4BF8A

Fpr4 ppi domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
117
structure length
117
Chain Sequence
GAMAKPKTKLLEGGIIIEDRVTGKGPHAKKGTRVGMRYVGKLKNGKVFDKNTKGKPFVFKLGQGEVIKGWDIGVAGMAVGGERRIVIPAPYAYGKQALPGIPANSELTFDVKLVSMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Activity of the Peptidyl-Prolyl Isomerase Domain from the Histone Chaperone Fpr4 Towards Histone H3 Proline Isomerization
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
molecule keywords FPR4
total genus 21
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4bf8A00
3O5IA 2RUDA 4N19A 2DG4A 4W9PA 1JNSA 2OFNA 3IKGA 2F21A 2XP9A 1D7JA 1Y0OA 1YATA 3UQBA 4DRQA 4JFJA 1F40A 1C9HA 2FKEA 2JZVA 1EYMA 1JVWA 2LJ4A 2XPBA 4IPXA 2KO7A 4DT4A 4TW7A 2M1IA 4GGQA 1ROTA 2F4EA 4MSPA 1J6YA 1J4RA 2KFWA 3CGNA 2KE0A 4R0XA 2ZQVA 1KT0A 1NMWA 4DRKA 2Q5AA 2RSEA 2VN1A 3UQIA 3LUOA 4DRPA 4JFIA 3O5GA 1F8AB 2F2DA 4ODLA 3UF8A 2XP6A 3WH0A 1D7HA 2DG9A 3ODKA 4DRNA 1FD9A 4FN2A 4TNSA 1D6OA 3TDBA 2KR7A 3O5KA 2N87A 2ZQSA 1FKIA 2LGOA 1FKFA 2KGJA 1NSGA 4ODPA 2K8IA 1KT1A 4DRJA 1U79A 3KAHA 3UI6A 1PINA 4JFLA 4LAVA 4JFMA 4DIPA 5I98A 4G2PA 1A7XA 3KABA 1M5YA 2PV2A 3B7XA 3FAPA 3KACA 4GIVA 4LAWA 4TYOA 2MLZA 2M08A 4ITZA 5BXJA 1FKRA 3KAFA 3UI4A 4DH0A 2Y78A 3IHZA 5DITA 5HT1A 1FKKA 5GPGA 4C02B 4DROA 1Q6UA 2XP4A 4DZ2A 5HW8A 1ZCNA 1QPFA 3PA7A 4O2TA 2PV3A 4QIBA 1FKDA 1FKBA 2MNTA 2XP8A 5DIVA 1FJDA 2MLXA 2ZR6A 5HTGA 2AWGA 3GPKA 1Q1CA 3IK8A 3NTPA 3PRDA 3VAWA 2FAPA 4TW8A 5HW6A 2KI3A 4G50A 5B8IC 4NNRA 4DZ3A 1FKJA 3JYJA 4DRHA 5D75A 3O5OA 2UZ5A 3KADA 2L2SA 2ZR5A 2IF4A 4J4OA 3TCZA 5HWCA 4JFKA 2M2AA 2MPHA 4ODQA 2D9FA 3UQAA 1PBKA 2PV1A 2RUCA 3I6CA 3IKDA 4TW6A 4ODRA 1BKFA 4JYSA 1QZ2A 2XP5A 1B6CA 3O5RA 4ODMA 3KAGA 5DIUA 3KZ7A 3O5FA 1QPLA 4FAPA 1Q6HA 4IQCA 1FKGA 2RURA 1NMVA 3EY6A 1Q6IA 3CGMA 4ODOA 5J6EA 4W9QA 5HW7A 4MGVA 2PBCA 4TX0A 1YW5A 2PPPA 5HWBA 3KCEA 3KAIA 4U84A 1FKSA 4LAXA 2DG3A 1J4HA 1FKLA 2XPAA 2ZQUA 2ITKA 2ZQTA 1P5QA 3O5JA 3O5QA 1HXVA 4J4NA 4QT2A 2PPOA 3NI6A 2LKNA 3PRBA 1FAPA 1L1PA 2VCDA 1D7IA 3JXVA 3OOBA 3O5DA 2MLYA 2ZR4A 1EQ3A 1W26A 2RUQA 1R9HA 2XP7A 3JYMA 2XP3A 4QT3A 4U86A 3RFWA 1JNTA 1N1AA 4DRIA 4IQ2A 4ODNA 3UI5A 1FKHA 5HUAA 3TC5A 1BL4A 1TCOC 4DRMA 1ZK6A 2RQSA 3O5EA 3O5PA 4LAYA 3O5LA 5HKGA 1J4IA 3MDYB 2LPVA 1FKTA 3H9RB 2MF9A 3O5MA 4U85A 3RGCA 3NRKA 4BF8A 2PPNA 4ODKA 1ROUA 4W9OA 1T11A
chains in the Genus database with same CATH superfamily
