4BG0A

Crystal structure of complement factors h and fhl-1 binding protein bbh06 or crasp-2 from borrelia burgdorferi
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
214
structure length
205
Chain Sequence
GRLNQRNINELKIFVEKAKYYSIKLDAIYNECTGAYNDIMTYSDQSKVNQAISIFKKDNKIVNKFKELEKIIEEYKPMFLSKLIDDFAIELDQAVDNARHVADSYKKLRKSVVLAYIESFDVISSKFVDSKFVEASKKFVNKAKEFVEENDLIALECIVKTIGDMVNDREINSRSRYNNFYKKEADFLGAAVELEGAYKAIKQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT REGULATOR-ACQUIRING SURFACE PROTEIN 2 (CRASP-2 (C
publication title Structural Characterization of Cspz, a Complement Regulator Factor H and Fhl-1 Binding Protein from Borrelia Burgdorferi.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Cell adhesion
total genus 88
structure length 205
sequence length 214
ec nomenclature
pdb deposition date 2013-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1640 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bg0A00
4BG0A 4CBEA
chains in the Genus database with same CATH superfamily
2YKZA 3SXYA 4A2NB 1I4YA 1ZW3A 1NG1A 2O9XA 4JCHA 2KJGA 2J0WA 2KNHA 1WTYA 2HJMA 2XLHA 1NFNA 2HSQA 3CSKA 1OCCC 4JJFA 4NCQA 4PFPA 4XPWA 4PJLA 1V55C 3A9CA 3K6BA 4AX2A 5BQGA 3QMKA 5CI9A 5BQHA 1V54C 4HE8D 1VK5A 1APCA 2A0BA 3FAPB 4LDQA 1B68A 1NLXA 2VCCA 3FHDA 3JSEO 5E2QA 2HKVA 1JR8A 2KYHA 1G5ZA 1PD1A 1ZHTA 1ZHWA 4LLCA 2LP4A 4XPYA 4P6IC 5JVEA 2AU5A 4WGZA 1YARO 5JSLA 4JVSA 2XLVA 5E3AA 1J8YF 1F1MA 4PFOA 1OW6A 2IXOA 4AL0A 2D4UA 4PJNA 5D92A 3QZCA 2GAQA 1VLSA 1W2WA 2AWYA 3DAFA 3KYJA 4JKVA 1MMDA 2HFIA 3BEHA 4MVSA 2IXMA 2L6FA 3SXZA 3TOLA 3NYJA 2NG1A 4Z9JA 5HV9A 4L6RA 2DYSC 3FOPA 4CS9C 2R7TA 4P9TA 3IQ5A 3RF3A 2HSBA 3DWWA 3QTHA 4LDKA 5L0JA 3B9QA 4C7OB 4Z9IA 2Q4FA 2QUPA 4Q7CA 3ZG1A 1HE1A 4WJ0A 3N24A 4RD9A 2VB6A 3S9OA 4C3DA 1NU9C 5BUOA 3JT1A 5A69A 2ZD9A 1NBBA 5F28E 3M1CB 3V5XA 3M15A 4BJTA 1OW8A 2KK1A 4CIPA 4QI2A 4DJ9A 5A6BA 3U2MA 1T01A 3JYYA 4CDYA 5K0IA 1AVOB 2IXPA 1YAUO 4MVUA 4EBKA 1CPRA 3EGDA 4MVOA 3GM1A 3ZDLA 2PX3A 5F5FA 1E86A 2OJED 1YVIA 1OR3A 1OKKA 1C02A 1O87A 2R7VA 1QVXA 1TFKB 2LQGA 2RSEB 3AQBA 3O6XA 2YRFA 3MYFA 3RW0A 2W45A 2M64A 2XL4A 3DXJF 3EGXB 5KYXB 4CSAC 3ECSA 4NY3A 4CDVA 3GWLA 4G78A 2OCCC 2XS8A 5JUAA 4KNWA 4XQ1A 3OWTA 2ZXPA 1YLMA 4JE9A 3C8ZA 5B3IA 2P7VA 1OCOC 4GYTA 3JRTA 2OQMA 5TJ5E 3W8IA 1JRAA 2E87A 2J9BA 3CEXA 3GORA 3SYNA 3TK0A 1I4ZA 4E7ZA 2YLDA 4JZAA 1D1CA 3K1HA 5AGFA 5DQTA 5KYWA 2A1DD 4GQHA 3AOUA 3F46A 5KYYB 1FAPB 2VH3A 3M4BA 3FAJA 2YVKA 4YJWA 3UR3C 4XEKA 2XLDA 2ZXRA 1BBHA 1V74B 2CCYA 2CW0F 1LI5A 3O39A 4P9FA 5D91A 3ZTZA 4BPMA 2L9JA 2CNWD 2XRHA 3JTLO 4ULVA 4JTDB 4F4BA 3B0UX 3L34A 4CS9A 1M2VA 1TWHA 4J32B 3AG1C 1YYXA 3DKAA 3Q6NA 1NSGB 1WWPA 4JEBA 2IYLD 1G4US 2X0CA 3W2WA 4UDVA 1RKEA 1M57C 3I5QA 4HFFB 4JIOA 4WABA 2QY9A 2EINC 1R4TA 1ZHXA 3AG2C 4EBJA 5BQIA 4I44A 3I4UA 1IZMA 2KW3C 2XLEA 2F22A 2YL0A 3B71A 4M63A 4EUKB 2OJQA 3OEOA 4E0HA 3GODA 2Q9BA 1D0XA 4B6IA 4LERA 1EQ1A 1LM3B 1Z3IX 4JRZA 2ASRA 2Q00A 4DOZA 4EWCA 2J8WA 5KYNA 3EHMA 2A6EF 3O10A 3QVZA 2WVQA 3RFYA 4K1OA 2J9VA 2J9WA 5A6BD 3UGOA 1ZW2A 3DE9A 4D4NA 5DS6A 1UG7A 5L3VA 2NUPA 1A7VA 1K40A 4ZLCA 4YL1A 3LNMB 4OINF 3GEIA 1YA9A 2C03A 3FDQA 3LEOA 4YT2A 5AC5A 5E33A 1OKKD 2EPLX 5CIVA 1UFBA 3EGDB 4QDLA 3ASOC 1G8XA 1EI7A 3KPHA 2HJ3A 4O79A 3SXKA 1RXQA 4KI2A 1O3UA 1TFOB 3WODF 3MLGA 2D5RB 3MYIA 4BJ1A 5EGYA 1T6UA 1U0BB 5DLJA 2L6HA 5IY5C 1A7DA 2HS5A 3C62A 3FOOA 5A6JA 2OKUA 3C8GA 2H7BA 3LAYA 2Y39A 2Y3HA 2GA0A 3HTKC 2HUJA 3NKDA 3L8IA 1BR1A 3VM6A 1ZYRF 1N1CA 4YT8A 4XLPF 4E7SA 3T6GB 