4BG0A

Crystal structure of complement factors h and fhl-1 binding protein bbh06 or crasp-2 from borrelia burgdorferi
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
214
structure length
205
Chain Sequence
b'GRLNQRNINELKIFVEKAKYYSIKLDAIYNECTGAYNDIMTYSDQSKVNQAISIFKKDNKIVNKFKELEKIIEEYKPMFLSKLIDDFAIELDQAVDNARHVADSYKKLRKSVVLAYIESFDVISSKFVDSKFVEASKKFVNKAKEFVEENDLIALECIVKTIGDMVNDREINSRSRYNNFYKKEADFLGAAVELEGAYKAIKQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT REGULATOR-ACQUIRING SURFACE PROTEIN 2 (CRASP-2 (C
publication title Structural Characterization of Cspz, a Complement Regulator Factor H and Fhl-1 Binding Protein from Borrelia Burgdorferi.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Cell adhesion
total genus 88
structure length 205
sequence length 214
ec nomenclature
pdb deposition date 2013-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1640 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bg0A00
4CBEA 4BG0A
chains in the Genus database with same CATH superfamily
3UMHA 1U6HA 2L9JA 4G0HA 5L3VA 5KYWA 1VLTA 4CSAC 1TR2A 4O6YA 4EIYA 3EHNA 3MYFA 2Y3GA 4LDQA 1A7DA 1OCCC 3NKDA 2F22A 4KNVA 1VB5A 1ZW2A 1AUEA 3EGDA 4J32B 2R25A 2CW0F 4PJMA 3FVYA 3S27A 5CI9A 2OJED 4MVRA 3ZQYA 4AE4A 4FAPB 3EGXA 3GWNA 1HMOA 3KPHA 2R7RA 1A7VA 2PNOA 3FHDA 5BQIA 4N06A 3J06A 1LI5A 2OCCC 4X0RA 1XZQA 3LEVA 2IBFA 2IXPA 2R9RB 4YJWA 2XLMA 3VYWA 1NG1A 4U5BE 1H6GA 3PCVA 3PHF2 4EKWA 4MTGA 5EGYA 3LS1A 2GFHA 3FAPB 3K1IC 1FMWA 4MVZA 3SEOA 2X0CA 2MYSA 3X2QC 1CPRA 3GODA 4NQFA 4YWQA 2YL1A 2P61A 3GORA 2R7OA 3GEIA 2DGJA 4XEKA 2J0WA 4YL3A 4BG0A 3RH3A 3U5SA 4Q4ZF 1OCRC 1Y4CA 5KYXA 5A6BA 2XLHA 1I4ZA 3WHNA 1LE4A 2M4EA 1YAUO 3T6GB 2OEXA 3PDMP 2TMVP 2XL6A 4OIRF 2R7UA 1DOVA 1V54C 1M2VA 2R7QA 3GEHA 3MFNA 1BBHA 2Q9BA 3JTLO 3ZQVA 2YZSA 1KNYA 2H7VC 3L8IA 3RQFA 4CSAA 2R7XA 5B3SC 4ZLDA 1OR3A 4MNDA 1O3UA 2W4BA 3M1CB 3GEEA 1PV3A 5AGFA 4C3BA 1BR4A 1LVKA 4ZLCA 3ZC4A 3U8VA 5JVEA 4QI2A 4QI0A 3RFYA 3T9OA 4EBKA 3W4YA 4O7GA 3NMIA 4XLPF 4WGYA 1MMAA 2Q9AA 4U5GA 2NG1A 1PD0A 4LLCA 2Y69C 2J9UA 1RJ9A 2L6HA 3ZDLA 3WG7C 3US6A 3AG3C 4KC9A 2UUIA 1T9KA 3K1IA 5FCLA 5JS5A 1JMWA 3AGTA 2JD3A 4ER9A 2EILC 2XS8A 4YN0B 3U8PA 1CGOA 3IEEA 1VK5A 4ANJA 3KL4A 2XSEA 1G4US 2WZLA 1N1CA 1FFTC 2WVOA 2Y3BA 1JPNA 2VCBA 3UR3C 2A0BA 4DVZA 5A6BD 4LERA 3DAFA 3AG1C 1FFHA 5KYWB 1GM5A 3QW0A 3JRMO 4U5HA 4RD9A 4D4XA 2HSBA 2V26A 2XS1A 3SXKA 2ZXRA 4N4WA 3AG2C 5BUOA 1ORJA 2QE9A 4JTDB 2XRHA 4BEMJ 4J7TA 3DI5A 2XXAA 4Q7CA 1FMVA 4BPMA 3ASOC 3EGXB 1OKKA 5KYUA 2EPLX 4Z9IA 5FZTA 3I5QA 4D4NA 3CAXA 3EZHA 5L0CA 1HMDA 3HNLA 3IPMO 1AEPA 1RKEB 1WASA 2P1AA 4MW3A 2J8WA 2PX0A 2R02A 3X1OA 1H9TA 3TJ6A 3EH2A 4ULWA 4C3EA 2KJGA 2C03A 2OEVA 3IQTA 4NY3A 1W2WA 3PMRA 