4BF8A

Fpr4 ppi domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
117
structure length
117
Chain Sequence
b'GAMAKPKTKLLEGGIIIEDRVTGKGPHAKKGTRVGMRYVGKLKNGKVFDKNTKGKPFVFKLGQGEVIKGWDIGVAGMAVGGERRIVIPAPYAYGKQALPGIPANSELTFDVKLVSMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FPR4
publication title Structure and Activity of the Peptidyl-Prolyl Isomerase Domain from the Histone Chaperone Fpr4 Towards Histone H3 Proline Isomerization
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 21
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4bf8A00
1KT1A 3LUOA 1ROUA 3MDYB 4FN2A 4TW6A 2XP9A 2Q5AA 4ODNA 4U86A 5HW6A 1B6CA 1FKKA 1P5QA 4JFMA 4DT4A 4LAYA 3RFWA 1J4HA 3CGNA 4U85A 2KR7A 1YATA 4ODPA 2LJ4A 1D7IA 4LAXA 4ODKA 4LAVA 2MPHA 3NRKA 2PPNA 4DRMA 3UQBA 1ZCNA 4ODRA 2DG3A 4GIVA 1F40A 1QPFA 1Y0OA 1PINA 3UF8A 4GGQA 1EYMA 3IK8A 2ZQVA 1YW5A 2LPVA 4ODOA 3O5GA 1FKHA 4DRJA 2ZR5A 5HKGA 5I98A 3VAWA 3JYJA 2OFNA 2PV2A 2VN1A 1ROTA 4IQCA 4JFIA 1NMVA 3KABA 4U84A 5BXJA 1KT0A 2KE0A 2RURA 3FAPA 2MLZA 3O5QA 3OOBA 4ITZA 3EY6A 2XP6A 4MSPA 1NMWA 5HT1A 4C02B 1J6YA 3NTPA 2RUDA 3UQAA 2XPBA 2PPPA 4TNSA 3TCZA 2RUQA 3TC5A 3CGMA 4FAPA 5J6EA 1JNSA 3UI5A 2XP3A 1HXVA 3O5IA 2PV3A 1J4IA 4G50A 3TDBA 1FKLA 1Q6IA 2XP4A 3PA7A 5D75A 4ODQA 4MGVA 5DITA 3KADA 5B8IC 2DG9A 1D6OA 3NI6A 3IHZA 4W9PA 2LGOA 2PV1A 1W26A 1FJDA 2IF4A 1N1AA 2MLYA 4LAWA 2RQSA 5HUAA 5DIVA 2D9FA 2VCDA 1ZK6A 3KAGA 3ODKA 4JYSA 2KO7A 2N87A 1QPLA 3GPKA 4QT3A 4DIPA 4DROA 2JZVA 4DZ3A 1FKTA 4ODMA 1FD9A 1A7XA 3UI4A 4BF8A 4DRIA 3PRDA 1FKBA 5HTGA 5HWBA 1D7HA 3O5PA 3IKGA 2KI3A 4IPXA 2ZQUA 3KCEA 5DIUA 4DH0A 1F8AB 3O5JA 2MNTA 3O5RA 3PRBA 1FKJA 1JVWA 3O5FA 3O5OA 2UZ5A 4TW8A 1L1PA 3I6CA 4N19A 4O2TA 2AWGA 2PPOA 4JFJA 2FKEA 4W9QA 1C9HA 3JXVA 3RGCA 1PBKA 5HW7A 5GPGA 1J4RA 1D7JA 4QIBA 4TX0A 4W9OA 1R9HA 4JFLA 1Q6HA 2ZQTA 3KACA 2ITKA 1M5YA 3B7XA 2PBCA 1QZ2A 4DZ2A 1FKDA 3KAFA 5HWCA 1TCOC 2M2AA 2MF9A 4IQ2A 2DG4A 3KAIA 4DRQA 4ODLA 4DRKA 4TW7A 2XPAA 1Q6UA 3JYMA 3H9RB 2F21A 2RSEA 2KGJA 4R0XA 2XP7A 2ZQSA 2M08A 3KZ7A 1NSGA 4G2PA 2FAPA 1FKSA 3O5KA 3UQIA 2LKNA 2Y78A 3UI6A 4DRHA 1FKGA 4J4OA 1Q1CA 2ZR6A 1FKFA 1T11A 2MLXA 2XP5A 2XP8A 1FKIA 3IKDA 3KAHA 3O5DA 4QT2A 4TYOA 4DRNA 2KFWA 1U79A 2F2DA 2ZR4A 3O5EA 4J4NA 4DRPA 3O5MA 2F4EA 5HW8A 2L2SA 2K8IA 1EQ3A 1FKRA 4NNRA 1JNTA 1BKFA 4JFKA 3WH0A 2RUCA 3O5LA 1FAPA 2M1IA 1BL4A
chains in the Genus database with same CATH superfamily
