4BEPA

Crystal structure of the legionella pneumophila fic domain-containing effector ankx protein (apo-form)
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
478
structure length
478
Chain Sequence
MPNLPGLYFLQAYPSEEIWRLFVDGRFWSKENGWRGYESREPGCLNAALESLCSIALQVEKSGEEFELSVDLIKRIHKKCGKKVEELQEKNPGELRTDEPVSFGIPAGRASIKGIEEFLSLVFLTEGGAEFGPGKAGPFGPRFDKNYFKNLNPEQIPDLAKQIYFDMCKYGHSNTNHFYLAVMKNVDVYLEKITQSYNKEIKTAETLDEKLKIIVKHIRMYEVLHPFRDANGRTFVNNLLNIPLMQQGLPPATFYEPNVFDLYSAEELVVVVKEAIFNTVEIIEQSKRKTPITLYGYHSSLEEQTKFRDMLDSPSYEKIKHMDFSDLNPEKLHLKTQKCLSSLNEQYPLHRGAIYLSDPGEIKLLLSNRNESQINQQIEQGAPPIYVGKTPAHLAVISGNMAMLDELIAKKADLSLQDYDGKTALHYAAECGNMQIMGKILKVVLSQEDAIKVLNIKDNHGKTAFHYAAEFGTPELIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOCHOLINE TRANSFERASE ANKX
publication title Structure of the Legionella Effector Ankx Reveals the Mechanism of Phosphocholine Transfer by the Fic Domain.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Transferase
total genus 150
structure length 478
sequence length 478
chains with identical sequence B
ec nomenclature ec 2.7.1.-:
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4bepA02
4DX6D 2KXPC 4HBDA 4YDWA 2VGEA 4K5CA 3ZUVB 4ZHBA 3V2XA 3NBNB 4BEPA 3B95A 1K1AA 4ATZD 4HLLA 2ZGDA 1N0QA 4HRLA 3ZNGA 4HRMB 3SO8A 2V5QC 5EN5D 1N11A 1BLXB 2RFAA 2HE0A 2KBXA 3F6QA 3DEPA 4QQIA 5ENQD 5AQ7A 5KNGA 1MX2A 1MX4A 1WG0A 4LG6A 5CEDB 1BU9A 4DRXE 4DX5D 3D9HA 2V4HC 5AQBA 4O60A 4U95D 5ENTD 2NYJA 5HS0A 4J8YA 4ZFHA 2FO1E 5AQAA 4GMRA 4JB8P 1BD8A 5AQ9A 5CBNA 1SVXA 4QFVA 2ZGGA 2PNNA 1WDYA 1BI8B 3J5PA 5D66A 4DX2A 2P2CP 3AJIA 2RFMA 2F8XK 5AN8A 3UTMA 2L6BA 1AWCB 3J5QB 4TUMA 2J8SD 1TR4A 4O1OA 3V2OA 1IHBA 4F6RD 4BERA 5AARA 2B0OE 4BETA 2MYOA 4DUIA 4BSZB 3V30A 2DVWA 4HNAD 5ITZF 4B93B 3DEOA 2QC9A 5EYPF 3TWVA 4F1PA 2DZOA 3IXEA 3Q9UC 3TWTA 5EYLA 4HB5A 2QYJA 1QYMA 1S70B 5EIDA 4HQDA 5BXUA 4OAUC 4U8YD 5ENOD 4CZ2D 1K1BA 5KBAA 3TWUA 3KEAA 1YMPA 3ZKJA 1DCQA 3ZU7B 3Q9NC 3V31A 4OAVB 4G8LA 3W9GA 2ETBA 5ENRD 3EHRA 3JXIA 3NOCD 3TWXA 2XZDG 4K5AB 2AJAA 3B7BA 4RLYA 3AAAC 4C48B 3UXGA 1UOHA 4K5BA 5KNHD 1NFIE 3HG0D 1A5EA 4LNUD 2ETAA 4HI9A 1BI7B 3TWWA 4YDYA 4GPMA 4G8KA 2ETCA 3C5RA 2F8YA 2Y1LE 5ENSD 5FIOA 4U96D 5JMND 3TWSA 3UI2A 4LSZE 3T9KA 1K3ZD 2JABA 4J7WA 1G3NB 2BKGA 2XEEA 1DC2A 4DX1A 4U8VD 3EU9A 3TWQA 2XENA 3NOGD 4A63B 2BKKB 4BESA 2F37A 3JUEA 5HRYA 2XEHA 1IXVA 4N5QA 5FINA 1MJ0A 3V79K 5EIBE 4HI8A 1OT8A 5BXOA 3LJNA 2Y0BG 3EHQA 5KWDA 4CYMD 3T8KA 5CERB 4DX7D 5JA4D 1SW6A 4UUCA 1IKND 1N0RA 4Z68A 5CECB 2DWZA 1YYHA 5AAOA 2XZTG 2A5EA 3HRAA 1D9SA 4HRNA 4NIKA 1MYOA 1YCSB 3JXJA 5HKPA 5CBOA 4O1PA 3W9FA 3TWRA 1OY3D 2DZNA 1AP7A 1MX6A 5EILA 5ENPD 5CEAA
chains in the Genus database with same CATH superfamily
3DPDA 4A3TA 4ZHBA 4J8SA 2LAIA 3EJNA 5CEDB 1NZNA 4LG6A 1IQRA 1OWOA 1MQSA 2I1JA 3ABLE 4JHRA 3ZYQA 4APOA 3DSSA 4E6HA 3B13A 4ZFHA 1UJJA 3MKRA 1X5BA 3IHYA 2KATA 2ZGGA 1U3DA 3DSTA 5G05J 4I9EA 5ENNA 2P9IG 2MYOA 2V0PA 3DRAA 3MZLB 4GTQA 1QYMA 3FTSA 3LY9A 3PZ2A 1ZU2A 1HO8A 4K0RA 3C98A 3JXIA 3ZXPA 3HVEB 1S64A 5T8IA 3B7UX 3NAWA 3TWWA 2LXMA 4JEHA 2YINA 3VTYA 3CVNA 3UM0A 3T5XA 3FTUA 2P9NG 4U7EB 3EU5A 1KT0A 4LSZE 4XX5A 5FJYA 3QKYA 2GW1A 4O6FA 4A63B 4GPKA 5AJLA 4D10C 2HYZA 3PDNA 1RW2A 3EHQA 3GYZA 2AXUA 4DX7D 5JA4D 1YYHA 4HRNA 2VTBB 1DVPA 2B6CA 3CLJA 5EX0A 4L9PA 2L6JA 5FQ8A 2P9SG 3I5PA 4ATZD 4HRLA 3L9TA 5CRVA 1IHGA 2V5QC 2MHKA 3JQ0A 3FH7A 3DEPA 2KCLA 5FQ4A 3TXNA 3D9JA 1N4QA 4A1SA 2WXPA 4FJYA 4G11A 4BT9A 2DYSE 2X6HA 3QWVA 2PQNA 2WMOA 3ZN3A 2IONA 5HQ8A 4C9BB 4LUNU 2PM7A 2DZOA 4U0SA 3CVLA 3S7BA 4F53A 3PVLA 3L54A 2DCPA 4KZ0A 4OAVB 3FY4A 4DJAA 1TNYA 3LJ3A 3HG0D 1HFAA 3FUMA 1KZOA 2KZTA 1O1RA 3EU9A 2HR2A 2WQ7A 4N5QA 3ISMC 3LPZA 3FULA 3SZ7A 4FHKA 3CK7A 2XZTG 4JHKA 5LX8A 4MBGA 4RQIA 4G2VA 1S0PA 3ONKA 1K1AA 1N0QA 3SFZA 4GA2A 2P9LG 3L17A 5FZSA 1H19A 4U8HA 3TAXA 4JC8A 3C3OA 