4BFBD

Bace2 xaperone complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
110
structure length
110
Chain Sequence
VQLQESGGGLVQPGGSLRLSCAASGFTFSSAIMTWVRQAPGKGREWVSTIGSDGSITTYADSVKGRFTISRDNARNTLYLQMNSLKPEDTAVYYCTSAGRRGPGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-SECRETASE 2
publication title Mapping the Conformational Space Accessible to Bace2 Using Surface Mutants and Co-Crystals with Fab-Fragments, Fynomers, and Xaperones
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 29
structure length 110
sequence length 110
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bfbD00
2ZNWA 3DSFH 4NP4H 1KLUA 2DKSA 3WS3A 3DX6B 4PRBB 3ES6B 4LSQL 1YMMD 2NY5H 1E4XI 4RAVA 5HSFA 2AQ3A 5GSRB 3VGBA 2EIBA 5JA8B 2DOCA 1NDMA 3L5HA 1MCBA 5FAAA 1JPST 3PWVA 5C09B 4FQQA 5HPMB 4R4FL 1WAAF 5F9WC 3QEUA 1B4JH 4Y1AB 3L9RA 4Z7WA 4NQXB 4XCEA 3HZYB 5IV2A 4NC2B 4O2EA 1BP3B 5EU6D 1F4XH 4RMVA 1QRND 1CFQB 4OD2B 4PV8B 3WUWB 4PGJA 1AGBB 3I3EA 5KSVA 3RWGA 2YK1L 5T5FL 1UC6A 1BFSA 5E56A 4Q7DA 3U82B 2OMNA 3MV7D 1VERA 4N8PA 4TVPH 1T5XA 5DJ2B 2D3VA 4NKMA 4MDJB 5DD5L 5KOVC 5FB8B 4NCC1 4DKFH 4KJYB 1QLEH 1ZA3B 5LQBL 3C9NA 5DUPH 3TIDA 1IGIH 1MAKA 3HC0B 4L4VE 2AKRA 1V7ML 3PG2A 4NKIL 4WNQA 4K07A 1HILB 5GGTL 3THMH 1U8LB 5ENWA 2FWOB 4KQ4L 4JKKA 4HS8H 3HE6B 3QIBA 4M7ZB 4M3JA 1MIMH 4NM4H 2OZ4A 4DN4H 3IU4L 5FUZH 3EJYD 4F57H 4MX7A 3K8MA 5IFHL 5J11B 3R8QA 4PPTA 3ETBF 1A6PA 5E7BA 1MCNA 5CD5D 3KHOA 4OM1H 2VH5L 3FAXA 1D7FA 5JLZB 4OZIE 2YPLE 5CSZB 4LU5H 5J57B 5J13C 3SHSA 2H26A 1OAYH 3AMKA 4LLYB 3ECBB 4BSWB 4YAQB 1KJ2B 5F9JB 5I8CB 1CICB 3UJTL 4JFQB 1G0DA 4KV5E 4IJ3B 2R0WH 4K71B 4U1JA 3TZVA 5EC2A 1YJDC 4N8VA 5CJOL 3OR7A 5DJYA 3SCMB 5MENE 3HFMH 4P2QB 3WNOA 1PG7H 4N0CD 4PTUB 2GIYA 2R0ZL 1RJZA 4DZ8A 2BY3A 3SGDI 4D0CA 1MWAL 1QYGH 3O4LA 2JELH 3B6SB 3CMGA 1B3JA 1MRDL 1JZ3A 1MHEB 3IFOA 4PRNB 4LPCA 2AJSH 2WP3T 3STLB 4ALAH 3TV3H 5JNYA 1WEJL 4GG6A 3GSVA 5C71A 4NHUB 1CGYA 3WXWL 1EEUA 3M1BA 1AKJA 1O0VA 2IPTH 4HZLB 4X98B 4JR9L 1NKRA 4FQ1L 3QUYA 1J87A 3RL1B 1G6RB 3OV6A 3G6DH 1J1PL 1K2DB 1U8MA 1YEGL 2E27L 1OM3H 4G7VH 1XGUA 4XNYH 3TBWB 4N9GA 1SHMA 1G9NC 1QLFA 2ZCHL 4AG4L 3B4NA 3Q6FA 3U4EA 1DVFA 3VA6A 4NM8L 3H9SB 5DEFB 4J3WA 2GJJA 3MLTB 1RFDH 4JN1H 4MXQC 5J12C 5CMAA 3OX8A 2PTTA 1ONQA 4WUUA 3CZFA 1ZT7B 2XRAH 4G6AC 1YEIL 2ZSVA 4RFNB 3BXNA 5DQJB 3HZKA 1E27A 2ESVD 3T0AA 1ZGLB 3PDOB 3GSRA 4I0PD 3VFNB 5ACZA 2X4QB 3CLFH 4OF7A 4PS4H 5D2LF 4HUUB 4R90L 4RRPA 3W9DB 4XMKH 3EAKA 3WJLC 2ARWA 3D0VB 2NX5A 5EPMB 5FDWB 5JW5B 1RIUH 1NCCL 5IG7A 2HJLB 4HJGB 1N6QL 3L5JA 4J12A 1LO0H 2HFGH 4HBQA 3QUZB 4CGTA 2W0FA 2ORBH 1DBML 4GMTH 1VEOA 3V4PL 4XXCA 3H9ZA 4F8TA 4Y4FD 1FFNA 3B5HA 4UQ2A 3RGHA 4X80L 5FM5O 2Y06L 4OM0L 3D3VE 1CR9L 1KB5L 1TQBB 2XTJB 5D1ZC 4PJ5E 4ACPA 3IVKB 2V2WB 5JIKA 5I9QB 1JBJA 3TCLB 2A73B 1T7YA 4RGNC 1J12A 1CVRA 1EFXD 2UV3A 1N64L 3QPXL 2ENSA 2EYRA 4M1GH 3WJJC 1AXSA 4OLWH 2YS4A 4Z0BL 3QO0A 3BQUB 3L7FB 1F58L 3FFDB 4LHQB 4JGMA 3NPSB 1IC4L 1CFTB 4U1HB 3MRQA 1Q94B 4MA1B 1BD2E 2DN7A 3O41B 1NGYB 5CEXB 3CPLB 1FL5B 3TFKC 1YNKH 4XVUC 4QHKJ 4OCYL 5LXGL 1JIBA 1C7TA 4DGYL 3EYVA 4WW2F 4GKNA 5KSBF 1C12A 1EHAA 3KPTA 3CSYA 4TSCL 5ELIA 2D31A 4OLVL 1HYSD 2AV7A 1JGVH 5DTFB 5IJVB 4OD3H 1A1MA 4OZGB 3DMMD 3MRDA 3ROOA 3ULUC 1WBXA 4EJ1C 1BQLL 3WEXB 1LE5A 5T1MB 2NR6C 2H2PD 3EOTH 4HJ0C 1K6QL 3HS0B 3SPVA 1SBSH 3QEQB 4BH7A 2F8XC 3I02B 1X5FA 4IRSD 1NFIA 3TJHD 3GI9H 2DQIH 1HKLH 4OCXH 4P46B 3HAEH 4N8CH 5IIEB 4LSPL 4XGZA 1KEGL 3O2WL 4FQ2H 4MZ3A 4QXWA 4HIJB 4KUCF 2GJZA 3HUJA 2W91A 3RP1A 4P9ML 4XPAH 3S9DB 2X1OA 1K4DB 3MNWA 4JHAH 1BZ7A 2AXHA 4PRIE 3Q6GH 4ZO9A 4ZUSB 3KLHC 1MCEA 1IAIH 1UG9A 2DMCA 2RJMA 4OF8A 4L1HA 4AH2B 3IFNH 2BNUB 5F1NB 3KYOA 4QGTA 1ZSDB 2UZXB 5HXMA 5I76B 3F7VB 3BPLC 3MV11 4K2UH 3RWEA 2MQ3A 4GAFB 3MTRA 3EIFA 2I25N 1NEZG 1HXMB 1P84K 4Y16B 3DROA 3OKMB 3X14A 2OMBA 1KCVL 4RMQA 4W4NA 4HWBH 2E8YA 2VL4A 4F9LC 4YH6A 2Z91A 3PWNA 3V7MA 1AGCB 4KUZL 2HLAB 3NPZB 5DUMH 5HYJB 5DGQA 3QAZC 3QIWA 4AZ8A 4JKPH 3TGXA 4K7PL 3S98A 4O9HL 4WW2B 2BRRL 3UTQA 5GZOC 3SDCA 3QDGA 5DFWH 2HT4C 4D8PB 3VXNA 2HFTA 2CK2A 4PJHF 1A7NL 2GY7B 3VDCA 3NCEB 1BFTA 3LKOA 5C92A 1N3NB 1TITA 4XH2A 3RZCD 5FYKH 1D6VL 2VC2L 3SEPA 4Y4KA 1NUDA 1A1NA 3C08H 3ULVD 3ZKQD 4E42B 4XP5H 3QUXB 5IEHA 1A3LL 3IF1B 4Y19A 4O58H 3VFRA 4QXUL 2FL5B 4L4VD 1V7NL 1XGPB 1B9ZA 3BZEB 4XCCH 3VFOB 3NFPA 1F3JA 3DUSA 3PHOB 4AK1A 2QQKL 3O2DA 3T09A 1LDPL 1H3GA 5DT1H 1Z6JT 1GZPB 2GEEA 2VLKE 2DQDH 2V17L 1ZVSB 3DURB 5F8QC 2AJVH 5FGCE 2YPLD 4NSKB 5D7LA 2LAGB 5E2TH 4NQDB 3EHBD 2YD2A 4QRRE 1CD8A 1DEEB 1YNLH 2I07B 4XXDA 3BT2H 3CCHA 3WHXB 4FFYL 4RFOH 5JHDA 5JQ6L 3UO1H 4NNPH 4QRTB 4XBPA 3VU2A 3O8XB 5GPRA 3CJJA 1I9IH 1YPZB 1U8JA 2B1AL 5H35B 1JNNH 1LP9F 4ELME 5I75C 2MKWA 4MQ7A 1I8MA 4KZEH 3W9EB 5A2JH 2R4SL 1PLGL 1QKZH 4NPYA 4JO2L 3VMOA 1SEQH 1F2XK 2E9WA 4PJEF 5I1EH 4KZDH 4GT7A 2P5WA 1CN4A 5B4MC 4JDZB 2R1YA 4PJCA 3FB8B 5ALCL 3TIEB 3WIHH 5BMFH 1ZLVK 1FFPB 3V7AG 5E2VH 4IIQC 1MHCB 3P77A 2NXYC 4K8RD 3ESUF 4PJHB 4XCFH 1MVUB 1LDSA 3LEXA 3U9PH 2BNRD 1J10A 1SYVB 1MPAL 4JPKH 3CH8A 3PQYE 3ZKSD 5JUEL 2J6EH 3D9AH 4X9FA 4G6KH 3RVTC 4FFVC 