4BEPA

Crystal structure of the legionella pneumophila fic domain-containing effector ankx protein (apo-form)
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
478
structure length
478
Chain Sequence
MPNLPGLYFLQAYPSEEIWRLFVDGRFWSKENGWRGYESREPGCLNAALESLCSIALQVEKSGEEFELSVDLIKRIHKKCGKKVEELQEKNPGELRTDEPVSFGIPAGRASIKGIEEFLSLVFLTEGGAEFGPGKAGPFGPRFDKNYFKNLNPEQIPDLAKQIYFDMCKYGHSNTNHFYLAVMKNVDVYLEKITQSYNKEIKTAETLDEKLKIIVKHIRMYEVLHPFRDANGRTFVNNLLNIPLMQQGLPPATFYEPNVFDLYSAEELVVVVKEAIFNTVEIIEQSKRKTPITLYGYHSSLEEQTKFRDMLDSPSYEKIKHMDFSDLNPEKLHLKTQKCLSSLNEQYPLHRGAIYLSDPGEIKLLLSNRNESQINQQIEQGAPPIYVGKTPAHLAVISGNMAMLDELIAKKADLSLQDYDGKTALHYAAECGNMQIMGKILKVVLSQEDAIKVLNIKDNHGKTAFHYAAEFGTPELIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Legionella Effector Ankx Reveals the Mechanism of Phosphocholine Transfer by the Fic Domain.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Transferase
molecule keywords PHOSPHOCHOLINE TRANSFERASE ANKX
total genus 150
structure length 478
sequence length 478
chains with identical sequence B
ec nomenclature ec 2.7.1.-:
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4bepA02
5EN5D 4LNUD 3TWXA 3ZNGA 1MJ0A 4LG6A 4BETA 2KXPC 1WG0A 2L6BA 2QYJA 5ENPD 1IXVA 2DVWA 1NFIE 4BSZB 4G8KA 3TWSA 5CEAA 1MYOA 2HE0A 4DX6D 5JMND 1AWCB 3NBNB 5ENSD 2RFMA 5CBOA 1S70B 5EILA 2Y1LE 1QYMA 5AQ9A 1SW6A 1BD8A 2XZDG 3AJIA 4K5BA 5CERB 5KNHD 2F8YA 3T9KA 5KWDA 3EHQA 3W9GA 5ENRD 4BESA 3T8KA 4HLLA 5EIBE 4U95D 2F8XK 2V4HC 4HNAD 1AP7A 2DWZA 1BI7B 4U8YD 2NYJA 4CYMD 4U8VD 5CECB 4NIKA 3LJNA 3JUEA 3DEPA 5FINA 4CZ2D 5HRYA 4O1OA 4DX5D 3HRAA 5AAOA 5AQAA 3JXIA 5EYPF 4BEPA 4Z68A 2XEEA 3NOCD 1BU9A 4HRLA 2ETBA 2DZNA 1TR4A 2V5QC 3D9HA 4HRNA 3J5PA 5D66A 1K1BA 2BKGA 4DUIA 2DZOA 5HS0A 4BERA 1MX2A 2VGEA 4HI9A 3V2XA 5BXUA 3TWUA 2KBXA 3KEAA 3W9FA 1WDYA 4QFVA 3TWVA 1IHBA 4HBDA 4J7WA 1D9SA 3UXGA 2B0OE 3EU9A 2ZGDA 4DRXE 1K3ZD 2FO1E 4A63B 1YYHA 1OT8A 3B95A 4K5CA 5AARA 3AAAC 4O1PA 4K5AB 2XENA 2AJAA 3JXJA 3J5QB 5ENTD 5EYLA 1MX4A 4HB5A 4DX1A 1OY3D 2ETAA 4UUCA 2Y0BG 3IXEA 4B93B 4G8LA 4TUMA 5HKPA 5JA4D 2ETCA 3V79K 1YCSB 1N0QA 1BLXB 4N5QA 5FIOA 4F6RD 3V31A 1G3NB 4ATZD 4GPMA 1N0RA 3F6QA 3TWTA 5KNGA 4HQDA 3UI2A 5AQ7A 4O60A 4ZHBA 1SVXA 2XZTG 2F37A 3TWRA 2JABA 4JB8P 5CEDB 3ZU7B 5ITZF 2BKKB 3EHRA 5ENQD 4C48B 2A5EA 4RLYA 2MYOA 2QC9A 3HG0D 3V2OA 4DX7D 3B7BA 4F1PA 1N11A 3NOGD 4HI8A 4YDWA 5BXOA 3Q9UC 4ZFHA 5KBAA 2J8SD 3TWWA 1K1AA 3C5RA 3V30A 3DEOA 5ENOD 2P2CP 2RFAA 5AN8A 3SO8A 3ZUVB 2ZGGA 1YMPA 1MX6A 1DC2A 4J8YA 5EIDA 1BI8B 4DX2A 1A5EA 5CBNA 3TWQA 3ZKJA 2XEHA 1UOHA 4OAUC 4YDYA 4GMRA 3Q9NC 1IKND 4QQIA 2PNNA 4OAVB 4HRMB 5AQBA 4U96D 3UTMA 1DCQA 4LSZE
chains in the Genus database with same CATH superfamily
4BT9A 1FT1A 1IXVA 1TJCA 4N39A 1NFIE 3AG2E 4BTBA 3MX3A 4GB9A 3I4GA 5ANLA 2GROB 1KPSB 2RFMA 3FHEA 2GRLA 1SW6A 5H7PA 1TN8A 2OOEA 5AYWD 4CDMA 3FH5A 5CMYA 4I6JA 4O1OA 1Z3YA 2YNQA 5AQAA 3EHNA 2XEEA 3S2AA 3AS8A 4XX5A 4JPSA 4AY6A 1WAO1 2DZOA 2AXVA 2J49A 4B8AA 2WXKA 3W9FA 2XGSA 4K0RA 3NZSA 4RG6A 2R59A 3Q15A 1SZAA 1YYHA 4F3VA 3L17A 5FT9A 1HE8A 3CHMA 3CGHA 3JXJA 4L7TA 4GTQA 3GZ2A 4N5CA 2BUGA 3T8MA 1BLXB 4PH4B 3DSUA 5AQ7A 1JPLA 4ZHBA 2F37A 4JZYA 5EX3A 4JHKA 2BKKB 2FEZA 2P9UG 2Q7FA 4G1TA 3T5XA 2XRYA 4GPKA 5ENOD 1O1SA 3G2UA 2QZAA 2VSXE 3BG1B 4TUUA 3C72A 4PS3A 5LCWC 2WXRA 3CHRA 1N95A 4BETA 2L6BA 2LSUA 1E7UA 4GTTA 4F7AA 1XGWA 4KXKB 1ELRA 4FHJA 3NBNB 4PUCA 1NA0A 3LY7A 3DXMG 4OYSA 4K5BA 3T9KA 2BTDA 2V4HC 4U8YD 2NYJA 4WAFA 1MQSA 4PS8A 2IU1A 5AENA 4GZDA 4I2WA 3DSSA 4URKA 1L5JA 4DRXE 5IY5E 3UIPC 3B13A 2YHCA 3I3NA 3FUJA 4FC8A 3ENEA 2I9CA 2C0MA 4ATZD 2LAHA 1X81A 2VQ2A 3F6QA 5KNGA 1Y8MA 2EIME 3OXFA 4ABNA 3CHSA 1QZ2A 4BSXA 2BF0X 3LXUX 4YVOA 1IQRA 3C5RA 4OVVA 5FQ6A 2WM9A 1FPPA 3CVLA 1E90A 4HS2A 4A55A 3CKBA 1OWMA 3BU8A 3FY4A 2P9PG 4AXHA 3L13A 4Q94A 4GCOA 5BW8C 1D8EA 4RG9A 2HE0A 3NZUA 