2RUDA 4N19A 2DG4A 2DSWA 2OFNA 2DPEA 3IKGA 5HBFA 3FXYA 4JFJA 4DRQA 2FKEA 1E6NA 2JZVA 1EYMA 3WD2A 1UR8A 4DT4A 2KO7A 4MSPA 3RMEA 1W9UA 3O5GA 1F8AB 1X6NA 4FN2A 2PN0A 3O5KA 3WL1A 1H0GA 1GPFA 4ODPA 1U79A 4S3JA 5DEZA 1E15A 1E9LA 3KACA 4P8XA 4ML4A 4P8WA 4ZPWR 3BXWA 1JNEA 5HT1A 1FKKA 5GPGA 1VF8A 3ARXA 4C02B 3PA7A 4O2TA 1FKDA 4HBEA 5HTGA 4MNJA 1WB0A 3IK8A 3PRDA 1JNDA 2FAPA 4TW8A 1XRVA 3WQVA 4G50A 3EIPA 3WL0A 3CH9A 2QF8A 3TCZA 5HWCA 4JFKA 4MNKA 2RUCA 3B9DA 1ITXA 4ODRA 2XP5A 1NWTA 3GTYX 4ODMA 1E6ZA 3EY6A 4Z2LA 4MGVA 1YW5A 2PPPA 3CHDA 2DG3A 2XPAA 2G41A 2ITKA 3O5JA 3WD4A 4J4NA 2LKNA 4S3KA 1L1PA 3OOBA 2XP7A 3JYMA 3RFWA 4R5EA 4ODNA 1BL4A 1TCOC 1NWRA 2RQSA 3O5EA 3O5LA 1ZBWA 1FKTA 1IX5A 3RGCA 2DT2A 2PPNA 1HKIA 3CHFA 3AS1A 1JNSA 1W1VA 4MTVA 5GPRA 2F21A 1W9VA 1F40A 1C9HA 1HJVA 2LJ4A 3ARWA 4IPXA 1J6YA 2A3EA 1ROTA 2F4EA 2KFWA 4AY1A 3B9AA 1XHGA 1KT0A 2Q5AA 2RSEA 3LUOA 1HKMA 3AS0A 4IT4A 1LJYA 4LGXA 1E44A 1D7HA 3WH0A 4P8UA 1D6OA 2KGJA 1NSGA 1KT1A 3RM9A 1LQ0A 3KAHA 3G6MA 4JFLA 4LAVA 2A3BA 4DIPA 3PR9A 4G2PA 2WM0A 3B7XA 3FAPA 4GIVA 1ZBKA 1FKRA 3UI4A 3AQUA 4DH0A 3IHZA 1GUVA 4DROA 1Q6UA 1OWQA 2XP4A 3ARTA 2B31A 4Q22A 4DWSA 2XP8A 5DIVA 1OGGA 1Q1CA 1D2KA 1FKJA 3PRAA 3JYJA 5D75A 2UZ5A 3KADA 4MNLA 3G6LA 4J4OA 2DSZA 2MPHA 4ODQA 3OA5A 2DSVA 4TW6A 4IT6A 5DIUA 1ZBCA 3KZ7A 1FKGA 1LL7A 1NMVA 2RURA 1Q6IA 1FFQA 4W9QA 2DT0A 1LG1A 3RM4A 1NH6A 3ARPA 3KAIA 3KCEA 1OGBA 4U84A 1FKLA 1ZB5A 4XAKA 4WKAA 4QT2A 3NI6A 1SYTA 3PRBA 2ETNA 3WD1A 2WK2A 3O5DA 2MLYA 3W4RA 1R9HA 4U86A 3CHEA 1JNTA 1N1AA 3UI5A 5DO2A 5DF0A 4ZS6A 4DWSD 4LAYA 2LPVA 1X6LA 3AS3A 1LL4A 4Z2GA 4L3NA 3NRKA 1SR0A 1KFWA 2A3CA 3O5IA 4L72B 1ZL1A 2XP9A 1D7JA 1YATA 3UQBA 1JVWA 2XPBA 2M1IA 4GGQA 1EDQA 3CGNA 2KE0A 4P8VA 4R0XA 2ZQVA 1NMWA 1HKJA 3UQIA 4JFIA 2DT1A 2XP6A 1EHNA 3ODKA 1W9PA 3ARVA 4TNSA 2EULA 2ZQSA 1FKIA 2LGOA 1FKFA 3B8SA 3FY1A 1PINA 4PTMA 1LG2A 1HJWA 5I98A 4WKFA 3KABA 4LAWA 4ITZA 1FFRA 4DWSC 2Y78A 3ARQA 4DZ2A 1QPFA 2PV3A 1FKBA 1FJDA 3WIJA 2O9OA 2ZR6A 2YBTA 4MPKA 4WK9A 2AWGA 4WIWA 3NTPA 3VAWA 1W1TA 5HW6A 3WD0A 4Q7NA 4Z2HA 5GQBA 4DRHA 2ZR5A 2M2AA 1W1PA 3UQAA 1ZBVA 2A3AA 3I6CA 3IKDA 4JYSA 4DWSB 3KAGA 3O5FA 4MAVA 4FAPA 1RD6A 3BMBA 4MNMA 2PBCA 1J4HA 2ZQUA 2ZQTA 2FDMA 2PPOA 1D7IA 1GRJA 3ARZA 2ZR4A 1HKKA 4NZCA 1W26A 4WJXA 2XP3A 4QT3A 3CZ8A 2DT3A 1FKHA 4Z2IA 1UR9A 3TC5A 1ZK6A 4KR0B 3H9RB 2MF9A 1CTNA 3ARUA 4BF8A 3ALGA 2DSUA 4W9OA 3WKZA 4W9PA 1TFVA 4KQZA 2OLHA 2B5UB 1Y0OA 3B9EA 2WLZA 4HBOA 3WD3A 4TW7A 1J4RA 3WQWA 4DRKA 2VN1A 4DRPA 4QZVB 1O6IA 4ODLA 2F2DA 3UF8A 2DG9A 4DRNA 1FD9A 1NWSA 3TDBA 2KR7A 2N87A 2P4VA 1K9TA 2K8IA 4DRJA 3UI6A 1NWUA 4JFMA 1A7XA 1M5YA 2PV2A 4TYOA 2MLZA 2ESCA 2M08A 5BXJA 3KAFA 2IUZA 3QOKA 1LL6A 1WAWA 5DITA 4UDMA 2F23A 5HW8A 1ZCNA 4ZPTR 3ARRA 3GU0A 2MNTA 4QIBA 4URIA 2MLXA 4NSBA 3AS2A 1E6RA 3GPKA 2KI3A 1EIBA 5B8IC 4NNRA 4DZ3A 2WLYA 3ARYA 4W5UA 1W1YA 4ZPVR 3O5OA 2L2SA 2IF4A 1GOIA 3CHCA 4HARA 4WKHA 2D9FA 1WNOA 1PBKA 2PV1A 1BKFA 1HJXA 1QZ2A 3O5RA 1B6CA 1JCHB 1QPLA 1Q6HA 2AOSA 4IQCA 4ODOA 3CGMA 1E6PA 5J6EA 5HW7A 4TX0A 5HWBA 1FKSA 4LAXA 2PI6A 1P5QA 3O5QA 1HXVA 1FAPA 2G8ZA 2VCDA 3JXVA 2YBUA 1EQ3A 2RUQA 4DRIA 4IQ2A 5HUAA 1H0IA 4Z2JA 1ZU8A 3AROA 4DRMA 3ALFA 5JH8A 2O92A 3O5PA 5HKGA 1J4IA 3MDYB 4U85A 3O5MA 3ARSA 4Z2KA 4ODKA 3RM8A 1ROUA 1T11A
