4BF8A

Fpr4 ppi domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
117
structure length
117
Chain Sequence
GAMAKPKTKLLEGGIIIEDRVTGKGPHAKKGTRVGMRYVGKLKNGKVFDKNTKGKPFVFKLGQGEVIKGWDIGVAGMAVGGERRIVIPAPYAYGKQALPGIPANSELTFDVKLVSMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FPR4
publication title Structure and Activity of the Peptidyl-Prolyl Isomerase Domain from the Histone Chaperone Fpr4 Towards Histone H3 Proline Isomerization
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 21
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4bf8A00
2KE0A 4IPXA 2Q5AA 1ROTA 1FKFA 3JYMA 3O5LA 5BXJA 1FKBA 5D75A 1FKDA 2XP6A 3KZ7A 4JFMA 4LAYA 4DRJA 2VN1A 2MLZA 4JFIA 3O5GA 2XP7A 1FKRA 3IKGA 3O5MA 2KFWA 4O2TA 1JVWA 2ITKA 2LKNA 3O5FA 1FKSA 3IHZA 3NRKA 1FKHA 4J4OA 3UI4A 4DT4A 2MLYA 3JXVA 3PRBA 2PV2A 1QPLA 3I6CA 3UQAA 2XPBA 4QIBA 4TYOA 3TC5A 4TNSA 4TW7A 3GPKA 3UQIA 1J6YA 1FKTA 3TDBA 4DROA 3ODKA 4LAWA 2DG3A 4ODPA 2XP9A 2XPAA 3O5OA 3PRDA 4J4NA 4W9PA 1F40A 4ODKA 3B7XA 1FAPA 5J6EA 1D7IA 5GPGA 3UF8A 3VAWA 4QT2A 1FKGA 2F2DA 2JZVA 2ZQTA 4U84A 4DZ3A 1EQ3A 4MGVA 3KAIA 4G2PA 2ZQVA 2RUCA 5B8IC 1BKFA 4DRQA 2ZQUA 4ODRA 5DITA 4TX0A 2F4EA 1W26A 1J4RA 4N19A 4NNRA 3KAFA 1L1PA 4DRIA 1M5YA 3FAPA 2Y78A 3CGNA 3O5IA 5HW6A 2M08A 2MNTA 3JYJA 1ZCNA 4JYSA 3RGCA 4R0XA 4GIVA 2OFNA 2PV1A 2RQSA 3O5RA 2LPVA 2UZ5A 5DIUA 4DRMA 5HUAA 1Q1CA 1Q6HA 4ODQA 1KT0A 4DZ2A 2XP8A 4ODLA 4DRNA 1B6CA 2PPPA 5HWBA 5HWCA 4ITZA 2DG4A 1JNSA 3O5QA 1N1AA 1QZ2A 2DG9A 3UI5A 2M2AA 1YW5A 4JFLA 1BL4A 4ODNA 2MF9A 3NI6A 4FN2A 2KO7A 1PINA 1T11A 1HXVA 1QPFA 2FAPA 2XP5A 4U86A 2VCDA 3CGMA 4DRPA 2PPNA 4LAVA 1ZK6A 3KADA 2M1IA 1J4IA 4QT3A 4W9QA 4IQCA 4C02B 1U79A 2KR7A 1A7XA 1J4HA 5I98A 4G50A 2IF4A 3H9RB 2L2SA 4TW8A 2RUQA 2KI3A 3WH0A 2K8IA 4FAPA 3TCZA 3KAHA 4IQ2A 4ODMA 1FD9A 1Y0OA 2MPHA 3KACA 4GGQA 4W9OA 3UQBA 3O5PA 1F8AB 2XP4A 3KAGA 1FKLA 3EY6A 2MLXA 4MSPA 1FKKA 2AWGA 2ZQSA 1FJDA 3KABA 3UI6A 1FKIA 1NSGA 1PBKA 2LJ4A 4DIPA 4DRHA 5DIVA 4DRKA 5HT1A 3O5JA 3O5KA 1P5QA 4ODOA 1NMWA 5HW8A 2N87A 1Q6IA 1EYMA 2LGOA 1D7HA 3IK8A 1TCOC 2RUDA 1KT1A 5HTGA 2PV3A 3O5DA 2KGJA 3RFWA 2PPOA 1JNTA 4BF8A 1C9HA 3IKDA 3MDYB 4U85A 1YATA 1D7JA 3OOBA 3O5EA 2RURA 3PA7A 2XP3A 1R9HA 1Q6UA 2ZR6A 2ZR5A 4JFJA 2FKEA 4TW6A 1D6OA 2F21A 5HKGA 2D9FA 4DH0A 4LAXA 3LUOA 2PBCA 4JFKA 1ROUA 2RSEA 3NTPA 2ZR4A 1NMVA 3KCEA 1FKJA 5HW7A
chains in the Genus database with same CATH superfamily