1YDIA 4U5HA 3PCVA 3DJNB 4CBEA 1YA7O 3S27A 3LS1A 4Q4ZF 3E70C 3MFNA 5T1DB 1T9KA 3V5YA 2YL1A 4NC3A 3RH3A 1FR0A 2HZ8A 5KYWB 3H65A 3VAYA 3IQTA 3X2QC 4MVMA 1CGOA 2OU6A 2R7SA 1JMWA 4OD5A 3LEVA 4O6MA 4CX9A 1M56C 4U5DE 1J8MF 2L6GA 3IPMO 3NYLA 4DXWA 3NDBB 1D1AA 2CDQA 1M6TA 4NTAA 3SP1A 5E3CA 1L7CA 3ABKC 2OOCA 2QTVA 3LLIA 4RDAA 5T3WA 4DBQA 4G0HA 5FCLA 2BE5F 3A11A 2AVKA 4N6HA 3W8HA 1LS4A 4OIPF 4J7TA 2XXAA 1LS1A 1M2VB 3AGTA 4QI0A 4AE4A 3M79A 3V7OA 3U8VA 4O6YA 2YEVA 3S29A 2LCHA 3W2VA 1WN0A 2JX0A 2NPUA 4XPXA 1NU7D 3JZ0A 4IRUA 2LIGA 3E9VA 1RKEB 2J7PD 2LFFA 4U5BE 4BJ6C 5L0IA 2DI3A 1AUEA 1WGWA 1YYJA 2VCAA 4E18A 2XL6A 1K04A 3DE8A 2FAPB 2PX0A 4O6NA 2B0HA 4MS2A 4CJOA 2PP4A 3R2PA 2CGEA 2H7VC 3T4RA 2EPOA 1EKYA 4IARA 4GEHA 4DRHB 1RCPA 1FMVA 1U89A 2BL2A 2NSGA 4KBLA 2P6VA 2VASA 2VC9A 3B0PA 3PHF2 4BJ5A 3DD7A 3AG4C 4H4KC 3T9OA 2MHRA 4YWQA 2IM8A 3HKKA 3JSZA 1ZU5A 1TWCA 3C63A 5GPGB 3CZ6A 2ICWG 2EILC 3NYMA 3ZSUA 4CJGA 3RVYA 1DOVA 1MMNA 2NUPB 5B3SC 3L8JA 4O7GA 4JURI 2DYRC 3MBGA 1ZHZA 4YL3A 2A68F 3ZQYA 2KGOA 3RKOF 5JLIA 3S84A 3KL4A 2RD9A 2WB7A 3SZRA 2GWWA 1Q0KA 1YZAA 4I3MA 1ZVZA 1RMVA 2GFHA 4OD4A 1VB5A 3RVZA 2MWQA 2W4MA 4KC9A 4CS7A 2B0JA 3DMDA 3CQZA 4BJ6A 3UMHA 2GDCA 3SNHA 3C8GD 3U0CA 2YLGA 2Y3DA 4N6CA 2ETSA 1LPEA 4NTFA 3NKEA 3IQCA 4MVZA 2NUTA 4D4XA 2EIKC 2ZXOA 3C8GB 3IQ6A 1A0BA 2XSEA 2KC3A 1Q0GA 3VYWA 4JJGA 2L7AA 4YL0A 1ORYA 1H9GA 5L0HA 5DVWA 1E84A 4IGGA 2HV7A 3N0TA 2PBEA 5JP7A 4EIYA 2XM0A 1Z5ZA 1OW7A 3U9MA 1HW1A 1ORSC 4KNVA 5L0CA 1S7ZA 4YK5A 3ITFA 3S0XA 3DJUB 4DVZA 4LLEA 4YT4A 2EIMC 1ZZPA 1O5HA 1MMGA 3L0IA 2AP3A 4DBRA 4U5EE 4JCZA 4U5GA 2Q7RA 3ZC4A 2R7XA 2UUIA 1A7EA 1Y4CA 1EA8A 1Q0MA 1Q0FA 2UUHA 3S90A 1TQGA 2J45A 5AC4A 3RIPA 1S05A 2XXAB 4IWBA 3EFOA 3TD7A 2XL8A 3NMIA 4LACB 2PNOA 2WZFA 1DOWA 4AE4B 3TQOA 2CYDA 2YLIA 4XTKA 4A4AA 1E83A 4PACA 2J9UA 4C7OA 1HMDA 1T5OA 1ZHYA 256BA 2YHSA 2Q9CA 4FX5A 4XLNF 3TJ6A 2EPMX 3NG1A 4ULWA 5A6AA 3K66A 2G62A 4FESA 3GEEA 5KYUA 4U9DA 4JW1A 1HE9A 1TR2A 4N06A 3U5SA 2LD6A 2OG2A 4C3BA 1LKXA 2YL7A 2V26A 4K7BA 1C03A 1SZIA 1L3PA 2XLWA 3EG9A 4DRJB 1VYKA 3LESA 4U5FE 2PF4E 3GWNA 1FFHA 5L0DA 3KH2A 1IW7F 3EZHA 2V3CC 1BR4A 5COFA 2XM4A 1VMAA 4OIOF 1GGQA 3QW0A 5KYYA 1PCXA 5KYXA 1XZQA 1OCZC 2R9RB 3IEEA 4MTFA 4BEJA 3Q7LA 4Z9HA 2YL3A 4MVRA 2WZGA 2VCBA 2Y3GA 3V5ZA 3LUTB 2A69F 2BC5A 1C17M 1KU2A 2WZLA 3U9JA 4JTCB 4W8KA 5L0GA 1CGNA 1XWJA 2TMVP 3BRJA 4IAQA 1BDJB 5JS5A 2H7OA 1Z6AA 4J30B 1RJ9A 3NMJA 4U5CE 2Y3BA 3GANA 4PJMA 4MTGA 2R02A 1NZEA 2NUTB 4BJ5C 3J06A 1QQ3A 2LSEA 3RQGA 3X1OA 4CS8C 1D1BA 2A6HF 1H9TA 4RBNA 1SR2A 2C04A 3K33A 4OIRF 3ABMC 2Z15A 3KYIA 3HNIA 4JTAB 3TOMA 4E0IA 5B1AC 3RYLA 2OEXA 4EBBA 3KMIA 3H2VA 3C18A 3I5PA 3G4ZA 3VF0A 1ST6A 4EHPA 2FFHA 3U8PA 2HMZA 3C7JA 5HSWA 3SXMA 3UMKA 1JOGA 3TULA 4OIQF 1YJGA 1Y6DA 3EHNA 2XLMA 3AGUA 4XEVA 2QLAA 3UMIA 4ER9A 4G7HF 1ZU4A 3M4CA 2IOQA 2CNWA 4YT5A 4U9EA 2R7UA 1VTMP 2WVNA 2G3KA 3HNJA 3FVYA 1SF8A 2R03A 3LLKA 4R32A 3S28A 1LVKA 4E17A 2R05A 3U3BA 2J0XA 3DI5A 2LK4A 3DM5A 3WAQA 4C3EA 3B29A 1JAFA 3HLZA 1R5ID 3EFOB 4PJJA 4ANJA 4CS8A 1Q0DA 2WVOA 2I15A 4FWVA 1TKNA 2Q9AA 2ZXWC 4DVYP 1YZCA 1A41A 1AEPA 1GS9A 3PMRA 2IBFA 2EPKX 4BG0A 2A0UA 5DS4A 3PDMP 1M2OA 3AG3C 3US6A 4IB4A 1HW2A 3EPVA 1PD0A 3NRHA 3ZIBA 3VRCA 1CGME 5KYUB 2XLOA 1H6GA 3KKBA 1VYIA 5L3QA 1K05A 1QSPA 4MQ9F 4PR9A 1OQCA 4MVQA 1E2XA 4LDRA 3Q7GA 4ZLDA 5EK0A 3SEOA 1GQAA 2P1AA 1LIHA 1RKCA 3EG9B 1XZPA 3RQEA 4W8PA 3TJ5A 3LS0A 3JCUQ 1Z7Qc 4I1MA 5JRAA 1U6HA 1FMWA 1MNDA 3ZWIA 4HEAJ 3AQCA 4J7YA 3JRMO 2J46A 5CI8A 4Q5SF 1KTMA 1MQVA 2H8AA 1Z63A 