chains in the Genus database with same CATH topology
2RUDA 4N19A 2DG4A 2DSWA 2OFNA 2DPEA 3IKGA 5HBFA 3FXYA 4JFJA 4DRQA 2FKEA 1E6NA 2JZVA 1EYMA 3WD2A 1UR8A 4DT4A 2KO7A 4MSPA 3RMEA 1W9UA 3O5GA 1F8AB 1X6NA 4FN2A 3O5KA 3WL1A 1H0GA 1GPFA 4ODPA 1U79A 4S3JA 5DEZA 1E15A 1E9LA 3KACA 4P8XA 4ML4A 4P8WA 4ZPWR 3BXWA 1JNEA 5HT1A 1FKKA 5GPGA 1VF8A 3ARXA 4C02B 3PA7A 4O2TA 1FKDA 4HBEA 5HTGA 4MNJA 1WB0A 3IK8A 3PRDA 1JNDA 2FAPA 4TW8A 1XRVA 3WQVA 4G50A 3WL0A 3CH9A 2QF8A 3TCZA 5HWCA 4JFKA 4MNKA 2RUCA 3B9DA 1ITXA 4ODRA 2XP5A 1NWTA 4ODMA 1E6ZA 3EY6A 4Z2LA 4MGVA 1YW5A 2PPPA 3CHDA 2DG3A 2XPAA 2G41A 2ITKA 3O5JA 3WD4A 4J4NA 2LKNA 4S3KA 1L1PA 3OOBA 2XP7A 3JYMA 3RFWA 4R5EA 4ODNA 1BL4A 1TCOC 1NWRA 2RQSA 3O5EA 3O5LA 1ZBWA 1FKTA 1IX5A 3RGCA 2DT2A 2PPNA 1HKIA 3CHFA 3AS1A 1JNSA 1W1VA 4MTVA 5GPRA 2F21A 1W9VA 1F40A 1C9HA 1HJVA 2LJ4A 3ARWA 4IPXA 1J6YA 2A3EA 1ROTA 2F4EA 2KFWA 4AY1A 3B9AA 1XHGA 1KT0A 2Q5AA 2RSEA 3LUOA 1HKMA 3AS0A 4IT4A 1LJYA 4LGXA 1D7HA 3WH0A 4P8UA 1D6OA 2KGJA 1NSGA 1KT1A 3RM9A 1LQ0A 3KAHA 3G6MA 4JFLA 4LAVA 2A3BA 4DIPA 3PR9A 4G2PA 2WM0A 3B7XA 3FAPA 4GIVA 1ZBKA 1FKRA 3UI4A 3AQUA 4DH0A 3IHZA 1GUVA 4DROA 1Q6UA 1OWQA 2XP4A 3ARTA 2B31A 4Q22A 4DWSA 2XP8A 5DIVA 1OGGA 1Q1CA 1D2KA 1FKJA 3PRAA 3JYJA 5D75A 2UZ5A 3KADA 4MNLA 3G6LA 4J4OA 2DSZA 2MPHA 4ODQA 3OA5A 2DSVA 4TW6A 4IT6A 5DIUA 1ZBCA 3KZ7A 1FKGA 1LL7A 1NMVA 2RURA 1Q6IA 1FFQA 4W9QA 2DT0A 1LG1A 3RM4A 1NH6A 3ARPA 3KAIA 3KCEA 1OGBA 4U84A 1FKLA 1ZB5A 4XAKA 4WKAA 4QT2A 3NI6A 1SYTA 3PRBA 3WD1A 2WK2A 3O5DA 2MLYA 3W4RA 1R9HA 4U86A 3CHEA 1JNTA 1N1AA 3UI5A 5DO2A 5DF0A 4ZS6A 4DWSD 4LAYA 2LPVA 1X6LA 3AS3A 1LL4A 4Z2GA 4L3NA 3NRKA 1SR0A 1KFWA 2A3CA 3O5IA 4L72B 1ZL1A 2XP9A 1D7JA 1YATA 3UQBA 1JVWA 2XPBA 2M1IA 4GGQA 1EDQA 3CGNA 2KE0A 4P8VA 4R0XA 2ZQVA 1NMWA 1HKJA 3UQIA 4JFIA 2DT1A 2XP6A 1EHNA 3ODKA 1W9PA 3ARVA 4TNSA 2ZQSA 1FKIA 2LGOA 1FKFA 3B8SA 3FY1A 1PINA 4PTMA 1LG2A 1HJWA 5I98A 4WKFA 3KABA 4LAWA 4ITZA 1FFRA 4DWSC 2Y78A 3ARQA 4DZ2A 1QPFA 2PV3A 1FKBA 1FJDA 3WIJA 2O9OA 2ZR6A 2YBTA 4MPKA 4WK9A 2AWGA 4WIWA 3NTPA 3VAWA 1W1TA 5HW6A 3WD0A 4Q7NA 4Z2HA 5GQBA 4DRHA 2ZR5A 2M2AA 1W1PA 3UQAA 1ZBVA 2A3AA 3I6CA 3IKDA 4JYSA 4DWSB 3KAGA 3O5FA 4MAVA 4FAPA 1RD6A 4MNMA 2PBCA 1J4HA 2ZQUA 2ZQTA 2FDMA 2PPOA 1D7IA 3ARZA 2ZR4A 1HKKA 4NZCA 1W26A 4WJXA 2XP3A 4QT3A 3CZ8A 2DT3A 1FKHA 4Z2IA 1UR9A 3TC5A 1ZK6A 4KR0B 3H9RB 2MF9A 1CTNA 