5AJDA 3MGBA 4CGWA 2A5UA 3UKUG 4KBQA 2F8XK 4HNAD 1P5QA 1OCCE 3HXBA 4NIKA 1HO8A 1UJJA 3APDA 5C2YA 4L2LA 1H2UA 3RSEG 5HS0A 4BERA 3CV0A 1MZCA 3QDNA 1N52A 1HXIA 1S64A 2MHKA 4J8DA 1WDYA 2XPYA 2WXMA 5T8IA 2MOWA 3LPZA 1V54E 4JHRA 3LY9A 2LO6A 4B93B 3NAWA 3FUFA 2WPVA 4F6RD 4N5QA 5CCLA 3GZSA 4WNDA 3Q73A 4GPMA 4BX9A 2XZTG 1X5BA 3TWRA 4JB8P 3ZU7B 1ELWA 3OAWA 3B7BA 3CK7A 4GCNA 3FDHA 3OXGA 5B1AE 3TWWA 2PQNA 4I1MA 3E34A 3SBTB 1YMPA 4J8EA 3CVVA 4DPRA 1MX6A 1E8WA 2XEHA 3E32A 3QNKA 3PE4A 1KT1A 1LD7A 2P9IG 1IKND 3ABKE 5M72A 4J6IA 3S7JA 1DCQA 3PZ4A 1U2VG 4JEHA 1WG0A 4U63A 2X6FA 4A1SA 3B7RL 4DX6D 2ILRA 2I1KA 2WXNA 3ZFWA 3UKRG 3W9GA 2NSZA 4BESA 3APCA 5J90A 4CDNA 3FTVA 4ME2A 4BEPA 1A17A 2NXPA 4UI9K 3GW4A 1FCHA 3UX4A 4YDOA 4PS7A 3O4ZA 1K1BA 4DUIA 3MYVA 3HVEA 3UMVA 4KVOA 4EBAG 5C1DA 1U3DA 4JA9A 3UXGA 3TAXA 3QK0A 1EPUA 2B6CA 1OCRE 1OT8A 2AXUA 3MV3B 3MKQB 4IN3B 3EUVA 4GTOA 2ETAA 4G8LA 2J09A 3FUIA 2WXFA 2VSNA 3SZ7A 1TNZA 3Q7FA 1V55E 1OWLA 2QC9A 3K9IA 5KBAA 3ULEG 3KEZA 2RFAA 4I9CA 4TV3A 1JWGA 2R05A 2KM4A 1H6OA 2KZTB 4DLOA 3FP3A 5E76A 1EYHA 3MJWA 2XS1A 2IQCA 4HOUA 2HM8A 3ZHEA 4U07A 3ZYKA 5BNWA 1AWCB 3ASNE 3D9KA 3LVRE 2KCLA 3HHMA 3PEUB 5EIBE 4U95D 4FLHA 3AG4E 3CLJA 3RJVA 3TXNA 3APFA 1E8ZA 3AG3E 3FUNA 2DCPA 4JD2G 3HRAA 3JXIA 3CVUA 3DPDA 5CRVA 1MX2A 4FP7A 2X6IA 2KBXA 4I17A 4GYWA 4I2ZA 4J7WA 5DBKA 3ZYMA 3BUAA 2P9SG 4G24A 4K5CA 4APFA 2VTBB 3PDNA 3QWWA 1UW4B 5EYLA 3UM2A 1NA3A 2WXLA 4X8QA 1N4RA 3B7SA 3BEEA 3V31A 1G3NB 3MV2B 5KJLA 3JUIA 4HQDA 3MA5A 3Q4AB 1IQUA 3SQVA 3EHRA 4C48B 1N11A 4IYPA 4ZFHA 2XGOA 3LS8A 4KYOB 1FVHA 3BQOA 5HI7A 2P2CP 3D9MA 1QQEA 4GYYA 5ENNA 3FH8A 3U3WA 4MRUA 1UG3A 2IONA 3SD5A 4QQIA 1BPOA 2J4BA 2VGXB 3GYZA 3G2VA 5ENPD 2UY1B 5B1BE 4BSZB 4HOTA 4HOSA 3CEQA 3IHVA 4RQIA 2I2OA 5CERB 5E75A 4TXQA 4ACKA 3ML8A 1ZB1A 3RRUA 3DWLG 1OUVA 4AIFA 5A6CA 5G55A 1LF8A 4I1AA 4J0UA 4F53A 4MBGA 3SI5A 5D66A 2ZXWE 4IRUA 3U4TA 3C3QA 3CHQA 3C3OA 4I43A 4U0ZA 3SHFA 4M7CA 2OV8A 4O1PA 4ACLA 2OCCE 3R9AB 4CRWA 2WXHA 1H6PA 3CVNA 5BUZA 3U9WA 2OEVA 3PS6A 3ABLE 2XQ0A 3UUXA 4ILIA 2MRIA 1D8DA 2OEWA 1H2TC 2XEVA 3ZKJA 2J9QA 4LNGA 1KZPA 3KD7A 2FBNA 2XGMA 3PREA 4UQXA 2XS8A 1H2VC 1OXJA 2DVWA 3LY8A 3DSXA 3FH7A 4XI0A 3CVYA 2VJ8A 3SFXA 4JEUA 4FLBA 3IHYA 1H6KA 4JHJA 1S70B 3CSFA 3CK8A 3AU4A 1TN7A 3QKYA 4H7XA 3D9NA 5G05J 2Y4UA 1FVFA 1SA4A 4O6FA 2XPZA 3FEYA 4KMOA 4B8CB 4AV7A 2LXLA 3G2TA 3QB2A 5FTPA 3L6AA 3MZLB 2VGEA 3EHMA 4A1GA 3TWUA 1IHBA 1D9SA 4ATGA 3PUJA 4NQ0A 4W9RA 1HU3A 5ENTD 3DSTA 3FFLA 3PZDA 3S7DA 3QOUA 3IV0A 4J8FA 3DBSA 4GTPA 4MS6A 5FIOA 4YDEA 5CEDB 2F0YA 1Z3XA 4CT0A 3OTNA 2L9BA 4MKTA 1H19A 2YHEA 2IJGX 2WXGA 2I6HA 2R03A 3L82A 4AEZC 4GMRA 4KT6B 5D0OD 1XNFA 2OVBA 5JJ6A 3HDXA 4BY6A 4EQFA 5DIZA 4ANUA 4XEIG 3FTYA 3IEGA 4N3BA 3VLDA 3HIZA 2R17C 3NQPA 2HYZA 5JMND 2H6FA 3HXEA 2X38A 5ENRD 1ELKA 2J4DA 3LJ3A 1AP7A 4GMJA 4L23A 4C0EA 4AVXA 4XIFA 1HZ4A 3CVPA 1U3CA 4L9PA 2WXOA 3UT8A 1ZBPA 3CVWA 2EIJE 3AS5A 5FZRA 1KLXA 3PUKA 2P58C 3PNLB 4ILGA 4QFVA 1UJKA 1HFAA 2CHWA 4XI9A 3LDZA 1OWNA 3E37A 3J5QB 4DJAA 4CGVA 2AWIA 2Y0BG 4TUMA 1DCEA 4L2YA 3QJZA 5FQ4A 2L0IA 4C0MA 3PVLA 4U7EB 3ZHEB 3UI2A 2PM6A 1SA5A 4EPZA 4RLYA 4F1PA 5BXOA 2GRNB 1N4PA 3AU5A 2RG8A 4GZ3A 3PZ3A 2C2LA 3PZ2A 2IOSA 4BTAA 1PAQA 2XRZA 4ILHB 3FTSA 4LEUA 4U96D 4GMLA 2QYJA 4I6EA 2IO3C 2WXIA 2KCKA 3D9LA 4RSYA 1MYOA 2KC7A 4AP2A 1HG5A 4KZCA 1E7VA 2R5SA 3LCAA 2Y1LE 1TN6A 1BD8A 1Q2ZA 1KZOA 3FUHA 2EINE 1KT0A 3B7UX 3SY2A 2YINA 4U8VD 3LJNA 1RW2A 2OVFA 2GRPB 2DYSE 2ZISA 3ZN3A 5BPPA 4FJYA 5AIJA 2V5FA 3MCXA 1TNOA 3UM1A 1SQMA 3ASGA 2VYIA 3D9IA 3CQGB 5AARA 2AW6A 2RKKA 5CHEE 4HB5A 4DX1A 4GA1A 1WY6A 4R7LA 3DXKG 3KS2A 2LSVA 1O1TA 1N94A 5LP0A 1HH8A 4E85A 4M3OA 5BT1A 5LOZA 2ZIRA 3EU5A 2V0PA 3DSVA 5ITZF 2LXMA 5A23A 2XCCA 3E30A 4HI8A 4YDWA 3ISMC 3TG4A 3ZYQA 5AN8A 3N71A 3RO2A 3L16A 2A4ZA 3SFZA 1DC2A 4UWFA 2E0IA 1TNYA 2X3MA 4XKBA 3RIBA 1INZA 4B0ZA 3WG7E 2UY1A 