3L1MA 4YN0B 2P61A 1KNYA 2R7WA 4N4WA 1T6QA 1Z23A 4G7ZF 3K1IC 3CAXA 3ZTMA 4EKWA 5F5HA 4ONSA 1D0ZA 1HMOA 1QKRA 5COMA 2YQYA 3UGPA 2Q3TA 1WATA 4NTBA 2FGYA 2I8BA 1WOLA 3EH1A 3WHNA 3MX3A 3B0VC 1D0YA 4I1OB 2JPUA 3JYHA 3O55A 4MTOA 4MW8A 4PK4A 2R7QA 1OXKA 2M4EA 3ATPA 1FTSA 3ZVRA 1HY5A 5L0FA 3DAGA 1LE2A 1RJ9B 2DGJA 1WASA 2PFDA 5EHHA 3T6JA 4K0DA 3HJCA 3LNRA 3OA1A 2QE9A 1QPUA 2ZPAA 3QVYA 1FFTC 3GM2A 3EH2A 4HFKB 1OXBA 4XWJA 5FZTA 2NSFA 3AJMA 3U2LA 5DQZA 5DS5A 4H54A 3R7CA 4DRIB 4X0RA 3POVA 1V4AA 2R25A 1CPQA 3HNLA 3W4YA 2R7RA 2W9YA 1TWGA 3ABLC 2EIJC 5COGA 4CSAA 4JEAA 4CIHA 3K1IA 4MW3A 2W4BA 3G4XA 3IHUA 2L81A 1PV3A 3UNGC 3DM9B 3EJNA 3RQFA 2WL8A 2G3VA 3ASNC 3ZQVA 2AWCA 2JD3A 1G4WR 3GM3A 1OR2A 3FXHA 4IJJA 2XS1A 3U3FA 1E85A 1FNTc 5JT4A 4AL1A 2IXNA 3G50A 1GM5A 1MNEA 2EPNA 3EQLF 3QW1A 4XEFA 1OCRC 2J7PA 1BZ4A 1MMAA 5A6KA 2KSFA 2P0NA 4IAOA 4G7OF 1QZXA 1T6IA 3K7DA 2QNLA 3Q6MA 2LFDA 2Y69C 2YZSA 3LJBA 3DZAA 2HV6A 1QLEC 4AK9A 1I5NA 3EGXA 1VLTA 2YWAA 4JC7A 3WG7C 1LI7A 1NFOA 1ORJA 1VOMA 3NMKA 2MYSA 3T6BA 1BR2A 5B1BC 3F47A 2KQ9A 4MNDA 4NQFA 4WGYA 1SYQA 2OEVA 1JPNA 1TWAA 3HNKA 4BEMJ 1JPJA 3GEHA 4CDAA 1H7IA 5T3TA 1LE4A 2R7OA 1SMYF 2X51A 4FAPB 2DB4A 3FMSA 3N2ZB 3EZIA 2HMQA 3H2UA
chains in the Genus database with same CATH topology
4A2NB 2O9XA 1NG1A 4JCHA 2KJGA 2J0WA 2KNHA 3CSKA 4JJFA 1OCCC 4AX2A 4PFPA 4PJLA 1V55C 3K6BA 3QMKA 5CI9A 1V54C 4HE8D 1VK5A 3FHDA 5E2QA 1PD1A 1ZHTA 1ZHWA 4LLCA 4P6IC 4JVSA 5E3AA 1J8YF 4PFOA 2IXOA 4PJNA 5D92A 3QZCA 1W2WA 3DAFA 1MMDA 2IXMA 3NYJA 2NG1A 2DYSC 2R7TA 3B9QA 4C7OB 4Q7CA 3ZG1A 4WJ0A 3N24A 4RD9A 2VB6A 4C3DA 1NU9C 5BUOA 3JT1A 3M1CB 4BJTA 4QI2A 2IXPA 3EGDA 2PX3A 5F5FA 1OKKA 1O87A 2R7VA 3O6XA 3AQBA 2W45A 2XL4A 3DXJF 3EGXB 4CSAC 5KYXB 3ECSA 4NY3A 2OCCC 4KNWA 3OWTA 2ZXPA 2P7VA 1OCOC 4GYTA 3JRTA 3W8IA 2E87A 3SYNA 4E7ZA 4JZAA 1D1CA 3K1HA 5KYWA 5DQTA 2A1DD 3F46A 5KYYB 2VH3A 3FAJA 4YJWA 3UR3C 2ZXRA 3O39A 2CW0F 5D91A 2L9JA 2CNWD 2XRHA 4F4BA 3B0UX 3L34A 4CS9A 1M2VA 1TWHA 4J32B 3AG1C 3Q6NA 2IYLD 3W2WA 1M57C 3I5QA 4HFFB 3AG2C 2QY9A 2EINC 1ZHXA 4I44A 3I4UA 1IZMA 2KW3C 4M63A 3OEOA 3GODA 2Q9BA 1D0XA 4B6IA 4LERA 1Z3IX 4DOZA 4EWCA 5KYNA 3EHMA 2A6EF 2WVQA 3RFYA 3UGOA 2J9VA 2J9WA 5DS6A 5L3VA 2NUPA 4ZLCA 4OINF 2C03A 3FDQA 4YT2A 5E33A 1OKKD 3EGDB 4QDLA 3ASOC 1G8XA 4O79A 4KI2A 3WODF 3MLGA 2D5RB 5EGYA 4BJ1A 5DLJA 5IY5C 3LAYA 2H7BA 2Y39A 2Y3HA 3HTKC 3NKDA 1BR1A 1ZYRF 1N1CA 4YT8A 4XLPF 4E7SA 4U5HA 3DJNB 4CBEA 4Q4ZF 3S27A 3LS1A 3E70C 5T1DB 3RH3A 5KYWB 3H65A 3VAYA 3X2QC 2R7SA 4OD5A 3LEVA 4O6MA 1M56C 4U5DE 1J8MF 3NDBB 1D1AA 2CDQA 3SP1A 5E3CA 3ABKC 4RDAA 2QTVA 3LLIA 5T3WA 4DBQA 4G0HA 5FCLA 2BE5F 3W8HA 2XXAA 4OIPF 1LS1A 1M2VB 4QI0A 4AE4A 3V7OA 4O6YA 2YEVA 3S29A 3W2VA 1NU7D 4IRUA 3E9VA 4U5BE 2J7PD 4BJ6C 1WGWA 2PX0A 4O6NA 2PP4A 2CGEA 2H7VC 3T4RA 4GEHA 1FMVA 4KBLA 2P6VA 2VASA 3B0PA 3PHF2 4BJ5A 3DD7A 3AG4C 4H4KC 4YWQA 3JSZA 1ZU5A 1TWCA 3CZ6A 2EILC 3NYMA 3ZSUA 5B3SC 1MMNA 2NUPB 4CS9C 4O7GA 4JURI 2DYRC 2R7UA 1ZHZA 2A68F 2KGOA 3RKOF 3KL4A 2WB7A 3SZRA 4I3MA 2GFHA 4OD4A 2MWQA 2W4MA 4KC9A 4CS7A 3CQZA 2B0JA 3DMDA 4BJ6A 3UMHA 3SNHA 2Y3DA 3NKEA 2NUTA 2EIKC 2ZXOA 2XSEA 3VYWA 4JJGA 5DVWA 2HV7A 3N0TA 1Z5ZA 4KNVA 3S0XA 1S7ZA 3ITFA 3DJUB 4DVZA 4LLEA 4YT4A 2EIMC 1O5HA 1MMGA 3L0IA 4DBRA 4U5EE 4U5GA 3ZC4A 2R7XA 2J45A 3RIPA 2XXAB 4IWBA 3EFOA 3TD7A 4LACB 2WZFA 4AE4B 4XTKA 4C7OA 2J9UA 4FX5A 1ZHYA 2YHSA 2Q9CA 4XLNF 3NG1A 4ULWA 3K66A 2G62A 4FESA 5KYUA 4JW1A 1TR2A 4N06A 2OG2A 1LKXA 4K7BA 2V26A 1SZIA 3EG9A 1VYKA 3LESA 4U5FE 2PF4E 1FFHA 3KH2A 1IW7F 3EZHA 