA 2JQ7A 3E1SA 2YKMA 2M7BA 2VGNA 1VYVA 3A01B 2RJDA 1QPIA 1LWWA 2RJFA 5AQUA 4E0DA 2ZD1A 3H6EA 3FXOA 1NHAA 4AU7A 3WXMB 2E1CA 1YG2A 4A3EJ 5J4VA 2ASOA 3I56I 1GLLO 4O8UA 3THWA 2VQEK 1BG3A 4GGGA 2R7WA 1KQ9A 3KD5E 2PMZN 1D5YA 2Y90A 5BN9A 5CO7A 2EIMH 3CD6T 2P9LA 2VT2A 1RCHA 5HY6A 2GF7A 1K9MR 2DOFA 3TU5A 2CP6A 4I6MB 4JKGA 1BQNA 3REOA 1NK4A 4BRAA 2DXUA 4Z6YA 4OMOA 5KQDA 4HXJA 1Z6TA 1IBKK 5LJ5g 4B9XA 3RPQA 1YI2Q 1R8OB 2D4WA 4BQZA 4IL6C 4CZEA 1N3AA 2BZXA 1IZ1A 2KP6A 4KUMA 5JLHA 4DR3K 1DTQA 2FPDA 3P5JA 1DJ7B 3BWGA 3V1RA 1Y71A 3NBPA 1YW7A 3SLCA 1BIUA 3ZX2A 3QZ5B 1UECA 4CEOA 2XY8A 2L3DA 5JVHL 1R58A 3LL3A 2FBYA 3NDKA 5GANg 3BG7A 2D5RA 2W85A 3RYPA 3OYBA 3SAGA 2JTEA 5C2FA 1CZAN 1PU8A 3HOYJ 4CDGA 4A3GJ 2P0WA 2PJRB 4D8KA 1LDJA 1KD1R 4DKWA 2OFKA 2DL4A 3HSRA 3LA2A 1NJYA 4RM3A 3CMEQ 1NH3A 1YTYA 2WAEA 4BH9A 1VQ7N 3UF4A 3EN9A 4FSSA 2RHUA 1MBGA 2KI7A 3KLGA 1VQNA 3Q0WA 1Q86O 4DR1K 4C8LA 4AH9A 1RIOH 4EMGA 1TGOA 2XAQA 2FZGB 1CF7B 5ICCA 2DPDA 3I5RA 4BKXA 1EP4A 2E7XA 1BL0A 2VG6A 1XX5A 4KI6A 1IN6A 5JLXA 4A5AA 5BMZA 4M7YA 2QWRA 3QDRB 3CF5F 2QQBA 2ROTA 4AIAA 3VGMA 4PJOC 4WF9L 4YOUA 4LF6K 5CQXA 5I22A 4XBFA 3X26B 4PDKA 2FB7A 1RAEB 4A4EA 4Q4ZF 2HBLA 4O8KA 3CPWP 3AA5X 2DFHA 2A61A 1B3QA 2DIQA 4X1EA 5GMKl 1VQNN 1YIJI 5ELZA 5CQEA 3FXQA 3TO9A 4DK9A 2KXCA 2EHGA 1HYZA 4A0ZA 5C3EJ 4AM3A 1VQMA 2CH0A 2PQ8A 1YI2N 1FOYA 1RABB 1F1ZA 2FLOA 2CP0A 1WN7A 4AFQC 1SC7A 1EKEA 5KYWB 3NPFA 2FA5A 4XU1A 4FJHA 2BDPA 2Z33A 2FSJA 5HP1A 3M57A 1IRXA 3I59B 4F7UG 4WQ5A 5ILUA 2ZQBA 1B1BA 2H09A 1I1SA 3V6DA 5GJVB 5J39A 2LRDA 3NHGA 1ZSZC 8AT1B 1VQNI 4RLFA 1KQ8A 2WTUA 1Y7XA 3L2VA 2XGXA 1W2BM 2HHQA 2LOOA 2J6KA 2CQXA 2XVCA 3MZYA 4W5QA 4EJTA 2GELA 3C4SA 2KFNA 1MNDA 5HODA 4H5WA 3FXMA 4GYIA 4H5NA 3HT3A 4CD1A 2R7QA 2HVRA 3A98A 1A36A 3A8GB 2QA4Q 3E7LA 1VQMI 2EKHA 4E19A 5JFRA 2RB6A 3QLHA 1W7AA 1WHGA 4YDUC 3P39A 2XU8A 2AIRB 1Q82U 3O1BA 4B3MK 4H0EA 2CGHA 1JL1A 1RL2A 5F0FA 3VESA 4JK1X 5KRSA 2F5CA 4Y0WA 2V6CA 2B86A 1ZBUA 3PIPL 3TAQA 1HQCA 3OMGA 3VS7A 2V1XA 2K7LA 4XAXB 1ILYA 1BBZA 5KYWA 3FEOA 1SEMA 5AR0A 2ZE2A 1TU0B 2XHCA 3UPUA 4LK0F 1R6RA 4DF8A 2NOLA 2W84A 4M41A 2J7IA 1LEBA 1R49A 3SXYA 3RPUD 3BJ6A 2EA2A 3VV0A 4FL9A 5LGUA 4CH7A 1EJ9A 4D7NA 3JW4A 4BGBA 1WHUA 1KU2A 4B1ZA 1EFNA 4PJMA 3KHYA 4RAFA 4RTUA 4E3SA 1NLPC 2QF7A 4EJUA 2JK3A 4E7SA 2Z1GA 4OB1B 1YN8A 1TQIA 2L7KA 2P4WA 3RZDJ 1IG7A 4Y28E 1IV6A 3VQPA 4B8XA 3GNFB 2MSYA 1KC8U 3AGRA 2QBYB 1YQMA 1TK0A 4CYCB 3TSUA 4RCBA 2RF0A 3E9FA 3RSEA 4Z4EA 4YOTA 4UB6C 1JJ2M 3I56T 3CWAA 4O5VA 3RVCA 2V7FA 4ABZA 2X3XD 1YT3A 3A5OC 2CP5A 3M8SA 3BG9A 3M0QA 1OI1A 3Q5FA 3RMCA 4YFKF 2VBWA 2KRHA 1HYVA 4CSWA 3LWHA 3HGGA 2JT4A 2EB7A 1I3AA 3HTVA 4IKFA 2K9QA 1BN5A 5LJ3h 1P6RA 5KYYB 2HTJA 1K9MO 4BRKA 4PIIA 1UZCA 2E1NA 1QKXA 5GAOl 3C2GA 3RRGA 5F1XA 3MWMA 4XICA 3OYEA 2O01E 4J6YA 3GZNB 4OOIA 2RN2A 1X43A 3JCMd 3R6OA 3P8BB 3DTIA 3F8CA 4CJQA 1F9NA 1RTIA 4B44A 2VB6A 2COYA 3META 3G3ZA 1G4DA 3HL8A 2Q2EB 2DA9A 4LDUA 4ZTFA 2Q0RA 1K9MU 1RRQA 4J2BA 2XKPA 3JSCA 3KLOA 4KRFA 2NVTJ 3GO5A 5BRFA 1OX9A 3SQ0A 4ELUA 5GAGJ 1OMIA 1SVMA 2X4YA 4KO0A 5JR3A 3WEEB 4FJKA 4DLGA 2G0EA 4FLUA 3R2XC 4A0YA 3S15J 3L0QA 2HZTA 2UXXA 4OB3B 4C2UA 5C4XJ 2NRWA 1QSYA 4CRIA 1V4RA 4RTFD 3GZ6A 4J00A 