4Q94A 2V4LA 1WM5A 1EF1C 1WDYA 1TYQG 2ZISA 3DBSA 1N94A 3MA5A 4GTTA 1N4PA 3DSXA 4EZLA 3RAUA 4HNAD 5CCMA 2EIME 2F0YA 2QYJA 5FZRA 2WXRA 1D8EA 4GB9A 4AV7A 1O1SA 1RZ4A 3V31A 3ZRHA 4EBAG 1OWNA 3QOUA 1JUQA 1NFIE 3CV0A 4HI9A 2J49A 5BW8C 3CVWA 2AXZA 3CKBA 5J08A 4LNGA 3PS6A 4DX1A 1TNZA 3RJVA 5CHEE 4GA0A 3APDA 3Q78A 1SA4A 2FO7A 3RRMB 3LJNA 5EDSA 3RU0A 4Z68A 5CECB 4ACLA 5AAOA 3LCAA 3HRAA 1MZCA 5FWQA 3TWRA 3RO2A 3UT8A 3L13A 4LNBA 3U4TA 3RSEG 4GZ6A 3LS8A 3B95A 4N3AA 4HLLA 3OAWA 5KNGA 5ENQD 1XNFA 2KBXA 2XPZA 1BU9A 2XQ0A 2WXNA 3LY8A 3WG7E 1E7VA 1EYHA 3GZSA 1X81A 2YHCA 4BETA 3PH0C 1JCRA 4FLBA 4GAAA 4HOQA 3ZEFA 3ZHEB 1JCQA 1DCEA 4BSXA 4L7TA 2CFZA 3P1UA 4GYYA 3FUIA 4DLOA 3K9IA 2Y3AA 3CIAA 4JEUA 2VYIA 2Q7FA 2AWIA 3CHMA 2ETBA 2GRLA 4GZ3A 5CRUA 3ENEA 4C48B 2YHEA 5T4YA 4ME2A 3FTWA 4U96D 5JJ6A 3D3MA 4GTOA 2F37A 1OT8A 2KZTB 4Q96A 4MRUA 3NZUA 5CBOA 3HXEA 5IY5E 2DZNA 3JCKC 3GZ2A 3MEKA 5CEAA 4ANUA 3KSLA 4EZKA 4UQYA 4BEPA 3Q75A 3ZNGA 3UKUG 4N2SA 2RFAA 3MX3A 4JA9A 1BPOA 3PE4A 4CDNA 3CSTA 2V8SE 5CMWA 3RKVA 1WG0A 3CQGB 3AU4A 2KCKA 4J8YA 2C0LA 1HH8A 4FULA 1SVXA 3MV2B 4XIFA 5D66A 3FUNA 3BEEA 3APCA 4HS2A 1TR4A 4O1OA 3CHSA 3IHVA 1KT1A 4CT0A 5AJDA 2I6HA 4ILHB 3RRUA 5ENOD 5E75A 3SFYA 3TWUA 5LCWC 3QAQA 3W9GA 3EHRA 3BG1B 3B7BA 3PEUB 3D9NA 4BWRA 3D9LA 5KJMA 2VGYA 1H2UA 4WAFA 2NSZA 4GPMA 3ONLA 2XPYA 1LTXA 2LAHA 4XKBA 2GGFA 2AXVA 2J08A 2P9KG 3FUJA 3NOGD 2MRIA 1K8KG 3PUJA 3UQ3A 2XCCA 1Z3YA 2A4ZA 2L0IA 4CYMD 4UUCA 2XS8A 1JCSA 4ILIA 1ELWA 5FQ7A 1YCSB 2WQ6A 3RIBA 3EIJA 3C72A 1OY3D 3FTYA 2QY7A 2PQRA 4DX6D 1S63A 2VGEA 4OVVA 3D9MA 3VLEA 1Y6IA 2ZGDA 4HRMB 4WWOA 3SI5A 5AQ7A 1TN8A 3QARA 2A5UA 4CT4A 3LYAA 4G1TA 5B1BE 4XKCA 4R7LA 3VLDA 4GTPA 5ANRA 4Y6WA 2BTDA 2GRQB 4EECA 1H6OA 1AWCB 3V2OA 1IHBA 4BERA 3EHMA 2UY1B 5FZQA 3DEOA 3OXGA 1E96B 1UJKA 1S70B 5D0OD 4XI9A 3APFA 4DLQA 1H6PA 3UT7A 4A3VA 4TXPA 4N5CA 3ZU7B 2UWJG 4CRWA 3FH8A 1FPPA 5G04J 3NB2A 2XPIA 2WB2A 2OVFA 1H6KA 4DI3A 3FTZA 3G2VA 5KJLA 3Q5MA 4I6GA 4AP2A 3BG0B 1IYGA 2J4BA 1QBQA 4GZDA 3HYMB 4I43A 2CHXA 3IKOB 3FTXA 4JXTA 3R9AB 2XRYA 1D9SA 2DBAA 1Y8MA 2WM9A 3QB2A 4ANVA 3G2SA 5JHAA 1TNOA 3NBNB 3MYVA 4K5CA 5KJNA 3KSQA 3UM2A 4CDRA 1L5JA 2WXOA 4PS3A 2CHWA 5EN5D 4JD2G 3FH5A 1H0AA 4WNDA 4KMOA 4B0ZA 4HLEA 4O60A 1UN8A 2KM4A 3FUFA 3D9KA 4P29A 3J5PA 2F8XK 4LERA 2I9CA 3MJWA 2XCBA 2V5FA 3CVPA 1ELRA 2GRNB 4B89A 4NACA 3HIZA 3RK6A 2J07A 3IXEA 3HXFA 3UIOC 2CFUA 4B94A 4IYPA 3SY2A 4HOSA 2WXFA 3SNXA 3OXFA 3P2BA 1P5QA 1DNPA 2WXLA 5G05C 4YDOA 2XGMA 3GW4A 4AJWA 4GU5A 4RLYA 1O5MA 4GMLA 2IU1A 4WNEA 4G8KA 3R7RA 4J8DA 2LSUA 2F8YA 1HX8A 3S7JA 3S7DA 4RSYA 4I1AA 2L0TB 3PUKA 3QWWA 3CR3A 3WXXA 1KZPA 4FLHA 2R59A 3TG4A 2YQ8A 3V79K 2R5SA 4N3CA 1OCRE 2J4DA 2Y0BG 5CERB 1N54A 4GYWA 1MYOA 3AS8A 2XRZA 1LD8A 3KAEA 4I2ZA 4DPRA 3KD7A 2WXGA 3TL5A 1NA0A 4XE0A 2P9PG 2PZIA 1QZ2A 1E7UA 3UINC 3T5VA 3CHQA 1Z5SC 4U63A 3UX4A 1MX2A 3UIPC 1ZB1A 4DRXE 4WUYA 2EINE 5HS0A 3TGOA 2GROB 4NRHB 1HF8A 2C0MA 3ZIMA 4BFRA 2R05A 2PNNA 3ULYA 3AG1E 2X6IA 2LSVA 2KCVA 2H6GA 2OVBA 1U3CA 4IULA 3AS5A 3QC1A 3Q9UC 1OCCE 5EYLA 4AY6A 4UI9J 1SZ9A 3TG5A 4WNFA 2EIJE 4RVBA 4M7CA 3ZXSA 4CCAA 4WNGA 4UQZA 4UWGA 4G8LA 3Q7FA 5BV0A 3UXGA 1WAO1 3ASFA 2ETAA 3U3WA 3ASGA 4XEIG 4YDYA 4EQFA 2RD0A 2IEJA 3KS2A 3SFXA 4XZ4A 4I1MA 3G2UA 2XENA 3S2AA 1V55E 3FHEA 5B3SE 2XEHA 5BXOA 4C0MA 1VDYA 2J9QA 4EBAA 3MV3B 1FVHA 1NA3A 4JHJA 4MKTA 5T3RA 4X8QA 3D9OA 2KXPC 3ABKE 2X6KA 1JPLA 3V2XA 3ASDA 3Q73A 4F3VA 3ASOE 2WXJA 3CHRA 2VSXE 3SO8A 5DIZA 3RO3A 4WWPA 5BV1A 5BPPA 3I3NA 4U95D 4GMRA 5BNWA 3ULQA 2OV8A 4J6IA 2P2CP 2XS1A 4CGWA 4G26A 4I17A 3FU3A 1GW6A 3LVQE 4BSZB 3PNLB 2BUGA 4C0EA 2I1KA 2CHZA 2E2EA 5JJTA 2Y4UA 3GZ1A 5D2MC 4KXKB 3LDZA 3CHPA 3FUHA 1TJCA 3PEVB 2R03A 1PY1A 3AAAC 1EPUA 3EDTB 3Q4AB 4JW1A 4PH4B 2JABA 3UPVA 4TXQA 2BKKB 5HRYA 4JPSA 3FP3A 4FP7A 3ABME 1TEZA 4H7YA 4BTBA 5EIBE 3UM3A 1IKND 1N0RA 5G2NA 2WXIA 2EIKE 2A5EA 2EILE 3JXJA 