3GM3A 4CJOA 3K66A 4HE8D 4H54A 4N6HA 4CDYA 3LNRA 1ORYA 1SMYF 1HE9A 3CQZA 2OQMA 2A0UA 4DBRA 3KKBA 3TOLA 2NUPA 4G7ZF 3M4BA 1D0YA 3SP1A 2R7TA 2HKVA 1BR2A 2PF4E 5D92A 2CGEA 1ZHTA 3C8ZA 4CS8C 1LPEA 2AVKA 2FAPB 4EWCA 2QNLA 4G78A 4LDKA 4P9TA 5EHHA 3RIPA 2IXNA 3UNGC 1M2VB 1CGNA 2I15A 1C02A 2HJMA 1H7IA 4MVOA 5DVWA 1YLMA 3ZVRA 2R7VA 2OKUA 4LACB 1YA9A 3U3BA 4U5DE 4BJ5C 2GDCA 3B0UX 2VASA 4I3MA 3TK0A 3W2VA 5L0GA 3HKKA 1U0BB 5A69A 2A1DD 2YL7A 1OKKD 1LE2A 2MWQA 2ASRA 2WZFA 3B9QA 3NMKA 4E7SA 3MYIA 1V55C 1GGQA 4JTAB 4IAOA 1MMDA 4OD5A 5DS6A 1TFKB 2YLIA 2J9BA 5KYNA 1YA7O 1T01A 3L0IA 2DYSC 3Q7GA 2G3VA 3S9OA 1NFNA 1RJ9B 4K1OA 1KTMA 2HZ8A 1A7EA 1ZHWA 2XLDA 2YKZA 4O79A 5JSLA 1T6UA 2I8BA 3TOMA 5A6KA 3O39A 1HW2A 2J9VA 1JOGA 3K6BA 1JPJA 1MNDA 2KYHA 1T6IA 1Z63A 1UG7A 2A6HF 1TWGA 3DE8A 1M57C 1NU9C 1M56C 1WOLA 3S28A 1OQCA 3UGOA 3RYLA 3FOPA 3VRCA 1XWJA 4CDAA 4CS8A 5F5FA 2LFFA 3KH2A 5JP7A 3DM5A 1OXKA 3NG1A 2Q3TA 3NRHA 1ORSC 3RVZA 2JX0A 1LS1A 3ABMC 256BA 3FAJA 3M79A 3VF0A 4MQ9F 3TJ5A 2ICWG 4PACA 4BJ5A 5KYUB 2P0NA 1TWAA 2J7PA 4IB4A 3LEOA 3AG4C 2WB7A 3JCUQ 4XPWA 4AL0A 3U2LA 1B68A 5B3IA 1E83A 2LCHA 3JYYA 4M63A 1Q0FA 1WATA 1QSPA 1H9GA 1T6QA 4NTFA 1ST6A 2VCCA 4JIOA 3JSEO 3ZIBA 4CS7A 1L7CA 2VH3A 3CEXA 4A2NB 1YYXA 4I44A 2NUTA 3C18A 1K40A 2A69F 3JT1A 4GYTA 4U5EE 2VB6A 2BE5F 2HMQA 2CDQA 2EIKC 4JEBA 4XEFA 5CIVA 1C17M 2P6VA 2XLVA 4O6NA 4PJNA 4MS2A 5CI8A 2HV6A 2L6FA 4LLEA 3VM6A 2NUPB 3M4CA 4MTOA 4PJLA 1E84A 3HNIA 3EFOA 1TKNA 2QTVA 3T6JA 5HV9A 1EA8A 1EKYA 3AQBA 5A6AA 4JURI 1G8XA 2A68F 4JJGA 1E86A 4J30B 1O87A 1NSGB 2WVQA 2LSEA 2XL4A 3DMDA 4JE9A 5T3TA 1TWHA 2ZXPA 3TULA 4U5CE 5AC5A 5E33A 2OJQA 2YL0A 4XWJA 3MLGA 2Z15A 2CCYA 2YLGA 1D1AA 3RQGA 3C7JA 2PX3A 3DKAA 1J8MF 2IOQA 2KNHA 4IWBA 5L0HA 2H7BA 3AGUA 2Q00A 3RQEA 3V5YA 1LI7A 4O6MA 1L3PA 1V74B 3I4UA 1I5NA 1IW7F 1NU7D 2J7PD 3OEOA 1M6TA 1ZU5A 3ITFA 3G50A 4YT2A 2HJ3A 5GPGB 1OCOC 3O6XA 4OIPF 1FR0A 2EPKX 1J8YF 3N24A 1APCA 3B29A 2EIJC 3LNMB 3MX3A 3QVZA 4JCZA 1F1MA 4ULVA 2O9XA 1HE1A 3NYJA 1QZXA 1E2XA 3QW1A 3R2PA 1Z6AA 3EGDB 2HSQA 3DD7A 4JJFA 4AE4B 3KMIA 3GM2A 1BR1A 4BJTA 2Y39A 3W2WA 1S05A 3F47A 4C7OA 2XLWA 3W8IA 4XEVA 2WVNA 4DJ9A 2WL8A 3LLIA 5E3AA 4FX5A 3ZSUA 1Z23A 1D0XA 3BRJA 3U9JA 1OW6A 3NYLA 4K0DA 1VMAA 1ZHXA 3SXZA 5E3CA 3ZWIA 3UMKA 4G7HF 1D0ZA 1T5OA 1JR8A 3HNJA 4L6RA 1D1BA 3L8JA 2CYDA 2KSFA 3IHUA 4R32A 4BJ1A 4K7BA 3EPVA 4CBEA 1TFOB 2XM4A 1VOMA 1UFBA 3LS0A 4KBLA 2V3CC 2FGYA 3VAYA 3G4ZA 1Q0GA 3U9MA 1VTMP 5KYXB 4MW8A 3ATPA 3AOUA 3KYJA 1NBBA 3LESA 3WAQA 2ETSA 4EBJA 5IY5C 2DB4A 3IQ5A 1VYIA 4JTCB 3NDBB 4P9FA 1A0BA 1QKRA 4BJ6C 1A41A 5D91A 2X51A 4YK5A 3RW0A 4JEAA 3LUTB 2P7VA 3EFOB 4IARA 3C8GA 2G3KA 4GEHA 1OR2A 2EPOA 1ZU4A 3SNHA 3B0PA 3T6BA 4E0IA 3FMSA 3SXMA 2LQGA 4A4AA 2A6EF 