4BE6A

V. cholera biofilm scaffolding protein rbma
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
234
structure length
225
Chain Sequence
b'PVIEANLSLNQNQLASNGGYISSQLGIRNESCETVKFKYWLSIKGPEGIYFPAKAVVGVDTDGRMLNVTRGFWVPEYMADGKYTVSLQVVAENGKVFKANQEFVKGVDLNSLPELNGLTIDIKNQFGINSVESTGGFVPFTVDLNNGREGEANVEFWMTAVGPDGLIIPVNAREKWVIASGDTYSKVRGINFDKSYPAGEYTINAQVVDIVSGERVEQSMTVVKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RBMA
publication title Structural Insights Into Rbma, a Biofilm Scaffolding Protein of V. Cholerae.
pubmed doi rcsb
source organism Vibrio cholerae mj-1236
molecule tags Cell adhesion
total genus 42
structure length 225
sequence length 234
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3880 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4be6A02
2.60.40.3880 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4be6A01
4KKRA 4BE6A 4BEIA 4BE5A 4KKPA 4KKQA
chains in the Genus database with same CATH superfamily
1MCQA 4M62H 2P1YA 4JKNA 3RY5A 1YJDC 3MR9B 4EZKA 4FQXC 4ZOAA 2FCBA 4GAYA 5HPOA 5AUMA 4KVCL 4PJ5B 4K3DH 2X89D 2H1PL 4UM9D 4Y1AE 3S35X 1SYSB 4IMLA 3X1GA 5I1KH 3B2MA 3OB0K 2HJLB 1D3CA 4G6MH 2VDPL 2ORBL 4PRIA 5K33A 2YQGA 3TESA 3J27A 4R96A 4ZUWB 1EZVX 5EZIL 4NKQB 4GQRA 3QQDA 4J23A 5DUJA 2W92A 1RKRA 2QLVB 2K0RA 1NMAL 2YMOA 1FL6B 3ETSA 3MZTA 1MOEA 1ZS8A 1FVEA 4RA3A 2X89A 4BCZA 1ZK5A 4UM9A 4B7LA 1UWEL 3KBPA 2Y6TE 1Q9WA 3ZK0A 1A1OB 2GIMA 5EOCJ 1U8JA 5ERWA 4JVUA 3PAYA 1U8OB 3MBXL 1CDIA 4EKJA 2ESVB 2V2WB 1JVKA 3LZNA 2E6PA 2HT4D 2KERA 2Z31D 3BW9A 1IKOP 2AV7B 2NNXA 3I50H 4H1LB 4KROD 5AL0A 2BNQD 1LXMA 2VLLA 4HIIA 3PL6B 5FIEA 3UTQA 4K23H 4B9KC 4HJ1A 4RRPG 1SZNA 4TL4A 1W16A 4XO4A 2PCPB 4Z9KB 3L6FA 3O6KL 1GH7A 1T21A 2IH9A 2DQEH 1L6XA 1TVBA 2R4SH 2OI9C 4AYBA 2QGEA 1B4RA 2FT6A 2KBGA 3RQ3A 1NCCL 2EYSA 3SCMD 5F7DB 2E7BA 5DA4A 3JV0A 4FXKB 2YGOA 2OMYB 2WNXA 2ZE0A 5J6HA 1IEAB 3EDDA 3MRKA 3FT3B 3NZ8A 4KKBD 4KTDL 5AB0A 4QXGL 5E8EB 1YPZB 1H6UA 4U4IA 1XAUA 2MTAA 2Z31A 1FE8H 2JF1A 3REVA 2X1PA 1A4JA 1CFQB 3KYNB 1CIUA 2BNQA 3B3BA 1KZQA 5ID0B 1OARL 4YHLL 4PTUB 3CZNA 2NZIA 1LD9A 5IF0A 2EVFA 1E9QA 2DMCA 3KYOA 5DK2A 1CICB 1JWUA 4NUGL 3SCMA 2CUIA 4N9GA 3EDEA 3D51A 3QQ9C 1XD1A 1JHKH 1YG9A 2R56L 5CEXB 3BIKB 1TQWA 4XGZA 1KF9B 3FB5B 4MJ4A 4PJHA 4AQZA 2A9NL 1NMCC 4XOEA 4QXTA 1Q1PA 2FNBA 5EEXA 5I6OA 1VJSA 4JN1L 2XQYK 1CVSC 1ZHKA 2BSRB 2EE0A 4X98B 4YH6A 3BPOC 2VLMD 4AMKH 3U6RB 2D7TL 1JF1A 2F5AH 3MV9B 4I9XA 5ANHA 1MFCL 3FH8A 1S46A 5DO8A 1IAII 2XZZA 4F58L 1UM5L 1OCWL 1W15A 4G8AC 5JW4N 4X7FC 2EDJA 3AGWA 3WELA 5C2BH 3QA3B 1ZDQA 5IW1B 2C3XA 2EEDA 5E1HB 4PJIF 1FVDB 4P57A 5ADPL 1JNLH 1HC1A 1L7TL 3RPBA 2IQ9H 2ZUYA 1J0HA 1FQ9C 4KJYA 2DQMA 1QTPA 2EJ1A 3EOTH 3QSKB 2AQ2A 4QRPD 2LLLA 3VTMA 4P5MA 2C1PB 3GJFB 3D07A 2O6DA 3WSQL 1KCBA 1HKLL 2NLJB 3DIFB 1AI1H 3KVQA 5GRJH 3TNNA 5ACZA 4KVPA 3GSVA 3P40A 2V3EA 4KZCA 2XN2A 5FA3A 3VFNB 5IVNA 1J88A 1JN6B 1YQVL 4P0DA 3BMVA 4B97A 3RYMA 1G0YR 1QWHA 4S10A 1SPDA 3C09C 4FS0A 3TTYA 3VRLF 1RJYA 4N1CA 4UMSA 3V6ZA 1W8NA 2Y06L 3O11A 1MJ8H 3KPPB 4QRPA 3GSWB 3UAEA 3QE5A 2FRGP 2WLHA 2VXSL 1A6AA 4JDTL 4U7MA 3BH9B 4L1DA 3CHRA 3ILPB 3WD5L 4Q6YA 1NCJA 1QLEL 2YZ8A 4TM9A 4PCTA 2VSDA 2WN3A 3HS0B 5AWNL 3ESMA 5DR5H 1RIVH 1NBCA 2R1XB 1U8IA 1DN0B 2GHWB 2H1PH 3FU5A 3BN9C 2VR3A 3KCWA 5CILH 2OYLA 2V9TA 4HAFA 3WNOA 4R7XA 1R5WA 2VDPH 1NCIA 2ORBH 2Z7YA 5B8CC 1IEBB 3UTZB 4JGUA 4HUMB 1PZDA 3AVEA 4OJDH 4DVRH 1SDAB 5MHSE 3T71A 4JKPL 4PJ9B 1BW8A 1OQOA 3CTTA 2Y7OA 3U0PB 4OFQA 2HT3D 3ARDD 4JPKL 1GGTA 3BSZA 4TSBL 1AE6L 1RZ8B 4PB0L 1TU2A 5E1AB 2RIKA 3OR7A 4M00A 4WSJA 1TSHA 3HB3D 1UWEH 3H3BC 4D9LL 1G9MC 3KCPB 2NY6B 4F27A 3P0VL 2Y6SC 2KUTA 5IR1B 1DE4B 4TUOB 2OL3A 4W9LC 2F53D 5EUKA 2WXOA 4HS3A 4ODTL 3QI9B 2JXMB 3MOAL 1B2YA 4MA7H 3TURA 5D8JL 3P73A 2KLRA 3NN8B 5FYLD 3BHBA 3ARDA 5MI0B 3MRGA 3AWFA 3QZWA 4FABL 2ED8A 5J13B 1NCCH 4YSUA 2YC1A 1MF2L 1YEKL 2QQNL 4FYQA 4RGNE 4BUQA 5LHDA 4A6YL 1H0DA 1ET5A 2E75C 3JYBA 4FNUA 4Z7VE 1LVEA 3NZHL 4KTDH 4YNYB 4QXGH 5B4MC 2VDRL 5T5NF 5HGDB 2FWUA 2ZWSA 2DBLL 2F53A 4JZOB 4DVBB 4JRXE 4UQDA 4R7NB 4HIXH 5L4IA 2IADB 3ERXA 2EP6A 2ADGB 3LB6C 2WQSA 5IVOA 2CQVA 3UAJC 5DK3A 4XPTL 4XX5A 5JXED 3CIQA 3K72A 1XGTA 1G6RH 4FERA 2XTSA 3S3SA 3QUXB 4YGVA 1CFNA 1ULVA 2GHZA 2R56H 3QFDB 4PJGA 4WWKC 5TE6H 3NDYE 3PHAA 3GXTA 3OM3B 1JYNA 4I77H 5IVZA 4KO7A 2BSSB 5A3ID 4R90L 4Z7UE 3P9LA 1LO0L 4K4KA 1XR9A 4RZKA 3QARA 4ORZC 3O0RL 2PUQT 3F00A 4X6FA 4AQAA 2A9NH 5DJAB 4YDMA 1K8DB 1Y6KR 2OMNA 3FPYA 1RJLA 2H8PA 1HL9A 4JN1H 4X9GA 2FX8H 1F1DA 4WI4A 4WGVB 5CHNA 3EBIA 3VQ1C 1TZAA 4NWUH 1NAKL 4XPHL 1T04B 2D7TH 2XCMC 3S4SA 2AFNA 4YHPB 3CVCA 5JXEA 1NBZA 3V0HA 3CFKA 1PY9A 4FNSA 1ONQA 1QTYT 1OCWH 1CN4A 1UM5H 4F58H 1GYAA 1PAMA 1URZA 1J9CT 1F4HA 4PJXE 1CE1L 2J1YA 4G2AA 4JMXA 1T1WA 4PJDE 3V0VB 4Z77A 1F1GA 4OFPA 4X6BA 3E6HB 4JZNB 4NLHA 4YL4A 5CGYD 5HPMA 1L7TH 25C8L 3L3IB 5IFJB 3F7PC 1HOEA 3MUGB 5JPNB 1BZ9B 3G08A 3WEOA 4G72B 1J8HB 1RUQL 1KJ2B 2WV3A 1EEZB 3WSQH 1C16B 2YOAA 4RSYA 4QI3A 3H2PA 2WXFA 4KV5F 5AVVB 3DTDA 4NNYB 2VL5A 3UC2A 3VFPA 4Z76B 3DX8A 2QHLA 4NCC2 1ILUA 3QFJE 4MS6A 1G9NL 2HT2C 2NUTA 1ORSA 2P42B 1LWJA 2Y06H 