3MDYB 3B8SA 1W1TA 4WJXA 4U86A 1FFQA 5HW6A 4JFMA 1J4HA 3CGNA 3BMBA 3AS2A 5DEZA 4ODKA 4LAXA 1JNEA 2B5UB 3UQBA 3AS1A 4ODRA 1PINA 3IK8A 5HKGA 1FKHA 2OFNA 1GOIA 2PV2A 2B31A 1SYTA 1NMVA 3CH9A 5BXJA 2KE0A 2RURA 3OOBA 2MLZA 1ZBKA 1LL4A 4DWSA 1NMWA 1E15A 1GPFA 3WD4A 2PPPA 3TCZA 2XP3A 1FKLA 2FDMA 5DITA 3B9EA 4W9PA 3KAGA 1HKJA 3GPKA 2JZVA 2F23A 1A7XA 2O9OA 3ARXA 3GTYX 4WKAA 5HTGA 5HWBA 3O5PA 1IX5A 4DH0A 2WK2A 3O5JA 1X6LA 3PRBA 1FKJA 1WNOA 1E6PA 4MTVA 2AWGA 1WB0A 3RM8A 1JNDA 2P4VA 2QF8A 1PBKA 5HW7A 5GPGA 1J4RA 1D7JA 2A3EA 1E9LA 1Q6HA 4ZS6A 2ITKA 4IQ2A 2DG4A 1ZU8A 2XPAA 3ALGA 3AQUA 2ZQSA 3KZ7A 1CTNA 3B9DA 3O5KA 3RM4A 3FXYA 4J4OA 1FKFA 1X6NA 2XP5A 2XP8A 3IKDA 4QT2A 3CHDA 3O5EA 2ZR4A 3G6MA 1JNTA 1LG2A 4JFKA 3WH0A 4O2TA 1KT1A 1ZBCA 4S3JA 5DF0A 3WQWA 4ODNA 1HKIA 4XAKA 1ZL1A 3RFWA 1LL6A 2KR7A 4R5EA 4ODPA 2DSUA 4DRMA 3NRKA 3OA5A 4GIVA 1W1YA 1HJWA 1QPFA 4GGQA 4URIA 2ZQVA 2LPVA 1ZBWA 1LJYA 1NWSA 1ROTA 1WAWA 3KABA 4U84A 1OGGA 5HT1A 3ALFA 1VF8A 3UQAA 4TNSA 2RUQA 3AS3A 4WKHA 1ZBVA 3O5IA 3TDBA 4G50A 4KR0B 2YBUA 1GUVA 4MGVA 3KADA 5B8IC 1K9TA 1UR9A 1W26A 4LAWA 2ESCA 2RQSA 2D9FA 2IUZA 5HBFA 4W5UA 2KO7A 1QPLA 4Z2HA 1E6ZA 4DROA 1FD9A 3PRDA 1FKBA 3IKGA 5DIUA 4DWSD 1F8AB 4IT4A 2MNTA 3O5FA 3ARWA 3AROA 4JFJA 1O6IA 3CHCA 3ARSA 3WD0A 4TX0A 1EHNA 2ZQTA 3KACA 1HKMA 2PBCA 1FKDA 3KAIA 4Z2IA 4DWSB 3B9AA 3H9RB 2RSEA 2M08A 2YBTA 4KQZA 4DRHA 3UI6A 1FFRA 1Q1CA 2ZR6A 4TYOA 2KFWA 1GRJA 4DRPA 1LQ0A 2G41A 2L2SA 1HJVA 1D2KA 1H0GA 3FY1A 2RUCA 1W9VA 3LUOA 2XP9A 2WLYA 4AY1A 1B6CA 4DT4A 1KFWA 4LAYA 1YATA 4LAVA 2MPHA 1ZCNA 2DG3A 1LL7A 3UF8A 1YW5A 3O5GA 1W1PA 2ZR5A 1E44A 1EIBA 2VN1A 1KT0A 5GQBA 2G8ZA 4C02B 4ML4A 2RUDA 3ARYA 2XPBA 5J6EA 1JNSA 3CGMA 4FAPA 3UI5A 1Q6IA 2XP4A 3PA7A 4ODQA 1W1VA 1XHGA 3NI6A 4ZPVR 2DSVA 2DSWA 2PV1A 1FJDA 2MLYA 5HUAA 5GPRA 2VCDA 4WKFA 4Z2KA 3ODKA 4JYSA 4PTMA 4ZPTR 2DT3A 1EDQA 4DZ3A 4QZVB 3WD1A 1W9PA 4Q22A 4ODMA 4MAVA 1NWTA 4S3KA 3UI4A 3RM9A 3ARRA 3W4RA 2ZQUA 4ZPWR 4MNKA 1ZB5A 4L72B 4WIWA 4TW8A 1L1PA 4HBOA 1JVWA 2UZ5A 2FKEA 3ARQA 3PR9A 4MNMA 1C9HA 3JXVA 2WM0A 3WKZA 3ARUA 2O92A 3CZ8A 4W9OA 3BXWA 1R9HA 3AS0A 3PRAA 4JFLA 3B7XA 4MNLA 3KAFA 1TCOC 2DT2A 4DRQA 4DRKA 4ODLA 1E6NA 3JYMA 4R0XA 1E6RA 1HKKA 4G2PA 2FAPA 1FKSA 1NH6A 5DO2A 4HARA 2Y78A 1FKGA 1T11A 2MLXA 4DRNA 1FKIA 1HXVA 1U79A 2F2DA 2PN0A 3O5MA 2F4EA 4IT6A 1W9UA 1OGBA 4NNRA 4UDMA 4MNJA 4Z2JA 2A3AA 1ROUA 1XRVA 4FN2A 4TW6A 2Q5AA 4P8WA 4P8XA 2DSZA 1FKKA 1P5QA 3WD2A 3ARZA 4U85A 3CHFA 2LJ4A 1D7IA 1F40A 2PPNA 1Y0OA 4P8VA 1ITXA 4HBEA 1EYMA 4DRJA 4ODOA 4Z2GA 3VAWA 3JYJA 5I98A 2AOSA 4LGXA 2ETNA 4IQCA 1H0IA 4JFIA 3FAPA 3O5QA 4ITZA 3EY6A 2XP6A 3CHEA 3ARTA 4MSPA 1J6YA 4Z2LA 3NTPA 3ARPA 3EIPA 3TC5A 1HJXA 2PV3A 1J4IA 2A3BA 5D75A 3WIJA 2DG9A 1D6OA 5JH8A 3IHZA 2LGOA 4P8UA 2IF4A 1N1AA 2OLHA 5DIVA 1NWUA 3WL1A 1ZK6A 1NWRA 2N87A 2DPEA 4QT3A 4DIPA 1LG1A 1FKTA 4BF8A 4DRIA 1D7HA 3QOKA 2KI3A 1JCHB 4IPXA 3KCEA 4Q7NA 1OWQA 1SR0A 3O5RA 3GU0A 3O5OA 3I6CA 4N19A 3WD3A 2PPOA 3WQVA 4W9QA 3RGCA 2PI6A 3RMEA 4QIBA 2DT0A 1M5YA 1QZ2A 4DZ2A 5HWCA 4MPKA 2M2AA 2MF9A 4TW7A 1Q6UA 2F21A 2KGJA 2XP7A 3WL0A 4WK9A 1TFVA 4L3NA 1NSGA 2A3CA 3UQIA 2LKNA 2DT1A 1RD6A 4DWSC 4NZCA 3O5DA 3KAHA 2EULA 3ARVA 3G6LA 4J4NA 4NSBA 5HW8A 1UR8A 2K8IA 1EQ3A 1FKRA 2WLZA 1BKFA 3O5LA 1FAPA 2M1IA 1BL4A