2DBAA 3I4RB 3Q9NC 5ANRA 2KCVA 5AQBA 4GZ5A 3L08A 4LNUD 3TWXA 1Y6IA 5ARFA 4FA6A 2WXPA 2L0TB 3TWSA 4N3CA 3S7BA 4EZLA 2WMNA 2DYRE 4E6HA 2HR2A 5CBOA 5LFAA 2VGXA 4GTMA 3CVXA 2XZDG 5CCMA 2F8YA 5KWDA 4JL0A 4B94A 3VTYA 3JUEA 2YQ8A 2X6HA 3CQCB 4DX5D 5AAOA 3ASDA 2M63A 2J08A 1BU9A 1FT2A 4YNDA 4XE0A 1TR4A 3Q5MA 1JUQA 5BXUA 3Q47B 3ZVVA 4FULA 3FU0A 4DK5A 3T5VA 4U0SA 3ONKA 1OY3D 4UI9J 3IXEA 2ETCA 3DRAA 5KCMA 2VTBA 2WMOA 2P9KG 3Q49B 2UWJG 2MYOA 3HG0D 3B7TA 3ONLA 2Y3AA 3FU5A 4RVBA 4GZ6A 5JHBA 4UWGA 3UT4A 5LCWJ 4J8YA 5EIDA 1BI8B 4FADA 3FTXA 1N4SA 3TJPA 4CDRA 1JCQA 4GA2A 1S0PA 4YDYA 5BV1A 2WB2A 4LSZE 3RU0A 1LD8A 2R2LA 4H7YA 4G8KA 2PZIA 3RO3A 2DIWA 3Q78A 5KNHD 3SNXA 2J07A 2V4LA 5J08A 4HLLA 3R9MA 4XZ4A 3Q79A 4HFGA 5EDSA 3ML9A 4WWPA 3C98A 3AG1E 3EIJA 3FU3A 3AS4A 3ASHA 3D9HA 4GU5A 1TEZA 5ARGA 2LUHA 2GRRB 3FTUA 3TGOA 3HXCA 4V3IA 3RRMB 1E8XA 2Y4TA 4K5AB 3R7RA 3OXLA 5HKPA 3BG0B 3MEKA 5HQ8A 1UN8A 5EKQD 2JLBA 4O60A 4UI9C 1E96B 1SZ9A 2ONDA 2A5EA 4JC8A 3FULA 1B89A 2IFUA 1S63A 2ZGGA 5AJLA 4LRZA 4ANXA 4K03A 5CRUA 1Z6TA 3VLFA 1IHGA 4WWOA 3UM0A 3JCKC 1N9AA 3MKQA 3KSLA 3FU6A 2CG2A 2ZU6B 2PL2A 5EN5D 2JEKA 1UN9A 3ASFA 2FULA 3L54A 4OVUA 4UQYA 3IKOB 4TXPA 3MKRA 5FJYA 3E33A 3ESKA 5CEAA 5G04J 5EILA 2H6GA 1HG2A 3EHQA 3QAQA 3X2QE 4CEMA 2IOLA 1WM5A 5JJTA 4C9BB 2FF4A 4F1SA 5HRYA 4TXRA 5EYPF 4Z68A 3NOCD 4HRLA 2DZNA 3KAEA 2L6JA 1YA0A 4YVQC 2B0OE 2ZGDA 4JVSA 4WNEA 4MLPA 3Q75A 3AAAC 2I1JA 2IO2C 2R02A 1RZ4A 5JA4D 3SF4A 3E4BA 2WVIA 3LKUA 4Q96A 3EDTB 2IEJA 3SGHA 4FU3A 3FEXA 1NL4A 3TG5A 2QY7A 3CK9A 4GTVA 2J8SD 4XKCA 3NF1A 1K1AA 2VSYA 1TNUA 3FTZA 3PH0C 4DX2A 1A5EA 1DVPA 1UOHA 3QC1A 4UWKA 4EECA 4WNGA 4UWLA 4BFRA 3RK6A 3VLEA 3ZNGA 4AY5A 1MJ0A 5KJNA 3UINC 2XPIA 2EILE 1HS6A 2FO7A 3CIAA 3TL5A 1BI7B 4G2VA 5FQ8A 3DSWA 5CECB 3QARA 4ANWA 2WQ7A 3UM3A 1MHQA 4CZ2D 2GRQB 3RKVA 4L1BA 2ETBA 3J5PA 3UIOC 5KJKA 4HOQA 3ZYLA 4IULA 4N3AA 2P9NG 5JJ7A 4EZKA 3HXFA 1N54A 3V79K 4JA7A 1YCSB 4N2SA 2LNIA 3HVEB 3FUMA 4AM9A 3CR3A 3G2SA 1O1RA 1QBQA 5G2NA 4DLQA 3G2WA 3QWPA 3ZW3A 4DX7D 3FUDA 3Q9UC 3EJNA 2H6IA 1VDYA 3V30A 3DEOA 2AXZA 4GAAA 4EHMA 1OWOA 2WXJA 1IYGA 3CSTA 4DI4A 3RAUA 2HO1A 1H0AA 5FZQA 4OAVB 2PNNA 4A3VA 3RRNB 4G25A 1W3BA 3PZ1A 4I1OB 3D3MA 4LNBA 2EIKE 4GTRA 1NP7A 1K8KG 3ESLA 3R7QA 1TNBA 3AJIA 4GA0A 3UQ3A 3ZRHA 2CFZA 5T3RA 3DEPA 4UWHA 5A7DB 2H6HA 3WXXA 2Y69E 3IBEA 2VGYA 2V5QC 3URZA 3C3RA 2WQ6A 4HI9A 4KVMA 5JHAA 4HBDA 4WWNA 3KSQA 5FZSA 3FTWA 4JXTA 4KZ0A 3SFYA 2EQXA 3LEWA 2IY0C 5G04C 4UUCA 3D9PA 4BT8A 1QNFA 2QFCA 1N0RA 3L22A 3TWTA 4BX8A 1SVXA 3HXDA 3ULYA 2CG3A 2CFUA 3TXMA 3I5PA 1DNPA 3JQ0A 4HORA 4I6GA 3GZ1A 2P9LG 5CBNA 3SBSA 1OCZE 3CKCA 3CHOA 4HRMB 2IF4A 3UTMA 2KXPC 4G23A 4U0UA 5BV0A 5AQ9A 3PE3A 4B89A 1JCRA 3ZEFA 2WQHA 4LERA 2DWZA 4P29A 3LVQE 1NZNA 3LYAA 1E8YA 4NACA 1EDUA 3UPVA 3U64A 5EX0A 3JYSA 2CHXA 1Z5SC 2PM7A 3V2XA 1HF8A 3KEAA 3TWVA 3UT7A 2GGFA 4A63B 3CHPA 5CMWA 3Q7AA 2KZTA 5KJMA 2XENA 5D0QD 3PRZA 1O5MA 3D9JA 1MX4A 1PY1A 4G11A 3PEVB 3FWVA 4HVBA 2BEDA 4EZJA 4NURA 3O48A 2JABA 4J8SA 4G26A 4NRHB 2GRMA 4Y6WA 4AJWA 4WUYA 3ABME 1NI1A 2GW1A 3S7FA 3ASOE 3ZUVB 4PDXA 3SO8A 5LX8A 2E2EA 3TWQA 2PQRA 4GYOA 1HX8A 4LCTA 2KATA 4Q69A 3L9TA 4LG6A 3HYMB 2FI7A 4LUNU 4EBAA 2X6JA 2RD0A 2C0LA 4HXIA 3ZXSA 1TJFA 2V8SE 5ENSD 1N4QA 1OCOE 3NB2A 1QYMA 3U66A 4AOFA 5B3SE 3DPYA 1GW6A 4D10C 3T8KA 1EF1C 4CYMD 3ZIMA 3ZPJA 4JW1A 1LTXA 5D2MC 2VSOE 5FINA 2X6KA 3ZGQA 3D9OA 4I9EA 5FQ7A 4DI3A 4UQZA 2XHEA 2XCBA 4HRNA 2BKGA 3PNTB 2CHZA 2FO1E 3EU9A 4WNFA 1PC2A 1K3ZD 4ANVA 4CT4A 3B95A 3P1UA 3QWVA 2AJAA 1ZU2A 1JWFA 3P2BA 1TYQG 4FJZA 4FHKA 4CCAA 1N0QA 4U04A 2LAIA 2QYUA 3ZXPA 4U8HA 4BWRA 5ENQD 3V2OA 3NOGD 2AVPA 2NC9A 3EIQC 4Y6CA 4GTSA 1OWPA 3FUKA 3FUEA 3JQ1A 1JCSA 4GZCA 5T4YA 2WXQA 4OAUC 4TRQA 5FWQA 3VTXA 5G05C 4N2QA 3CVQA 4APOA 4A3TA 3ULQA 4HLEA
chains in the Genus database with same CATH topology