2KE0A 2Q5AA 3FXYA 5BXJA 2WLZA 5GQBA 1ZBKA 4JFMA 4JFIA 1ZU8A 3O5GA 2XP7A 1ITXA 3RM8A 1FKSA 3IHZA 3PRBA 2XPBA 1IX5A 3UQIA 4Z2GA 2A3AA 3TDBA 1ZBVA 2OLHA 2DG3A 4ODPA 4J4NA 4W9PA 3B7XA 5J6EA 3UF8A 1FKRA 1EQ3A 2F2DA 1SR0A 4MGVA 4DWSD 2ZQVA 5GPRA 2ZQUA 4ODRA 2F4EA 1W26A 4NNRA 4Z2IA 4DRIA 2O92A 2B5UB 3AS0A 4GIVA 2OFNA 1WNOA 2PV1A 4P8XA 3WQVA 2UZ5A 4NSBA 4WJXA 1KT0A 4W5UA 2XP8A 5HWBA 1B6CA 1N1AA 1LL4A 2XP5A 4DRPA 3ARSA 3KADA 4L72B 4QT3A 4IQCA 1U79A 1A7XA 4URIA 3AS2A 1EHNA 2L2SA 1HJWA 1RD6A 3KAHA 4ML4A 2DT0A 4XAKA 1Y0OA 2MPHA 3B9EA 1GUVA 3O5PA 1F8AB 1FKLA 1VF8A 3GU0A 2AWGA 1W9PA 4DIPA 1FFRA 4DRHA 2DPEA 3O5KA 1P5QA 1LG2A 3FY1A 2DT3A 3WQWA 2KGJA 4Q22A 3WIJA 3IKDA 3W4RA 2IUZA 3WD1A 2ZR5A 1Q6UA 2ZR6A 4MNLA 5HKGA 5DEZA 3LUOA 4JFKA 2EULA 1GOIA 4IPXA 3QOKA 1SYTA 1FKDA 2XP6A 1TFVA 3AS1A 2VN1A 4MTVA 1O6IA 1W9UA 1UR8A 4WIWA 4P8UA 3BMBA 3O5MA 2KFWA 4O2TA 5DO2A 3O5FA 1XRVA 3JXVA 4P8WA 4TYOA 4QIBA 3TC5A 2ETNA 3ODKA 4LAWA 2XP9A 3ARYA 2WK2A 5I98A 3VAWA 4QT2A 2ZQTA 4DZ3A 1ZL1A 3KAIA 4G2PA 1BKFA 2YBTA 1J4RA 3KAFA 1XHGA 1M5YA 1UR9A 1LJYA 3ARTA 3B9DA 3CGNA 5HW6A 3RGCA 2YBUA 2LPVA 3ARWA 4UDMA 3ARZA 5DIUA 4ODQA 2ESCA 4ODLA 1HKIA 4ITZA 1JNSA 4Q7NA 1QZ2A 1YW5A 2DSUA 4JFLA 4IT4A 3ARPA 2MF9A 4ODNA 2KO7A 1T11A 1E6NA 3CGMA 2A3CA 1ZK6A 2M1IA 1J4IA 4DWSA 1W1TA 3RM4A 2K8IA 3TCZA 3EIPA 3KACA 3AS3A 3KAGA 3CHDA 4QZVB 3OA5A 2QF8A 5DIVA 5HT1A 1H0IA 1NMWA 5HW8A 1CTNA 1EYMA 1D7HA 5HTGA 2RUDA 1JNTA 1C9HA 3MDYB 1W1PA 3O5EA 3PA7A 4DWSB 1OGBA 1WAWA 4DH0A 4LAXA 3ALFA 1ROUA 2RSEA 3NTPA 1NMVA 1ZB5A 2P4VA 3PRAA 4MAVA 3CHEA 1ROTA 1FKFA 3O5LA 4MPKA 3KZ7A 4LAYA 2MLZA 3GTYX 3IKGA 4S3KA 1JVWA 2ITKA 4J4OA 3UI4A 2PV2A 1QPLA 1K9TA 3WD4A 4TNSA 4TW7A 4KR0B 1FKTA 1NWTA 1NWSA 4DROA 4PTMA 4IT6A 1EDQA 2XPAA 3PRDA 1W1VA 4ODKA 2B31A 2DSZA 1JCHB 1FAPA 2JZVA 4U84A 1OWQA 1L1PA 3G6MA 1E15A 4Z2LA 4ZS6A 3FAPA 1HJVA 2Y78A 1W9VA 2M08A 2MNTA 1ZCNA 4R0XA 4HBEA 2RQSA 3O5RA 4R5EA 4DRMA 4WKAA 1Q1CA 1LQ0A 1Q6HA 4DZ2A 2G8ZA 1OGGA 4WK9A 5HWCA 1GPFA 2DG9A 3CH9A 2AOSA 2F23A 1GRJA 3NI6A 1HXVA 1NH6A 4U86A 2VCDA 3B9AA 1HJXA 2PPNA 3G6LA 1X6LA 3CZ8A 5JH8A 2IF4A 3H9RB 4TW8A 2RUQA 2KI3A 4IQ2A 4ODMA 4MNJA 3ARRA 3UQBA 4W9OA 2XP4A 3EY6A 4MSPA 1FKKA 2ZQSA 1FJDA 2G41A 3KABA 3UI6A 1FKIA 4MNKA 1EIBA 4DRKA 3WL0A 2N87A 2LGOA 1NWUA 1TCOC 1KT1A 2PV3A 3O5DA 3RFWA 3WD0A 2PPOA 4U85A 1ZBCA 1YATA 1D7JA 4P8VA 2DSVA 2RURA 2WM0A 1R9HA 4JFJA 1JNDA 1KFWA 2D9FA 2WLYA 1FFQA 2ZR4A 5HBFA 3JYMA 3AROA 1FKBA 5D75A 3ARVA 4DRJA 1ZBWA 2O9OA 3ALGA 3BXWA 4ZPWR 1LG1A 5DF0A 1HKJA 2LKNA 3NRKA 1FKHA 4HBOA 4DT4A 2MLYA 3I6CA 3UQAA 3PR9A 3GPKA 1J6YA 2FDMA 1WB0A 1F40A 3O5OA 1HKMA 3WL1A 4HARA 2DT1A 1D7IA 5GPGA 1FKGA 3ARXA 1H0GA 4MNMA 1X6NA 2RUCA 4ZPTR 4DRQA 5DITA 1JNEA 5B8IC 4TX0A 4WKHA 4ZPVR 4N19A 3ARQA 1E6RA 3O5IA 3JYJA 4JYSA 3RM9A 4S3JA 2PI6A 4AY1A 5HUAA 1E6PA 3WD2A 1NWRA 1W1YA 4DRNA 2PPPA 3CHFA 2DG4A 3B8SA 3O5QA 3UI5A 2DT2A 2M2AA 4Z2HA 1BL4A 4FN2A 1PINA 1QPFA 2FAPA 4LAVA 4W9QA 1LL6A 4C02B 2KR7A 1LL7A 1J4HA 4G50A 2A3BA 3CHCA 3WH0A 4FAPA 1E9LA 4LGXA 4Z2JA 1FD9A 4GGQA 2DSWA 2MLXA 1E6ZA 2A3EA 4Z2KA 1PBKA 1NSGA 1D2KA 2LJ4A 3O5JA 3WD3A 4ODOA 2PN0A 1Q6IA 3IK8A 4WKFA 3WKZA 1HKKA 4BF8A 3ARUA 4L3NA 3OOBA 3AQUA 1E44A 2XP3A 4NZCA 4KQZA 2FKEA 4TW6A 1D6OA 3RMEA 2F21A 2PBCA 3KCEA 4DWSC 1FKJA 5HW7A