1RXQA 4JVSA 4KI2A 1ZHZA 4FESA 4Q5SF 5B1AC 3S29A 4DOZA 3Q7LA 2PFDA 1LIHA 1ZHYA 3O55A 4OIOF 5E2QA 2LK4A 1Q0DA 2YWAA 2EIMC 3A11A 4IRUA 4YT8A 1G4WR 1K05A 3K1HA 3EH1A 1YYJA 2Q4FA 4YT4A 1HW1A 3EQLF 3JYHA 2J0XA 3V5ZA 4AX2A 1WTYA 2XLEA 3ABLC 3SZRA 4HFFB 2RSEB 5T3WA 2ZPAA 3KYIA 2R03A 3EZIA 3NMJA 3OWTA 1WWPA 3B71A 1K04A 5L0IA 3ZTZA 4DBQA 3S0XA 2HFIA 3HJCA 5B1BC 3SYNA 1ZW3A 2EINC 3BEHA 1QLEC 1QQ3A 2YEVA 3W8HA 3SXYA 2D4UA 5JUAA 2B0HA 4IJJA 1Z3IX 2L6GA 2IM8A 4BJ6A 1SYQA 2PP4A 3LJBA 4NTAA 4PFPA 4YL0A 5JLIA 1O5HA 3N0TA 2XXAB 2BL2A 3E70C 3HLZA 2Q9CA 3WODF 4F4BA 3N2ZB 4P6IC 1ZZPA 5KYYA 3C8GD 1WGWA 1FNTc 2EPNA 5BQHA 2GWWA 5L0DA 1IZMA 2QUPA 4CS9C 4C7OB 2BC5A 1HY5A 1LS4A 3GANA 4QDLA 3CZ6A 3FXHA 5COGA 3A9CA 2YHSA 5EK0A 5L3QA 3RKOF 4HEAJ 4IAQA 4U9DA 2LD6A 3C62A 3HNKA 3EG9A 3JRTA 4G7OF 1NZEA 3TD7A 2NSFA 3GM1A 5AC4A 2J9WA 1RKEA 5JRAA 2W9YA 2H7OA 2AP3A 2YLDA 3AJMA 2PBEA 1VLSA 2OG2A 4ONSA 1C03A 1Q0KA 2KW3C 3DJNB 4JZAA 3RVYA 3H2VA 3Q6NA 2XLOA 4PR9A 3B0VC 1TWCA 3L34A 5L0JA 4EBBA 1CPQA 1JRAA 1SZIA 5BQGA 1RCPA 3CSKA 2JPUA 1S7ZA 1OW7A 4I1MA 2J46A 3LLKA 1TQGA 4JKVA 4YL1A 4OINF 4XLNF 4E17A 4U5FE 4WABA 3S84A 3DE9A 1YDIA 3C8GB 4MVQA 2DI3A 2ZD9A 3IQ6A 3FOOA 3O10A 3OA1A 4NTBA 1LKXA 3LAYA 2GAQA 5F5HA 2L81A 4JW1A 2QLAA 4NC3A 1D1CA 3IQCA 1ZYRF 1Y6DA 3ASNC 5COMA 2HS5A 2R7WA 1PD1A 1AVOB 2Y3DA 3UGPA 1YZCA 1QPUA 2W45A 2RD9A 4CS9A 3U0CA 4EHPA 1YARO 2KK1A 3U3FA 4Z9HA 4E18A 2R7SA 1XZPA 4W8PA 2AU5A 2UUHA 5DS5A 2QY9A 4J7YA 3V7OA 1MQVA 1YZAA 2YVKA 4MVUA 3DAGA 5DQTA 4AK9A 2MHRA 5JT4A 4KNWA 2AWCA 2G62A 2ZXOA 2KC3A 5F28E 3E9VA 4E0HA 2Q7RA 4W8KA 4OIQF 1MMNA 2C04A 4MVSA 3F46A 2J45A 1OCZC 3QMKA 1RMVA 3AQCA 1EQ1A 1GQAA 3S90A 2LIGA 2VCAA 5T1DB 4JC7A 5HSWA 1MNEA 1BZ4A 1KU2A 1Z7Qc 2DYRC 1V4AA 2HMZA 2CNWA 2YQYA 3DZAA 5K0IA 3EJNA 4UDVA 1SR2A 3QVYA 3K33A 5KYYB 1OW8A 2KGOA 4DXWA 2VC9A 2NPUA 3ZG1A 3H2UA 3V5XA 3ZTMA 1Z5ZA 4WJ0A 2IYLD 1U89A 3HTKC 4JCHA 4B6IA 4CDVA 2XL8A 3TQOA 3R7CA 2LP4A 2Y3HA 4GQHA 1M2OA 2NUTB 3DWWA 2KQ9A 3EG9B 1GS9A 3POVA 1NLXA 4PK4A 1LM3B 2W4MA 4CIPA 2WZGA 1RKCA 1VYKA 1NFOA 3C63A 3Q6MA 1BDJB 4Z9JA 5DLJA 5A6JA 3M15A 4E7ZA 2OOCA 1SF8A 1ZVZA 3DJUB 2D5RB 2XM0A 1DOWA 2LFDA 4XPXA 4NCQA 2GA0A 2YRFA 1FAPB 4U9EA 2B0JA 4LDRA 4AL1A 2HV7A 5DQZA 4BEJA 2E87A 4MVMA 4XPYA 2IXOA 5DS4A 3FDQA 4DVYP 3T4RA 4EUKB 1CGME 2YL3A 4PFOA 4N6CA 1WN0A 4CX9A 1PCXA 3NKEA 3RF3A 1G5ZA 3U2MA 5TJ5E 4C3DA 2M64A 3I5PA 1R4TA 2CNWD 3DM9B 3DXJF 2FFHA 3K7DA 1Q0MA 2ZXWC 2AWYA 4JRZA 4RBNA 4XTKA 2HUJA 2L7AA 1EI7A 1I4YA 3UMIA 1QVXA 1OXBA 1YJGA 4OD4A 2R05A 3MBGA 4PJJA 3GWLA 1FTSA 4HFKB 4DRIB 3QTHA 4MTFA 1E85A 3ECSA 3QZCA 1YVIA 3L1MA 1JAFA 5COFA 4FWVA 4I1OB 3NYMA 2NSGA 1MMGA 3JZ0A 3G4XA 4DRJB 4DRHB 3H65A 5L0FA 4YT5A 4XQ1A 4WGZA 3EHMA 4CJGA 2IXMA 3JSZA 3ABKC 2H8AA 4CIHA 4RDAA 4IGGA 1R5ID 2EPMX 4H4KC 2OU6A
