4BELD

Bace2 xaperone complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
112
structure length
112
Chain Sequence
QVQLQESGGGLVQPGGSLRLSCAASGFTFSSAIMTWVRQAPGKGREWVSTIGSDGSITTYADSVKGRFTISRDNARNTLYLQMNSLKPEDTAVYYCTSAGRRGPGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-SECRETASE 2
publication title Mapping the Conformational Space Accessible to Bace2 Using Surface Mutants and Co-Crystals with Fab-Fragments, Fynomers, and Xaperones
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 29
structure length 112
sequence length 112
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4belD00
2UZYB 3MLRL 1U3ZA 4PS4H 2B7DT 5FYLH 3MJ8A 3BSZL 3TO2A 2B39A 4GKSA 1M71A 4AG4H 4XTRD 3DX6A 4JPKH 4JO1L 4Y1AA 5TQ0H 3GMOA 4OAWA 1KYOK 3CFCL 2G75A 2VLKD 3AU1B 4K3GA 2C5DC 4K55A 3VFSA 4CL7A 5IG7A 3MRIB 2VDQH 3D87B 4MYWB 4M93B 5GGUB 1IC4H 1LDSA 5KVFL 3PV6B 1E0OB 3MRNB 3VFNA 2CGRL 5CZXC 1K6QL 4IRSB 1HXYA 4HFUL 3L7FA 4P2OA 1Z0MA 1QOKA 1RSFA 4I0PD 5I17B 5MP6H 2RQ8A 5LGJB 3P9MA 3BP5A 5F44A 2NY2D 4WW2F 1IGFH 4OZIE 1S7QA 2J8UF 2JCCE 4HUXA 4JJ5A 4IOIB 3ZE2F 4FZ8H 2WLYA 2HVJB 1MCJA 3QYCA 3SJVB 4JR9L 4FFYL 4M8QA 3JV5A 1ZA3A 2MMXA 2PXYD 5KSBA 5ELIA 3U4BL 2NW2B 3LIZH 1KCUH 5EO9B 3QXDB 4AEFA 3TF7C 4JY5H 4LCUA 4C59B 4PJ9D 5C07D 1KELH 5TDOA 4U4BA 2DQEH 5EDXA 3MCLL 2VYRE 3ARFA 3NIFE 2CIKA 4XGZB 5CEYA 4PBXA 3VA6A 2GAZA 3KYMA 1RZJC 3D39A 1B4RA 3RDTC 1JUFB 3QHFH 5TFSL 3ZDXE 1U3HA 4HIEA 1NUDA 5IW3A 1T3FB 4LPCA 1CFNB 2EDJA 4GXUM 2ADIB 2N56A 4R96A 1QBAA 4WWKB 3FQRB 4K7PL 3WE6B 5F1NA 8FABB 4ZFFA 4QTHB 2X4QA 1CGXA 2P5EA 3PWUB 1MY7A 2H32B 4LASH 3O6FB 4BZ1L 3SN6N 4KRNA 1I85A 3DLQR 2HMID 5FV1L 4MHHG 4PJIE 1IGMH 3CXHK 4PJHF 3DX7B 4LGRB 5KOVC 4Y4KD 4MLIA 4S1RL 1UVQA 4MJID 5T3XL 3DVGB 4ZG1A 1MFNA 4L8CB 5KS9A 3GDBA 3RUGB 4XT1C 3DRTA 1P9MC 4XNYL 4Z0XA 4C58B 4DAGH 3G08B 2HT3D 3TBTB 3MLUH 5EU3A 1XGTA 1WAAF 2NR6C 3BYYA 2OTWB 1GVIA 2VC2H 1IKFL 3LQZB 4NN7B 1QBLL 4JFQA 1GRWA 3EFDL 3SE4A 3SCMA 1JGVH 1TIUA 4I3SH 3PUCA 1B0RB 3JSSA 3MLVH 4X6EB 4PRBB 5HHQA 2EH8L 1H5BC 2LTQB 3VXUD 1EFXD 2ICES 3P11H 3BDXA 2QKIA 2EDWA 1VFBA 3DWTA 4TTDD 1LEIA 4EI5C 3P9LB 1FNGA 3UJIL 3LB6D 1P4BL 1UZ6F 3T0BA 4XP5H 3EJJX 4N5UA 3OKOA 4RGNE 4PGDB 5T1LA 3PV7A 3R0MA 2ZUWA 3WNNA 3ZHLA 5J6GA 4S11A 1O0VA 2BHYA 2DMCA 4X6DF 1I3GL 1B9ZA 5EIIB 1QFWI 1JRHL 2JJVA 3ZE2E 5DWUH 4E5XB 4MSWA 4LARH 4PJAE 5HGBB 1U2HA 4O2CB 3QXAA 1N6UA 2R1XB 4ZPVA 3MSPA 3BGMB 1SY6L 1RIVH 5D7JC 5GJSL 5DGRA 4UNVA 5D5MB 2HT4D 3UTSD 3QFDB 3HAEA 1SYVA 3X12B 4BZYA 2BVPA 2DLIA 3T0AA 4U6HB 5GRXG 2YD6A 1RUKL 25C8H 2DYPB 2V9TA 3TFKC 3EGSB 1WWCA 1CL7H 1A4JB 2VISA 1NSNL 5C08B 3KLHC 2Y1VA 3WV0A 1MWAB 5EN2A 3NFPA 5EBMB 3TN0B 1A6AB 4OLYL 3D5OF 2FWOB 4M5YL 3IF1B 4JN1H 4DQOH 5HVWA 3BD5A 4UILH 5JHDD 2AQ2A 1JPSL 4MZ2A 4Z0BL 1IRAY 4LHUG 3I75A 4U2YA 2GSIB 3MA7A 2ATKB 3BFOA 2WUCH 1KENH 4QXUH 3REWA 5D1QB 3GMNA 5IT2L 5E2JA 2I9LA 3SDAC 4NC1E 3OAZK 4QRRD 4GBXA 5IFAL 2GTZA 4KQ4H 1KOAA 1YY8A 2CPCA 2DM4A 3QIWB 3TNMA 4PJHE 1NMAL 4DKFL 4UB0H 4BH7A 3MACL 3FO0L 2NTFB 5DQ9B 5IB2A 3B6SB 1TNMA 3KJ6H 4F15C 1PZUB 4DGYL 3BP6B 4XMKL 1I9JH 2JJTC 1CDJA 1FZKB 1BD2B 1TXKA 3HZYB 5C0CE 5FGSA 4P9MH 1WAAE 3ARPA 5KG9B 3DURB 2H2SC 2IJ0C 2CLRA 15C8L 4PJBB 2QQNH 4XPGH 3VWJD 2YZ1A 4HD9A 1DUYA 4ZO8A 2YA2A 3QCUH 1DN0A 5DI8B 2EDHA 2R2HB 2B5IB 4Z76B 3CFBA 4J2XA 2OL3H 4QRTA 4BSVB 4U6XB 1TITA 2Y7QB 3WHXB 2HLFC 4MLSA 4F33A 3FFCB 4X0KA 1DJSA 3L3KA 4R9HA 2W9DL 5GJTL 4JN2A 3I9GL 2VLJB 1EGJA 3ZZ1A 4GKNB 4NQCD 3ARWA 3VGHA 3S96A 3BZEB 1CFSB 4AQ1B 4MD4A 2A83B 5BS0D 2AXGA 4HGMA 4LKXB 2GJ6D 4OGXL 4RGMC 5MEPB 3PGDA 3K8LA 3P30L 5DUBA 4P2OC 3VXMB 2P7TA 4ORGA 4JRWA 5CCKL 4PV8A 4XXDB 1EHXA 3OKDA 5DQDL 1I8KA 2ADJB 3QDGE 4CW1A 4QGTA 3DXAA 3F65A 4HIXH 5GRJH 2NX5E 4HIIB 2VKWA 3VDBA 4HXAL 2A1WL 3KR3L 3VE0A 2WV3A 4HMDA 2AK4D 5EOQH 1I7RA 1S9WB 1XIWA 4LAJH 3RWCA 4UOW0 1Z2KA 3TIDB 1V3MA 3IJYA 3HG1A 4K8RL 1HHIA 3WLBA 1S7WB 5FV2A 2JIXA 1M6OB 2CJUL 3CH1B 4XCFL 5TGBB 1I4FB 4GJTB 4V1DD 2E8ZA 5JW3L 1B90A 3PWVB 4FQ1L 3T2PA 5IM7A 4HKBA 1T2XA 3ARFC 3QNYB 5ITBL 5JOPD 4HDIB 2XG5A 4FQJH 4NN5B 5FO8B 3EYVA 1MIEH 4JM2B 3RWFB 2AK1L 4JQXA 1CU4L 1MELA 3SGJA 2AV1A 4P5TB 4RAHA 1T04A 3QWRA 2VR5A 4WWKD 5MI0B 4JQVA 1SY6A 1JN6B 5IMOB 1T1YA 4LK4A 3OKNB 3O6FD 5KVGL 1IGIL 4P9HH 1RJYA 1H0DA 1QZ1A 4YHLL 1NGWB 2P8LA 3FFDB 5BJTA 2F53A 1JV5B 3H3KA 4YXLH 2VKXA 5HGDA 3MV8E 3B9KC 1X4XA 4PD4J 5D7LD 3SDCA 1NGZB 4OCWH 3VRIB 1E28A 3WNLA 2Y9RT 3SQOH 3VWKD 4HK0A 2C7UA 1OAYL 3AUVA 1IKNC 5L8LB 5C09B 1YQ2A 3JBG7 4OM0L 1YNKH 1RZ7L 3QH3A 4G6AD 2F5AH 1R5WB 1XH3A 3F62A 4Q2ZA 1QRNA 4NM8L 3QPXH 1D5MA 1NC2B 2Q6WA 5L2KB 4ODSL 2IGFL 1S7VB 3Q3GA 3DMMC 5H94B 5MEOA 1I7ZB 3S9DB 3MBXL 4YHPB 3PWPD 3JVGA 4BQCA 4KXZI 1AC6A 4WU7A 5ALBH 3SCMC 4DN4H 4NO3A 2AEQH 1OLZA 3JV0A 4QOKB 4K71C 1PDKA 5CWSB 4G7YH 1D6VL 4XWGH 3I84A 4KRMB 5JR1L 1ZT7A 1YMMB 4OF0A 4CVZB 4ERSH 3FN9A 2CRIA 4FFVC 2BMKA 4PYGA 4ONFL 3ARRA 4YDLC 4HCRL 1CFTB 4HIJB 3MLZH 5HHME 2FEDC 2ESVE 3STZA 1G1YA 1QNZL 1WZKA 3CX2A 1EO5A 4XAWH 5SV3A 4TUJB 3QI9A 1GXEA 4W70A 3IXAA 1KLGB 4XVSH 2BSRB 1PZ5A 1FE8L 3SKJH 3TT1L 5C7XH 3MROA 1Z9OA 4NHCH 4HWEH 4U1GC 