chains in the Genus database with same CATH topology
2KE0A 2Q5AA 3FXYA 5BXJA 2WLZA 5GQBA 1ZBKA 4JFMA 4JFIA 1ZU8A 3O5GA 2XP7A 1ITXA 3RM8A 1FKSA 3IHZA 3PRBA 2XPBA 1IX5A 3UQIA 4Z2GA 2A3AA 3TDBA 1ZBVA 2OLHA 2DG3A 4ODPA 4J4NA 4W9PA 3B7XA 5J6EA 3UF8A 1FKRA 1EQ3A 2F2DA 1SR0A 4MGVA 4DWSD 2ZQVA 5GPRA 2ZQUA 4ODRA 2F4EA 1W26A 4NNRA 4Z2IA 4DRIA 2O92A 3AS0A 4GIVA 2OFNA 1WNOA 2PV1A 4P8XA 3WQVA 2UZ5A 4NSBA 4WJXA 1KT0A 4W5UA 2XP8A 5HWBA 1B6CA 1N1AA 1LL4A 2XP5A 4DRPA 3ARSA 3KADA 4L72B 4QT3A 4IQCA 1U79A 1A7XA 4URIA 3AS2A 1EHNA 2L2SA 1HJWA 1RD6A 3KAHA 4ML4A 2DT0A 4XAKA 1Y0OA 2MPHA 3B9EA 1GUVA 3O5PA 1F8AB 1FKLA 1VF8A 2AWGA 1W9PA 4DIPA 1FFRA 4DRHA 2DPEA 3O5KA 1P5QA 1LG2A 3FY1A 2DT3A 3WQWA 2KGJA 4Q22A 3WIJA 3IKDA 3W4RA 2IUZA 3WD1A 2ZR5A 1Q6UA 2ZR6A 4MNLA 5HKGA 5DEZA 3LUOA 4JFKA 1GOIA 4IPXA 3QOKA 1SYTA 1FKDA 2XP6A 1TFVA 3AS1A 2VN1A 4MTVA 1O6IA 1W9UA 1UR8A 4WIWA 4P8UA 3O5MA 2KFWA 4O2TA 5DO2A 3O5FA 1XRVA 3JXVA 4P8WA 4TYOA 4QIBA 3TC5A 3ODKA 4LAWA 2XP9A 3ARYA 2WK2A 5I98A 3VAWA 4QT2A 2ZQTA 4DZ3A 1ZL1A 3KAIA 4G2PA 1BKFA 2YBTA 1J4RA 3KAFA 1XHGA 1M5YA 1UR9A 1LJYA 3ARTA 3B9DA 3CGNA 5HW6A 3RGCA 2YBUA 2LPVA 3ARWA 5DIUA 3ARZA 4ODQA 2ESCA 4ODLA 1HKIA 4ITZA 1JNSA 4Q7NA 1QZ2A 1YW5A 2DSUA 4JFLA 4IT4A 3ARPA 2MF9A 4ODNA 2KO7A 1T11A 1E6NA 3CGMA 2A3CA 1ZK6A 2M1IA 1J4IA 4DWSA 1W1TA 3RM4A 2K8IA 3TCZA 3KACA 3AS3A 3KAGA 3CHDA 4QZVB 3OA5A 2QF8A 5DIVA 5HT1A 1H0IA 1NMWA 5HW8A 1CTNA 1EYMA 1D7HA 5HTGA 2RUDA 1JNTA 1C9HA 3MDYB 1W1PA 3O5EA 3PA7A 4DWSB 1OGBA 1WAWA 4DH0A 4LAXA 3ALFA 1ROUA 2RSEA 3NTPA 1NMVA 1ZB5A 3PRAA 4MAVA 3CHEA 1ROTA 1FKFA 3O5LA 4MPKA 3KZ7A 4LAYA 2MLZA 3IKGA 4S3KA 1JVWA 2ITKA 4J4OA 3UI4A 2PV2A 1QPLA 1K9TA 3WD4A 4TNSA 4TW7A 4KR0B 1FKTA 1NWTA 1NWSA 4DROA 4PTMA 4IT6A 1EDQA 2XPAA 3PRDA 1W1VA 4ODKA 2B31A 2DSZA 1FAPA 2JZVA 4U84A 1OWQA 1L1PA 3G6MA 1E15A 4Z2LA 4ZS6A 3FAPA 1HJVA 2Y78A 1W9VA 2M08A 2MNTA 1ZCNA 4R0XA 4HBEA 2RQSA 3O5RA 4R5EA 4DRMA 4WKAA 1Q1CA 1LQ0A 1Q6HA 4DZ2A 2G8ZA 1OGGA 4WK9A 5HWCA 1GPFA 2DG9A 3CH9A 2AOSA 3NI6A 1HXVA 1NH6A 4U86A 2VCDA 3B9AA 1HJXA 2PPNA 3G6LA 1X6LA 3CZ8A 5JH8A 2IF4A 3H9RB 4TW8A 2RUQA 2KI3A 4IQ2A 4ODMA 4MNJA 3ARRA 3UQBA 4W9OA 2XP4A 3EY6A 4MSPA 1FKKA 2ZQSA 1FJDA 2G41A 3KABA 3UI6A 1FKIA 4MNKA 1EIBA 4DRKA 3WL0A 2N87A 2LGOA 1NWUA 1TCOC 1KT1A 2PV3A 3O5DA 3RFWA 3WD0A 2PPOA 4U85A 1ZBCA 1YATA 1D7JA 4P8VA 2DSVA 2RURA 2WM0A 1R9HA 4JFJA 