chains in the Genus database with same CATH topology
3UMHA 2L9JA 4G0HA 5L3VA 5KYWA 4CSAC 1TR2A 4O6YA 3EHNA 2Y3GA 1OCCC 3NKDA 4KNVA 3EGDA 4J32B 4PJMA 2CW0F 4G7ZF 3FVYA 3S27A 5CI9A 4AE4A 4QI2A 3EGXA 2R7RA 3FHDA 4N06A 2OCCC 4X0RA 4YJWA 3LEVA 3VYWA 2IXPA 1NG1A 4U5BE 3PHF2 5EGYA 3LS1A 2GFHA 3K1IC 1FMWA 3SEOA 2MYSA 3X2QC 3GODA 4YWQA 2R7OA 2DGJA 2J0WA 4BG0A 3RH3A 4Q4ZF 1OCRC 5KYXA 2M4EA 4OIRF 2R7UA 1V54C 1M2VA 2R7QA 2Q9BA 2R7XA 2YZSA 2H7VC 4CSAA 5B3SC 4ZLDA 4MNDA 2W4BA 3M1CB 4C3BA 1BR4A 1LVKA 4ZLCA 3ZC4A 4QI0A 3RFYA 4O7GA 4XLPF 1MMAA 2Q9AA 4U5GA 2NG1A 1PD0A 4LLCA 2Y69C 2J9UA 1RJ9A 3WG7C 3AG3C 4KC9A 5FCLA 2JD3A 2EILC 4YN0B 3IEEA 1VK5A 4ANJA 3KL4A 2XSEA 2WZLA 1N1CA 1FFTC 2WVOA 2Y3BA 1JPNA 3UR3C 4DVZA 4LERA 3DAFA 3AG1C 1FFHA 5KYWB 4U5HA 4RD9A 2V26A 2ZXRA 3AG2C 5BUOA 2XRHA 2XXAA 4Q7CA 1FMVA 3ASOC 3EGXB 1OKKA 5KYUA 3I5QA 3EZHA 2PX0A 3X1OA 3EH2A 4ULWA 4C3EA 2KJGA 2C03A 5L3QA 4NY3A 1W2WA 3PMRA 3K66A 4HE8D 3LNRA 1SMYF 3CQZA 4DBRA 3KKBA 2NUPA 1D0YA 3SP1A 2R7TA 1BR2A 2PF4E 5D92A 2CGEA 1ZHTA 4CS8C 4EWCA 5EHHA 3RIPA 2IXNA 3UNGC 1M2VB 5DVWA 2R7VA 3ZVRA 4LACB 4BJ5C 4U5DE 3B0UX 2VASA 4I3MA 3W2VA 2A1DD 1OKKD 2MWQA 2WZFA 3B9QA 4E7SA 1V55C 4IAOA 1MMDA 4OD5A 5DS6A 5KYNA 3L0IA 3Q7GA 2DYSC 2G3VA 1RJ9B 1ZHWA 4O79A 2I8BA 3O39A 2J9VA 3K6BA 1JPJA 1MNDA 1Z63A 2A6HF 1TWGA 1M57C 1NU9C 1M56C 3S28A 3UGOA 3RYLA 4CS8A 5F5FA 3KH2A 3DM5A 3NG1A 2Q3TA 3NRHA 1LS1A 3ABMC 3FAJA 4MQ9F 5KYUB 4BJ5A 1TWAA 2J7PA 3AG4C 2WB7A 3JCUQ 4M63A 3ZIBA 4CS7A 1ST6A 2VH3A 4A2NB 4I44A 2NUTA 2A69F 3JT1A 4GYTA 4U5EE 2VB6A 2BE5F 2CDQA 2EIKC 2P6VA 4PJNA 4O6NA 5CI8A 2HV6A 4LLEA 2NUPB 4PJLA 3EFOA 1TKNA 2QTVA 3T6JA 3AQBA 4JURI 1G8XA 2A68F 4JJGA 4J30B 1O87A 2XL4A 2WVQA 2LSEA 3DMDA 5T3TA 1TWHA 2ZXPA 4U5CE 5E33A 4XWJA 3MLGA 2Z15A 1D1AA 2PX3A 1J8MF 2IOQA 2KNHA 4IWBA 2H7BA 4O6MA 3I4UA 1IW7F 1NU7D 2J7PD 3OEOA 1ZU5A 3ITFA 4YT2A 4OIPF 1OCOC 3O6XA 1J8YF 3N24A 2EIJC 3MX3A 2O9XA 3NYJA 1QZXA 1Z6AA 3EGDB 3DD7A 4JJFA 4AE4B 3KMIA 1BR1A 4BJTA 2Y39A 3W2WA 3F47A 4C7OA 3W8IA 2WVNA 2WL8A 3LLIA 5E3AA 4FX5A 3ZSUA 1Z23A 1D0XA 3NYLA 4K0DA 1VMAA 1ZHXA 5E3CA 3UMKA 4G7HF 1D0ZA 1D1BA 4BJ1A 4K7BA 3EPVA 4CBEA 1VOMA 3LS0A 4KBLA 2V3CC 2FGYA 3VAYA 5KYXB 3LESA 5IY5C 3NDBB 1VYIA 4BJ6C 5D91A 2X51A 2P7VA 3EFOB 2G3KA 4GEHA 3SNHA 1ZU4A 3B0PA 3T6BA 2A6EF 4JVSA 4KI2A 1ZHZA 4FESA 4Q5SF 5B1AC 3S29A 4DOZA 3Q7LA 2PFDA 1ZHYA 4OIOF 5E2QA 2EIMC 4IRUA 4YT8A 3K1HA 3EH1A 4YT4A 3EQLF 3JYHA 2J0XA 4AX2A 3SZRA 3ABLC 4HFFB 5T3WA 2ZPAA 3EZIA 3OWTA 4DBQA 3S0XA 5B1BC 3HJCA 3SYNA 2EINC 1QLEC 3W8HA 2YEVA 4IJJA 1Z3IX 4BJ6A 2PP4A 3LJBA 4PFPA 1O5HA 3N0TA 2XXAB 3E70C 3HLZA 2Q9CA 3WODF 4F4BA 3N2ZB 4P6IC 5KYYA 1WGWA 1IZMA 4CS9C 4C7OB 3GANA 4QDLA 3CZ6A 