4BEX1

Structure of human cofilin1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
166
structure length
166
Chain Sequence
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRATLAEKLGGSAVISLEGKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the Human Cofilin1 Structure Reveals Conformational Changes Required for Actin-Binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords COFILIN-1
total genus 46
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 4bex100
1WFSA 2FF3A 1WM4A 1AK7A 1P8ZG 1T3XA 4PKGG 1RGIG 1V6FA 5HVKD 1T3YA 4CBUG 1F7SA 3DAWB 1NLVG 2NUTB 5KYWB 1PD0A 3FFNA 2FH4A 1COFA 2FF6G 2LXXA 3FG6A 5KYXB 4Z94G 1SVYA 1TVJA 1Q8GA 3FFKA 3EGXB 4LIZA 3EG9B 3EH1A 5KYUA 1EQYS 1ESVS 2MV2A 1AK6A 1Q8XA 1SVRA 1KCQA 1CFYA 2QTVA 1D4XG 4KEEA 2FGHA 1DEJS 2L72A 3CJCG 5KYYA 5KYUB 3A5MS 1M2OA 5KYYB 3EGXA 2KVKA 5FAEA 2D8BA 1TMWA 2VACA 4KEFA 1NMDG 1PCXA 1M2VA 3L50A 4BEX1 1AHQA 1VFQA 2NUTA 1NM1G 5KYWA 3CJBG 2VILA 3TU5B 5KYNA 3CIPG 2FH1A 4CBXG 1J72A 2HD7A 1M4JA 1CNUA 3EG9A 1D0NA 1PD1A 1SVQA 1T2LA 3CI5G 4PKHB 3A5NS 4CBWG 2LJ8A 2LLFA 5DD2A 1C0FS 2XFAA 1MDUA 2NUPB 1T44G 1VKKA 1H1VG 3Q2BA 2XF1A 1HQZ1 1X67A 3EH2A 2MOTA 4S10C 5FAFA 3A5OS 3EGDB 3A5LS 1P8XA 2W0IA 4PKIG 1QPVA 3EFOA 1M2VB 4JD2H 1UDMA 1YVNG 3EGDA 1NPHA 3EFOB 5A1MA 2MP4A 5IVUA 1C0GS 2FH3A 5L6WC 5KYXA 5HVKB 1JHWA 1YAGG 2FH2A 2NUPA 1WNJA 2VIKA 3FG7A 4KEDA 2I2QA
chains in the Genus database with same CATH superfamily
1WFSA 2FF3A 1WM4A 1AK7A 1P8ZG 1T3XA 4PKGG 1RGIG 1V6FA 5HVKD 1T3YA 4CBUG 1F7SA 3DAWB 1NLVG 2NUTB 5KYWB 1PD0A 3DA7A 3FFNA 2FH4A 1COFA 2FF6G 2LXXA 3FG6A 5KYXB 4Z94G 1SVYA 1TVJA 1Q8GA 3FFKA 3EGXB 4LIZA 3EG9B 3EH1A 5KYUA 1EQYS 1ESVS 2MV2A 1AK6A 1Q8XA 1SVRA 1KCQA 1CFYA 2QTVA 1D4XG 4KEEA 2FGHA 1DEJS 2L72A 3CJCG 5KYYA 5KYUB 3A5MS 1M2OA 5KYYB 3EGXA 2KVKA 5FAEA 2D8BA 1TMWA 2VACA 4KEFA 1NMDG 1PCXA 1M2VA 3L50A 4BEX1 1AHQA 1VFQA 2NUTA 1NM1G 5KYWA 3CJBG 2VILA 3TU5B 5KYNA 3CIPG 2FH1A 4CBXG 1J72A 2HD7A 1M4JA 1CNUA 3EG9A 1D0NA 1PD1A 1SVQA 1T2LA 3CI5G 4PKHB 3A5NS 4CBWG 2LJ8A 2LLFA 5DD2A 1C0FS 2XFAA 1MDUA 2NUPB 1T44G 1VKKA 1H1VG 3Q2BA 2XF1A 1HQZ1 1X67A 3EH2A 2MOTA 4S10C 5FAFA 3A5OS 3EGDB 3A5LS 1P8XA 2W0IA 4PKIG 1QPVA 3EFOA 1M2VB 4JD2H 1UDMA 1YVNG 3EGDA 1NPHA 3EFOB 5A1MA 2MP4A 5IVUA 1C0GS 2FH3A 5L6WC 5KYXA 5HVKB 1JHWA 1YAGG 2FH2A 2NUPA 1WNJA 2VIKA 3FG7A 4KEDA 2I2QA
chains in the Genus database with same CATH topology