1GRWA 3LS4L 4RFOH 3H0TA 4PJ7A 1BJ8A 5EBLA 4QMEA 1DUYA 1YEGL 3PAUA 1E65A 3FUMA 1J0JA 3N50A 2OTWA 4WTXA 1QR4A 5D7LB 5F7UA 4Z23A 4JDTH 1MCJA 2P45B 4QHKJ 2CUHA 1AFVL 4ZOBA 5AD0A 4PV9A 1AQMA 1QLEH 3ARGD 1TYEB 4ZFQA 2JKLA 1GW6A 4PP1D 1HH6A 5AWNH 3DBXB 3EYQD 2CIIA 5IY5B 5CLTA 5C0DB 2OR7A 3QR1A 4NZ8A 2YQ3A 4MVBC 3MBEB 3ZKSD 3P1VA 3VD9A 4JY6B 4U6YA 2W0FB 4X6DE 1J9SA 1ZTXE 1TJGL 2X4TB 4FFYH 3SKMB 3ARWA 3VGHA 1U58A 3C5ZC 5KSVB 3OVUB 4JM4L 4XCCH 4JKPH 3A0OA 1NIBA 4S0TD 3TEYA 5EEWA 1Y6NR 4JVPA 1DVQA 3MV7D 5DC0A 2NR6C 3ARGA 4TSBH 1AE6H 4XAWH 4RQQB 4CKQA 3PNWA 2FEDD 1K4DA 3G5ZB 1OT1A 1HYSD 2DJUA 5I18L 3FRPA 4BCYA 3LV3B 2FATH 5IOPB 4S1DD 2E6QA 1QLFB 3QCUH 2VUYA 3GRBA 2HRPH 1XHHA 3BQUC 1G94A 3BSGA 4A7TA 2SEBA 3P0VH 4YBLB 4FTDA 1QP1A 5DJ2A 3NJNA 3RY6A 1S7XA 3W39B 4ODTH 5E8DL 5I2IA 2PWEA 3QHFH 2JI3A 2JI2A 3MOAH 4LSQL 3REWA 4KDVA 1KZYA 1KXHA 5D8JH 4FFZL 1P0SE 5F88B 3MV7A 1YUHB 4MAYC 5ID1B 4FABH 4FX5A 1J11A 1E2WA 1YEKH 3WY3A 1MCLA 4XN2A 5FKPB 1A3LL 4KKNA 4YK4C 2YSSB 5K59F 1U92B 3S36H 1NUFA 3VXQB 1WWCA 4M93B 3TBWB 4GAGL 5BZZA 2OMXB 3MLRL 1OP3K 3EYSL 1R5IB 1IL1B 1S7QB 2GABA 4HBCH 1FFNB 1FG9C 2CM6A 5F6HI 4AGLA 4CBPA 1SHSA 2R69L 1JZ7A 1BEYL 1WV7T 5G5DA 5HHOB 4YBHA 4NZUL 4TQIA 3QIWB 4XCYB 2IAMB 3ZN6A 3RFRA 3MX0A 4XPTH 1PCSA 5I6PA 1LILA 1EFXD 5SWZD 1T4KA 1MH5A 3DYMA 3QUMA 4MDIB 4PG9A 4IK6A 1EHLL 1EUTA 5DD1L 5IBUG 3NFPA 1D9KB 4BK4A 2ATKB 2ZKYA 1A6TA 5FYJU 1FSKC 5HGAB 3B5TA 3ZRCC 3O0RH 4G8EB 3DX2A 4ZNCD 3D2UB 5E5LA 2VITA 2QVKA 4PP2A 5AW4B 3FQ4A 4TLSA 5HVFB 2EH8L 4JM2C 2P80D 3KPLA 4Y9CA 4DP5X 1QSFB 3JWNE 1BZDA 2FZ3A 4D8OA 5IFHL 1NAKH 4J3WA 4XPHH 1HSBB 1PQZB 4GYBA 4WO4D 5IFAL 2Z65C 3N55A 1EFXA 4I5BB 5C0BE 5SWZA 4FL4B 4F7EB 2B1AL 1E4KC 3V52H 4A2DA 3H9SD 3ZJAA 4YQXL 4ZFFB 4OCMC 2KQMA 1HXMA 4F15B 3S36X 4L2YA 5BZDB 4IHOA 2PPCA 1ZT4A 4KNSA 1QFUH 2FWLB 3WHE0 1VFMA 3TEZA 4POUB 2YBRA 1QBLL 3KGRA 4IKJA 2NY2C 1G7MA 1OGSA 3CCHA 4MASA 25C8H 2IMMA 5JW5A 3QULB 5G2NA 1ZMYA 2BZDA 3AABA 2P80A 3CHSA 4PJ8B 1RUQH 4WO4A 5D2NE 1BV8A 4YN3A 1WTLA 3Q5OA 1MCWM 4PJHE 3VRIB 2H45A 1VDGA 4K5PA 3IRZA 4NQQA 2DQDH 4UV4L 5EUOA 5BVJB 3H9SA 1DDTA 1TIUA 2XTJD 4DKEH 4JL2A 2PYEB 3MJ9L 4F7KA 1MDTA 5KJRL 5F0MB 3T4YB 1UACL 5F71A 4H8VA 2MNWA 4C8XA 3BAEL 1VADB 1WZAA 2WZ6A 3U0WL 1UUNA 1YEGH 5GGRB 1MW2A 2ITCA 2VZ3A 2VO8A 5KANI 2VTFA 1NCAL 1ETZA 1AFVH 1AO7E 3HG2A 3B2PA 5MENE 2LTQC 2GUYA 3BPCB 5CBAB 5F7BA 1GMEA 4NBYB 5GSVB 2IALA 3UL4A 1H8OA 2VW4A 2VLME 4A63A 5T1KB 1ZJBA 1DVUA 4HCIA 1ZLVH 1AD0A 2L7QA 1OWRM 1FH5H 4WCYH 1T5WA 4Y4HB 4JRLA 1BPLB 2CGZA 2CA4A 3B1UA 5DHMC 5T5FL 4NHUB 1IC5L 2ESVD 5HI3D 3ATAA 1X6NA 3N85L 2P49B 4XP9L 2DJSA 1LWHA 4JM0A 4M1CD 3RPIB 3OMZA 3TBSA 4D94A 4JM4H 4DOHE 3WCYA 2P24A 5E6ZA 2A6JB 1EX0A 3UPRB 3CPLA 2I9LA 3ZYIA 1N0XL 3CQQA 3BGMA 3BVXA 1R5VA 5C0IA 4PBWD 3GPEA 3GTNA 3WDIA 4W1TA 5I18H 4DQOL 5TE7L 3D9AL 5CJOL 1M9SA 2F7OA 1KG0B 4BK8A 1W72A 4XOAA 2AV7A 2G0KA 3W0WD 1RP9A 5I28A 3RKDD 2G60L 3B5HA 4NJAL 3L7FA 1JGUL 1H3UA 4UDTB 1WDAA 4W9DC 5CGBA 4R7LA 2QR0B 3NA9L 3D09A 4BDVA 2EO1A 4D7PA 3M1BA 4DGIH 3L3OB 3ML8A 1DVFC 1CICD 2X28A 4I3SL 3ZE2B 1F5WA 3MRDA 5BQ7B 4G6FD 1EVTC 1AHMA 2MCPH 5CZXC 5LGKA 3RUGA 3KGSA 4FAAB 1MCBA 4FXKA 3D8MA 4HQQH 3BT2L 1TO4A 3OJMB 4ABVA 3UP6A 4AEEA 3KVDD 1TQCC 2LVEA 5EF3A 4GAGH 5C08B 3W0WA 1OGTB 3QNYB 4YDZA 5B7FA 2OAAA 1Q4NX 4PGDA 4HIQA 4YHIB 5L0QC 3GHEL 4PTUA 1YEFL 2R69H 2EEBA 2VERA 4NZUH 2VLRE 1T0MB 3CX5K 4Y4KB 4UQ3B 4FFWD 3MV9D 3VXSE 1GOGA 4U7KA 2OYMA 3EJPA 4Q58C 3HAEG 4XVJH 3Q06A 4CVXA 4HWEL 1TQTA 3WHXB 3QO0A 2NSXA 4J28A 2HX7A 3PDDA 1F4XL 1GGUA 2J8HA 2ZZUT 2OCFD 4BGLA 1DJZA 4LEOA 3CVIH 3K2IA 1TLMA 5IB2B 2BP8B 1UCTA 3MUY1 2E7CA 3DOSA 4WHYH 3I6KA 5I0YA 2NY5C 4MMXC 3O2DL 1L9OA 5I6KA 4XNQB 3EJZC 1CD8A 5H2BA 3ULVF 3MLTA 4NHCL 1VERA 4QOKB 5C71A 3AGVA 2CJTA 1OAZL 5BO1L 4EN3B 1Z6JT 4Q7DA 3ECBA 4RESB 2EH8H 4QTFA 4R4BB 4X98A 5HD8C 5E4AA 4M6OH 3U6RA 3MV9A 4DAGL 3CFBA 1WFIA 4F5CA 4XI5D 5AAMC 1HIML 1EO5A 1U91B 3WEBA 1Y18B 5I1IL 4RFNC 4XAKD 4DERA 5B21A 2HKFL 2CO7A 3G9VA 4E5XA 5DUBB 2NZ9C 3QW9A 5FYLE 4HOZA 4CAGA 1FVDA 4WIQA 4N90D 3DC0A 3Q01A 1OAQH 4Z7OB 1BF2A 2Y23A 4M7KL 4ANUA 3HG5A 4HH9B 1QBLH 2VO5A 4YC2C 2LHAA 4DCQB 2LFGA 4PJGE 2P52A 1OLLA 4BCXA 4YDIL 1ZSHA 2N7SA 1Q9KB 1S7UA 2D3LA 1YHPA 2V37A 5JW4M 2OCCB 1A6PA 1KB9K 2P46B 4LHUG 3B34A 1DSYA 2CCWA 5FLUA 3TO4C 2H41A 2JVUA 2WCSA 3FUFA 3VFNA 4B9FA 5F7HA 4WNJA 1JN6A 1KB3A 1L9PA 4UV4H 4XBPB 2HYMA 3FN9A 5I5RA 5K69A 1SXBA 2H32A 3MJ9H 5MERB 1TZOA 3FU9A 3U30B 3WFEL 4HJTA 1MRFL 2JH2A 2ENYA 3L9RB 4NBZB 1T5XB 2LLGA 1SM3L 1I1CA 4MJID 3MJ8B 2VJ0A 1J7VR 4X80L 5I76B 1KGXA 2PTTB 1U41A 5E95B 3ELAT 2XUWA 1JMZA 2NY0B 4PJ9D 2F68X 2XPYA 3FQNA 4K8RD 3BH9A 4OU3A 4R0LB 1WBXB 4Z7OF 1E4WH 3Q1SH 2BP5M 4P3CL 4LVEA 3VA6A 4ZAKB 2W07B 1OTUD 3X14A 3MRQA 2NYZA 3AROA 2WW8A 5EDXA 5IMKB 1P2CB 4MMZA 2XWXA 1RZKC 4TVUA 2AXGB 2ITEA 2GEQA 3V0WL 5E2TL 1H3WM 1Z5LB 5EEVA 5D71L 3BEWA 5SV4A 5FGCE 2EDXA 2XG5A 3IDYC 3MLVL 5T5FH 3HZMB 2CO1A 2WWMD 3N85H 3OG6B 5D7IA 4MJIA 5LNDA 2PYFB 2WYIA 5JNYB 4DUWA 1SRDA 3SO5A 4B5EA 3QI9D 2GCYA 4N0CC 3D4GA 1JPST 4PJ9A 4DF9A 3MROA 5CBEB 1URLA 1CS6A 3CDZA 4MQ7A 4IKKA 1RZ7H 2J1XA 1CGSH 