chains in the Genus database with same CATH topology
3MDYB 3B8SA 1W1TA 4WJXA 4U86A 1FFQA 5HW6A 4JFMA 1J4HA 3CGNA 3AS2A 5DEZA 4ODKA 4LAXA 1JNEA 3UQBA 3AS1A 4ODRA 1PINA 3IK8A 5HKGA 1FKHA 2OFNA 1GOIA 2PV2A 2B31A 1SYTA 1NMVA 3CH9A 5BXJA 2KE0A 2RURA 3OOBA 2MLZA 1ZBKA 1LL4A 4DWSA 1NMWA 1E15A 1GPFA 3WD4A 2PPPA 3TCZA 2XP3A 1FKLA 2FDMA 5DITA 3B9EA 4W9PA 3KAGA 1HKJA 3GPKA 2JZVA 1A7XA 2O9OA 3ARXA 4WKAA 5HWBA 5HTGA 3O5PA 1IX5A 4DH0A 2WK2A 3O5JA 1X6LA 3PRBA 1FKJA 1WNOA 1E6PA 4MTVA 2AWGA 1WB0A 3RM8A 1JNDA 2QF8A 1PBKA 5HW7A 5GPGA 1J4RA 1D7JA 2A3EA 1E9LA 1Q6HA 4ZS6A 2ITKA 4IQ2A 2DG4A 1ZU8A 2XPAA 3ALGA 3AQUA 2ZQSA 3KZ7A 1CTNA 3B9DA 3O5KA 3RM4A 3FXYA 4J4OA 1FKFA 1X6NA 2XP5A 2XP8A 3IKDA 4QT2A 3CHDA 3O5EA 2ZR4A 3G6MA 1JNTA 1LG2A 4JFKA 3WH0A 4O2TA 1KT1A 1ZBCA 4S3JA 5DF0A 3WQWA 4ODNA 1HKIA 4XAKA 1ZL1A 3RFWA 1LL6A 2KR7A 4R5EA 4ODPA 2DSUA 4DRMA 3NRKA 3OA5A 4GIVA 1W1YA 1HJWA 1QPFA 4GGQA 4URIA 2ZQVA 2LPVA 1ZBWA 1LJYA 1NWSA 1ROTA 1WAWA 3KABA 4U84A 1OGGA 5HT1A 3ALFA 1VF8A 3UQAA 4TNSA 2RUQA 3AS3A 4WKHA 1ZBVA 3O5IA 3TDBA 4G50A 4KR0B 2YBUA 1GUVA 4MGVA 3KADA 5B8IC 1K9TA 1UR9A 1W26A 4LAWA 2ESCA 2RQSA 2D9FA 2IUZA 5HBFA 4W5UA 2KO7A 1QPLA 4Z2HA 1E6ZA 4DROA 1FD9A 3PRDA 1FKBA 3IKGA 5DIUA 4DWSD 1F8AB 4IT4A 2MNTA 3O5FA 3ARWA 3AROA 4JFJA 1O6IA 3CHCA 3ARSA 3WD0A 4TX0A 1EHNA 2ZQTA 3KACA 1HKMA 2PBCA 1FKDA 3KAIA 4Z2IA 4DWSB 3B9AA 3H9RB 2RSEA 2M08A 2YBTA 4KQZA 4DRHA 3UI6A 1FFRA 1Q1CA 2ZR6A 4TYOA 2KFWA 4DRPA 1LQ0A 2G41A 2L2SA 1HJVA 1D2KA 1H0GA 3FY1A 2RUCA 1W9VA 3LUOA 2XP9A 2WLYA 4AY1A 1B6CA 4DT4A 1KFWA 4LAYA 1YATA 4LAVA 2MPHA 1ZCNA 2DG3A 1LL7A 3UF8A 1YW5A 3O5GA 1W1PA 2ZR5A 1EIBA 2VN1A 1KT0A 5GQBA 2G8ZA 4C02B 4ML4A 2RUDA 3ARYA 2XPBA 5J6EA 1JNSA 3CGMA 4FAPA 3UI5A 1Q6IA 2XP4A 3PA7A 4ODQA 1W1VA 1XHGA 3NI6A 4ZPVR 2DSVA 2DSWA 2PV1A 1FJDA 2MLYA 5HUAA 5GPRA 2VCDA 4WKFA 4Z2KA 3ODKA 4JYSA 4PTMA 4ZPTR 2DT3A 1EDQA 4DZ3A 4QZVB 3WD1A 1W9PA 4Q22A 4ODMA 4MAVA 1NWTA 4S3KA 3UI4A 3RM9A 3ARRA 3W4RA 2ZQUA 4ZPWR 4MNKA 1ZB5A 4L72B 4WIWA 4TW8A 1L1PA 4HBOA 1JVWA 2UZ5A 2FKEA 3ARQA 3PR9A 4MNMA 1C9HA 3JXVA 2WM0A 3WKZA 3ARUA 2O92A 3CZ8A 4W9OA 3BXWA 1R9HA 3AS0A 3PRAA 4JFLA 3B7XA 4MNLA 3KAFA 1TCOC 2DT2A 4DRQA 4DRKA 4ODLA 1E6NA 3JYMA 4R0XA 1E6RA 1HKKA 4G2PA 2FAPA 1FKSA 1NH6A 5DO2A 4HARA 2Y78A 1FKGA 1T11A 2MLXA 4DRNA 1FKIA 1HXVA 1U79A 2F2DA 3O5MA 2F4EA 4IT6A 1W9UA 1OGBA 4NNRA 4MNJA 4Z2JA 