3ARUA 4BF8A 3ALGA 2DSUA 4W9OA 3WKZA 4W9PA 1TFVA 4KQZA 2OLHA 1Y0OA 3B9EA 2WLZA 4HBOA 3WD3A 4TW7A 1J4RA 3WQWA 4DRKA 2VN1A 4DRPA 4QZVB 1O6IA 4ODLA 2F2DA 3UF8A 2DG9A 4DRNA 1FD9A 1NWSA 3TDBA 2KR7A 2N87A 1K9TA 2K8IA 4DRJA 3UI6A 1NWUA 4JFMA 1A7XA 1M5YA 2PV2A 4TYOA 2MLZA 2ESCA 2M08A 5BXJA 3KAFA 2IUZA 3QOKA 1LL6A 1WAWA 5DITA 5HW8A 1ZCNA 4ZPTR 3ARRA 4QIBA 2MNTA 4URIA 2MLXA 4NSBA 3AS2A 1E6RA 3GPKA 2KI3A 1EIBA 5B8IC 4NNRA 4DZ3A 2WLYA 3ARYA 4W5UA 1W1YA 4ZPVR 3O5OA 2L2SA 2IF4A 1GOIA 3CHCA 4HARA 4WKHA 2D9FA 1WNOA 1PBKA 2PV1A 1BKFA 1HJXA 1QZ2A 3O5RA 1B6CA 1QPLA 1Q6HA 2AOSA 4IQCA 4ODOA 3CGMA 1E6PA 5J6EA 5HW7A 4TX0A 5HWBA 1FKSA 4LAXA 2PI6A 1P5QA 3O5QA 1HXVA 1FAPA 2G8ZA 2VCDA 3JXVA 2YBUA 1EQ3A 2RUQA 4DRIA 4IQ2A 5HUAA 1H0IA 4Z2JA 1ZU8A 3AROA 4DRMA 3ALFA 5JH8A 2O92A 3O5PA 5HKGA 1J4IA 3MDYB 4U85A 3O5MA 3ARSA 4Z2KA 4ODKA 3RM8A 1ROUA 1T11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5I A;  2RUD A;  4N19 A;  2DG4 A;  4W9P A;  1JNS A;  2OFN A;  3IKG A;  2F21 A;  2XP9 A;  1D7J A;  1Y0O A;  1YAT A;  3UQB A;  4DRQ A;  4JFJ A;  1F40 A;  1C9H A;  2FKE A;  2JZV A;  1EYM A;  1JVW A;  2LJ4 A;  2XPB A;  4IPX A;  2KO7 A;  4DT4 A;  4TW7 A;  2M1I A;  4GGQ A;  1ROT A;  2F4E A;  4MSP A;  1J6Y A;  1J4R A;  2KFW A;  3CGN A;  2KE0 A;  4R0X A;  2ZQV A;  1KT0 A;  1NMW A;  4DRK A;  2Q5A A;  2RSE A;  2VN1 A;  3UQI A;  3LUO A;  4DRP A;  4JFI A;  3O5G A;  1F8A B;  2F2D A;  4ODL A;  3UF8 A;  2XP6 A;  3WH0 A;  1D7H A;  2DG9 A;  3ODK A;  4DRN A;  1FD9 A;  4FN2 A;  4TNS A;  1D6O A;  3TDB A;  2KR7 A;  3O5K A;  2N87 A;  2ZQS A;  1FKI A;  2LGO A;  1FKF A;  2KGJ A;  1NSG A;  4ODP A;  2K8I A;  1KT1 A;  4DRJ A;  1U79 A;  3KAH A;  3UI6 A;  1PIN A;  4JFL A;  4LAV A;  4JFM A;  4DIP A;  5I98 A;  4G2P A;  1A7X A;  3KAB A;  1M5Y A;  2PV2 A;  3B7X A;  3FAP A;  3KAC A;  4GIV A;  4LAW A;  4TYO A;  2MLZ A;  2M08 A;  4ITZ A;  5BXJ A;  1FKR A;  3KAF A;  3UI4 A;  4DH0 A;  2Y78 A;  3IHZ A;  5DIT A;  5HT1 A;  1FKK A;  5GPG A;  4C02 B;  4DRO A;  1Q6U A;  2XP4 A;  4DZ2 A;  5HW8 A;  1ZCN A;  1QPF A;  3PA7 A;  4O2T A;  2PV3 A;  4QIB A;  1FKD A;  1FKB A;  2MNT A;  2XP8 A;  5DIV A;  1FJD A;  2MLX A;  2ZR6 A;  5HTG A;  2AWG A;  3GPK A;  1Q1C A;  3IK8 A;  3NTP A;  3PRD A;  3VAW A;  2FAP A;  4TW8 A;  5HW6 A;  2KI3 A;  4G50 A;  5B8I C;  4NNR A;  4DZ3 A;  1FKJ A;  3JYJ A;  4DRH A;  5D75 A;  3O5O A;  2UZ5 A;  3KAD A;  2L2S A;  2ZR5 A;  2IF4 A;  4J4O A;  3TCZ A;  5HWC A;  4JFK A;  2M2A A;  2MPH A;  4ODQ A;  2D9F A;  3UQA A;  1PBK A;  2PV1 A;  2RUC A;  3I6C A;  3IKD A;  4TW6 A;  4ODR A;  1BKF A;  4JYS A;  1QZ2 A;  2XP5 A;  1B6C A;  3O5R A;  4ODM A;  3KAG A;  5DIU A;  3KZ7 A;  3O5F A;  1QPL