2YHSA 3RKOF 4HEAJ 4G7OF 3EG9A 3JRTA 1NZEA 3TD7A 2J9WA 2W9YA 2H7OA 2OG2A 2KW3C 3DJNB 4JZAA 3Q6NA 3B0VC 1TWCA 3L34A 4EBBA 1SZIA 3CSKA 1S7ZA 4I1MA 4XLNF 2J46A 3LLKA 4OINF 4U5FE 3OA1A 1LKXA 3LAYA 5F5HA 2L81A 4JW1A 1D1CA 1ZYRF 2R7WA 3ASNC 1PD1A 3UGPA 2Y3DA 4CS9A 2W45A 2R7SA 5DS5A 2QY9A 3V7OA 3DAGA 5DQTA 4AK9A 4KNWA 2G62A 2ZXOA 3E9VA 4W8KA 4OIQF 1MMNA 2C04A 3F46A 2J45A 1OCZC 3QMKA 3AQCA 5T1DB 5HSWA 1MNEA 1KU2A 2DYRC 2CNWA 3DZAA 3EJNA 3K33A 5KYYB 2KGOA 1Z5ZA 4WJ0A 2IYLD 3HTKC 4JCHA 4B6IA 2Y3HA 1M2OA 2NUTB 2KQ9A 3EG9B 3POVA 4PK4A 2W4MA 2WZGA 1VYKA 3Q6MA 5DLJA 4E7ZA 1SF8A 3DJUB 2D5RB 2B0JA 4BEJA 2HV7A 5DQZA 5DS4A 2E87A 3FDQA 2IXOA 4DVYP 3T4RA 4PFOA 1PCXA 3NKEA 4C3DA 3I5PA 2CNWD 3DM9B 3DXJF 3K7DA 2FFHA 4XTKA 2ZXWC 4RBNA 3UMIA 4OD4A 4PJJA 1FTSA 4HFKB 3ECSA 3QZCA 4FWVA 4I1OB 3NYMA 1MMGA 3H65A 4YT5A 3EHMA 2IXMA 3JSZA 3ABKC 4CIHA 4RDAA 3ZG1A 4H4KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CBE A;  4BG0 A; 
#chains in the Genus database with same CATH topology
 3UMH A;  1U6H A;  2L9J A;  4G0H A;  5L3V A;  5KYW A;  1VLT A;  4CSA C;  1TR2 A;  4O6Y A;  4EIY A;  3EHN A;  3MYF A;  2Y3G A;  4LDQ A;  1A7D A;  1OCC C;  3NKD A;  2F22 A;  4KNV A;  1VB5 A;  1ZW2 A;  1AUE A;  3EGD A;  4J32 B;  2R25 A;  2CW0 F;  4PJM A;  3FVY A;  3S27 A;  5CI9 A;  2OJE D;  4MVR A;  3ZQY A;  4AE4 A;  4FAP B;  3EGX A;  3GWN A;  1HMO A;  3KPH A;  2R7R A;  1A7V A;  2PNO A;  3FHD A;  5BQI A;  4N06 A;  3J06 A;  1LI5 A;  2OCC C;  4X0R A;  1XZQ A;  3LEV A;  2IBF A;  2IXP A;  2R9R B;  4YJW A;  2XLM A;  3VYW A;  1NG1 A;  4U5B E;  1H6G A;  3PCV A;  3PHF 2;  4EKW A;  4MTG A;  5EGY A;  3LS1 A;  2GFH A;  3FAP B;  3K1I C;  1FMW A;  4MVZ A;  3SEO A;  2X0C A;  2MYS A;  3X2Q C;  1CPR A;  3GOD A;  4NQF A;  4YWQ A;  2YL1 A;  2P61 A;  3GOR A;  2R7O A;  3GEI A;  2DGJ A;  4XEK A;  2J0W A;  4YL3 A;  4BG0 A;  3RH3 A;  3U5S A;  4Q4Z F;  1OCR C;  1Y4C A;  5KYX A;  5A6B A;  2XLH A;  1I4Z A;  3WHN A;  1LE4 A;  2M4E A;  1YAU O;  3T6G B;  2OEX A;  3PDM P;  2TMV P;  2XL6 A;  4OIR F;  2R7U A;  1DOV A;  1V54 C;  1M2V A;  2R7Q A;  3GEH A;  3MFN A;  1BBH A;  2Q9B A;  3JTL O;  3ZQV A;  2YZS A;  1KNY A;  2H7V C;  3L8I A;  3RQF A;  4CSA A;  2R7X A;  5B3S C;  4ZLD A;  1OR3 A;  4MND A;  1O3U A;  2W4B A;  3M1C B;  3GEE A;  1PV3 A;  5AGF A;  4C3B A;  1BR4 A;  1LVK A;  4ZLC A;  3ZC4 A;  3U8V A;  5JVE A;  4QI2 A;  4QI0 A;  3RFY A;  3T9O A;  4EBK A;  3W4Y A;  4O7G A;  3NMI A;  4XLP F;  4WGY A;  1MMA A;  2Q9A A;  4U5G A;  2NG1 A;  1PD0 A;  4LLC A;  2Y69 C;  2J9U A;  1RJ9 A;  2L6H A;  3ZDL A;  3WG7 C;  3US6 A;  3AG3 C;  4KC9 A;  2UUI A;  1T9K A;  3K1I A;  5FCL A;  5JS5 A;  1JMW A;  3AGT A;  2JD3 A;  4ER9 A;  2EIL C;  2XS8 A;  4YN0 B;  3U8P A;  1CGO