4O1PA 1HXIA 4PS7A 1N52A 4HBDA 4KZCA 2WPVA 1WY6A 3ZPJA 1HG5A 2IFUA 1Z3XA 3URZA 5AQBA 2NYJA 3JUIA 4GZCA 1HE8A 5AENA 3EIQC 4TUMA 4L1BA 1OWMA 3CVQA 3CSFA 3V30A 4ACKA 3AG4E 4JA7A 2H6IA 2KC7A 4APFA 5ITZF 4GMJA 4GYOA 2HO1A 4KYOB 4HB5A 2DIWA 2FEZA 3MGBA 4ANWA 5A23A 2NXPA 1ELKA 4AEZC 3KEAA 5EKQD 2HM8A 3Q79A 3Q9NC 1XGWA 4LCTA 2LUHA 2R2LA 4K5AB 1SA5A 3VTXA 2XEVA 4V3IA 3C3RA 3FUKA 3BU8A 3QNKA 3X2QE 3MKQA 2VSOE 3Q47B 5ARGA 5ANLA 5B1AE 2XGSA 3L16A 4EHMA 1UN9A 4J0UA 1LD7A 2OEWA 4G23A 2WXHA 4GTSA 4GCNA 4KVMA 1E90A 1AP7A 4AY5A 5ENPD 4TV3A 3Q15A 3DXKG 4TUUA 3ZW3A 3HXBA 3F6QA 1SZAA 5HI7A 4AM9A 3Q7AA 2AVPA 3UMVA 4L23A 5LP0A 4QFVA 4JL0A 1ZBPA 3PZ3A 5M72A 3E37A 4UWHA 3FFLA 4DUIA 2FI7A 1YA0A 4ANXA 4HQDA 2CG2A 2R02A 3UKRG 3ZYKA 3O4ZA 1N9AA 1E8YA 3BQOA 1YMPA 3CQCB 3E4BA 4HOUA 3NQPA 2PM6A 1H2VC 4GCOA 1NL4A 4G25A 2IQCA 5AIJA 1BI7B 4YVOA 4WWNA 4CDMA 2Y1LE 5ENSD 3CK9A 3ZFWA 2QYUA 1K3ZD 4ATGA 4BY6A 4HFGA 2E0IA 3S7FA 3BUAA 2C2LA 1HZ4A 3FU5A 4N3BA 3D9PA 3KEZA 2X3MA 4FU3A 3T8KA 2IO3C 4HORA 1SW6A 2XGOA 3HXDA 3SBTB 2VJ8A 5E76A 4K03A 3FWVA 5HKPA 3W9FA 4W9RA 4N2QA 3G2TA 2X6JA 5AYWD 5EX3A 3JYSA 4F1SA 4YNDA 2FF4A 3CVYA 4B8CB 2VSYA 2X6FA 3QK0A 1BLXB 4DX5D 4NURA 4FA6A 3AS4A 3R7QA 2NC9A 2P9UG 5KCMA 1E8ZA 3HHMA 2L6BA 1JWGA 3J5QB 3G2WA 3EUVA 5BT1A 4YDEA 4F6RD 5AARA 2B0OE 1KLXA 2WXQA 2JEKA 4FHJA 3OTNA 3ZYMA 1N95A 3TWTA 2YNQA 4HOTA 3UT4A 3ML9A 4NQ0A 3ESLA 5BXUA 3NF1A 4CZ2D 3AG3E 4BX8A 1K1BA 4RG6A 3CVVA 2XZDG 3I4RB 3D9IA 1TN7A 4K5BA 4I9CA 4LNUD 2I2OA 5CCLA 3TWSA 4G24A 3UI2A 1EDUA 3AG2E 3NZSA 2OCCE 1DC2A 1D8DA 4U8VD 2P58C 3CVXA 4BESA 4AOFA 5G04C 1MJ0A 5KWDA 3SD5A 2OOEA 3L08A 3ZHEA 1QNFA 3Q49B 3CGHA 3PZDA 3MKQB 3L6AA 3LXUX 4A55A 4PUCA 1TNBA 2DYRE 5A7DB 2WQHA 3L22A 1FT2A 3IEGA 1IQUA 4OYSA 4TRQA 4JVSA 4U07A 4IRUA 5D0QD 3QWPA 4LRZA 5AQAA 2QFCA 5AQ9A 1BI8B 4RG9A 3LVRE 2RFMA 5AN8A 5LOZA 2J8SD 4U0ZA 2Y69E 3U66A 1OCOE 4B93B 3TWVA 4F1PA 5JHBA 2VGXA 3PE3A 2BF0X 5EIDA 4OAUC 1OWLA 4U8YD 4FJZA 3HDXA 5KBAA 2MOWA 4BT8A 4JZYA 3U9WA 2IY0C 3CK8A 4FADA 3CEQA 3DXMG 3DSVA 2IOSA 2X38A 4CEMA 2EQXA 3JQ1A 2ETCA 1OCZE 5FIOA 1OXJA 3T9KA 4J7WA 1U2VG 1B89A 3E30A 2J09A 2R17C 4HXIA 5H7PA 4UWKA 3B7RL 1H2TC 2GRMA 3PRZA 4XI0A 1UW4B 3E32A 2ILRA 1TN6A 4Y6CA 2WXKA 3CHOA 4L2LA 2ZIRA 3OXLA 4DK5A 2HE0A 1V54E 4DI4A 1MX4A 3AU5A 3ESKA 1BD8A 5CBNA 1N4RA 1E8WA 5J90A 2VQ2A 4OVUA 4GZ5A 3E34A 3QJZA 3TJPA 2H6HA 3DSWA 4BTAA 3PNTB 2WMNA 3ZKJA 1DCQA 2VSNA 3FU6A 3IBEA 4GA1A 1UOHA 2XHEA 5ARFA 5KNHD 1A5EA 2H6FA 3UM1A 2M63A 1HU3A 3U64A 4UI9C 5LFAA 3MCXA 3B7SA 3UUXA 1W3BA 2BKGA 1O1TA 4I1OB 2GRRB 3EHNA 4UI9K 3JUEA 2FULA 1PC2A 4LEUA 2IOLA 4N39A 2UY1A 3ZYLA 1HG2A 3ZGQA 4B8AA 2QZAA 3T8MA 1OWPA 3C3QA 5C1DA 5C2YA 3CVUA 1MX6A 1QQEA 3PZ1A 4UWFA 4U04A 4QQIA 4IN3B 3DSUA 3ASHA 3ZVVA 5DBKA 2FO1E 4I2WA 4URKA 3CKCA 3R9MA 5LCWJ 4DX2A 2GRPB 3AJIA 2WVIA 2L9BA 2Y4TA 3UTMA 3LKUA 3TXMA 5FT9A 2DVWA 4PDXA 4FC8A 3HVEA 4UWLA 5EYPF 1TJFA 4ILGA 4EZJA 2WXMA 5FQ6A 3SGHA 2AW6A 3FEYA 4AIFA 3ULEG 5KJKA 2LNIA 1MHQA 1UG3A 5ENRD 5G55A 1FVFA 5A6CA 2AJAA 4KT6B 1Q2ZA 4UQXA 2VGXB 2IJGX 4J8FA 4M3OA 1KPSB 5JMND 3LY7A 2VTBA 2XEEA 4L2YA 4CGVA 3FUEA 5FINA 3FUDA 2OEVA 4AXHA 4ABNA 4I6EA 3HXCA 3SQVA 4NIKA 2RG8A 1LF8A 5EILA 4YDWA 3ZUVB 4YVQC 2ZU6B 3ASNE 3L82A 5CMYA 5JJ7A 3SF4A 1N11A 3IV0A 3FU0A 3D9HA 2V4HC 5ENTD 2CG3A 4F7AA 4JB8P 3FTVA 4H7XA 4A1GA 2BEDA 4HVBA 2IO2C 4PS8A 4GTMA 4MLPA 3DWLG 2RKKA 4EPZA 4Q69A 3PREA 1FCHA 1INZA 1SQMA 3ML8A 1A17A 1FT1A 2QC9A 4KVOA 4TXRA 3RRNB 1E8XA 3FDHA 4MS6A 3PZ4A 2IF4A 3SHFA 4AVXA 3QDNA 4U0UA 3NOCD 3TWXA 2JLBA 4GTRA 1JWFA 1NP7A 3SBSA 4I6JA 3N71A 3C5RA 4KBQA 1PAQA 1G3NB 3TWQA 1OUVA 2LXLA 3LEWA 1IXVA 2FBNA 3B7TA 3FEXA 5FTPA 1NI1A 2PL2A 4J8EA 4HI8A 4BX9A 1Z6TA 1HS6A 3I4GA 4E85A 1N4SA 3DPYA 2DWZA 2ONDA 3VLFA 2LO6A 4GTVA 3E33A 1TNUA 5BUZA 2ZXWE 3O48A
chains in the Genus database with same CATH topology