3TI0A 2OZSA 2R5ZB 1KVCA 4CF8A 3BY5A 1XUPO 5IXBA 3L2QA 3JCMb 4MZMA 4HAMA 1AHJB 1ZSZA 5LY3A 4NDLA 2L7MP 4D9JA 1VIFA 1RT2A 2E6NA 1KD1C 4BBSJ 2PJRA 3LSMA 2CGPA 1HBXG 2WSEE 2FSKA 4II3A 1W0HA 2E65A 1B9DA 3W6JB 3GDQA 1Q9YA 3F9KA 4A63B 2WV1A 1X3ZB 2V8KA 3JAMK 4DSFA 1MUDA 2H8HA 4IF4A 1UDLA 2KRNA 5ICEA 3BR2A 3D45A 5FPDA 5E79C 3LNQA 2HMAA 2Q2EA 1Y64A 1RDDA 3LFKA 5LLQA 2KEAA 4MO5A 2NS7A 5BR8K 1UGQB 3CUQA 3GEZA 4ID5A 1EV7A 1WXBA 2L7ZA 4ORZA 4FISA 2D1VA 1M3BA 3CJRB 4XORA 1FBSA 2A6AA 4G6DA 3V8LA 3SEZA 2AZVA 2K85A 1Q82O 4B3OA 4CJUA 1SKRA 2YV0X 4CE9A 1TWCJ 4J83A 4YELA 5H1SQ 2X1DA 2X78A 3U1DA 3PIOA 2GWKA 1KIKA 1S3JA 3R3LA 1RFQA 3HM5A 1NYGA 2JNGA 3KP6A 4HPQA 3M6GA 3I58A 3CLQA 2AHJB 3VU3C 2CV2A 4F93B 1P7JA 3MXMA 2CO5A 5D5VB 1KYWA 1KO9A 1U5TA 3KPHA 2YNGA 1IUYA 3HRTA 3CMEI 4F3OA 4X62K 1WSGA 4P55A 3FK7A 1I5ZA 2LLKA 2VPLA 1R1UA 2LY2A 3QP6A 1RT5A 4ZDLA 1HYSA 4WFNL 3SQNA 1IO2A 2OANA 5ED4A 2GA1A 3CJNA 3CMAI 2L3PA 3ABUA 3NTIA 1SKSA 3WT0A 2R5YA 3ZPLA 1QQJA 4QLCU 1C6VX 4JRQA 4KUIA 4DJAA 4PSWA 1WSIA 3KTUA 2OI3A 5B3SH 3GF2A 2VCPA 4NS5A 8ATCB 5GAN4 4E6KG 5LJ5d 2HXOA 4N41A 3KEQA 3W6KB 1WEFA 2GWRA 3FFKB 5FJ8J 4JKDA 2HNIA 3LSJA 4CIEA 1RR8C 4ELTA 4E70A 5FDLA 1ETQA 5FWBA 3DRSA 4WXDA 5IAYA 2A69F 1Z67A 1FWZA 2LY1A 4PKGA 1UA1A 1FK9A 1R59O 2DI3A 5HRNA 3K4NA 2FSNA 1LWYA 3FHFA 4DTXA 4DTRA 2WSFE 4M3YA 1K4TA 2HBWA 1U04A 2DX1A 3MCAB 2KNBB 3HP6A 4QOZB 2P9SB 2EZLA 3GFJA 3QMLA 1VQ9A 5H20A 2CGJA 1W4SA 1N9RA 4NXNK 2F4OB 3SQ4A 4CICA 4M6VA 5M9OA 2VQHA 4FM2A 4E4HA 1VQLT 2MGQA 3O9QA 4BC3A 4HYEA 4K42A 4CJSA 4FJLA 4FL6A 4OAYA 5DV5A 3C1DA 1WX6A 3RR8A 2ZAEA 2HHHK 3AL0C 1VQ7Q 2L5QA 3REAB 2LCSA 4DR4K 3ULRB 4L9TA 1D8KA 2L0AA 1CLQA 5E1XA 1YJNQ 1T0FC 3IDHA 3HSEA 2LP5A 3VDXA 5CZ2A 3SZPA 3CCUI 1U1SA 3GZ5A 3HBLA 1S72N 2J06A 4Y1DA 2DPPB 4OMPA 4KN4X 4DQSA 5C24A 2RH2A 3KD1E 2ZJ2A 5HLIA 2LH9A 5C15A 4JJDA 1AWJA 3RMAA 1FIPA 3BR1A 3EETA 3G71N 2M16A 4HOBA 2EFNA 3F8MA 4ENMA 3LX7A 1W7PD 4IZZA 2ZMEC 1H1VA 2LF7A 3LDQA 2YHAA 2JM8A 2YHBA 2PMUA 4JI6K 3RMQA 2OTLT 4E7JA 4FWPA 5DCFA 1D3YA 3ZLJA 1SD4A 4BG8A 2UZKA 3KJVA 4BWJA 3UR3C 2QEXA 3CCSQ 4DF4A 4EJVA 2K3FA 1WZOA 5CR2A 4JI4K 4EW0A 5KYYA 3M56A 2NRHA 1BR2A 5EU7A 2F5DA 4CJ3A 3RCOA 1WQ2A 3H1CA 4CGFA 4I9QA 3GL1A 2LVSA 2FUG2 3WE3A 1B9MA 3AVHA 2O4IA 4LNPA 2J5PA 4E1NA 1BCOA 1RTDA 2FBVA 5AQFA 3SQ2A 2HWVA 4AQYK 3CJ9A 2PNIA 3J81K 2DMQA 4CZZA 2CJJA 4FASD 4M3EA 3AFHA 1W2BA 2QYZA 3H0DA 4OB2B 3U6FA 3TSWA 3CCUN 1DGRM 1M2VA 4AIHA 2Y30A 2DVJA 5CKDA 4RGSA 2EJGA 4JJCA 1VQ4A 4BI3A 2QEXQ 4Y7NJ 2BTFA 4XRFA 4X1VA 3CD6A 3A0IX 3CCSA 5BREA 1PRMC 3NTKA 4HG2A 4BHPA 2GX9A 2F1LA 3G71I 2GCXA 2C06A 1JTXA 3IFRA 5A2QZ 1DPRA 3CC4N 4FYVB 1H89C 1M1KU 1NMNA 1XWLA 3DOKA 3JCMP 1H641 2K9GA 5F0XA 3CCMT 1KVBA 2DQRA 3O4NA 2RKIA 4J9EA 3SPYA 4CCJA 1X6OA 1YJ9A 3HSFA 4LK1F 1TC3C 4KBOA 2BY1A 1OYYA 3VKIA 1KU7A 4AHTA 4W5TA 1MSFC 3QETA 3DXMA 1U5TC 2YJEA 1CXQA 2L8DA 1WWXA 3WODF 4DYCA 1TS9A 4BROA 3JB9D 2DA2A 1NGJA 5AFUA 3VA3A 3JRFA 2XAHA 3ZMUA 3FSPA 1YHQT 2ETJA 2GGRA 3QO9A 3O8HA 3H5AA 3ZGKA 2BKDN 2HYFA 4Z2YA 2E36A 4NQWA 2A3LA 4Y4RA 3GLLA 3DKMA 1WQWA 1SG5A 2MWOA 2FZCB 4DQPA 4RKUE 1K7AA 4E1MA 3M8QA 2F8TA 1X4PA 2RI2A 1LOJA 1Z3YA 1XC9A 3QU3A 2ZWHA 5KYXA 5FLMJ 4PKHA 4LH4A 4C5EA 