3BEVB 3PS6A 4PJ7E 1A2YA 3B6SB 2JIXB 4FFVD 5D1XC 2M2DA 4LRIC 4J1UA 1WWAX 3VWJB 3T0ED 5IR1A 5H37A 2QADC 3RG1C 3PWJB 3NJLA 4MMYB 4ZW3A 2UY6A 2KHAA 4P99A 2JXMA 1JGUH 1DLHB 1E5YA 4H0HB 5FOBA 3NA9H 4AIXA 1B6UA 2EIZB 4NIYE 4HZAA 1QPXA 4J2QA 4YBQD 3DLQR 3KM1A 5KSAD 4I3SH 2XX0A 5CP3H 1UM4H 1CJYA 1TO5A 2WLYA 4HIPA 4GUQA 4MJ6B 4JDVA 4JW3A 4YSAA 1P5VB 2DIBA 3TBTB 4XP4L 3HC4H 3WL9A 3T0EA 1HE7A 4L1LA 4DVBA 1CGTA 3PPSA 5T1LB 3GHEH 1NAMA 5FGSA 5DJXA 1DBKH 3B83A 3QJXA 1YEFH 2Q20A 1MI5D 2ADGA 4W4OC 2A73B 5I1LB 3OMAB 4FCHA 4MYPA 1KV3A 2NSQA 4KXCA 4EIGB 5KSAA 5ADOL 5B39G 8FABB 2ZP0T 3C9NA 2WLKA 4TXVB 2EDFA 3F12B 1UGNA 5BMFL 2OMVB 2OW6A 3C8DA 1F4XH 1QSED 2VDNB 5DT1H 5T8IA 2QJDA 1P9MC 4QF1B 4YE0A 4M29A 3EW3B 5EORH 1X44A 4QKTA 1OW0A 3VMPA 2DJMA 2DEXX 2BSSA 2AQQA 1WWBX 2ITDA 3NEOA 3O2DH 5E5MA 3D85D 4IGBB 5KBLA 4NHCH 4MCYB 5DJAA 1K8DA 2V5MA 3C6LC 1WA0X 3E6FA 4MJJA 3CDYA 1E6OL 3D69A 1MI5A 2DQTL 2VDQH 5DWUL 3BX7C 4FG0A 2RBLA 4GW1A 4GIAA 1IEHA 3IGKA 4HKJB 1O5DT 5FFOA 4Q9RL 3FTUA 5I1IH 3JQOB 1GYVA 3GNML 4XBEL 1QSEA 5A6IA 1LP9B 1EA9C 2C9AA 2VCOA 1IGMH 3RL2B 1IC4L 1YEDB 2UZYB 4LO9A 5SX4I 1NFIB 3IWVA 1CGXA 1AGCA 4UQIM 2P7TB 4O4YL 3D85A 3OAYH 3U9UB 5E99H 1X7QB 2KS0A 4NP9A 1CFSA 5DJCA 4HALA 3EGXB 4EEEA 4UQBA 5IFJA 2FEEL 3I85A 5SWSD 2IBZX 2ZSWA 5KVEL 1BZ9A 4YDIH 4KXZH 1JTPA 3V6OE 4I85A 3W82A 1Q1JL 4OIBA 5CR8A 2CALA 5D7LD 1YEIL 4O9HH 4YXLH 1PMYA 2EYRB 4TPRL 2XG4B 2YUVA 4J3BA 4QTIL 1F58L 1HU8A 1MIML 3CZEA 5DLLA 5TTRA 4WW2C 5AVWB 4YHKH 3VSVA 5CU9A 1K8IB 2I26N 4L4VD 2GT9B 4PREB 5DHVH 1MWOA 1INQB 1LNUA 2UX6A 4DUVA 4LVOB 5IHBA 4AIOA 4RGMC 3MN8A 2VM3A 1SN2A 1S9YB 5SWZE 3T2NL 1AZZC 1SM3H 5KVDH 1J1PL 2G5BA 2X4OB 1P1ZA 5SWSA 2YD1A 4X80H 3MI6A 3HVNA 1I1AB 2H1XA 3NZUA 1MHEB 1KELH 4ERSL 1E6JL 2DPKA 2QSTA 1YMHB 4WGWB 4NC0B 1RPQA 1IKNC 1UM6L 2YR3A 4GO8A 3QDJB 4IBZA 4MS8D 4KKLC 1ID5I 1CBVH 1IM9D 4I7ZC 4L4VA 1MN4A 2VABB 1KEGL 5C0DA 4RMQA 3S97C 4UT7L 4X4ZA 3BJ91 5E2TH 1AQDA 5D71H 4S11A 4YVUA 4JHWL 1FF5A 3MREB 1WS8A 3MTRA 4WI0B 5EUOE 3VM7A 5C97A 2X5PA 3S5ZA 1AVAA 2JQMA 3BIBX 2Q7YA 1SY6L 2VWEE 2VDML 1AD9B 1B0RB 4IOIA 1MHCA 3EIFA 2RJMA 2ZUSA 3Q6FB 4Y2DD 5I0WA 1E4JA 1KFGA 4XNXH 1IM9A 1XIWB 3STLB 3UFIA 4AM0Q 4BH8A 1D5MB 3LV3A 2W80C 3T0BA 3NABL 5KYYB 2EEXA 5IBUB 5D2LB 4OKVB 1MAJA 3RZCA 5EU4B 5DC4B 2HG5A 1UFUA 2A74A 3OB0H 4M7JL 1HHIB 3W39A 5MEPB 2IDUA 1GW0A 2XTJE 3NJVA 1BVNT 2WXQA 4YXHL 2VDLL 1KIUB 3ZHFA 4O00A 1GJIA 1B90A 4Y2DA 5I19H 1YUHA 5GS0C 4KMTL 3HNTH 2W5PA 2NT1A 4HLEA 3VXPA 1MNUL 3ZL4L 4XXDA 2VMJA 3A6CL 1MG3C 3MOBL 2YSSA 3VM5A 5BS0B 5IZ7A 1A9VA 2NYYC 1UYWH 1INEL 4TNVK 4Y1SA 4IEFA 3HE6D 2OMXA 1X5FA 1IL1A 2JB6B 4FMVA 2H2SD 4L5FL 3K46A 1GZQB 3RWHB 2BIOA 3L7EA 4JG0L 1P69B 3MLWH 1WF5A 2P8MA 3SYOA 5FCUL 4XCYA 4BA0A 1QSFD 1P7BA 3RX8A 1DSFL 4UT9A 2AEIT 2E8ZA 2ESVE 1XF5B 5D2LF 3DVNB 3MXVH 3QFGA 5HVGB 2RHEA 2WP3T 3UTTB 2N1TE 3X13B 5KS9B 4UNIA 1BZQK 5A16A 3LQZA 5K1NA 2VMFA 5F7FA 5D7KD 4DGYL 3LEXB 4TVSa 3U2SB 4H20L 1OZUA 3HE6A 4U33A 3JTSB 5EOTA 2ATKA 1EGJH 1QZ1A 4CJ0A 1IBDA 3TVMC 1H19A 2QV2A 3U46B 5TH2B 4Z18A 3B7TA 1MW3A 3G3LA 5CKGA 1FZKB 3NCYP 2Z91B 3L5IA 2GAZA 2DQTH 4KK5D 1QSFA 4X4ME 5DWUH 1BYOA 3K2UL 2WVVA 1YPZE 4PJ8D 1HSBA 3GI9H 3SB3A 4ABWA 1N26A 3NCEB 4ZW6A 5CFHA 4L9LB 4GXUN 3W0WE 1I85A 1ZHBB 2R0LL 1O0VA 5KW9L 4F2MB 3DJTA 3GNMH 4XBEH 4A1RA 2QPDB 1DBML 3Q9PA 4ZFFA 1BF5A 1CT8B 2RQEA 4KRPC 4R97C 3CGTA 3BVDB 1XL4A 3NRQA 1WCBA 3DPBB 1BVKA 3LPOA 4HUCA 5FYJD 2MOQA 2CLZA 4B60A 4IS6A 4NRXA 3H9YA 1BQSA 5FEBA 3KLHD 1JGDA 4UANA 1RSFA 4K3JL 5KVEH 1THCA 4F8TA 5CJXC 4PJ8A 3UEQA 4JG1L 1Q1JH 4YIQA 5EPMB 2X6UA 1XTLA 2P5WB 3WAKA 3EHBC 5HSFA 1KBPA 2EDTA 1YEIH 3HTLX 4R7DB 3QZLA 3VRIA 4DO5A 1X5MA 2Y7NA 1MIMH 1COBA 3X3FL 4OJCA 5BVJA 2JJSA 3C60B 4NENA 1PKOA 2JJWA 2D2OA 3VRLE 4GP4B 4ZMXA 1MLCB 1P84J 1UEYA 2ZP9A 1NCWL 3MV9E 2WNGA 3K81A 5T1KD 4F5CE 3VFOA 2HB0A 4C4KO 4HFUL 3MV11 1BD2B 1NIDA 4OF7A 4J3SA 1ECZA 2RMNA 3T2NH 3UP1A 1J1PH 1VADA 5JHLH 3BVUA 5C3IA 4HMCA 3G6DH 3LX9A 4WSGA 3ULSB 3V4VL 1UH2A 3PHOB 2AQ1A 5GGRA 4ERSH 5BW7A 5KYXA 4RRPA 1E6JH 4XP5L 1NUGA 4BK5A 1RLBA 1IX2A 5HP5A 1UM6H 1Y1DA 4ZS6D 5CBAA 2XU9A 5I16B 3OXRA 3ARRA 5IW3A 3L3DB 2ODHA 1P53A 1RIHL 3K0YA 2C9UA 3UGEA 1JK9A 3G9AB 4V2BA 5T1KA 1KYOK 4ZMWA 2NW2A 1IT9L 1TENA 3QWQB 2IJ0C 3N9GH 2J2ZB 3ARSA 3Q8EA 4U6XB 5I9QB 4M6ML 2ZG2A 4JHWH 4XAKE 5AW8B 4Z7QB 4BWUA 2Z4QB 5KTEL 3JVGC 1TXKA 3QIUB 4GSQA 1OM9A 1ORQB 4K5OA 4AZ8B 1V54B 5ECJE 3R0NA 4PB9L 3ESPA 2X4SB 3CFTA 4WF7A 1SY6H 1WSST 2XKSA 2VDMH 2OSYA 4OAWB 4ZX6A 2WYZA 3UPRA 1IBFA 2VRKA 1HCVA 1IGFL 2X2JA 2X4NB 3CLFL 4BXVA 5FB8A 3HAEB 1INDL 1MWAL 5JO5B 3WMQA 2VMCA 2IC2A 2D7MA 5CINL 4G8GD 4FQQB 3DO7A 1KG0A 4LPWA 3BISA 1AQ8A 2F8IA 4IBTA 3GMRB 4XOCA 4P5TC 5C08D 4HIJB 4ODSL 3IXAB 1LGVA 3HI1B 1NCBL 1FWXA 1QAWA 3RWGB 4UDTA 4XCNB 3MGTB 1JIBA 2C9SA 2JKJA 4Y4KD 3QEHA 4OLVL 3L3OA 4A2HA 3LCYA 3B9AA 4LRNH 4PMEA 5CMAA 1JGIA 5D55A 5D7IE 1FO0A 5GS2D 3H2QA 1QG3A 4Z7QF 2ZKHH 4EBQH 3ZL4H 1CXKA 1O75A 3LHAA 3W1ZA 3MOBH 4JHUA 3S3CB 2DQGH 4G8GA 2E8YA 1G7JB 1BEXA 4CGTA 2NNRA 4WENB 4MSWA 3U82B 1HZLA 1NC2D 5C08A 3I3BA 2YJQA 5TQ2L 5EMYA 3K71B 1UKSA 4L5FH 5DXWA 5KVGL 1A3QA 4QOKD 2BM3A 