4Y4HC 2G2RA 4UNUA 1RK1B 1I9IH 5FA3B 4LCYB 1N64L 5IMKB 1JYVA 1N7ML 1JGDB 3LDBC 4L8BB 2YA0A 1JPGA 1AGDB 4MD0B 4ISVB 2ORBL 1YEDB 2EDDA 1T5WB 4MJ5A 4MXWH 4Z7VB 3WLWC 1LK3H 5ANME 2C1OB 2Z31A 4UT6H 4KKAC 1QPXA 2N1KA 1KB5B 4JPVL 4Y2DB 1DLFH 5C08D 4Y1AD 1MREL 1FN4B 4TQEL 2MWCA 3TN0D 3QFJA 4U1MA 1N4XL 1NH6A 1GHFH 3NFNA 3T2OA 2IADB 4KJQC 1DVFB 2FX8L 4P0DA 1CD0A 4EIGB 1B6UA 3O4OB 5IF0A 1JHLH 3EYQD 1RZ8A 2DQJL 3OPZH 5KBNC 4WVRA 1TVBB 4CMHC 5I74B 1RHFA 4PTUB 2F8XC 1CGSH 1UWEH 4YO0B 4FZEL 4NZRH 1T2QH 3C8KA 2WSKA 4X7TB 3MPCA 1KCSH 4ONGL 3QBTB 2V7NB 4KMTL 2D7MA 4MNQB 4MZ3A 3PP3H 3QUKA 2F9BT 3TYGH 1YMHA 2HFTA 2YHGA 5EOCL 3KPSA 5E8PA 3HPLA 4Y5YA 2HG5B 1ZGLP 1KPVA 3DSFL 4LHJB 2CD0A 4LEXL 4XCCL 1AXSA 2YMXL 1U8HB 4NQSA 4UU9A 4LCCC 3S36H 4AENA 1C8PA 3X14B 3K2UH 2CDGB 4NCC2 4JCMA 2NY7H 5HYEA 1SBBA 3LRHA 4N9GB 1A6UH 1U3HD 1A3QA 1ZA6B 5F1IB 1H15B 3U2SB 1N8ZB 4PD4K 1KACB 2ZZUT 3FONB 1VADB 1F13A 3SKNB 1HH6A 3NCBB 2VLJD 4G42A 5FYKD 3ZKMC 2P5ED 4UOJA 4ZS6D 1A14L 1DBJH 3ROOB 4K7PY 2VDNL 4UBDC 5CJXA 5T5FH 1G6RH 1XZ0A 2YD1A 1ZT4A 3MRMA 4HC1L 2BFVH 2WWMC 4G8FB 3MXWH 4HHAA 5CJ5A 1IGJA 5DJ8A 3PHOA 1J8KA 1VFOA 2EE3A 5C86A 3VXMD 4U1SA 4U1JA 3BHBA 5TQ2L 2VLRE 3QUZB 3RTQB 5ISZA 4D9RE 2XNAB 2NLJA 4YDJA 3MOAH 3IDJA 5DUPH 4PJEA 1W0VB 1FVEB 1LO3H 4KK8C 5E95B 4L4JA 1U8KB 3U4AA 4KK6D 1NEZA 5JORA 3VFUA 1XF5A 3MNVB 3NCJH 4IMKA 3WO3B 5K9OB 3BKYL 1XIWC 1XF4B 5IBLD 3FOMB 4FNLL 1TNNA 4IRZH 3WO4B 3C2SA 3T65A 4B7IA 4KVNH 1ZGLM 4OKVB 1KIPB 5IVXF 1AQKH 3EYFA 4JO2H 3RWDB 3RGVC 5DRZB 3ZSTA 1WEJL 2NXYC 2DQTL 5FF6A 1LE5A 1QSFE 2WIIB 3GFUA 1RUPL 3IS0X 2DICA 3LZFH 1E4XH 5FUCC 4P2QE 3SGJC 2BDNH 2PTUA 5IMLA 4ZS7L 3ULUE 1JYXA 1MIMH 5CJQH 1NL0H 1GGBL 1ZGLB 3ES6A 5DK2B 1I7UB 5JQHC 4KUZH 5JDSB 1OGTA 1U8JB 5IEKB 3O3AA 1KJ3L 1EO8L 1IAOA 2ZKHH 2GUOB 5ICXB 2AW2A 4KTDH 3S35X 3D3VE 3WL9B 3RAJL 2X89A 1CICC 5ITFB 4F7PB 1FL6A 3SDCC 5TQ0L 5JMRA 2LABA 1ZMYA 1YPZA 4I3GA 1U92A 1N6VA 1CGYA 1XR8A 1OCWH 2YPVL 3BGAA 4EVNB 1K8IB 2NY1C 3CVHH 4OZ4B 4ZUSA 4P46A 4P99A 5DJZB 3MYZA 5J06A 4BQ9A 5IK3A 2X40A 3QO1B 3GIZH 3SDXB 3SKOB 1IGFL 3T1FA 3GSUA 2VWEE 4FFZH 3FZUD 2PYEB 3ZKXC 4FZ8L 2Y06H 4NKIH 2P24B 3FQXB 1A4KA 3QIUC 3O81A 1LWRA 2PF6A 1V3LA 4GBXD 3DIFB 2BNUA 5D1ZB 4XMLH 1J1OL 1URLA 3BMWA 5TF1H 1OQOA 4CDHA 1KELL 1MFEH 2HTKD 1YY9C 2BSED 3BWAB 1ZHLA 2IMMA 4JY4A 3QI9C 1P53A 3UPRB 2D4FA 4KKLC 2E9IA 2IALA 4HSQA 3EYOB 1CDCA 5GGRB 4JREC 3LAFA 1FG2A 5CHNB 4Z5RA 2IANA 1H3UA 1AE6H 1C5DA 2ARJA 3QHFL 1F2QA 2PW2B 4WHYG 4J4PD 3RHWF 2RR3A 5EO1A 1IGCL 4QRPA 1M4KA 5INCA 2OTPA 5HYQA 5B8CC 4ODHH 5IVXE 5F7YC 1YUHB 4HC1A 1JHKL 1MQKH 4BFEA 5I1HH 2Y5EA 1I1CA 1MHEB 1RPQA 1B2WH 1RY7B 5CS7A 1Q0YL 3AREB 3D0LB 4LVNC 1EXUB 1DVFD 4UT7H 4C56A 1NGXA 3CZJA 3WUWB 2NY4B 1UM6L 2EYRA 3BMVA 3BP7B 1PEZA 4ZPTB 4H26B 1AGBB 4ZUWB 3FB8B 1KXQE 1U9KA 1JPFB 1VEOA 1L6XA 3S37H 2MQ3A 3JXAA 4OJFL 1ORQA 3T0EA 2RBLA 4G80A 2ZSVB 3QDJB 4GW5B 3WIFA 1LP9B 1JGVL 3KXFB 4MNQD 1XGYH 4MAUH 4K8RC 3A6BH 1T83C 5D7IB 1RK0B 5AYQA 2Q76A 1HE7A 4Y19E 3ARBC 3O3BB 2BSTB 1ZT1B 4DZBA 4G43B 5A2LH 5DMIL 3BZFA 3T0XA 1MHCA 1QBMH 1QKZH 2X4PB 4ODWB 5DHYA 4XP5L 2X7LA 1BFOB 2LAAA 5C0FB 1NEUA 4WEMB 1CBVH 4Y5YC 2AEIT 5CSBA 3TBVB 3LV3A 3HR6A 5E5MA 1WZMA 2XRAL 3SY0A 4KK9C 5DD5L 1NAMH 4PRNA 5DMGC 4NBZB 3RZCB 5J0BA 2MNUA 2DF3A 5T5NF 4GXVH 5CLWA 3TA3B 3BAEL 1A7RH 4O51A 4D9QD 1J87A 1MSPA 3GGWA 4H1LG 1OF2B 4N0CD 1CGWA 3O0RH 1BECA 2XTJC 5BVPL 4M3JA 1HZHH 1RIVL 1UJ3B 4YQXH 3WMSA 4KKNA 3P4OA 4MB3A 4F7CA 1F4HA 3H9HB 4P23A 2O5XL 5CJXC 4MQSB 5E2TH 4H0GA 3RL1A 2P4AB 4TULH 4CU6A 1HQRA 3BIAX 3SBWA 5C0RH 3OXRB 4XZUB 1Z5LB 2WWKO 4FG6D 1A2YA 1CLYL 2B1AH 2YUXA 4JGJA 4Z8FH 1QRND 5CZKA 3V9FA 2WQ8A 3KPLB 4JN1L 1FFNB 5IR1A 4E42B 2UWEA 4WTZG 2IPUG 4NYLB 1FRGH 4M1CD 4NN6B 2RFXB 1DP0A 1N0LA 4DN3H 4TVPH 4PGCB 4O02H 4Q9QL 4QXUL 3B2VL 3B8SA 4LLYA 2WM0A 5BV7B 2W65A 5DUML 3OG4B 5IW1A 4HAGA 4ZFGL 2UZIL 2V2WA 3QUMH 4HFWA 3FTGB 3CLEH 4F3FA 2PCPA 1JF1B 1R3KB 1A5FL 3KJ6L 2NY3B 3V0VA 3V5DA 1LQSR 2GT9B 4IJ3B 3ULVL 3O4LA 2LQRA 5AYUL 1I9JL 1K4DA 4MA7H 2C3WA 5JZ7C 4BZ2L 1BBDL 4P9ML 2X4TA 1X6LA 2UUDK 4LNVA 4YC2C 4GG6F 1A7OH 5FHBL 3OGCB 4XPGL 4LL9A 1PKQA 1WJ3A 1KBGL 1Q9OB 3KYOB 5T3ZD 3RWHB 4EDXB 2VMFA 3B2UC 5LCVH 2JK5B 1T5XB 3CDGA 3G5VB 2RJMA 2HVKA 2Z31D 1L0XA 3B4NA 1HWGB 3EHBD 1I8LA 4P2RB 4KI5C 2CKNA 1H3PL 4LLMA 1FJ1A 4M7LH 3CDYA 3U0PA 2OMNA 1RULL 2XQYG 5HJ3B 1RMFH 5MENA 1MCFA 2QADB 2Y07H 1QR1A 3GSNL 4L8SB 4YDKL 1A7NH 1IGTB 2GYSA 2M8XA 4P2YA 2FYYB 3WXWL 1UJTA 4JPIA 3KWWA 3TVMB 2PYED 4GUPB 4GFTB 2JELL 2NY5H 2Q8AL 1XGPA 1INQA 4QNPF 1MAML 2PYFB 4I77H 2C9AA 4WY7H 2QL1A 2VQ1B 4HIXL 2FO1A 4X4XA 4FQLH 1J5OL 3O45B 5SWSB 4XXCC 5EOQL 2XN9E 1MFAH 3KHQA 5HDBF 1JHTA 4FQIL 2EYTA 3OAUH 4B53A 3PWJB 1NJ9A 2AV7B 3NAAH 3IDIA 1A9EA 1RAMA 3CUPA 3KPSD 1GH7A 3WD5H 3QB7C 2NW3B 5ESAA 5AWNH 4PJ5A 1Q94A 1WFOA 2FO4A 4HXBH 5DMJB 1YYMH 3V8OA 1E6JH 1NC4B 4NKDB 4Q6IC 5EU4A 2ZNXA 5IQ7H 3IFNH 3ET9F 2QHRL 3IU3A 5DFVC 3EBAA 4CVXA 1A1MB 1UM4L 3HUJB 4R2GC 4LPTA 2JB5H 2EXWC 2FD6L 4KY1L 3P3YA 5IFJB 3KYAA 2CQVA 4H20H 4OLEA 1EUUA 3CIQA 4QTIL 3BP4B 3O41A 1MCDA 3QP3A 4WUUA 3JWDL 5EUOF 2DKSA 3MO1B 