4HNTA 1SHFA 2Y4YA 3LW5E 5KAIC 3QDFA 2LQWA 1ZBSA 3A02A 3AVAA 3KP4A 1ZYQA 4M78B 2L9NA 2YUSA 5D5XB 4NB4A 1TK5A 2C6YA 1QO0D 3A4CA 3CCSI 4JRKA 3A8MB 4FTHA 1XG1A 2LVMA 3SFZA 4OVLA 3FWEA 3EKUA 4XKCA 4B21A 3DLLA 3CC4Q 4CC4B 1W5CC 3C3WA 2VUMJ 1RLQC 3ZP5A 4BY1J 4M77E 3RMDA 3MP1A 1OVYA 3F8FA 3DRRA 4L5IA 3IWFA 3HSTB 2KFDA 3U2RA 5LHGA 4ZDPA 1QZYA 3AA2A 3CC7I 1GLJO 2QGUA 2M1HA 4CCLA 4BEHB 1NGEA 4CBUA 3DPTA 4NBQA 4YORA 2IAIA 3K0SA 2XUBA 4WXCA 4KHNA 1GBQA 1YW9A 2PQWA 3FXLA 3VS5A 2CQ7A 5EVZA 2Z2SB 4KN7X 3JCMc 2JRTA 3BTIA 1ABQA 3WTUC 1BIZA 3N4PA 1X58A 1PYVA 3VQ4A 3TO7A 3CO6C 4XTXA 3H0FA 4FWNA 2YCHA 2X48A 2P9NB 3QYEA 3OVNA 4IOAF 5CVJA 4LDXA 1U06A 4B1VA 2IVNA 3WGHA 1HKGA 5IHNA 4M3ZA 4R79A 3GTOJ 2ITMA 4V2SA 3NAUA 3F10A 3ULEA 3RSNA 2R5YB 1X19A 2HFHA 4IOCF 4FPBA 3UWNA 3OYNA 2ELKA 3QODA 3KP7A 2KT1A 1ZGAA 4EGZA 2K3BA 4BDZA 3FDRA 3QEVA 2YRDA 3O9TA 1NPPA 3CCRT 5J2QA 2J6OA 5B8HA 3EZWA 4W1UA 5EEGA 4GV6A 3FZKA 5DM7L 1BA0A 1L0OC 2HPMA 6PAXA 1I5LA 3I4PA 1R4MB 1UUEA 3CCVI 4A3KJ 4JOMA 3HSBA 3L2CA 5IY5H 3ZMTA 4MDBA 1NK5A 4M7DA 1VQ7I 3VYHB 1H9GA 4CIGA 3DLMA 5E26A 1IRZA 1HPZA 1LMZA 3RTRA 5JVGF 1TWFJ 1HNZK 1SPKA 2ZSIB 4NLCA 2KSSA 1OYIA 4CJRA 2WUSA 4A93J 5JVGL 1N5ZA 1R1TA 3ONQA 1WOQA 2HS5A 5GTHC 3RMBA 3BR0A 3CCMQ 4C5HA 2R58A 3FHGA 4K25A 1V5GA 3OW2S 4BRPA 4RBOA 4CCHA 4VUBA 4DFJA 3WTYC 1QVUA 3DLLF 4ZGDB 1RT7A 1VQ5Q 4KDPA 1T39A 2W42A 1D0XA 1E6GA 2FE3A 2QEXT 4YNQA 4LSLA 1U49A 2LBFB 1C0WA 4PZJA 4FWSA 2CS3A 4CGZA 4DV0K 3KFWX 1NJWA 4EW4A 2EBIA 2XPVA 3EE8A 4MDAA 2JJ9A 3J81E 1MGQA 1WHLA 3KK1A 3LSIA 3HFOA 5IHKA 3LL7A 4DG1A 1BKBA 2K02A 1XHXA 2DY4A 3QEPA 1X3WB 5GAEP 3HBTA 1ZUUA 4CZIA 5DEQA 1AU7A 1S72Q 2HNHA 2KR3A 2ZJQL 3S3NA 3D5LA 4EQQA 2JRMA 4PCQA 4JKAA 3GMEA 4CHUA 1Y96A 5HK3A 1AD5A 5J3LA 3OSVA 1JQQA 4QCLA 4ZH4F 3BF3A 2DAQA 2K6DA 3ITHA 2VKHA 1ZG1A 4M75C 3I5SA 3GP8A 3IH3A 4UNFA 2K3PA 1HU0A 2DNUA 3I53A 3EKSA 4KHQA 1K73C 2K4JA 2LSOA 3LSHA 1WJRA 4A5BA 5LGNA 4IEIA 5GAMf 1RBUA 2CUZA 4A2AA 3ISPA 3HOTA 4MQ3A 2LR8A 2AT1B 1GLAG 2EBPA 3IC7A 1HQUA 2VG5A 4Z4CA 3TANA 3HFNA 4E7LA 3DTKA 2IA1A 1LWVA 3H5RA 2RQRA 2E64A 4IJNA 3O6BB 5HLFA 1FP1D 1T33A 3DXKB 4KFBA 4MO7A 2O9LA 5FROA 1RBRA 1V76A 2KQRA 1ERDA 3CUQC 3D7EO 1N78A 2Q1ZB 1SKWA 1QGPA 5GAOp 2E1MC 2MF2A 3CCEI 1BOBA 3IKVA 1WXTA 3AG4H 1Y57A 3RSEB 3E2UA 3SZ2A 4B9VA 5CKTA 1S8NA 3BLYA 3P4IA 3M0PA 3VEZA 2XAGA 1RDUA 4MDXA 3WHCA 5ICGA 2IIMA 2GXGA 4AM6A 4QVZA 3RKXA 4RTTA 3CCJI 4DV1K 3GTJJ 2OAZA 3JCMV 1IH7A 4CYDA 1V55H 2LSNA 1Q81O 1JTYA 2W48A 4A62A 4BDYA 2K4YA 1KAYA 1EIFA 2LQNA 2JHNA 3I8DA 1Q7YR 4NC6A 2NAZA 4O5BA 3VQQA 5HROA 4IXCA 3RDVA 3L00A 2GLOA 1Z26A 4X64K 3N05A 4E1JA 1BOAA 3M53A 2EK5A 1ON2A 3ZMDA 4G7OF 2XSDC 3SZGA 2XSJC 4FHTA 4FM1A 4OMMA 5K5OA 3L1PA 3COAC 3UATA 1S3XA 3QBYA 1FMKA 5GMKe 2J6FA 1VSHA 1HJOA 4CCNA 1P59A 1X75C 3QDKA 3GTLJ 2EZIA 1B6AA 2R5ZA 1Q18A 3JB9I 3CM6A 3R1XA 4JS5A 2RK2A 2BBYA 5E3NA 3KEYA 2ROLA 3CDIA 4N9IA 3V9XA 2XDPA 3HJFA 2F69A 4N47A 4JKBA 2AA4A 4CEZA 3HO1A 3UKUB 3P9KA 4FYDA 4FLWA 4EMKC 3MO8A 2OU2A 3DYAA 3SZTA 1KQ0A 2XDVA 3X24B 3FKJA 4CBXA 1OCZH 1K79A 4OKEA 1JU5C 1VQ8N 1F5TA 4YHHK 3FBIB 3HHHA 1VSDA 1J9AA 1N27A 1MNMC 3ZCOA 4RG8A 1KFSA 1YQAA 1QSSA 3PNVA 1LJOA 4R1HA 1XB4A 3CCVT 5CLSA 3K4LA 1RNLA 