5EN5D 4LNUD 3TWXA 3ZNGA 1MJ0A 4LG6A 4BETA 2KXPC 1WG0A 2L6BA 2QYJA 5ENPD 1IXVA 2DVWA 1NFIE 4BSZB 4G8KA 3TWSA 5CEAA 1MYOA 2HE0A 4DX6D 5JMND 1AWCB 3NBNB 5ENSD 2RFMA 5CBOA 1S70B 5EILA 2Y1LE 1QYMA 5AQ9A 1SW6A 1BD8A 2XZDG 3AJIA 4K5BA 5CERB 5KNHD 2F8YA 3T9KA 5KWDA 3EHQA 3W9GA 5ENRD 4BESA 3T8KA 4HLLA 5EIBE 4U95D 2F8XK 2V4HC 4HNAD 1AP7A 2DWZA 1BI7B 4U8YD 2NYJA 4CYMD 4U8VD 5CECB 4NIKA 3LJNA 3JUEA 3DEPA 5FINA 4CZ2D 5HRYA 4O1OA 4DX5D 3HRAA 5AAOA 5AQAA 3JXIA 5EYPF 4BEPA 4Z68A 2XEEA 3NOCD 1BU9A 4HRLA 2ETBA 2DZNA 1TR4A 2V5QC 3D9HA 4HRNA 3J5PA 5D66A 1K1BA 2BKGA 4DUIA 2DZOA 5HS0A 4BERA 1MX2A 2VGEA 4HI9A 3V2XA 5BXUA 3TWUA 2KBXA 3KEAA 3W9FA 1WDYA 4QFVA 3TWVA 1IHBA 4HBDA 4J7WA 1D9SA 3UXGA 2B0OE 3EU9A 2ZGDA 4DRXE 1K3ZD 2FO1E 4A63B 1YYHA 1OT8A 3B95A 4K5CA 5AARA 3AAAC 4O1PA 4K5AB 2XENA 2AJAA 3JXJA 3J5QB 5ENTD 5EYLA 1MX4A 4HB5A 4DX1A 1OY3D 2ETAA 4UUCA 2Y0BG 3IXEA 4B93B 4G8LA 4TUMA 5HKPA 5JA4D 2ETCA 3V79K 1YCSB 1N0QA 1BLXB 4N5QA 5FIOA 4F6RD 3V31A 1G3NB 4ATZD 4GPMA 1N0RA 3F6QA 3TWTA 5KNGA 4HQDA 3UI2A 5AQ7A 4O60A 4ZHBA 1SVXA 2XZTG 2F37A 3TWRA 2JABA 4JB8P 5CEDB 3ZU7B 5ITZF 2BKKB 3EHRA 5ENQD 4C48B 2A5EA 4RLYA 2MYOA 2QC9A 3HG0D 3V2OA 4DX7D 3B7BA 4F1PA 1N11A 3NOGD 4HI8A 4YDWA 5BXOA 3Q9UC 4ZFHA 5KBAA 2J8SD 3TWWA 1K1AA 3C5RA 3V30A 3DEOA 5ENOD 2P2CP 2RFAA 5AN8A 3SO8A 3ZUVB 2ZGGA 1YMPA 1MX6A 1DC2A 4J8YA 5EIDA 1BI8B 4DX2A 1A5EA 5CBNA 3TWQA 3ZKJA 2XEHA 1UOHA 4OAUC 4YDYA 4GMRA 3Q9NC 1IKND 4QQIA 2PNNA 4OAVB 4HRMB 5AQBA 4U96D 3UTMA 1DCQA 4LSZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EN5 D;  4LNU D;  3TWX A;  3ZNG A;  1MJ0 A;  4LG6 A;  4BET A;  2KXP C;  1WG0 A;  2L6B A;  2QYJ A;  5ENP D;  1IXV A;  2DVW A;  1NFI E;  4BSZ B;  4G8K A;  3TWS A;  5CEA A;  1MYO A;  2HE0 A;  4DX6 D;  5JMN D;  1AWC B;  3NBN B;  5ENS D;  2RFM A;  5CBO A;  1S70 B;  5EIL A;  2Y1L E;  1QYM A;  5AQ9 A;  1SW6 A;  1BD8 A;  2XZD G;  3AJI A;  4K5B A;  5CER B;  5KNH D;  2F8Y A;  3T9K A;  5KWD A;  3EHQ A;  3W9G A;  5ENR D;  4BES A;  3T8K A;  4HLL A;  5EIB E;  4U95 D;  2F8X K;  2V4H C;  4HNA D;  1AP7 A;  2DWZ A;  1BI7 B;  4U8Y D;  2NYJ A;  4CYM D;  4U8V D;  5CEC B;  4NIK A;  3LJN A;  3JUE A;  3DEP A;  5FIN A;  4CZ2 D;  5HRY A;  4O1O A;  4DX5 D;  3HRA A;  5AAO A;  5AQA A;  3JXI A;  5EYP F;  4BEP A;  4Z68 A;  2XEE A;  3NOC D;  1BU9 A;  4HRL A;  2ETB A;  2DZN A;  1TR4 A;  2V5Q C;  3D9H A;  4HRN A;  3J5P A;  5D66 A;  1K1B A;  2BKG A;  4DUI A;  2DZO A;  5HS0 A;  4BER A;  1MX2 A;  2VGE A;  4HI9 A;  3V2X A;  5BXU A;  3TWU A;  2KBX A;  3KEA A;  3W9F A;  1WDY A;  4QFV A;  3TWV A;  1IHB A;  4HBD A;  4J7W A;  1D9S A;  3UXG A;  2B0O E;  3EU9 A;  2ZGD A;  4DRX E;  1K3Z D;  2FO1 E;  4A63 B;  1YYH A;  1OT8 A;  3B95 A;  4K5C A;  5AAR A;  3AAA C;  4O1P A;  4K5A B;  2XEN A;  2AJA A;  3JXJ A;  3J5Q B;  5ENT D;  5EYL A;  1MX4 A;  4HB5 A;  4DX1 A;  1OY3 D;  2ETA A;  4UUC A;  2Y0B G;  3IXE A;  4B93 B;  4G8L A;  4TUM A;  5HKP A;  5JA4 D;  2ETC A;  3V79 K;  1YCS B;  1N0Q A;  1BLX B;  4N5Q A;  5FIO A;  4F6R D;  3V31 A;  1G3N B;  4ATZ D;  4GPM A;  1N0R A;  3F6Q A;  3TWT A;  5KNG A;  4HQD A;  3UI2 A;  5AQ7 A;  4O60 A;  4ZHB A;  1SVX A;  2XZT G;  2F37 A;  3TWR A;  2JAB A;  4JB8 P;  5CED B;  3ZU7 B;  5ITZ F;  2BKK B;  3EHR A;  5ENQ D;  4C48 B;  2A5E A;  4RLY A;  2MYO A;  2QC9 A;  3HG0 D;  3V2O A;  4DX7 D;  3B7B A;  4F1P A;  1N11 A;  3NOG D;  4HI8 A;  4YDW A;  5BXO A;  3Q9U C;  4ZFH A;  5KBA A;  2J8S D;  3TWW A;  1K1A A;  3C5R A;  3V30 A;  3DEO A;  5ENO D;  2P2C P;  2RFA A;  5AN8 A;  3SO8 A;  3ZUV B;  2ZGG A;  1YMP A;  1MX6 A;  1DC2 A;  4J8Y A;  5EID A;  1BI8 B;  4DX2 A;  1A5E A;  5CBN A;  3TWQ A;  3ZKJ A;  2XEH A;  1UOH A;  4OAU C;  4YDY A;  4GMR A;  3Q9N C;  1IKN D;  4QQI A;  2PNN A;  4OAV B;  4HRM B;  5AQB A;  4U96 D;  3UTM A;  1DCQ A;  4LSZ E; 
#chains in the Genus database with same CATH topology