4X0KA 5LCVL 5TF1L 2PYEB 1OPGL 4YHYC 2X9XA 1PKQA 3FT3A 5E5RB 3V5KB 3I6GA 2NY1C 3OKKB 2ITDA 1LILA 4YDKH 3TYGH 5FEBA 3TA3A 2X44D 4IMKA 5LAXA 2QHRL 2O5ZH 5C1MB 3T2NH 3LB6D 1JN6B 5HVHC 3SKMA 4UTBL 3VFGH 1YMMB 4PJFF 2VXUH 1BM3H 1MI5E 1I9JH 4FQCL 4LGSB 1CGVA 5FO7B 1DUYB 4M6MH 3V4VH 2JIXD 1J8HA 1KCSL 1TLKA 1JPSL 3GKZA 3LIZH 1A2YA 1J18A 2VQ1A 4I48A 2UY7A 1J5OL 4K3EH 3C5ZA 4KFZC 3B9KA 1QLRA 1IRAY 3FRUB 2HVJB 2I26N 5F3HA 2OQJB 1MRCL 3EOYG 4N0YH 1QRNB 5F96L 2F58H 1J88A 2HYMA 5L88H 4ZTOH 3VXUD 1WBZB 3KWWA 1UM6L 4ZUTA 1IMHC 3K0WA 3RUGB 1HSAB 1MNUH 2E7BA 1DQQA 3D3VD 4ZXBD 3TN0A 4PUBH 4PJ5D 3WFHB 2XT1B 1CDCA 4FOMA 1BGXL 3OG6B 4S1DC 3GRWH 4KWUA 5HHVL 4YE4L 4DN3L 4YJZL 4GW5A 5I8KH 2OJEA 3PUCA 4MD5A 4JKLA 1W72A 1SM3L 3QIBC 4JFZL 4LPTA 3UBXA 5F9OL 4HLJA 4C54A 5C0DA 1SY6L 5CGTA 2VLRD 3MV01 3QQ3B 4GOSA 1AH1A 4Z7VE 3BI9X 3X3FL 4APQD 2OR8A 1DBKH 5GGQL 3SY0B 4L5FL 2X4TB 1XIWD 4Y2DD 4HFUL 1ROWA 4PIRF 1DUZB 1HEZB 2X4OB 2ZJSL 2NYYD 3GJFH 4KRPC 3HZMB 1IFHH 4P2OD 5HI4C 4CJ1A 2FLRT 3U4BL 2E6QA 5F88B 3VXOB 1LHZA 2BCKA 1DBJL 4ZUVB 3ZE1E 2F54A 1NBVH 2YXFA 3PNWA 3KLSA 3MLSL 3V0VA 5BS0D 4OQ1A 4QOKA 1A14L 1FL3A 3BWUC 3OZ9L 2OXHA 3MJ7A 3QQ9D 3U0PB 1NUNB 1T22A 1QPXA 4ONGL 4PRID 3QDMA 3VRJA 3PP3K 4WGVB 1ORSB 4HAFA 2GK0A 2W9LA 2XZCL 5B38B 2ATPA 2VWEC 3QUYC 5D2NB 3X11B 4QHLB 2B5IC 4MJ6A 4EN3D 4M7KL 4GRLD 4ONHA 4AEIL 1JZ7A 2FJFB 4DZBA 5GGRA 5JHLH 4JGJA 5DQ9A 4P0DA 4WI6A 4U1IA 2RHEA 3LQAC 5FKAB 3MYZA 3ES6A 1OD7A 4PRBA 5KS9E 4LIQH 4N5EC 1DVFC 1RZKH 4MDIB 2WWMC 5JO5B 2DTML 3BIKB 1PG7W 1ZLWH 4YHOL 5CJ5A 3SO3B 3BGMA 1WIUA 1JPFB 3NOIA 1ACYL 3EYFB 2FX9H 1BFOA 5HYFA 4NQTA 4L4JA 1CFNA 5HPMA 5DUBB 2EIZA 1EEZB 2QLVB 2FEDC 2ESVB 4Y1AA 1CG9A 1FRGH 4FP8H 4TTDD 5TPWL 3WLBA 5D6CB 2X4PA 4Q97A 1Q0YH 2A6KA 3MUY1 3P4LA 2DQTH 3RDTD 1P5VA 4ZOEA 5KVGH 5T1DL 1SVCP 4ZO6A 1GGIH 1CFQA 2Q87A 3BH8B 1U58A 2ZKHL 1CVSC 3GJEB 4KKCC 4OD2A 4QWWC 1AGBA 1OAXH 1CT8A 3REWA 4KI5D 1KLGB 3MRMB 2MCG1 3ZE0E 2YD8A 4MD0A 4BH8B 2GTZB 4H88L 4PLKC 1BEYL 3SE8H 5IHBA 1UT9A 2VXTH 3L3KB 2R2BA 1MH5A 1MIEH 4Q0XL 2GSIA 4HT1L 3GGWB 5I15L 3TPUA 4OSUL 3G08B 3NH7L 3TJEH 4Z8FH 3WDHA 5F1KC 3ESVF 3HR5A 5ID0A 1JRHL 1BWWA 4LLMB 2FB4H 1RUAL 1G9EA 2MQ0A 4N90E 3ARED 5FF6B 1LO4L 3GSNA 3GSOB 3B5TA 8FABB 3FO2A 2D0FA 1EFXB 3MRHB 3PWPA 1TDQA 2GJ6E 4X4XB 5H94A 4PJDB 5JLZA 4WHTA 2VLKD 2NTFB 4OKVB 4OLZL 4R26H 1E4KA 4BJLA 1CICA 1LO3L 1AC0A 4TUOB 2C1PA 1K8IA 3H6JA 5DR5H 2H6PB 3CC5A 3B9AA 4L3EE 5MEOB 1JWUB 4R96A 4LLUB 2GHWB 2VE6A 3VXSE 4WDIA 2XOTA 2XN9B 4M8VA 1UWXK 4GG8B 1IC5H 2XZQL 4RQQA 4BQ6A 3W2DL 2HWZH 2VKWA 1MAJA 3SJVA 1OAUL 1S9XB 1AJ7H 3MNVB 4I9WE 1WAAA 4WFFD 3S3PA 4IRSB 5DMIH 5T1LA 5CGMA 3SDDD 4LASH 5DJAB 3STLA 1S78C 2H2SC 2AEQL 4O2CB 2OLDA 4WU5B 4JFFE 1DFBL 1S5HA 3JTTA 3LZFH 4HKJA 3RWHB 4ZFOA 1IL1B 3RL1A 1BAFH 5INDB 3C87A 1G6RA 4LEXL 3DYMA 1K2DA 2DICA 3EYUL 1A64A 3UTOA 3RVUD 1QEWB 5HHPB 3N1QC 1REIA 2OXGA 2F8OA 4N9OB 4FQXA 2Y6SD 1DSFH 5ERWB 5MEPB 4EZMA 3PQYD 2XWTB 1KGCD 4X9IA 3FO9A 3DSNA 3VDAA 1KJVB 3NN8B 2QBWA 2R0KL 3SE4C 4FXGB 1NMBH 1GZQA 5IMOB 3U2SB 4PJBF 4UBDD 4KV5F 1ZT7A 1WBYB 1UWGL 1AP2A 4NN7C 4U05A 1HSBB 4MS8D 5CS7A 1BVLA 5DSCB 1U93B 5KVDL 3V6BR 4M6AA 2EO1A 2W07A 4X7DC 1FNFA 2LABA 4UOW1 3WHE0 1FSKB 5L9DL 3CMOL 1T1XA 4LCWD 5DMJB 4DCQB 4ZYKA 2AXJA 3GMOA 5I19L 2BFVL 3DHJA 4MJIE 3G5YA 3OB8A 5CFHA 4L8BA 3F6LA 5E9DB 4OFYA 3KNBB 2H1PL 4IRJC 3QIWC 4R4BB 3FFCD 2QADB 3PHQA 4RFEB 3SE3C 5DRNA 1KCRH 5I17B 3LV3A 2IG2H 3L3HA 5FYLL 5DO2D 1KOAA 2VSCA 4KTDL 1E4XL 1NC2D 3I2CL 4U1SA 4YC2C 5C6WH 3QRFM 2DLHA 3C09B 3AU1B 2FEEI 5C0BD 4JFEE 3UTTA 3P4MB 4HV8A 4HGWB 4OCSH 2BERA 1S9WB 4YDIL 5DJZB 1CD1A 5IJKA 4HUXB 4LSTH 5B21A 3VWJA 3BPOC 1AGDB 4S11A 5F8RC 4M93B 2YWYA 1FDLL 3S88H 1NLBL 4U1KB 1YQVH 2Y7QB 2EDEA 4I4WB 4LHUG 4Y4KC 3MLYL 4LCYA 3QI9B 1MCSA 5BZDA 4XBEL 1T04B 1UCBL 1EH9A 5BZWA 3T2OA 3BQUA 3EO1A 3FFDA 4JG1H 5GGRY 4K23L 3GIZH 5C6TH 5HYSG 1LK3H 4HKZB 4U6HA 5B3NA 4JLRA 3CFKA 3QUKA 5SX5H 1OWRM 1YN6A 3FO0L 3KJ4C 4DKEL 1F4WH 3MJ8B 4WWKD 2JB5H 2IAMD 4KQ3H 4WI4A 4X4YB 5F7FA 1ZS8A 5EO1B 3LS4H 3CFCH 5TDPA 3QCUH 4YIQB 4JY4A 1MCDA 4PJBB 1ZA6A 2B8OT 4J8RA 4U33A 2WZPD 4I13B 4PTTA 1ZVYA 1A9BB 2XWBB 3GEWB 2NY4C 5DQDH 4PGCA 1L0XA 1E28B 1Q9WB 1TETH 4HIXH 3FRPA 4C83A 1EERB 5FK9B 3UC0L 4HQQL 1A6UL 5D2LA 2OTUB 3MBEA 4CNIB 4HIJA 2C26A 3MV9E 1IGCL 2G9HB 4PJAE 1GVIA 1KEML 5E08L 4Y4HD 3QFJD 5L7XH 1K4DA 1A3QA 1X5JA 1HDMA 2X7LB 1S7WB 4XX1G 5FKPB 2NY0C 1CFVL 4NBXB 1FCGA 1U6AH 4GMSH 1TVBB 3O2VH 4TSBL 5EUKB 2D9QB 5EU4A 1ZSDA 5CZKA 3MOAH 1NDGB 2C7UA 3KPSE 2BNRB 5GZND 1G9ML 1F6AB 3HC4H 2HTKD 3OGOE 3N1PC 2AJ3B 2APXA 3OB0K 4G9FE 3O6FA 4LRIA 4DOHB 3DX8A 1KELH 5KN5B 4QHUA 1XF3B 4FFWC 1UA6L 3I6LE 4OLYL 1T5WB 2VDMH 4HC1H 5DYOB 5KOMC 1KF9B 4LAQL 1AGFB 1F3DH 4NBZB 5CIPH 3TA3C 4IMKC 5D8JL 1U91A 2C4FT 3O81A 1R3JA 4NN6B 1EXUB 3GBML 3OSKA 5HHME 3IJHB 3HI1B 2YSSA 5EBLB 5A16B 4F3FB 4WW2A 1JVKA 4U1NB 1NC4D 4F7MB 1OB1A 1KN2L 5JMOC 4JY6B 5KSBA 1I1AB 1I8IA 2VOTA 1IAOB 4ISVB 1NCUA 2EDWA 3DVNA 3ULSB 3MLWL 1IAII 3B9KC 3V8OA 1SJXA 4UT7H 4X99A 3ARGB 3VE0B 1CDGA 4MNHB 2B4CC 4KKAD 2F53A 4BKLA 4UT6H 1ADQA 1OGAA 1MCRA 3TF7C 2B20A 