4DX6D 2KXPC 4HBDA 4YDWA 2VGEA 4K5CA 3ZUVB 4ZHBA 3V2XA 3NBNB 4BEPA 3B95A 1K1AA 4ATZD 4HLLA 2ZGDA 1N0QA 4HRLA 3ZNGA 4HRMB 3SO8A 2V5QC 5EN5D 1N11A 1BLXB 2RFAA 2HE0A 2KBXA 3F6QA 3DEPA 4QQIA 5ENQD 5AQ7A 5KNGA 1MX2A 1MX4A 1WG0A 4LG6A 5CEDB 1BU9A 4DRXE 4DX5D 3D9HA 2V4HC 5AQBA 4O60A 4U95D 5ENTD 2NYJA 5HS0A 4J8YA 4ZFHA 2FO1E 5AQAA 4GMRA 4JB8P 1BD8A 5AQ9A 5CBNA 1SVXA 4QFVA 2ZGGA 2PNNA 1WDYA 1BI8B 3J5PA 5D66A 4DX2A 2P2CP 3AJIA 2RFMA 2F8XK 5AN8A 3UTMA 2L6BA 1AWCB 3J5QB 4TUMA 2J8SD 1TR4A 4O1OA 3V2OA 1IHBA 4F6RD 4BERA 5AARA 2B0OE 4BETA 2MYOA 4DUIA 4BSZB 3V30A 2DVWA 4HNAD 5ITZF 4B93B 3DEOA 2QC9A 5EYPF 3TWVA 4F1PA 2DZOA 3IXEA 3Q9UC 3TWTA 5EYLA 4HB5A 2QYJA 1QYMA 1S70B 5EIDA 4HQDA 5BXUA 4OAUC 4U8YD 5ENOD 4CZ2D 1K1BA 5KBAA 3TWUA 3KEAA 1YMPA 3ZKJA 1DCQA 3ZU7B 3Q9NC 3V31A 4OAVB 4G8LA 3W9GA 2ETBA 5ENRD 3EHRA 3JXIA 3NOCD 3TWXA 2XZDG 4K5AB 2AJAA 3B7BA 4RLYA 3AAAC 4C48B 3UXGA 1UOHA 4K5BA 5KNHD 1NFIE 3HG0D 1A5EA 4LNUD 2ETAA 4HI9A 1BI7B 3TWWA 4YDYA 4GPMA 4G8KA 2ETCA 3C5RA 2F8YA 2Y1LE 5ENSD 5FIOA 4U96D 5JMND 3TWSA 3UI2A 4LSZE 3T9KA 1K3ZD 2JABA 4J7WA 1G3NB 2BKGA 2XEEA 1DC2A 4DX1A 4U8VD 3EU9A 3TWQA 2XENA 3NOGD 4A63B 2BKKB 4BESA 2F37A 3JUEA 5HRYA 2XEHA 1IXVA 4N5QA 5FINA 1MJ0A 3V79K 5EIBE 4HI8A 1OT8A 5BXOA 3LJNA 2Y0BG 3EHQA 5KWDA 4CYMD 3T8KA 5CERB 4DX7D 5JA4D 1SW6A 4UUCA 1IKND 1N0RA 4Z68A 5CECB 2DWZA 1YYHA 5AAOA 2XZTG 2A5EA 3HRAA 1D9SA 4HRNA 4NIKA 1MYOA 1YCSB 3JXJA 5HKPA 5CBOA 4O1PA 3W9FA 3TWRA 1OY3D 2DZNA 1AP7A 1MX6A 5EILA 5ENPD 5CEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DX6 D;  2KXP C;  4HBD A;  4YDW A;  2VGE A;  4K5C A;  3ZUV B;  4ZHB A;  3V2X A;  3NBN B;  4BEP A;  3B95 A;  1K1A A;  4ATZ D;  4HLL A;  2ZGD A;  1N0Q A;  4HRL A;  3ZNG A;  4HRM B;  3SO8 A;  2V5Q C;  5EN5 D;  1N11 A;  1BLX B;  2RFA A;  2HE0 A;  2KBX A;  3F6Q A;  3DEP A;  4QQI A;  5ENQ D;  5AQ7 A;  5KNG A;  1MX2 A;  1MX4 A;  1WG0 A;  4LG6 A;  5CED B;  1BU9 A;  4DRX E;  4DX5 D;  3D9H A;  2V4H C;  5AQB A;  4O60 A;  4U95 D;  5ENT D;  2NYJ A;  5HS0 A;  4J8Y A;  4ZFH A;  2FO1 E;  5AQA A;  4GMR A;  4JB8 P;  1BD8 A;  5AQ9 A;  5CBN A;  1SVX A;  4QFV A;  2ZGG A;  2PNN A;  1WDY A;  1BI8 B;  3J5P A;  5D66 A;  4DX2 A;  2P2C P;  3AJI A;  2RFM A;  2F8X K;  5AN8 A;  3UTM A;  2L6B A;  1AWC B;  3J5Q B;  4TUM A;  2J8S D;  1TR4 A;  4O1O A;  3V2O A;  1IHB A;  4F6R D;  4BER A;  5AAR A;  2B0O E;  4BET A;  2MYO A;  4DUI A;  4BSZ B;  3V30 A;  2DVW A;  4HNA D;  5ITZ F;  4B93 B;  3DEO A;  2QC9 A;  5EYP F;  3TWV A;  4F1P A;  2DZO A;  3IXE A;  3Q9U C;  3TWT A;  5EYL A;  4HB5 A;  2QYJ A;  1QYM A;  1S70 B;  5EID A;  4HQD A;  5BXU A;  4OAU C;  4U8Y D;  5ENO D;  4CZ2 D;  1K1B A;  5KBA A;  3TWU A;  3KEA A;  1YMP A;  3ZKJ A;  1DCQ A;  3ZU7 B;  3Q9N C;  3V31 A;  4OAV B;  4G8L A;  3W9G A;  2ETB A;  5ENR D;  3EHR A;  3JXI A;  3NOC D;  3TWX A;  2XZD G;  4K5A B;  2AJA A;  3B7B A;  4RLY A;  3AAA C;  4C48 B;  3UXG A;  1UOH A;  4K5B A;  5KNH D;  1NFI E;  3HG0 D;  1A5E A;  4LNU D;  2ETA A;  4HI9 A;  1BI7 B;  3TWW A;  4YDY A;  4GPM A;  4G8K A;  2ETC A;  3C5R A;  2F8Y A;  2Y1L E;  5ENS D;  5FIO A;  4U96 D;  5JMN D;  3TWS A;  3UI2 A;  4LSZ E;  3T9K A;  1K3Z D;  2JAB A;  4J7W A;  1G3N B;  2BKG A;  2XEE A;  1DC2 A;  4DX1 A;  4U8V D;  3EU9 A;  3TWQ A;  2XEN A;  3NOG D;  4A63 B;  2BKK B;  4BES A;  2F37 A;  3JUE A;  5HRY A;  2XEH A;  1IXV A;  4N5Q A;  5FIN A;  1MJ0 A;  3V79 K;  5EIB E;  4HI8 A;  1OT8 A;  5BXO A;  3LJN A;  2Y0B G;  3EHQ A;  5KWD A;  4CYM D;  3T8K A;  5CER B;  4DX7 D;  5JA4 D;  1SW6 A;  4UUC A;  1IKN D;  1N0R A;  4Z68 A;  5CEC B;  2DWZ A;  1YYH A;  5AAO A;  2XZT G;  2A5E A;  3HRA A;  1D9S A;  4HRN A;  4NIK A;  1MYO A;  1YCS B;  3JXJ A;  5HKP A;  5CBO A;  4O1P A;  3W9F A;  3TWR A;  1OY3 D;  2DZN A;  1AP7 A;  1MX6 A;  5EIL A;  5ENP D;  5CEA A; 
#chains in the Genus database with same CATH topology