A;  4FAP A;  1Q6H A;  4IQC A;  1FKG A;  2RUR A;  1NMV A;  3EY6 A;  1Q6I A;  3CGM A;  4ODO A;  5J6E A;  4W9Q A;  5HW7 A;  4MGV A;  2PBC A;  4TX0 A;  1YW5 A;  2PPP A;  5HWB A;  3KCE A;  3KAI A;  4U84 A;  1FKS A;  4LAX A;  2DG3 A;  1J4H A;  1FKL A;  2XPA A;  2ZQU A;  2ITK A;  2ZQT A;  1P5Q A;  3O5J A;  3O5Q A;  1HXV A;  4J4N A;  4QT2 A;  2PPO A;  3NI6 A;  2LKN A;  3PRB A;  1FAP A;  1L1P A;  2VCD A;  1D7I A;  3JXV A;  3OOB A;  3O5D A;  2MLY A;  2ZR4 A;  1EQ3 A;  1W26 A;  2RUQ A;  1R9H A;  2XP7 A;  3JYM A;  2XP3 A;  4QT3 A;  4U86 A;  3RFW A;  1JNT A;  1N1A A;  4DRI A;  4IQ2 A;  4ODN A;  3UI5 A;  1FKH A;  5HUA A;  3TC5 A;  1BL4 A;  1TCO C;  4DRM A;  1ZK6 A;  2RQS A;  3O5E A;  3O5P A;  4LAY A;  3O5L A;  5HKG A;  1J4I A;  3MDY B;  2LPV A;  1FKT A;  3H9R B;  2MF9 A;  3O5M A;  4U85 A;  3RGC A;  3NRK A;  4BF8 A;  2PPN A;  4ODK A;  1ROU A;  4W9O A;  1T11 A; 
#chains in the Genus database with same CATH topology
 2RUD A;  4N19 A;  2DG4 A;  2DSW A;  2OFN A;  2DPE A;  3IKG A;  5HBF A;  3FXY A;  4JFJ A;  4DRQ A;  2FKE A;  1E6N A;  2JZV A;  1EYM A;  3WD2 A;  1UR8 A;  4DT4 A;  2KO7 A;  4MSP A;  3RME A;  1W9U A;  3O5G A;  1F8A B;  1X6N A;  4FN2 A;  2PN0 A;  3O5K A;  3WL1 A;  1H0G A;  1GPF A;  4ODP A;  1U79 A;  4S3J A;  5DEZ A;  1E15 A;  1E9L A;  3KAC A;  4P8X A;  4ML4 A;  4P8W A;  4ZPW R;  3BXW A;  1JNE A;  5HT1 A;  1FKK A;  5GPG A;  1VF8 A;  3ARX A;  4C02 B;  3PA7 A;  4O2T A;  1FKD A;  4HBE A;  5HTG A;  4MNJ A;  1WB0 A;  3IK8 A;  3PRD A;  1JND A;  2FAP A;  4TW8 A;  1XRV A;  3WQV A;  4G50 A;  3EIP A;  3WL0 A;  3CH9 A;  2QF8 A;  3TCZ A;  5HWC A;  4JFK A;  4MNK A;  2RUC A;  3B9D A;  1ITX A;  4ODR A;  2XP5 A;  1NWT A;  3GTY X;  4ODM A;  1E6Z A;  3EY6 A;  4Z2L A;  4MGV A;  1YW5 A;  2PPP A;  3CHD A;  2DG3 A;  2XPA A;  2G41 A;  2ITK A;  3O5J A;  3WD4 A;  4J4N A;  2LKN A;  4S3K A;  1L1P A;  3OOB A;  2XP7 A;  3JYM A;  3RFW A;  4R5E A;  4ODN A;  1BL4 A;  1TCO C;  1NWR A;  2RQS A;  3O5E A;  3O5L A;  1ZBW A;  1FKT A;  1IX5 A;  3RGC A;  2DT2 A;  2PPN A;  1HKI A;  3CHF A;  3AS1 A;  1JNS A;  1W1V A;  4MTV A;  5GPR A;  2F21 A;  1W9V A;  1F40 A;  1C9H A;  1HJV A;  2LJ4 A;  3ARW A;  4IPX A;  1J6Y A;  2A3E A;  1ROT A;  2F4E A;  2KFW A;  4AY1 A;  3B9A A;  1XHG A;  1KT0 A;  2Q5A A;  2RSE A;  3LUO A;  1HKM A;  3AS0 A;  4IT4 A;  1LJY A;  4LGX A;  1E44 A;  1D7H A;  3WH0 A;  4P8U A;  1D6O A;  2KGJ A;  1NSG A;  1KT1 A;  3RM9 A;  1LQ0 A;  3KAH A;  3G6M A;  4JFL A;  4LAV A;  2A3B A;  4DIP A;  3PR9 A;  4G2P A;  2WM0 A;  3B7X A;  3FAP A;  4GIV A;  1ZBK A;  1FKR A;  3UI4 A;  3AQU A;  4DH0 A;  3IHZ A;  1GUV A;  4DRO A;  1Q6U A;  1OWQ A;  2XP4 A;  3ART A;  