1WFSA 2FF3A 1WM4A 1AK7A 1P8ZG 1T3XA 4PKGG 1RGIG 1V6FA 5HVKD 1T3YA 4CBUG 1F7SA 3DAWB 1NLVG 2NUTB 5KYWB 1PD0A 3DA7A 3FFNA 2FH4A 1COFA 2FF6G 2LXXA 3FG6A 5KYXB 4Z94G 1SVYA 1TVJA 1Q8GA 3FFKA 3EGXB 4LIZA 3EG9B 3EH1A 5KYUA 1EQYS 1ESVS 2MV2A 1AK6A 1Q8XA 1SVRA 1KCQA 1CFYA 2QTVA 1D4XG 4KEEA 2FGHA 1DEJS 2L72A 3CJCG 5KYYA 5KYUB 3A5MS 1M2OA 5KYYB 3EGXA 2KVKA 5FAEA 2D8BA 1TMWA 2VACA 4KEFA 1NMDG 1PCXA 1M2VA 3L50A 4BEX1 1AHQA 1VFQA 2NUTA 1NM1G 5KYWA 3CJBG 2VILA 3TU5B 5KYNA 3CIPG 2FH1A 4CBXG 1J72A 2HD7A 1M4JA 1CNUA 3EG9A 1D0NA 1PD1A 1SVQA 1T2LA 3CI5G 4PKHB 3A5NS 4CBWG 2LJ8A 2LLFA 5DD2A 1C0FS 2XFAA 1MDUA 2NUPB 1T44G 1VKKA 1H1VG 3Q2BA 2XF1A 1HQZ1 1X67A 3EH2A 2MOTA 4S10C 5FAFA 3A5OS 3EGDB 3A5LS 1P8XA 2W0IA 4PKIG 1QPVA 3EFOA 1M2VB 4JD2H 1UDMA 1YVNG 3EGDA 1NPHA 3EFOB 5A1MA 2MP4A 5IVUA 1C0GS 2FH3A 5L6WC 5KYXA 5HVKB 1JHWA 1YAGG 2FH2A 2NUPA 1WNJA 2VIKA 3FG7A 4KEDA 2I2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFS A;  2FF3 A;  1WM4 A;  1AK7 A;  1P8Z G;  1T3X A;  4PKG G;  1RGI G;  1V6F A;  5HVK D;  1T3Y A;  4CBU G;  1F7S A;  3DAW B;  1NLV G;  2NUT B;  5KYW B;  1PD0 A;  3FFN A;  2FH4 A;  1COF A;  2FF6 G;  2LXX A;  3FG6 A;  5KYX B;  4Z94 G;  1SVY A;  1TVJ A;  1Q8G A;  3FFK A;  3EGX B;  4LIZ A;  3EG9 B;  3EH1 A;  5KYU A;  1EQY S;  1ESV S;  2MV2 A;  1AK6 A;  1Q8X A;  1SVR A;  1KCQ A;  1CFY A;  2QTV A;  1D4X G;  4KEE A;  2FGH A;  1DEJ S;  2L72 A;  3CJC G;  5KYY A;  5KYU B;  3A5M S;  1M2O A;  5KYY B;  3EGX A;  2KVK A;  5FAE A;  2D8B A;  1TMW A;  2VAC A;  4KEF A;  1NMD G;  1PCX A;  1M2V A;  3L50 A;  4BEX 1;  1AHQ A;  1VFQ A;  2NUT A;  1NM1 G;  5KYW A;  3CJB G;  2VIL A;  3TU5 B;  5KYN A;  3CIP G;  2FH1 A;  4CBX G;  1J72 A;  2HD7 A;  1M4J A;  1CNU A;  3EG9 A;  1D0N A;  1PD1 A;  1SVQ A;  1T2L A;  3CI5 G;  4PKH B;  3A5N S;  4CBW G;  2LJ8 A;  2LLF A;  5DD2 A;  1C0F S;  2XFA A;  1MDU A;  2NUP B;  1T44 G;  1VKK A;  1H1V G;  3Q2B A;  2XF1 A;  1HQZ 1;  1X67 A;  3EH2 A;  2MOT A;  4S10 C;  5FAF A;  3A5O S;  3EGD B;  3A5L S;  1P8X A;  2W0I A;  4PKI G;  1QPV A;  3EFO A;  1M2V B;  4JD2 H;  1UDM A;  1YVN G;  3EGD A;  1NPH A;  3EFO B;  5A1M A;  2MP4 A;  5IVU A;  1C0G S;  2FH3 A;  5L6W C;  5KYX A;  5HVK B;  1JHW A;  1YAG G;  2FH2 A;  2NUP A;  1WNJ A;  2VIK A;  3FG7 A;  4KED A;  2I2Q A; 
#chains in the Genus database with same CATH topology