 3DPD A;  4A3T A;  4ZHB A;  4J8S A;  2LAI A;  3EJN A;  5CED B;  1NZN A;  4LG6 A;  1IQR A;  1OWO A;  1MQS A;  2I1J A;  3ABL E;  4JHR A;  3ZYQ A;  4APO A;  3DSS A;  4E6H A;  3B13 A;  4ZFH A;  1UJJ A;  3MKR A;  1X5B A;  3IHY A;  2KAT A;  2ZGG A;  1U3D A;  3DST A;  5G05 J;  4I9E A;  5ENN A;  2P9I G;  2MYO A;  2V0P A;  3DRA A;  3MZL B;  4GTQ A;  1QYM A;  3FTS A;  3LY9 A;  3PZ2 A;  1ZU2 A;  1HO8 A;  4K0R A;  3C98 A;  3JXI A;  3ZXP A;  3HVE B;  1S64 A;  5T8I A;  3B7U X;  3NAW A;  3TWW A;  2LXM A;  4JEH A;  2YIN A;  3VTY A;  3CVN A;  3UM0 A;  3T5X A;  3FTU A;  2P9N G;  4U7E B;  3EU5 A;  1KT0 A;  4LSZ E;  4XX5 A;  5FJY A;  3QKY A;  2GW1 A;  4O6F A;  4A63 B;  4GPK A;  5AJL A;  4D10 C;  2HYZ A;  3PDN A;  1RW2 A;  3EHQ A;  3GYZ A;  2AXU A;  4DX7 D;  5JA4 D;  1YYH A;  4HRN A;  2VTB B;  1DVP A;  2B6C A;  3CLJ A;  5EX0 A;  4L9P A;  2L6J A;  5FQ8 A;  2P9S G;  3I5P A;  4ATZ D;  4HRL A;  3L9T A;  5CRV A;  1IHG A;  2V5Q C;  2MHK A;  3JQ0 A;  3FH7 A;  3DEP A;  2KCL A;  5FQ4 A;  3TXN A;  3D9J A;  1N4Q A;  4A1S A;  2WXP A;  4FJY A;  4G11 A;  4BT9 A;  2DYS E;  2X6H A;  3QWV A;  2PQN A;  2WMO A;  3ZN3 A;  2ION A;  5HQ8 A;  4C9B B;  4LUN U;  2PM7 A;  2DZO A;  4U0S A;  3CVL A;  3S7B A;  4F53 A;  3PVL A;  3L54 A;  2DCP A;  4KZ0 A;  4OAV B;  3FY4 A;  4DJA A;  1TNY A;  3LJ3 A;  3HG0 D;  1HFA A;  3FUM A;  1KZO A;  2KZT A;  1O1R A;  3EU9 A;  2HR2 A;  2WQ7 A;  4N5Q A;  3ISM C;  3LPZ A;  3FUL A;  3SZ7 A;  4FHK A;  3CK7 A;  2XZT G;  4JHK A;  5LX8 A;  4MBG A;  4RQI A;  4G2V A;  1S0P A;  3ONK A;  1K1A A;  1N0Q A;  3SFZ A;  4GA2 A;  2P9L G;  3L17 A;  5FZS A;  1H19 A;  4U8H A;  3TAX A;  4JC8 A;  3C3O A;  4Q94 A;  2V4L A;  1WM5 A;  1EF1 C;  1WDY A;  1TYQ G;  2ZIS A;  3DBS A;  1N94 A;  3MA5 A;  4GTT A;  1N4P A;  3DSX A;  4EZL A;  3RAU A;  4HNA D;  5CCM A;  2EIM E;  2F0Y A;  2QYJ A;  5FZR A;  2WXR A;  1D8E A;  4GB9 A;  4AV7 A;  1O1S A;  1RZ4 A;  3V31 A;  3ZRH A;  4EBA G;  1OWN A;  3QOU A;  1JUQ A;  1NFI E;  3CV0 A;  4HI9 A;  2J49 A;  5BW8 C;  3CVW A;  2AXZ A;  3CKB A;  5J08 A;  4LNG A;  3PS6 A;  4DX1 A;  1TNZ A;  3RJV A;  5CHE E;  4GA0 A;  3APD A;  3Q78 A;  1SA4 A;  2FO7 A;  3RRM B;  3LJN A;  5EDS A;  3RU0 A;  4Z68 A;  5CEC B;  4ACL A;  5AAO A;  3LCA A;  3HRA A;  1MZC A;  5FWQ A;  3TWR A;  3RO2 A;  3UT8 A;  3L13 A;  4LNB A;  3U4T A;  3RSE G;  4GZ6 A;  3LS8 A;  3B95 A;  4N3A A;  4HLL A;  3OAW A;  5KNG A;  5ENQ D;  1XNF A;  2KBX A;  2XPZ A;  1BU9 A;  2XQ0 A;  2WXN A;  3LY8 A;  3WG7 E;  1E7V A;  1EYH A;  3GZS A;  1X81 A;  2YHC A;  4BET A;  3PH0 C;  1JCR A;  4FLB A;  4GAA A;  4HOQ A;  3ZEF A;  3ZHE B;  1JCQ A;  1DCE A;  4BSX A;  4L7T A;  2CFZ A;  3P1U A;  4GYY A;  3FUI A;  4DLO A;  3K9I A;  2Y3A A;  3CIA A;  4JEU A;  2VYI A;  2Q7F A;  2AWI A;  3CHM A;  2ETB A;  2GRL A;  4GZ3 A;  5CRU A;  3ENE A;  4C48 B;  2YHE A;  5T4Y A;  4ME2 A;  3FTW A;  4U96 D;  5JJ6 A;  3D3M A;  4GTO A;  2F37 A;  1OT8 A;  2KZT B;  4Q96 A;  4MRU A;  3NZU A;  5CBO A;  3HXE A;  5IY5 E;  2DZN A;  3JCK C;  3GZ2 A;  3MEK A;  5CEA A;  4ANU A;  3KSL A;  4EZK A;  4UQY A;  4BEP A;  3Q75 A;  3ZNG A;  3UKU G;  4N2S A;  2RFA A;  3MX3 A;  4JA9 A;  1BPO A;  3PE4 A;  4CDN A;  3CST A;  2V8S E;  5CMW A;  3RKV A;  1WG0 A;  3CQG B;  3AU4 A;  2KCK A;  4J8Y A;  2C0L A;  1HH8 A;  4FUL A;  1SVX A;  3MV2 B;  4XIF A;  5D66 A;  3FUN A;  3BEE A;  3APC A;  4HS2 A;  1TR4 A;  4O1O A;  3CHS A;  3IHV A;  1KT1 A;  4CT0 A;  5AJD A;  2I6H A;  4ILH B;  3RRU A;  5ENO D;  5E75 A;  3SFY A;  3TWU A;  5LCW C;  3QAQ A;  3W9G A;  3EHR A;  3BG1 B;  3B7B A;  3PEU B;  3D9N A;  4BWR A;  3D9L A;  5KJM A;  2VGY A;  1H2U A;  4WAF A;  2NSZ A;  4GPM A;  3ONL A;  2XPY A;  1LTX A;  2LAH A;  4XKB A;  2GGF A;  2AXV A;  2J08 A;  2P9K G;  3FUJ A;  3NOG D;  2MRI A;  1K8K G;  3PUJ A;  3UQ3 A;  2XCC A;  1Z3Y A;  2A4Z A;  2L0I A;  4CYM D;  4UUC A;  2XS8 A;  1JCS A;  4ILI A;  1ELW A;  