2A3AA 1ROUA 1XRVA 4FN2A 4TW6A 2Q5AA 4P8WA 4P8XA 2DSZA 1FKKA 1P5QA 3WD2A 3ARZA 4U85A 3CHFA 2LJ4A 1D7IA 1F40A 2PPNA 1Y0OA 4P8VA 1ITXA 4HBEA 1EYMA 4DRJA 4ODOA 4Z2GA 3VAWA 3JYJA 5I98A 2AOSA 4LGXA 4IQCA 1H0IA 4JFIA 3FAPA 3O5QA 4ITZA 3EY6A 2XP6A 3CHEA 3ARTA 4MSPA 1J6YA 4Z2LA 3NTPA 3ARPA 3TC5A 1HJXA 2PV3A 1J4IA 2A3BA 5D75A 3WIJA 2DG9A 1D6OA 5JH8A 3IHZA 2LGOA 4P8UA 2IF4A 1N1AA 2OLHA 5DIVA 1NWUA 3WL1A 1ZK6A 1NWRA 2N87A 2DPEA 4QT3A 4DIPA 1LG1A 1FKTA 4BF8A 4DRIA 1D7HA 3QOKA 2KI3A 4IPXA 3KCEA 4Q7NA 1OWQA 1SR0A 3O5RA 3O5OA 3I6CA 4N19A 3WD3A 2PPOA 3WQVA 4W9QA 3RGCA 2PI6A 3RMEA 4QIBA 2DT0A 1M5YA 1QZ2A 4DZ2A 5HWCA 4MPKA 2M2AA 2MF9A 4TW7A 1Q6UA 2F21A 2KGJA 2XP7A 3WL0A 4WK9A 1TFVA 4L3NA 1NSGA 2A3CA 3UQIA 2LKNA 2DT1A 1RD6A 4DWSC 4NZCA 3O5DA 3KAHA 3ARVA 3G6LA 4J4NA 4NSBA 5HW8A 1UR8A 2K8IA 1EQ3A 1FKRA 2WLZA 1BKFA 3O5LA 1FAPA 2M1IA 1BL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KT1 A;  3LUO A;  1ROU A;  3MDY B;  4FN2 A;  4TW6 A;  2XP9 A;  2Q5A A;  4ODN A;  4U86 A;  5HW6 A;  1B6C A;  1FKK A;  1P5Q A;  4JFM A;  4DT4 A;  4LAY A;  3RFW A;  1J4H A;  3CGN A;  4U85 A;  2KR7 A;  1YAT A;  4ODP A;  2LJ4 A;  1D7I A;  4LAX A;  4ODK A;  4LAV A;  2MPH A;  3NRK A;  2PPN A;  4DRM A;  3UQB A;  1ZCN A;  4ODR A;  2DG3 A;  4GIV A;  1F40 A;  1QPF A;  1Y0O A;  1PIN A;  3UF8 A;  4GGQ A;  1EYM A;  3IK8 A;  2ZQV A;  1YW5 A;  2LPV A;  4ODO A;  3O5G A;  1FKH A;  4DRJ A;  2ZR5 A;  5HKG A;  5I98 A;  3VAW A;  3JYJ A;  2OFN A;  2PV2 A;  2VN1 A;  1ROT A;  4IQC A;  4JFI A;  1NMV A;  3KAB A;  4U84 A;  5BXJ A;  1KT0 A;  2KE0 A;  2RUR A;  3FAP A;  2MLZ A;  3O5Q A;  3OOB A;  4ITZ A;  3EY6 A;  2XP6 A;  4MSP A;  1NMW A;  5HT1 A;  4C02 B;  1J6Y A;  3NTP A;  2RUD A;  3UQA A;  2XPB A;  2PPP A;  4TNS A;  3TCZ A;  2RUQ A;  3TC5 A;  3CGM A;  4FAP A;  5J6E A;  1JNS A;  3UI5 A;  2XP3 A;  1HXV A;  3O5I A;  2PV3 A;  1J4I A;  4G50 A;  3TDB A;  1FKL A;  1Q6I A;  2XP4 A;  3PA7 A;  5D75 A;  4ODQ A;  4MGV A;  5DIT A;  3KAD A;  5B8I C;  2DG9 A;  1D6O A;  3NI6 A;  3IHZ A;  4W9P A;  2LGO A;  2PV1 A;  1W26 A;  1FJD A;  2IF4 A;  1N1A A;  2MLY A;  4LAW A;  2RQS A;  5HUA A;  5DIV A;  2D9F A;  2VCD A;  1ZK6 A;  3KAG A;  3ODK A;  4JYS A;  2KO7 A;  2N87 A;  1QPL A;  3GPK A;  4QT3 A;  4DIP A;  4DRO A;  2JZV A;  4DZ3 A;  1FKT A;  4ODM A;  1FD9 A;  1A7X A;  3UI4 A;  4BF8 A;  4DRI A;  3PRD A;  1FKB A;  5HTG A;  5HWB A;  1D7H A;  3O5P A;  3IKG A;  2KI3 A;  4IPX A;  2ZQU A;  3KCE A;  5DIU A;  4DH0 A;  1F8A B;  3O5J A;  2MNT A;  3O5R A;  3PRB A;  1FKJ A;  1JVW A;  3O5F A;  3O5O A;  2UZ5 A;  4TW8 A;  1L1P A;  3I6C A;  4N19 A;  4O2T A;  2AWG A;  2PPO A;  4JFJ A;  2FKE A;  4W9Q A;  1C9H A;  