5J9PA 3VG9C 2NY3C 5ISZB 3HNTL 1GAFH 3GJFB 2CJUL 3QUXA 4KY1H 3VXUB 1KN4L 3IF1A 3FQRB 4KVCH 4PD4K 1ACZA 4NO0A 4MAUL 4H20H 4AIXA 1ZLUK 5JXED 4ZXBB 3TN0C 5ESVB 1M7DA 2HN7B 3KG5A 1TJGL 2NLJB 2GJ6D 1FNHA 2IJ0C 2BMKB 4DKAA 2ERJB 4NSKA 4JREC 3LN9A 1HH6A 4PRHB 2J12B 5ADPL 4LPXA 15C8H 3MNZA 5CWSB 1QOKA 4YGVA 2FD6L 4YHPA 1RIVH 2B39A 5DK2A 3CLEH 2VLRB 1IQDB 3PL6D 4NQUA 5T1KA 1EK3A 3T0WA 3LS5L 4JRYA 3VXSD 2ARJA 1K85A 5JDSB 4ZNCD 3RIFF 4P4KD 3LRGA 3IKCA 3MGTA 1NGWA 5SWZD 2PXYD 5ID1A 5SWQB 4JQIH 5JORA 4EI6A 1IKFH 2FJGB 1AO7E 3LKRA 3G6JE 5B8CA 2RQ8A 3DBXB 4LEOB 4LF3B 3G6AB 1A1OA 1D9KD 2VMFA 1RU9L 4YDLB 5JXAH 2LV4A 5DHYB 3RY6C 4JFFD 1URLA 4PJHA 4PG9B 4FABL 1T21B 4P99A 1MVUA 5BS0B 4XPGL 1S9YB 2XXMB 4WEUD 5GRJL 4LPUA 1MJ7L 1SYVA 3B9VA 3W39A 1GGBL 5H2BA 3T65A 4ZO8A 4LBEB 3L3OB 5CD3A 5CINH 1G0YR 4KHTH 3VFVB 3ALPA 2EC9U 4DUXA 2XI9A 4EN3B 1M71B 4O2FB 1OAKL 1F11A 3QQ4A 1NGPL 4XNZC 1OF2B 2XA8L 5DJCA 3HN3A 1CE6B 5DFVC 3PHSA 5DHVH 1G7MB 4JO1H 1YMMA 1MFCH 5C0EB 4K3HA 4LQFH 3ZTNL 3D85B 2C3HA 4ELMF 3HC3L 4LMQE 4KROB 3E8UL 1EAJA 4GXVL 1KTLB 1J0JA 1A5FL 1IC1A 5ETUB 4WFHE 2J5LC 2DIBA 1QR1A 1BJ1H 5KBNC 4OGZA 2H45A 4MJID 1I3RB 4WRLA 5DK0B 3NACL 1DDHB 4FS0A 4WUKH 5FA4A 5BJTB 4HEPG 3QFDA 1A8JH 3RDTB 4G8GE 1MREH 2AEPH 4YXHH 3O3UN 5EU6A 4JANA 3S36X 5GRUL 1QRNA 1DLFH 2ZWLT 1DN2A 2BVPA 1P4IH 4QT5B 1LP9A 2SEBB 5IR1B 4HIEA 4XPTL 1IAMA 4S2SB 4JFED 1JGUL 3MV7A 5FOBB 1WTGT 4PJEA 1LE9B 3T0BA 1KXQE 1KG0A 4GJTB 3DX9A 2F8VA 1RZGA 3QZWG 2EICA 3AXLA 3L95B 3H42L 3QNZB 1DBAL 1JPTH 5K33A 1EJOH 4JZJA 1Z0NA 3SGJA 4TQEL 3GSXB 1F5WA 4CUCA 3QJFB 1JF1A 3JWOH 3GB7B 4HFWB 1AXIB 4PRPD 2A77L 1A0QH 2CK0L 1F3RB 1XCQB 3AREB 5J0BA 1S9KC 2WWKT 5GJTH 3WN5B 1KJ2L 3SE9L 4EI5D 4R7NA 4BFIA 1FO0B 4ZOBA 1MHPL 5JR1H 4KRNA 1U36A 5I0DA 4CN6A 3GSWB 3U1SL 3IETA 2Y5TA 5T5NG 1CDHA 5IMLB 3VXPB 5MHSE 3DV4B 4P4RA 4P5TC 2AGJL 3F8UB 3RQ3A 5IW6B 3GO1L 1ZAGA 1J1XL 1B0WA 1XCTA 1N5AA 5TDOB 1IEHA 2X4OA 3QISA 2Z8SA 4N8VG 5DZNA 2HKFH 4Z7UE 2NXZB 5J3HD 1FVDB 4PJFA 1QBBA 4WV1A 3D25B 5E94B 4ELKA 1RI8A 1CDIA 1XGQA 3HB3D 1ZEAH 1S3KH 5J1SC 1KC5H 3VXOA 1G6VK 5LQBH 1CDUA 5GIRB 3AM8C 2Y36H 1A7PH 3KPPA 1NL0H 3BO8A 4HBCL 4NKIH 4K3DL 3MV9D 3W0WE 4U3CA 2B2XH 3V6ZA 4BFGA 3SDDB 4TULL 4JZNB 4YDJB 1P7QD 5FV1L 2CLVA 1H5BA 3KDMB 1R5WA 2EEDA 2CIIB 5AAWA 5F70A 3VGAB 3L7EB 1KPVA 2WNGA 4MXQD 2LTQB 1X5HA 5EO9B 1YJDH 3FB5B 1NANH 2CDGB 4Y5XA 3U48A 5HGGS 1YEEL 3FZUD 3C5SA 2EDNA 4RZCA 3KPSD 1T2QH 2EE6A 3OQ3B 3GHBH 3HI6H 4G6AD 5EZIL 3UJTH 5TF0A 1YY8B 2VLJB 1NEZB 2C4FU 5C0NC 3BYYA 4MDIA 3IS0X 2DQFA 4Z7VF 4L4TD 2KZ1B 1UJ3B 4YWGL 4YBQC 5DA0B 1JPFA 1P4LB 4YHLL 4AJ0A 3AAZB 3JTSB 1W8NA 2AK4A 4G7YH 3I6LD 4P3DA 1YDPB 5IB3A 2XFXA 3CVHA 4AQOA 4LVOC 3TO4C 1ZT1B 4I0PA 3DWTA 1E4WL 3EDJA 5HHMD 4RRPG 4L8DA 4ZFGH 4WY7H 5ESAB 4HUMB 5F93C 1PY9A 4V1DE 5BW7C 3GJEA 1CK0H 3ZE1F 3ZLQC 3CU1A 5FO9A 3WXWH 3PGCB 1XFPA 2WUCL 2GTZA 4HIIA 5DRXB 3FFCB 4JHWL 3HE7D 5DGRA 3VGHA 4OLXL 5DVMA 2V7NB 4OGAC 1WVZA 3OKNB 5IMMB 3L3KA 2XG4A 2ZCHH 3P4NA 2J8OA 4RGND 4DW2H 3ARRA 1BVKB 3NFNB 2VDPH 1IGJA 3ARDB 1SBBA 4Y4FA 5C0BB 4XCNA 3H2WA 2NNAB 5KG9B 5FHBL 2NW2A 1QSED 1ZTXH 2BOBB 1CU4L 2Q86B 1MLBA 3N1MC 4HX1B 5GS0L 3MMEB 1FZJA 2HVKB 5KS9F 2BVUA 3O3EA 4M6OH 3TFKD 4XVUD 4KHXL 3KPNA 2WMPA 4UTAL 4KRLB 1OY3B 7CGTA 2X4SB 3J7HA 3T1FA 1MCCA 4M1DL 5C0RL 4HCRA 3MJ9L 5T3XH 4IOIA 4N0FA 4MNQE 2F5BL 2DLIA 3ULUD 5JPNA 3OJDB 5ICZA 1AGEB 4X6CE 5HGDB 1Q9LA 2NR6D 2VAAA 3CH1B 4HJ0D 4LLUA 1N6QH 2VTFA 4UV7H 2VDKL 1INEL 2UZYB 2Q6WA 3HPLB 4YBLC 5EORH 1B2WL 1U92B 3DMMA 5FHAL 2X10A 4ZSOB 3ZE0F 5IROA 3Q5TA 3L3GA 2CKBA 4A6YH 2I9TA 2J8UE 4HJJL 1PQZB 1TJIL 4OF6A 3MNVA 2IADB 2Y06H 4EDXB 4IRSA 3RWJB 4NNXA 2WM0A 5BO1L 4R4NC 1HNFA 1VGKB 5C0CE 2RCSH 3U4AA 4LNVA 2ICCA 4PJGB 2VWEE 4K94L 2XNAB 3FN9A 3IDJA 2AXFA 3RWHA 2HKHH 5INDA 1YC7A 1HQ4B 4YZFE 3WYRA 4Y4HB 3QFJB 4R9HA 5HHPA 4B5EA 3LEYL 3MRBB 1P9MC 5D93C 4TNWF 3KPQB 3Q3GA 5EIVA 1JWSB 5D7JD 2DS4A 1G7IA 3KLDA 4R3SA 2C4XA 3I75A 4NQVA 5C08D 3RBGA 4KDWA 2Y23A 3ZKXB 1RY7B 3NZ8B 5IMOA 4Z18A 5LWYH 3QULA 4PGDA 3FB6A 5E6IB 2VLLA 1X7QA 2P24B 4MVBC 5IQ9B 2LQRA 5GS2H 1JHTB 3GK8L 1CF8H 3T8XA 4Y8AA 3O6FC 1EEQA 4LRIC 4OQTL 2VDNH 4DCQA 1K6QH 4RGOL 4Q6YA 2ZG2A 1Q1JL 2P8LA 2HT4D 1QVOB 4HMDA 3EZJB 4OFVA 1FP5A 4R4BA 4WFHD 4LAJH 5FUCC 3ZSTA 1HHHB 1INDH 1DQMH 4RFEA 4OGXL 2R8SL 1VACB 4JM4L 4N0UE 1ZVHA 3FO1B 1LD9A 4UV4L 3FQWA 4G8GD 1QA9B 3MXWH 3Q1SH 5I1DB 1WZ1L 1HHIA 2EE2A 3U6RA 4HWEH 3VXME 2BVQB 5FECB 1UXSB 3VI4E 2R69L 1EAPA 3G9AB 1S9WA 2GW5A 3QT2A 4HGWA 3RAJH 1H15A 4R8WL 1DE4A 5ACMA 3RZCA 4X6FB 1GH7A 3JVGA 4I4WA 3RIFK 4WVRA 4S1RL 3EOAA 4NWUH 2DYPA 3QCVL 1T89A 2Q8AL 4HXAL 4NZRH 1B0RB 1X9QA 4OZHE 4Q2ZA 4L4VA 4PJ8B 4BSJA 5DD1H 2PYFA 3JBG7 4KUZH 1RUPL 4CL7A 4QGYA 2EH8L 1AE6L 4HKZA 2DTSA 1K4CB 1SJEB 1A6ZB 2GCYB 3L5XL 4WI8A 5CP7B 3H9YA 4KVNH 4ERSL 4J3TA 5TDNA 4ZMAT 5I73C 4CMMB 2CKNA 3FL7A 5GSVA 1R5IB 4Z0XB 4XNUH 2N1KA 2HH0L 3FOLB 3RY5A 3W11C 4NRYB 2YPLA 3VFMB 4CDHA 5A3IC 4KXZH 1CFSB 2BXZA 4HPOH 1NAMH 1FG9C 4NP4L 3GSUB 4RGMB 1MCJA 2ZSWA 4X4ME 3WNMA 1OTUC 4OFDA 4PJBA 3H3PH 4O02H 2NY5L 5I1HH 1XT5A 1I8LA 1U42A 3U36B 4GSDH 2AAVA 