5FQ7 A;  1YCS B;  2WQ6 A;  3RIB A;  3EIJ A;  3C72 A;  1OY3 D;  3FTY A;  2QY7 A;  2PQR A;  4DX6 D;  1S63 A;  2VGE A;  4OVV A;  3D9M A;  3VLE A;  1Y6I A;  2ZGD A;  4HRM B;  4WWO A;  3SI5 A;  5AQ7 A;  1TN8 A;  3QAR A;  2A5U A;  4CT4 A;  3LYA A;  4G1T A;  5B1B E;  4XKC A;  4R7L A;  3VLD A;  4GTP A;  5ANR A;  4Y6W A;  2BTD A;  2GRQ B;  4EEC A;  1H6O A;  1AWC B;  3V2O A;  1IHB A;  4BER A;  3EHM A;  2UY1 B;  5FZQ A;  3DEO A;  3OXG A;  1E96 B;  1UJK A;  1S70 B;  5D0O D;  4XI9 A;  3APF A;  4DLQ A;  1H6P A;  3UT7 A;  4A3V A;  4TXP A;  4N5C A;  3ZU7 B;  2UWJ G;  4CRW A;  3FH8 A;  1FPP A;  5G04 J;  3NB2 A;  2XPI A;  2WB2 A;  2OVF A;  1H6K A;  4DI3 A;  3FTZ A;  3G2V A;  5KJL A;  3Q5M A;  4I6G A;  4AP2 A;  3BG0 B;  1IYG A;  2J4B A;  1QBQ A;  4GZD A;  3HYM B;  4I43 A;  2CHX A;  3IKO B;  3FTX A;  4JXT A;  3R9A B;  2XRY A;  1D9S A;  2DBA A;  1Y8M A;  2WM9 A;  3QB2 A;  4ANV A;  3G2S A;  5JHA A;  1TNO A;  3NBN B;  3MYV A;  4K5C A;  5KJN A;  3KSQ A;  3UM2 A;  4CDR A;  1L5J A;  2WXO A;  4PS3 A;  2CHW A;  5EN5 D;  4JD2 G;  3FH5 A;  1H0A A;  4WND A;  4KMO A;  4B0Z A;  4HLE A;  4O60 A;  1UN8 A;  2KM4 A;  3FUF A;  3D9K A;  4P29 A;  3J5P A;  2F8X K;  4LER A;  2I9C A;  3MJW A;  2XCB A;  2V5F A;  3CVP A;  1ELR A;  2GRN B;  4B89 A;  4NAC A;  3HIZ A;  3RK6 A;  2J07 A;  3IXE A;  3HXF A;  3UIO C;  2CFU A;  4B94 A;  4IYP A;  3SY2 A;  4HOS A;  2WXF A;  3SNX A;  3OXF A;  3P2B A;  1P5Q A;  1DNP A;  2WXL A;  5G05 C;  4YDO A;  2XGM A;  3GW4 A;  4AJW A;  4GU5 A;  4RLY A;  1O5M A;  4GML A;  2IU1 A;  4WNE A;  4G8K A;  3R7R A;  4J8D A;  2LSU A;  2F8Y A;  1HX8 A;  3S7J A;  3S7D A;  4RSY A;  4I1A A;  2L0T B;  3PUK A;  3QWW A;  3CR3 A;  3WXX A;  1KZP A;  4FLH A;  2R59 A;  3TG4 A;  2YQ8 A;  3V79 K;  2R5S A;  4N3C A;  1OCR E;  2J4D A;  2Y0B G;  5CER B;  1N54 A;  4GYW A;  1MYO A;  3AS8 A;  2XRZ A;  1LD8 A;  3KAE A;  4I2Z A;  4DPR A;  3KD7 A;  2WXG A;  3TL5 A;  1NA0 A;  4XE0 A;  2P9P G;  2PZI A;  1QZ2 A;  1E7U A;  3UIN C;  3T5V A;  3CHQ A;  1Z5S C;  4U63 A;  3UX4 A;  1MX2 A;  3UIP C;  1ZB1 A;  4DRX E;  4WUY A;  2EIN E;  5HS0 A;  3TGO A;  2GRO B;  4NRH B;  1HF8 A;  2C0M A;  3ZIM A;  4BFR A;  2R05 A;  2PNN A;  3ULY A;  3AG1 E;  2X6I A;  2LSV A;  2KCV A;  2H6G A;  2OVB A;  1U3C A;  4IUL A;  3AS5 A;  3QC1 A;  3Q9U C;  1OCC E;  5EYL A;  4AY6 A;  4UI9 J;  1SZ9 A;  3TG5 A;  4WNF A;  2EIJ E;  4RVB A;  4M7C A;  3ZXS A;  4CCA A;  4WNG A;  4UQZ A;  4UWG A;  4G8L A;  3Q7F A;  5BV0 A;  3UXG A;  1WAO 1;  3ASF A;  2ETA A;  3U3W A;  3ASG A;  4XEI G;  4YDY A;  4EQF A;  2RD0 A;  2IEJ A;  3KS2 A;  3SFX A;  4XZ4 A;  4I1M A;  3G2U A;  2XEN A;  3S2A A;  1V55 E;  3FHE A;  5B3S E;  2XEH A;  5BXO A;  4C0M A;  1VDY A;  2J9Q A;  4EBA A;  3MV3 B;  1FVH A;  1NA3 A;  4JHJ A;  4MKT A;  5T3R A;  4X8Q A;  3D9O A;  2KXP C;  3ABK E;  2X6K A;  1JPL A;  3V2X A;  3ASD A;  3Q73 A;  4F3V A;  3ASO E;  2WXJ A;  3CHR A;  2VSX E;  3SO8 A;  5DIZ A;  3RO3 A;  4WWP A;  5BV1 A;  5BPP A;  3I3N A;  4U95 D;  4GMR A;  5BNW A;  3ULQ A;  2OV8 A;  4J6I A;  2P2C P;  2XS1 A;  4CGW A;  4G26 A;  4I17 A;  3FU3 A;  1GW6 A;  3LVQ E;  4BSZ B;  3PNL B;  2BUG A;  4C0E A;  2I1K A;  2CHZ A;  2E2E A;  5JJT A;  2Y4U A;  3GZ1 A;  5D2M C;  4KXK B;  3LDZ A;  3CHP A;  3FUH A;  1TJC A;  3PEV B;  2R03 A;  1PY1 A;  3AAA C;  1EPU A;  3EDT B;  3Q4A B;  4JW1 A;  4PH4 B;  2JAB A;  3UPV A;  4TXQ A;  2BKK B;  5HRY A;  4JPS A;  3FP3 A;  4FP7 A;  3ABM E;  1TEZ A;  4H7Y A;  4BTB A;  5EIB E;  3UM3 A;  1IKN D;  1N0R A;  5G2N A;  2WXI A;  2EIK E;  2A5E A;  2EIL E;  3JXJ A;  4O1P A;  1HXI A;  4PS7 A;  1N52 A;  4HBD A;  4KZC A;  2WPV A;  1WY6 A;  3ZPJ A;  1HG5 A;  2IFU A;  1Z3X A;  3URZ A;  5AQB A;  2NYJ A;  3JUI A;  4GZC A;  1HE8 A;  5AEN A;  3EIQ C;  4TUM A;  4L1B A;  1OWM A;  3CVQ A;  3CSF A;  3V30 A;  4ACK A;  3AG4 E;  4JA7 A;  2H6I A;  2KC7 A;  