3JXV A;  3RGC A;  1PBK A;  5HW7 A;  5GPG A;  1J4R A;  1D7J A;  4QIB A;  4TX0 A;  4W9O A;  1R9H A;  4JFL A;  1Q6H A;  2ZQT A;  3KAC A;  2ITK A;  1M5Y A;  3B7X A;  2PBC A;  1QZ2 A;  4DZ2 A;  1FKD A;  3KAF A;  5HWC A;  1TCO C;  2M2A A;  2MF9 A;  4IQ2 A;  2DG4 A;  3KAI A;  4DRQ A;  4ODL A;  4DRK A;  4TW7 A;  2XPA A;  1Q6U A;  3JYM A;  3H9R B;  2F21 A;  2RSE A;  2KGJ A;  4R0X A;  2XP7 A;  2ZQS A;  2M08 A;  3KZ7 A;  1NSG A;  4G2P A;  2FAP A;  1FKS A;  3O5K A;  3UQI A;  2LKN A;  2Y78 A;  3UI6 A;  4DRH A;  1FKG A;  4J4O A;  1Q1C A;  2ZR6 A;  1FKF A;  1T11 A;  2MLX A;  2XP5 A;  2XP8 A;  1FKI A;  3IKD A;  3KAH A;  3O5D A;  4QT2 A;  4TYO A;  4DRN A;  2KFW A;  1U79 A;  2F2D A;  2ZR4 A;  3O5E A;  4J4N A;  4DRP A;  3O5M A;  2F4E A;  5HW8 A;  2L2S A;  2K8I A;  1EQ3 A;  1FKR A;  4NNR A;  1JNT A;  1BKF A;  4JFK A;  3WH0 A;  2RUC A;  3O5L A;  1FAP A;  2M1I A;  1BL4 A; 
#chains in the Genus database with same CATH topology
 3MDY B;  3B8S A;  1W1T A;  4WJX A;  4U86 A;  1FFQ A;  5HW6 A;  4JFM A;  1J4H A;  3CGN A;  3BMB A;  3AS2 A;  5DEZ A;  4ODK A;  4LAX A;  1JNE A;  2B5U B;  3UQB A;  3AS1 A;  4ODR A;  1PIN A;  3IK8 A;  5HKG A;  1FKH A;  2OFN A;  1GOI A;  2PV2 A;  2B31 A;  1SYT A;  1NMV A;  3CH9 A;  5BXJ A;  2KE0 A;  2RUR A;  3OOB A;  2MLZ A;  1ZBK A;  1LL4 A;  4DWS A;  1NMW A;  1E15 A;  1GPF A;  3WD4 A;  2PPP A;  3TCZ A;  2XP3 A;  1FKL A;  2FDM A;  5DIT A;  3B9E A;  4W9P A;  3KAG A;  1HKJ A;  3GPK A;  2JZV A;  2F23 A;  1A7X A;  2O9O A;  3ARX A;  3GTY X;  4WKA A;  5HTG A;  5HWB A;  3O5P A;  1IX5 A;  4DH0 A;  2WK2 A;  3O5J A;  1X6L A;  3PRB A;  1FKJ A;  1WNO A;  1E6P A;  4MTV A;  2AWG A;  1WB0 A;  3RM8 A;  1JND A;  2P4V A;  2QF8 A;  1PBK A;  5HW7 A;  5GPG A;  1J4R A;  1D7J A;  2A3E A;  1E9L A;  1Q6H A;  4ZS6 A;  2ITK A;  4IQ2 A;  2DG4 A;  1ZU8 A;  2XPA A;  3ALG A;  3AQU A;  2ZQS A;  3KZ7 A;  1CTN A;  3B9D A;  3O5K A;  3RM4 A;  3FXY A;  4J4O A;  1FKF A;  1X6N A;  2XP5 A;  2XP8 A;  3IKD A;  4QT2 A;  3CHD A;  3O5E A;  2ZR4 A;  3G6M A;  1JNT A;  1LG2 A;  4JFK A;  3WH0 A;  4O2T A;  1KT1 A;  1ZBC A;  4S3J A;  5DF0 A;  3WQW A;  4ODN A;  1HKI A;  4XAK A;  1ZL1 A;  3RFW A;  1LL6 A;  2KR7 A;  4R5E A;  4ODP A;  2DSU A;  4DRM A;  3NRK A;  3OA5 A;  4GIV A;  1W1Y A;  1HJW A;  1QPF A;  4GGQ A;  4URI A;  2ZQV A;  2LPV A;  1ZBW A;  1LJY A;  1NWS A;  1ROT A;  1WAW A;  3KAB A;  4U84 A;  1OGG A;  5HT1 A;  3ALF A;  1VF8 A;  3UQA A;  4TNS A;  2RUQ A;  3AS3 A;  4WKH A;  1ZBV A;  3O5I A;  3TDB A;  4G50 A;  4KR0 B;  2YBU A;  1GUV A;  4MGV A;  3KAD A;  5B8I C;  1K9T A;  1UR9 A;  1W26 A;  4LAW A;  2ESC A;  2RQS A;  2D9F A;  2IUZ A;  5HBF A;  4W5U A;  2KO7 A;  