1JNDA 1KFWA 2D9FA 2WLYA 1FFQA 2ZR4A 5HBFA 3JYMA 3AROA 1FKBA 5D75A 3ARVA 4DRJA 1ZBWA 2O9OA 3ALGA 3BXWA 4ZPWR 1LG1A 5DF0A 1HKJA 2LKNA 3NRKA 1FKHA 4HBOA 4DT4A 2MLYA 3I6CA 3UQAA 3PR9A 3GPKA 1J6YA 2FDMA 1WB0A 1F40A 3O5OA 1HKMA 3WL1A 4HARA 2DT1A 1D7IA 5GPGA 1FKGA 3ARXA 1H0GA 4MNMA 1X6NA 2RUCA 4ZPTR 4DRQA 5DITA 1JNEA 5B8IC 4TX0A 4WKHA 4ZPVR 4N19A 3ARQA 1E6RA 3O5IA 3JYJA 4JYSA 3RM9A 4S3JA 2PI6A 4AY1A 5HUAA 1E6PA 3WD2A 1NWRA 1W1YA 4DRNA 2PPPA 3CHFA 2DG4A 3B8SA 3O5QA 3UI5A 2DT2A 2M2AA 4Z2HA 1BL4A 4FN2A 1PINA 1QPFA 2FAPA 4LAVA 4W9QA 1LL6A 4C02B 2KR7A 1LL7A 1J4HA 4G50A 2A3BA 3CHCA 3WH0A 4FAPA 1E9LA 4LGXA 4Z2JA 1FD9A 4GGQA 2DSWA 2MLXA 1E6ZA 2A3EA 4Z2KA 1PBKA 1NSGA 1D2KA 2LJ4A 3O5JA 3WD3A 4ODOA 1Q6IA 3IK8A 4WKFA 3WKZA 1HKKA 4BF8A 3ARUA 4L3NA 3OOBA 3AQUA 2XP3A 4NZCA 4KQZA 2FKEA 4TW6A 1D6OA 3RMEA 2F21A 2PBCA 3KCEA 4DWSC 1FKJA 5HW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KE0 A;  4IPX A;  2Q5A A;  1ROT A;  1FKF A;  3JYM A;  3O5L A;  5BXJ A;  1FKB A;  5D75 A;  1FKD A;  2XP6 A;  3KZ7 A;  4JFM A;  4LAY A;  4DRJ A;  2VN1 A;  2MLZ A;  4JFI A;  3O5G A;  2XP7 A;  1FKR A;  3IKG A;  3O5M A;  2KFW A;  4O2T A;  1JVW A;  2ITK A;  2LKN A;  3O5F A;  1FKS A;  3IHZ A;  3NRK A;  1FKH A;  4J4O A;  3UI4 A;  4DT4 A;  2MLY A;  3JXV A;  3PRB A;  2PV2 A;  1QPL A;  3I6C A;  3UQA A;  2XPB A;  4QIB A;  4TYO A;  3TC5 A;  4TNS A;  4TW7 A;  3GPK A;  3UQI A;  1J6Y A;  1FKT A;  3TDB A;  4DRO A;  3ODK A;  4LAW A;  2DG3 A;  4ODP A;  2XP9 A;  2XPA A;  3O5O A;  3PRD A;  4J4N A;  4W9P A;  1F40 A;  4ODK A;  3B7X A;  1FAP A;  5J6E A;  1D7I A;  5GPG A;  3UF8 A;  3VAW A;  4QT2 A;  1FKG A;  2F2D A;  2JZV A;  2ZQT A;  4U84 A;  4DZ3 A;  1EQ3 A;  4MGV A;  3KAI A;  4G2P A;  2ZQV A;  2RUC A;  5B8I C;  1BKF A;  4DRQ A;  2ZQU A;  4ODR A;  5DIT A;  4TX0 A;  2F4E A;  1W26 A;  1J4R A;  4N19 A;  4NNR A;  3KAF A;  1L1P A;  4DRI A;  1M5Y A;  3FAP A;  2Y78 A;  3CGN A;  3O5I A;  5HW6 A;  2M08 A;  2MNT A;  3JYJ A;  1ZCN A;  4JYS A;  3RGC A;  4R0X A;  4GIV A;  2OFN A;  2PV1 A;  2RQS A;  3O5R A;  2LPV A;  2UZ5 A;  5DIU A;  4DRM A;  5HUA A;  1Q1C A;  1Q6H A;  4ODQ A;  1KT0 A;  4DZ2 A;  2XP8 A;  4ODL A;  4DRN A;  1B6C A;  2PPP A;  5HWB A;  5HWC A;  4ITZ A;  2DG4 A;  1JNS A;  3O5Q A;  1N1A A;  1QZ2 A;  2DG9 A;  3UI5 A;  2M2A A;  1YW5 A;  4JFL A;  1BL4 A;  4ODN A;  2MF9 A;  3NI6 A;  4FN2 A;  2KO7 A;  1PIN A;  1T11 A;  1HXV A;  1QPF A;  2FAP A;  2XP5 A;  4U86 A;  2VCD A;  3CGM A;  4DRP A;  2PPN A;  4LAV A;  1ZK6 A;  3KAD A;  2M1I A;  1J4I A;  4QT3 A;  4W9Q A;  4IQC A;  4C02 B;  1U79 A;  2KR7 A;  1A7X A;  1J4H A;  5I98 A;  4G50 A;  2IF4 A;  3H9R B;  2L2S A;  4TW8 A;  2RUQ A;  2KI3 