2V3CC 1BR4A 1VMAA 4OIOF 1PCXA 5KYXA 3IEEA 1OCZC 4BEJA 3Q7LA 2WZGA 2Y3GA 2A69F 1KU2A 2WZLA 4W8KA 2H7OA 1Z6AA 4J30B 1RJ9A 4U5CE 2Y3BA 3GANA 4PJMA 1NZEA 2NUTB 4BJ5C 2LSEA 3X1OA 4CS8C 1D1BA 2A6HF 4RBNA 4C3BA 2C04A 3K33A 4OIRF 3ABMC 2Z15A 5KYYA 5B1AC 3RYLA 4EBBA 3KMIA 3I5PA 1ST6A 2FFHA 5HSWA 3UMKA 4OIQF 3EHNA 3UMIA 4G7HF 1ZU4A 2IOQA 2CNWA 4YT5A 2WVNA 2G3KA 3FVYA 1SF8A 3LLKA 3S28A 1LVKA 2J0XA 3DM5A 4C3EA 3HLZA 3EFOB 4PJJA 4ANJA 4CS8A 2WVOA 4FWVA 4DVYP 1TKNA 2Q9AA 2ZXWC 3PMRA 4BG0A 5DS4A 1M2OA 3AG3C 3EPVA 1PD0A 3NRHA 3ZIBA 5KYUB 3KKBA 5L3QA 1VYIA 4MQ9F 3Q7GA 4ZLDA 3SEOA 3EG9B 3LS0A 3JCUQ 4I1MA 1FMWA 1MNDA 4HEAJ 3AQCA 5CI8A 4Q5SF 2J46A 1Z63A 4YN0B 2R7WA 1Z23A 4G7ZF 3K1IC 5F5HA 1D0ZA 3UGPA 2Q3TA 2FGYA 2I8BA 3EH1A 3B0VC 3MX3A 1D0YA 4I1OB 3JYHA 4PK4A 2R7QA 2M4EA 1FTSA 3ZVRA 3DAGA 1RJ9B 2DGJA 2PFDA 5EHHA 3T6JA 4K0DA 3HJCA 3LNRA 3OA1A 2ZPAA 4XWJA 1FFTC 3EH2A 4HFKB 5DQZA 5DS5A 4X0RA 3POVA 2R7RA 2W9YA 1TWGA 3ABLC 2EIJC 4CSAA 4CIHA 2W4BA 2L81A 3UNGC 3DM9B 3EJNA 2WL8A 2G3VA 3ASNC 2JD3A 4IJJA 2IXNA 1MNEA 3EQLF 1OCRC 2J7PA 1MMAA 4IAOA 4G7OF 1QZXA 3K7DA 3Q6MA 2Y69C 2YZSA 3LJBA 3DZAA 2HV6A 1QLEC 4AK9A 3EGXA 3WG7C 1VOMA 3T6BA 2MYSA 1BR2A 5B1BC 3F47A 2KQ9A 4MNDA 1JPNA 1TWAA 1JPJA 5T3TA 2X51A 2R7OA 1SMYF 3NYLA 3N2ZB 3EZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BG0 A;  4CBE A; 
#chains in the Genus database with same CATH topology
 2YKZ A;  3SXY A;  4A2N B;  1I4Y A;  1ZW3 A;  1NG1 A;  2O9X A;  4JCH A;  2KJG A;  2J0W A;  2KNH A;  1WTY A;  2HJM A;  2XLH A;  1NFN A;  2HSQ A;  3CSK A;  1OCC C;  4JJF A;  4NCQ A;  4PFP A;  4XPW A;  4PJL A;  1V55 C;  3A9C A;  3K6B A;  4AX2 A;  5BQG A;  3QMK A;  5CI9 A;  5BQH A;  1V54 C;  4HE8 D;  1VK5 A;  1APC A;  2A0B A;  3FAP B;  4LDQ A;  1B68 A;  1NLX A;  2VCC A;  3FHD A;  3JSE O;  5E2Q A;  2HKV A;  1JR8 A;  2KYH A;  1G5Z A;  1PD1 A;  1ZHT A;  1ZHW A;  4LLC A;  2LP4 A;  4XPY A;  4P6I C;  5JVE A;  2AU5 A;  4WGZ A;  1YAR O;  5JSL A;  4JVS A;  2XLV A;  5E3A A;  1J8Y F;  1F1M A;  4PFO A;  1OW6 A;  2IXO A;  4AL0 A;  2D4U A;  4PJN A;  5D92 A;  3QZC A;  2GAQ A;  1VLS A;  1W2W A;  2AWY A;  3DAF A;  3KYJ A;  4JKV A;  1MMD A;  2HFI A;  3BEH A;  4MVS A;  2IXM A;  2L6F A;  3SXZ A;  3TOL A;  3NYJ A;  2NG1 A;  4Z9J A;  5HV9 A;  4L6R A;  2DYS C;  3FOP A;  4CS9 C;  2R7T A;  4P9T A;  3IQ5 A;  3RF3 A;  2HSB A;  3DWW A;  3QTH A;  4LDK A;  5L0J A;  3B9Q A;  4C7O B;  4Z9I A;  2Q4F A;  2QUP A;  4Q7C A;  3ZG1 A;  1HE1 A;  4WJ0 A;  3N24 A;  4RD9 A;  2VB6 A;  3S9O A;  4C3D A;  1NU9 C;  5BUO A;  3JT1 A;  5A69 A;  2ZD9 A;  1NBB A;  5F28 E;  3M1C B;  3V5X A;  3M15 A;  4BJT A;  1OW8 A;  2KK1 A;  4CIP A;  4QI2 A;  4DJ9 A;  5A6B A;  3U2M A;  1T01 A;  3JYY A;  4CDY A;  5K0I A;  1AVO B;  2IXP A;  1YAU O;  4MVU A;  4EBK A;  1CPR A;  3EGD A;  4MVO A;  3GM1 A;  3ZDL A;  2PX3 A;  5F5F A;  1E86 A;  2OJE D;  1YVI A;  1OR3 A;  1OKK A;  1C02 A;  1O87 A;  2R7V A;  1QVX A;  1TFK B;  2LQG A;  2RSE B;  3AQB A;  3O6X A;  2YRF A;  3MYF A;  3RW0 A;  2W45 A;  2M64 A;  2XL4 A;  3DXJ F;  3EGX B;  5KYX B;  4CSA C;  3ECS A;  4NY3 A;  4CDV A;  3GWL A;  4G78 A;  2OCC C;  2XS8 A;  5JUA A;  4KNW A;  4XQ1 A;  3OWT A;  2ZXP A;  1YLM A;  4JE9 A;  3C8Z A;  5B3I A;  2P7V A;  1OCO C;  4GYT A;  3JRT A;  2OQM A;  5TJ5 E;  3W8I A;  1JRA A;  2E87 A;  2J9B A;  3CEX A;  3GOR A;  3SYN A;  3TK0 A;  1I4Z A;  4E7Z A;  2YLD A;  4JZA A;  1D1C A;  3K1H A;  5AGF A;  5DQT A;  5KYW A;  2A1D D;  4GQH A;  3AOU A;  3F46 A;  5KYY B;  1FAP B;  2VH3 A;  3M4B A;  