3NFSH 2V2TB 4QXTB 5B4MD 1A6TB 5C3LD 1D6VH 3NABH 4PRDB 5DHVB 5DJ6B 3OKOA 2DLTA 2DI8A 1FZKB 1B4JL 4OZFA 3WNLA 2B7DT 4ZQKB 2C3WA 1KTKE 4LLWA 3RRQA 3VFTA 1ITBB 1XGRA 3U0WH 2YOCA 3BKYH 1KYOK 1WICA 1T2XA 3REVB 3T4AA 2D0HA 4YFLF 1F4XL 1DQLH 5B8CC 2A83A 4YQXH 1EZVX 4LNRA 4QRQB 1D9KB 1GOFA 3KPMA 1T0MA 3LVEA 3VD7A 3RVTD 2CDFA 3WV0A 1X5XA 3C8DA 2GY5A 1V3LA 5JZ7C 1ORQA 5F7EH 2NY1D 1NDGA 5AYUH 4TVPL 1OGTB 5GGSB 1LWRA 1GOGA 1HWHB 2UZIH 3MUJA 5KSUA 1T7XA 2I5YH 4ODUA 4DKFL 1QLEL 1U3HB 5IW1B 2BY0A 2PF6A 5DUPL 1IGIL 3WE6A 1EGJA 1I85A 1KT2B 3WSQH 5HBBA 3THML 2W38A 5IVXE 5IBTH 1B6UA 4NUGH 1K8DA 4X5LA 4HS8L 4GBXB 1T20B 4YPGA 1MIML 5ESQA 3SKOB 1SEBB 5FUZL 4DN4L 1AGFA 4ZPTB 4F57L 5F9WB 1W0WB 5DVNA 1EXUA 1S7RB 4OM1L 4X5WA 1OP3H 2P47B 4JRXB 3TM6A 5E99H 2X9WA 4LU5L 4BQCA 2JIXA 4NJ9H 1UEMA 3SDXB 4JY6A 2E7CA 5I8EB 1OAYL 1HCVA 4U6XA 2AV1B 1D6EA 3T77A 5CSGA 1Y6KR 3OL2A 4V1DD 3ULSA 2R0WL 5E6ZA 3R1GL 2Z92A 4P57A 2VAJA 1FL6B 1CIDA 1HI6A 4MNHA 8CGTA 3QWQB 1GOHA 3HFML 5K9KB 2IALA 4PJ7E 1FAIH 4QRSB 5L0QC 1PG7L 4XC3H 3VD9A 1NFDB 3UROR 1JGDA 4OB5H 4S1DD 1QYGL 1S7UA 2JELL 4PB0H 3MV8D 3QIBD 3D3VA 2DLGA 3IDMA 1A4JA 1EX0A 5DEZA 4ZXBA 1NCAH 4XWGH 3V6OC 2AJSL 4PJ5A 4ALAL 1OARH 1ZHBA 4MB4A 1NCNA 3DECA 2IPTL 1LEKA 4JZJC 2MFNA 2VDQH 1D5XA 3G6DL 4F80A 3DPBA 1T4KA 2VIRB 4PRPB 4K7FA 2FEEL 3ALWA 4G7VL 4PLOB 1OM3L 3UBXG 4OBSA 3BWAB 2YHGA 4FZEH 3EJYC 2VDRL 5EOQH 5C8JB 1BD2A 3K74B 4F2MA 4MNQD 3BE1H 2JB6A 4AQ1B 3BEVA 5AUMB 1RFDL 5MERB 2CDEB 4I0KA 4KRPD 3PGFH 3BSZH 5EZLB 1N5YH 1RZ8B 1FV1A 4APQA 1NCBH 5LGJA 3L1OH 1MRCH 3BDYL 1XIWA 1YMHA 4Y2DA 5HI4D 1S7QB 2XRAL 3C6LA 4NC1E 3FMGH 5HHNA 5JPMA 5JOEA 1HHKB 4LGRB 3O4LD 1HOCA 4KDTA 1RULL 3CLFL 4CU8A 3RTQC 4NRZA 5B3JE 1IT9H 4PS4L 4WV1C 5FYKU 4DFIA 5BVJA 5L2JA 4P2OA 3V6FA 5CLWA 2RBLA 2V9QA 4LEOA 4XMKL 3FQTB 3PABB 4LF3A 2OZ4H 4M9OA 1PVHA 4N0CC 3LQZB 5C0CD 1RIUL 2QV2A 2XKNB 5BXFB 3IKKA 2EYTB 3QUYD 1EO8H 4DN3H 3HI5H 4D0DB 2FX7H 3PWLA 4QRPB 1SM3H 5CKAA 3O4OC 4Y0GA 2ORBL 1P7QB 3OAYH 4XBGA 4GMTL 4IS6B 5TE4L 1H5BC 4UAOC 1ND0B 4PRIA 4N5ED 3W5NA 4MCZB 3OHXB 1RK1A 4UMGA 4P5KA 3C8KB 3ULUF 3WO4C 1G7HA 4GRLA 2WUBH 3MODH 1MFEH 4LLVA 2ZG3A 4HUNB 4CN1A 1CE6A 1VA9A 1CGXA 1V3KA 4ZPVA 1I1YA 2Z35B 5D71H 1TZGH 1CDBA 3O3BA 3OMZA 4ZUUB 4M1GL 1LVEA 3IGAA 1M6OB 4OFKA 4OLWL 3VD5A 2DWEA 4KKBD 3V5HB 4L4TB 4MQTB 5FA3B 2D03H 2KH2B 5DI8A 4S1SH 1YNKL 4KKCD 4QWWD 5FYJD 1BWMA 2ZUQC 4ORZC 4G8EB 43C9B 3C6SA 1OTTC 2CD0A 5KVFH 3BPNB 2YPKA 5DK0A 2ADIB 1NCWL 5FO8B 3K7UA 1OW0A 3MLSH 3MRFB 3G6JF 3MYJA 3OR6A 3VFWA 1WZMA 1FN4A 1D5MB 1A9EA 3EGSB 5DDHA 1ZLSH 4OD3L 4ODTH 3LQAH 2YUVA 3QWOB 4NO5A 5HDBE 1S8DA 3F7RA 4GRWH 4I2XB 5D9SA 3EOTL 4Z78A 1KUMA 3G5XA 1SBSL 1XMWA 5D1ZB 1YEHH 3GKWL 5E2UH 3GI9L 2DQIL 5IM7B 1HKLL 5F7YC 2Q20A 4QTHA 4AENA 4OCXL 5DRZB 4A6YB 2X4RB 4XPHH 4N8CL 4LHUB 4FQ2L 4Y4FC 3QXVA 5E7FA 1JHKL 2VYRE 1LK2B 5LBSH 3WS6A 2DTMH 2L7UA 1QSEB 1BQHA 1EBPA 4NZUH 4XPAL 1XCQA 2EXYD 1R3KA 1U2CA 3Q6GL 3WN5A 1IAIL 2ICWJ 1FO0A 2N56A 5EO0A 4GAYB 3QSKB 1X5AA 4DQOH 5AYQA 5TE7L 1FZOB 3IFNL 1HE7A 3MACH 5IEKA 2VLKA 4OLUH 1TCRA 3D18B 2VABB 4HS6A 5IMLA 3ZE2E 3F6IA 2O61B 4K2UL 4QEGA 4H5SA 3VXRE 1KJ3H 1DQDL 1RVFH 1XGYH 1QQDB 4LDEB 3U0TA 3RL2A 5D4QA 4HWBL 1IQWH 4QRRA 2P5EB 3QHZH 3V5DB 3WDJA 3NIFE 3ILPB 3QP3A 4XVTH 5D7SL 5T3ZH 1U8HA 4AT6B 4J4PC 4JZOB 3WFBH 3JV4A 2WBJA 2ZUTA 1HYSC 3P4OB 2V5TA 2H2SD 3BH9A 5DUML 4NQEE 3DMMC 4ELMA 3ARZA 5I15H 5D1QA 3WIFB 2EH7H 1UQSB 3KYMA 1C08A 4C56E 4JKPL 5EIIB 3WFEH 1S7SA 3GZKA 1QSFB 4C4KO 1EO5A 3D39B 4YDJA 1N0LA 2Y4SA 1LO4H 4LSRH 2P8PB 1JMZA 3GUTB 5CEYA 3QCTH 1H3VA 4ODBD 3BPLB 5CUSH 2JF1A 2IH1B 3CNKA 4UILH 4JKWA 5F9AC 5FYKL 4P5MA 3I6KA 3RVXC 4F7EB 5F7UA 4P23B 1P2CA 4L3AA 5FCUH 1NFDE 1HH9B 1XH3B 3C08L 4PJIB 3PQYA 2A1WH 4XP5L 5C08B 2O93L 4X7SH 1NBYA 3NCJH 1PSKH 4RNRB 2EC8A 4JFDE 4M8QB 1P4LA 2BSSA 4LCCB 4XP6H 1U0QA 1UZ8A 4XCCL 2JK5A 1QFWM 1S9VA 4XNMB 3LKSA 3T1WA 2XZQH 3AS1A 5DD6A 5GRYA 4D9RD 5DT1L 4IRJD 2LU3A 5E00B 4Z7UF 3FTGB 3QIWD 4M6NL 3BW9B 5EU5B 4LCWA 1MI5A 4XTRD 1J0IA 4M5ZH 2BSTA 2AJVL 3OPZH 2OI9C 3WIIH 4LLDB 2W65A 5E2TL 2OTWA 3BP6A 3BD4A 1T0NA 2CSPA 1DFBH 3OKYA 1GYAA 1YNLL 2DMBA 4Z5RB 2GT9A 3MLPA 3BT2L 5I18L 4YHZL 3IB4A 4RFOL 3ARPA 2PW1B 3UO1L 4NNPL 2DLEA 3EYUH 3TBTA 1CLOH 5DC9B 1I9IL 5F6IC 1NAMB 1JNNL 4NFBA 3T2PA 1L0YA 1NC2A 1WT5C 4JN2A 1JYWA 1NANI 4JJ5A 4KZEL 1U8QB 1QKZL 5C0BA 1YEFH 3ULVL 5KG9A 1EPFA 5I1EL 1ZHNA 4KZDL 3QH3B 1MY5A 1PAMA 2BOBA 4Y19D 2Q86A 4BUHA 4HX1A 4PGBB 3MCKB 3RZCC 2DWDB 4EOWH 2FYYB 3WIHL 5BMFL 1MCFA 2A38A 5DMKA 3BRFA 4O51A 4LK4A 1T89C 2VN7A 3DXAB 4YX2H 4XCFL 2F9BT 1A3RH 3S96A 3U9PL 1ZHKB 4PJ9A 3TYFB 3VXQA 4JPKL 4ENED 5HHQA 3EYSH 1EO7A 3DIFB 3CU7A 3DRQB 3O9WD 4WU7B 2I9LB 3F7YB 1SJVA 2J6EL 5FUOH 2W9EH 4G6KL 3ZYZA 3RWDA 2DM3A 2GAZB 3CH1A 1CZ8H 5ANMB 2XPGA 1J05B 2NY4D 5JHDD 1EHXA 3F65A 4WWKA 2UYLB 2IAMA 3F7PC 4NYLA 4YDKL 3C2SA 3TYGL 5I75B 4Y7MA 4Z7VA 1BBJB 4DVBA 1T83C 3GMMB 3T2NL 1QSZA 2D0GA 4XVJH 3VFGL 3KPLA 2VXUL 1PQZA 1BM3L 3IDYC 1I9JL 1VFBB 4LFHG 4M6ML 4W6YB 3V4VL 1EEYB 4OCLC 2GTWA 4KAQH 3SDYH 3FRPG 3T0EC 1G9MC 1NLBH 5JOFB 3WFDH 3LIZL 4G6JH 1JWMB 3LHPH 4GS7B 2IQAB 