2B31 A;  4Q22 A;  4DWS A;  2XP8 A;  5DIV A;  1OGG A;  1Q1C A;  1D2K A;  1FKJ A;  3PRA A;  3JYJ A;  5D75 A;  2UZ5 A;  3KAD A;  4MNL A;  3G6L A;  4J4O A;  2DSZ A;  2MPH A;  4ODQ A;  3OA5 A;  2DSV A;  4TW6 A;  4IT6 A;  5DIU A;  1ZBC A;  3KZ7 A;  1FKG A;  1LL7 A;  1NMV A;  2RUR A;  1Q6I A;  1FFQ A;  4W9Q A;  2DT0 A;  1LG1 A;  3RM4 A;  1NH6 A;  3ARP A;  3KAI A;  3KCE A;  1OGB A;  4U84 A;  1FKL A;  1ZB5 A;  4XAK A;  4WKA A;  4QT2 A;  3NI6 A;  1SYT A;  3PRB A;  2ETN A;  3WD1 A;  2WK2 A;  3O5D A;  2MLY A;  3W4R A;  1R9H A;  4U86 A;  3CHE A;  1JNT A;  1N1A A;  3UI5 A;  5DO2 A;  5DF0 A;  4ZS6 A;  4DWS D;  4LAY A;  2LPV A;  1X6L A;  3AS3 A;  1LL4 A;  4Z2G A;  4L3N A;  3NRK A;  1SR0 A;  1KFW A;  2A3C A;  3O5I A;  4L72 B;  1ZL1 A;  2XP9 A;  1D7J A;  1YAT A;  3UQB A;  1JVW A;  2XPB A;  2M1I A;  4GGQ A;  1EDQ A;  3CGN A;  2KE0 A;  4P8V A;  4R0X A;  2ZQV A;  1NMW A;  1HKJ A;  3UQI A;  4JFI A;  2DT1 A;  2XP6 A;  1EHN A;  3ODK A;  1W9P A;  3ARV A;  4TNS A;  2EUL A;  2ZQS A;  1FKI A;  2LGO A;  1FKF A;  3B8S A;  3FY1 A;  1PIN A;  4PTM A;  1LG2 A;  1HJW A;  5I98 A;  4WKF A;  3KAB A;  4LAW A;  4ITZ A;  1FFR A;  4DWS C;  2Y78 A;  3ARQ A;  4DZ2 A;  1QPF A;  2PV3 A;  1FKB A;  1FJD A;  3WIJ A;  2O9O A;  2ZR6 A;  2YBT A;  4MPK A;  4WK9 A;  2AWG A;  4WIW A;  3NTP A;  3VAW A;  1W1T A;  5HW6 A;  3WD0 A;  4Q7N A;  4Z2H A;  5GQB A;  4DRH A;  2ZR5 A;  2M2A A;  1W1P A;  3UQA A;  1ZBV A;  2A3A A;  3I6C A;  3IKD A;  4JYS A;  4DWS B;  3KAG A;  3O5F A;  4MAV A;  4FAP A;  1RD6 A;  3BMB A;  4MNM A;  2PBC A;  1J4H A;  2ZQU A;  2ZQT A;  2FDM A;  2PPO A;  1D7I A;  1GRJ A;  3ARZ A;  2ZR4 A;  1HKK A;  4NZC A;  1W26 A;  4WJX A;  2XP3 A;  4QT3 A;  3CZ8 A;  2DT3 A;  1FKH A;  4Z2I A;  1UR9 A;  3TC5 A;  1ZK6 A;  4KR0 B;  3H9R B;  2MF9 A;  1CTN A;  3ARU A;  4BF8 A;  3ALG A;  2DSU A;  4W9O A;  3WKZ A;  4W9P A;  1TFV A;  4KQZ A;  2OLH A;  2B5U B;  1Y0O A;  3B9E A;  2WLZ A;  4HBO A;  3WD3 A;  4TW7 A;  1J4R A;  3WQW A;  4DRK A;  2VN1 A;  4DRP A;  4QZV B;  1O6I A;  4ODL A;  2F2D A;  3UF8 A;  2DG9 A;  4DRN A;  1FD9 A;  1NWS A;  3TDB A;  2KR7 A;  2N87 A;  2P4V A;  1K9T A;  2K8I A;  4DRJ A;  3UI6 A;  1NWU A;  4JFM A;  1A7X A;  1M5Y A;  2PV2 A;  4TYO A;  2MLZ A;  2ESC A;  2M08 A;  5BXJ A;  3KAF A;  2IUZ A;  3QOK A;  1LL6 A;  1WAW A;  5DIT A;  4UDM A;  2F23 A;  5HW8 A;  1ZCN A;  4ZPT R;  3ARR A;  3GU0 A;  2MNT A;  4QIB A;  4URI A;  2MLX A;  4NSB A;  3AS2 A;  1E6R A;  3GPK A;  2KI3 A;  1EIB A;  5B8I C;  4NNR A;  4DZ3 A;  2WLY A;  3ARY A;  4W5U A;  1W1Y A;  4ZPV R;  3O5O A;  2L2S A;  2IF4 A;  1GOI A;  3CHC A;  4HAR A;  4WKH A;  2D9F A;  1WNO A;  1PBK A;  2PV1 A;  1BKF A;  