3FAJ A;  2YVK A;  4YJW A;  3UR3 C;  4XEK A;  2XLD A;  2ZXR A;  1BBH A;  1V74 B;  2CCY A;  2CW0 F;  1LI5 A;  3O39 A;  4P9F A;  5D91 A;  3ZTZ A;  4BPM A;  2L9J A;  2CNW D;  2XRH A;  3JTL O;  4ULV A;  4JTD B;  4F4B A;  3B0U X;  3L34 A;  4CS9 A;  1M2V A;  1TWH A;  4J32 B;  3AG1 C;  1YYX A;  3DKA A;  3Q6N A;  1NSG B;  1WWP A;  4JEB A;  2IYL D;  1G4U S;  2X0C A;  3W2W A;  4UDV A;  1RKE A;  1M57 C;  3I5Q A;  4HFF B;  4JIO A;  4WAB A;  2QY9 A;  2EIN C;  1R4T A;  1ZHX A;  3AG2 C;  4EBJ A;  5BQI A;  4I44 A;  3I4U A;  1IZM A;  2KW3 C;  2XLE A;  2F22 A;  2YL0 A;  3B71 A;  4M63 A;  4EUK B;  2OJQ A;  3OEO A;  4E0H A;  3GOD A;  2Q9B A;  1D0X A;  4B6I A;  4LER A;  1EQ1 A;  1LM3 B;  1Z3I X;  4JRZ A;  2ASR A;  2Q00 A;  4DOZ A;  4EWC A;  2J8W A;  5KYN A;  3EHM A;  2A6E F;  3O10 A;  3QVZ A;  2WVQ A;  3RFY A;  4K1O A;  2J9V A;  2J9W A;  5A6B D;  3UGO A;  1ZW2 A;  3DE9 A;  4D4N A;  5DS6 A;  1UG7 A;  5L3V A;  2NUP A;  1A7V A;  1K40 A;  4ZLC A;  4YL1 A;  3LNM B;  4OIN F;  3GEI A;  1YA9 A;  2C03 A;  3FDQ A;  3LEO A;  4YT2 A;  5AC5 A;  5E33 A;  1OKK D;  2EPL X;  5CIV A;  1UFB A;  3EGD B;  4QDL A;  3ASO C;  1G8X A;  1EI7 A;  3KPH A;  2HJ3 A;  4O79 A;  3SXK A;  1RXQ A;  4KI2 A;  1O3U A;  1TFO B;  3WOD F;  3MLG A;  2D5R B;  3MYI A;  4BJ1 A;  5EGY A;  1T6U A;  1U0B B;  5DLJ A;  2L6H A;  5IY5 C;  1A7D A;  2HS5 A;  3C62 A;  3FOO A;  5A6J A;  2OKU A;  3C8G A;  2H7B A;  3LAY A;  2Y39 A;  2Y3H A;  2GA0 A;  3HTK C;  2HUJ A;  3NKD A;  3L8I A;  1BR1 A;  3VM6 A;  1ZYR F;  1N1C A;  4YT8 A;  4XLP F;  4E7S A;  3T6G B;  1YDI A;  4U5H A;  3PCV A;  3DJN B;  4CBE A;  1YA7 O;  3S27 A;  3LS1 A;  4Q4Z F;  3E70 C;  3MFN A;  5T1D B;  1T9K A;  3V5Y A;  2YL1 A;  4NC3 A;  3RH3 A;  1FR0 A;  2HZ8 A;  5KYW B;  3H65 A;  3VAY A;  3IQT A;  3X2Q C;  4MVM A;  1CGO A;  2OU6 A;  2R7S A;  1JMW A;  4OD5 A;  3LEV A;  4O6M A;  4CX9 A;  1M56 C;  4U5D E;  1J8M F;  2L6G A;  3IPM O;  3NYL A;  4DXW A;  3NDB B;  1D1A A;  2CDQ A;  1M6T A;  4NTA A;  3SP1 A;  5E3C A;  1L7C A;  3ABK C;  2OOC A;  2QTV A;  3LLI A;  4RDA A;  5T3W A;  4DBQ A;  4G0H A;  5FCL A;  2BE5 F;  3A11 A;  2AVK A;  4N6H A;  3W8H A;  1LS4 A;  4OIP F;  4J7T A;  2XXA A;  1LS1 A;  1M2V B;  3AGT A;  4QI0 A;  4AE4 A;  3M79 A;  3V7O A;  3U8V A;  4O6Y A;  2YEV A;  3S29 A;  2LCH A;  3W2V A;  1WN0 A;  2JX0 A;  2NPU A;  4XPX A;  1NU7 D;  3JZ0 A;  4IRU A;  2LIG A;  3E9V A;  1RKE B;  2J7P D;  2LFF A;  4U5B E;  4BJ6 C;  5L0I A;  2DI3 A;  1AUE A;  1WGW A;  1YYJ A;  2VCA A;  4E18 A;  2XL6 A;  1K04 A;  3DE8 A;  2FAP B;  2PX0 A;  4O6N A;  2B0H A;  4MS2 A;  4CJO A;  2PP4 A;  3R2P A;  2CGE A;  2H7V C;  3T4R A;  2EPO A;  1EKY A;  4IAR A;  4GEH A;  4DRH B;  1RCP A;  1FMV A;  1U89 A;  2BL2 A;  2NSG A;  4KBL A;  2P6V A;  2VAS A;  2VC9 A;  3B0P A;  3PHF 2;  4BJ5 A;  3DD7 A;  3AG4 C;  4H4K C;  3T9O A;  2MHR A;  4YWQ A;  2IM8 A;  3HKK A;  3JSZ A;  1ZU5 A;  1TWC A;  3C63 A;  5GPG B;  3CZ6 A;  2ICW G;  2EIL C;  3NYM A;  3ZSU A;  4CJG A;  3RVY A;  1DOV A;  1MMN A;  2NUP B;  5B3S C;  3L8J A;  4O7G A;  4JUR I;  2DYR C;  3MBG A;  1ZHZ A;  4YL3 A;  2A68 F;  3ZQY A;  2KGO A;  3RKO F;  5JLI A;  3S84 A;  3KL4 A;  2RD9 A;  2WB7 A;  3SZR A;  2GWW A;  1Q0K A;  1YZA A;  4I3M A;  1ZVZ A;  1RMV A;  2GFH A;  4OD4 A;  1VB5 A;  3RVZ A;  2MWQ A;  2W4M A;  4KC9 A;  4CS7 A;  2B0J A;  3DMD A;  3CQZ A;  4BJ6 A;  3UMH A;  2GDC A;  3SNH A;  3C8G D;  3U0C A;  2YLG A;  2Y3D A;  4N6C A;  2ETS A;  1LPE A;  4NTF A;  3NKE A;  3IQC A;  4MVZ A;  2NUT A;  4D4X