4IIQB 3O2DH 4K3EL 5D5ME 3BMWA 2NXYB 5T3XE 1HQ4A 2ARJQ 4K23H 3WNKA 4L8CA 5DHXB 4NCC2 3VGGA 4HK0B 4N0YL 2F58L 3LKQB 5L88L 2JJSA 3QG7H 1E0OB 3PJSB 4P59H 3K2MC 4LSVH 5ICXB 4K8RC 5IUSA 1TJHH 3QNYB 4FFWD 1MNUL 4H25A 4NDMA 2P24A 3TA3D 4PUBL 4X6CF 1KLUB 3WS3B 1SYSB 1ZWIA 4BZYA 5HVHB 5IQ9A 1GXEA 2LAAA 5KS9A 4Y89A 2M8XA 4JO4H 3S34L 4EUPB 5L2KE 1I85C 5I8KL 2X70A 3BAEH 1N8ZA 3RWFA 3S4SA 1HNGA 1J8HD 4V2CB 4QHMA 4G80A 3TVMA 1VFAA 1VFOA 1DCLA 2J8UF 3PWVB 5J6GA 2FSEA 3QWRD 3LB6C 1KNOA 3QEUB 1HQRA 1FNEA 1IGCH 2DQHH 1CQKA 3L9RB 4Z7WB 3WUZA 4XCEB 2AQ2A 5DURD 4HULB 2V5SA 4ZDHA 1XF1A 5IV2B 1NC4A 4HKBA 1HIMH 2WLZA 5CEZH 1DBKL 2BRQA 1H3TA 5JW3H 3UAJC 5CBEA 1X6NA 4QYOA 2ED7A 2BVQA 3LN5A 5FECA 3NCYS 2HT3D 3OAUH 5KSVB 4YZFF 3TT1H 5DVKA 2X40A 1LQSR 1UXWA 1T5XB 1GC1C 3AY4A 2MNUA 5E8PB 4NKMB 2BXYA 5C0JA 4LGPB 2ID5A 4EVNA 3C9NB 1HHJA 3TIDB 3UJJH 1NBVL 1PD6A 2AKRB 4WNQB 4OCWH 3MV8B 3PF2A 5ENWB 4TUKH 5CZXD 2QKIB 3E3QE 3QIBB 1JCKA 1MY7A 4XX1E 5D8JH 4MX7B 4OCNC 3ZYIA 4N0RA 2IAND 2D7MA 4IDLA 1T03H 4L9LC 3U79A 4HD9A 2GJ6A 4KH2A 3WLWC 3TCXA 1WIPA 1MFDH 1LEGA 1E6OH 1RK0A 4LKCA 2AS5M 5JHLL 4S1QH 1OSZA 2H26B 2CXKA 1EZVY 4R7DA 5EC1A 4WI2A 1S7VA 4LIQL 4WHCA 3VXRD 3EYQD 1RZKL 2GQHA 4FTVE 5C2BL 4KRPB 2V6HA 2RB8A 3PL6A 1WCQA 4U1JB 4L3EA 2DIAA 5EC2B 4D3CH 4N8VB 1C5DA 5GRVK 3OR7B 5DJYB 3VXSA 4X7CC 4APQC 4YR6A 2FX9L 1XIWC 1L9MA 3P40A 3VI4F 1I1RA 4P4KA 3C6LC 1RJZB 4DZ8B 4NQED 3ZTJG 3V9FA 1FRGL 4FP8L 5EN2A 2YXMA 3O4LB 5SWZA 2PXYA 1Q0YL 3BMVA 4KDTC 2DQTL 4K3GA 1CXLA 4C56D 3V8CA 5KVGL 3HG1E 3KXFE 4NBYB 1CIUA 1W72H 3ZDXE 1GGIL 3IFOB 5H37G 4GG6B 5JNYB 3GSVB 2CR3A 1VB9A 1OAXL 4OZHF 1AKJB 4JFFA 3QDJE 3QUYB 2B5IB 4K3JH 1U8MB 4PBXA 3SE8L 1XGUB 2VXTL 4Q6IA 4N9GB 4M3KB 3QQ9C 1QLFB 5DFVD 1MIEL 5IB5A 3Q6FB 4JCMA 3TESA 4KXZI 3U4EB 1DVFB 3O3AA 3TJEL 2YUXA 1E6JH 2FB4L 1KJMA 2QSQA 2I24N 5CMAB 3OX8B 1AQDA 4GRLC 5C0AE 4JFPB 1PW3A 5E70A 2PTTB 1ONQB 4QTIH 4XNQA 4JFDD 4WUUB 5DS8A 3CZFB 2ZSVB 3VW3H 3BXNB 1E27B 1N59A 1H0DA 1G1CA 3GSRB 4WGWB 3BD5A 3LRSA 3M45A 3HE6C 2AV1A 4LOUD 3MUGA 1Q38A 2NX5B 5DR5L 1RU9H 4MJIA 4D9QD 1II4E 1XAUA 4ODVH 1I7RA 3K1DA 5IG7B 1IE5A 3MRRA 4E5XA 2EEBA 1OW0C 1ZT4A 3QHFH 2DLFH 3E0GA 1EV2E 1MJJA 2DBJA 4XHQA 4QRSA 1IC5L 1GGBH 2V7HA 2HWZL 2IMMA 3SKJH 4KDVA 4G9DA 1FFNB 1JTPA 2APVA 4UQ2B 1AJ7L 4JFEA 3VXTB 4K71C 5E8OA 3K3QA 4FZ8H 2Y25A 2P1YA 4JFYA 5DMIL 4LASL 5FIEA 3EOBA 5F72S 1FVEA 2VLME 3STBA 4PYGA 3LZFL 2EYRB 5IVXF 2YA0A 4L8SA 1BAFL 3VGEA 1CBVH 3WS6C 1I75A 2VIRA 2LVCA 3QO0B 4PRPA 1FLRH 4P5TD 3MRQB 3S37X 2CRZA 5EB9A 4EI5A 3CSBA 2MOVA 1DSFL 5F97E 1UB5A 1UH3A 2EDKA 1YC8A 1C12B 5EZLA 3CSYB 1RZ8A 4X5XB 3I84A 1NMBL 2D31B 3MRKA 2CMRL 4I18A 2G5BB 2AV7B 1MLCA 2XY2A 3HLAA 1A1MB 3X17A 3MRDB 3ROOB 4RAUA 1WBXB 1LE5B 1RUMH 1DL7H 2ZOLA 1R24A 1UJTA 4FMFA 4TYUA 4BH7B 3V52H 3ELAT 2WBJC 4GKZA 3VH8B 3ABZA 3GSNH 2X89D 4PJXE 4XGZB 4EXPX 5D1QC 2VISA 4AY0A 5ITBH 4FQLH 4CBPA 1A22B 1FYTE 2GJZB 3MV9A 3VFPA 3NTCH 1CL7I 2QSTA 1KCRL 2IEPA 1P7QA 2IG2L 3MNWB 4DFHA 1BZ7B 1ND0A 4NNYA 2E9IA 1KJ2H 5B38G 1DQJB 5DZOA 3LQMA 4Z6AT 5JQHC 1NMAH 4OCSL 1RJLA 2QR0B 4MNGE 5E03A 1YN7A 4LSTL 3BUYA 3MXVH 4YBQD 1T0PB 2AGJH 2D4FA 3RWEB 3S88L 2W60A 1YQVL 3KPSA 4NN7B 2ITCA 2HFFA 2Y6SC 2Z35A 3DROB 4JJHA 3X14B 2NTSP 4ZUUA 3MOQA 3TO4D 3FCTA 5D96C 2ZP0T 2LU7A 4G9FA 3RHWF 2OX5A 2Z91B 3PWNB 4JG1L 1ZLVH 5FOJA 3GIZL 5C6TL 1R3LA 1LK3L 2VR5A 2XTJC 2A6DA 4Q9CA 3GM8A 3HAEA 2G2RA 1MFNA 1Z2KA 3LN4A 3SDAA 2C5DC 3QIWB 3VDBA 5FO8A 5MEQA 2K7QA 5B3JF 25C8H 1F4WL 1G6RH 1MJUH 1XR8A 4OF3A 4OGAD 2JB5L 2J3SA 4KQ3L 5E6YA 3QDGB 4YC2B 1QHOA 3LS4L 2R29H 4P48A 3VXNB 4MA1C 3QCUL 4E41E 4E0RA 2YWZA 5KSAD 1IKNA 3HE7A 4Y5YA 3RX5A 3LKOB 5I1AA 3BPOB 5DQDL 4LHJB 3V6OE 4XH2B 3P9MA 1TETL 3MZGB 4XMPL 4HIXL 4Y4KB 2JCCE 3QUMA 4NFCA 5IB2A 1L6XA 1A1NB 2X4RA 1ODAA 2Z0BA 5M7QA 3HZVA 5EOCH 2DQJH 2C3GA 2DQGH 3PGDA 5IEHB 1LK2A 4XT1C 3K4DA 2OP4L 5AWNL 3TLRA 4Y19B 3VFRB 1DR9A 1FORH 4X6DE 5DD3H 5L7XL 6FABH 3SOBH 4N1HB 5J1AB 3NFPB 2JLLA 1F3JB 3DUSB 4ZD3H 3AC0A 1VFMA 4JQVA 1U6AL 4GMSL 5F1SA 3O2VL 4D9LH 1VGEH 1IJ9A 3BZ4A 5DJDA 3LAFA 2H8PA 3MOAL 5I1JH 5D7LB 3HC4L 3L6FA 4PJ9C 4WI3A 1QQDA 2LFGA 4GRWE 4K94C 3LDBC 3GHEH 1KELL 1MUJA 3BEWB 1VSCA 2NY4B 5GS1A 2NY6D 4JHWH 4U1MA 4W6WB 3ZKMC 5JHDB 1HINH 4HC1L 5HDBF 4P2YA 4MQ7B 3TNMA 3DRTA 3OXRA 1I8MB 4Z77A 5E95B 2V5YA 4NPYB 4GQ9H 5HI3C 3QDHA 5EZJA 3JWDL 5FHBH 2CQVA 3DVIA 1BJ1J 5SX4H 2P5WB 5HY9A 1QNZH 3MGOA 5GS0H 2R1YB 4PJCB 2NY0B 5FXCH 5IVOA 1FG2B 3HG1D 3KXFD 5IK3A 3G6JA 4WO4D 1KCUH 1INQA 3RBSA 3RKDD 2DMKA 1DP0A 4NUJA 3HPJA 2CXGA 1A4KA 3CXHJ 3P77B 3VMNA 3OKLA 4UT7L 1A6WH 4JM2A 4BSVA 3ZZ1A 2D7OA 3H3KA 3IU3A 5HGHB 5EBMA 5IFAH 4MVBD 4UNVA 4ODXA 1UENA 2HT2C 5D7JA 4R97C 1GAFL 4KY1L 2JJSC 4X0KB 5C08A 3ZE2F 4KVCL 3OG4B 2MMXA 4H20L 1PKQB 3CSPA 3FT3B 3I6GB 1C16A 1GGTA 2ITDB 4V2BA 2VDKH 4EQ3A 2BVOA 4U4BA 2BX5A 3O0RH 3TA3B 1PEZA 4NN5B 5LAXB 4YXKH 4KRMB 3G9VA 3SKMB 5JW4N 1MCIA 3NIFF 4X7TA 3T04D 3GDBA 5CGYC 3GSQA 1RZ7L 2GKIA 3JV5A 1R3IH 4MSWA 4LLDA 3WO3B 1J8HB 3PP3H 4XNXH 1I3GH 4WW1B 1A2YB 3TVMC 1XZ0A 3BRDA 4JDVA 2VQ1B 4I48B 15C8L 2X1QA 1QR4A 1RIVL 1X3DA 5IFJA 1YECL 3C5ZB 