4AK1A 3ARED 2XWJA 3PHQA 3ARXA 2B2XL 3MOBH 3WKNA 2QQLH 4YXLL 2ICEB 4OCMC 4Z6AT 3QEHB 1J1XH 3CSPA 1Z3GL 4NT6B 5CJ8A 5EBLA 3VCLB 4ELMB 3SQOL 2BC4B 4X80H 1Q38A 3SGDH 5E2VL 5FO7B 5FUOL 3VXOB 1FFPB 4UTBH 4KH2A 2SEBB 4XP9H 5DK0B 3T4AB 3EZJB 1F6LL 4L3AA 5IWLC 4AL8L 3G5ZB 3LKNB 5BZDB 5I1CH 1TPXC 3N1PC 2X4RB 3QDJD 3OKEA 5A3IC 4LCWE 1BZ9B 1U95A 3HE7C 3T0EC 4KHTH 4X6CF 4FQPA 4WO4A 2ADGA 4X83A 3LMJL 1A1OA 1YA5A 1NGYB 4DN4L 5CSZA 2AEQL 3S97C 1U8MA 4NSKA 1RZKC 5LBSH 3VXSE 1TJIH 3DARA 4P59H 5KSUB 3HC0B 5INDB 1OVZA 1PKOA 1IILE 2I27N 1OTTC 4JO3H 1KB5H 5L2JA 5D96C 4YFLI 4ERSL 1DUZA 1V7MH 3AB0C 2OTUB 2JJSA 3L5WB 3CCHB 3I3DA 1GGIH 1ZLWH 2HTLC 3F12B 3GRWL 2DWDA 1FGVH 1MCLA 5EU5A 4RISH 4OF5A 4JZJA 4DGIL 4XAWL 4OZFB 1R24B 3IRPX 4XHQA 4APQC 5SX4I 2Q86B 5EZIL 5F3HA 4QF1B 4QNPE 3MLSH 3SKJL 1ZWIA 3LRSA 3L3JA 2EDRA 4F58H 1CK0H 2W9EH 1I9IL 4PJ7F 3L3GA 1JTTA 4L29A 4U6VL 5F7KC 2IBZX 3IJSB 3SGEH 1H5BB 5HI5D 4G8EA 4EEEA 5F7UA 4KZEL 4LHUA 3RX7A 3DVNA 3KNBA 4EI5B 5GS2D 4XHJD 2AERT 1NANI 4KROC 4MXWL 4OZIA 2JKXA 2JCCA 4M1DL 2X89D 5IHZB 1P7QA 3NFSH 2ZUQC 3GSNA 4JO4H 1DLFL 3IGAA 3SBWC 1IL1A 3GK8L 4POYA 1LO5A 3BN9D 3K0WA 5FKAB 3UYOD 4DTGH 1MH5A 5DJYB 2LVCA 3C6SA 5C0ND 5SX5K 4P46D 4WFHE 5EU6B 4X9BA 3EO0A 3D1MC 3MJGX 3SO3C 1JHLL 2VLKE 2WBWB 5BZWB 2XICA 4K7FB 4ZFOL 5L0QB 2C3VB 2X70A 5JOFB 3MBEA 2X2YA 3GNMH 4J7RA 5EUOE 1D5XA 5HHPB 3WFBH 4Y4FB 1REIA 1II4E 4D9LH 5FK9A 1CGSL 1UWEL 3KYNB 5I2IA 2QQQA 5C0JA 4JDTL 3VGDA 2FX9L 3PWLB 3GSQA 2H9GB 1IEBB 1NBZB 1DLHA 1J8HB 1VGKA 3MCKB 1MCKA 2DBLL 2VL4A 3B43A 4CNIB 1OW0A 1CN4A 3FQUA 1F11A 4MNHB 3LS4L 2BVQB 5GS0H 3T3ME 1UH4A 3OHXB 5CEXB 3QQ3A 3I3EA 4L9LB 4MA8L 4EUPG 4BKLB 4AM0B 4X6CE 4QHUA 3RWIA 1KNOB 4PJGA 3BOVA 5C07E 4PJIA 2YKLH 5EOCJ 5JXAH 3K2UL 3RU8H 2BOBA 2PETA 2K7PA 2NY7L 5ERWA 1WTGT 4G8GE 1ONQA 4JHAH 1T7YA 3CMOL 1KLFA 4CGTA 4QRPD 5F8RC 3SDAB 1MCIA 1T0MB 3T8XB 4WFED 4U6YA 4FXKB 4MQ7A 1IARB 4HGWA 2QEJA 3V6OE 4CRPA 1DBJL 3MNWA 1KLUB 1HQ4A 1UB6A 4RMSA 1MHHA 5T5FL 4F15B 3VRJA 5BO1H 4DEPB 1KCRH 4UT9L 4YNYA 1C08A 5AZ2H 4PRAA 2LAGB 1BQUA 2EKSA 4C56D 4PJXB 5JUEH 5E08H 1P1ZB 4PP2B 4YIQB 1DZBA 4LLUB 3TVMD 1UC6A 1ZHNB 2HJLB 4NRYA 5JDJA 1A21A 4FA8A 2UVFA 4JG0L 4PJ7E 2HLAB 4R26H 4H5SA 1CQYA 4P5MB 1ZLUK 5CINH 3PDOA 1DE4B 5E8OA 5DMKB 4WW2A 3U9UA 1JGUL 4FTVA 4JDVA 3I6GB 4MJIE 1JF5A 5HHNA 1LO3L 5I1DB 2OR8A 1S9YB 4UIKL 3W82A 4JKWA 4D0BB 2BNRB 1TTGA 2VUYA 2YWYA 4JANA 4LFHG 4OV5B 4PJAA 4LLWA 3GRWA 4F7EB 1P7HL 1J05B 2X4SB 3AMKA 4IRZL 2YEZB 3HMXH 4KVNL 3QPQD 4EI6A 2CKBA 3RY6A 3VXUE 4ZOAA 4PJ8B 2DD8L 2ZP0T 3DGGA 2R1WA 3MRDB 4RGMB 3LKRA 5C2UB 5FGCE 1MFCL 1C5BL 3P9MB 1W72H 1IAII 3KPPA 1E4XL 4YHIA 1WBXB 2BDNL 4RQQB 3J7HA 1SJXA 4LSPH 5CJQL 1NL0L 2YRPA 2V7HB 1D9KD 4PLNC 3W0WA 5I8EB 3KLAA 5F7EL 1FV1A 2EO1A 1HSAA 1S8DA 4P49A 3V5HA 4WEBH 3O3EB 4LIQE 4R97B 5HYSB 1A9BA 1O7SA 4P2CG 1A6ZA 2HRPL 4D0DA 3UO1H 4P23D 2Z4QB 2FZ3B 4Z7UB 2FJFA 4Z78A 3F8UB 4I18B 3OB0H 3U4EA 2A6JB 1FZJA 5D9SB 1ZAGA 4PLJD 1ORSA 3MQIA 5MERB 3FO2A 2CIKB 4PGJA 1XFPA 5DR5H 4LSUH 4PJHA 5F6IC 3F7VA 3UTSE 1N3NB 3CVHL 5C0GB 4ZFOA 3GIVA 2YC1B 4PGEA 5CP7A 3MZGB 1ZOXA 5KVDL 1ZVYA 1AJ7H 3ZT6A 1YN7A 1BBJA 5C0CA 2JB6A 5DD0H 3OV6A 3MMEA 1L9MA 2A6IB 1A3RL 5CMAB 4FQCH 4NKIL 3KPRB 2O5YL 3RWJB 4G6JH 4WU5B 5JHDE 5FO9B 5HHVH 3B9KB 4BFIA 1HH9B 2ZUSA 5T33L 4NFCA 3QULB 1SJEB 1JE6A 3N06B 3IDNB 4U1LB 3O4LD 2XYCA 3WFEL 4NNXA 5IHUH 3UTQA 2BJML 3UTPD 2DIBA 4MAYA 5EB9A 4DKEL 5BXFB 1IAMA 2W60B 2HN7A 1TZGH 1MUJA 3DMMB 4IMLA 4RGOH 3ARZA 1T7XA 2ZCKH 2XFXB 2QSQA 4IOFC 2FDBP 3NOIA 4PG9B 3LD8C 2FEEI 1LE9B 4K71B 1EJ6A 2D31A 4LVHC 4LKCB 4HIHA 5DO2D 5DHVB 5BOPA 2VLLA 5FDYA 5FA4B 4PUBH 2HJKA 5DZOA 3H9SE 4K94L 4OI7A 4TYUA 1K4CB 1NGQL 5I16B 4BUGA 4YXKL 4YDLB 3QDGA 4A2LA 2PNDA 3W9EA 1Q9KA 5I1HL 2NX5A 2V2XB 2QHLA 5CIPB 3HNSL 4CN1A 5D72H 4OLZH 4TSBH 4Y0GA 5MEND 3FQWB 2JE8A 3LHPH 1X5GA 4ODUA 3KPMB 3HNTH 4XVUC 4ZYKA 1GL4B 5FFLA 1AQDA 1U93A 2VDLL 1FZOA 3DX9B 4Y4HB 2W0KA 3HZMB 2CRYA 4Y4FD 5D2NC 4M6NH 3OAZH 3S37L 1PLGH 4YHKH 3EAKA 1N2RA 2Y5TA 2ZPKL 2VUOA 4Z95H 1MY5A 3LDBB 2WWKT 2IFFL 4YHOH 4QWWC 2FH8A 2IPKA 1LO4H 4JKKA 4OSUH 4K2UH 1XGYL 2R0ZL 4JRXB 4KPHH 3A6BL 2NZ9D 3NMEA 5ADOH 4TNVF 3SJVE 3RWEB 4CU8A 5FYJU 2VL5B 5DJ2A 1QKZL 4MS8D 3VD7A 4EOWH 4LEOA 3G6JB 4Y5VC 1MCPH 3DUSA 1RZIA 4OCYL 1CBVL 4WHCA 3VXPA 3AAZB 2EIDA 1QG3A 3FO9B 2UYLB 1LHZA 3MV8A 2DI9A 2DLFH 1T66C 1CXEA 3MUZ1 3U7WL 4CMHB 1T80A 3REVA 3CPLA 5E8NA 3MNZA 3OKKB 3ORJA 2R2BB 2R0WH 5J12B 1A7RL 1ACYH 4AEEA 5TJWK 4WJ5A 1YQVL 3JWDC 5JOPE 1DFBL 5J6HB 4POZD 4XH2B 3O0RL 2OP4H 4DFHA 5C0EA 3PP4H 5I1AA 3HR5B 5KW9H 4WUUD 1GZQB 4GS7C 1PEWA 1KB9J 1T1ZA 3WXVL 1P2CB 4ODXB 3T2NL 1DDHA 2CDFA 5E2TL 4NQEB 2IC2A 3M45A 5E8DH 4EDWL 4FQHA 4F9PA 2H1PH 4OQTL 4XBPB 4HUUB 1ZHKA 4N5ED 3D0VA 5DD1L 1LVEA 5FYJD 4LCCB 5C2BH 2VQUA 3D2UB 2ESVA 2B1AL 4OI8A 1SEQH 5D7LE 4R0LB 3QQNA 5KSBF 1EHLH 1AR2A 3CDFA 1BZ7B 4F57H 4WW2C 3BKCL 1FGNH 2P8MB 4I48B 5GRYA 4DN3L 3BESR 2DQIH 1K9TA 1Y6MR 1EEZA 1QA9B 2APTA 1CD1A 1NDMA 4JFOB 5BRZB 2AQ3A 1F6AA 2DQCL 5ACZB 5DA0B 4M7KH 3WUZA 3ULUL 3CFJB 4PJ8D 3ULVD 2BCKA 5GGSA 5HVGB 4PG2A 2EDLA 4XNUH 4QRSB 4IM8A 5E00A 