A;  3IEE A;  1VK5 A;  4ANJ A;  3KL4 A;  2XSE A;  1G4U S;  2WZL A;  1N1C A;  1FFT C;  2WVO A;  2Y3B A;  1JPN A;  2VCB A;  3UR3 C;  2A0B A;  4DVZ A;  5A6B D;  4LER A;  3DAF A;  3AG1 C;  1FFH A;  5KYW B;  1GM5 A;  3QW0 A;  3JRM O;  4U5H A;  4RD9 A;  4D4X A;  2HSB A;  2V26 A;  2XS1 A;  3SXK A;  2ZXR A;  4N4W A;  3AG2 C;  5BUO A;  1ORJ A;  2QE9 A;  4JTD B;  2XRH A;  4BEM J;  4J7T A;  3DI5 A;  2XXA A;  4Q7C A;  1FMV A;  4BPM A;  3ASO C;  3EGX B;  1OKK A;  5KYU A;  2EPL X;  4Z9I A;  5FZT A;  3I5Q A;  4D4N A;  3CAX A;  3EZH A;  5L0C A;  1HMD A;  3HNL A;  3IPM O;  1AEP A;  1RKE B;  1WAS A;  2P1A A;  4MW3 A;  2J8W A;  2PX0 A;  2R02 A;  3X1O A;  1H9T A;  3TJ6 A;  3EH2 A;  4ULW A;  4C3E A;  2KJG A;  2C03 A;  2OEV A;  3IQT A;  4NY3 A;  1W2W A;  3PMR A;  3GM3 A;  4CJO A;  3K66 A;  4HE8 D;  4H54 A;  4N6H A;  4CDY A;  3LNR A;  1ORY A;  1SMY F;  1HE9 A;  3CQZ A;  2OQM A;  2A0U A;  4DBR A;  3KKB A;  3TOL A;  2NUP A;  4G7Z F;  3M4B A;  1D0Y A;  3SP1 A;  2R7T A;  2HKV A;  1BR2 A;  2PF4 E;  5D92 A;  2CGE A;  1ZHT A;  3C8Z A;  4CS8 C;  1LPE A;  2AVK A;  2FAP B;  4EWC A;  2QNL A;  4G78 A;  4LDK A;  4P9T A;  5EHH A;  3RIP A;  2IXN A;  3UNG C;  1M2V B;  1CGN A;  2I15 A;  1C02 A;  2HJM A;  1H7I A;  4MVO A;  5DVW A;  1YLM A;  3ZVR A;  2R7V A;  2OKU A;  4LAC B;  1YA9 A;  3U3B A;  4U5D E;  4BJ5 C;  2GDC A;  3B0U X;  2VAS A;  4I3M A;  3TK0 A;  3W2V A;  5L0G A;  3HKK A;  1U0B B;  5A69 A;  2A1D D;  2YL7 A;  1OKK D;  1LE2 A;  2MWQ A;  2ASR A;  2WZF A;  3B9Q A;  3NMK A;  4E7S A;  3MYI A;  1V55 C;  1GGQ A;  4JTA B;  4IAO A;  1MMD A;  4OD5 A;  5DS6 A;  1TFK B;  2YLI A;  2J9B A;  5KYN A;  1YA7 O;  1T01 A;  3L0I A;  2DYS C;  3Q7G A;  2G3V A;  3S9O A;  1NFN A;  1RJ9 B;  4K1O A;  1KTM A;  2HZ8 A;  1A7E A;  1ZHW A;  2XLD A;  2YKZ A;  4O79 A;  5JSL A;  1T6U A;  2I8B A;  3TOM A;  5A6K A;  3O39 A;  1HW2 A;  2J9V A;  1JOG A;  3K6B A;  1JPJ A;  1MND A;  2KYH A;  1T6I A;  1Z63 A;  1UG7 A;  2A6H F;  1TWG A;  3DE8 A;  1M57 C;  1NU9 C;  1M56 C;  1WOL A;  3S28 A;  1OQC A;  3UGO A;  3RYL A;  3FOP A;  3VRC A;  1XWJ A;  4CDA A;  4CS8 A;  5F5F A;  2LFF A;  3KH2 A;  5JP7 A;  3DM5 A;  1OXK A;  3NG1 A;  2Q3T A;  3NRH A;  1ORS C;  3RVZ A;  2JX0 A;  1LS1 A;  3ABM C;  256B A;  3FAJ A;  3M79 A;  3VF0 A;  4MQ9 F;  3TJ5 A;  2ICW G;  4PAC A;  4BJ5 A;  5KYU B;  2P0N A;  1TWA A;  2J7P A;  4IB4 A;  3LEO A;  3AG4 C;  2WB7 A;  3JCU Q;  4XPW A;  4AL0 A;  3U2L A;  1B68 A;  5B3I A;  1E83 A;  2LCH A;  3JYY A;  4M63 A;  1Q0F A;  1WAT A;  1QSP A;  1H9G A;  1T6Q A;  4NTF A;  1ST6 A;  2VCC A;  4JIO A;  3JSE O;  3ZIB A;  4CS7 A;  1L7C A;  2VH3 A;  3CEX A;  4A2N B;  1YYX A;  4I44 A;  2NUT A;  3C18 A;  1K40 A;  2A69 F;  3JT1 A;  4GYT A;  4U5E