A;  2EIK C;  2ZXO A;  3C8G B;  3IQ6 A;  1A0B A;  2XSE A;  2KC3 A;  1Q0G A;  3VYW A;  4JJG A;  2L7A A;  4YL0 A;  1ORY A;  1H9G A;  5L0H A;  5DVW A;  1E84 A;  4IGG A;  2HV7 A;  3N0T A;  2PBE A;  5JP7 A;  4EIY A;  2XM0 A;  1Z5Z A;  1OW7 A;  3U9M A;  1HW1 A;  1ORS C;  4KNV A;  5L0C A;  1S7Z A;  4YK5 A;  3ITF A;  3S0X A;  3DJU B;  4DVZ A;  4LLE A;  4YT4 A;  2EIM C;  1ZZP A;  1O5H A;  1MMG A;  3L0I A;  2AP3 A;  4DBR A;  4U5E E;  4JCZ A;  4U5G A;  2Q7R A;  3ZC4 A;  2R7X A;  2UUI A;  1A7E A;  1Y4C A;  1EA8 A;  1Q0M A;  1Q0F A;  2UUH A;  3S90 A;  1TQG A;  2J45 A;  5AC4 A;  3RIP A;  1S05 A;  2XXA B;  4IWB A;  3EFO A;  3TD7 A;  2XL8 A;  3NMI A;  4LAC B;  2PNO A;  2WZF A;  1DOW A;  4AE4 B;  3TQO A;  2CYD A;  2YLI A;  4XTK A;  4A4A A;  1E83 A;  4PAC A;  2J9U A;  4C7O A;  1HMD A;  1T5O A;  1ZHY A;  256B A;  2YHS A;  2Q9C A;  4FX5 A;  4XLN F;  3TJ6 A;  2EPM X;  3NG1 A;  4ULW A;  5A6A A;  3K66 A;  2G62 A;  4FES A;  3GEE A;  5KYU A;  4U9D A;  4JW1 A;  1HE9 A;  1TR2 A;  4N06 A;  3U5S A;  2LD6 A;  2OG2 A;  4C3B A;  1LKX A;  2YL7 A;  2V26 A;  4K7B A;  1C03 A;  1SZI A;  1L3P A;  2XLW A;  3EG9 A;  4DRJ B;  1VYK A;  3LES A;  4U5F E;  2PF4 E;  3GWN A;  1FFH A;  5L0D A;  3KH2 A;  1IW7 F;  3EZH A;  2V3C C;  1BR4 A;  5COF A;  2XM4 A;  1VMA A;  4OIO F;  1GGQ A;  3QW0 A;  5KYY A;  1PCX A;  5KYX A;  1XZQ A;  1OCZ C;  2R9R B;  3IEE A;  4MTF A;  4BEJ A;  3Q7L A;  4Z9H A;  2YL3 A;  4MVR A;  2WZG A;  2VCB A;  2Y3G A;  3V5Z A;  3LUT B;  2A69 F;  2BC5 A;  1C17 M;  1KU2 A;  2WZL A;  3U9J A;  4JTC B;  4W8K A;  5L0G A;  1CGN A;  1XWJ A;  2TMV P;  3BRJ A;  4IAQ A;  1BDJ B;  5JS5 A;  2H7O A;  1Z6A A;  4J30 B;  1RJ9 A;  3NMJ A;  4U5C E;  2Y3B A;  3GAN A;  4PJM A;  4MTG A;  2R02 A;  1NZE A;  2NUT B;  4BJ5 C;  3J06 A;  1QQ3 A;  2LSE A;  3RQG A;  3X1O A;  4CS8 C;  1D1B A;  2A6H F;  1H9T A;  4RBN A;  1SR2 A;  2C04 A;  3K33 A;  4OIR F;  3ABM C;  2Z15 A;  3KYI A;  3HNI A;  4JTA B;  3TOM A;  4E0I A;  5B1A C;  3RYL A;  2OEX A;  4EBB A;  3KMI A;  3H2V A;  3C18 A;  3I5P A;  3G4Z A;  3VF0 A;  1ST6 A;  4EHP A;  2FFH A;  3U8P A;  2HMZ A;  3C7J A;  5HSW A;  3SXM A;  3UMK A;  1JOG A;  3TUL A;  4OIQ F;  1YJG A;  1Y6D A;  3EHN A;  2XLM A;  3AGU A;  4XEV A;  2QLA A;  3UMI A;  4ER9 A;  4G7H F;  1ZU4 A;  3M4C A;  2IOQ A;  2CNW A;  4YT5 A;  4U9E A;  2R7U A;  1VTM P;  2WVN A;  2G3K A;  3HNJ A;  3FVY A;  1SF8 A;  2R03 A;  3LLK A;  4R32 A;  3S28 A;  1LVK A;  4E17 A;  2R05 A;  3U3B A;  2J0X A;  3DI5 A;  2LK4 A;  3DM5 A;  3WAQ A;  4C3E A;  3B29 A;  1JAF A;  3HLZ A;  1R5I D;  3EFO B;  4PJJ A;  4ANJ A;  4CS8 A;  1Q0D A;  2WVO A;  2I15 A;  4FWV A;  1TKN A;  2Q9A A;  2ZXW C;  4DVY P;  1YZC A;  1A41 A;  1AEP A;  1GS9 A;  3PMR A;  2IBF A;  2EPK X;  4BG0 A;  2A0U A;  5DS4 A;  3PDM P;  1M2O A;  3AG3 C;  3US6 A;  4IB4 A;  1HW2 A;  3EPV A;  1PD0 A;  3NRH A;  3ZIB A;  3VRC A;  1CGM E;  5KYU B;  2XLO A;  1H6G A;  3KKB A;  1VYI A;  5L3Q A;  1K05 A;  1QSP A;  4MQ9 F;  4PR9 A;  1OQC A;  4MVQ A;  1E2X A;  4LDR A;  3Q7G A;  4ZLD A;  5EK0 A;  3SEO A;  1GQA A;  2P1A A;  1LIH A;  1RKC A;  3EG9 B;  1XZP A;  3RQE A;  4W8P A;  3TJ5 A;  3LS0 A;  3JCU Q;  1Z7Q c;  4I1M A;  5JRA A;  1U6H A;  1FMW A;  1MND A;  3ZWI A;  4HEA J;  3AQC A;  4J7Y A;  3JRM O;  2J46 A;  5CI8 A;  4Q5S F;  1KTM A;  1MQV A;  2H8A A;  1Z63 A;  3L1M A;  4YN0 B;  2P61 A;  1KNY A;  2R7W A;  4N4W A;  1T6Q A;  1Z23 A;  4G7Z F;  3K1I C;  3CAX A;  3ZTM A;  4EKW A;  5F5H A;  4ONS A;  1D0Z A;  1HMO A;  1QKR A;  5COM A;  