2K9UA 3RY6C 5GRUH 3GMRB 3RVVC 4LIQH 4Z7WF 1F02I 1D5BB 4ONOA 4PLKC 1U8OA 4H0IA 4NQVB 1CCZA 4DVRL 3PL6A 4W4OA 4YAQA 4HKJB 5C6TL 4F9LC 4CW1B 1CG9B 1G9NL 1WCQA 3L6FA 3VGAC 1IQDA 1JWMB 1AXTL 1K8DB 1U91A 1WWBX 1NCDH 4LDLB 2R9HC 4OZHB 3OR6A 1MFBL 3TH2T 1B0GA 3BKML 1J0YA 3QIBA 3LN4B 3CK0H 3Q2CA 3BUYA 4LHUD 4NM4L 4MHHI 2Y36H 1NBVH 1EEYA 3H9ZA 1QO3A 4P3CL 5FECA 4HBCL 5TE7L 3WS6C 5KS9F 3NACH 1MFDH 2OJEA 2YK1H 3DO3A 5C8JA 4XNQB 5D5ME 4M62H 2IH1A 2K3TA 4CJ0A 3NBNA 4M7LL 3HA0A 4NC1C 3RGVB 1UWGH 2X4NA 4M6ML 2B4CL 1YDPB 5AUMA 4KJPD 1OGAA 4OKDA 2Y07L 5FM5O 1L7IH 1A7NL 1DQMH 3B5HA 4MJ6B 4PP1C 5KSVB 2AQ1A 5DZLA 5C08E 4Y1AE 4P4KA 5F9OH 3V6FA 2A73B 5FM4A 3SE9L 2C4FU 3VFWB 4K3JH 2HH0H 2NY5L 4DJMA 2ZOLB 3MRHA 3MBED 4HH9B 3GKZA 2E27L 4LLVA 1VKXA 1X5YA 3UZQA 1VPOH 2HYMA 4HPYL 4OTXH 4QY8B 1T2JA 1A3LL 2F15A 2GY5A 3VGBA 2NXZC 1CICB 2OQJB 2FECI 1MFAL 2AABH 3RPIA 1Z9LA 1TVHA 3DRQA 3T77A 1BIHA 3VG0H 3MXVH 5E99L 3WD5L 2NY1B 5EC2B 4A6YL 3DMMD 1RZJH 1WISA 2EECA 1F6FB 4MAYC 1KFAL 3L3OB 4HXBL 1YYML 2Q6WB 3QO0B 1KJ2H 5DRNA 4XMPH 3TESA 4NKMB 3ZDYF 3D18A 1KB9K 2Q87A 4YWGL 2IBBA 3GSOB 3I85A 3FQNA 3L5JA 4D0CA 5T1DH 4XRCA 3ZKXB 2JB5L 4H20L 3T4YB 4RFOH 3QIUB 4DCQA 12E8H 3NZ8B 2YS4A 4PR5A 1A0QL 4KXZH 5GSVB 5BVJB 5CD3B 3GI8H 4X6BA 4Z7WE 4OQTA 1QVOB 3LRGA 2FJHA 2QQLL 3FFCE 1KPRB 3D9AL 3TYFB 5CZVL 2DIAA 4OZFH 3QI9B 1YEHH 3QWOA 4ZUUB 3MRFA 2VLJE 1UM5L 1DBAH 2EIBA 5FYKE 2O61B 3O2WH 2J5LB 4JREB 5DJXA 2R8SH 5I8CA 4DGVH 4TOYH 3H0TB 4Q0XH 2DIJA 4N0FA 4RGND 3VDCA 1BWMA 3LKSB 4AT6B 4WHTB 3RL2A 1GYAA 1A7QH 2Q7YB 5B38A 5D70L 5I30L 1OTUD 2IQ9H 1ND0B 4HT1H 3WLWD 3D25A 3VXME 3GKWL 1FZMB 4FTVD 5J4MA 3VD9A 3QDAA 1FORL 5KS9E 2CMRL 4P2QA 4H1LA 5B8CB 1HXMA 2QR0A 1TJIL 3AFLA 5ALCH 4R90H 5DURB 5JXEC 4O4YH 1WBYB 2DTSA 1OSZB 4JO3L 1LNUB 4I4WA 2BY0A 3FT3A 4X4YB 1V7ML 1CFQB 2P8PB 4R7NB 1GGIL 2FATL 3DETC 1WBZA 1QLRB 1FGVL 1EUTA 3D3VA 4RISL 2HFEB 2DLTA 4MCYA 1AD0A 1KT2A 1IJ9A 1GPOL 2VN4A 4HV8B 1JMZA 5J1AB 4NUGH 5JHLH 3FT4A 4OFDA 5IF0B 3EZ8A 1WT5A 3D48R 4O2EA 3W2DH 3FCTB 4MX7B 4BFBD 5D6CA 5KSAA 5F6HI 3MODH 3E8UH 3QG7H 2OBGA 3H7BB 2IH3A 5SWZB 2W9EL 4NWTL 3W0WD 4WTZA 4KRPC 1LMKA 3ARGB 2VDMH 2WUBL 5HY9A 5DVOA 3ARBB 2CLVB 3CC5A 3HNVH 4MA3A 2X1PA 43CAB 1RUQH 4MQXC 2BNQB 5JIIA 1IM9A 3VXTB 3BX7C 3WS3A 1AGFB 2HJFB 4JO4L 1MQ8A 2R23B 3D2UD 4Y16A 2KBGA 2ITDA 2ZOKB 5AZEH 4YR6A 1BEYH 3ZDYE 1CF8H 1H8SA 2NNAA 3ELAT 3V52H 3FAWA 3LEXB 1MI5B 3ZKNC 3WNPA 3LN9A 3CDCA 5C0DA 2CO6B 4QRUA 2G5BB 4XCYB 1R3LB 1OB1A 1NAKH 1V05A 3WHE0 3U36A 3WEXA 3GNML 3MLWH 3TH4T 5FM5M 5BRZD 2XTJB 1QSEB 2Z8SA 2P47B 1NCBH 3H3PH 3C6LA 2EDOA 3VJ6B 3ZE1F 4E41A 5J9PA 2VITB 2VQTA 5F96H 4WV1A 2R0KL 1ZT4B 2X1QA 4NRZB 2BY1A 4XPAH 2LU4A 5A16B 3LCYA 3ZDZE 3ULSB 4A6YA 2G60L 1JGEB 1NUNB 4L8DA 3BPCA 3MRJA 1NCTA 5IVXA 3QDHA 1MRFH 4ZTPL 4ELKB 1U8NA 5CGYD 1H3WM 2IBZY 4GQ9H 4JFYB 4HJGA 5GGSY 5ENWA 3PL6C 2J2ZA 1TZIA 2P44B 3TBWA 5DS8A 5HTSA 1INEL 3RX5A 1YNTB 1JF6A 5I75B 3S5LA 2XWTB 1K2DB 1V3KA 2RCSH 1ZVSB 2PTVA 2V2TB 1XF5B 5EORH 4M9PA 3S4SB 1R3HB 1ERNA 1R3JB 3VFMB 4RIRA 2C1PA 2GTWB 4Q7DA 3WIHL 2A6KB 3NPZB 4RDQG 1S9XB 4ODTL 1UEMA 3RFZC 3VXRB 1FVDA 2VDRH 5EUKA 2Z91A 2NX5D 4K23H 4LRNH 1TQBC 4KAQH 5BO1L 1BOGA 3HE6A 1KCRL 4Y19A 1WWAX 5FKPB 2YR3A 4KKCD 5FF6B 5IB3A 5CEZH 3CFKA 1I3VA 4ETQA 3QG6A 4YC2B 4OGAC 1ZANH 4NQUA 1RJZA 3NA9L 5ETUA 3SE8L 4U1NB 4EBQL 1Y18A 2FJGA 3BISA 2QTEA 4OLXL 2X9WA 3BE1H 4NO5A 5GQBA 3WKML 3EW3B 2DDQH 4PJCB 3CSBA 1FAIL 2QSCH 1BFSA 2BSSB 4O5LH 4ZFZB 4HS6B 3HI1A 4MNQE 3EOAA 3HMXL 2CSPA 3FMGH 2EEDA 2VAAA 3SKUD 4N8CH 5DT1H 1AY1L 3DX8B 3MV8D 3MLTA 5IV2A 2YOCA 5DFTA 3O6MH 2J12B 3HMWH 1DR9A 3D69A 4NNPH 3QUYC 3FQTB 4PGBA 5F7DB 5FYKH 1WICA 5FAAA 2O26U 4YXHH 2EE2A 1FLRH 1QLEH 4U3CA 3GMQB 3V4UH 1QHPA 2DRUA 4X5WB 5C9KA 4HLZG 2F54B 2F19H 4MXQD 5J3HD 1L7TH 2R0LH 3FOLA 5IEHA 4BSWA 3O6KL 4YFLF 3SDXF 3GSRB 2X9YA 1DBBH 1JNNL 1OARH 4X7SH 3OKMB 1WCBB 3TPUA 1U8PB 4GLRI 2AEWA 2VSCA 4JKMA 1JFQL 2ADFL 2NY0D 3FN0L 5HD8C 5C0IB 3V79C 2XZAL 4LSUL 3PNWB 4Q6IB 4Q9BA 1KXVC 2E7LC 1DN2A 3BO8A 3LEYL 4O2FB 2ESVD 4UDTB 1RI8A 4JY6B 4GW1B 3PWNA 5K9QG 1XGUA 4R2GB 4FFWD 2Z92A 1AJ7L 4G6FB 2ITCB 4HBQA 1I1AC 3S36X 1IT9L 5I15H 3OB8A 5IKCB 1QRNE 4HMCA 1MLCB 4WI2A 4RAVB 1RHHA 3KHOA 2YBRA 5L88H 2APWA 5IROA 1TETL 1YC8A 2OLDA 3UC0L 3FB5B 1JL8A 4NQDB 3RVWC 4NJ9L 1NMCB 5IB4B 5DQJA 1N0XH 1A7PH 1P4IL 5EBWA 3GBNL 4Q9RL 4HS3A 1IQWH 5DJDA 1G9NC 1T1XA 2DJ4A 2H6PB 1RJLA 2DLGA 3MLRH 1A02N 1ES0A 3HE7B 4RGOL 1ORQB 5KSAC 1QEWB 2DQGH 3BSZH 3L1OH 1EAPA 3ARGD 3UZVB 5KVEL 1S7XA 3WIHA 3WJJA 5DEGA 4BQBA 1FO0L 2Z35A 4JO1H 1EMTH 1YEFL 3TIEA 3CFCH 3HAEH 3WSQL 5E6IA 3C9NB 1BVKA 4PUBL 5D96B 3F6LA 5GGVH 2VWEC 5KVFH 4N9OB 1NDGB 1KCKA 2CGRH 1GOHA 1QQDA 1K6QH 5T3ZE 1SEBB 3C60C 1C5CH 1L0YA 2D4DA 4Y16C 5FB8B 1MI5D 1KN2L 2XPGB 2XN9A 3V6ZB 5JW4R 1WIUA 4PRHB 5I6XB 4APQB 3VFTA 4PJEF 2VZ3A 1OGAD 3Q1SH 4G9DB 3VXQA 3LHPL 3TPKA 2IPTH 3HNTL 1LEGA 4R3SA 4BUHA 4EUPA 1CR9L 2NY5C 5H35B 4JR9H 4FFYH 2HKHH 2E6JA 5EC1A 5CD5C 3U4BH 3O8XC 4Z7QE 4J8RB 4R4BA 2XZCL 5K9JL 1QFWL 3BZ4B 4IS6A 1G9ML 3SDXE 1FVCB 2ZUTA 1Y6NR 4M1GL 4OSUL 3MCLH 2A0LC 4JPWL 4K2UL 4KROB 4UNTA 