E;  2VB6 A;  2BE5 F;  2HMQ A;  2CDQ A;  2EIK C;  4JEB A;  4XEF A;  5CIV A;  1C17 M;  2P6V A;  2XLV A;  4O6N A;  4PJN A;  4MS2 A;  5CI8 A;  2HV6 A;  2L6F A;  4LLE A;  3VM6 A;  2NUP B;  3M4C A;  4MTO A;  4PJL A;  1E84 A;  3HNI A;  3EFO A;  1TKN A;  2QTV A;  3T6J A;  5HV9 A;  1EA8 A;  1EKY A;  3AQB A;  5A6A A;  4JUR I;  1G8X A;  2A68 F;  4JJG A;  1E86 A;  4J30 B;  1O87 A;  1NSG B;  2WVQ A;  2LSE A;  2XL4 A;  3DMD A;  4JE9 A;  5T3T A;  1TWH A;  2ZXP A;  3TUL A;  4U5C E;  5AC5 A;  5E33 A;  2OJQ A;  2YL0 A;  4XWJ A;  3MLG A;  2Z15 A;  2CCY A;  2YLG A;  1D1A A;  3RQG A;  3C7J A;  2PX3 A;  3DKA A;  1J8M F;  2IOQ A;  2KNH A;  4IWB A;  5L0H A;  2H7B A;  3AGU A;  2Q00 A;  3RQE A;  3V5Y A;  1LI7 A;  4O6M A;  1L3P A;  1V74 B;  3I4U A;  1I5N A;  1IW7 F;  1NU7 D;  2J7P D;  3OEO A;  1M6T A;  1ZU5 A;  3ITF A;  3G50 A;  4YT2 A;  2HJ3 A;  5GPG B;  1OCO C;  3O6X A;  4OIP F;  1FR0 A;  2EPK X;  1J8Y F;  3N24 A;  1APC A;  3B29 A;  2EIJ C;  3LNM B;  3MX3 A;  3QVZ A;  4JCZ A;  1F1M A;  4ULV A;  2O9X A;  1HE1 A;  3NYJ A;  1QZX A;  1E2X A;  3QW1 A;  3R2P A;  1Z6A A;  3EGD B;  2HSQ A;  3DD7 A;  4JJF A;  4AE4 B;  3KMI A;  3GM2 A;  1BR1 A;  4BJT A;  2Y39 A;  3W2W A;  1S05 A;  3F47 A;  4C7O A;  2XLW A;  3W8I A;  4XEV A;  2WVN A;  4DJ9 A;  2WL8 A;  3LLI A;  5E3A A;  4FX5 A;  3ZSU A;  1Z23 A;  1D0X A;  3BRJ A;  3U9J A;  1OW6 A;  3NYL A;  4K0D A;  1VMA A;  1ZHX A;  3SXZ A;  5E3C A;  3ZWI A;  3UMK A;  4G7H F;  1D0Z A;  1T5O A;  1JR8 A;  3HNJ A;  4L6R A;  1D1B A;  3L8J A;  2CYD A;  2KSF A;  3IHU A;  4R32 A;  4BJ1 A;  4K7B A;  3EPV A;  4CBE A;  1TFO B;  2XM4 A;  1VOM A;  1UFB A;  3LS0 A;  4KBL A;  2V3C C;  2FGY A;  3VAY A;  3G4Z A;  1Q0G A;  3U9M A;  1VTM P;  5KYX B;  4MW8 A;  3ATP A;  3AOU A;  3KYJ A;  1NBB A;  3LES A;  3WAQ A;  2ETS A;  4EBJ A;  5IY5 C;  2DB4 A;  3IQ5 A;  1VYI A;  4JTC B;  3NDB B;  4P9F A;  1A0B A;  1QKR A;  4BJ6 C;  1A41 A;  5D91 A;  2X51 A;  4YK5 A;  3RW0 A;  4JEA A;  3LUT B;  2P7V A;  3EFO B;  4IAR A;  3C8G A;  2G3K A;  4GEH A;  1OR2 A;  2EPO A;  1ZU4 A;  3SNH A;  3B0P A;  3T6B A;  4E0I A;  3FMS A;  3SXM A;  2LQG A;  4A4A A;  2A6E F;  1RXQ A;  4JVS A;  4KI2 A;  1ZHZ A;  4FES A;  4Q5S F;  5B1A C;  3S29 A;  4DOZ A;  3Q7L A;  2PFD A;  1LIH A;  1ZHY A;  3O55 A;  4OIO F;  5E2Q A;  2LK4 A;  1Q0D A;  2YWA A;  2EIM C;  3A11 A;  4IRU A;  4YT8 A;  1G4W R;  1K05 A;  3K1H A;  3EH1 A;  1YYJ A;  2Q4F A;  4YT4 A;  1HW1 A;  3EQL F;  3JYH A;  2J0X A;  3V5Z A;  4AX2 A;  1WTY A;  2XLE A;  3ABL C;  3SZR A;  4HFF B;  2RSE B;  5T3W A;  2ZPA A;  3KYI A;  2R03 A;  3EZI A;  3NMJ A;  3OWT A;  1WWP A;  3B71 A;  1K04 A;  5L0I A;  3ZTZ A;  4DBQ A;  3S0X A;  2HFI A;  3HJC A;  5B1B C;  3SYN A;  1ZW3 A;  2EIN