1IFGA 2WM0A 3ARBB 3GD1C 5ITFB 1XVSA 2EXWD 3FU3A 5AW1B 4UYPA 2YGVA 3JT2A 3UO1H 1DSFH 4S1SL 5AG9A 4CDGC 1GGBH 3F7KA 4ZPVB 1BXVA 3QS3A 15C8L 1MZYA 1X4XA 5JW4R 4L3FA 3V4PB 3SBRA 2E9JA 1JYVA 1ADQL 5BV7B 4L3CB 4U7SA 5IB2A 1FUNA 1CLOL 5DVKA 1CQKA 4IDLA 3GXPA 4H20H 4P2OD 4DK6A 2HLAA 1NC2A 2X12A 5BZWA 1FJ1B 4LPYA 3ZXAC 4XB7A 4LCYB 3U7WL 4HKXB 4QOKA 1LE5A 3F6LA 1CL7L 1HCZA 4LXFA 1G0DA 2CNZA 2HFEB 4R4BA 1NANI 3SYPA 5D4JA 1PDKA 3RDTD 2HX9A 3K2UH 4G42A 1GCYA 3CFCL 2HLEB 3RTQD 2B1HL 5BRZD 5KW9H 2FJFB 2KC0A 3K8LA 4UB0H 3SE4C 5MEOB 5I0ZA 1AC0A 5I66B 2ZXDA 3O6FD 2JCWA 3U7YL 3L4WA 1GGIL 3FUDA 2EABA 1A6VL 1F6FB 4MD4A 3HN3A 5E56A 4P2OA 1F4WL 4K7PH 4TN9A 3FCTB 3UBXI 1RFDL 2OSLA 2W9EH 2XKNB 1A1NB 4BWTA 4ZO8A 3QXAA 1THAA 4K7FA 4MNHB 3VA2C 4AIZA 1QI3A 2GK0A 4Y5XA 1BZ8A 1MHPL 2CH8A 2IPKA 4KHTL 3FUKA 4BKLA 2VC2B 4XVUD 1QFWH 3RDTA 3ESOA 4JG1H 3RTQA 5B3NA 5I5IA 4C59B 5BRZA 1DQLL 4HS6B 3I9AA 2WQ8A 1FGVH 3O6FA 4W93A 1V7MH 3CXDL 4V1DB 3X3FH 1H3PL 4TUKL 4OM1L 1EJFA 2VR6A 3EGDB 3QIBC 3NT0A 5B22A 3ZDYF 1NCWH 4Q52A 3Q3GB 3L9RA 2CJ3A 4HFUH 1IBGL 1T5XA 2MWCA 1K4CA 3OPZL 4MKMA 5HDQL 2F9BT 2WCGA 2XXCB 3CH1A 2XRAH 1CI5A 3NH7L 3SO3C 1BGXH 4DUXA 3FQWB 3V4VH 2V8LA 5ICZA 2IBBA 3T3PB 1FFOA 4XP5H 4L29B 3DX6B 2E46A 5HHXL 4AJVA 1KC5L 5IUSA 1FRGL 1MFDL 1OZTG 1RUAL 4QNPE 5CEZH 4XXWC 3BH8A 3LHPL 3T65A 1RIHH 5FKAA 1P2CA 1G87A 1R4XA 1I7TA 2AXGA 5TD4A 3WAJA 1IT9H 4K7PX 1EZVY 4HDIB 2YFOA 2WUBL 3KNBA 5T3XL 2GFBB 3HZMA 4LMQI 4HA1A 4P23D 3VWJD 3RWCA 2YKKA 3ARFC 2FTAA 4K5NA 3TCLB 4XO3A 2OMZA 3CHPA 2MTPA 2OBGA 3N2JA 5D7JC 2XXMB 5KTEH 3EYFB 3R4RA 1B4JH 5GJTL 3D06A 4M5TA 2OS7A 4ZOCA 2W94A 1L0PA 4NCDA 1JHLL 3KLAA 3N91A 3DV6B 4BKSC 5CAYB 4Q4EA 2CKBA 5IB4B 5DF0A 5B39B 4Y8AA 5SWSE 5DRXA 4U1JB 3D30A 4F7TB 2E7HA 1TQBC 4OV5B 4OIAA 3GSNB 3FQXA 5E9NA 2PWGA 3FONB 5C0ND 1OE1A 3LPWA 4LLDA 4XMKL 3KGTA 3D0VA 5D7LE 5IJVB 2IPUG 3VMOA 4A2EA 4G82A 3VWJA 4P23A 3BRFA 4ODSH 5E5UB 2H6UA 4A6YA 3B43A 4GRMB 2JTDA 1FBIL 2ZQKA 2NCEA 1U9KA 3S88H 4EI5C 3MRFB 4D0DA 2XXGA 3FJTA 4TTGA 2R15A 4TL5A 1NDGB 1L5GB 1W9XA 2KMWA 4AYFA 3R18A 1DZBA 3WUWB 2UZPA 1R46A 4BELD 2JKWA 5K59E 4IMKA 4F9PA 5GS1A 5CKAA 1E9PA 3TT3L 1CF8H 3QG6A 3ZR5A 1JZDC 3AT0A 3AMKA 1UB6B 3MYJB 3P4MA 3PAVA 3QXVA 4MB5A 3RUGF 4IGBD 3RVUC 5KVGH 5HI4D 3SDXB 3SPIA 1AKJA 4OH2A 1GJWA 3ABMB 3G6JF 2OP4H 4KUCD 1JPEA 3WFHA 5I1LA 2OR8A 3N1PC 4HJGA 1N12A 4O2EA 5IG7B 3VB9A 2C4FU 4S1SH 15C8H 3F12A 1S8DB 1UB5A 2X6AA 2WAQA 3M88A 2BHUA 1ADQH 2ZONA 3G5YA 3GSRB 1CLOH 3C5SA 3LKNA 3BLPX 1CE6A 1QNZH 4YMPA 2NY1D 4IGBA 1OP3H 2R7EB 3U7WH 4HUVB 4R6UA 1WFUA 3S9DB 5DC2A 43CAB 3ZY7A 4JREC 2B15A 3LN5A 3DUSB 4Y9EA 3RNQB 1EHNA 3T4AC 4GT7A 4HKJA 5C0JB 5AZEL 2BW4A 4AEIL 4ILDA 3MRMB 3TTSA 1QWUA 1CGVA 1SXSA 3FT2B 3TBYB 2X40A 4KZ0A 4NO5B 3WJJC 2DH2A 5IVXF 3U7YH 5HHOE 3SDXF 1GGIH 3RL2A 2EIDA 1NINA 2UZYA 4BJLA 2DI9A 1D5XB 2OTUB 3P4NB 3OAWA 1WA1X 4PWEA 4DKTA 1RFDH 4ODWB 4PRPB 2AK1L 1RZKL 5D9SB 2V9RA 1X7QA 1TVHA 3DX3A 2CRIA 3C08L 3CFDB 3BCDA 4RVBA 2IH1A 1MHPH 1GOHA 2YRPA 1I1AD 3VGGA 5DMKB 4YHML 3WKYA 2X9YA 2VRAA 5D6CB 3IFPB 1MW0A 3EO9H 1S7WB 2YMXH 2YIHA 3HBZA 1H3PH 4H26A 4TUKH 2GT9A 4QJ4B 1QSFE 3ORJA 3MLXL 4A7QA 1INQA 4ZQKA 1XWVA 1LEKB 3EJQA 1ASOA 2C3WA 4N0FA 1BCIA 5TFSL 2D0HA 4LSSL 3EDKA 1IBGH 4PGBA 4OZHA 3UZEC 2X4OA 1I1AA 1Y7VA 1BREA 2YD8A 5D7KE 3V0DA 1UVQB 1EJOH 1MHEA 2DLFL 1SUJA 2VDKB 1OOWA 2APSA 1G9HA 4PJBB 3IJ8A 4Y1TA 3TPKA 4Z0BL 4TRPH 3EJRA 3RB5A 1FVCB 3QDMB 3ARPA 1A6WL 3W2DL 1KC5H 1MFDH 4OCWL 1XIWD 3VE0A 3LHPH 1IC1A 1MCFA 4NKIL 4G43A 4HIHB 2WB7A 2L4OA 4I2XB 4TKWA 4NP4H 4HSCX 5LN4A 1AOZA 4KO9A 2WUBH 4ISVB 5T3XH 2EDDA 3GIZL 4QGTA 4WI0A 4ZFZA 3SDYH 3V6BR 1QRKA 3CZGA 3OL2A 4ZW5A 4MQXC 2IMNA 4LARL 1HAUA 1IGYB 5GJTH 5D1ZD 3QZNA 1HK6A 2O4EA 3BLBA 1D5ZA 5FYJE 4HWBL 1J9QA 1EEYB 1ZSDA 3ULUF 3S5LG 1XIWA 3STLA 3LSOB 1XR8B 3DMMC 5KYNA 3OAZH 4BINA 1B88A 1OD7A 4RMWA 1FDLL 1TFPA 3EFDL 3OKOB 1JDCA 1HQRA 1RVFL 4FFZA 1XZ0A 4OKVA 4XMKH 5DO2C 4FQCL 1F11A 2Z35B 4HJ0D 2ZYIA 1PG7X 4WDIB 4EDWL 2F1BA 1KIUA 5D1ZA 1MNNA 1FBIH 5LQBL 3IFLL 1S9VB 4X7TA 5EO0B 4N2LA 1UWGL 2XWTB 5HJ3B 4FDWA 5AKRA 2OSWA 1OAYH 4Y89A 2R69A 4V33A 3UG5A 1WP6A 3UJTL 3MRBB 3PHQA 2J43A 3ZT6A 3GI8H 2GTQA 4GLRI 5DJYB 5C6PB 5IJDC 3KPRB 1URIA 4LSTH 4NO2A 4WO0A 4W9GC 5HYFA 4Y19D 1YEHL 5IK3A 4TQEL 2YKLL 1BVOA 1U21A 2CWRA 2VUOA 4WI8A 4LASL 3ELQA 4K3EH 2C4FT 1U93A 3DVNA 3JT0A 5JIIA 3D08A 7PAZA 3QJSB 3D39D 5D6DA 1TQSA 1HHJA 3BZEB 3NSJA 2A83B 2BWDA 3AQYA 3LH9A 4WFFD 5E2UL 3HZVB 3DJ9A 3IBEA 4PJAB 4HPYH 2H0EA 3JZ7A 3FB8B 3MRCB 4JK0D 3ZE2E 4LEXL 3U46A 3HW7A 5TH2A 2F8XC 4Y19A 4K2UL 1J18A 3JSSA 5C3TA 4PLJC 3GBNL 3NTCH 1UZ6F 5HGGS 3CLWA 3QUZC 2Z91A 5JPMC 5JW4Q 3L1FA 2OMUA 3NJKA 4QWWD 4G8GE 3IMSA 4NQXA 4HD5A 4JDEA 1UOWA 3S6CA 1KBKA 3GYRA 1QATA 3QS2A 5C08E 5AZEH 3GPSA 4KDTC 1ZHBA 1KGCD 3D39A 5T1MB 4NFDA 4F2MA 3FK3A 5M95B 3VGEA 4G71B 2IH3B 4BZ1H 2YPVL 3I6GB 4G80B 2XIBA 4NQED 1PYWA 4P46D 5C0AD 3C5ZB 2AK1H 1WT5C 1F00I 3MNMA 1BD2D 3LXCA 1DANU 3VFTA 1XCTA 3C08H 1FL3B 2A6KB 3F7VB 5ANMB 5L4FA 2WUCL 4GXUM 4Y9FA 3BUIA 3RFZC 5DURB 3TWYA 3WLWC 4F3FA 4RMTA 5GRVL 4QEGA 4QOKE 4TOYH 4PY8J 2ZX8A 5C0RL 2ROYA 2HFGL 5F1IA 4NQEA 