2YQY A;  3UGP A;  2Q3T A;  1WAT A;  4NTB A;  2FGY A;  2I8B A;  1WOL A;  3EH1 A;  3WHN A;  3MX3 A;  3B0V C;  1D0Y A;  4I1O B;  2JPU A;  3JYH A;  3O55 A;  4MTO A;  4MW8 A;  4PK4 A;  2R7Q A;  1OXK A;  2M4E A;  3ATP A;  1FTS A;  3ZVR A;  1HY5 A;  5L0F A;  3DAG A;  1LE2 A;  1RJ9 B;  2DGJ A;  1WAS A;  2PFD A;  5EHH A;  3T6J A;  4K0D A;  3HJC A;  3LNR A;  3OA1 A;  2QE9 A;  1QPU A;  2ZPA A;  3QVY A;  1FFT C;  3GM2 A;  3EH2 A;  4HFK B;  1OXB A;  4XWJ A;  5FZT A;  2NSF A;  3AJM A;  3U2L A;  5DQZ A;  5DS5 A;  4H54 A;  3R7C A;  4DRI B;  4X0R A;  3POV A;  1V4A A;  2R25 A;  1CPQ A;  3HNL A;  3W4Y A;  2R7R A;  2W9Y A;  1TWG A;  3ABL C;  2EIJ C;  5COG A;  4CSA A;  4JEA A;  4CIH A;  3K1I A;  4MW3 A;  2W4B A;  3G4X A;  3IHU A;  2L81 A;  1PV3 A;  3UNG C;  3DM9 B;  3EJN A;  3RQF A;  2WL8 A;  2G3V A;  3ASN C;  3ZQV A;  2AWC A;  2JD3 A;  1G4W R;  3GM3 A;  1OR2 A;  3FXH A;  4IJJ A;  2XS1 A;  3U3F A;  1E85 A;  1FNT c;  5JT4 A;  4AL1 A;  2IXN A;  3G50 A;  1GM5 A;  1MNE A;  2EPN A;  3EQL F;  3QW1 A;  4XEF A;  1OCR C;  2J7P A;  1BZ4 A;  1MMA A;  5A6K A;  2KSF A;  2P0N A;  4IAO A;  4G7O F;  1QZX A;  1T6I A;  3K7D A;  2QNL A;  3Q6M A;  2LFD A;  2Y69 C;  2YZS A;  3LJB A;  3DZA A;  2HV6 A;  1QLE C;  4AK9 A;  1I5N A;  3EGX A;  1VLT A;  2YWA A;  4JC7 A;  3WG7 C;  1LI7 A;  1NFO A;  1ORJ A;  1VOM A;  3NMK A;  2MYS A;  3T6B A;  1BR2 A;  5B1B C;  3F47 A;  2KQ9 A;  4MND A;  4NQF A;  4WGY A;  1SYQ A;  2OEV A;  1JPN A;  1TWA A;  3HNK A;  4BEM J;  1JPJ A;  3GEH A;  4CDA A;  1H7I A;  5T3T A;  1LE4 A;  2R7O A;  1SMY F;  2X51 A;  4FAP B;  2DB4 A;  3FMS A;  3N2Z B;  3EZI A;  2HMQ A;  3H2U A; 
#chains in the Genus database with same CATH homology
 4A2N B;  2O9X A;  1NG1 A;  4JCH A;  2KJG A;  2J0W A;  2KNH A;  3CSK A;  4JJF A;  1OCC C;  4AX2 A;  4PFP A;  4PJL A;  1V55 C;  3K6B A;  3QMK A;  5CI9 A;  1V54 C;  4HE8 D;  1VK5 A;  3FHD A;  5E2Q A;  1PD1 A;  1ZHT A;  1ZHW A;  4LLC A;  4P6I C;  4JVS A;  5E3A A;  1J8Y F;  4PFO A;  2IXO A;  4PJN A;  5D92 A;  3QZC A;  1W2W A;  3DAF A;  1MMD A;  2IXM A;  3NYJ A;  2NG1 A;  2DYS C;  2R7T A;  3B9Q A;  4C7O B;  4Q7C A;  3ZG1 A;  4WJ0 A;  3N24 A;  4RD9 A;  2VB6 A;  4C3D A;  1NU9 C;  5BUO A;  3JT1 A;  3M1C B;  4BJT A;  4QI2 A;  2IXP A;  3EGD A;  2PX3 A;  5F5F A;  1OKK A;  1O87 A;  2R7V A;  3O6X A;  3AQB A;  2W45 A;  2XL4 A;  3DXJ F;  3EGX B;  4CSA C;  5KYX B;  3ECS A;  4NY3 A;  2OCC C;  4KNW A;  3OWT A;  2ZXP A;  2P7V A;  1OCO C;  4GYT A;  3JRT A;  3W8I A;  2E87 A;  3SYN A;  4E7Z A;  4JZA A;  1D1C A;  3K1H A;  5KYW A;  5DQT A;  2A1D D;  3F46 A;  5KYY B;  2VH3 A;  3FAJ A;  4YJW A;  3UR3 C;  2ZXR A;  3O39 A;  2CW0 F;  5D91 A;  2L9J A;  2CNW D;  2XRH A;  4F4B A;  3B0U X;  3L34 A;  4CS9 A;  1M2V A;  1TWH A;  4J32 B;  3AG1 C;  3Q6N A;  2IYL D;  3W2W A;  1M57 C;  3I5Q A;  4HFF B;  3AG2 C;  2QY9 A;  2EIN C;  1ZHX A;  4I44 A;  3I4U A;  1IZM A;  2KW3 C;  4M63 A;  3OEO A;  3GOD A;  2Q9B A;  1D0X A;  4B6I A;  4LER A;  1Z3I X;  4DOZ A;  4EWC A;  5KYN A;  3EHM A;  2A6E F;  2WVQ A;  3RFY A;  3UGO A;  2J9V A;  2J9W A;  5DS6 A;  5L3V A;  2NUP A;  4ZLC A;  4OIN F;  2C03 A;  3FDQ A;  4YT2 A;  5E33 A;  1OKK D;  3EGD B;  4QDL A;  3ASO C;  1G8X A;  4O79 A;  4KI2 A;  3WOD F;  3MLG A;  2D5R B;  5EGY A;  4BJ1 A;  5DLJ A;  5IY5 C;  3LAY A;  2H7B A;  2Y39 A;  2Y3H A;  3HTK C;  3NKD A;  1BR1 A;  1ZYR F;  1N1C A;  4YT8 A;  4XLP F;  4E7S A;  4U5H A;  3DJN B;  4CBE A;  4Q4Z F;  3S27 A;  3LS1 A;  3E70 C;  5T1D B;  3RH3 A;  5KYW B;  3H65 A;  