 4BT9 A;  1FT1 A;  1IXV A;  1TJC A;  4N39 A;  1NFI E;  3AG2 E;  4BTB A;  3MX3 A;  4GB9 A;  3I4G A;  5ANL A;  2GRO B;  1KPS B;  2RFM A;  3FHE A;  2GRL A;  1SW6 A;  5H7P A;  1TN8 A;  2OOE A;  5AYW D;  4CDM A;  3FH5 A;  5CMY A;  4I6J A;  4O1O A;  1Z3Y A;  2YNQ A;  5AQA A;  3EHN A;  2XEE A;  3S2A A;  3AS8 A;  4XX5 A;  4JPS A;  4AY6 A;  1WAO 1;  2DZO A;  2AXV A;  2J49 A;  4B8A A;  2WXK A;  3W9F A;  2XGS A;  4K0R A;  3NZS A;  4RG6 A;  2R59 A;  3Q15 A;  1SZA A;  1YYH A;  4F3V A;  3L17 A;  5FT9 A;  1HE8 A;  3CHM A;  3CGH A;  3JXJ A;  4L7T A;  4GTQ A;  3GZ2 A;  4N5C A;  2BUG A;  3T8M A;  1BLX B;  4PH4 B;  3DSU A;  5AQ7 A;  1JPL A;  4ZHB A;  2F37 A;  4JZY A;  5EX3 A;  4JHK A;  2BKK B;  2FEZ A;  2P9U G;  2Q7F A;  4G1T A;  3T5X A;  2XRY A;  4GPK A;  5ENO D;  1O1S A;  3G2U A;  2QZA A;  2VSX E;  3BG1 B;  4TUU A;  3C72 A;  4PS3 A;  5LCW C;  2WXR A;  3CHR A;  1N95 A;  4BET A;  2L6B A;  2LSU A;  1E7U A;  4GTT A;  4F7A A;  1XGW A;  4KXK B;  1ELR A;  4FHJ A;  3NBN B;  4PUC A;  1NA0 A;  3LY7 A;  3DXM G;  4OYS A;  4K5B A;  3T9K A;  2BTD A;  2V4H C;  4U8Y D;  2NYJ A;  4WAF A;  1MQS A;  4PS8 A;  2IU1 A;  5AEN A;  4GZD A;  4I2W A;  3DSS A;  4URK A;  1L5J A;  4DRX E;  5IY5 E;  3UIP C;  3B13 A;  2YHC A;  3I3N A;  3FUJ A;  4FC8 A;  3ENE A;  2I9C A;  2C0M A;  4ATZ D;  2LAH A;  1X81 A;  2VQ2 A;  3F6Q A;  5KNG A;  1Y8M A;  2EIM E;  3OXF A;  4ABN A;  3CHS A;  1QZ2 A;  4BSX A;  2BF0 X;  3LXU X;  4YVO A;  1IQR A;  3C5R A;  4OVV A;  5FQ6 A;  2WM9 A;  1FPP A;  3CVL A;  1E90 A;  4HS2 A;  4A55 A;  3CKB A;  1OWM A;  3BU8 A;  3FY4 A;  2P9P G;  4AXH A;  3L13 A;  4Q94 A;  4GCO A;  5BW8 C;  1D8E A;  4RG9 A;  2HE0 A;  3NZU A;  5AJD A;  3MGB A;  4CGW A;  2A5U A;  3UKU G;  4KBQ A;  2F8X K;  4HNA D;  1P5Q A;  1OCC E;  3HXB A;  4NIK A;  1HO8 A;  1UJJ A;  3APD A;  5C2Y A;  4L2L A;  1H2U A;  3RSE G;  5HS0 A;  4BER A;  3CV0 A;  1MZC A;  3QDN A;  1N52 A;  1HXI A;  1S64 A;  2MHK A;  4J8D A;  1WDY A;  2XPY A;  2WXM A;  5T8I A;  2MOW A;  3LPZ A;  1V54 E;  4JHR A;  3LY9 A;  2LO6 A;  4B93 B;  3NAW A;  3FUF A;  2WPV A;  4F6R D;  4N5Q A;  5CCL A;  3GZS A;  4WND A;  3Q73 A;  4GPM A;  4BX9 A;  2XZT G;  1X5B A;  3TWR A;  4JB8 P;  3ZU7 B;  1ELW A;  3OAW A;  3B7B A;  3CK7 A;  4GCN A;  3FDH A;  3OXG A;  5B1A E;  3TWW A;  2PQN A;  4I1M A;  3E34 A;  3SBT B;  1YMP A;  4J8E A;  3CVV A;  4DPR A;  1MX6 A;  1E8W A;  2XEH A;  3E32 A;  3QNK A;  3PE4 A;  1KT1 A;  1LD7 A;  2P9I G;  1IKN D;  3ABK E;  5M72 A;  4J6I A;  3S7J A;  1DCQ A;  3PZ4 A;  1U2V G;  4JEH A;  1WG0 A;  4U63 A;  2X6F A;  4A1S A;  3B7R L;  4DX6 D;  2ILR A;  2I1K A;  2WXN A;  3ZFW A;  3UKR G;  3W9G A;  2NSZ A;  4BES A;  3APC A;  5J90 A;  4CDN A;  3FTV A;  4ME2 A;  4BEP A;  1A17 A;  2NXP A;  4UI9 K;  3GW4 A;  1FCH A;  3UX4 A;  4YDO A;  4PS7 A;  3O4Z A;  1K1B A;  4DUI A;  3MYV A;  3HVE A;  3UMV A;  4KVO A;  4EBA G;  5C1D A;  1U3D A;  4JA9 A;  3UXG A;  3TAX A;  3QK0 A;  1EPU A;  2B6C A;  1OCR E;  1OT8 A;  2AXU A;  3MV3 B;  3MKQ B;  4IN3 B;  3EUV A;  4GTO A;  2ETA A;  4G8L A;  2J09 A;  3FUI A;  2WXF A;  2VSN A;  3SZ7 A;  1TNZ A;  3Q7F A;  1V55 E;  1OWL A;  2QC9 A;  3K9I A;  5KBA A;  3ULE G;  3KEZ A;  2RFA A;  4I9C A;  4TV3 A;  1JWG A;  2R05 A;  2KM4 A;  1H6O A;  2KZT B;  4DLO A;  3FP3 A;  5E76 A;  1EYH A;  3MJW A;  2XS1 A;  2IQC A;  4HOU A;  2HM8 A;  3ZHE A;  4U07 A;  3ZYK A;  5BNW A;  1AWC B;  3ASN E;  3D9K A;  3LVR E;  2KCL A;  3HHM A;  3PEU B;  5EIB E;  4U95 D;  4FLH A;  3AG4 E;  3CLJ A;  3RJV A;  3TXN A;  3APF A;  1E8Z A;  3AG3 E;  3FUN A;  2DCP A;  4JD2 G;  3HRA A;  3JXI A;  3CVU A;  3DPD A;  5CRV A;  1MX2 A;  4FP7 A;  2X6I A;  2KBX A;  4I17 A;  4GYW A;  4I2Z A;  4J7W A;  5DBK A;  3ZYM A;  3BUA A;  2P9S G;  4G24 A;  4K5C A;  4APF A;  2VTB B;  3PDN A;  3QWW A;  1UW4 B;  5EYL A;  3UM2 A;  1NA3 A;  2WXL A;  4X8Q A;  1N4R A;  3B7S A;  3BEE A;  3V31 A;  1G3N B;  3MV2 