3B9KB 3GFUA 4HSQA 1QLRB 2ICWA 1Z9LA 1TFHA 2CLZA 5F3HB 4G8GA 3FHAA 1U8QA 2NY3B 2FNBA 3CX5J 1H9VA 3ZT7A 3Q2CA 2ADFH 2APWA 3KWWB 5FV2A 4ZUTB 2L4OA 3A6CH 4KI1A 4NO0D 4JQIL 3MCKA 3NA4A 2GSGA 1DQQB 1FAKT 1MHHA 3MR9A 4HMEA 3TN0B 3AY4C 4G6MH 5JXAL 3TBYA 2NY5C 4MB3A 4KJPC 4FXLA 3HUJE 5IOPA 1KPUB 2OJEB 4RGOH 3HMXA 4MD5B 4RA0C 1W72B 4JREB 5A3ID 1ZHKA 3SKUD 3UBXB 2VZ3A 1JZ6A 1ZE3C 1LNUA 2IANB 3BP7A 5F9DC 1H8OA 5CINL 2HAZA 2BJMH 4KHTL 5ANMA 5J7CC 1KENH 5GHWH 2COQA 5C07E 1RPQA 5EA0H 2R8SH 2ED8A 5T1KD 4HXBH 5GQBA 2Z31C 1MCWW 2W9DH 3MLXH 1TTUA 4DUVA 4JO1L 1ADQH 3L3DA 4O00A 1C7SA 1MFCL 4OIIL 4J3SA 4CMHC 4LQFL 1ED3B 4TSAL 4R8WH 1EEYA 3PL6C 5I8OH 1BZQK 2WV3A 4FHBD 5C3TA 1UVQA 1Q0XH 4Z7UA 4OV5A 3PWJA 4OZFG 5SWSD 4MA8H 3V79C 3AB0C 1Q9KB 2KL6A 3QIUC 2BCKB 1P6AB 2Q8AH 1WWBX 3GRWA 3BPCA 3QG6A 4WUKL 3PNWB 5JZ7D 1G7PB 3V0VB 1MREL 1FYTD 1PX4A 4YXHL 4LSSH 3W0WA 1FL3B 1PFCA 5ICYB 2Q7NA 4I1NB 3MJ7B 1DLFL 3LKQA 2ZUWA 5E8NA 1WCBA 3R06A 4P2RD 1RHFA 1P4IL 1ZKAA 4WTZG 1LO5A 3QDMB 3VRJB 4PR5A 2BNQE 2GK0B 2DF3A 5EBGA 1QFWH 5FYLE 4BZ1L 4MJ6B 4XNZB 1UWXH 2HG5A 4ONHB 3D69A 5GGRB 1MQKH 1AQKH 5DQ9B 3CUPA 1ETZA 1SYSA 4U1IB 3N50A 1JPTL 4MAYC 1EJOL 4NJAH 2FDBP 4EUPA 5TH2A 5TE6H 2CR6A 3JWOL 1FE8H 4HPYL 3ZTJH 2O5XL 1A0QL 3BGMB 1BFOB 2C3XA 1TVHB 5GJTL 1CFNB 2J5LB 2EIZB 1FZMA 3IDIB 3VA2C 4WTXA 5JR1L 5H37H 1CG9B 5DXWA 4HDIA 1WV7T 3WLBB 5I1IL 2X4PB 2A6KB 3B9EA 4YHML 2ADGA 5HHOE 4AL8L 4WEBH 1BX2B 1U8OA 1PZUB 2UWEE 3O6LH 5D5MF 1U58B 4ZODA 4V1DA 4B41A 2OL3A 1CT8B 3REWB 1P53A 3TBSA 4CAGA 4E41D 2HKFL 4MD0B 4UB0H 1CGSL 4WI5A 4JFHE 3D6GA 1KB9K 2XA3A 5HGBA 3UZVB 4U7KA 4XCYB 2R2BB 4GW4A 4WJ5A 1MH5B 5E8PA 4ZOAA 1ZEAL 1S3KL 1Z5LA 1ZOXA 2APFA 1KC5L 2GSIB 3S35X 4JKMA 3TPUB 5BRZE 2Y36L 1A7PL 2R39A 2J7LA 2WLYA 1NL0L 5BV7C 3HR5B 1JZ4A 5ID0B 1I7ZA 3MV8A 3VWKC 2QKIA 2B2XL 5F44A 4ZG1A 3CXDH 2EDYA 5D1XD 3GSNB 3FO2B 4WFED 3PWPB 3VI3E 2IBZX 1MWAB 5H94B 4L8SC 4NCDA 4WHTB 5EUOE 5CEZE 4NZJA 1YJDL 5FGRA 3QPQC 4HLZG 3NCMA 4LP5A 4YO0A 1T2QL 3GHBL 3HI6L 4BYHA 1QACA 5ACLA 1CFBA 4EI5C 5ADOH 4MNQA 4XWOD 2C1PB 1K8IB 2VITA 2JJWA 3L5IA 3CC5B 3FAWA 3R1GH 4X6CA 4R96B 3MREA 2VE6B 2VZVA 4KTYA 3T0EE 5D2NC 4WDIB 3RTQD 2MHAA 1IARB 1B4RA 3RGVA 4I18C 3VD3A 4G7YL 1NGQH 4I3GA 3GBNH 2YMXH 4RQQB 3UTSE 2NCMA 4JFXA 3SJVB 3RHWK 2J8UA 2YRLA 3EBAA 5J3HC 3P9WB 1RZFH 5T1LB 1FFQA 4WY7L 4ZFGL 1FC2D 1I4FA 4GUPA 3HB3C 5CP3A 5I2IA 1G9NL 1CK0L 3VJ6A 5C0CA 3KYKH 5CILL 4IMLA 1S5HB 3JTTB 2DIJA 3NBNA 5I6XC 1KSRA 1UFUA 4HKJB 4ZFOB 4W4OA 3T0XA 3IRZA 2H3NA 4CW1B 1UKSA 3DVFA 4QLRA 4ZUWA 3NIGE 3FT4A 2XQBH 2YD5A 3RNKA 4M9PA 3UXFA 2WSKA 5EFIA 5EH1A 1Y6MR 2UUDK 4FQXB 2N7AA 2VDRH 4DW2L 2R9HD 1X4YA 2VDPL 3V0WL 3BX7C 4NGHH 3FO9B 3WFCH 1ZTXL 3F12A 1F45A 4JFPA 1GZQB 3FZUC 3BDYH 3P30H 5GXBB 4M6OL 4NQCE 2AK4D 1AP2B 1CLCA 2ENYA 4ONFL 4LVOB 3TO4B 1BVLB 1OTTD 1YEDA 2IPUK 4BZ2H 2F5AH 3KPRD 1T1XB 1RULH 5T3XL 4ZYKB 1KACB 3GMOB 4MA3B 3VRLF 4ETQA 4HH9A 5HJ3A 3UTPE 1GRWA 1X4XA 3G5YB 4ZFFA 4L8BB 1KLFA 1YYMH 3SDAC 1SMAA 3UBXI 1NLDH 3CFBA 1VPOH 3MA7A 3PHQB 3ZDXF 2WK2A 2R4RH 4UV7L 5DRNB 1FC1A 3LV3B 3L3HB 4MB5A 5EORL 4N0UA 3UPRB 3OB0H 5TE4H 4U1SB 2D9CA 4H26A 4A6YL 4FQIH 2X9YA 3O45A 3UTTB 4CVZA 3VXMA 3FQUA 3VXTA 4HV8B 1UM5H 3RIAK 1CD1B 2NY2C 1IKNC 3EKCA 3HE7C 4HF5H 4G43A 4Y5YC 3VWJB 2QSCH 3RFZC 4POYA 5E1HB 3C60C 2RCSL 3AFLA 3TNNA 4ONOA 3BN3B 3QXTA 1UWEH 4LCYB 5EZOH 4NC0B 1NCDH 5BZDB 2F54E 1F6FB 2FO4A 1BQHG 2HKHL 4ORGA 5GISH 5BZWB 2AJXH 4GKOA 2HFEA 2Z93A 3EO1B 4QOKE 5D6DC 2Z8VC 4OZHA 1RMFH 12E8H 2VRAA 2KQMA 4U6HB 3VFUA 1XR9A 4JLRB 1DLHA 3CFKB 2BZDA 3QUKB 4JQVC 1YN6B 1XF4A 1NCWH 4JB9H 4DGVH 4X5XA 5DF0A 2A6IA 4J4PD 5LWYL 5C07D 1JTTA 1V3MA 2G5BA 4A2LA 1JZ2A 1ZS8B 5TDPB 1P1ZA 4RDQF 4JY4B 4Y2OA 1ZA6B 1CF8L 4X4MA 1MFBL 4J8RB 4PTTB 1ZLUH 2VDNL 5GS1C 3IYLW 4OAWB 4PGCB 4PB9H 3QHTC 1Y18A 4WI7A 3GKWH 3GI8H 5C09E 3VH8A 4XAKE 1XGTA 4C83B 4Y1AE 5D2LB 3MBEB 5K59E 3CFJA 1JHKH 1INDL 1DQML 4NWTL 4I77H 1A7BA 3RVXD 1HDMB 4HCRH 3TC9A 3DHMA 3HNVH 2BK8A 3MXWL 3Q1SL 1DQJA 2MCPH 4HWEL 5F71A 2Q8BH 5TE7H 3E6FA 3RAJL 2QR0A 5MP6H 3SE4A 2BNQD 5EU4B 3FB7B 4J2XA 2BVYA 4JM2C 2C7UB 5FYLD 4N68A 2OSLA 1DQDH 5INCA 5CBAA 1I1FA 1QUNA 4NWUL 1JZ8A 1MFAH 3GMPA 4NT6A 5D7JC 3FT2A 4NZDA 3JZ7A 4NZRL 3O6FB 1RHHA 2CKBH 3DX8B 2VKXA 5D7SH 4QHUB 3AVEA 5DD1L 5IVXA 1UKTA 1AHWA 3ARYA 2VERN 2RFXA 1F4HA 5FM8A 1OQXA 1U91B 4KVNL 3QI9C 4IRJA 1R3JB 1IGYB 5F3BA 2LU4A 4F58L 4XNUL 2VXVH 4P3WA 1TMCB 1MCHA 2YSSB 3SE3A 1H3UA 1OB1B 2HRPH 2IH3A 3BKMH 3MRJA 5KSBB 4HPOL 1NAML 4PJXF 1KPRA 2WW8A 3GMLA 3RX7A 3EUUA 5HHOD 1I8IB 2Z9TA 3H3PL 4O02L 5I1HL 5DWUH 3DVNB 2EDBA 2Z8RA 4BK4A 1VKXA 4GSDL 3NFSL 2M1KA 4X99B 5KANI 1AIFA 4KC3B 4P2QE 3NABL 2GFBA 4JAMA 4JFHD 2F53B 4JFOA 5DZLA 1D5ZA 4BKLB 1OGAB 2VXQH 5FGBA 4XZUB 5J9PB 2DYPD 1YYLH 3QA3A 1WAAE 5I16A 1FNAA 2D7TL 2AJZA 4P3CH 3U0WL 4NO0B 1V3JA 3BKYL 3U83A 2AEIT 2D2OA 4XPFH 5J1AA 2W0LA 4XHJC 6CGTA 1DQLL 3IFLH 4YQXL 4YGAB 1M7DB 5I73B 5L8JB 4M6NH 5F7EL 3TEUA 5IBLC 1L7TH 5AYUL 1Y0LA 2VUYA 1G84A 4R2GD 3UEZA 4NOBA 1HH6B 2UZIL 4JPVL 3O9WA 2I5YL 4GLRH 3H9SE 5F7KC 2HLFC 4F37F 2BDNH 1WUNT 3MNZB 4YGVB 4YHPB 3AUVA 4TUJB 3EDDA 5DK2B 