4APF A;  5ITZ F;  4GMJ A;  4GYO A;  2HO1 A;  4KYO B;  4HB5 A;  2DIW A;  2FEZ A;  3MGB A;  4ANW A;  5A23 A;  2NXP A;  1ELK A;  4AEZ C;  3KEA A;  5EKQ D;  2HM8 A;  3Q79 A;  3Q9N C;  1XGW A;  4LCT A;  2LUH A;  2R2L A;  4K5A B;  1SA5 A;  3VTX A;  2XEV A;  4V3I A;  3C3R A;  3FUK A;  3BU8 A;  3QNK A;  3X2Q E;  3MKQ A;  2VSO E;  3Q47 B;  5ARG A;  5ANL A;  5B1A E;  2XGS A;  3L16 A;  4EHM A;  1UN9 A;  4J0U A;  1LD7 A;  2OEW A;  4G23 A;  2WXH A;  4GTS A;  4GCN A;  4KVM A;  1E90 A;  1AP7 A;  4AY5 A;  5ENP D;  4TV3 A;  3Q15 A;  3DXK G;  4TUU A;  3ZW3 A;  3HXB A;  3F6Q A;  1SZA A;  5HI7 A;  4AM9 A;  3Q7A A;  2AVP A;  3UMV A;  4L23 A;  5LP0 A;  4QFV A;  4JL0 A;  1ZBP A;  3PZ3 A;  5M72 A;  3E37 A;  4UWH A;  3FFL A;  4DUI A;  2FI7 A;  1YA0 A;  4ANX A;  4HQD A;  2CG2 A;  2R02 A;  3UKR G;  3ZYK A;  3O4Z A;  1N9A A;  1E8Y A;  3BQO A;  1YMP A;  3CQC B;  3E4B A;  4HOU A;  3NQP A;  2PM6 A;  1H2V C;  4GCO A;  1NL4 A;  4G25 A;  2IQC A;  5AIJ A;  1BI7 B;  4YVO A;  4WWN A;  4CDM A;  2Y1L E;  5ENS D;  3CK9 A;  3ZFW A;  2QYU A;  1K3Z D;  4ATG A;  4BY6 A;  4HFG A;  2E0I A;  3S7F A;  3BUA A;  2C2L A;  1HZ4 A;  3FU5 A;  4N3B A;  3D9P A;  3KEZ A;  2X3M A;  4FU3 A;  3T8K A;  2IO3 C;  4HOR A;  1SW6 A;  2XGO A;  3HXD A;  3SBT B;  2VJ8 A;  5E76 A;  4K03 A;  3FWV A;  5HKP A;  3W9F A;  4W9R A;  4N2Q A;  3G2T A;  2X6J A;  5AYW D;  5EX3 A;  3JYS A;  4F1S A;  4YND A;  2FF4 A;  3CVY A;  4B8C B;  2VSY A;  2X6F A;  3QK0 A;  1BLX B;  4DX5 D;  4NUR A;  4FA6 A;  3AS4 A;  3R7Q A;  2NC9 A;  2P9U G;  5KCM A;  1E8Z A;  3HHM A;  2L6B A;  1JWG A;  3J5Q B;  3G2W A;  3EUV A;  5BT1 A;  4YDE A;  4F6R D;  5AAR A;  2B0O E;  1KLX A;  2WXQ A;  2JEK A;  4FHJ A;  3OTN A;  3ZYM A;  1N95 A;  3TWT A;  2YNQ A;  4HOT A;  3UT4 A;  3ML9 A;  4NQ0 A;  3ESL A;  5BXU A;  3NF1 A;  4CZ2 D;  3AG3 E;  4BX8 A;  1K1B A;  4RG6 A;  3CVV A;  2XZD G;  3I4R B;  3D9I A;  1TN7 A;  4K5B A;  4I9C A;  4LNU D;  2I2O A;  5CCL A;  3TWS A;  4G24 A;  3UI2 A;  1EDU A;  3AG2 E;  3NZS A;  2OCC E;  1DC2 A;  1D8D A;  4U8V D;  2P58 C;  3CVX A;  4BES A;  4AOF A;  5G04 C;  1MJ0 A;  5KWD A;  3SD5 A;  2OOE A;  3L08 A;  3ZHE A;  1QNF A;  3Q49 B;  3CGH A;  3PZD A;  3MKQ B;  3L6A A;  3LXU X;  4A55 A;  4PUC A;  1TNB A;  2DYR E;  5A7D B;  2WQH A;  3L22 A;  1FT2 A;  3IEG A;  1IQU A;  4OYS A;  4TRQ A;  4JVS A;  4U07 A;  4IRU A;  5D0Q D;  3QWP A;  4LRZ A;  5AQA A;  2QFC A;  5AQ9 A;  1BI8 B;  4RG9 A;  3LVR E;  2RFM A;  5AN8 A;  5LOZ A;  2J8S D;  4U0Z A;  2Y69 E;  3U66 A;  1OCO E;  4B93 B;  3TWV A;  4F1P A;  5JHB A;  2VGX A;  3PE3 A;  2BF0 X;  5EID A;  4OAU C;  1OWL A;  4U8Y D;  4FJZ A;  3HDX A;  5KBA A;  2MOW A;  4BT8 A;  4JZY A;  3U9W A;  2IY0 C;  3CK8 A;  4FAD A;  3CEQ A;  3DXM G;  3DSV A;  2IOS A;  2X38 A;  4CEM A;  2EQX A;  3JQ1 A;  2ETC A;  1OCZ E;  5FIO A;  1OXJ A;  3T9K A;  4J7W A;  1U2V G;  1B89 A;  3E30 A;  2J09 A;  2R17 C;  4HXI A;  5H7P A;  4UWK A;  3B7R L;  1H2T C;  2GRM A;  3PRZ A;  4XI0 A;  1UW4 B;  3E32 A;  2ILR A;  1TN6 A;  4Y6C A;  2WXK A;  3CHO A;  4L2L A;  2ZIR A;  3OXL A;  4DK5 A;  2HE0 A;  1V54 E;  4DI4 A;  1MX4 A;  3AU5 A;  3ESK A;  1BD8 A;  5CBN A;  1N4R A;  1E8W A;  5J90 A;  2VQ2 A;  4OVU A;  4GZ5 A;  3E34 A;  3QJZ A;  3TJP A;  2H6H A;  3DSW A;  4BTA A;  3PNT B;  2WMN A;  3ZKJ A;  1DCQ A;  2VSN A;  3FU6 A;  3IBE A;  4GA1 A;  1UOH A;  2XHE A;  5ARF A;  5KNH D;  1A5E A;  2H6F A;  3UM1 A;  2M63 A;  1HU3 A;  3U64 A;  4UI9 C;  5LFA A;  3MCX A;  3B7S A;  3UUX A;  1W3B A;  2BKG A;  1O1T A;  4I1O B;  2GRR B;  3EHN A;  4UI9 K;  3JUE A;  2FUL A;  1PC2 A;  4LEU A;  2IOL A;  4N39 A;  2UY1 A;  3ZYL A;  1HG2 A;  3ZGQ A;  4B8A A;  2QZA A;  3T8M A;  1OWP A;  3C3Q A;  5C1D A;  5C2Y A;  3CVU A;  1MX6 A;  1QQE A;  3PZ1 A;  4UWF A;  4U04 A;  4QQI A;  4IN3 B;  3DSU A;  3ASH A;  3ZVV A;  5DBK A;  2FO1 E;  4I2W A;  4URK A;  