2DN0A 4WCIA 1IKVA 1S5LC 1UG2A 1NTCA 3B6OA 1GL5A 1XMKA 1T44A 2KKZA 4BG9A 2RHYA 1IN7A 3CXCP 3GTGJ 1ENHA 2HD0A 1RACB 1X9MA 2R7UA 1GFCA 4KB1A 1ODDA 2PY5A 3PM1A 3K7AJ 4CEEA 3QP5A 4I98B 3ZL7C 3ZETA 2YUOA 4RB0A 1SSFA 2EKOA 3DKXA 3S2DJ 3OR1C 3OS0A 1T3SA 3K9KA 3K4CA 1USTA 3GPLA 1VQMN 5E8IA 2WV0A 4PJJA 1QZ6A 4DQ8A 2PJPA 1M2OA 3NMZC 3WTVC 4FX4A 3R4KA 1QVFS 4D8DA 3VS2A 3VYTB 1PJRA 3GVAA 3GBGA 4CF2A 2NS0A 2R7RA 1G59A 1WAFA 5C0YA 3QEIA 4PJ0C 2BXZA 1JKQC 1XG7A 3M55A 4M3WA 4LIUA 4CD3A 3BEXA 3CD6N 2QK0A 2V9KA 2B7EA 3E9OA 3OTOK 1Z9CA 1IJJA 1HRHA 1LAWA 2CT4A 4AMCA 1WHHA 4GVEA 5AT1B 2DM1A 1KC8O 3H1QA 3X28B 4M7AD 3AO5A 2NLUA 4HX4A 2HPIA 2KYMA 3QKJA 4I2QA 3KVGA 2HF3A 1D5AA 4M77G 3DPUA 3QINA 3DKWA 2XAFA 3MKYB 4P5NA 4V19S 2O8FB 2VJ4A 3LP1A 3AARA 1HA8A 5EJCA 1EZZB 5AQSA 4FJGA 4OIPF 9ATCB 4PHTX 3KKSA 3GF5A 1FSEA 4LD5A 1O3TA 2GIZA 3LP0A 1WPKA 4M3GA 3F8NA 2OZUA 3VENA 1RDBA 2PVDB 1ZC6A 3Q3SA 3VPRA 3ASOH 3FM5A 1VZ0A 2E2OA 3QOEA 1KD1U 4NQWB 3PIOF 4XLHA 2CV1A 4CVNE 2AQEA 3D5RC 2KT8A 1D4XA 5J26A 3CMYA 4M75F 1Y1VJ 1LKXA 4C30A 3CMAT 1WH7A 1W9HA 2XASA 5BPIA 3M07A 3EG9A 1IXRC 3K4KA 1S5JA 3WTWC 2JA5J 1RESA 4XM3A 1HPMA 3CCET 5M3FJ 3FHZA 2DFUA 2PI0A 2O8XA 1Q7YC 2JHJA 3TO6A 4H0YB 3CCYA 3CCLI 2COBA 2FX0A 1GXQA 2UWMA 3NF8A 5EZHA 3FXJA 2STWA 2GXAA 5F27A 4CJPA 5DUKA 3KYCB 1JEGA 5FKOA 1YHQA 2Y75A 2FPEA 2LX9A 3FC3A 1OULA 2LC4A 3ZEUB 4BREA 4DBHA 1S1WA 1JKPC 3C6UA 1X3UA 1F4KA 2LNBA 4J8OA 2MMPA 1DT9A 1X1DA 2X6SA 4E6RA 4XH1A 1YITA 5EGOB 1T08B 3EUHC 3IAYA 4U7DA 2R4GA 3DLEA 3G0QA 4CGDA 1M3CA 5GJWB 2L54A 2IIRA 2XF6A 1XI1A 3UA7A 1ZG5A 1YJWA 2W03A 1NG7A 5H2FC 1W97L 3V1QA 3CCMA 2GZWA 1NEBA 3W0LA 4OVAA 4RAGA 2FRYA 2HL3A 1Y8RB 4BR5A 2RREA 2GBZA 2NUZA 3LPUA 3E6BA 4R5PA 4HT9A 3CJTB 3FISA 3OYDA 1BISA 3DBRB 2IGKA 3NGZA 1DLOA 1QLYA 1ZELA 3CVTA 2FNPA 4OPKA 4QPQA 5J47A 4LN2A 1KC8C 5DCMB 2BY2A 5LJ5h 1R36A 3NHNA 4A4KA 1X9WA 1SFOJ 1X3MA 3WNHA 3V7SA 2G8HA 5DK5A 2DEUA 2CGKA 3QXEB 5FLXK 4YPHA 1Q82C 2DMUA 2YUPA 2D6FA 3LFUA 3G73A 5LD2C 2ICWG 2LQ8A 2BUPA 3EDPA 2IEKA 5EEHA 1Y8QB 2HR3A 4FJIA 3EGDA 4IUPA 3MEXA 4DZPA 1MHNA 1IRFA 1QPMA 1MWKA 1K78B 3CCEN 5GAMj 2JVGA 3TP3A 2QCOA 3CCQI 4DV2K 4C1NK 4CIFA 1Q1HA 1K61A 1X1CA 4MFBA 3CP8A 1S9HA 3DLHA 1J0RA 1WJ5A 3CXCA 3GUDA 3RR6A 2E6MA 1GOCA 2V4JC 3A01A 3F0CA 1PVSA 4RLQA 3OSSC 3MAQA 2HQNA 4EJZA 3WQTA 1ZBHA 2Z3YA 5JHUA 4EJOA 3HUGA 2A07F 2F2WA 4B4CA 4A3FJ 3KUFA 4HCBA 3R0AA 3VFZA 2O8BB 5AN4A 2A1SA 1I5OB 2NLXA 5AQKA 2L2OA 1TNSA 3EG0A 4F7UE 2G8FA 2ID6A 1JE8A 1E4GT 4P9UA 4M71A 1DIZA 1B4AA 3GBTA 3KFVA 4YG2F 4Q5SF 2RNGA 4LJZF 4UV8A 4EMSA 5FRMA 4M9SA 2AHQA 2HZYA 3H9JA 3HUGB 4XL9A 4M78F 1FMVA 5GANf 3G71T 1XSXA 1X9JA 4W97A 1OYWA 2K9SA 2XHBA 1I27A 3H3UA 3G7ZA 4KULA 1IXCA 3CCUA 2X6WA 4HLYA 3K5NA 5GMKi 3W2AA 3VEPA 3IAM2 1BB9A 3HTSB 3HKZN 5LJ5e 2DAOA 4PY5A 1YIJN 4WXHA 5L3DA 4HF0A 3C7JA 4C3IJ 2XKOA 2M34A 4XN3A 3LDNA 1BI3A 2FMLA 3DP7A 3E9PA 1W5TA 3I71A 4GV9A 5JS1A 4L6V5 3MEVA 1VSMA 5IYDJ 4C8QG 2JZYA 4N4OB 1PVEA 3PV8A 1OCOH 3NQOA 3MEWA 1TW3A 3E6CC 3DLLL 4C92E 4GRIA 4M72A 4CGJA 3Q1JA 4LFCK 1XC3A 3ENOA 2ED1A 1T95A 2XICA 3OW2P 4LSNA 3J80O 4OWRB 4DHYA 3MX5A 1T8EA 4Z4FA 2KZVA 2JJ7A 1O75A 2UV1A 2P9PB 2ZMEA 3NARA 2DTHA 3ZT1A 4Q5VA 5DY9A 4AC0A 