A;  3WH0 A;  2K8I A;  4FAP A;  3TCZ A;  3KAH A;  4IQ2 A;  4ODM A;  1FD9 A;  1Y0O A;  2MPH A;  3KAC A;  4GGQ A;  4W9O A;  3UQB A;  3O5P A;  1F8A B;  2XP4 A;  3KAG A;  1FKL A;  3EY6 A;  2MLX A;  4MSP A;  1FKK A;  2AWG A;  2ZQS A;  1FJD A;  3KAB A;  3UI6 A;  1FKI A;  1NSG A;  1PBK A;  2LJ4 A;  4DIP A;  4DRH A;  5DIV A;  4DRK A;  5HT1 A;  3O5J A;  3O5K A;  1P5Q A;  4ODO A;  1NMW A;  5HW8 A;  2N87 A;  1Q6I A;  1EYM A;  2LGO A;  1D7H A;  3IK8 A;  1TCO C;  2RUD A;  1KT1 A;  5HTG A;  2PV3 A;  3O5D A;  2KGJ A;  3RFW A;  2PPO A;  1JNT A;  4BF8 A;  1C9H A;  3IKD A;  3MDY B;  4U85 A;  1YAT A;  1D7J A;  3OOB A;  3O5E A;  2RUR A;  3PA7 A;  2XP3 A;  1R9H A;  1Q6U A;  2ZR6 A;  2ZR5 A;  4JFJ A;  2FKE A;  4TW6 A;  1D6O A;  2F21 A;  5HKG A;  2D9F A;  4DH0 A;  4LAX A;  3LUO A;  2PBC A;  4JFK A;  1ROU A;  2RSE A;  3NTP A;  2ZR4 A;  1NMV A;  3KCE A;  1FKJ A;  5HW7 A; 
#chains in the Genus database with same CATH topology
 2KE0 A;  2Q5A A;  3FXY A;  5BXJ A;  2WLZ A;  5GQB A;  1ZBK A;  4JFM A;  4JFI A;  1ZU8 A;  3O5G A;  2XP7 A;  1ITX A;  3RM8 A;  1FKS A;  3IHZ A;  3PRB A;  2XPB A;  1IX5 A;  3UQI A;  4Z2G A;  2A3A A;  3TDB A;  1ZBV A;  2OLH A;  2DG3 A;  4ODP A;  4J4N A;  4W9P A;  3B7X A;  5J6E A;  3UF8 A;  1FKR A;  1EQ3 A;  2F2D A;  1SR0 A;  4MGV A;  4DWS D;  2ZQV A;  5GPR A;  2ZQU A;  4ODR A;  2F4E A;  1W26 A;  4NNR A;  4Z2I A;  4DRI A;  2O92 A;  2B5U B;  3AS0 A;  4GIV A;  2OFN A;  1WNO A;  2PV1 A;  4P8X A;  3WQV A;  2UZ5 A;  4NSB A;  4WJX A;  1KT0 A;  4W5U A;  2XP8 A;  5HWB A;  1B6C A;  1N1A A;  1LL4 A;  2XP5 A;  4DRP A;  3ARS A;  3KAD A;  4L72 B;  4QT3 A;  4IQC A;  1U79 A;  1A7X A;  4URI A;  3AS2 A;  1EHN A;  2L2S A;  1HJW A;  1RD6 A;  3KAH A;  4ML4 A;  2DT0 A;  4XAK A;  1Y0O A;  2MPH A;  3B9E A;  1GUV A;  3O5P A;  1F8A B;  1FKL A;  1VF8 A;  3GU0 A;  2AWG A;  1W9P A;  4DIP A;  1FFR A;  4DRH A;  2DPE A;  3O5K A;  1P5Q A;  1LG2 A;  3FY1 A;  2DT3 A;  3WQW A;  2KGJ A;  4Q22 A;  3WIJ A;  3IKD A;  3W4R A;  2IUZ A;  3WD1 A;  2ZR5 A;  1Q6U A;  2ZR6 A;  4MNL A;  5HKG A;  5DEZ A;  3LUO A;  4JFK A;  2EUL A;  1GOI A;  4IPX A;  3QOK A;  1SYT A;  1FKD A;  2XP6 A;  1TFV A;  3AS1 A;  2VN1 A;  4MTV A;  1O6I A;  1W9U A;  1UR8 A;  4WIW A;  4P8U A;  3BMB A;  3O5M A;  2KFW A;  4O2T A;  5DO2 A;  3O5F A;  1XRV A;  3JXV A;  4P8W A;  4TYO A;  4QIB A;  3TC5 A;  2ETN A;  3ODK A;  4LAW A;  2XP9 A;  3ARY A;  2WK2 A;  5I98 A;  3VAW A;  4QT2 A;  2ZQT A;  4DZ3 A;  1ZL1 A;  3KAI A;  4G2P A;  1BKF A;  2YBT A;  1J4R A;  3KAF A;  1XHG A;  1M5Y A;  1UR9 A;  1LJY A;  3ART A;  3B9D A;  3CGN A;  5HW6 A;  3RGC A;  2YBU A;  2LPV A;  3ARW A;  4UDM A;  3ARZ A;  5DIU A;  