1HJX A;  1QZ2 A;  3O5R A;  1B6C A;  1JCH B;  1QPL A;  1Q6H A;  2AOS A;  4IQC A;  4ODO A;  3CGM A;  1E6P A;  5J6E A;  5HW7 A;  4TX0 A;  5HWB A;  1FKS A;  4LAX A;  2PI6 A;  1P5Q A;  3O5Q A;  1HXV A;  1FAP A;  2G8Z A;  2VCD A;  3JXV A;  2YBU A;  1EQ3 A;  2RUQ A;  4DRI A;  4IQ2 A;  5HUA A;  1H0I A;  4Z2J A;  1ZU8 A;  3ARO A;  4DRM A;  3ALF A;  5JH8 A;  2O92 A;  3O5P A;  5HKG A;  1J4I A;  3MDY B;  4U85 A;  3O5M A;  3ARS A;  4Z2K A;  4ODK A;  3RM8 A;  1ROU A;  1T11 A; 
#chains in the Genus database with same CATH homology
 2RUD A;  4N19 A;  2DG4 A;  2DSW A;  2OFN A;  2DPE A;  3IKG A;  5HBF A;  3FXY A;  4JFJ A;  4DRQ A;  2FKE A;  1E6N A;  2JZV A;  1EYM A;  3WD2 A;  1UR8 A;  4DT4 A;  2KO7 A;  4MSP A;  3RME A;  1W9U A;  3O5G A;  1F8A B;  1X6N A;  4FN2 A;  3O5K A;  3WL1 A;  1H0G A;  1GPF A;  4ODP A;  1U79 A;  4S3J A;  5DEZ A;  1E15 A;  1E9L A;  3KAC A;  4P8X A;  4ML4 A;  4P8W A;  4ZPW R;  3BXW A;  1JNE A;  5HT1 A;  1FKK A;  5GPG A;  1VF8 A;  3ARX A;  4C02 B;  3PA7 A;  4O2T A;  1FKD A;  4HBE A;  5HTG A;  4MNJ A;  1WB0 A;  3IK8 A;  3PRD A;  1JND A;  2FAP A;  4TW8 A;  1XRV A;  3WQV A;  4G50 A;  3WL0 A;  3CH9 A;  2QF8 A;  3TCZ A;  5HWC A;  4JFK A;  4MNK A;  2RUC A;  3B9D A;  1ITX A;  4ODR A;  2XP5 A;  1NWT A;  4ODM A;  1E6Z A;  3EY6 A;  4Z2L A;  4MGV A;  1YW5 A;  2PPP A;  3CHD A;  2DG3 A;  2XPA A;  2G41 A;  2ITK A;  3O5J A;  3WD4 A;  4J4N A;  2LKN A;  4S3K A;  1L1P A;  3OOB A;  2XP7 A;  3JYM A;  3RFW A;  4R5E A;  4ODN A;  1BL4 A;  1TCO C;  1NWR A;  2RQS A;  3O5E A;  3O5L A;  1ZBW A;  1FKT A;  1IX5 A;  3RGC A;  2DT2 A;  2PPN A;  1HKI A;  3CHF A;  3AS1 A;  1JNS A;  1W1V A;  4MTV A;  5GPR A;  2F21 A;  1W9V A;  1F40 A;  1C9H A;  1HJV A;  2LJ4 A;  3ARW A;  4IPX A;  1J6Y A;  2A3E A;  1ROT A;  2F4E A;  2KFW A;  4AY1 A;  3B9A A;  1XHG A;  1KT0 A;  2Q5A A;  2RSE A;  3LUO A;  1HKM A;  3AS0 A;  4IT4 A;  1LJY A;  4LGX A;  1D7H A;  3WH0 A;  4P8U A;  1D6O A;  2KGJ A;  1NSG A;  1KT1 A;  3RM9 A;  1LQ0 A;  3KAH A;  3G6M A;  4JFL A;  4LAV A;  2A3B A;  4DIP A;  3PR9 A;  4G2P A;  2WM0 A;  3B7X A;  3FAP A;  4GIV A;  1ZBK A;  1FKR A;  3UI4 A;  3AQU A;  4DH0 A;  3IHZ A;  1GUV A;  4DRO A;  1Q6U A;  1OWQ A;  2XP4 A;  3ART A;  2B31 A;  4Q22 A;  4DWS A;  2XP8 A;  5DIV A;  1OGG A;  1Q1C A;  1D2K A;  1FKJ A;  3PRA A;  3JYJ A;  5D75 A;  2UZ5 A;  3KAD A;  4MNL A;  3G6L A;  4J4O A;  2DSZ A;  2MPH A;  4ODQ A;  3OA5 A;  2DSV A;  4TW6 A;  4IT6 A;  5DIU A;  1ZBC A;  3KZ7 A;  1FKG A;  1LL7 A;  1NMV A;  2RUR A;  1Q6I A;  1FFQ A;  4W9Q A;  2DT0 A;  1LG1 A;  3RM4 A;  1NH6 A;  3ARP A;  3KAI A;  3KCE A;  1OGB A;  4U84 A;  1FKL A;  1ZB5 A;  4XAK A;  4WKA A;  4QT2 A;  