B;  5KJL A;  3JUI A;  4HQD A;  3MA5 A;  3Q4A B;  1IQU A;  3SQV A;  3EHR A;  4C48 B;  1N11 A;  4IYP A;  4ZFH A;  2XGO A;  3LS8 A;  4KYO B;  1FVH A;  3BQO A;  5HI7 A;  2P2C P;  3D9M A;  1QQE A;  4GYY A;  5ENN A;  3FH8 A;  3U3W A;  4MRU A;  1UG3 A;  2ION A;  3SD5 A;  4QQI A;  1BPO A;  2J4B A;  2VGX B;  3GYZ A;  3G2V A;  5ENP D;  2UY1 B;  5B1B E;  4BSZ B;  4HOT A;  4HOS A;  3CEQ A;  3IHV A;  4RQI A;  2I2O A;  5CER B;  5E75 A;  4TXQ A;  4ACK A;  3ML8 A;  1ZB1 A;  3RRU A;  3DWL G;  1OUV A;  4AIF A;  5A6C A;  5G55 A;  1LF8 A;  4I1A A;  4J0U A;  4F53 A;  4MBG A;  3SI5 A;  5D66 A;  2ZXW E;  4IRU A;  3U4T A;  3C3Q A;  3CHQ A;  3C3O A;  4I43 A;  4U0Z A;  3SHF A;  4M7C A;  2OV8 A;  4O1P A;  4ACL A;  2OCC E;  3R9A B;  4CRW A;  2WXH A;  1H6P A;  3CVN A;  5BUZ A;  3U9W A;  2OEV A;  3PS6 A;  3ABL E;  2XQ0 A;  3UUX A;  4ILI A;  2MRI A;  1D8D A;  2OEW A;  1H2T C;  2XEV A;  3ZKJ A;  2J9Q A;  4LNG A;  1KZP A;  3KD7 A;  2FBN A;  2XGM A;  3PRE A;  4UQX A;  2XS8 A;  1H2V C;  1OXJ A;  2DVW A;  3LY8 A;  3DSX A;  3FH7 A;  4XI0 A;  3CVY A;  2VJ8 A;  3SFX A;  4JEU A;  4FLB A;  3IHY A;  1H6K A;  4JHJ A;  1S70 B;  3CSF A;  3CK8 A;  3AU4 A;  1TN7 A;  3QKY A;  4H7X A;  3D9N A;  5G05 J;  2Y4U A;  1FVF A;  1SA4 A;  4O6F A;  2XPZ A;  3FEY A;  4KMO A;  4B8C B;  4AV7 A;  2LXL A;  3G2T A;  3QB2 A;  5FTP A;  3L6A A;  3MZL B;  2VGE A;  3EHM A;  4A1G A;  3TWU A;  1IHB A;  1D9S A;  4ATG A;  3PUJ A;  4NQ0 A;  4W9R A;  1HU3 A;  5ENT D;  3DST A;  3FFL A;  3PZD A;  3S7D A;  3QOU A;  3IV0 A;  4J8F A;  3DBS A;  4GTP A;  4MS6 A;  5FIO A;  4YDE A;  5CED B;  2F0Y A;  1Z3X A;  4CT0 A;  3OTN A;  2L9B A;  4MKT A;  1H19 A;  2YHE A;  2IJG X;  2WXG A;  2I6H A;  2R03 A;  3L82 A;  4AEZ C;  4GMR A;  4KT6 B;  5D0O D;  1XNF A;  2OVB A;  5JJ6 A;  3HDX A;  4BY6 A;  4EQF A;  5DIZ A;  4ANU A;  4XEI G;  3FTY A;  3IEG A;  4N3B A;  3VLD A;  3HIZ A;  2R17 C;  3NQP A;  2HYZ A;  5JMN D;  2H6F A;  3HXE A;  2X38 A;  5ENR D;  1ELK A;  2J4D A;  3LJ3 A;  1AP7 A;  4GMJ A;  4L23 A;  4C0E A;  4AVX A;  4XIF A;  1HZ4 A;  3CVP A;  1U3C A;  4L9P A;  2WXO A;  3UT8 A;  1ZBP A;  3CVW A;  2EIJ E;  3AS5 A;  5FZR A;  1KLX A;  3PUK A;  2P58 C;  3PNL B;  4ILG A;  4QFV A;  1UJK A;  1HFA A;  2CHW A;  4XI9 A;  3LDZ A;  1OWN A;  3E37 A;  3J5Q B;  4DJA A;  4CGV A;  2AWI A;  2Y0B G;  4TUM A;  1DCE A;  4L2Y A;  3QJZ A;  5FQ4 A;  2L0I A;  4C0M A;  3PVL A;  4U7E B;  3ZHE B;  3UI2 A;  2PM6 A;  1SA5 A;  4EPZ A;  4RLY A;  4F1P A;  5BXO A;  2GRN B;  1N4P A;  3AU5 A;  2RG8 A;  4GZ3 A;  3PZ3 A;  2C2L A;  3PZ2 A;  2IOS A;  4BTA A;  1PAQ A;  2XRZ A;  4ILH B;  3FTS A;  4LEU A;  4U96 D;  4GML A;  2QYJ A;  4I6E A;  2IO3 C;  2WXI A;  2KCK A;  3D9L A;  4RSY A;  1MYO A;  2KC7 A;  4AP2 A;  1HG5 A;  4KZC A;  1E7V A;  2R5S A;  3LCA A;  2Y1L E;  1TN6 A;  1BD8 A;  1Q2Z A;  1KZO A;  3FUH A;  2EIN E;  1KT0 A;  3B7U X;  3SY2 A;  2YIN A;  4U8V D;  3LJN A;  1RW2 A;  2OVF A;  2GRP B;  2DYS E;  2ZIS A;  3ZN3 A;  5BPP A;  4FJY A;  5AIJ A;  2V5F A;  3MCX A;  1TNO A;  3UM1 A;  1SQM A;  3ASG A;  2VYI A;  3D9I A;  3CQG B;  5AAR A;  2AW6 A;  2RKK A;  5CHE E;  4HB5 A;  4DX1 A;  4GA1 A;  1WY6 A;  4R7L A;  3DXK G;  3KS2 A;  2LSV A;  1O1T A;  1N94 A;  5LP0 A;  1HH8 A;  4E85 A;  4M3O A;  5BT1 A;  5LOZ A;  2ZIR A;  3EU5 A;  2V0P A;  3DSV A;  5ITZ F;  2LXM A;  5A23 A;  2XCC A;  3E30 A;  4HI8 A;  4YDW A;  3ISM C;  3TG4 A;  3ZYQ A;  5AN8 A;  3N71 A;  3RO2 A;  3L16 A;  2A4Z A;  3SFZ A;  1DC2 A;  4UWF A;  2E0I A;  1TNY A;  2X3M A;  4XKB A;  3RIB A;  1INZ A;  4B0Z A;  3WG7 E;  2UY1 A;  2DBA A;  3I4R B;  3Q9N C;  5ANR A;  2KCV A;  5AQB A;  4GZ5 A;  3L08 A;  4LNU D;  3TWX A;  1Y6I A;  5ARF A;  4FA6 A;  2WXP A;  2L0T B;  3TWS A;  4N3C A;  3S7B A;  4EZL A;  2WMN A;  2DYR E;  4E6H A;  2HR2 A;  5CBO A;  5LFA A;  2VGX A;  4GTM A;  3CVX A;  2XZD G;  5CCM A;  