4ODQ A;  2ESC A;  4ODL A;  1HKI A;  4ITZ A;  1JNS A;  4Q7N A;  1QZ2 A;  1YW5 A;  2DSU A;  4JFL A;  4IT4 A;  3ARP A;  2MF9 A;  4ODN A;  2KO7 A;  1T11 A;  1E6N A;  3CGM A;  2A3C A;  1ZK6 A;  2M1I A;  1J4I A;  4DWS A;  1W1T A;  3RM4 A;  2K8I A;  3TCZ A;  3EIP A;  3KAC A;  3AS3 A;  3KAG A;  3CHD A;  4QZV B;  3OA5 A;  2QF8 A;  5DIV A;  5HT1 A;  1H0I A;  1NMW A;  5HW8 A;  1CTN A;  1EYM A;  1D7H A;  5HTG A;  2RUD A;  1JNT A;  1C9H A;  3MDY B;  1W1P A;  3O5E A;  3PA7 A;  4DWS B;  1OGB A;  1WAW A;  4DH0 A;  4LAX A;  3ALF A;  1ROU A;  2RSE A;  3NTP A;  1NMV A;  1ZB5 A;  2P4V A;  3PRA A;  4MAV A;  3CHE A;  1ROT A;  1FKF A;  3O5L A;  4MPK A;  3KZ7 A;  4LAY A;  2MLZ A;  3GTY X;  3IKG A;  4S3K A;  1JVW A;  2ITK A;  4J4O A;  3UI4 A;  2PV2 A;  1QPL A;  1K9T A;  3WD4 A;  4TNS A;  4TW7 A;  4KR0 B;  1FKT A;  1NWT A;  1NWS A;  4DRO A;  4PTM A;  4IT6 A;  1EDQ A;  2XPA A;  3PRD A;  1W1V A;  4ODK A;  2B31 A;  2DSZ A;  1JCH B;  1FAP A;  2JZV A;  4U84 A;  1OWQ A;  1L1P A;  3G6M A;  1E15 A;  4Z2L A;  4ZS6 A;  3FAP A;  1HJV A;  2Y78 A;  1W9V A;  2M08 A;  2MNT A;  1ZCN A;  4R0X A;  4HBE A;  2RQS A;  3O5R A;  4R5E A;  4DRM A;  4WKA A;  1Q1C A;  1LQ0 A;  1Q6H A;  4DZ2 A;  2G8Z A;  1OGG A;  4WK9 A;  5HWC A;  1GPF A;  2DG9 A;  3CH9 A;  2AOS A;  2F23 A;  1GRJ A;  3NI6 A;  1HXV A;  1NH6 A;  4U86 A;  2VCD A;  3B9A A;  1HJX A;  2PPN A;  3G6L A;  1X6L A;  3CZ8 A;  5JH8 A;  2IF4 A;  3H9R B;  4TW8 A;  2RUQ A;  2KI3 A;  4IQ2 A;  4ODM A;  4MNJ A;  3ARR A;  3UQB A;  4W9O A;  2XP4 A;  3EY6 A;  4MSP A;  1FKK A;  2ZQS A;  1FJD A;  2G41 A;  3KAB A;  3UI6 A;  1FKI A;  4MNK A;  1EIB A;  4DRK A;  3WL0 A;  2N87 A;  2LGO A;  1NWU A;  1TCO C;  1KT1 A;  2PV3 A;  3O5D A;  3RFW A;  3WD0 A;  2PPO A;  4U85 A;  1ZBC A;  1YAT A;  1D7J A;  4P8V A;  2DSV A;  2RUR A;  2WM0 A;  1R9H A;  4JFJ A;  1JND A;  1KFW A;  2D9F A;  2WLY A;  1FFQ A;  2ZR4 A;  5HBF A;  3JYM A;  3ARO A;  1FKB A;  5D75 A;  3ARV A;  4DRJ A;  1ZBW A;  2O9O A;  3ALG A;  3BXW A;  4ZPW R;  1LG1 A;  5DF0 A;  1HKJ A;  2LKN A;  3NRK A;  1FKH A;  4HBO A;  4DT4 A;  2MLY A;  3I6C A;  3UQA A;  3PR9 A;  3GPK A;  1J6Y A;  2FDM A;  1WB0 A;  1F40 A;  3O5O A;  1HKM A;  3WL1 A;  4HAR A;  2DT1 A;  1D7I A;  5GPG A;  1FKG A;  3ARX A;  1H0G A;  4MNM A;  1X6N A;  2RUC A;  4ZPT R;  4DRQ A;  5DIT A;  1JNE A;  5B8I C;  4TX0 A;  4WKH A;  4ZPV R;  4N19 A;  3ARQ A;  1E6R A;  3O5I A;  3JYJ A;  4JYS A;  3RM9 A;  4S3J A;  2PI6 A;  4AY1 A;  5HUA A;  1E6P A;  3WD2 A;  1NWR A;  1W1Y A;  4DRN A;  2PPP A;  3CHF A;  2DG4 A;  3B8S A;  3O5Q A;  3UI5 A;  2DT2 A;  2M2A A;  4Z2H A;  1BL4 A;  4FN2 A;  1PIN A;  1QPF A;  2FAP A;  4LAV A;  4W9Q A;  