4YHZH 5I18H 3BEWA 5T5NF 3WSQL 4PP1D 5IBTL 3MUHL 4NUGL 5T1KB 3T0ED 4JRYB 3CFDA 4H0IA 2ARJB 2G75A 3BP4A 3LD8C 5MEND 2AERT 4F7TB 4ZTPH 4HK3N 4HUWA 3FQNA 3ULVH 4URTB 2VB5A 3IKCB 3MGTB 3UTSD 1BECA 4NO2A 5E99L 1NGWB 5ID1B 2WIIA 4XPBL 2JCCF 4NJ9L 2ZUYA 2W59A 4EI6B 5JORB 1LEIA 3JUYA 4B50A 3LKRB 2R2EA 5B8CB 4XVSH 1FG2A 3VMPA 3S36H 2EKSA 2YEZA 1A1OB 4BUGA 1F4YL 1VESA 5KW9L 5KVMC 4OUUA 4X6DF 2Z4QA 2K1MA 1R3HA 1ERNA 1T3FA 3B83A 4HHAB 5AAMA 5HGHA 1U95A 1FAIL 3DYOA 3W39B 4HKXA 4XC3L 5H2BB 3T65B 4P2RB 1I1AC 1RZJC 5CD3B 2CRMA 4OB5L 5EDXA 5HD8C 1F8TH 1IM3A 4PB0L 2XTJE 4OI8A 1F11B 3QQ4B 3ARGC 4GRWF 2EYSA 4MMXC 4UUJA 1NCAL 4XWGL 1OARL 5DJCB 5I1CH 4ODWA 2DM4A 5IMKA 5DA4A 4GFTB 1KFAL 5JMRA 4M7JH 2FLBT 2VDQL 1DJSA 2QJDA 4OZFH 5F7MC 3S4SG 4MQXC 4Y8DC 5E5UB 3B2UD 2ZZUT 5SX4I 4FZEL 4WW1A 4YXLH 4LPYA 3QWRA 3G5VB 5EOQL 3UAJD 1QR1B 3X12A 1SJHA 3UTPD 3BE1L 4X8JA 3IDNA 3PGFL 1B0GB 3BSZL 5FA4B 3P9LA 1N5YL 4K8RH 2JJUA 3NZHH 3QFDB 2N7BA 3GMNA 1NCBL 2PR4H 3L1OL 5EU6B 1GSMA 4JANB 4OZGE 2ERJC 4FQJH 5L0QB 4C4KT 2BVPB 2P43B 3D2UD 3FMGL 2CRYA 1LP9B 4H8WC 1MJ8H 4KKLC 3PP4H 4HIEB 3QEQE 4HEME 3VG0H 1NAKH 2AEWA 1EGJH 3MV7B 1BQSA 1IT9L 4PJEB 2BY1A 1KG0B 1NCTA 1JFQH 1HZHH 3DX9B 1RZGB 2OZ4L 3AXLB 4GKSA 5DJ0A 3ARSA 4HS3A 2ZUSA 1RZKC 1N2RA 5HDQH 4JZJB 3S34H 3WLWD 1EO8L 5E8EA 3HI5L 1RJYA 1NUGA 1KPUA 1JF1B 2FX7L 2ZNXA 4FFZH 4K9EH 3MRIA 3ARBA 1Q8MA 3B3IA 1JNHB 3L3IA 4UIMA 2IANA 4R7NB 1BD2D 4BFIB 4KGJA 4YDLC 5C0GA 4N1EA 1NPUA 5D7IF 3RPKA 3IETB 2WUBL 3MODL 2OR9H 2Y5TB 1MFEL 3RPIA 4MZ2A 4MWFA 4P4RB 3E2HC 5DMYA 3L5WA 3H9HA 1GC1H 1B90A 4M62H 3OGCA 5D71L 1TZGL 3R8BB 2V5MA 3VXRA 1RUQH 1N5AB 1XCTB 3C6LD 2CPCA 2K3TA 1FFOA 1ED3A 2P7TA 2DJSA 4K7PX 3QXWA 3KLAA 4QCIA 3B2VH 4G5ZH 3A0OA 3PXHA 4PJFB 4WV1B 5GGVY 4ELKB 2D03L 5HYJE 1HXYB 3PWUA 5ITFA 3RGVC 1XGQB 1GHFH 4S1SL 1E4JA 4M61A 1Q9KA 4OI7A 2DRUA 4LDLB 4NQEA 3DYPA 3RY6A 3DV6A 5KVFL 3KPPB 3BO8B 1G7PA 4C56A 3BGFB 1MCLA 4DAGH 2UVFA 3V6ZB 5ICYA 4KROC 1ZLSL 4ODTL 2CLVB 1H5BB 4UAOB 1R5WB 2PW2A 1Q72L 4HLZH 3LQAL 4Q9RL 2J4WH 4F9PC 2FZ3B 1D5IH 1KPVB 4W4OC 4XRCB 5C6PB 1YEHL 1ZV5A 4Y5XB 5E2UL 3SGEH 3C5SB 4YK4C 4RZCB 1JI1A 4XPHL 5JW4M 5F89A 2IPKA 2H41A 5C2BH 2DQFB 5LBSL 1M7XA 3OTTA 4NZUL 4YUEH 2BVEA 1A7QL 3HE6D 4JFDA 1TVHA 1BREA 3RU8L 2AK4B 3IDIA 4U2ZA 4P3DB 2ZUQB 5IB3B 2XFXB 3CVHB 4DQOL 3MACL 4I0PB 2XZAH 4KKBC 5GGTA 2J88H 4OLUL 4W81A 1M7IA 4L8DB 1FNSH 3B43A 4NQDE 3AMLA 1FYHB 1BX2A 3HRZA 1KJ3L 1QO3A 1RVFL 1MSPA 1P7KA 5D7IB 1XGYL 2IBZY 4PY7A 3INUH 2R23A 5DEGA 3D1MC 2YC1A 3PIQA 3SKNA 5FO9B 2BSED 1IQWL 3QHZL 3IXAA 1T1YA 4HIIB 1U41A 4XVTL 5T3ZL 4J6RH 1PYWA 1YPZE 4UQ3A 3RNQA 3WFBL 1QFWI 1G7LA 3SCMD 4OIAA 4XCYA 1A7OH 2WINA 2X4NA 3P4NB 3UPCA 3CDGA 5B39A 1IGJB 4Y4FB 4Y5VA 3I9GH 2EH7L 3MGAA 4XCNB 2ZCKH 2VZ1A 3WFEL 3CGTA 2NW2B 2FIKA 4L3CA 1MLBB 2HJFB 2NXZC 3CK0H 1FFRA 1G1YA 1FZJB 5BOZG 3O3EB 4LSRL 4P9HH 4OGYL 3NIDE 3KPNB 5ALBH 1MWAA 3QCTL 2AW2A 4PJHE 1A6AA 3T1FB 1I8KA 4LCUA 4P5TA 5CUSL 4IOIB 4UILL 4N0FB 2EXYC 3OKDA 4GAGH 5FCUL 2GYSA 4G8IA 5JPNB 3KS0J 5ICZB 2OBGA 2A1WL 2PYEE 5T33H 3H9SD 1O7SA 1Q9LB 4DJMA 4QRRD 2VAAB 4X7SL 3BKJL 3NCJL 4TVPE 1FVCB 1X5KA 1PSKL 2CLRA 3GMQB 1BJMA 2DI9A 3NCBB 1L7IH 2UWEF 4XP6L 2WBJD 2Q6WB 2EDOA 3DMMB 1D5BA 1FPTH 1YMME 1WFOA 2HMIC 3AM8A 5LJYH 3L3GB 5JW4Q 2CKBB 2I9TB 5D1QD 5TGBA 2DM7A 4KK8D 1IZJA 1QRKA 4M5ZL 4UINH 3OPZL 3IAPA 1AFVH 3WIIL 4NNXB 4KMTH 5J56B 1KTDB 2X89A 5D7KE 2E7MA 2EKJA 1G7JA 1FO0H 3IDJB 2AXFB 3VRIA 3GMRB 1M05A 4CW1A 3MRNA 5D5MA 2J1KA 4MQSB 1CLOL 1NSNL 1QRNE 3L3JA 2JTDA 3VI3F 5ILTL 1IVLA 2YD1A 2Q76A 3Q3GB 1LP9E 1UZ6E 5EIQA 5LGKA 1YEFL 3WFZA 4OZIF 1G7IB 2M26A 5EUOF 4R3SB 4YLQT 3RUGE 3I75B 4NQVB 1NBZA 1QBMH 3QULB 3DETD 4EOWL 4PGDB 2CMRH 2XTJD 3FB6B 2VLLB 4XP4H 1X7QB 4QNPE 3TO4A 2VXSH 3KJ6H 5HYEA 1EHLH 3ARDC 3T8XB 2EC9T 4UOW0 4RSVA 4LDOB 1MI5D 4MHHG 4YX2L 1KB5A 1CXIA 5L2KA 1A3RL 1HYRC 4MA3A 3IDGA 4J3VA 2P8LB 5BW7A 1AHWC 3EYSL 5TQ0H 4PG2C 2A0LD 2IQ9H 4IBLT 4UDTA 3DGGA 2W9EL 5FUOL 4NFDA 1JV5B 4LARH 1CZ8L 3TP4A 2QQNH 1JK8A 4XTRC 3EZ8A 5F6IB 3DVGA 3K4AA 4GW1A 3UPRA 1LD9B 4CADA 3FQWB 3KR3H 4F37K 1G7QA 1IAKA 1HHIB 3U6RB 4XVJL 4EBQH 32C2A 4IHOA 5KSAA 1X5IA 3ZKNC 2WBKA 1EAPB 5IVZA 3NIGF 1H15B 3BIAX 5IGXL 1DE4B 3SDYL 4KAQL 2YN3A 1SMOA 3RZCB 1GIGH 4AIZA 5E8DH 4L29A 3WFDL 4G6JL 3EOAB 3LHPL 1N7MH 1OOAA 4P46D 2DYPB 3NCCB 5FGBC 3O2DL 1RQ5A 1ZHLA 2CO6B 4G42A 1TZIA 5DLMH 4Q2ZB 4L4VB 1NFKA 2OS7A 5KVEH 4XMLH 1DBBH 2PYFB 5K93A 2JJVA 4PJ9D 1TTGA 1MELA 3OF6A 2OCFD 1KIPB 3QG7L 2E9BA 5TFSH 4P59L 5TDNB 4WI9A 5D2NE 4LSVL 1J1OL 5GSVB 3ZKMD 2E8ZA 1TJHL 4DEPB 3EO0A 5E1AA 4OZIB 2YPLB 3B5GA 4YFEA 3KPOB 1VCAA 3LSOA 1PJ9A 3BKCH 4ENEC 3S3SA 5HVGB 2ZSWB 1R0AH 3O9WC 2AJUH 4Z76A 5HI3D 1KXTB 5DJ8A 4JO4L 2L0DA 1I7UA 3BAEL 4OAWA 3ZKXC 3TBVA 4R0LA 1H3PH 4XMPH 3B8YA 1OCWH 3OKOB 1MF2H 1IM9A 2ESVE 3E6HA 1NJ9B 1BOGA 4OZFB 3WD5H 5J6HA 2DQHL 3P0YH 4NC1C 1X5ZA 2OP4H 5AWNH 1PX3A 4LLWB 4RX4D 3VFTB 1XGRB 3HTLX 1HIML 1JGLH 5HVWA 1KIQA 3T4AB 5CEZL 2P8MA 1JMXA 3HG1A 3KXFA 1P9MA 5JW3L 2A83B 4WO4A 1N0XH 1P84J 2DDQH 2HT2D 4LNRB 1MEXH 3KPMB 1T0MB 4E9LA 2CDFB 3OAUL 5K9OA 3TT1L 2IFFH 3H8NA 3S6CA 