1QPL A;  4Z2H A;  1E6Z A;  4DRO A;  1FD9 A;  3PRD A;  1FKB A;  3IKG A;  5DIU A;  4DWS D;  1F8A B;  4IT4 A;  2MNT A;  3O5F A;  3ARW A;  3ARO A;  4JFJ A;  1O6I A;  3CHC A;  3ARS A;  3WD0 A;  4TX0 A;  1EHN A;  2ZQT A;  3KAC A;  1HKM A;  2PBC A;  1FKD A;  3KAI A;  4Z2I A;  4DWS B;  3B9A A;  3H9R B;  2RSE A;  2M08 A;  2YBT A;  4KQZ A;  4DRH A;  3UI6 A;  1FFR A;  1Q1C A;  2ZR6 A;  4TYO A;  2KFW A;  1GRJ A;  4DRP A;  1LQ0 A;  2G41 A;  2L2S A;  1HJV A;  1D2K A;  1H0G A;  3FY1 A;  2RUC A;  1W9V A;  3LUO A;  2XP9 A;  2WLY A;  4AY1 A;  1B6C A;  4DT4 A;  1KFW A;  4LAY A;  1YAT A;  4LAV A;  2MPH A;  1ZCN A;  2DG3 A;  1LL7 A;  3UF8 A;  1YW5 A;  3O5G A;  1W1P A;  2ZR5 A;  1E44 A;  1EIB A;  2VN1 A;  1KT0 A;  5GQB A;  2G8Z A;  4C02 B;  4ML4 A;  2RUD A;  3ARY A;  2XPB A;  5J6E A;  1JNS A;  3CGM A;  4FAP A;  3UI5 A;  1Q6I A;  2XP4 A;  3PA7 A;  4ODQ A;  1W1V A;  1XHG A;  3NI6 A;  4ZPV R;  2DSV A;  2DSW A;  2PV1 A;  1FJD A;  2MLY A;  5HUA A;  5GPR A;  2VCD A;  4WKF A;  4Z2K A;  3ODK A;  4JYS A;  4PTM A;  4ZPT R;  2DT3 A;  1EDQ A;  4DZ3 A;  4QZV B;  3WD1 A;  1W9P A;  4Q22 A;  4ODM A;  4MAV A;  1NWT A;  4S3K A;  3UI4 A;  3RM9 A;  3ARR A;  3W4R A;  2ZQU A;  4ZPW R;  4MNK A;  1ZB5 A;  4L72 B;  4WIW A;  4TW8 A;  1L1P A;  4HBO A;  1JVW A;  2UZ5 A;  2FKE A;  3ARQ A;  3PR9 A;  4MNM A;  1C9H A;  3JXV A;  2WM0 A;  3WKZ A;  3ARU A;  2O92 A;  3CZ8 A;  4W9O A;  3BXW A;  1R9H A;  3AS0 A;  3PRA A;  4JFL A;  3B7X A;  4MNL A;  3KAF A;  1TCO C;  2DT2 A;  4DRQ A;  4DRK A;  4ODL A;  1E6N A;  3JYM A;  4R0X A;  1E6R A;  1HKK A;  4G2P A;  2FAP A;  1FKS A;  1NH6 A;  5DO2 A;  4HAR A;  2Y78 A;  1FKG A;  1T11 A;  2MLX A;  4DRN A;  1FKI A;  1HXV A;  1U79 A;  2F2D A;  2PN0 A;  3O5M A;  2F4E A;  4IT6 A;  1W9U A;  1OGB A;  4NNR A;  4UDM A;  4MNJ A;  4Z2J A;  2A3A A;  1ROU A;  1XRV A;  4FN2 A;  4TW6 A;  2Q5A A;  4P8W A;  4P8X A;  2DSZ A;  1FKK A;  1P5Q A;  3WD2 A;  3ARZ A;  4U85 A;  3CHF A;  2LJ4 A;  1D7I A;  1F40 A;  2PPN A;  1Y0O A;  4P8V A;  1ITX A;  4HBE A;  1EYM A;  4DRJ A;  4ODO A;  4Z2G A;  3VAW A;  3JYJ A;  5I98 A;  2AOS A;  4LGX A;  2ETN A;  4IQC A;  1H0I A;  4JFI A;  3FAP A;  3O5Q A;  4ITZ A;  3EY6 A;  2XP6 A;  3CHE A;  3ART A;  4MSP A;  1J6Y A;  4Z2L A;  3NTP A;  3ARP A;  3EIP A;  3TC5 A;  1HJX A;  2PV3 A;  1J4I A;  2A3B A;  5D75 A;  3WIJ A;  2DG9 A;  1D6O A;  5JH8 A;  3IHZ A;  2LGO A;  4P8U A;  2IF4 A;  1N1A A;  2OLH A;  5DIV A;  1NWU A;  3WL1 A;  1ZK6 A;  1NWR A;  2N87 A;  2DPE A;  4QT3 A;  4DIP A;  1LG1 A;  1FKT A;  4BF8 A;  4DRI A;  1D7H A;  3QOK A;  2KI3 A;  1JCH B;  4IPX A;  3KCE A;  4Q7N A;  1OWQ A;  1SR0 A;  3O5R A;  3GU0 A;  3O5O A;  3I6C A;  