5KSUB 4P46A 5C0AA 4HUWB 2CXGA 3BP7B 4YDLC 1KJ3L 5TFSH 5TJWK 1BD2A 1F0LA 1TMQA 3QRGL 4OVUA 4A2LA 1U8NB 1T22A 2FX9H 2VE6B 4MAYB 4JKWA 3QIUD 4LLVB 4G8IA 1HCFX 3ULSA 2HMIC 2X4QA 4KI5F 1QBML 2YEZA 3G04A 4ELMB 4YR6B 4NDMA 4Z0BH 3CU7A 1HWHB 2ENJA 3QDHA 3TA3C 1IFRA 1KIPA 5I16A 1WBZB 5GS0L 4OCWH 4N8VG 4Q0XL 3MLSH 1D5IL 1DYZA 1I31A 3U36A 1YNKL 3JTTB 3CFJA 1MPAH 2J2ZA 5KUMA 4AGQA 4F7MB 2WXLA 2QMKA 5E2VL 1U33A 3QIUA 4M9PA 4CADB 5BUPA 3HE7B 3OAUL 4LARH 4AL8H 2X4SA 3BVNB 4J5VA 4OI9A 4WFED 2BFGA 4LPXA 4JO2L 3FU7B 4XR8C 3NRPA 4HWBH 2ED6A 3VXRB 4L4TB 4NQVA 5CS7A 2WLLB 3HAEA 1AZBA 4H7VA 2GJJA 1FSKB 1IRAY 4BA8A 2GEEA 3GQFA 1FDLH 1K9TA 4UQAA 3EFDH 4BV1A 2NYKA 2WTRB 3TN0C 4ODXB 4J27A 2NNAA 3LAFA 4JM2B 4KJQC 3F84A 4EI6A 5JOPD 2TAAA 5FDWB 3HI1A 3L1OH 3QEQB 4W9JC 3EGSB 4X6CB 4DZBA 3DIVA 3NIDB 3MGTA 5DTFA 4DKFH 5HDBE 1SFHA 4M1DH 3FB6B 4LF3B 1BHGA 3D87B 3F5WB 4HK3N 1TZIA 4UUJB 5C0CD 3US0A 1BQ5A 3GMMB 5JORB 3CDFA 1KCLA 3NFNA 3OHXC 4LHUD 3ATFA 1B9ZA 4HKBB 3US9A 1V3MA 2E7LC 1KJVA 1I8UA 3W38A 1XF3A 4Z1PA 4NRYB 3TZVC 5C92A 4O02L 3LDBC 3KYKH 4KQ4L 5E0FA 3BUYA 2H5UA 2H1LM 1X5KA 4MXWH 1U8MB 1JE6A 5HI5C 1LK3L 3P3TA 1J0IA 5EOCL 4OGQC 4Z5RA 2O6FA 4FQXD 1JP5A 2BVQA 2R51A 4MA1C 5LVEA 5C0CA 4NKMB 3O2DA 4ZPVA 1Z9SB 4LHUA 1QQDA 1BYPA 2AK4B 1UEMA 3Q8BA 3V4PA 5I74C 3GLDA 4X5PA 5GGVH 5ACMA 3ULAB 1D5RA 3RWFB 3EFOB 2R2EB 2V2XA 2WWOA 4X6CF 4Q9QH 3S4SB 2PETA 2W38A 5HYJB 1AIZA 2CJUL 1FJ1A 2P8PB 4S1QL 4DEUA 5JQ6L 4PCSA 3VI4B 1WIPA 3UZVB 2VLJD 2R2BB 4K2UH 3QK0A 3V5KB 3GBNH 1TKWB 2Z92B 5D7HA 5IB1B 4QHLA 1MJ7L 2LTQB 1M2VB 4FQXA 4U3CA 3M17A 2N3JA 5A2KH 4XCFL 3WHE1 4QR7A 5I66A 3SZKC 2V7NA 4V1DD 2YPVH 5GRWA 3WY4A 1EXUA 2Z3FA 5DGRA 3G5XB 3LS5L 2P5ED 2VLJA 2IGFH 3OJDA 2CK0H 3L9EA 3QQ3B 1U36A 5GJSH 2JE8A 3Q13A 3VG0L 1DANT 3L81A 4G5ZL 3PJLA 5DZOA 3FTVA 2DWEA 3HR5A 3BAKA 3LZFL 3VAEA 3FTSA 3KPMB 3PQYB 2W60B 4HS6A 3H3PL 2HZHA 3V0GA 1T20A 3WE6B 5EA0H 4BFJA 4V1DA 2D03H 5AB2A 4A2FA 1BWWA 3EGDA 4ZSOA 5C0RH 4IIZA 1AP2B 1RIUL 3GEFA 5LGJA 1N4XH 1UJ3B 5ALCH 2P5EA 1KJ3H 1S3KH 4UOW0 3QRGH 2TRYA 2WD0A 3L4CA 1RZPA 1OP4A 4BYHA 1LP9E 3LN4A 2X1QA 1NUNB 2NXYC 4I18C 4WUUB 1QBMH 2QMJA 2ZX6A 3QQ9D 5ESAA 1SXNA 4KFZC 3KWVA 5LBSL 4LLUA 3UOAB 1TQCB 5GRXG 3ZLQC 3EYUL 3UERA 4MXVF 3COOA 2AJXL 3Q8AA 4EPSA 3GUTA 1MCCA 2PR9A 5L0QB 4TNGA 4JQIL 1TCMA 32C2B 4HDIA 4UILH 4NZRL 2O61B 4KTEH 2GFBA 3ROLA 1KTJA 3MLZL 2ODIA 3ZE0F 3TCLA 4IRJC 4KKRA 1AKPA 3B2VH 3QUYC 3OAUH 2BSBA 4K9EL 4HSAC 4FI7A 4DTGL 5EO9A 3EYVB 1FA4A 1OO2A 3RGVC 4CA4A 1MFAH 4HSQA 5LDUA 3IGUA 4Q2ZB 2E27L 2XZCH 3A4EA 3OG4B 4OZHE 2BOCA 5IB4A 5B39A 1NPJA 2R8SL 12E8H 3MGOB 2GC4C 4MMXB 4X6EA 3GSNA 3N0AA 4GQ9L 4IJ3C 5FO7B 1G6RB 5BCAA 1VF5C 2NY3C 2PR4H 3U6XA 4AYDC 2DMKA 3FOLB 1PSKL 1O9ZA 3QDJE 1BXUA 1YDPB 3HPJB 4EAEA 4MNQD 5I17A 3MRFA 1OD9A 2ZG1A 1ZHLB 1NDGA 3KBEA 4LQ1A 5EWIL 4AKOA 1FIGL 4FMFA 4NNXB 1ITCA 4M6NL 3DX9B 4BSWA 1WFTA 3L3HB 1XF1A 4YC2B 3WFCL 4JFUA 1NDTA 1BJ1H 3WKQA 4P5SA 4CVWA 3VCLA 2AQPA 3FFCB 1GYWA 4HCGA 1U30A 1LK3H 1RJZA 2ADFL 4MNQA 4YDNA 5EOCH 3TO4B 1I8MA 4KUZH 2HVKB 5IG7A 1GC1L 1R3HB 2EDKA 3FDWA 4N8PA 3LRHA 3ZQ9A 3BN9D 2JWYA 4JFVA 1JRHL 4OGYL 1A9EB 2W95A 3MCLL 4M61B 1XH3B 1JERA 3FC8A 2ICEB 2ZOTA 1RZJL 3FPXA 3OKDB 4XO5A 5DD5H 4UQ9A 5EZLA 3VGAB 3UJIL 4AEFA 2J21A 1Z5HA 2K4AA 2XFGB 2BDNH 3NJGA 4OLEA 4S1QH 5JQ6H 3CFQA 3HG3A 3BPNC 3PCYA 5GGTL 4OLXH 4OQTL 2ADJB 2I07B 2JJVA 4JPIB 43CAA 3V8CA 2IANB 2EIMB 2BZCA 4H13C 2YLKA 5E9DB 3CWGA 1UQSB 4P06A 3S3JA 4BSVB 3M46A 3MRRB 3TBYA 3JV5A 3MDJA 2DL2A 5CIPB 1U8LB 3QZBA 4JHAL 4P49A 3IDYB 2Y6SD 4X42A 5E6RB 5BQDA 5B8CA 5C0FA 2VYRE 3U1SL 1K3IA 4KZEL 3N1QC 5K39B 1DJIA 3DA0A 5KS9E 4GP5B 2G9KA 3GXIA 3LS5H 2FNWA 5AVZB 5JIKA 4G7RB 4LSPH 5JYMA 2PWHA 3TF4A 5IIEA 3MLUL 4WJKB 2J25A 5TDPA 3RGBA 3GSQA 5DMKA 1N2RB 1NCOA 3TT1H 3O8XD 5J6GB 1J05B 3MV8D 2VH5H 1F2XK 1X9QA 2CO6A 4HK0A 2AHIA 3ZBMA 1PX4A 3HLAB 4DCQA 4PRBA 3PV7A 5B4MD 2YAMA 4JZJB 3PXHA 1S9KC 3AXHA 4XMPL 2L0DA 4H25A 1M05A 4QRTA 5LGYA 4PG2C 1OANA 2RA1A 3GBDA 4L23A 3D39E 1RV6X 4F2ME 3UACA 3LB6D 1KN4H 4C83B 1K2DB 2RACA 2WBJD 3FO9B 3K3QA 1KXTB 1I8IB 1VPOL 3LXUX 4WFFE 3UAJD 3VDCA 1OK0A 1UVQA 3II2A 5DHYB 1XF4A 3O8XA 4PJBA 5EOQL 3MV8A 2MOVA 2F1AA 2PTVA 4WWKD 3JXAA 2DYPD 5LBSH 3WJLC 5A6LA 2BJMH 4L3ED 5BJTA 1FGNH 4UMGA 3QWOA 1UASA 3EYUH 3ZKNC 2XDHA 3HFML 4APXA 2AJXH 2C9XA 4I2XA 2WNWA 4ONOA 2OZNA 1OALA 3GJEA 3QH3A 1CXFA 2Z0UA 5DS8B 5FM5M 1KGCE 3RHWF 4NZRH 4DKAA 5GZOC 1S7RA 2GBAA 3IWUA 3MLZH 2WBJA 4XN4A 3UAJA 4YX2L 3R06A 3GO1L 3FH7A 3UH8A 1E9OB 1IGYA 3C6SB 1PBYA 1I53A 2A9AA 4HGWB 4NQEE 4K9EH 5C0AE 5C6TH 4OCYL 4WWKA 5KOVC 1YYML 1I1FB 1ZTXL 2DYPA 2VL4A 3FQTB 1HEJC 4L3EA 1BD2E 2E27H 5GISL 1IZJA 2R8SH 1JI2A 1XR8A 4NUPA 1MREL 3DXAD 4EUPG 1BFSA 3ARTA 3CZLA 4GQ9H 1QACA 4HEPG 2O93L 3WNJA 3KPRD 2D31A 3LYRA 2NUPA 1NGQH 2X88A 2O5XH 3WYRA 4WDIA 3SEPA 1MQKL 4AVJA 1S9VA 3VWKC 2QQKL 4AC2A 4Q97A 3HUJB 5K9JH 3VFSA 1FIGH 4QY8B 4XNDA 2HT2D 2IFFL 3DXAA 3WE1A 1BXXA 4KNTA 2WXNA 3PWLB 4DN3H 4FYSA 4OZGA 1X4YA 2GB2A 5FHBH 2ZOUA 5DJYA 1NBVH 4OZFG 3HN5A 4Q6IC 4LSUL 2F5BL 5IMLB 3PIQA 3HC3H 4R2GC 2Z8SA 4RMSA 5IMMB 1UXWA 3HS9A 5EU5A 1NFAA 4K94H 5IJCC 4JHVA 4WW2B 