1LL6 A;  4C02 B;  2KR7 A;  1LL7 A;  1J4H A;  4G50 A;  2A3B A;  3CHC A;  3WH0 A;  4FAP A;  1E9L A;  4LGX A;  4Z2J A;  1FD9 A;  4GGQ A;  2DSW A;  2MLX A;  1E6Z A;  2A3E A;  4Z2K A;  1PBK A;  1NSG A;  1D2K A;  2LJ4 A;  3O5J A;  3WD3 A;  4ODO A;  2PN0 A;  1Q6I A;  3IK8 A;  4WKF A;  3WKZ A;  1HKK A;  4BF8 A;  3ARU A;  4L3N A;  3OOB A;  3AQU A;  1E44 A;  2XP3 A;  4NZC A;  4KQZ A;  2FKE A;  4TW6 A;  1D6O A;  3RME A;  2F21 A;  2PBC A;  3KCE A;  4DWS C;  1FKJ A;  5HW7 A; 
#chains in the Genus database with same CATH homology
 2KE0 A;  2Q5A A;  3FXY A;  5BXJ A;  2WLZ A;  5GQB A;  1ZBK A;  4JFM A;  4JFI A;  1ZU8 A;  3O5G A;  2XP7 A;  1ITX A;  3RM8 A;  1FKS A;  3IHZ A;  3PRB A;  2XPB A;  1IX5 A;  3UQI A;  4Z2G A;  2A3A A;  3TDB A;  1ZBV A;  2OLH A;  2DG3 A;  4ODP A;  4J4N A;  4W9P A;  3B7X A;  5J6E A;  3UF8 A;  1FKR A;  1EQ3 A;  2F2D A;  1SR0 A;  4MGV A;  4DWS D;  2ZQV A;  5GPR A;  2ZQU A;  4ODR A;  2F4E A;  1W26 A;  4NNR A;  4Z2I A;  4DRI A;  2O92 A;  3AS0 A;  4GIV A;  2OFN A;  1WNO A;  2PV1 A;  4P8X A;  3WQV A;  2UZ5 A;  4NSB A;  4WJX A;  1KT0 A;  4W5U A;  2XP8 A;  5HWB A;  1B6C A;  1N1A A;  1LL4 A;  2XP5 A;  4DRP A;  3ARS A;  3KAD A;  4L72 B;  4QT3 A;  4IQC A;  1U79 A;  1A7X A;  4URI A;  3AS2 A;  1EHN A;  2L2S A;  1HJW A;  1RD6 A;  3KAH A;  4ML4 A;  2DT0 A;  4XAK A;  1Y0O A;  2MPH A;  3B9E A;  1GUV A;  3O5P A;  1F8A B;  1FKL A;  1VF8 A;  2AWG A;  1W9P A;  4DIP A;  1FFR A;  4DRH A;  2DPE A;  3O5K A;  1P5Q A;  1LG2 A;  3FY1 A;  2DT3 A;  3WQW A;  2KGJ A;  4Q22 A;  3WIJ A;  3IKD A;  3W4R A;  2IUZ A;  3WD1 A;  2ZR5 A;  1Q6U A;  2ZR6 A;  4MNL A;  5HKG A;  5DEZ A;  3LUO A;  4JFK A;  1GOI A;  4IPX A;  3QOK A;  1SYT A;  1FKD A;  2XP6 A;  1TFV A;  3AS1 A;  2VN1 A;  4MTV A;  1O6I A;  1W9U A;  1UR8 A;  4WIW A;  4P8U A;  3O5M A;  2KFW A;  4O2T A;  5DO2 A;  3O5F A;  1XRV A;  3JXV A;  4P8W A;  4TYO A;  4QIB A;  3TC5 A;  3ODK A;  4LAW A;  2XP9 A;  3ARY A;  2WK2 A;  5I98 A;  3VAW A;  4QT2 A;  2ZQT A;  4DZ3 A;  1ZL1 A;  3KAI A;  4G2P A;  1BKF A;  2YBT A;  1J4R A;  3KAF A;  1XHG A;  1M5Y A;  1UR9 A;  1LJY A;  3ART A;  3B9D A;  3CGN A;  5HW6 A;  3RGC A;  2YBU A;  2LPV A;  3ARW A;  5DIU A;  3ARZ A;  4ODQ A;  2ESC A;  4ODL A;  1HKI A;  4ITZ A;  1JNS A;  4Q7N A;  1QZ2 A;  1YW5 A;  2DSU A;  4JFL A;  4IT4 A;  3ARP A;  2MF9 A;  4ODN A;  2KO7 A;  1T11 A;  1E6N A;  3CGM A;  2A3C A;  1ZK6 A;  2M1I A;  1J4I A;  4DWS A;  1W1T A;  3RM4 A;  2K8I A;  3TCZ A;  3KAC A;  3AS3 A;  3KAG A;  3CHD A;  4QZV B;  3OA5 A;  2QF8 A;  5DIV A;  5HT1 A;  1H0I A;  1NMW A;  5HW8 A;  1CTN A;  1EYM A;  1D7H A;  5HTG A;  2RUD A;  1JNT A;  1C9H A;  3MDY B;  1W1P A;  3O5E