5C7XH 2DQUH 3FB7A 1ORQB 3QDJA 4F7PA 3UX9B 2BHUA 3MLUH 1TQCC 1Q9OA 1DANT 2O5YH 2WBWB 5KSUB 4ODUB 1YNTA 4TVSa 4FN0A 5CGYD 3UJJL 3WE6B 2F74A 4OCWL 4DK3A 4TUKL 1K8DB 1FIGH 1CGUA 2EEAA 2QQLH 4YPGB 3LEVH 5ESQB 5A43C 3TVMD 3ZYOA 3OXSA 4WCYH 4LRNH 1T03L 1IGYA 4PJDE 1IEAA 4EKXA 4X5WB 1JHLH 3JWDH 5FM4A 5CSBA 1MFDL 2OJZL 4AM0B 1E6OL 1IGMH 1KIUA 4PJ8C 3LKNA 5I71C 2JIXB 4S1QL 3A6BH 4G8FA 3DTXA 4U6XB 4C55A 1UB6A 5K59F 3JWNC 1D6EB 3T77B 1CLZH 3V4UH 1T1ZA 4QY8A 2ICES 3TH3T 4M02A 1OAQH 4IM8A 3HMWH 4KMLB 2Z92B 4P57B 4D3CL 2MKLC 3FHQA 3UYOD 4JE4B 2XN9E 1NGXA 1HI6B 3B8SA 1ES0A 1K9TA 4RISH 2AK1H 2D4DA 2IALB 1ZMYA 4XZUA 4RGMC 1JGDB 1F00I 4KJPD 2HT3C 3BZFB 4TRPH 1S7UB 1J7VR 3C8HA 4CVUA 5CCKH 1W72L 3QJHA 3D3VB 3IDMB 3VGDA 1A4JB 4LLQA 4N90D 4PJ5B 1IC7H 1ZHBB 3WCYA 3J8F7 1LEKB 4QRUA 3WKMH 3OBAA 1RZ7H 3FOMA 4K3JL 1D5XB 1X6LA 3P11H 3PXJA 1T4KB 5CZXC 4K7FB 3T0DA 2EE9A 2Z31D 3ARBC 5IHUH 5EU7E 3ZO0A 3MJ6A 1BD2B 4F2MB 1W0YT 2Y9RT 1FH5H 2JB6B 4TUJA 1QBLH 1YECH 3BEVB 3QXAA 5FYKE 3TH4T 1E6JL 4L3ED 2YN5A 1FV1B 3CVIH 2HRLA 4TVPD 4APQB 5LVEA 1XF5A 5I66B 4QTIL 5LGJB 1QFHA 3PV6A 1XIWB 1YMHB 4Y2DB 4F7TA 3QIUD 1NMCB 2BOCA 3C6LB 5BQ7A 3VW3L 3EYQC 5HHNB 5IESH 1U3HC 2YA1A 3N9GL 5JPMB 2AQ1A 2DM2A 1HOCB 4OFIA 3TO2A 4I9WD 4QO1A 4ZS7H 4GXUN 4NRZB 4N1CA 2AI0H 4GBXC 5BVJB 4U1LA 5L2JB 4P2OB 1OHQA 5SWSA 3V6FB 5E9DE 5AZ2H 2OYPA 1NBQA 1YEKH 3OJ2C 3LPGA 4M48H 4PJXA 4XB8A 5D7KD 4ODVL 4F7CA 1KCKA 4I5BB 3JWOC 4ESKA 1FYTA 3BOVA 3PWLB 3QHFL 1S7TA 2DLFL 4HHAA 4XBGB 3DOSA 1WGOA 1VFUA 4P2RA 4PRIB 4UDUA 4MAYD 3SKJL 1CE1H 4JVWA 1WZLA 4GLRI 1RK1B 4P5KB 3N85H 4JEGB 5EOCJ 4FZ8L 5HDLA 4MNGA 1G7HB 4GRLB 4NKQB 3F5WA 4LLVB 3QXUA 4GAJH 3BZDA 2PNDA 4ZPVB 3ULVE 2DI7A 1I1YB 2PO6C 5EU3A 2ZUXA 4EUPG 3O3BB 3QZWA 4OIIH 1EMTH 3IGAB 4MJ2A 4NRXA 2DWEB 4TSAH 1CBVL 3F62A 1FLRL 1PBYA 1EVUA 4F33A 3CSGA 1P4BH 3CAFA 4RBPK 2N4IA 5BVPH 3G5VA 5DI8B 2BC4A 3C6SB 3MPCA 2KDGA 2YPKB 5C9KA 1B0GA 1ZANH 2G5RA 4YHIA 1XF2A 4KJWC 3WBDA 3MYJB 3OR6B 3VFWB 1FN4B 1A9EB 3BHBA 5DDHB 3QB7C 2GUOA 4LOUC 1F90H 4PJBE 1VADA 4HZAA 1SY6A 4NO5B 1RUML 3ORJA 1S8DB 4E41A 1DL7L 1EBAA 3MFFA 5D9SB 1WITA 4Z78B 4BZ1H 3VWKD 3MQIA 3G5XB 2AJYL 2X6MA 3V52L 2BSRB 4RMSA 3NMEA 3V6OA 2PUQT 4QTHB 2R0LL 4AENB 2JCCA 3GSNL 3UYRL 4Y5VC 4K7PY 1X5GA 3EJZC 1W0VA 5I30L 5ITBL 4FQLL 4POZD 2ZCLH 5D70H 1K3IA 4YDVA 3MO1A 1BQHB 4X83A 5J4MA 3QPQD 3NTCL 4HPYH 2O5XH 1MCPH 3OKEA 1JNHA 4X6DA 2E6JA 5D1XA 1DN0A 1R3KB 2FIRT 4X6EB 3NGBB 4DUWA 5EO0B 3NAAH 1H3XA 1NMAL 5JIHA 5I1IH 1R5VA 2VDLH 5IEKB 2VLKB 1TCRB 3MXVL 2FR4A 4OFPA 4HS6B 2BNRE 4YHMH 3QRGH 3C2AH 2DQCH 4AL8H 1PY4A 5FGCB 4H5SB 5HGAB 1BIIA 1J0YA 4O5LH 4KKNA 3U0TB 4DOHE 5KJRH 3RL2B 3P73A 4QRRB 4ZFZA 2VNCA 2CUHA 5BV7H 1CGSH 4OZGF 3RTQA 1U8HB 4LQ1A 3HHRB 43CAA 3R4DA 3JV4B 4M03A 2WBJB 1HXYA 3BH9B 4ELMB 5D1QB 3KYMB 1WK0A 2X1WL 1C08B 3ARFC 2YZ8A 1OSPH 2UY6A 4ZFOL 25C8L 1S7SB 4BK5A 1MCOH 1G6RL 1MJUL 3UJIL 1AI1H 3UTZA 2QQQA 3IXTA 1VEMA 2IGFH 1BHGA 5I1KH 2R29L 1DANU 5AEAA 2EDQA 4MMZC 2PCPA 5TJWK 3OAZK 3MUZ1 5JIIA 2FZ3A 5CEYB 4AMKH 4Z7OE 3BPNC 4G3YH 4XRCA 2E7LA 2YD6A 1J0KA 4MCYA 4P5MB 3I6KB 2LE9A 1P2CB 3M17A 4P49A 1GGUA 1CI5A 5ISZE 1I3VA 3VXUE 2J8HA 4IDJH 5EOCL 2DQJL 2DQGL 5D96B 3PQYB 1T7WA 3IAQA 1NBYB 4G9FD 4IRZH 4L9DA 1FORL 5DD3L 2BSSB 6FABL 3SGKC 1JPGA 1UZ8B 3SOBL 2JK5B 3GBLA 1S9VB 3LKSB 1U9KA 4ZD3L 4ZAKC 5DD6B 4M5YH 3SDAD 4D9LL 1VGEL 5AD0A 1FJ1B 3DJ9A 3KPRA 4AEHH 4LCWB 1MI5B 4IOSD 2BSTB 3FN3A 5I1JL 4PRHE 2W65B 5EG6C 1LMKA 4YFDB 1JGEA 2OTWB 5D7IA 3BP6B 1T80A 1G9NH 1T0NB 5I0ZA 4D0BA 3H7BA 5CILH 3GHEL 4PV9A 4Z95L 1PZ5B 2VLRE 5J8OA 2GT9B 1OP5K 4HAGA 5LKNA 2NY2D 3KVQA 3TBTB 5DVLA 1LO2H 1HINL 5TQ2H 2VL5A 4LIQE 3QBTB 1N4XH 2XN9D 1NC2B 3P0VL 3C60D 5DRWA 2D7NA 4JN2B 3K4ZA 4JJ5B 3FKUS 3JV6A 1RZIA 3SGEI 5CJXA 3RWIA 4GQ9L 2CIKB 3V0WH 5KSAC 2ADJB 3BJ91 4OD1H 1ZHNB 1AR2A 1Z9MA 3VFSA 2HJFA 1QNZL 1GJIA 5BOPA 3RZWA 3FONA 2EDJA 5E5MA 1CXFA 5L6YH 5DMKB 1KCUL 1IGTA 4FXKA 4ONFH 4W6XB 2KPNA 5CHNA 1DEDA 4O51B 4LVNC 3QEGH 5BS0E 1A6WL 3S96B 5IKCA 4PJ9B 3VXQB 5H8DA 5IFAL 3RY4A 3E3QC 1I7TA 5HHQB 4LKXA 2HJKB 3LDBB 2FJHA 5IVNA 3RWDB 3MROA 1RURH 4AIOA 1FVCA 2XPGB 4KPHH 1N6VA 3X3GH 4J4PA 4WWKB 5C07A 3GMQA 2IAMB 5FYKD 4NYLB 3SO5A 1L4IA 3O0RL 4Z7VB 4DVBB 4YXKL 4P23C 3QUMH 4X6BA 3KPLB 1LGVA 1YPZF 1R3IL 2NY6C 2GTWB 1OLZA 1WISA 3VH8G 4R0LC 1BFVH 1KTDA 2DD8H 4F15B 4LCCC 4H1LA 1I3GL 4XNXL 4BQ8A 1ZK9A 1AO7D 4NQSB 1C5CH 4AYFA 3GIVA 5JOPE 1V8HA 4QXGH 4FG6C 5E9DD 5C0FA 1CDJA 5E2WH 4I0CC 3GMRA 3WL9A 4XC1H 4Z7NE 4EXKA 2QADD 4JM2D 2A74A 4L8CB 1MAMH 3NIDF 4U3XA 3LKPA 4WO4C 1I9RH 4KI5E 1PEWA 4R97B 3RKDC 2VQTA 3ULUH 2ADFL 3QR2A 5GRXG 3JXAA 2BNQA 3A6CL 4EEEA 3BN9D 3LMJH 4H25B 4NDMB 4WHYG 2DAVA 1ZWIB 4G6ML 3QI9D 5KS9B 1MFBH 4M7LL 4NO3A 3D0LB 5DMGC 2MPAH 4NKOA 2X70B 2ZOKB 1N8ZB 3RWFB 4OJFH 3S4SB 4QHMB 4Q58C 4G80B 3TVMB 1VFAB 3I3BA 5J6GB 2FSEB 2ILLA 1KNOB 1HQRB 1FNEB 1JV5A 1QFUH 2BJML 1KENL 1RUKH 5GHWL 5E4EB 5HTSA 5EA0L 4NWTH 2IMNA 4ZDHB 5F6HI 1NC4B 4HXBL 4HKBB 1WT5A 3HRPA 5EULV 3TH2T 2W9DL 5HHOA 2PTVA 3MLXL 5DJXA 5CBEB 4QYOB 2OTPA 1ADQL 3LN5B 4QF1A 4WIQA 2UWEA 3RWCB 1KBGH 4OZ4A 5I8OL 3MLRH 2MWCA 2VSDA