3PGFL 3KXFD 1F4YH 1GC1H 1X9RA 1HEZB 2FYYB 3N42B 2DW5A 3ZIYA 3PJSB 5CP7B 5FR3A 3HMXA 4TQ8A 5F96H 1L7IL 1UHVA 4MVBD 2A83A 4WFEE 4OGYH 1PD0A 3ARVA 3HZVA 4IBVA 4YDJB 5IQNA 3AITA 3N0PB 3VXMD 1RZJH 1JPTL 2CDFA 4C4UA 3IS1X 3UJIH 3MRCA 2YD4A 2HH0L 1S9WB 1T0NB 3C5ZD 2LVCA 5DEJA 2GTZA 3V5DB 1TVDA 4PSPA 1Q0EA 4O2FB 4ZI8A 3AMLA 4KXBA 4L8SB 1DQDL 5GGTH 4TUUA 3APDA 3BP6B 3KJ4C 4B41A 3F83A 3BZ4A 2NR6D 5GSRB 2VR9A 4NO0B 5ICYB 3HS0C 3KXFA 4WAFA 4XWGL 1MFBH 3P4OB 2CU9A 3QNFA 4RDQF 1DEDA 3V4UL 1NFDB 5IBLC 1EXGA 3T8VA 3MRLB 3BQUD 4GINA 4HK3J 3VXMA 3BP5B 3D2TA 4ZFGH 2CDGB 3PGCB 5JMRA 1BMWA 3U1SH 2IBZY 4PHZA 1WIOA 4KZEH 1BZ7B 5C0CE 1Y6MR 1KCWA 1T6VN 4NLAA 3N42F 5LNEA 4MAZA 1CDBA 2ADYA 1F86A 1SEQL 2Z1PA 3F7VA 2KL6A 4AK1A 2NR6A 4MAYD 3SE9H 3FMGL 3NP3A 2CLVB 1SQMA 1FNHA 2Q2EB 4XZ4A 1OB1B 1AC6A 2A77L 3BQUA 2Z8VC 1GGCH 4IIQB 5ICXB 1OM3H 5DQ9A 2HJFB 2NXZB 2BZ7A 3BP7A 2O6CA 1HJCA 1NWOA 2WPGA 4WJ5B 1MLBA 1VLXA 3BAJA 3VGFA 3DURA 3LEVL 2VE6A 1VPOH 1A7QL 1NFDF 3JWNG 3QXDB 4MAYA 4XZUA 5C9JA 5E9AA 2R2CA 4L8BA 3O45B 3ZYOA 1RZGA 4M56A 4XNAA 4ELMA 3IS0X 1TNMA 5AOKA 5EOQH 2WLIA 4UV7L 4B53A 2HFFA 4I48A 4NM4L 4W68A 2RFXA 4DKDC 1GS6X 4L4TD 1GZPA 4PJEB 1WBZA 2XV0A 1IJNA 4XODA 1YEWA 3DDGA 3HFMH 3KM2A 3OGOE 2H3KA 2UX7A 3UTOA 4PR5A 3ZHKA 4DP4X 2P26A 3CVHL 1AGDA 4RNRB 2XWJB 3DROA 2GY7B 3A21A 4YLBA 4JM2D 2WJ7A 3FXIC 2PNDA 1FNSL 1MWAA 2MNUA 3BKJH 1G7HA 3A24A 4RLDA 3AWGA 3CN3A 3IF1A 1E43A 3QEQD 4ZSOE 3TYFB 4UOQA 2IPTL 1VENA 2M8XA 1JNJA 3FU7A 3LXBA 4OCYH 3G7TA 2BVTA 4W6YB 3S8WA 5GISH 4TUJB 3U4BL 2DQHL 3ZX1A 1WCQA 4AOFA 2MKWA 3ZHDA 1NL0L 3B3IA 4X9BA 3VTAA 3IDNB 2BVEA 2EXTA 2OMBA 1MREH 1YNTB 3BO8A 2NY2D 4POZC 1M7UA 2PPEA 3KWXA 3QJZA 3T3PE 2ZXEB 1RY7B 1YVLA 2BMKB 4JM2A 1A02N 4EXPX 1YY8B 4NM8L 5FDWA 3TBVA 5C0GA 4M4RB 1E28B 2KYIA 4NQCB 1MQKH 1TZ8A 1E4KA 3DYOA 3FB6A 3HZKB 4EDXB 3D7PA 2K9FB 3I6LD 3TH4T 2QQKH 2ZAGA 5DUPL 3AACA 4KRPB 2QHRH 4I3RL 2A0LC 3ROOB 5I23A 1AZRA 1WZ1L 1ZWIB 3QQNA 4HKBA 3VD1A 3AB0B 2X4UA 3BSHA 3H8NA 4JR9L 2FD6H 1LEGA 5GGQL 2IFFH 1T1YA 1XCWA 2DIAA 4PBXA 4LFHG 4ZUUA 3UPCA 3RL1B 3AFLA 5F3BB 3BXNB 3TWCH 1SYVB 1YC8A 3SPVB 1IE4A 2FH8A 4JKLA 1MAML 1U8MA 3PWVA 2WO2B 1V3KA 2RALA 2YD6A 1JXJA 1FZOA 3EHBB 4FXLA 4OM0L 5KAQG 1SJHA 1ZA3A 5IWLC 3P3SA 5M94B 2UY7B 3HMWL 1AGBB 4XC1H 1EHXA 4AKPA 3GSXB 1YNTF 3FHEA 5H94B 3RBSA 3WDHA 4NKMA 1P6FA 5M7QA 1PJWA 1Z9SA 3TJEH 1XL6A 1AZVA 1L7IH 3DTXA 5KBMA 1G7IA 3MCG1 1XZWA 1MCSA 3RWFA 3WJMB 1LEIB 2K7PA 1A4KA 2R2EA 3FS9A 3MYZA 1IAIL 1X5YA 3LY6A 2CE6A 3BVWA 4FP8L 4ONFL 2P8PA 3MXWH 2BOBB 2HH0H 5LNGA 2XC8A 3GB7B 1DHKA 3VI4A 4R7VA 4YVNA 1F90H 3CQFA 1FNFA 4EVNA 5T3ZE 1TKWA 5D5MA 1RZFL 4DFIA 2R9HD 2W8CA 1JVOA 1M2VA 2YQ2A 2YK1L 3R4DA 5FO9B 4JPVL 4N4YB 2IG2H 1Q9LB 3D3VB 4DN4L 4XWGH 2ZCKL 4GUPA 3KPQB 2BRQA 3V4UH 3M7FB 3SDXE 4HULB 4ENZA 1O5PA 3MBEC 3GMLA 1AANA 2AI0L 3R1GL 4MBRA 4ORGB 4MNQE 4V11A 1M71B 2XPGB 5CLYA 4JJ5B 2ZWLT 5CN1A 1I8KB 5GXBB 5EZJB 4N8CL 4XVTL 2GI0A 3TCTA 4LVHC 3G5XA 1DEEA 1OOAA 3MO1B 3QQ3A 5C1MB 4OB5L 4YDKH 1H5BC 2FVNA 1DVFD 4JFPA 5FYLL 4HLJA 3RWIA 3FMGH 5AQ0A 3DO4A 4WUUD 4AYSA 2PW1B 3FT4B 5KBKA 5CZXD 2W60A 3B2DC 1H8NA 5DJ8B 3I75B 4MNGB 5E4IA 5K1JA 5D72L 2R2HB 2A77H 4QRSB 5DMIH 3HRZC 2WBXA 4P5TB 3FCGA 4YBLC 1U3HC 1G9EA 1N7MH 1C5DB 2HSIA 4OLUH 4LCWD 3KZ8A 2UZIH 3F7LA 3FO1B 3SDAC 1VEOA 2WWNA 4F7PA 1EAPA 4G8FA 4DWHA 5F1SA 1BX2B 1DVFA 3H42H 5ALBH 2FR4A 4GAJL 3PP4H 5HHME 3BRDA 4WUUA 2Q86A 5LAXA 1OAUL 1TMCB 3GMOA 4PVBA 4PVNA 2XBDA 1S7SB 2VN7A 4OBSA 4LLMB 5CSGA 4WU7B 4J8QA 4M93C 3PV6A 4E41D 4OLYL 3CX2A 1C1EL 1OWWA 3SN6N 2VXTL 3ILQD 1QVOA 1DR9A 3BGAA 4O51B 4LCWA 5HGHB 1LJMA 3CMOH 2G75B 4PGEA 2ZX9A 4WY7L 5HYSG 5HD8D 2CCLA 3QIWC 4MFHA 2DIEA 3T6WA 1OF0A 2ARJA 3QQXA 1PZSA 1Q9OA 2EINB 3AXLB 2IPTH 4HJEA 5DEGA 4ZTPL 2HVJB 2Z0BA 3DSNB 4Y5YA 3BKML 5D4IA 3T5WA 5SV3A 1PZCA 4AVHA 2ETWA 1ACYH 5C09A 2B20A 4E41A 3U4BH 1MRCL 2DQHH 2BVOB 1D9KC 5E8OB 2X9XA 2CBPA 2DEYX 4X83A 1UD8A 3AM8C 5JOFB 3LKSB 1HESA 3NSXA 4PJBE 1RZQA 5DQJB 5FO7A 1UOKA 3MV8E 4Y88A 4ELKB 4KPHH 1TPXC 3FOLA 4FJ6A 1U6AL 2HRHA 1G4MA 1PLGH 5IGXL 1R3JA 5FS5A 3FFCD 5AAMA 4DNLA 4BRJA 3B7YA 4QRBA 1ZHNB 4L3AA 1YDPA 3HPJA 4B27A 3TO4D 4I2XE 4FL4C 2HRGA 5TQ0L 3BPLB 2GPZA 1UUSA 3AU1A 4LOUC 4LIQL 1KIRA 1ZHLA 1KGIA 5I6XB 1IBHA 4U1HB 2VDQB 4X9YA 4XE0A 4JRYB 5AVUB 5IKCA 4NNXA 1ZJAA 1WZ1H 3K6SB 4HXAH 1NIFA 3B56A 5C86A 3U9WA 2MPAL 3FOMB 5KG9B 2KQNA 2VJ8A 3AAZB 2XN9B 2LAAA 1OE3A 4AKQA 5E1IA 1VIWA 5AVQB 3ASNB 3ZZ1A 3FT0A 1A3ZA 2EVGA 4L3EE 2DIJA 1TTFA 2D7OA 3FZUC 4DEWA 1I75A 3FFCA 3DI2B 5BNXD 1DQTA 1MAMH 2AZUA 3H1ZA 2BRRL 2ID5A 4OM0H 4CU7A 5H35B 3TO4A 4HIEB 4KX7A 4QHMA 4AGOA 3HMWH 4LAQL 4LSDA 3FTWA 2YPLD 3HA0A 4OUUA 4ONGL 1R3HA 1TR7A 3BSZH 3QIBB 3RAJH 2G2RA 1USZA 2Y07H 1HKFA 3BOVA 1AR1D 1NEZG 1Q0YH 1IKFL 4TV3A 2IXQB 3B37A 1EERB 5KVMC 1VSCA 5L6YH 4FP8H 4MWFB 4A2MA 4ONFH 5HHNA 2L7EA 5AL8A 2Q76A 2OL3H 2YUZA 5DHVB 5JQIB 1EVUA 2XPZA 4N0CD 4JFFD 1CDYA 5HHVL 1R3LA 4NQUA 5KSBA 4TNWF 3DXAE 2WMPA 3VD4A 3HHMA 1RZFH 2NOYA 4F57L 4OZGE 2F54B 1DO5A 1F1AA 2YK1H 2YPLA 3UDWC 2CBTA 2CHZA 2IWGA 3KPRE 1DJGA 2WTOA 5B3SB 5IV2B 2ZCKH 4XNUL 5D1XD 4W9KC 1X5IA 4Y4HC 5E00B 5CIPA 