3NI6 A;  1SYT A;  3PRB A;  3WD1 A;  2WK2 A;  3O5D A;  2MLY A;  3W4R A;  1R9H A;  4U86 A;  3CHE A;  1JNT A;  1N1A A;  3UI5 A;  5DO2 A;  5DF0 A;  4ZS6 A;  4DWS D;  4LAY A;  2LPV A;  1X6L A;  3AS3 A;  1LL4 A;  4Z2G A;  4L3N A;  3NRK A;  1SR0 A;  1KFW A;  2A3C A;  3O5I A;  4L72 B;  1ZL1 A;  2XP9 A;  1D7J A;  1YAT A;  3UQB A;  1JVW A;  2XPB A;  2M1I A;  4GGQ A;  1EDQ A;  3CGN A;  2KE0 A;  4P8V A;  4R0X A;  2ZQV A;  1NMW A;  1HKJ A;  3UQI A;  4JFI A;  2DT1 A;  2XP6 A;  1EHN A;  3ODK A;  1W9P A;  3ARV A;  4TNS A;  2ZQS A;  1FKI A;  2LGO A;  1FKF A;  3B8S A;  3FY1 A;  1PIN A;  4PTM A;  1LG2 A;  1HJW A;  5I98 A;  4WKF A;  3KAB A;  4LAW A;  4ITZ A;  1FFR A;  4DWS C;  2Y78 A;  3ARQ A;  4DZ2 A;  1QPF A;  2PV3 A;  1FKB A;  1FJD A;  3WIJ A;  2O9O A;  2ZR6 A;  2YBT A;  4MPK A;  4WK9 A;  2AWG A;  4WIW A;  3NTP A;  3VAW A;  1W1T A;  5HW6 A;  3WD0 A;  4Q7N A;  4Z2H A;  5GQB A;  4DRH A;  2ZR5 A;  2M2A A;  1W1P A;  3UQA A;  1ZBV A;  2A3A A;  3I6C A;  3IKD A;  4JYS A;  4DWS B;  3KAG A;  3O5F A;  4MAV A;  4FAP A;  1RD6 A;  4MNM A;  2PBC A;  1J4H A;  2ZQU A;  2ZQT A;  2FDM A;  2PPO A;  1D7I A;  3ARZ A;  2ZR4 A;  1HKK A;  4NZC A;  1W26 A;  4WJX A;  2XP3 A;  4QT3 A;  3CZ8 A;  2DT3 A;  1FKH A;  4Z2I A;  1UR9 A;  3TC5 A;  1ZK6 A;  4KR0 B;  3H9R B;  2MF9 A;  1CTN A;  3ARU A;  4BF8 A;  3ALG A;  2DSU A;  4W9O A;  3WKZ A;  4W9P A;  1TFV A;  4KQZ A;  2OLH A;  1Y0O A;  3B9E A;  2WLZ A;  4HBO A;  3WD3 A;  4TW7 A;  1J4R A;  3WQW A;  4DRK A;  2VN1 A;  4DRP A;  4QZV B;  1O6I A;  4ODL A;  2F2D A;  3UF8 A;  2DG9 A;  4DRN A;  1FD9 A;  1NWS A;  3TDB A;  2KR7 A;  2N87 A;  1K9T A;  2K8I A;  4DRJ A;  3UI6 A;  1NWU A;  4JFM A;  1A7X A;  1M5Y A;  2PV2 A;  4TYO A;  2MLZ A;  2ESC A;  2M08 A;  5BXJ A;  3KAF A;  2IUZ A;  3QOK A;  1LL6 A;  1WAW A;  5DIT A;  5HW8 A;  1ZCN A;  4ZPT R;  3ARR A;  4QIB A;  2MNT A;  4URI A;  2MLX A;  4NSB A;  3AS2 A;  1E6R A;  3GPK A;  2KI3 A;  1EIB A;  5B8I C;  4NNR A;  4DZ3 A;  2WLY A;  3ARY A;  4W5U A;  1W1Y A;  4ZPV R;  3O5O A;  2L2S A;  2IF4 A;  1GOI A;  3CHC A;  4HAR A;  4WKH A;  2D9F A;  1WNO A;  1PBK A;  2PV1 A;  1BKF A;  1HJX A;  1QZ2 A;  3O5R A;  1B6C A;  1QPL A;  1Q6H A;  2AOS A;  4IQC A;  4ODO A;  3CGM A;  1E6P A;  5J6E A;  5HW7 A;  4TX0 A;  5HWB A;  1FKS A;  4LAX A;  2PI6 A;  1P5Q A;  3O5Q A;  1HXV A;  1FAP A;  2G8Z A;  2VCD A;  3JXV A;  2YBU A;  1EQ3 A;  2RUQ A;  4DRI A;  4IQ2 A;  5HUA A;  1H0I A;  4Z2J A;  1ZU8 A;  3ARO A;  4DRM A;  3ALF A;  5JH8 A;  2O92 A;  3O5P A;  5HKG A;  1J4I A;  3MDY B;  4U85 A;  3O5M A;  3ARS A;  4Z2K A;  4ODK A;  3RM8 A;  1ROU A;  1T11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...