2F8Y A;  5KWD A;  4JL0 A;  4B94 A;  3VTY A;  3JUE A;  2YQ8 A;  2X6H A;  3CQC B;  4DX5 D;  5AAO A;  3ASD A;  2M63 A;  2J08 A;  1BU9 A;  1FT2 A;  4YND A;  4XE0 A;  1TR4 A;  3Q5M A;  1JUQ A;  5BXU A;  3Q47 B;  3ZVV A;  4FUL A;  3FU0 A;  4DK5 A;  3T5V A;  4U0S A;  3ONK A;  1OY3 D;  4UI9 J;  3IXE A;  2ETC A;  3DRA A;  5KCM A;  2VTB A;  2WMO A;  2P9K G;  3Q49 B;  2UWJ G;  2MYO A;  3HG0 D;  3B7T A;  3ONL A;  2Y3A A;  3FU5 A;  4RVB A;  4GZ6 A;  5JHB A;  4UWG A;  3UT4 A;  5LCW J;  4J8Y A;  5EID A;  1BI8 B;  4FAD A;  3FTX A;  1N4S A;  3TJP A;  4CDR A;  1JCQ A;  4GA2 A;  1S0P A;  4YDY A;  5BV1 A;  2WB2 A;  4LSZ E;  3RU0 A;  1LD8 A;  2R2L A;  4H7Y A;  4G8K A;  2PZI A;  3RO3 A;  2DIW A;  3Q78 A;  5KNH D;  3SNX A;  2J07 A;  2V4L A;  5J08 A;  4HLL A;  3R9M A;  4XZ4 A;  3Q79 A;  4HFG A;  5EDS A;  3ML9 A;  4WWP A;  3C98 A;  3AG1 E;  3EIJ A;  3FU3 A;  3AS4 A;  3ASH A;  3D9H A;  4GU5 A;  1TEZ A;  5ARG A;  2LUH A;  2GRR B;  3FTU A;  3TGO A;  3HXC A;  4V3I A;  3RRM B;  1E8X A;  2Y4T A;  4K5A B;  3R7R A;  3OXL A;  5HKP A;  3BG0 B;  3MEK A;  5HQ8 A;  1UN8 A;  5EKQ D;  2JLB A;  4O60 A;  4UI9 C;  1E96 B;  1SZ9 A;  2OND A;  2A5E A;  4JC8 A;  3FUL A;  1B89 A;  2IFU A;  1S63 A;  2ZGG A;  5AJL A;  4LRZ A;  4ANX A;  4K03 A;  5CRU A;  1Z6T A;  3VLF A;  1IHG A;  4WWO A;  3UM0 A;  3JCK C;  1N9A A;  3MKQ A;  3KSL A;  3FU6 A;  2CG2 A;  2ZU6 B;  2PL2 A;  5EN5 D;  2JEK A;  1UN9 A;  3ASF A;  2FUL A;  3L54 A;  4OVU A;  4UQY A;  3IKO B;  4TXP A;  3MKR A;  5FJY A;  3E33 A;  3ESK A;  5CEA A;  5G04 J;  5EIL A;  2H6G A;  1HG2 A;  3EHQ A;  3QAQ A;  3X2Q E;  4CEM A;  2IOL A;  1WM5 A;  5JJT A;  4C9B B;  2FF4 A;  4F1S A;  5HRY A;  4TXR A;  5EYP F;  4Z68 A;  3NOC D;  4HRL A;  2DZN A;  3KAE A;  2L6J A;  1YA0 A;  4YVQ C;  2B0O E;  2ZGD A;  4JVS A;  4WNE A;  4MLP A;  3Q75 A;  3AAA C;  2I1J A;  2IO2 C;  2R02 A;  1RZ4 A;  5JA4 D;  3SF4 A;  3E4B A;  2WVI A;  3LKU A;  4Q96 A;  3EDT B;  2IEJ A;  3SGH A;  4FU3 A;  3FEX A;  1NL4 A;  3TG5 A;  2QY7 A;  3CK9 A;  4GTV A;  2J8S D;  4XKC A;  3NF1 A;  1K1A A;  2VSY A;  1TNU A;  3FTZ A;  3PH0 C;  4DX2 A;  1A5E A;  1DVP A;  1UOH A;  3QC1 A;  4UWK A;  4EEC A;  4WNG A;  4UWL A;  4BFR A;  3RK6 A;  3VLE A;  3ZNG A;  4AY5 A;  1MJ0 A;  5KJN A;  3UIN C;  2XPI A;  2EIL E;  1HS6 A;  2FO7 A;  3CIA A;  3TL5 A;  1BI7 B;  4G2V A;  5FQ8 A;  3DSW A;  5CEC B;  3QAR A;  4ANW A;  2WQ7 A;  3UM3 A;  1MHQ A;  4CZ2 D;  2GRQ B;  3RKV A;  4L1B A;  2ETB A;  3J5P A;  3UIO C;  5KJK A;  4HOQ A;  3ZYL A;  4IUL A;  4N3A A;  2P9N G;  5JJ7 A;  4EZK A;  3HXF A;  1N54 A;  3V79 K;  4JA7 A;  1YCS B;  4N2S A;  2LNI A;  3HVE B;  3FUM A;  4AM9 A;  3CR3 A;  3G2S A;  1O1R A;  1QBQ A;  5G2N A;  4DLQ A;  3G2W A;  3QWP A;  3ZW3 A;  4DX7 D;  3FUD A;  3Q9U C;  3EJN A;  2H6I A;  1VDY A;  3V30 A;  3DEO A;  2AXZ A;  4GAA A;  4EHM A;  1OWO A;  2WXJ A;  1IYG A;  3CST A;  4DI4 A;  3RAU A;  2HO1 A;  1H0A A;  5FZQ A;  4OAV B;  2PNN A;  4A3V A;  3RRN B;  4G25 A;  1W3B A;  3PZ1 A;  4I1O B;  3D3M A;  4LNB A;  2EIK E;  4GTR A;  1NP7 A;  1K8K G;  3ESL A;  3R7Q A;  1TNB A;  3AJI A;  4GA0 A;  3UQ3 A;  3ZRH A;  2CFZ A;  5T3R A;  3DEP A;  4UWH A;  5A7D B;  2H6H A;  3WXX A;  2Y69 E;  3IBE A;  2VGY A;  2V5Q C;  3URZ A;  3C3R A;  2WQ6 A;  4HI9 A;  4KVM A;  5JHA A;  4HBD A;  4WWN A;  3KSQ A;  5FZS A;  3FTW A;  4JXT A;  4KZ0 A;  3SFY A;  2EQX A;  3LEW A;  2IY0 C;  5G04 C;  4UUC A;  3D9P A;  4BT8 A;  1QNF A;  2QFC A;  1N0R A;  3L22 A;  3TWT A;  4BX8 A;  1SVX A;  3HXD A;  3ULY A;  2CG3 A;  2CFU A;  3TXM A;  3I5P A;  1DNP A;  3JQ0 A;  4HOR A;  4I6G A;  3GZ1 A;  2P9L G;  5CBN A;  3SBS A;  1OCZ E;  3CKC A;  3CHO A;  4HRM B;  2IF4 A;  3UTM A;  2KXP C;  4G23 A;  4U0U A;  5BV0 A;  5AQ9 A;  3PE3 A;  4B89 A;  1JCR A;  3ZEF A;  2WQH A;  4LER A;  2DWZ A;  4P29 A;  3LVQ E;  1NZN A;  3LYA A;  1E8Y A;  4NAC A;  