4C8QD 3BC8A 1R0CB 3BGRA 3A5MC 1U8BA 4KISA 2M0MA 4MZPA 1PM3A 1MMGA 2YPRA 3IH7A 1NGBA 3TQNA 3QWXX 4NNJA 3LSTA 3M8JA 3HEFA 4YIFA 3J7AO 3A2KA 4P96A 3M5RA 1XMQK 4Z4GA 3CTAA 1I6XA 2FD5A 5K5RA 3G6ET 2P9PA 1HC8A 3CXCM 1LNXA 3KZYA 3OYFA 3CWUA 1MMSA 1X2NA 5FFXA 3LA7A 3LAPA 3O9RA 1TWGJ 4I01A 3I0XA 3A8HB 4FSXA 1ZXOA 2O8CA 2ZXWH 2FNAA 3CC7T 4KRTA 2XB5A 1ZX6A 5KCHA 4WK8F 1HK9A 4BBRJ 3PIOL 3M8EA 2X6OA 4H4MA 2CP7A 4C8QB 2UXCK 2YS9A 3HIFA 2VXDA 1J5EK 2RC4A 4V19K 1OISA 2CYZB 2FL7A 3OMYA 5J2MA 1O7LA 2KVQG 2OA8A 3MXIA 4F8RA 4IHTA 2XY5A 2M7AA 2FC0A 2PYLA 4QS7A 3PT9A 4F7UB 1C0MA 5KAFC 2IGIA 3UDCA 4AVZA 3DRPA 2BGGA 4N5SA 3SFMA 1BK2A 2GIVA 3EPZA 2ECZA 3RKYA 1G99A 2XF7A 3CFRA 5HVQC 3DTEA 3GTKJ 4M78G 4Y52J 3V7CA 4ISGA 2ASPA 5J3BA 1PC0A 2YRVA 4WFAL 4JYKA 2EFPA 5HDNA 1MMAA 4I2OA 3ZMVA 2YUNA 3SWNC 2PZ1A 2VODA 4JX6A 1IAWA 3GE1A 1JKHA 3LZJA 4JBAA 4X65K 3JREA 1T03A 3UT1A 5KPTA 3E1YA 2XG8D 3HZ6A 1MSEC 5C25A 4U0WA 1EA3A 2GQVA 1YRNB 2D1KA 2LJ3A 1XDUA 3J7ZO 1JHFA 4IUVA 2O4GA 3QYBA 3JXUA 3R0JA 1R9TJ 3BPXA 4ON0A 2DXIA 5HLHA 4G1QA 4DV5K 1NKBA 3BDPA 4G94A 1DEJA 1KA8A 4E47A 3CMMA 4CEQA 3CCSN 2XD0A 1RNHA 3HM9A 5AZIB 2NOZA 4HCCA 2YLCA 4FT4A 3LP2A 2L3SA 2NOIA 2TDXA 1MZBA 3VQ9A 3RKWA 3VMFB 2YR2A 1MV3A 2COZA 2RQVA 2CFXA 1IBMK 4LE9A 1O1WA 1VSKA 3LGLA 3SYTA 3GCMA 2MA3A 3WTZA 4DSLA 3CCUQ 3TGNA 2QEXI 2EQKA 3Q7BA 2OA4A 2HHVA 2YU3A 1MJBA 3DV8A 2RM4A 3THVA 3MQ0A 3PNWC 3ZT0A 3PNYA 5AFUH 3OY9A 4U0YA 1QVPA 1K6OA 3BY6A 1YX5A 1XSDA 4JKCA 1Q81R 5J8CA 1DQUA 1B7TA 2Q1NA 4NC8A 3BQYA 3K1PA 1VQLQ 2NZTA 5EG0A 2P9KA 3SJJA 4QTRA 3NF9A 4ZC3A 3EZ5A 1BBYA 4M3RA 2HEQA 5DYMA 1PU7A 1YVUA 5GPCA 2RVCA 3T1AA 1ATRA 3ZBDA 4FE7A 4H0TB 3R8EA 3DXKA 4M7AF 1JXEA 4LLGF 5LMUK 2NRXA 1RR7A 2ZXJA 2HQAA 3FKIJ 5FPMA 5TJJA 1DKGD 4BRHA 3TTCA 2ZKZA 1XPXA 2KDSA 2Y0MA 3OL4A 4F16A 2E41A 3CCJQ 4L5JA 4ZYGA 4G8XA 2ELJA 1K8KA 4JJBA 2I10A 5E3OA 1JLEA 5LJ5f 1EH6A 3G4SA 1LW2A 3KZIC 2XAUA 1RPWA 2E34A 1GLEG 2XGDA 3EY1A 3NE6A 3ZOBA 3G2BA 4JV5K 3LWMA 4M7DB 3SBGA 5AQVA 2TRTA 3WNEA 4BR9A 1FBUA 1WFWA 1M1KC 3AHUA 2KJBA 1JO8A 4QSHA 4HNVA 1TH7A 2DO7A 2O8BA 3P9IA 1CSKA 2RK1A 3OYCA 4MZTA 3M0RA 1QQIA 3MN5A 2GNCA 2B0LA 1DU0A 1M4ZA 1T56A 1G3SA 2ZFUA 1OFCX 2M30A 1K6YA 4RTYA 3IAS2 4M7AC 3VS0A 4D1QA 1LWCA 5IWAK 1YUWA 2B5JA 1PRLC 4B1UB 3DXMB 2EV5A 5BRDA 2LT1A 2KRCA 1V1CA 4IIMA 3UKGA 2HVQA 4M77D 3C0CA 3G6EA 4OFEA 3DLKA 4B1YB 3LDOA 3P31A 3MP8A 4M45A 2I0NA 2M0OA 1WEIA 1VQLN 1V5FA 4Z0UA 3VQDA 2VPRA 1RTJA 4JUVA 1SV5A 3DAWA 2CDTA 2J4RA 1OOTA 3CCRA 5GANe 1LDDA 2BHYA 4XU3A 2H3EB 3JSMA 2DOEA 2E5ZA 2JTFA 4QQGA 5IOYA 4JPBW 2XDDA 1UA0A 3S1NJ 2KQ2A 4AHSA 1GLNA 3ZQQA 3BP8A 2ESWA 5FPEA 4NXMK 3CCLA 4CERA 1XGOA 3JTGA 3C6AA 2EYZA 4OPHA 1P7IA 4H5VA 4I9LA 3CW7A 3SUOA 5A0DA 2BW3B 3J7YJ 3L4IA 1CQTA 1UJYA 1H88C 5D8LB 1B9NA 4CW7B 2H1KA 1DGKN 5KHDA 3ZETB 1FEXA 2Q31A 4O3MA 3NH0A 3QERA 1N39A 2HU9A 2EPDA 2HVIA 2RQUA 1UTIA 2OJED 3WQUA 3OYGA 4YOWA 4HF2A 2JVHA 2R93J 4GXOA 2CUFA 1USSA 3I3LA 2E6ZA 4F7UA 1ZTRA 2R7SA 3AVFA 1TOVA 4HLXA 4F3QA 3NH1A 1SRMA 3FZHA 2E5NA 3RBBB 4RCCA 2NNWA 1YJ9Q 1LCKA 4FJ8A 3RQ4A 1MBJA 4PUSA 2M0CA 1VQLA 3MEGA 3OJUA 3ZSVA 2DMNA 3H45C 1YIJA 2K5LA 3H1VX 3WVDB 3Q7CA 2PLYA 1UHSA 2K2MA 1G3YA 3L2ZA 5AQNA 4PFOA 4RMNA 4NCBA 