3VAY A;  3X2Q C;  2R7S A;  4OD5 A;  3LEV A;  4O6M A;  1M56 C;  4U5D E;  1J8M F;  3NDB B;  1D1A A;  2CDQ A;  3SP1 A;  5E3C A;  3ABK C;  4RDA A;  2QTV A;  3LLI A;  5T3W A;  4DBQ A;  4G0H A;  5FCL A;  2BE5 F;  3W8H A;  2XXA A;  4OIP F;  1LS1 A;  1M2V B;  4QI0 A;  4AE4 A;  3V7O A;  4O6Y A;  2YEV A;  3S29 A;  3W2V A;  1NU7 D;  4IRU A;  3E9V A;  4U5B E;  2J7P D;  4BJ6 C;  1WGW A;  2PX0 A;  4O6N A;  2PP4 A;  2CGE A;  2H7V C;  3T4R A;  4GEH A;  1FMV A;  4KBL A;  2P6V A;  2VAS A;  3B0P A;  3PHF 2;  4BJ5 A;  3DD7 A;  3AG4 C;  4H4K C;  4YWQ A;  3JSZ A;  1ZU5 A;  1TWC A;  3CZ6 A;  2EIL C;  3NYM A;  3ZSU A;  5B3S C;  1MMN A;  2NUP B;  4CS9 C;  4O7G A;  4JUR I;  2DYR C;  2R7U A;  1ZHZ A;  2A68 F;  2KGO A;  3RKO F;  3KL4 A;  2WB7 A;  3SZR A;  4I3M A;  2GFH A;  4OD4 A;  2MWQ A;  2W4M A;  4KC9 A;  4CS7 A;  3CQZ A;  2B0J A;  3DMD A;  4BJ6 A;  3UMH A;  3SNH A;  2Y3D A;  3NKE A;  2NUT A;  2EIK C;  2ZXO A;  2XSE A;  3VYW A;  4JJG A;  5DVW A;  2HV7 A;  3N0T A;  1Z5Z A;  4KNV A;  3S0X A;  1S7Z A;  3ITF A;  3DJU B;  4DVZ A;  4LLE A;  4YT4 A;  2EIM C;  1O5H A;  1MMG A;  3L0I A;  4DBR A;  4U5E E;  4U5G A;  3ZC4 A;  2R7X A;  2J45 A;  3RIP A;  2XXA B;  4IWB A;  3EFO A;  3TD7 A;  4LAC B;  2WZF A;  4AE4 B;  4XTK A;  4C7O A;  2J9U A;  4FX5 A;  1ZHY A;  2YHS A;  2Q9C A;  4XLN F;  3NG1 A;  4ULW A;  3K66 A;  2G62 A;  4FES A;  5KYU A;  4JW1 A;  1TR2 A;  4N06 A;  2OG2 A;  1LKX A;  4K7B A;  2V26 A;  1SZI A;  3EG9 A;  1VYK A;  3LES A;  4U5F E;  2PF4 E;  1FFH A;  3KH2 A;  1IW7 F;  3EZH A;  2V3C C;  1BR4 A;  1VMA A;  4OIO F;  1PCX A;  5KYX A;  3IEE A;  1OCZ C;  4BEJ A;  3Q7L A;  2WZG A;  2Y3G A;  2A69 F;  1KU2 A;  2WZL A;  4W8K A;  2H7O A;  1Z6A A;  4J30 B;  1RJ9 A;  4U5C E;  2Y3B A;  3GAN A;  4PJM A;  1NZE A;  2NUT B;  4BJ5 C;  2LSE A;  3X1O A;  4CS8 C;  1D1B A;  2A6H F;  4RBN A;  4C3B A;  2C04 A;  3K33 A;  4OIR F;  3ABM C;  2Z15 A;  5KYY A;  5B1A C;  3RYL A;  4EBB A;  3KMI A;  3I5P A;  1ST6 A;  2FFH A;  5HSW A;  3UMK A;  4OIQ F;  3EHN A;  3UMI A;  4G7H F;  1ZU4 A;  2IOQ A;  2CNW A;  4YT5 A;  2WVN A;  2G3K A;  3FVY A;  1SF8 A;  3LLK A;  3S28 A;  1LVK A;  2J0X A;  3DM5 A;  4C3E A;  3HLZ A;  3EFO B;  4PJJ A;  4ANJ A;  4CS8 A;  2WVO A;  4FWV A;  4DVY P;  1TKN A;  2Q9A A;  2ZXW C;  3PMR A;  4BG0 A;  5DS4 A;  1M2O A;  3AG3 C;  3EPV A;  1PD0 A;  3NRH A;  3ZIB A;  5KYU B;  3KKB A;  5L3Q A;  1VYI A;  4MQ9 F;  3Q7G A;  4ZLD A;  3SEO A;  3EG9 B;  3LS0 A;  3JCU Q;  4I1M A;  1FMW A;  1MND A;  4HEA J;  3AQC A;  5CI8 A;  4Q5S F;  2J46 A;  1Z63 A;  4YN0 B;  2R7W A;  1Z23 A;  4G7Z F;  3K1I C;  5F5H A;  1D0Z A;  3UGP A;  2Q3T A;  2FGY A;  2I8B A;  3EH1 A;  3B0V C;  3MX3 A;  1D0Y A;  4I1O B;  3JYH A;  4PK4 A;  2R7Q A;  2M4E A;  1FTS A;  3ZVR A;  3DAG A;  1RJ9 B;  2DGJ A;  2PFD A;  5EHH A;  3T6J A;  4K0D A;  3HJC A;  3LNR A;  3OA1 A;  2ZPA A;  4XWJ A;  1FFT C;  3EH2 A;  4HFK B;  5DQZ A;  5DS5 A;  4X0R A;  3POV A;  2R7R A;  2W9Y A;  1TWG A;  3ABL C;  2EIJ C;  4CSA A;  4CIH A;  2W4B A;  2L81 A;  3UNG C;  3DM9 B;  3EJN A;  2WL8 A;  2G3V A;  3ASN C;  2JD3 A;  4IJJ A;  2IXN A;  1MNE A;  3EQL F;  1OCR C;  2J7P A;  1MMA A;  4IAO A;  4G7O F;  1QZX A;  3K7D A;  3Q6M A;  2Y69 C;  2YZS A;  3LJB A;  3DZA A;  2HV6 A;  1QLE C;  4AK9 A;  3EGX A;  3WG7 C;  1VOM A;  3T6B A;  2MYS A;  1BR2 A;  5B1B C;  3F47 A;  2KQ9 A;  4MND A;  1JPN A;  1TWA A;  1JPJ A;  5T3T A;  2X51 A;  2R7O A;  1SMY F;  3NYL A;  3N2Z B;  3EZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...