5AW2B 1U8LA 2E9BA 3T2OA 3R1GH 1KLUA 2AI0H 3AZUA 4PS4H 2BSTA 2I5YL 1CTNA 4QXUH 1QZNA 2BSCA 3DUHA 3NA4A 5EBGA 2P47B 2QADD 4N8CH 5D7JB 3VU1A 4E9SA 4XVTH 3ABKB 5IBTH 4JN2A 3L8QA 2NMSA 4JFFA 4KJPC 5JA8B 1UA6L 5GHWL 4OB5H 5IOKA 3K74B 1A3RL 5FYLH 1WRFA 2G2NA 4GRLB 3V5HA 4PJAE 1TQBB 2YSTA 4ZMAT 5D1XA 4LRIA 1USQA 3GMQA 5D72H 4F91B 3S5LA 3UAAA 2JB5L 2B3RA 2OX5B 4HBQA 3KXFE 1OTSC 4ATTA 1P7KB 3GXNA 4IYKA 3EO1A 1I4FA 1TNNA 2DI8A 1NCGA 4EI5B 1D6EB 1SN5A 1XSKA 5DZ9A 3KS0J 4NCC1 3FO9A 3GRGA 3SJVB 3ULVC 4N68A 3B8SA 3N43B 4NUJA 3LKPA 4NIKB 3BWAB 3KE0A 1D7CA 1FZJB 3QR0A 1NLBL 2Y9RT 4YXKL 4MJ5A 4X2UA 1MEXL 3CZFA 4JHBA 3F7RA 4E9XA 2ZX7A 4K7PY 5B38G 1I8LC 4UNUA 4OLYH 2ZCZA 4L18A 5ANME 1ZIAA 2X4RB 1JG9A 1TCRB 2VXTH 1NGPL 1OGAB 3C6LD 5LBVA 4M7ZB 2IFGA 4WY7H 2AJZB 3CAFA 5J1TC 1JOIA 5E8PA 1E9OA 3N44B 3C6SA 4HGWA 3BH4A 3V9CA 3SOBL 1CI3M 3BKMH 3RHWK 3L4UA 4AH2A 4AV5A 4CNIA 1JYXA 2CRMA 2H3NA 4RAUA 4AQ8C 2VXUH 4JDZB 3IGAB 2VXVH 3IFNL 3N43F 4ELME 3FN0L 3TOPA 2JCCA 3C6LA 4EN3C 4HU8A 3FBKA 4ZTOL 1U6AH 1H9DA 5FDYA 2P28B 3NMEA 3QDAA 4AGNA 3T4AB 3UYOD 1E3XA 2DD8H 4OLZH 3DVGA 2EO7A 3EXJA 1JFQL 3NIFE 1MKFA 1U8KB 2A5UA 3QISA 3WENA 1AS6A 1I1YA 1RJCA 3O3EB 4GKSB 5TQ0H 4IBWA 4D0BB 3HUJA 2LAGB 2ZXAA 5F7LB 1ED3A 2F1EA 2XQBH 4HLZG 3H6AA 1KIQB 4AW4A 2MPAH 2BH0A 2X44D 4Z7WA 1KYAA 4PJCB 1KYUA 4X5XA 4UOJA 4H5SB 1B6DA 2FO4B 3MNZB 3VD2A 5D7SL 5IMLA 3TLRA 4L4TE 4GG6F 3KBFA 1QNIA 1Y0LB 2F15A 4TQPA 1KJMB 1HE8A 3A47A 4I87A 4WW2A 3PWNA 5EG6C 4LAQH 4FFTA 1FAKT 3ES6B 4KKLD 5EIIB 4OZIA 2FYYA 3IDMB 1R3IH 1XGYH 4ONGH 1WHOA 3PJSA 5CP7A 1AXSB 2ZOLB 1XSJA 4N0UA 5E24E 3U30C 3MMEB 3QEQE 2QZQA 3IDUA 3BDBA 3NIDE 4P59L 4GAAA 2R29A 4JO8A 1LM8V 4PHXA 1MFEL 5EC1B 1T0NA 4XTRC 5I26A 1VFBA 3Q9QA 2NY0C 2W65B 2WB1A 2Y0SA 4MJ2A 4O2FA 3V7AE 5EB9A 5HHVH 4ADJA 3H7BB 4GKNB 4R0LC 5GSRA 4BFIB 3VQLA 4H2AA 2Z93B 1ZEAH 1S9XA 2VDOB 1Z32X 4X7DC 4F57H 3JV4A 2YAQA 4PJCF 4ZAKC 2GBVA 2EE6A 5KOMC 2DBJA 4G1EB 3UEZA 5C8JA 2DQFB 2HKHL 2WGNB 5E8NB 5FECB 5MEQB 1GAFL 3V6FB 4QHUA 4XNUH 5DK0B 4OF6A 4U1MB 3ZGIA 3UCRA 2OYKA 1E90A 1RP8A 2V5YA 3HCVB 3CUPA 4N8VA 3U2JA 2BNUA 2XT1B 2DDQL 4HX1B 1AXTL 1RI8A 1ZDSA 3ARED 4KK9C 1JD7A 4F37F 2AK4E 4JFDB 4D2NA 5IM7A 1YN7B 2J8UB 4EXKA 4WKZB 3OSKA 4QHNB 3S37H 2WZAA 5GS0D 3RWDB 3F7YA 1SXCA 1A3RH 2BNRA 1R75A 1NH6A 3DMMB 4H1LG 1KMGA 2WOBA 5ESQB 1U95A 3NJFA 3WTWA 5DCCA 3VI4E 4QO1B 3KPTA 5EU3A 5TE4L 3QUMH 2CAKA 2NYYD 1JGLL 1YECL 2DQIH 3IU4H 3P11H 4JRFA 5D5ME 5D93B 1CU4L 1U2CA 3TIDB 3O4OB 3GUFA 1PVHA 2CSPA 5HGBB 4Z3JA 3ZDZF 2H47C 2B77A 3AREA 3SCMC 5JDSB 3Q6GH 4FQLH 1CG9A 1MHHB 3RWJA 1BLNB 5CJQH 2OQJB 5EN2B 2NNFA 1RERA 3HHSA 2A3TA 3OX8B 4AQOA 5ENWA 4PSRA 4YXKH 1N6QH 2DZEA 1MEXH 3IDGB 1Z2KA 4MXVE 3CIAA 1PD1A 4GEJA 3CZUB 3TVMD 1JS4A 4FQ1L 3ETBJ 3WV0A 4OI8A 1OY3B 2GJPA 3PQYE 1ZE3C 4RNRA 2XWJA 5GQBA 5IEHA 3GSOA 4ONHB 5EIVA 3RLSA 4ZFOB 1HNFA 3CMGA 4ELKA 5KANG 3S37X 4NQCD 1J86A 3QAQA 1BFTA 2ICWB 2H4EA 5BO0D 5AW3B 2DQUL 4NZDA 1NUDA 2VISB 1CIDA 2VQTA 2C3HA 2UYLB 3TVMA 1CFMA 4U1KB 1IGJA 4J3OG 4WUUE 4YSOA 2LOEA 3UYRH 1HILB 4KHXL 2VAAB 3FN0H 3QZOA 5K9KA 5JPMB 3JZYA 4H44C 1CLZL 2ALWA 1WBYB 4HWZB 4P8QA 2QSCL 1JZ8A 1UATA 2IAAC 1U8HB 1H3XA 2QQLL 3ZDXB 3EHBD 1JFQH 1FN4B 1E28A 2VSKB 1FH2A 4M4RA 4NQCA 2WIMA 5FXCH 2Q6WA 5I73B 5J06A 4YLQT 3V55A 3GSUB 4LCWE 1L0XA 3TO2B 3WO4C 4P9HL 4O02A 3ME0B 1NPNA 4LLQB 1JYWA 3DX7B 4L0YA 3PWPB 4M5YL 2B0SL 1ZWIA 1AIFB 2I85A 3LKQA 4AGPA 3SE3C 4YSTA 1PKQA 1Q90A 1WPCA 4N20A 1QPPA 4JAMB 1LWRA 3BXNA 4ZUSB 4GFXA 6PAZA 1XDTT 5CJXA 4EZLA 4FQHA 4HF5H 2VR8A 2YA1A 3WXVH 5I8KH 5F89B 4RIRB 4DP6X 3RZWA 2OW7A 2Q2LA 3GKWH 3IMWA 3FCBA 3ZTNH 1YA5A 3N3EA 4K8RL 3KJ6L 5FHAH 5H94A 2BXYA 1T0PB 5FUOH 3WDJA 3V10A 3D3VD 4HG4K 2G30A 3VFGL 1M3JA 1LK2A 2A9ML 4YDLB 1UH4A 4LVOC 1ZS2A 5I30L 4FC3E 1QLRA 5A2IH 3WJMA 3GINA 3QNZB 3B1TA 2VAJA 4P59H 3ZDXF 4X9IA 2BHYA 1W72H 4NWTH 3LQAC 4KJWC 1MFEH 5FC9A 3RA7H 4XVSL 4N3UA 3IRCA 3LZPA 3NIGB 4GSUA 4ZMYA 2RTTA 4LSRL 2AV1B 3TA3B 3QRBA 1HHKA 2YEQA 3H3KA 5GIRA 3GGWB 3DRTA 3D3VA 1MJUH 1Q9LA 2BVYA 2HKHH 1GAFH 3FFCE 4DP8X 5E2JA 3PABA 4YE4L 4QYOB 4WHCA 5T5NG 1MY5A 1JVLA 1M71A 2PXYB 1YAIA 3AW5A 1I8KA 2FJGA 3LZLA 4KQ3L 1NMBH 4P5TD 5EZJA 1DN2A 2HT3C 2LU3A 3JVGA 4I4WB 1F13A 2BY1A 1AGFB 3R8QA 2ATPB 3QPXL 1AXTH 4OD1L 3U4EB 2FL5B 2ZUQB 3VVVA 2WSPA 5IHUH 1FFPA 3HB3C 3P0YL 2Y22A 5BRPA 3OWRA 3UGUA 5HHQA 2MCMA 3IFOB 5E4EC 2J20A 5E6SB 3SZ6A 5C3LD 1N5YH 4YUEL 4MNGA 1NC4B 3FHAA 2HPOA 3TN0B 5F7MC 1XSOA 1DUZB 1U8CB 3A4DA 3MSPA 3B2XA 4P5TA 3HJEA 1CZ8H 4BGDA 2BPBA 4JG5A 3MLYH 1KCUH 2O30A 1JPFB 4LCCB 2KPWA 1BWMA 1T7XA 1ET7A 3Q5TA 3VXTA 5E9DE 1HQ4B 3E8UL 4P3DA 5FW7A 1JV2B 2E0PA 2CMRL 2R83A 4JANA 1JFHA 1U2YA 3WLBB 4YLCA 4M48H 1UD4A 2PP9A 2Y7QA 3OHXB 1PG7W 4HW6A 5I1DB 4JQIA 1UA3A 3BRGC 3IDJB 3IETB 1GMIA 3QXTA 4G6KH 4XX1E 3IVKA 3STZA 3SE8L 3TZVB 4LGRB 1AXIB 4NKDB 1HHHA 3LDBB 3O6ML 2AZAA 4H8WH 4U05A 3FB7B 4FQ1H 2CIKB 4WEBH 4LLWB 4O51A 3RU8H 5HGHA 4LZKA 2MHAB 2YGPA 5D1XE 4N2MA 5I8CA 1OQXA 3GZPA 4DK3A 1W8OA 2FBOJ 2BCMA 4Z78A 4FZEL 2COQA 4MA1B 3C2SA 3P3UA 2CXKA 4MA8L 3KLKA 4U4BA 3DO3A 2BCKB 1KJ2L 3QGVA 5C7ZA 4HOXA 5L2KB 1L6PA 3D33A 3DSNA 1BQHG 3ZT5A 3KL3A 