4IOAL 2ADUA 4OINF 2WAQN 1ORNA 2NVUB 2DA6A 4L59A 5LJ3g 4ELYC 1FJGK 3UKRB 4R0KA 5C4JJ 1NMDA 4CESA 1GV2A 3I55I 4ENNA 3IUOA 1J59A 2DPUA 2O8FA 3MEUA 2YWWA 3CD6I 1F1BB 1R5ID 2W82A 2VI6A 2ZJRF 4L9NA 2QGGA 2C0OA 3BTJA 3SMSA 4NO7A 4RTXA 2VN2A 2E2QA 5FKKA 2E3IA 1ZSZB 2DETA 4FLYA 1XSVA 1JL2A 3AGKA 3RQIA 3AVCA 1I8FA 4PJOA 3AVLA 3G4SQ 3KX2A 1MDMA 1W36D 2O03A 2TCTA 4B24A 3HHGA 1Q81C 4FETA 4OIOF 2JA6J 4FLZA 3OA6A 4KPYA 1WJEA 3THYA 1YTUA 3CVSA 1VQPA 5HLTA 3OW2A 4LLLA 5AZJA 5E3MA 1ZREA 3H3NO 4DBRA 3THWB 1Q81U 1Y0UA 3KCCA 2X9DA 4C92D 5GAMd 3KYDB 2JW4A 3JRDA 4DTNA 2VBXA 3HOVJ 4JS4A 2IW5A 1UAXA 2P4TA 3E0JB 4IUUA 4RS8A 4FWKA 4UVBA 3QNNA 1WFXA 5ADXA 2A42A 2D45A 2VYPA 3AVMA 2JUGA 5LRSA 2H27A 2DJIA 1FIAA 5K1YA 3WU1B 3TCJA 2X74A 5AQPA 4PGGA 1NU0A 4WQ5C 3MD2A 4KHYA 5JS2A 4KAZA 3DOLA 3GLXA 4A3CJ 1E3HA 4Q47A 3R6MA 5BPDA 4OKKA 4JRPA 1ARKA 4BXXJ 2FSWA 3LDLA 3CC7N 2JMAA 1S7AA 2B4JA 2M5WA 1Y07A 2ASMA 3AVNA 4DYQA 5J1EA 1UJ8A 3H3OB 3EYYA 5GAN7 4F91B 4YOXA 2RDPA 2CH5A 3DB3A 3DU5A 5FLVA 1LWEA 3SV4A 1UEBA 1PSEA 4DSJA 4JJNK 3QFUA 3PX0A 4E9FA 3ABLH 3PFIA 1Z9QA 1QP2A 4RW4A 4EMKB 4B3RK 3TREA 3CPEA 3EFOA 2HW3A 5IOZA 5M5YJ 4I09A 3SAFA 4A3JJ 2RQPA 2XY6A 4JP0A 4XMYA 2DIGA 2HKOA 3A5LC 2R7OA 2HF4A 4CJWA 3G0ZA 1TWBA 2DYBA 4KH0B 4ILGB 4LB6B 1VQNQ 3KIOA 2P51A 3ZSQA 3P83D 4HX7A 2QLZA 3CCQQ 2E5LK 3L09A 2W7NA 3ZT3A 2IVMA 2DA5A 2VT3A 3G71A 4M3BA 1K83J 6AT1B 2VC0A 3A1YA 5HRSA 1VRLA 1YJ9T 1YQRA 2KZGA 3HYIA 1WJFA 2FXAA 2I8DA 4CJ4A 3I0RA 3O1WA 1M3AA 4UV9A 3GTMJ 2XF5A 5JLFA 3RERA 3KZBA 1JGSA 3HB9A 4BQOA 5HCKA 3SEMA 3PO5A 2RJCA 4ESBA 1S1TA 3PX4A 3OMCA 2HNYA 5KRTA 2RN8A 3P8DA 3N4QA 1RUNA 1JRIA 3JAMO 3D5SC 2DE0X 4LG0B 3HVRA 2P5VA 1LFUP 1HNWK 1KK7A 4AG1C 4LFAK 4Y92A 2ZO4A 1N5YA 2WBMA 3S17J 1C0UA 3QG1A 2L3RA 1GCQA 2HOAA 3NAEA 1VQPI 2ESNA 5SZTA 4JD2A 2DD4A 2ESHA 4N4HA 1R71A 2YSRA 3J81Z 1AZGB 4EJYA 3FF5A 2OJ2A 1SL0A 2HB5A 5GPAA 2LNHB 2NOEA 1UWBA 1HQEA 5FD5A 1U3OA 4A59A 3VW4A 3MMYB 1K9MC 4DSIA 1RT3A 1BC8C 5FD6A 2VVKA 1I6HJ 2JPCA 2OV7A 1GFDA 2CWEA 1X1AA 5LRRA 3KKRA 5I21A 4ZDOA 3KXTA 1NGFA 4R8HA 1WI9A 5GANh 4CZKA 3LWLA 1VFCA 1XTDA 3M0UA 2O4XB 1AWWA 3CJBA 4J6WA 2ZJQF 3C7NB 3FGUA 5F0HA 3TW6A 4H0PA 3OYAA 1KRPA 4J7FA 1KQSM 4GBQA 1XNIA 1LB2A 1AWOA 2QXLA 3VQEA 2WB1N 2NWMA 1Y0NA 2YG8A 1N6QA 4HZFA 1EH7A 2STTA 4A3LJ 4M75A 1RLPC 2EWSA 1NG9A 2DDBA 3GW2A 4CI6A 4BI4A 1T6CA 1M3HA 1K73U 1W2BS 1HSTA 3VODA 1TAQA 4XK8E 4J19A 2V1UA 1A5VA 1Y97A 3T1YK 1REVA 1FTZA 3EG1A 3TAMA 2F5KA 3TWHA 3H3ZA 1WGSA 1BI2A 4AT1B 3MN7A 2B8AA 4BVOA 1M5Q1 1VQPN 4H4OA 1BO5O 4J2AA 3QRFF 2XB0X 3LQQA 1KQ1A 4ENKA 1TQMA 3QPHA 3ELKA 2EZHA 4YIRX 1QVFP 1KD1O 2MLGA 2DT6A 2IGNA 1X2QA 2O0YA 1VQ6I 1FOWA 1RKTA 1LNWA 2G7HA 4BQNA 5CHIA 1NJZA 4C3HJ 2KE9A 2ZGZA 1DUXC 4M78A 2MG4A 3O4WA 4LF9K 2L7FP 3HVTA 1ETWA 2I5UA 3CLOA 3TU4K 5F6FA 4II2A 2UUCK 4LUEA 3OGDA 2KIUA 4KIBA 3HKZA 2O9VA 3JCMe 5C0MA 1VSLA 4CHYA 2MI6A 1HLUA 2X4XA 4ICLA 2JWLA 1QVGP 4NL3A 3H92A 2HBKA 4DQIA 4BY7J 4GDFA 5B1BH 4CJEA 4RW8A 1JLAA 4XH4A 4QIWN 4RG2A 4B1WB 3H0GJ 4PNOA 2Q2RA 5FRNA 1K78A 4NCGA 1ASVA 3CCJA 1R1VA 1D3BA 2M9UA 3U3YA 4C9YA 1NK7A 1LE8A 1D0ZA 1H3HA 4JQFA 3DWLE 1WQ7A 5M1FA 2C0IA 2LDMA 3AV9A 4JK9A 1O9SA 3ULQB 3CESA 1S7OA 3M54A 3D2EA 2LJ0A 2NOJB 