3BT2H 4ZQKB 3CLFH 2YPLA 2PYEE 3QCTL 4KDTA 4WV1C 3BXNA 3BQUC 4L3EA 1HI6B 1UXWA 4HZLB 2ZUQB 3C2AL 4JFHE 4MWFB 2UUDH 2A9MH 1HQRB 1T4KA 3U1SH 1G7LB 4EOWL 4FMKA 3QZWB 1BX2B 4MNGE 2PW1A 1OAUL 5IMMB 1M1SA 1SQ2N 1D5ZB 3NN8B 2UY6A 4F8TA 4F37F 1MHPL 2AJZB 4KTYA 3FRPG 5E1HB 4K7PH 5ACLA 3B5TA 1PQZA 1XF3A 5T1KB 1GOFA 1OAKH 1NCAL 3DTXB 1KV3A 1FPTL 2EEAA 3PXHA 4X8JB 1KTLB 3VXRD 2NY6C 4D9RD 4YUEH 1YPZF 4ZNCD 1EGJH 3OF6A 3QQ4B 5KW9L 4S1RH 4R7DB 1S5IH 3FL7A 1AC0A 5MHSD 4KJWC 3HE6C 4XNYH 3VXSA 5IB1B 2Q3AA 4PGZA 3AY4A 4FHBD 3HZKA 2X4TB 1IKFH 4S1QL 4I5BA 3VI3E 1QBLH 4ORZC 5HI3D 3DYMA 2YD2A 2EH8H 4N0YH 2JJWA 4GRLC 5DD6B 1PKQB 3FT2A 4OT1H 2E8YA 4KZDL 4NRXA 3UJIH 5F21B 1MJUL 1ZTXL 5EOTB 4N0UB 5JW5A 1P4BH 4V2CB 4F57L 2VDKH 1FGNL 3BVNB 2I26N 5CP3A 3VFOB 3DVFA 1F45A 5IB5B 2LV4A 4LNRB 3GJFK 2VIRB 3MUGB 1N59B 2DQIL 3QDJE 1LP9E 3TZVC 3KXFE 2FL5A 5KAQF 1DL7H 5D7IE 5FHAH 1I3GH 1NGPL 4M5ZH 4M7KL 1JRHH 4NUJB 3DHMA 4F7MA 5AD0A 3VFVB 2FIKA 1SBSL 2BRRH 3QDMB 5HDQH 4LIQL 2VDPL 5D8JH 4MJ4A 1X5XA 3P4NA 2R2CA 2EYSB 4IDLA 1SY6H 3BD3A 4S1SH 1DBMH 5GJSH 4KK5C 1AO7A 3QCVH 4OZGA 1INQB 1MJJA 4NHUB 4ZD3H 1FO0A 2DQHH 4LBEB 4U1HA 1AHWA 3EJYC 2F54D 3C5SA 1VEPA 1WZ1L 2ED8A 1AKJB 3GSXA 3BIKB 2I24N 1RUKH 2D9CA 4HWZA 3VI4F 2BOCB 4RFEA 2WLZA 5LKNA 1WC7B 2Y36L 3QRGL 5B39B 1HK6A 5BCAA 4PBVC 3GUTB 3WFHB 2D3VA 3TGXA 1HINH 3RWGB 3PQYA 3QNZA 3MX0A 3NACL 1P69B 1R5VA 4FQQA 4ZNEE 4M5YH 2I9TA 5HVHC 4I0PA 3G5YB 3IJHB 3T2QA 4MDJB 5FOBB 4V2BA 1JPSH 4E0RA 4WNQB 4UQ3A 2DI8A 4GKZB 3K80A 4QHMB 4JFZL 1F4YL 4KWUA 1NLBH 5IT2H 1LD9A 5F9OL 4PJDB 3L9RB 1OHQA 4YHNB 2HKFH 1CE1L 5IFAH 5DRWB 1NMAH 2HH0L 2DB8A 4DKFH 5EZJA 3MACH 4X6CA 5H37H 1JWUB 3FO0H 3OR7B 2BXZA 3MUJA 4X9FA 3UDWC 4PJ9A 2HT2C 4DGYH 2KUTA 3C6LD 3HRZA 4P4RA 2R1YA 4E41D 3P73B 1KJVB 1NFDF 4G8GA 5HPMB 1MLBB 1DSFL 3H6JA 4K9EL 5F88B 5I0ZA 1L9NA 4LSQL 1M7IA 2EXYD 5GZNC 1J88A 1HHKA 3LOWA 2AABL 15C8H 1WIPA 5DJ0B 1NKOA 1BZQK 4JGUA 5F6IB 3V6OA 2KQMA 4TSCL 4YGVA 5DTFB 3MRGB 3V4VL 4UAOC 1FFOA 4YFEA 1PSKL 1VENA 2IAMB 3OKEB 3M8OL 1FNAA 1KG0B 4Z7OF 2HA1A 3C5ZB 3ECBA 5C0BA 1U42A 2W9DH 4X6FA 1JZ7A 1HSBB 4W6YB 2VRAA 5T1DL 4PJ7A 4MA1C 3ZLQC 3KLSA 3AXLB 4PV9A 5E6IC 2X4OA 4WFFD 5DJ6B 3VFRA 4EN3C 4OUUA 4WRLA 3EJZC 5K9KB 4OGXH 5F9JA 1HYSD 3P30H 1M7DA 1DBKL 3AS1A 1JYWA 5CCKH 2Z8VC 5DQDH 2UWEF 2XY2A 1BVLA 2IQAA 4S2SA 4J1UB 1EFQA 3TH3T 4X98B 5IESL 5L8JB 2A6DB 4MD5B 3MFFB 3QHTC 2YZ8A 3LRSB 4HXAH 5F7NC 1BGXL 3KR3H 3GSWA 4JQIL 5FYLD 5CJOL 3VDAA 3VXUA 4XCNA 4NNYA 3VRLF 2OL3B 1T0NA 1BQHB 4L29B 3VI4E 1OPGL 2ICWA 3MRBA 4NKOA 3TCXA 4K8RH 5SX4H 3WUWG 2GK0A 4LVHB 4H25B 4BSJA 3OJVC 4YJZL 4XBGB 4HMEA 1MCBA 2VLMD 3KPQA 4PRDA 4XCFH 5DGQA 3BDYL 1N5AA 4U7KA 5C6PB 4M3KB 3BUTA 3IS1X 4FQ1H 3MV7B 4JZNA 2C3XA 1JI2A 4PRPB 3SKMA 5KN5A 5ITBH 2XKUA 2X9XA 1G7PA 5SWSE 3IGAB 3IDGB 3LY6A 1CU4H 4OUOA 5DEFB 1MCRA 1NANH 5EIQA 3TCLB 3C5JA 3VD5A 4P3WA 4U49A 2BRQA 3C6SB 1UB5A 2AJVH 2NYYC 4QT5B 5T1KD 3X3GL 5TF0A 2OZ4A 5D2NB 3DUUB 1IGIH 3L5XL 4HK3N 3W2DL 2PTTA 3MODL 3BPNC 5T1MA 1A6WL 1OT2A 3EO1B 4WHDA 3UTSA 4MMXC 1NFDE 1VEMA 3CFDB 4R4ND 5M95B 3L7EB 4XP1L 5LQBL 2APXA 3L3IA 1KN4L 1OAYH 1CD8A 2IPUK 5IOPA 3QUXA 4OM0H 1CT8A 1S5HB 3EUUA 1F11B 4Z77A 4Y5VB 2X4UA 1D6EA 3GSVA 1V7NH 4GRMB 3QQ3B 2YD5A 4XPBL 1R3IL 1PFCA 2H3NB 3MBXH 5AZEL 4CN4A 3ARDC 3U83A 2WBJD 5HGAB 3HRPA 1MCHA 3B9AA 5F89A 4AIZB 4ELME 1KEGH 1D6VH 4HUVA 4JFDB 2J3SA 4HEPG 1WK0A 3E6FA 3C09C 5I73B 5ADPH 5E9DB 3DI2B 4F7TB 5LJYH 4M61B 2Q20A 3MREA 4C57C 4ZDHB 3TNNA 1QNZH 4GS7B 4GRWH 1CXFA 2IMNA 4L1DA 2FLBT 4UV4L 1XGRB 5F96L 2X41A 3VRJB 2UWEE 4XCEA 1HCVA 5CSGA 3W39B 3M07A 4HUWB 3TT1H 4IRJC 4AH2A 3ABZA 3H9SA 1FNEB 5DD3L 3VWJA 1TTFA 3B3IB 4D8PA 5CKGA 1IGYB 5LAXA 3T3PF 4NRYB 3BPLC 1FBIH 3BRGC 4PY8J 1N7MH 4GQ9L 2ZSWB 1A47A 9CGTA 2ORBH 4LLAA 5C0AB 1ZSDB 5I1EL 1SM3H 5KJRL 4GMTH 1AKJD 5FDWB 3MRKB 4PJXF 1J18A 5GS2H 3AU1A 2J8UB 4XTRC 4JPVH 3MRIA 2F58L 32C2B 3UTPE 3EYSH 5EZLB 4X99B 5GGUA 4YHYC 4JANB 1MREH 3PV6A 5GS1B 4LLWB 4TQEH 2Z8WC 3LKQB 1N4XH 2L7UA 4XI5D 1H9VA 4IRSA 1OOAA 4M6AA 4B41A 1DEDA 2NMSA 5LGJA 5I17A 1T89A 3N9GL 1OWWA 1F42A 4KGJA 5EO0A 4K23L 4LRNL 4KAQL 4I0PC 2DQJH 1YZZA 4IOIA 5HDOA 2XN9D 1KYOJ 2NY2C 4WGVB 2HVJA 1PY9A 3SJVA 5GZOD 3THML 2KZWA 5IW6B 4HF5H 2V5MA 1PG7L 4NO0B 4FZEH 2NW2A 3QXDA 4RWHA 3VGAB 4KJYA 4RNRB 1I1YB 1YEIH 4ACPA 2PXYC 4PTTB 4ONGH 5I19H 1G9MC 3SE3A 4FABH 3ULVF 5ICYB 5M94B 2VOTA 1EZVX 4PJ9C 1JNLL 1GIGL 1IAIH 4HX1B 1RIHH 4XGZA 2DDQL 1T6VN 4FXGB 5E2UL 2YPLD 2I07B 4F2MB 1JZ4A 3DSFH 4L3ED 4LEXH 1JUFA 2YMXH 3V5KB 4XC3H 4O5LL 1MJ8L 1T3FA 5HYJB 1ORSB 1ZEAH 1CFNA 3FO2B 2YD8A 2IAMD 4WWKA 3FQRA 1XR9B 3WE6A 3U30C 3C5ZD 5HI4C 8FABA 4QTHA 2GJZB 3NABH 3PWUA 2AI0H 2H32A 3IYLW 3ZTJH 4N68A 3O6FA 4KHXH 3O6ML 4KQ3L 4OZIF 5M7QA 3HMWL 4LSVH 2VDNH 3MRRB 2YPKB 1TCRB 4UDUB 1HWHB 3DV4B 3JTSB 3O3UN 5FYKL 3DX7A 4HC1H 4YXHL 1HDMB 3HKFA 2HMIC 5D7LA 4P3DB 4ZUVB 4TUOB 2EDEA 1YEEL 2NXZB 3DVGA 4L8CA 4LQFL 4N8VB 5CILL 1EO7A 1W8NA 3VWKA 4X7EC 4Y4KC 3OKYA 5DJAB 1G0XA 3G08A 3RHWK 5TQ2H 4LFHD 4PRID 3TBTA 3T3PE 1AH1A 4JFFB 4IBLT 1GGUA 2OTWA 3K4ZA 3VXSD 3LQZA 2HT3C 4ONHB 3ZYJA 4BQ8A 3UTQB 3ZYZA 