3CKC A;  3R9M A;  5LCW J;  4DX2 A;  2GRP B;  3AJI A;  2WVI A;  2L9B A;  2Y4T A;  3UTM A;  3LKU A;  3TXM A;  5FT9 A;  2DVW A;  4PDX A;  4FC8 A;  3HVE A;  4UWL A;  5EYP F;  1TJF A;  4ILG A;  4EZJ A;  2WXM A;  5FQ6 A;  3SGH A;  2AW6 A;  3FEY A;  4AIF A;  3ULE G;  5KJK A;  2LNI A;  1MHQ A;  1UG3 A;  5ENR D;  5G55 A;  1FVF A;  5A6C A;  2AJA A;  4KT6 B;  1Q2Z A;  4UQX A;  2VGX B;  2IJG X;  4J8F A;  4M3O A;  1KPS B;  5JMN D;  3LY7 A;  2VTB A;  2XEE A;  4L2Y A;  4CGV A;  3FUE A;  5FIN A;  3FUD A;  2OEV A;  4AXH A;  4ABN A;  4I6E A;  3HXC A;  3SQV A;  4NIK A;  2RG8 A;  1LF8 A;  5EIL A;  4YDW A;  3ZUV B;  4YVQ C;  2ZU6 B;  3ASN E;  3L82 A;  5CMY A;  5JJ7 A;  3SF4 A;  1N11 A;  3IV0 A;  3FU0 A;  3D9H A;  2V4H C;  5ENT D;  2CG3 A;  4F7A A;  4JB8 P;  3FTV A;  4H7X A;  4A1G A;  2BED A;  4HVB A;  2IO2 C;  4PS8 A;  4GTM A;  4MLP A;  3DWL G;  2RKK A;  4EPZ A;  4Q69 A;  3PRE A;  1FCH A;  1INZ A;  1SQM A;  3ML8 A;  1A17 A;  1FT1 A;  2QC9 A;  4KVO A;  4TXR A;  3RRN B;  1E8X A;  3FDH A;  4MS6 A;  3PZ4 A;  2IF4 A;  3SHF A;  4AVX A;  3QDN A;  4U0U A;  3NOC D;  3TWX A;  2JLB A;  4GTR A;  1JWF A;  1NP7 A;  3SBS A;  4I6J A;  3N71 A;  3C5R A;  4KBQ A;  1PAQ A;  1G3N B;  3TWQ A;  1OUV A;  2LXL A;  3LEW A;  1IXV A;  2FBN A;  3B7T A;  3FEX A;  5FTP A;  1NI1 A;  2PL2 A;  4J8E A;  4HI8 A;  4BX9 A;  1Z6T A;  1HS6 A;  3I4G A;  4E85 A;  1N4S A;  3DPY A;  2DWZ A;  2OND A;  3VLF A;  2LO6 A;  4GTV A;  3E33 A;  1TNU A;  5BUZ A;  2ZXW E;  3O48 A; 
#chains in the Genus database with same CATH homology
 4DX6 D;  2KXP C;  4HBD A;  4YDW A;  2VGE A;  4K5C A;  3ZUV B;  4ZHB A;  3V2X A;  3NBN B;  4BEP A;  3B95 A;  1K1A A;  4ATZ D;  4HLL A;  2ZGD A;  1N0Q A;  4HRL A;  3ZNG A;  4HRM B;  3SO8 A;  2V5Q C;  5EN5 D;  1N11 A;  1BLX B;  2RFA A;  2HE0 A;  2KBX A;  3F6Q A;  3DEP A;  4QQI A;  5ENQ D;  5AQ7 A;  5KNG A;  1MX2 A;  1MX4 A;  1WG0 A;  4LG6 A;  5CED B;  1BU9 A;  4DRX E;  4DX5 D;  3D9H A;  2V4H C;  5AQB A;  4O60 A;  4U95 D;  5ENT D;  2NYJ A;  5HS0 A;  4J8Y A;  4ZFH A;  2FO1 E;  5AQA A;  4GMR A;  4JB8 P;  1BD8 A;  5AQ9 A;  5CBN A;  1SVX A;  4QFV A;  2ZGG A;  2PNN A;  1WDY A;  1BI8 B;  3J5P A;  5D66 A;  4DX2 A;  2P2C P;  3AJI A;  2RFM A;  2F8X K;  5AN8 A;  3UTM A;  2L6B A;  1AWC B;  3J5Q B;  4TUM A;  2J8S D;  1TR4 A;  4O1O A;  3V2O A;  1IHB A;  4F6R D;  4BER A;  5AAR A;  2B0O E;  4BET A;  2MYO A;  4DUI A;  4BSZ B;  3V30 A;  2DVW A;  4HNA D;  5ITZ F;  4B93 B;  3DEO A;  2QC9 A;  5EYP F;  3TWV A;  4F1P A;  2DZO A;  3IXE A;  3Q9U C;  3TWT A;  5EYL A;  4HB5 A;  2QYJ A;  1QYM A;  1S70 B;  5EID A;  4HQD A;  5BXU A;  4OAU C;  4U8Y D;  5ENO D;  4CZ2 D;  1K1B A;  5KBA A;  3TWU A;  3KEA A;  1YMP A;  3ZKJ A;  1DCQ A;  3ZU7 B;  3Q9N C;  3V31 A;  4OAV B;  4G8L A;  3W9G A;  2ETB A;  5ENR D;  3EHR A;  3JXI A;  3NOC D;  3TWX A;  2XZD G;  4K5A B;  2AJA A;  3B7B A;  4RLY A;  3AAA C;  4C48 B;  3UXG A;  1UOH A;  4K5B A;  5KNH D;  1NFI E;  3HG0 D;  1A5E A;  4LNU D;  2ETA A;  4HI9 A;  1BI7 B;  3TWW A;  4YDY A;  4GPM A;  4G8K A;  2ETC A;  3C5R A;  2F8Y A;  2Y1L E;  5ENS D;  5FIO A;  4U96 D;  5JMN D;  3TWS A;  3UI2 A;  4LSZ E;  3T9K A;  1K3Z D;  2JAB A;  4J7W A;  1G3N B;  2BKG A;  2XEE A;  1DC2 A;  4DX1 A;  4U8V D;  3EU9 A;  3TWQ A;  2XEN A;  3NOG D;  4A63 B;  2BKK B;  4BES A;  2F37 A;  3JUE A;  5HRY A;  2XEH A;  1IXV A;  4N5Q A;  5FIN A;  1MJ0 A;  3V79 K;  5EIB E;  4HI8 A;  1OT8 A;  5BXO A;  3LJN A;  2Y0B G;  3EHQ A;  5KWD A;  4CYM D;  3T8K A;  5CER B;  4DX7 D;  5JA4 D;  1SW6 A;  4UUC A;  1IKN D;  1N0R A;  4Z68 A;  5CEC B;  2DWZ A;  1YYH A;  5AAO A;  2XZT G;  2A5E A;  3HRA A;  1D9S A;  4HRN A;  4NIK A;  1MYO A;  1YCS B;  3JXJ A;  5HKP A;  5CBO A;  4O1P A;  3W9F A;  3TWR A;  1OY3 D;  2DZN A;  1AP7 A;  1MX6 A;  5EIL A;  5ENP D;  5CEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...