5GIOA 5E1ZB 4CCMA 2EGAA 1ZLJA 2SRCA 3IRXA 4F2SA 4CGIA 1ONVA 1K0XA 3AG1H 2M4GA 1HKBA 4J9IA 4BRFA 4B9WA 1ETVA 1EH8A 4NOYA 4PKCC 2KISA 3FFIA 3A0HC 1O3RA 3NVMA 2YJFA 2DJQA 4B9TA 3P8HA 2OF7A 3FDYA 4FJ5A 4HSTA 2D5VA 4BQAA 3INZA 1B9FA 4NHJA 1LVAA 4CHNA 1AT1B 4CGHA 1X2MA 3KEOA 1M8VA 4J9CA 1CKBA 1LVKA 5GTIC 2BZYA 1VUBA 3VS4A 2JG6A 3VQ6A 4ID1A 2EYYA 2PBDA 1J9IA 3CCRN 2CP2A 3HRMA 2EA4A 3ZSRA 3J80K 1HMVA 2NOFA 3I33A 2OYQA 5ICFA 4QS8A 1OKRA 1QA6A 2D0BA 3I56Q 4LF4K 1GT0C 4Y17A 2JMWA 2XIGA 1LPLA 4K8XA 3Q9VA 3WE2A 2MIOA 5I2SA 4N9HA 1S7EA 2HQRA 2RGVA 1SQKA 3HRSA 1RAGB 3V7RA 1EX4A 3I5UA 2CV0A 4IRHA 4A3DJ 1X2KA 4DFKA 5C2DA 3CPWM 2OZMA 3S1QJ 4M3XA 3DJCA 2ZFWA 2X1EA 3TOAA 4HQMA 3ZT4A 2ENMA 2EJ9A 2OC6A 3E6MA 4JI5K 2H8RA 3WTSC 2RPIA 4B47A 4XKWA 4IBNA 4CI0C 1VQ9Q 4FT2A 1V4SA 3JSPA 1WRJA 3C18A 2DKGA 5F2RA 3CPWS 3JCMQ 2QASA 4OP0A 2R7XA 2MABA 1G8XA 2Q0OA 1R23A 3M8PA 2H1LA 2D0PA 1M27C 3GXOA 2BH1A 5JLWA 5DDGA 5A0LA 4RB2C 2HQEA 3EAEA 2P5GA 1TYQA 4BNCA 2V8JA 1K8KB 4UXNA 2KL4A 1NBWA 2MPXC 3IHOA 1FYMA 4H0OA 1N77A 4CK2A 5KQ8A 2HL5C 3VPZA 1VSFA 2MAMA 2BOLA 4BL0B 2KRMA 3CMEA 2P9UA 3FRNA 3FZVA 3I35A 2IXSA 2IG0A 2E3HA 2IRFG 3HG9A 5J4YA 1M90C 4BGDA 5C42A 4KHUA 1ZR2A 1YJNN 3CJAA 2EW3A 4A6EA 2M4KA 4I99C 2A05A 5EF6A 4IO9F 2JS2A 3FJ5A 5E17F 2ZSHB 4H0XB 3CCUT 3JRCA 4JAXA 1NM7A 3AVJA 2E1MB 2DK8A 5LJ3f 2VASA 1J09A 1SD5A 5AQQA 4BY6B 2K3XA 2CZ6B 3HP9A 4MNUA 1GLBG 3T8TA 2VIXA 1LQ1A 4OMNA 1JT6A 2L89A 3BG5A 4HKEA 1UJ0A 2VOPA 3FK6A 2QXFA 4OO1J 2A40A 1BDGA 4M9ZA 4UY8O 4M7AA 3HPWA 4M75D 3UE5A 1YITQ 4M78E 1LAVA 4FCYA 2HKQB 2M8EA 4PSXA 4HNUA 2QSFX 3DEEA 1XGSA 2BVMA 4FWQA 4J9BA 2JM9A 5KPZA 4XRSA 1NG6A 1JLQA 3I59A 2F8SA 1JUMA 4A5NA 1XJWB 3CCQA 4UVCA 2YKNA 1Q8IA 2HDWA 3PUBA 4BY6C 2WWYA 2IPQX 2XV4S 2VWJA 2EX3A 1Z25A 2KTQA 4ILHA 4K0KK 4XTZA 3S3MA 1TUCA 2UU9K 1J75A 4Q5WA 4FYYB 3CQYA 3V4IA 1YIJT 2UXNA 4J6XA 1ETXA 1TWHJ 2Z1DA 3E97A 4XLEA 5DLQE 1Q86U 5EYRA 5GAOq 2YXYA 1N8RU 4C92B 5AJ3K 1HW1A 1W1FA 3I55Q 3NVKA 1YLFA 2DJNA 2BW3A 4ZYHA 5LEJA 4DTUA 3M4OJ 2ZGWA 3VF2A 1X6GA 4H4KC 2QA4N 4RM2A 4CC3A 4L0ZB 4W5OA 3OOPA 4DW6A 1WPYA 3TAGA 2XC7A 1YFNA 5EX5A 1NPRA 2PN6A 2QDYB 3KP2A 4LFBK 4YEJA 3CUQB 1NLOC 2JPBA 1AA7A 3J7AF 3FXUA 2EQIA 1HKCA 1D8JA 4FM4B 1T3LA 5CKFA 4M3TA 1K4SA 5CKEA 2F9WA 2NUTB 4GLMA 2BE5F 4CK1A 1XQPA 4L9VA 2DL7A 5MLCQ 4IUQA 1YNZA 1HJRA 3EG3A 1J3TA 3CCMI 1JCEA 4JI0K 5GAMh 3K59A 1G3WA 1YJWN 1Y0MA 2DCEA 2NUPB 3QPTA 2RMOA 2KIQA 5GADJ 1A5XA 1ESVA 1F21A 1ZGWA 4J2DA 5K5QA 2K5FA 4HT8A 3O5ZA 5CK9A 1SRLA 3CI5A 1SL1A 3F8BA 1N6AA 4FYWB 1FSHA 4BGAA 3OIQA 3V8KA 3VYUB 1Q7YU 3I9V2 3EEQA 2FYKA 3M7GA 3EHRA 5EG2A 1FLIA 2NUPA 4V2GA 4FOEA 3S6IA 2CSOA 3I54A 1OLTA 1OH6A 4CC7A 1BI1A 2A0FB 1BW6A 1QVFM 1ZA1B 2KY9A 3GWZA 2E5QA 2A28A 4DV7K 2I2LA 3MWPA 1OPLA 5FPNA 4WWCA 5BRHA 4DUYK 1MBKA 4JI2K 4CJLA 4EVVA 4EAHD 3BTLA 1YI2I 4C8NA 5CYMA 4PWDA 1PP7U 4A69C 3ISNC 2JWTA 3VQ7A 1WI3A 4LF8K 1FMWA 2OFIA 1QHGA 3HRGA 4AILC 4AG2C 3G1OA 2ID3A 1G3TA 1PUEE 5JVTA 3TKYA 3CWSA 3QSUA 1BQMA 1WI7A 2ZMEB 4IG3A 2D8JA 1XMXA 3ESWB 2CSQA 3BE3A 2ZNZA 3R61A 3EYZA 4UQGA 3VUBA 3LZIA 4JYAK 3C65A 1JT0A 2LDUA 1H0MA 2FBKA 1FJLA 5B66C 3VQ8A 5DD4A 4UVAA 1H8KA 3LM2A 5F64A 4Y1CA 1C1AA 3AA4A 1BIBA 4C8OA 4DU1A 