1EDU A;  3UPV A;  3U64 A;  5EX0 A;  3JYS A;  2CHX A;  1Z5S C;  2PM7 A;  3V2X A;  1HF8 A;  3KEA A;  3TWV A;  3UT7 A;  2GGF A;  4A63 B;  3CHP A;  5CMW A;  3Q7A A;  2KZT A;  5KJM A;  2XEN A;  5D0Q D;  3PRZ A;  1O5M A;  3D9J A;  1MX4 A;  1PY1 A;  4G11 A;  3PEV B;  3FWV A;  4HVB A;  2BED A;  4EZJ A;  4NUR A;  3O48 A;  2JAB A;  4J8S A;  4G26 A;  4NRH B;  2GRM A;  4Y6W A;  4AJW A;  4WUY A;  3ABM E;  1NI1 A;  2GW1 A;  3S7F A;  3ASO E;  3ZUV B;  4PDX A;  3SO8 A;  5LX8 A;  2E2E A;  3TWQ A;  2PQR A;  4GYO A;  1HX8 A;  4LCT A;  2KAT A;  4Q69 A;  3L9T A;  4LG6 A;  3HYM B;  2FI7 A;  4LUN U;  4EBA A;  2X6J A;  2RD0 A;  2C0L A;  4HXI A;  3ZXS A;  1TJF A;  2V8S E;  5ENS D;  1N4Q A;  1OCO E;  3NB2 A;  1QYM A;  3U66 A;  4AOF A;  5B3S E;  3DPY A;  1GW6 A;  4D10 C;  3T8K A;  1EF1 C;  4CYM D;  3ZIM A;  3ZPJ A;  4JW1 A;  1LTX A;  5D2M C;  2VSO E;  5FIN A;  2X6K A;  3ZGQ A;  3D9O A;  4I9E A;  5FQ7 A;  4DI3 A;  4UQZ A;  2XHE A;  2XCB A;  4HRN A;  2BKG A;  3PNT B;  2CHZ A;  2FO1 E;  3EU9 A;  4WNF A;  1PC2 A;  1K3Z D;  4ANV A;  4CT4 A;  3B95 A;  3P1U A;  3QWV A;  2AJA A;  1ZU2 A;  1JWF A;  3P2B A;  1TYQ G;  4FJZ A;  4FHK A;  4CCA A;  1N0Q A;  4U04 A;  2LAI A;  2QYU A;  3ZXP A;  4U8H A;  4BWR A;  5ENQ D;  3V2O A;  3NOG D;  2AVP A;  2NC9 A;  3EIQ C;  4Y6C A;  4GTS A;  1OWP A;  3FUK A;  3FUE A;  3JQ1 A;  1JCS A;  4GZC A;  5T4Y A;  2WXQ A;  4OAU C;  4TRQ A;  5FWQ A;  3VTX A;  5G05 C;  4N2Q A;  3CVQ A;  4APO A;  4A3T A;  3ULQ A;  4HLE A; 
#chains in the Genus database with same CATH homology
 5EN5 D;  4LNU D;  3TWX A;  3ZNG A;  1MJ0 A;  4LG6 A;  4BET A;  2KXP C;  1WG0 A;  2L6B A;  2QYJ A;  5ENP D;  1IXV A;  2DVW A;  1NFI E;  4BSZ B;  4G8K A;  3TWS A;  5CEA A;  1MYO A;  2HE0 A;  4DX6 D;  5JMN D;  1AWC B;  3NBN B;  5ENS D;  2RFM A;  5CBO A;  1S70 B;  5EIL A;  2Y1L E;  1QYM A;  5AQ9 A;  1SW6 A;  1BD8 A;  2XZD G;  3AJI A;  4K5B A;  5CER B;  5KNH D;  2F8Y A;  3T9K A;  5KWD A;  3EHQ A;  3W9G A;  5ENR D;  4BES A;  3T8K A;  4HLL A;  5EIB E;  4U95 D;  2F8X K;  2V4H C;  4HNA D;  1AP7 A;  2DWZ A;  1BI7 B;  4U8Y D;  2NYJ A;  4CYM D;  4U8V D;  5CEC B;  4NIK A;  3LJN A;  3JUE A;  3DEP A;  5FIN A;  4CZ2 D;  5HRY A;  4O1O A;  4DX5 D;  3HRA A;  5AAO A;  5AQA A;  3JXI A;  5EYP F;  4BEP A;  4Z68 A;  2XEE A;  3NOC D;  1BU9 A;  4HRL A;  2ETB A;  2DZN A;  1TR4 A;  2V5Q C;  3D9H A;  4HRN A;  3J5P A;  5D66 A;  1K1B A;  2BKG A;  4DUI A;  2DZO A;  5HS0 A;  4BER A;  1MX2 A;  2VGE A;  4HI9 A;  3V2X A;  5BXU A;  3TWU A;  2KBX A;  3KEA A;  3W9F A;  1WDY A;  4QFV A;  3TWV A;  1IHB A;  4HBD A;  4J7W A;  1D9S A;  3UXG A;  2B0O E;  3EU9 A;  2ZGD A;  4DRX E;  1K3Z D;  2FO1 E;  4A63 B;  1YYH A;  1OT8 A;  3B95 A;  4K5C A;  5AAR A;  3AAA C;  4O1P A;  4K5A B;  2XEN A;  2AJA A;  3JXJ A;  3J5Q B;  5ENT D;  5EYL A;  1MX4 A;  4HB5 A;  4DX1 A;  1OY3 D;  2ETA A;  4UUC A;  2Y0B G;  3IXE A;  4B93 B;  4G8L A;  4TUM A;  5HKP A;  5JA4 D;  2ETC A;  3V79 K;  1YCS B;  1N0Q A;  1BLX B;  4N5Q A;  5FIO A;  4F6R D;  3V31 A;  1G3N B;  4ATZ D;  4GPM A;  1N0R A;  3F6Q A;  3TWT A;  5KNG A;  4HQD A;  3UI2 A;  5AQ7 A;  4O60 A;  4ZHB A;  1SVX A;  2XZT G;  2F37 A;  3TWR A;  2JAB A;  4JB8 P;  5CED B;  3ZU7 B;  5ITZ F;  2BKK B;  3EHR A;  5ENQ D;  4C48 B;  2A5E A;  4RLY A;  2MYO A;  2QC9 A;  3HG0 D;  3V2O A;  4DX7 D;  3B7B A;  4F1P A;  1N11 A;  3NOG D;  4HI8 A;  4YDW A;  5BXO A;  3Q9U C;  4ZFH A;  5KBA A;  2J8S D;  3TWW A;  1K1A A;  3C5R A;  3V30 A;  3DEO A;  5ENO D;  2P2C P;  2RFA A;  5AN8 A;  3SO8 A;  3ZUV B;  2ZGG A;  1YMP A;  1MX6 A;  1DC2 A;  4J8Y A;  5EID A;  1BI8 B;  4DX2 A;  1A5E A;  5CBN A;  3TWQ A;  3ZKJ A;  2XEH A;  1UOH A;  4OAU C;  4YDY A;  4GMR A;  3Q9N C;  1IKN D;  4QQI A;  2PNN A;  4OAV B;  4HRM B;  5AQB A;  4U96 D;  3UTM A;  1DCQ A;  4LSZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...