1E4KA 3HPJB 1B0RA 3PJSB 3QJFB 4X6EA 4PRBA 4XP4L 2HRLA 4X6DB 2DWEB 4PJXE 3P9LA 5SV4A 1OTSD 4P5KB 3ZDXF 5GSRB 3BKYH 4CUCA 1CFBA 2IBGA 4TTDC 1RUAL 2NCMA 3LB6C 4FNLH 4PGDA 3MV7D 4OCSL 2ATPB 5FYJE 5DSCB 1G6RB 5I15L 3FB7B 5E1AB 5GGTL 5EIIA 3CZFB 1WEJH 1CXIA 3NIGF 3O9WB 2DQTH 4GW4B 2H45A 2BNRE 5L88L 4E5XA 4PJGF 5HGBA 4LLDB 4O2CA 2R1XA 4ZS7H 3IFLL 3BGMA 2AJXH 1GGBH 5HHOB 1GZPB 4N90E 1ZXQA 3RRQA 2C4XA 2KDGA 5D5MA 1ZS8B 1KJ3H 1EO8H 4MJ2A 1VERA 3QFDA 3RVXD 1ADQL 3X12A 1P5UA 4HPOL 1AO7D 3RAJH 2GSGB 2YA1A 5E0QA 2DQGL 3IDMB 3L1OL 4U6HA 2HT4C 1S9VB 2ZUYA 2V6HA 3EYUH 4OZFG 3RIAF 2DYPA 1YYLL 1H3XA 3EGSA 2EC9U 1A4JA 5CFHA 3E1F1 4WFHD 5C08A 5J1TC 1EMTL 5IUSA 1MWAA 3SHSA 5EBMA 3TN0A 1A6AA 4UI2A 1YN6B 4X4ZA 2FWOA 2YPVH 5GGVL 2G9HB 1QFOA 3IF1A 1VGEL 3F7PC 3PQYD 2GFBA 1UACL 4LLQB 2GSIA 4Z7UE 1C5CL 2E7BA 1LGVA 3LN5B 3Q1SL 5JTWA 1A1NB 1IE5A 2UVEA 3LH2H 1UXSB 2IPTL 4NDMB 1MPAH 5KOMC 3QAZB 2EDXA 3QIWA 3CPLB 1EVUA 3HB3D 1EK3A 2F74B 2VZSA 4GOSA 4PJAF 3G6JF 2HKHL 2NTFA 5DQ9A 2R39A 1KEML 1J1OH 3DV6B 3BP6A 3ILPB 4KRPB 4J3UA 4L9DA 4XBEL 4M7ZC 3R0NA 5IIEA 1HOCB 1FZKA 1KUMA 3HZYA 5DJCB 4K9EC 5KG9A 1QSZA 3DURA 4LAQH 1CQKA 3BT2L 3CLFL 4G8GD 2FSEB 3G5XB 4PJBA 1MCWM 2CDEB 3KPRE 5DI8A 2A9ML 2R2HA 3CVHB 3WN5C 3U1SL 1P84J 3VWJC 4Z76A 4ENED 3Q5YA 3RZWA 5C92A 4S10A 1G0YR 4ZXBB 4BSVA 4YDVB 3OKLB 4U6XA 5C0AD 2Y7QA 4Z7WA 5DK3A 2M26A 3FFCA 1IGCH 5I0DA 2VLJA 3GJFB 2RB8A 5C0BD 2W0FB 1JHKH 4GKNA 3ZMRA 4G3YL 1OAKL 3NIGE 3BZEA 3P77B 1CFSA 3FO1B 1Q0YH 4L4TB 1OT1A 4P48A 4PJGE 1CYGA 2MCG1 4YUEL 2J4WL 1F6AB 5HPOA 5MEPA 2ED7A 1EGJL 2QJDA 1UM6H 2YXFA 4JJHA 1F4AA 4BJLA 3KGRA 3VXMA 1T89C 1S5IL 2EIZB 3TEUA 4XXDA 3JV6B 3OB0K 5ANMB 2CLZB 4JLRB 4NO0D 4OJFH 4HIIA 1B6DA 3UJTL 3MR9A 4U7SA 1UEYA 5H2BB 5FCUL 1S9WA 3UTTB 4QHNB 5DZNA 3ZL4L 4N0YL 3W11D 1S7WA 1OQXA 1RURL 1M6OA 1J86A 4OT1L 3CH1A 3QEQB 4X9HA 5TGBA 5DXWA 1I4FA 5DMIH 3SE3C 1I3RA 5EIVA 5GGTA 3PWVA 2VDKL 3A6CL 5JW4N 3X11B 3QNYA 4HDIA 3TV3H 5B4MD 2MCPL 5FO8A 4JM2A 3RWFA 5HYJD 3TJHD 2XI9A 2VH5H 1DL7L 2XRAH 1TQBB 4P5TA 5FHAL 3DROB 4FTVE 4M5ZL 5DD5H 4Y5XC 4EKXA 1AR1D 1JN6A 5IMOA 3G04B 3K4AA 1GC1L 3BAEH 2BRRL 3ZT7A 4WWKC 1HILB 3OKNA 3WNKA 3G6JE 3IDXH 4N1EA 3WNOA 1ADQA 5HDQL 4JHWL 1G7QB 1A6TB 3UMTA 4GMSH 5D8JL 3V6FB 3FFDA 2BVTA 5F7FA 5BVPH 1JV5A 4S1SL 1DBML 3U46B 1M7XA 5K59F 4ZD3L 3QCVL 4UINL 3TT3L 1NGZA 2DQHL 2O5XH 4LLVB 1FP5A 3BEWB 4NBYB 3AM8A 5E6ZA 2VXTL 3RKDD 5C09A 1NUFA 4JFFD 3G9VA 3VWKC 2HFFB 1R5WA 4JG1L 3QUXD 1NC2A 5L2KA 2ERJC 1RZGB 1S7VA 1F3JB 5H94A 1CLYH 4G6AC 1I7ZA 3W0WE 1HINL 4YHPA 3SDDD 5HYSG 1P6AB 1NAMB 3G6AB 4QOKA 4YDIL 5CWSA 2LTQC 2FB4L 3HZVB 5I8OL 5F1OB 1OD9A 1YMMA 2OSLB 4CVZA 2LE9A 4LPWA 1VCAA 4J23A 1U8IB 1TJGH 4Q9QH 3B2VH 1NLBL 1CFTA 3QUYB 5DUMH 3WDHA 4HIJA 3FQNB 2VLRB 4D0CB 4ZFGH 1Q1JL 2HKFL 2KPNA 1WITA 1MCSA 2UZIH 3JTTB 4K3HA 3BDBA 2A38A 3QR2A 4TUJA 1P84K 1NQBA 3O9WD 2Q8BL 2R4SL 3HI5L 1A5FH 2WAHA 1KLGA 5J89A 1Y0LB 1I3UA 3ULVH 2BSRA 5AYUH 5GIRB 1DTUA 3HLAB 4ZAKB 3S35H 4BZ2H 1BBDH 2FBJH 1OAQH 1PGRB 3HC3L 1RK1A 2EDYA 5HHOD 5FA3A 5BRZE 1UH2A 4WI4A 4LCYA 5FHBH 3K8KA 2ICWI 3AC0A 3GMPB 5IMKA 3H9SD 5BQ7A 1JGDA 4L8BA 5T3XE 2R56L 2N4IA 1KBGH 3U48A 5I8CB 1AGDA 4MD0A 4ISVA 1YEDA 3RKPA 3DO7B 1T5WA 4EIZC 4Z7VA 1BM3L 4J4PA 2C1OA 2VZVA 3V95A 1T21B 5F70A 1J0KA 4L5FL 1N6QL 4Y2DA 5T3ZL 1QSFB 1I1AB 3D85B 1FN4A 1H3PH 1JMXA 3QUMB 1T7WA 3FRUA 1QSVA 4OZHE 1DVFA 3DOSA 1RULH 3TN0C 2APVA 3GSNH 4IRSD 4YDKH 1P6FA 1W0WB 3UBXB 5LWYL 5CAYB 1TVBA 1J1PH 1XT5A 2O5ZH 2WBKA 3WXWH 4PTUA 3HS0B 3OGOE 3EYQC 5FCSH 5I1LB 4YO0A 2JELH 2Q8AH 2A2QT 4KMLB 3GO1L 1MAMH 4FQ2L 5K59E 3SJVD 1OSPL 1E27B 2BVYA 5GGQL 4TTGA 2VR4A 4X7TA 1X5FA 2V7NA 4MNQA 4ZODA 4PB0H 1J5OH 3BIBX 3G6DL 5EU7E 3PXJA 4P57B 3VFPB 1FYTB 5EFIB 5JQ6H 4JE4B 5FUCE 3N1GC 4FQIH 3W9DB 3HCVB 2HG5A 2DQFB 4HKXB 3IAGC 4RA0C 4NZUH 2VXSH 2YSSB 1U8HA 1X7QB 3X14A 2CDGA 2X1OA 4OF3A 3C60B 4N9GA 4ZXBD 1S7SB 1F2XK 1ZA6A 4UUJB 3U2SA 1H15A 2QHRH 3A67L 1N8ZA 2B5IC 4XVTL 3EOTH 1UM4H 1DQJB 1U3HC 3FONA 5TE4H 2P46B 1VADA 3SKNA 5MEQB 2JLLA 3K7UA 2FD6H 4KY1H 5FUZH 5DRXB 2XA8H 2AJVL 1BIIB 3HC4L 3ROOA 4QTIH 1KF9B 1FIGL 1VACA 2V9RA 3O8XB 3CNKA 4JFXB 1E4JA 3JWDH 4RFNC 3U36B 1VSCA 4G8FA 4L4TD 4ZS6C 2XA3A 3GMMB 2B2XH 2FGZA 5I8KL 1LDPL 1I85C 1Z3GH 1S7UB 2D7PA 1U8QB 3BQUB 3RVTD 3QUZA 3RTQA 2GITB 4AZ8A 5E2VH 5FUOH 3UPAA 1JCKA 3KJ4C 1HIML 3OZ9L 4AL8H 4KKBD 1W0VA 1FVEA 1V7NL 1U8KA 3UTTD 1MCEA 1TMCB 1FC1A 3MNVA 5HGHB 2I60H 1UZ8B 1FNLA 3LMJH 3SE4C 5K9OA 3QEQD 1TQCC 1XF4A 3KPNB 4KK6C 1LK2B 2W59A 1KEGL 3FOMA 5ID1A 2WANA 4JFPB 4JM4L 3S5LB 1RJCA 1M05A 5IBLC 1KIPA 1NPUA 5ADPL 3MRPB 3RWDA 3L3DB 2NY6B 5DRZA 3GRWH 3KPOB 2WIIA 3WIIH 1I9RH 3NGBC 4DGIH 4NN5C 1I7TB 3V6BR 3UEZA 4L3CB 2CKBH 3RGHA 2ARWA 4XC1L 1SYSB 3M1BB 5EZIH 1EEQA 1H3TA 4JVUA 3JV4B 5IQ9B 1ZGLA 1QHOA 3KAAA 5DK2A 1XGQB 4R4FH 1I7UA 1UFUA 5JDSA 1U8JA 5IEKA 4QHLB 4BYHA 2GUOA 5ICXA 3MOQA 4U6VH 1FBIL 5CLTA 1CLOH 4I2XB 3WL9A 3ARSA 2AXJA 4GRLB 4KZEH 4U3HA 4XWOD 4DW2L 4RMVA 2V17L 1WV7T 3IFPB 5ITFA 4F7PA 3TO4B 2BZDA 1SM3L 4GMTL 3SOBL 2Y72A 4M4PA 4PB9H 4M1DH 4X7DC 3TBYA 2DYPD 2PO6B 4CJ1A 4GAYB 4M9OA 3AM8C 3PIQB 4XPFL 3S34L 