4N19 A;  3WD3 A;  2PPO A;  3WQV A;  4W9Q A;  3RGC A;  2PI6 A;  3RME A;  4QIB A;  2DT0 A;  1M5Y A;  1QZ2 A;  4DZ2 A;  5HWC A;  4MPK A;  2M2A A;  2MF9 A;  4TW7 A;  1Q6U A;  2F21 A;  2KGJ A;  2XP7 A;  3WL0 A;  4WK9 A;  1TFV A;  4L3N A;  1NSG A;  2A3C A;  3UQI A;  2LKN A;  2DT1 A;  1RD6 A;  4DWS C;  4NZC A;  3O5D A;  3KAH A;  2EUL A;  3ARV A;  3G6L A;  4J4N A;  4NSB A;  5HW8 A;  1UR8 A;  2K8I A;  1EQ3 A;  1FKR A;  2WLZ A;  1BKF A;  3O5L A;  1FAP A;  2M1I A;  1BL4 A; 
#chains in the Genus database with same CATH homology
 3MDY B;  3B8S A;  1W1T A;  4WJX A;  4U86 A;  1FFQ A;  5HW6 A;  4JFM A;  1J4H A;  3CGN A;  3AS2 A;  5DEZ A;  4ODK A;  4LAX A;  1JNE A;  3UQB A;  3AS1 A;  4ODR A;  1PIN A;  3IK8 A;  5HKG A;  1FKH A;  2OFN A;  1GOI A;  2PV2 A;  2B31 A;  1SYT A;  1NMV A;  3CH9 A;  5BXJ A;  2KE0 A;  2RUR A;  3OOB A;  2MLZ A;  1ZBK A;  1LL4 A;  4DWS A;  1NMW A;  1E15 A;  1GPF A;  3WD4 A;  2PPP A;  3TCZ A;  2XP3 A;  1FKL A;  2FDM A;  5DIT A;  3B9E A;  4W9P A;  3KAG A;  1HKJ A;  3GPK A;  2JZV A;  1A7X A;  2O9O A;  3ARX A;  4WKA A;  5HWB A;  5HTG A;  3O5P A;  1IX5 A;  4DH0 A;  2WK2 A;  3O5J A;  1X6L A;  3PRB A;  1FKJ A;  1WNO A;  1E6P A;  4MTV A;  2AWG A;  1WB0 A;  3RM8 A;  1JND A;  2QF8 A;  1PBK A;  5HW7 A;  5GPG A;  1J4R A;  1D7J A;  2A3E A;  1E9L A;  1Q6H A;  4ZS6 A;  2ITK A;  4IQ2 A;  2DG4 A;  1ZU8 A;  2XPA A;  3ALG A;  3AQU A;  2ZQS A;  3KZ7 A;  1CTN A;  3B9D A;  3O5K A;  3RM4 A;  3FXY A;  4J4O A;  1FKF A;  1X6N A;  2XP5 A;  2XP8 A;  3IKD A;  4QT2 A;  3CHD A;  3O5E A;  2ZR4 A;  3G6M A;  1JNT A;  1LG2 A;  4JFK A;  3WH0 A;  4O2T A;  1KT1 A;  1ZBC A;  4S3J A;  5DF0 A;  3WQW A;  4ODN A;  1HKI A;  4XAK A;  1ZL1 A;  3RFW A;  1LL6 A;  2KR7 A;  4R5E A;  4ODP A;  2DSU A;  4DRM A;  3NRK A;  3OA5 A;  4GIV A;  1W1Y A;  1HJW A;  1QPF A;  4GGQ A;  4URI A;  2ZQV A;  2LPV A;  1ZBW A;  1LJY A;  1NWS A;  1ROT A;  1WAW A;  3KAB A;  4U84 A;  1OGG A;  5HT1 A;  3ALF A;  1VF8 A;  3UQA A;  4TNS A;  2RUQ A;  3AS3 A;  4WKH A;  1ZBV A;  3O5I A;  3TDB A;  4G50 A;  4KR0 B;  2YBU A;  1GUV A;  4MGV A;  3KAD A;  5B8I C;  1K9T A;  1UR9 A;  1W26 A;  4LAW A;  2ESC A;  2RQS A;  2D9F A;  2IUZ A;  5HBF A;  4W5U A;  2KO7 A;  1QPL A;  4Z2H A;  1E6Z A;  4DRO A;  1FD9 A;  3PRD A;  1FKB A;  3IKG A;  5DIU A;  4DWS D;  1F8A B;  4IT4 A;  2MNT A;  3O5F A;  3ARW A;  3ARO A;  4JFJ A;  1O6I A;  3CHC A;  3ARS A;  3WD0 A;  4TX0 A;  1EHN A;  2ZQT A;  3KAC A;  1HKM A;  2PBC A;  1FKD A;  3KAI A;  4Z2I A;  4DWS B;  3B9A A;  3H9R B;  2RSE A;  2M08 A;  2YBT A;  4KQZ A;  4DRH A;  3UI6 A;  1FFR A;  1Q1C A;  2ZR6 A;  4TYO A;  2KFW A;  4DRP A;  1LQ0 A;  2G41 A;  2L2S A;  1HJV