A;  3PA7 A;  4DWS B;  1OGB A;  1WAW A;  4DH0 A;  4LAX A;  3ALF A;  1ROU A;  2RSE A;  3NTP A;  1NMV A;  1ZB5 A;  3PRA A;  4MAV A;  3CHE A;  1ROT A;  1FKF A;  3O5L A;  4MPK A;  3KZ7 A;  4LAY A;  2MLZ A;  3IKG A;  4S3K A;  1JVW A;  2ITK A;  4J4O A;  3UI4 A;  2PV2 A;  1QPL A;  1K9T A;  3WD4 A;  4TNS A;  4TW7 A;  4KR0 B;  1FKT A;  1NWT A;  1NWS A;  4DRO A;  4PTM A;  4IT6 A;  1EDQ A;  2XPA A;  3PRD A;  1W1V A;  4ODK A;  2B31 A;  2DSZ A;  1FAP A;  2JZV A;  4U84 A;  1OWQ A;  1L1P A;  3G6M A;  1E15 A;  4Z2L A;  4ZS6 A;  3FAP A;  1HJV A;  2Y78 A;  1W9V A;  2M08 A;  2MNT A;  1ZCN A;  4R0X A;  4HBE A;  2RQS A;  3O5R A;  4R5E A;  4DRM A;  4WKA A;  1Q1C A;  1LQ0 A;  1Q6H A;  4DZ2 A;  2G8Z A;  1OGG A;  4WK9 A;  5HWC A;  1GPF A;  2DG9 A;  3CH9 A;  2AOS A;  3NI6 A;  1HXV A;  1NH6 A;  4U86 A;  2VCD A;  3B9A A;  1HJX A;  2PPN A;  3G6L A;  1X6L A;  3CZ8 A;  5JH8 A;  2IF4 A;  3H9R B;  4TW8 A;  2RUQ A;  2KI3 A;  4IQ2 A;  4ODM A;  4MNJ A;  3ARR A;  3UQB A;  4W9O A;  2XP4 A;  3EY6 A;  4MSP A;  1FKK A;  2ZQS A;  1FJD A;  2G41 A;  3KAB A;  3UI6 A;  1FKI A;  4MNK A;  1EIB A;  4DRK A;  3WL0 A;  2N87 A;  2LGO A;  1NWU A;  1TCO C;  1KT1 A;  2PV3 A;  3O5D A;  3RFW A;  3WD0 A;  2PPO A;  4U85 A;  1ZBC A;  1YAT A;  1D7J A;  4P8V A;  2DSV A;  2RUR A;  2WM0 A;  1R9H A;  4JFJ A;  1JND A;  1KFW A;  2D9F A;  2WLY A;  1FFQ A;  2ZR4 A;  5HBF A;  3JYM A;  3ARO A;  1FKB A;  5D75 A;  3ARV A;  4DRJ A;  1ZBW A;  2O9O A;  3ALG A;  3BXW A;  4ZPW R;  1LG1 A;  5DF0 A;  1HKJ A;  2LKN A;  3NRK A;  1FKH A;  4HBO A;  4DT4 A;  2MLY A;  3I6C A;  3UQA A;  3PR9 A;  3GPK A;  1J6Y A;  2FDM A;  1WB0 A;  1F40 A;  3O5O A;  1HKM A;  3WL1 A;  4HAR A;  2DT1 A;  1D7I A;  5GPG A;  1FKG A;  3ARX A;  1H0G A;  4MNM A;  1X6N A;  2RUC A;  4ZPT R;  4DRQ A;  5DIT A;  1JNE A;  5B8I C;  4TX0 A;  4WKH A;  4ZPV R;  4N19 A;  3ARQ A;  1E6R A;  3O5I A;  3JYJ A;  4JYS A;  3RM9 A;  4S3J A;  2PI6 A;  4AY1 A;  5HUA A;  1E6P A;  3WD2 A;  1NWR A;  1W1Y A;  4DRN A;  2PPP A;  3CHF A;  2DG4 A;  3B8S A;  3O5Q A;  3UI5 A;  2DT2 A;  2M2A A;  4Z2H A;  1BL4 A;  4FN2 A;  1PIN A;  1QPF A;  2FAP A;  4LAV A;  4W9Q A;  1LL6 A;  4C02 B;  2KR7 A;  1LL7 A;  1J4H A;  4G50 A;  2A3B A;  3CHC A;  3WH0 A;  4FAP A;  1E9L A;  4LGX A;  4Z2J A;  1FD9 A;  4GGQ A;  2DSW A;  2MLX A;  1E6Z A;  2A3E A;  4Z2K A;  1PBK A;  1NSG A;  1D2K A;  2LJ4 A;  3O5J A;  3WD3 A;  4ODO A;  1Q6I A;  3IK8 A;  4WKF A;  3WKZ A;  1HKK A;  4BF8 A;  3ARU A;  4L3N A;  3OOB A;  3AQU A;  2XP3 A;  4NZC A;  4KQZ A;  2FKE A;  4TW6 A;  1D6O A;  3RME A;  2F21 A;  2PBC A;  3KCE A;  4DWS C;  1FKJ A;  5HW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...