 1WFS A;  2FF3 A;  1WM4 A;  1AK7 A;  1P8Z G;  1T3X A;  4PKG G;  1RGI G;  1V6F A;  5HVK D;  1T3Y A;  4CBU G;  1F7S A;  3DAW B;  1NLV G;  2NUT B;  5KYW B;  1PD0 A;  3DA7 A;  3FFN A;  2FH4 A;  1COF A;  2FF6 G;  2LXX A;  3FG6 A;  5KYX B;  4Z94 G;  1SVY A;  1TVJ A;  1Q8G A;  3FFK A;  3EGX B;  4LIZ A;  3EG9 B;  3EH1 A;  5KYU A;  1EQY S;  1ESV S;  2MV2 A;  1AK6 A;  1Q8X A;  1SVR A;  1KCQ A;  1CFY A;  2QTV A;  1D4X G;  4KEE A;  2FGH A;  1DEJ S;  2L72 A;  3CJC G;  5KYY A;  5KYU B;  3A5M S;  1M2O A;  5KYY B;  3EGX A;  2KVK A;  5FAE A;  2D8B A;  1TMW A;  2VAC A;  4KEF A;  1NMD G;  1PCX A;  1M2V A;  3L50 A;  4BEX 1;  1AHQ A;  1VFQ A;  2NUT A;  1NM1 G;  5KYW A;  3CJB G;  2VIL A;  3TU5 B;  5KYN A;  3CIP G;  2FH1 A;  4CBX G;  1J72 A;  2HD7 A;  1M4J A;  1CNU A;  3EG9 A;  1D0N A;  1PD1 A;  1SVQ A;  1T2L A;  3CI5 G;  4PKH B;  3A5N S;  4CBW G;  2LJ8 A;  2LLF A;  5DD2 A;  1C0F S;  2XFA A;  1MDU A;  2NUP B;  1T44 G;  1VKK A;  1H1V G;  3Q2B A;  2XF1 A;  1HQZ 1;  1X67 A;  3EH2 A;  2MOT A;  4S10 C;  5FAF A;  3A5O S;  3EGD B;  3A5L S;  1P8X A;  2W0I A;  4PKI G;  1QPV A;  3EFO A;  1M2V B;  4JD2 H;  1UDM A;  1YVN G;  3EGD A;  1NPH A;  3EFO B;  5A1M A;  2MP4 A;  5IVU A;  1C0G S;  2FH3 A;  5L6W C;  5KYX A;  5HVK B;  1JHW A;  1YAG G;  2FH2 A;  2NUP A;  1WNJ A;  2VIK A;  3FG7 A;  4KED A;  2I2Q A; 
#chains in the Genus database with same CATH homology
 1WFS A;  2FF3 A;  1WM4 A;  1AK7 A;  1P8Z G;  1T3X A;  4PKG G;  1RGI G;  1V6F A;  5HVK D;  1T3Y A;  4CBU G;  1F7S A;  3DAW B;  1NLV G;  2NUT B;  5KYW B;  1PD0 A;  3DA7 A;  3FFN A;  2FH4 A;  1COF A;  2FF6 G;  2LXX A;  3FG6 A;  5KYX B;  4Z94 G;  1SVY A;  1TVJ A;  1Q8G A;  3FFK A;  3EGX B;  4LIZ A;  3EG9 B;  3EH1 A;  5KYU A;  1EQY S;  1ESV S;  2MV2 A;  1AK6 A;  1Q8X A;  1SVR A;  1KCQ A;  1CFY A;  2QTV A;  1D4X G;  4KEE A;  2FGH A;  1DEJ S;  2L72 A;  3CJC G;  5KYY A;  5KYU B;  3A5M S;  1M2O A;  5KYY B;  3EGX A;  2KVK A;  5FAE A;  2D8B A;  1TMW A;  2VAC A;  4KEF A;  1NMD G;  1PCX A;  1M2V A;  3L50 A;  4BEX 1;  1AHQ A;  1VFQ A;  2NUT A;  1NM1 G;  5KYW A;  3CJB G;  2VIL A;  3TU5 B;  5KYN A;  3CIP G;  2FH1 A;  4CBX G;  1J72 A;  2HD7 A;  1M4J A;  1CNU A;  3EG9 A;  1D0N A;  1PD1 A;  1SVQ A;  1T2L A;  3CI5 G;  4PKH B;  3A5N S;  4CBW G;  2LJ8 A;  2LLF A;  5DD2 A;  1C0F S;  2XFA A;  1MDU A;  2NUP B;  1T44 G;  1VKK A;  1H1V G;  3Q2B A;  2XF1 A;  1HQZ 1;  1X67 A;  3EH2 A;  2MOT A;  4S10 C;  5FAF A;  3A5O S;  3EGD B;  3A5L S;  1P8X A;  2W0I A;  4PKI G;  1QPV A;  3EFO A;  1M2V B;  4JD2 H;  1UDM A;  1YVN G;  3EGD A;  1NPH A;  3EFO B;  5A1M A;  2MP4 A;  5IVU A;  1C0G S;  2FH3 A;  5L6W C;  5KYX A;  5HVK B;  1JHW A;  1YAG G;  2FH2 A;  2NUP A;  1WNJ A;  2VIK A;  3FG7 A;  4KED A;  2I2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...