A;  1D2K A;  1H0G A;  3FY1 A;  2RUC A;  1W9V A;  3LUO A;  2XP9 A;  2WLY A;  4AY1 A;  1B6C A;  4DT4 A;  1KFW A;  4LAY A;  1YAT A;  4LAV A;  2MPH A;  1ZCN A;  2DG3 A;  1LL7 A;  3UF8 A;  1YW5 A;  3O5G A;  1W1P A;  2ZR5 A;  1EIB A;  2VN1 A;  1KT0 A;  5GQB A;  2G8Z A;  4C02 B;  4ML4 A;  2RUD A;  3ARY A;  2XPB A;  5J6E A;  1JNS A;  3CGM A;  4FAP A;  3UI5 A;  1Q6I A;  2XP4 A;  3PA7 A;  4ODQ A;  1W1V A;  1XHG A;  3NI6 A;  4ZPV R;  2DSV A;  2DSW A;  2PV1 A;  1FJD A;  2MLY A;  5HUA A;  5GPR A;  2VCD A;  4WKF A;  4Z2K A;  3ODK A;  4JYS A;  4PTM A;  4ZPT R;  2DT3 A;  1EDQ A;  4DZ3 A;  4QZV B;  3WD1 A;  1W9P A;  4Q22 A;  4ODM A;  4MAV A;  1NWT A;  4S3K A;  3UI4 A;  3RM9 A;  3ARR A;  3W4R A;  2ZQU A;  4ZPW R;  4MNK A;  1ZB5 A;  4L72 B;  4WIW A;  4TW8 A;  1L1P A;  4HBO A;  1JVW A;  2UZ5 A;  2FKE A;  3ARQ A;  3PR9 A;  4MNM A;  1C9H A;  3JXV A;  2WM0 A;  3WKZ A;  3ARU A;  2O92 A;  3CZ8 A;  4W9O A;  3BXW A;  1R9H A;  3AS0 A;  3PRA A;  4JFL A;  3B7X A;  4MNL A;  3KAF A;  1TCO C;  2DT2 A;  4DRQ A;  4DRK A;  4ODL A;  1E6N A;  3JYM A;  4R0X A;  1E6R A;  1HKK A;  4G2P A;  2FAP A;  1FKS A;  1NH6 A;  5DO2 A;  4HAR A;  2Y78 A;  1FKG A;  1T11 A;  2MLX A;  4DRN A;  1FKI A;  1HXV A;  1U79 A;  2F2D A;  3O5M A;  2F4E A;  4IT6 A;  1W9U A;  1OGB A;  4NNR A;  4MNJ A;  4Z2J A;  2A3A A;  1ROU A;  1XRV A;  4FN2 A;  4TW6 A;  2Q5A A;  4P8W A;  4P8X A;  2DSZ A;  1FKK A;  1P5Q A;  3WD2 A;  3ARZ A;  4U85 A;  3CHF A;  2LJ4 A;  1D7I A;  1F40 A;  2PPN A;  1Y0O A;  4P8V A;  1ITX A;  4HBE A;  1EYM A;  4DRJ A;  4ODO A;  4Z2G A;  3VAW A;  3JYJ A;  5I98 A;  2AOS A;  4LGX A;  4IQC A;  1H0I A;  4JFI A;  3FAP A;  3O5Q A;  4ITZ A;  3EY6 A;  2XP6 A;  3CHE A;  3ART A;  4MSP A;  1J6Y A;  4Z2L A;  3NTP A;  3ARP A;  3TC5 A;  1HJX A;  2PV3 A;  1J4I A;  2A3B A;  5D75 A;  3WIJ A;  2DG9 A;  1D6O A;  5JH8 A;  3IHZ A;  2LGO A;  4P8U A;  2IF4 A;  1N1A A;  2OLH A;  5DIV A;  1NWU A;  3WL1 A;  1ZK6 A;  1NWR A;  2N87 A;  2DPE A;  4QT3 A;  4DIP A;  1LG1 A;  1FKT A;  4BF8 A;  4DRI A;  1D7H A;  3QOK A;  2KI3 A;  4IPX A;  3KCE A;  4Q7N A;  1OWQ A;  1SR0 A;  3O5R A;  3O5O A;  3I6C A;  4N19 A;  3WD3 A;  2PPO A;  3WQV A;  4W9Q A;  3RGC A;  2PI6 A;  3RME A;  4QIB A;  2DT0 A;  1M5Y A;  1QZ2 A;  4DZ2 A;  5HWC A;  4MPK A;  2M2A A;  2MF9 A;  4TW7 A;  1Q6U A;  2F21 A;  2KGJ A;  2XP7 A;  3WL0 A;  4WK9 A;  1TFV A;  4L3N A;  1NSG A;  2A3C A;  3UQI A;  2LKN A;  2DT1 A;  1RD6 A;  4DWS C;  4NZC A;  3O5D A;  3KAH A;  3ARV A;  3G6L A;  4J4N A;  4NSB A;  5HW8 A;  1UR8 A;  2K8I A;  1EQ3 A;  1FKR A;  2WLZ A;  1BKF A;  3O5L A;  1FAP A;  2M1I A;  1BL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...