3EYSL 5JLZB 3U82B 1RVFH 5SWZE 4EVNA 4FQXB 1K8IA 4OZ4A 4RMUA 3TZVB 3BEVB 3GK8H 3WJLA 1KXTB 4J6RL 1I8MB 4NO2B 1U0QA 3QO1A 1RV6X 3HI1B 1MVUB 1CGTA 1RQ5A 3SDXA 3SKOA 3AS0A 5GGVY 3MV9B 3CVIL 2PYEA 2BNQE 4UIMB 1WWWX 5D1QD 5KZCB 2P24A 4ZO6A 3K74B 3WFCL 3FZUC 3ESUF 3FQXA 2LVEA 3ILQD 3WDIA 3CD4A 4HF5L 1MRDL 3DIFA 5F9WB 4NFDA 3QIWD 5D1ZA 3ULUF 3DBXB 4JDTH 4LSTL 4MNGA 2FX9H 3CMGA 1MI5E 1YEIL 4QXGL 5I19L 4GBXC 4F8QA 1OGAE 4FABL 3BWAA 2DBLH 1BD2D 3UPRA 4ZAKD 1IAIL 3LS4H 2HTKC 1RIHL 2EH7H 3EYOA 1QSEE 4BSWB 5CHNA 4MA8H 5D7KD 4Y8AA 2DM3A 4XC3L 2PW2A 3NH7L 1ZEAL 1FAKT 2GKIA 1KCVH 4U1KB 1R6VA 1Z6JT 2YD9A 3CMOH 3EOBB 4MCZB 4TVPD 4GLRH 1KJMB 4J4PC 2W1NA 3NTCL 3FFCD 4OLVL 5DDHB 3NABL 4YEEA 5E8EB 2AI0L 4MVBD 3RY4A 1MHEA 1PVHA 4KHXL 3AREA 3D0LA 4LSVL 3C8DA 1EXUA 5LVEA 1QYGL 3WUWA 1KTDB 4UT9H 5DC9B 3F5WB 3BP7A 3ESVF 4ZPTA 1DVFC 4H26A 1AGBA 4ZUWA 3FB8A 4XNXL 1Q0XH 1JPFA 2XV6B 3IAQA 4PY7B 1I1FB 3LKPB 2XWBB 2QQKH 1FSKC 3K3QA 4JG0H 5I74C 3UCRA 1G7JB 1BOYA 5GXBB 3QJHB 2GCYB 3VXRE 3I2CL 3EFFB 2ZSVA 5EBWB 3QDJA 4GW5A 1LP9A 3KXFA 2GI7A 4LSSL 1SVCP 5D7IA 1RK0A 3BH9B 1JGUH 3MJ9A 1HHGB 4WI7A 1ZVHA 4OM1L 3V0WL 3O3BA 4OGZA 2BSTA 5I9QC 1ZT1A 4UIKH 1FL5B 4G43A 5MHSE 3GJEB 1R5IB 4O00A 5TH2B 3Q6FB 1WFTA 2X4PA 4JAMB 4ODWA 1BFOA 1AGEB 5C0FA 5F9AC 3MJ7B 4DZ8A 4GKOA 4JRYB 4G8IB 3C8HA 4LSRH 4U05A 4Q9CA 3TBVA 1QD0A 1KCLA 4M48L 2DD8H 4EN3B 2AJUL 3IETB 4ZOCA 4OCRL 4JM2D 3RZCA 1N26A 35C8L 4HJ0D 2FEEL 1E4WH 4PJCE 3TA3A 3KLDA 1GC1C 4P5TD 1MFCH 1C5BH 4JQXC 1Q72L 1OF2A 4B5EA 5F93C 4TNVK 1KPUB 1ITBB 3UTZB 4OB5L 2AJXL 4JQVC 1HHJB 3R06B 4Z7NF 1UJ3A 4N0CC 3U7AA 3K8MA 5F7EH 1WFNA 3U6RB 1OP3K 4ZNEA 4TSAL 3H9HA 1JVKA 3P0YL 2HRPH 5D93B 4QRQB 1AD9B 1ED3B 4X5XB 4XNZB 3EYUL 2P42B 2YD7A 5LXGH 3OXRA 5C09D 3SGKA 4XZUA 1YECL 3CSYB 1Z5LA 4LPXA 2DMBA 5CUSL 1NC2D 5L2KD 4C83B 2VTFA 5I1GH 3KPLA 4WWID 4FG6C 1Q9LB 4E42A 2F54E 2AJYL 4PJFB 1JK8B 3I6KB 1VFMA 4NYLA 4RA3A 5KVDH 2RFXA 4NIKB 4QOKD 4YPGB 4PGCA 1KIRA 1W72B 1S3KL 3JVGC 4M7LT 3OX8B 4M1CC 1B4JL 3VD3A 1YMMD 1A3RH 3LH2L 1MPAL 3GJFH 4GG6B 1PYWB 5TPWL 3TC9A 1YEGL 3KDMB 2O5YH 3WO4C 1W0YT 2NY6D 1BP3B 3BPNB 1U58B 3VXNB 2CIIB 1JF1A 4JVPA 1R3KA 4HAFA 2YXMA 3ZHDA 4YHML 2GT9A 4ODVL 2CXKA 5E56A 5T33H 5JO5B 4LCWB 1MRCH 4LOUD 1QP1A 3MGTA 4AIXA 3MA9H 5C70A 3WFEH 4LAQL 3HN3A 3UX9B 3OGCA 2BJMH 4ZSOE 4DKEH 5A43C 4KU1A 4B50A 1Q9OA 1YC7A 3KYOA 5E94B 4CMMB 4XP6H 3RWHA 4E41E 4NQDE 4EDXA 3ARDB 4MXVE 5CBAA 3EOYG 2JK5A 1T5XA 5C9JB 5JNYB 3MRLB 5F1KC 3TO4D 3G5VA 4LPYA 43C9B 4HW6A 4OD3L 4DVBB 2F8OA 5B3JE 2DM7A 2PO6D 4K94H 1CE6B 3C09B 1EBPA 4P2RA 4JFEB 1NGQH 4Y2DD 5JW5B 3OXSB 4YXKH 2MPAL 2Z31C 4FQXD 4K3EL 3RVUD 1DQQB 4OGYH 5HJ3A 3EHBC 3GMLB 4FP8L 1JNJA 3VD4A 4L8SA 3HNSH 2MHAB 4G9FB 2DS4A 3S98A 3T0DA 3IKCB 4YHZH 2FYYA 4L4VB 1QRKA 3TVMA 4IRJB 2R29L 3QEUB 4Z7NE 2VDLH 3S4SG 5KZCD 2EDTA 1INDL 3RY5A 2PYFA 5K9QI 3LKOB 3BPLB 2VQ1A 4WFFE 3BH8B 2Z93B 4Y2OA 2ZPKH 2IFFH 3O45A 5SWSA 2A74B 4PRHE 2R0ZH 3QXWA 1R0AL 4D3CH 4OBRA 3VFGH 3PWJA 4MDIA 5DLMH 2AV7A 4YLQT 4WHYH 3ROLB 2BHUA 4AEHL 3UAJD 5GISH 4YHYB 4AMKH 4BH8B 3MRCA 2VLKB 3ZTNL 3UROR 2VERN 4OCYH 5FYLE 1NC4A 4NKDA 5EUOB 1JNHB 5CGMA 3TV3L 4TRPH 4HWBL 1NFDA 2EE6A 2F5BH 4EXKA 1A1MA 2ZCHL 1NFKA 2VH5L 1FQ9C 3HUJA 1NLDL 1Q8MA 2VLME 1HHHB 3U7WH 3M17B 1EHAA 2NY2B 4IDJL 5L9DL 3IB4A 4I8DA 1JWSB 3BP4A 2XIDA 3IDXL 1D9KA 1YQVH 3ZKSD 5FGRA 4NQXB 1DFBH 3MO1A 4GMSL 4S1DD 5JPMB 4RAUB 5TDPB 4UZGA 4HWUA 2PXYB 4LVEA 3GB7B 3UXFA 4YBQD 4TN9A 2ICEA 3QEHA 3AREC 1OAZL 3WXVH 4OLWH 1X5IA 4NT6A 3T2NH 5C07B 4ELMA 3QXTA 2BC4A 4NGHH 5I1IH 4FN0A 3HRZB 4HWNA 5IBTL 5AEAA 5FO7A 3VXOA 4EDWH 5GS0D 1BVZA 5JPNB 1FFPA 1WTLA 4OQTH 5DK0A 3T4AA 3QUZD 3RTQD 3G5ZA 3LKNA 5BZDA 1TZHB 2X10A 3UYRL 2X4RA 5DD1H 1LO2L 3UP1A 5FYJL 1NGYA 5DHXB 2FECL 3E3QE 3U30B 5LGHL 3BKCH 5KSUA 1HKFA 2J8OA 1BAFH 5INDA 4Q6YA 5SWQB 1MEXH 1TJGL 2OTUA 3Q5OA 4IMKC 3L5WA 3TBSB 1QFHA 3CCHA 2AS5M 3I02B 1D5IL 3F12A 2DQCH 3QNXB 4H1LH 4PJ7B 1U8LB 5C1MB 2J6EA 5D2LF 5I1JL 3ULUH 1GAFH 4RZCB 4K7PX 1R24A 4OZFA 1P9MA 3OJDB 2Q86A 2OK0L 4Y4KB 4QF1A 4MJIB 3ZTJG 2D03L 3S35L 4DVRH 2FBJL 1OAQL 1ZHBB 3T1WA 3WFZA 3MV11 5C6TH 3IJSA 3PABB 1H5BA 1G9NH 4NPYB 1AXTH 4LDOB 1S7TB 3P9WB 4EI5A 1MFBH 2DL9A 1P7KB 2R15A 1F58L 3BKMH 2ENSA 2O93L 5HI5C 5KVMC 1EFXB 2LU7A 3F7YB 4NM4H 2W91A 4NC2B 1IM3B 5IHZA 3BW9B 4P3CH 4XHJC 2B0SL 4R8WL 4WDIB 2AJ3B 4HBCH 4NOFA 5TE7H 3BGFB 5FGCB 2QV2A 5DVNA 1L6ZA 1X5LA 5FKAA 1QFUL 4LVOC 4M6MH 2B4CH 5DJYA 3RX8A 3BN9C 1EPFA 1F3DH 5GPRA 2GQHA 4S0SD 1C16B 2KKQA 5BZWA 3X13B 4K7FA 5C0NC 4P46C 2C3VA 1TJHL 1J1PL 2O5ZL 5JOFA 1LEKB 3R1GL 2IWGA 4POUB 5HHPA 4Y4FA 2OS7A 4IIQA 4NN6C 3E6HB 4PREB 3SE9H 5HYIA 3S8WA 5D1XB 4RRPG 1MNUH 3KYNA 1HEZB 2WINB 4UQ2B 4WIQA 4AEIL 4JFHD 1DEEB 2E27H 2FX7L 1IEHA 3PWLA 2H9GA 2ZG1A 1B3JA 1IEBA 3O2DL 1NBZA 1XF2B 2XTLA 1FCGA 1J8HA 4PB0L 5D1ZD 3L95B 4HPYH 3MCKA 1A3LH 4CNIA 4I3RL 4GG8B 5JQ6L 1GGTA 3L5HA 3O6LH 4MNHA 4D2NA 5BMFL 3GHBL 2BVQA 3OHXA 5CEXA 1K5NB 5ID0B 4HEME 4L9LA 4HWBA 1Z0NA 3R8QA 4BKLA 3LQMA 4LF3B 2VJXA 4AM0A 4NZUL 5E99H 2VXSL 1KNOA 4A6YH 1X3DA 4HJJL 4Z77B 5EWIH 1KFAH 3VH8B 3MLYL 1T20B 4OZGF 5JHDB 4YWGH 