3KWGA 4X9CA 1PHTA 3F6VA 2A3ZA 3FZMA 1RKWA 1D1AA 2KGTA 1OH5A 1OH8A 2DBKA 3QYGB 1YOVB 4HRIA 4LDYA 4MLHA 2RO0A 1MU2A 1JUPA 2WACA 5CHZA 3HDDA 3SD4A 4CJ5A 2DILA 4GNIA 3HOWJ 1OYXA 3OS5A 4IRIA 3R9PA 1NOYA 5M1QA 4B9QA 5CVRA 1JGGA 1KU3A 5DM6F 3PGGA 1QVGS 3FBNB 1WSHA 2O7OA 1QQCA 4HDVA 3KLEA 4DTOA 4F92B 1D3BB 2EINH 3FM3A 2V7YA 5C12A 1YCYA 1WHKA 4CFDA 4KIFA 1U1TA 2W00A 1WUAA 3KLNA 3RJPA 5CVIA 1RZ4A 1W0TA 1APLC 3N97A 3S93A 2K9MA 3FB9A 3LPTA 1VQ7T 4MHGA 2KIFA 4HSRA 4IX7A 1Z77A 2CU7A 5CKBA 4BWMA 3T19A 3M4YA 2GA2A 1RGIA 1IXSB 1JI8A 2XPWA 5AIPA 1RAAB 1BR1A 1RBTA 3QESA 4B3TK 3P7NA 1W6XA 3ZR8X 4FYXB 1FKOA 3SPZA 1J53A 1QP3A 4YOVA 4EM2A 1ZKGA 2VWFA 2OBPA 4ZYDA 4Z94A 2EFOA 2YDLA 1S72A 1IHVA 5I9EB 1PNJA 4CC2A 5AQMA 3VEWA 2WA0A 4GYGA 3SI6A 3U9DA 5ILSA 4WF2A 3IV5A 2H94A 2G8WA 2BXYA 5GANj 5GAN3 4XKBA 1WSUA 3MKDA 4XU0A 4UNOA 1SAUA 2IVPA 4DR5K 1FBQA 2Z5UA 5IHIA 3ATVA 1B34B 2OCCH 1ZLKA 1YJ9N 4ELZC 4CFCA 2VG7A 3VEXA 3PLAA 1BA1A 4EP4A 2CG4A 2RNAA 3RNJA 4A4GA 3KE2A 2R7FA 2HHUA 2E88A 4IUTA 4KUDK 4KNYA 3NH2A 1SEUA 1EETA 2XIDA 2K40A 2QKMB 2KPMA 5IYBJ 4DZJA 4EGYA 1O57A 2KXDA 5IT9E 1VQ4T 1W2BP 2MD0A 1FOKA 2R7YA 2AXLA 2W57A 4YOYA 2RKHA 3K5MA 4FW1A 1VQMQ 2QWWA 2KKOA 2L9VA 2NYXA 2HDCA 1GCPA 1F36A 5L8RE 1IO6A 2HOEA 2Y1IA 4IWVA 3AT1B 4FWLA 3QQAA 1N8RC 3SV3A 2P5LC 3QO3A 3AVBA 5LJ3e 1T0HA 1R4NB 4NZGA 3TAFA 1JCGA 1KVAA 4JD2B 4CCOA 3JCMW 1MWMA 5KK1A 1WDXA 2EFQA 4KHWA 1TL8A 1VQOT 1GOBA 2L2PA 3QBWA 3QIPA 4A54A 1E4FT 3H46O 3AVGA 2GTJA 4OLBA 4BD3A 5FLXZ 1QE1A 1I07A 3FXKA 1EO1A 3MDQA 4H5RA 2EQRA 3T9NA 3R6NA 5KYNA 4BS9A 1S29A 3JB9G 3LSGA 3PQJA 1FN7A 4DV3K 2FJ1A 2M87A 3OS2A 1BWFO 3MN2A 3EE9A 3Q9SA 2X6NA 1U84A 1QW1A 3NF7A 2O4XA 3A5ZB 1WHMA 3K2ZA 2YHYA 1FYLA 3GBQA 1QVTA 2R7TA 4AHRA 4OMLA 2ZF5O 3IUCA 2HBJA 3VS6A 2GBYA 1VQKA 3O9SA 5CKHA 4DTSA 1WHJA 4BR7A 4HVVA 3CCJT 2NNNA 4CF9A 4ANJA 1TNTA 5AQYA 4QVCA 5KE2A 5F08A 2DK3A 4N4GA 5AQXA 2RAEA 1GRIA 4S05A 1ZBIA 3HK2A 1X1BA 1BIAA 4Y13A 2W6KA 2YNFA 1DTTA 4C0ZA 3MFKA 4RTWA 2RQTA 4LF7K 4P9FA 1FYNA 3JCMf 1JHHA 1MDUB 1JJ2P 4DYRA 3VB2A 1ORPA 2DVEA 3SCXA 1SVLA 2VV5A 2ZBKA 4YFUA 1ZBLA 1ATNA 5FLXE 1QVFA 3LAMA 4KV8A 3C6HA 2BTTA 4GV3A 5FW9A 5IYCJ 2V51B 3OB9A 1M1KR 4KH6A 1KG1A 2XKOC 1GBRA 2EV0A 1Z05A 3Q0VA 2P6TA 1S1UA 4M73A 1Z0XA 5L3GA 1H8AC 2MCNA 1HX1A 2JWKA 2DDAA 4G7HF 1KJWA 4J9DA 3IQLA 3C6TA 1OU8A 3ME9A 2HHTA 2HI3A 2VKVA 2F4VK 1H3ZA 3UB5A 3E6DA 1U3EM 2YX4A 3VQBA 2IVWA 4PKIA 3PSIA 2AKLA 2WB1A 3I0TA 3SMPA 3K4JA 3LH5A 4FX0A 1PKSA 4XEIA 2HBMA 1KSWA 3MX2A 2F48A 4XU2A 1P4XA 4O55A 3AO4A 4EHTA 2P9LB 3TR8A 4OMFB 1PWTA 5H6QA 2NOBA 2LRQA 4DUZK 4UY8I 1N8RO 2SEMA 4DR2K 2EGCA 5LMNK 3VF4A 1OCRH 3UKRA 3EGUA 4F14A 4DSKA 1LOTB 5KCOA 4B43A 1T38A 2HSTA 5EZGA 1X6BA 2I5JA 2JA2A 1G5VA 3F22A 3ZYYX 3JB9F 4FJXA 1BOTO 4N4IA 1RAIB 3OBYA 2ZPFB 4JX4A 1QZ5A 4MTEA 3TMOA 1TAUA 4MIMA 1NK6A 2KMTA 4UOBA 2JLEA 4A3IJ 3O3GA 2FHDA 2MLKA 4PFZA 5BPNA 4BYYA 4TSXA 1X9SA 2Q8KA 2QM1A 3S1MJ 1YITN 3TDZC 2E5KA 1ZHFA 2GEMA 2KW4A 3IRRA 1UB4A 3N5NX 2LJ1A 3BTCA 5KN8A 2CMPA 4FJ7A 3CIPA 3SUQA 1VQKI 3DFGA 2P5OA 1SKUB 5LBQA 3TABA 2V1QA 1UAAA 4FW2A 2FQ3A 2FBHA 2DW4A 4BAYA 2CQKA 1IN4A 3IH2A 1QVGM 1X1PA 2XY7A 2RA2A 1VYTA 3LP3A 4J9HA 1NZ9A 2R7ZJ 4NYFA 1KYZA 4FSVA 4F7ZA