4KC3B 5DHEA 3QO1B 4WNSA 4JRYD 1P1VA 2BVOA 3DHUA 3FFDB 4CJ1A 5FUZL 3O3AA 4L8CB 3LKRB 5H8DA 4WFGD 5MP6H 3AT8A 3X1EA 2H32H 4J39A 5DQJA 2Q3XA 2BSED 4RZCA 4KHXH 2GUOA 2P44B 1HWGB 1KCVL 1CLZH 3NEXA 1AY1L 3K4AA 3QEGH 1ZHNA 2AJSH 4HMDA 3P02A 3O3DA 3HC0A 4L9LC 5F7EL 3SE4A 4ZMOA 5A6MA 1I7ZB 4YHZH 5HYIA 4BEIA 1ZVSA 4P9HH 2AXWA 2IVFC 1Q0XL 3QIBD 4Q74A 2R1WB 4JRYA 3OKLA 3Q2LA 1M6UA 5INDA 1BPVA 2DB8A 2FBJH 2B0SH 4DH2A 1SLXA 1N0LB 1NSNL 3VDAA 2AQSA 1AH1A 3CN0A 1JV5A 2BSEA 2EYTB 3QHZH 4LT7A 5DLML 1XMWA 1IBYA 1NJ9A 2Y36L 2RCSL 1KTLB 1SHWA 1J5IA 2LE9A 2ZKMX 4NKOB 2XFXA 5K93A 2AJYL 4P4RA 1MUJB 3Q2WA 2DWDB 1ACZA 4K8RH 3O6LL 3MCKA 4XNZC 3C60C 3ZYZA 1DJWA 3QIBA 4XBMA 3PGDB 3UTSD 3QCTH 2A9MH 4NZJA 4KWUA 5GGTA 3I9GH 4KXDA 4OQTA 1JXDA 4X4YB 5I1GL 1Z3GL 5LBGA 2XV6B 3ARFD 2VGLM 4Z7UA 3WIHA 3HUJE 4A55A 1JXKA 4U0RB 2NXYB 4IHBA 4S2SA 1TEYA 1RPUA 4I18B 5H37H 1RUPH 3SGEH 1TZHB 1KN2L 4FQ2H 4PP1C 5D70L 5DRWB 3WTTA 2ZT9C 4NT6B 4UTAL 4XP6L 3RKPA 4ICXA 4XXWA 1FNGA 3IJYA 3DVFA 3LKOB 2H6OA 3US1A 1J10A 4O2CB 3UTSA 1WE5A 3EFFB 2HXAA 4P2RB 4UINL 2DLTA 4PJXA 2ZUUA 4TNWK 4PJDA 4MDRA 1T0OA 3NJXA 4KQ3H 3G6AB 4PLKC 3ARFA 2UXGA 3ZZLA 2I69A 2NQCA 3QFJD 1TT6A 1NBYB 5EH1A 3QPXH 3L9YA 2QTVA 3DK2A 3OLIA 3KPNB 4EI5D 4Z7NB 1HYSC 1NAMH 1G1OA 3OR6A 4JKMA 4S1DC 5IQ9A 3ML9A 4HMEA 3ISYA 3INOA 5B3JE 3GT6A 3IBOA 3AWEA 5GGVY 1JK8B 2HUEA 5DS1A 2H0PA 4ADIA 2WVUA 4YUEH 5G4NA 3ZGHA 4ETYA 1S7VB 1CR9H 1V3LA 3NACL 4UOW1 4UAHA 5DJ0A 3VI3B 3ENEA 1VESA 2OX5A 2YUWA 3B9KB 3QFJA 4OZ4A 3WFDL 2FWOB 4EUPA 3RE0A 4NN6C 4JGNA 1RURH 2WKOA 4PLNC 4HEPA 5ETUB 4YHNB 3IAGC 4GBXD 4HZLB 2AMUA 2NSMA 4XXCC 3QJHB 3R7QA 3U79A 4D8PB 2CMRH 4UU9B 3SE6A 3QPKA 2A9BA 3BWAA 4JQVC 3VNYA 2Z7ZA 2O6EA 2AMGA 1HEHC 1CDGA 1NZRA 1XMEB 2R1YA 5I6MA 3LJ3A 4MDJB 1P6AB 3BMWA 3OKKB 1FI8C 2EIJB 4C56B 2I27N 3IU3A 2UUDH 4YSRA 3RP1A 4Z7NF 3ILDA 4M7LT 1YNLL 4X0KB 5FW6A 3ARBC 2CR6A 2HTKC 2WANA 3WEAA 5CJ5A 1RK0B 3PWUA 4OZFA 4H2CA 3VX1A 4GBXA 1KTBA 5BVPL 2D4FA 4L05A 1OGPA 1FYTB 3K6FA 4R84A 3OJVC 2I9TA 3S96B 5GGSY 2Z7UA 3P69A 2DAVA 3A6OA 2VT0A 3C2AL 1MDAA 3VI3F 3KR3H 4BHUA 5BV7C 4LCUB 4PRDB 2ZUWA 5HHPA 4PY7B 2BIPA 5FUZH 4OD2A 3RVWC 3RVVC 4AXWA 1PX3A 4QRRB 3BPNB 5KJ7E 1LL1A 5AAPA 5JW3H 5FYJL 4E42A 5E94A 1KCVH 1ODUA 1AY1H 1NGYB 5LCVA 3T4AA 4U6HA 5ESVB 4ETQB 4PJEE 2MCAA 2ITFA 1W0WA 2VSMB 2XETA 3CZSA 1OCRB 3VFRA 2X0VA 4YO0B 5ILTL 3BT0A 4LSVL 3TC9A 1QSVA 1SVZA 1KCRH 1Q0XH 2AXFB 5F0LB 2FUQA 1BIIB 5CCKL 3GMPB 3HNSH 1RHFA 2ZNWA 3OLGA 3IKCA 3RJDA 4YHYB 1NSNH 1CD9B 4HHAB 3UYPB 3RY4A 5DLMH 3V0AC 3QT2A 1BAFL 2Y36H 5DEFB 3IXTA 5EZOH 7FABL 4CN4A 1G7LA 1Y0LA 1BMZA 4L1TA 4G9FB 6PCYA 3PDOB 4D0CA 4E0RA 3ARUA 5JDJA 4GI9A 2E9IA 4RFEB 5IHWA 2BC4B 2R23B 1HINL 3NJIA 4XPBL 5I8EB 1A9BB 1XGQB 1AZUA 3IDMA 3VD3A 3ZE1E 4AY0A 1LE9A 5K9OB 2VIRB 5C0BD 3BAYA 1R3KB 2D8KA 3MA9L 3MJGX 3QC6X 3TF7C 1NOLA 3QZMA 4NQCE 5CD5D 2DN7A 4HGKC 1NEPA 2AGJL 4C4KT 1JZ4A 5A2LH 4LESA 2KZKA 2N56A 3BDXA 2ICWI 3KPOB 4MQXD 5ES4B 4JO5A 1B0GA 3L95A 3CSYB 3DYPA 5EC1A 2W81C 2XX1A 2YHGA 1N18A 4WRLA 1ZIBA 2W65A 1D6VL 1KN2H 2R0KL 2Y1YA 4JFDD 1BBJB 4NO3A 4BFNA 3OKNA 3HPLA 1AG6A 1PLBA 1WAAF 3ULVL 2ZXBA 2Z93A 5LXGL 4RCAA 4N6RA 1PKQE 3FN3A 4OGAC 4DZ8A 1CXIA 4U1IB 3DMMD 4IRZL 3VU2A 2WKLA 4UIKL 1RD6A 3VGBA 1T7ZA 1FO0L 5C0BA 5I6LA 5KSBF 1B3JA 1KWKA 1C8PA 1TJHL 4PTTB 3WUZA 4UINH 5DO2D 3HI6L 3VJ6B 4PJIB 3ARQA 2FK9A 3EBAA 3KYMA 4RGOH 3P3RA 2BHFA 3P2BA 5EC2A 5ACLA 3F65A 2Q8AL 2B3IA 3D0LB 7TAAA 1MXGA 1N8ZB 3WNMA 4K0OA 5KZCB 4JFDA 4J8RB 1IGCL 4CSZA 4WKZA 1JPSL 1NICA 4QHNA 3WTSA 2A4EA 3PG2A 3OQRA 5L2JB 4Z8FL 5AALA 5D2NA 4UT9H 3P0GB 2R0WL 3W11C 3DMMA 2W9DL 3TIEB 1A6UL 1XT5A 4FYTA 3RX9A 4HFWA 3ZU8A 1AO7D 1P4LB 3D25A 4F37K 5MEND 3UJJL 4FJZA 1JGVL 2QKIB 4ALAH 4KTYA 1WAPA 1YN6B 3WFBL 2X4PB 3JV6B 1RK1A 3CV5A 4WUKL 1QRNB 2WP3O 3WFDH 3T3MB 4WWOA 3D3VE 4LFHD 1T3FB 1P5UB 4JUSA 1NA8A 2CO2A 4LKCA 3VWKB 1QFWI 4CL7A 1TTRA 4JO1L 2XZAL 2ZF9A 5INCB 4H8UA 1LEIA 4FZ8L 2QFRA 2B4CC 1UT9A 4HCRA 5EN2A 4HOWA 5DSCB 1RUKL 2GI7A 4RA0C 4WW1A 1SOQA 3OLEA 1W80A 4H0LC 1OSZB 3CVHA 4ZBJA 1FORH 4WHDA 1AO7A 5MENA 3OF6D 1EZSA 2CBOA 3DV4A 3MZGB 1XCXA 4Q6IB 3J2PA 4KO6A 4R2GB 3UC0H 1G84A 4AMXA 1YNLH 1XB6A 2OPCA 2BLFA 3JWOC 4G7YH 3N6YA 3QUZD 4R4NC 3LEYL 1WZMA 3HI5H 4MNGE 5JUEL 2JKIS 3WS3A 5DVLA 4IU2A 1CLYH 2WJ5A 2SODB 4BD4A 2GSGB 1VZHA 3ZKQD 2GTWB 4H8WC 3UZQA 4MXQC 3QNXB 4F33B 3C2AH 4JE0A 3OF6A 3EJUA 3T3MF 2WWKO 2KLSA 1OAKL 3GZQA 3LVEA 3D52A 4JFOA 3ZZSA 3UMNA 1I9RH 1M6OB 1HHGB 3T77B 4XI5C 4YZFF 5AZ2L 4N5UA 3L5JA 1DQMH 5FYJH 3QUZA 1DJXA 3MBWB 4X50A 1HOCA 3EZ8A 3J07A 1JJUA 3KJ4B 1S6NA 4Q8BA 3ZQXA 3IJSB 3SGJA 5JA9A 5SWQA 2JLLA 5LDSA 3T6QC 2A99A 4KVCH 4XWOC 4Y2OB 3WLWD 1FN4A 1FNEA 2JCCF 2J4WL 4KDTA 1V05A 4LP4A 3WNNA 3GM8A 4A7GA 4LLYB 4M8QA 5FM5O 1OKEA 2VLRD 3T8XB 1T89C 5EU7E 1FL5B 1KCSL 2CPUA 3VXSD 4BE5A 5J0BA 5F3HB 4HJIA 4DT2A 3KW8A 2W0KA 2OZ4L 3LMJL 2F74A 2BX5A 1AIFA 3EO0B 1WT5A 1KBVA 5EZIH 4MCNA 2AJ3A 3G5VB 1KDIA 5EU6D 2XZQL 4JFEB 4N9OB 3FCUB 2X0UA 1NMAH 2QKSA 3CXHJ 2X87A 2HMID 3RFZA 4Z7WF 3WKNA 5F89A 4RIRA 1FC2D 4JFQB 2VLRA 3EOBA 3N06B 4N8UA 1E8YA 3POCA 3MBXH 1HINH 3VXSA 2CKBL 2HLFD 2EQDA 2B9AA 3K1DA 5GRYA