3EOTL 2YPLE 1A6VH 3SDAA 1T1WB 3P4MB 5TE4L 3SPVB 1T0MA 5F89B 4L3EE 4FXKA 3VMPA 5FUZL 2XA8L 5D2LE 4YZFE 1J10A 4Q97A 1KLUA 4QRRB 5IJVB 3QZWG 3RNKB 1TTUA 1Q9WB 1A0QH 3B9VA 4KUCD 4M7ZB 2JJTA 4DOHB 1UKQA 4PJXA 1BLNB 1XAUA 1P1ZA 4PP2A 1LILA 1SMAA 4WW1B 2NY4D 4YIQA 3D9AH 4LLUA 3U0TB 5CZVH 1ZHNA 2HJLA 1L0QA 2AKRB 1FL3B 2H26B 1UM5H 1G9EA 2HLAA 4CADB 2OR9L 3QHZH 4P5MA 4G6KL 3FB6B 3WN5B 4N1HB 1DE4A 5DMKA 3U7YL 1ETZB 3RDTB 3T3MF 1U41A 1RFDL 4OBSA 3I6GA 1DCLA 1KJ2B 5I1DA 3N0PB 2C3GA 3BPOC 3JWNC 1S9YA 3KXFD 4QHKI 5D70H 5I30H 4D0BA 3GKWH 2BNRA 4LHQB 1YNLH 2I60L 4OV5A 4PRIE 4WFGD 1FORH 4ZUTB 2CMRH 4F7EA 4AJ0A 1J05A 4XAKD 3PHSA 3FJTA 2X4SA 3RNQB 4JDZB 2YEZA 4OD2B 1G7MB 4PJ8A 4NQCB 4HKZB 2IG2L 5I1KH 3MRDA 2FATH 3CXDH 3QPQC 2VE6B 2AXFB 2DN7A 3WIIL 1I9RL 5BS0B 4CDGC 2OR7A 5I76B 1GPOH 5E2WH 3RZCD 2GJ6B 3O11B 2EC8A 2CKBL 1WBXA 4RQQA 4J12A 5EO0B 3TA3D 3MV7E 5GRVL 4JHZA 4NJAL 3VGEA 2V7HA 2XY1A 4PRPE 1T22B 4NBXB 4R4FL 5I8EA 4U1IB 3LSOB 2AEPH 3O3DB 1RUMH 3O3EA 4IHOB 4NWTH 4YE4H 5HYSA 1D9KC 2BVEA 2WMPA 2EZ0D 1CLOL 4LCIH 2ZCLH 3NCCB 1N5YL 2D0HA 2WUBH 4KJYB 4DUWA 2AK4B 1G7IA 4O58L 5I66B 2Z4QA 2FZ3A 4Q74A 4Z7UA 5DEZA 5JIKA 1ITCA 1JBJA 1WUNT 4KC3B 4I18A 2A6JA 5D9SA 5D2NE 4P23C 4PB9L 4V1DB 4NZDA 5MERA 4GAFB 1VFAB 4PFEA 1RVFL 1NBYB 4PLJC 1N3NA 5C0GA 3GEWB 1QLFB 1TFHA 1AO7E 3MYJB 4OZGE 1UENA 2YC1A 3P4LA 2XXMB 2OYPA 4Y5XB 5HI4D 1QR4A 1KSRA 4WI9A 4N8PA 4OFPA 2A6IA 2P5WB 5B39G 3O2DA 5CMAA 5HHXL 3L3HB 3KPRA 3RWJA 2VDOL 3DJ9A 4WU5A 1EAJA 3PQYE 5D7JB 4G6ML 5FO9A 3MGOB 4XNMB 1T6WA 3B9KA 4WUKL 1HH9A 1FNFA 4GT7A 4H88H 3QULA 4U31A 4X9IA 2R0KH 2ZJSL 5TDNB 1SJEA 2NY3D 3BD4A 1S7RB 2XXCB 4JFDE 1IKNA 5D7LB 1F5WA 3IDNA 4U1LA 3BJLA 5GHWL 2G60H 1HNFA 5E9DE 3VWKB 3ALPA 4ZTPH 5BXFA 2EH7L 2W60A 2HFGL 2ERJB 3DMMA 5IVZB 4JZOB 2XFXA 4HK3J 4PG9A 1G84A 2WZPD 1LE9A 2AJSH 1XCTB 3PWPB 1INEH 3QXVA 4LKCA 4A2MA 3V4PH 3IVKB 1I8IB 4GO6B 2ZG2A 5DHVA 2MKLC 3HFML 1KCVL 1FDLL 5FA4A 1K4CA 5I16A 4RX4D 5DO2C 3WIHH 4M7JH 1NFIB 2V2XA 4ODTH 4P2RD 2DTMH 4QCIB 5E24E 2FR4B 5CIPA 4WTWA 2FRGP 5C0AE 5CBEB 1FNSH 3GHEL 3STLB 4H0HB 1I8LC 3K46A 3FQWA 5DA4A 5JIHA 2QADD 2C26A 2E9BA 3KPMA 1CS6A 5ESQB 2J8UE 3DHJA 2GJJA 3RA7L 1Q0XL 5C0BE 4OIIL 3IFOB 2VABB 3DX9A 4Y4HA 5AG9A 2VB5A 3V7AG 3HZMA 1S78C 5D1XD 1NCWH 2GIYA 4RCAA 2QQKL 2BVOB 3QQ9D 5L0QC 1IAKB 2Y6SD 3MLPA 4OIBA 4IOSD 4Y4FC 4IIQC 2H2PD 3NA9H 4EUPH 1OAXL 3SE8H 4EBQH 4QXTB 4JRXA 5EPMB 5SWSD 5B3NA 4OLXH 3WKMH 3MJ8B 3RWEA 3TO2B 3OAYK 2CK0L 2PN5A 2VR9A 4OCNC 1FAIH 2NZ9C 2VL5A 5ILTL 4GKSB 3V0AC 1M71B 3G6JA 1F4WL 3DX6B 4Y1AB 3AAZA 4LSRL 3GMOB 3LVEA 4OAWB 4Y88A 1WLHA 3FO9A 2G75B 4MS8C 4CAGA 2BK8A 4L9LC 2UYLA 5CZXD 3VFSB 5IG7B 2QSVA 1MF2H 4KFZC 1CFVH 2CUMA 1NC4D 2J7LA 4M43L 3RIFF 1AY1H 1BQHG 3VFNB 2GFBB 3H9YA 1E4WL 3CGTA 3K4DA 1HXYB 3L7FB 3OKKA 4LRIA 4P2OB 2R2BA 1V8HA 3BP5B 2MOVA 4M4RA 1NCCL 4XH2A 1S7QB 5J6HA 5HYJE 3CU1A 2R69H 4HUXB 4JJ5B 1E6OH 1F90L 3HR5A 2RAMA 1GZQA 5F7WC 4POZC 4M8QB 1NKRA 1P2CA 4U7MA 1ZA3B 1D3CA 2GY7B 5KSBB 4ODXA 4DEPC 2BY2A 4NQEA 4F37K 1VHPA 5IIEB 3LS5L 4LSDA 3HTLX 1ZLSL 3O6KH 4LCUB 1NCUA 1JNNH 5TDOB 4XBPA 5LXGL 4HUUA 3X3FL 3ZE0F 4M6OL 1WIOA 1JFQH 4LCCA 2ADFH 3D2UA 1BJ1H 3FN0H 1EERB 3ARFB 2IF7A 5ESVA 3RDTD 2D7TL 4R6UA 2XZAH 4R0LA 5CEYB 4DUXA 4N5EC 1OP5K 1MCOH 2GAZB 3KYMB 3D39B 3LEYH 2W9LA 5I1GL 4RWYL 1BZ7A 2P8MA 2DQUH 1UZ6E 1U3HB 4HIEB 4H8WH 2FBOJ 4HQQH 5HBBA 1BFTA 4JFFE 4I48A 3IAPA 4Z7WB 4WO4C 1QA9A 4R96B 1GGCH 4JFOA 3DUHA 3GI9H 1IT9H 3FHQA 5BRZA 5ACZA 5F1NB 5LG1A 4ZFFB 4RFNB 2X4QB 3CFJA 4X6DE 2P5EB 5CP3H 4N1CA 2HWZL 4QRSA 3VW3L 4J3OC 1TETH 3GMRA 3UC0H 4JHBA 1IC7H 4PJ8C 3ULVC 2JJSC 4NJ9H 1D5BA 1MRCL 4NQVA 4HUNB 2J1KA 4JZJC 1UVQB 3H42L 3KJ4B 1P4IH 3MA9L 4HKJA 3GBNH 5D6DA 4Q9RH 5KS9B 3DRTB 2NR6D 1CG9A 4Z0XB 1OM3L 1JWMA 1K8DA 4OZHA 5EU3B 1XGTB 1UQSA 3MR9B 3LN4A 3INUL 4XP6L 4JFQB 3SCMB 4R97C 5KVEH 1TQCB 4EI5D 1FO0H 3GM0A 5HHQB 4Y7MA 1YEFH 5HHOE 2QKIB 3WSQH 1VFBB 1LEIB 3RUGF 1AGCA 1DANU 1I3RB 1FNGB 4XNQA 4I18C 3K1DA 2UY7A 3SO5A 1KTRL 3RGVA 2E9JA 1YDPA 3E0GA 3PGFL 4OGYL 2I25N 3OKOB 2XZQH 4K07A 3NGBB 5T1LB 1I9EA 1KN2H 1C1EH 5A40E 5J6GB 4KJPC 4MJ6A 4YHZL 5KSVA 2HP4A 5EU6D 2A73A 3VFWA 2P5WD 1CR9H 2ZOLA 4U1GB 2IFGA 4HH9A 1SJHA 4MSWB 4OFYA 4LU5H 2APBA 5D7JD 3QXAB 4ZPVB 2XZCH 5DMYA 5K9JH 3MBEC 1WSST 4QY8A 1QFWH 1CICA 1G9MH 7FABL 2OQJA 4PIRF 4M1GH 4JPWH 1J8HD 4D3CL 1JYNA 3QCTH 3ZE0E 3HAEB 4W6WB 1SYVB 3VFGL 5DLML 3TFKD 3C2AH 2BVPB 4WI5A 2YN5A 3KLHD 5GISL 4AMKL 2ZNWA 1YEKL 5EC2A 3WFDL 1OW0C 1BF2A 4ALAL 5E7BA 2VISB 3L3OA 3QO0A 4NKMA 1OAUH 4TRPL 1BMGA 3NCFB 5EN2B 3NFPB 5D5MF 2F5BL 1MHPH 3GBLA 3GSOA 5EA0L 4OV6F 5FEBA 3LEVL 3T4YA 3I75B 3JUZA 3QIUA 3SDAD 1NCAH 3MA7B 3NZ8A 1FPTH 3REWB 5GSVA 5BVJA 2EDFA 3GMNB 1IBGL 2I5YL 2I9LB 5CD3A 1QVOA 4GBXB 2AXHA 2GTZB 1YY8B 3TNMB 1KPRA 4OCLC 3TYFA 4BH7B 1T7VA 2D7OA 4OLWL 5HXMA 2VZUA 4ZUUA 5IB2B 2O61A 4JCLA 2VXUH 4NGHL 5I1IL 5CGTA 2H2SD 3H0TA 1UCBL 4QGYA 4S1QH 4L4TE 4XVJH 4B7LA 1NUGA 3LKSA 3P2TA 4AT6A 4WHTA 2CLRB 2Q7YA 5BQ7B 4GAJL 1ND0A 4RGNC 1FZMA 1DUYB 4KZDH 1DN0B 4N8VG 1MJUH 1ZTXH 3RUGE 2HLFD 5B8CA 1OTUC 5FXCH 2BNRD 3CFBB 1BAFL 1AFVL 4QRTB 1WBYA 1DANT