C;  3BEH A;  1QLE C;  1QQ3 A;  2YEV A;  3W8H A;  3SXY A;  2D4U A;  5JUA A;  2B0H A;  4IJJ A;  1Z3I X;  2L6G A;  2IM8 A;  4BJ6 A;  1SYQ A;  2PP4 A;  3LJB A;  4NTA A;  4PFP A;  4YL0 A;  5JLI A;  1O5H A;  3N0T A;  2XXA B;  2BL2 A;  3E70 C;  3HLZ A;  2Q9C A;  3WOD F;  4F4B A;  3N2Z B;  4P6I C;  1ZZP A;  5KYY A;  3C8G D;  1WGW A;  1FNT c;  2EPN A;  5BQH A;  2GWW A;  5L0D A;  1IZM A;  2QUP A;  4CS9 C;  4C7O B;  2BC5 A;  1HY5 A;  1LS4 A;  3GAN A;  4QDL A;  3CZ6 A;  3FXH A;  5COG A;  3A9C A;  2YHS A;  5EK0 A;  5L3Q A;  3RKO F;  4HEA J;  4IAQ A;  4U9D A;  2LD6 A;  3C62 A;  3HNK A;  3EG9 A;  3JRT A;  4G7O F;  1NZE A;  3TD7 A;  2NSF A;  3GM1 A;  5AC4 A;  2J9W A;  1RKE A;  5JRA A;  2W9Y A;  2H7O A;  2AP3 A;  2YLD A;  3AJM A;  2PBE A;  1VLS A;  2OG2 A;  4ONS A;  1C03 A;  1Q0K A;  2KW3 C;  3DJN B;  4JZA A;  3RVY A;  3H2V A;  3Q6N A;  2XLO A;  4PR9 A;  3B0V C;  1TWC A;  3L34 A;  5L0J A;  4EBB A;  1CPQ A;  1JRA A;  1SZI A;  5BQG A;  1RCP A;  3CSK A;  2JPU A;  1S7Z A;  1OW7 A;  4I1M A;  2J46 A;  3LLK A;  1TQG A;  4JKV A;  4YL1 A;  4OIN F;  4XLN F;  4E17 A;  4U5F E;  4WAB A;  3S84 A;  3DE9 A;  1YDI A;  3C8G B;  4MVQ A;  2DI3 A;  2ZD9 A;  3IQ6 A;  3FOO A;  3O10 A;  3OA1 A;  4NTB A;  1LKX A;  3LAY A;  2GAQ A;  5F5H A;  2L81 A;  4JW1 A;  2QLA A;  4NC3 A;  1D1C A;  3IQC A;  1ZYR F;  1Y6D A;  3ASN C;  5COM A;  2HS5 A;  2R7W A;  1PD1 A;  1AVO B;  2Y3D A;  3UGP A;  1YZC A;  1QPU A;  2W45 A;  2RD9 A;  4CS9 A;  3U0C A;  4EHP A;  1YAR O;  2KK1 A;  3U3F A;  4Z9H A;  4E18 A;  2R7S A;  1XZP A;  4W8P A;  2AU5 A;  2UUH A;  5DS5 A;  2QY9 A;  4J7Y A;  3V7O A;  1MQV A;  1YZA A;  2YVK A;  4MVU A;  3DAG A;  5DQT A;  4AK9 A;  2MHR A;  5JT4 A;  4KNW A;  2AWC A;  2G62 A;  2ZXO A;  2KC3 A;  5F28 E;  3E9V A;  4E0H A;  2Q7R A;  4W8K A;  4OIQ F;  1MMN A;  2C04 A;  4MVS A;  3F46 A;  2J45 A;  1OCZ C;  3QMK A;  1RMV A;  3AQC A;  1EQ1 A;  1GQA A;  3S90 A;  2LIG A;  2VCA A;  5T1D B;  4JC7 A;  5HSW A;  1MNE A;  1BZ4 A;  1KU2 A;  1Z7Q c;  2DYR C;  1V4A A;  2HMZ A;  2CNW A;  2YQY A;  3DZA A;  5K0I A;  3EJN A;  4UDV A;  1SR2 A;  3QVY A;  3K33 A;  5KYY B;  1OW8 A;  2KGO A;  4DXW A;  2VC9 A;  2NPU A;  3ZG1 A;  3H2U A;  3V5X A;  3ZTM A;  1Z5Z A;  4WJ0 A;  2IYL D;  1U89 A;  3HTK C;  4JCH A;  4B6I A;  4CDV A;  2XL8 A;  3TQO A;  3R7C A;  2LP4 A;  2Y3H A;  4GQH A;  1M2O A;  2NUT B;  3DWW A;  2KQ9 A;  3EG9 B;  1GS9 A;  3POV A;  1NLX A;  4PK4 A;  1LM3 B;  2W4M A;  4CIP A;  2WZG A;  1RKC A;  1VYK A;  1NFO A;  3C63 A;  3Q6M A;  1BDJ B;  4Z9J A;  5DLJ A;  5A6J A;  3M15 A;  4E7Z A;  2OOC A;  1SF8 A;  1ZVZ A;  3DJU B;  2D5R B;  2XM0 A;  1DOW A;  2LFD A;  4XPX A;  4NCQ A;  2GA0 A;  2YRF A;  1FAP B;  4U9E A;  2B0J A;  4LDR A;  4AL1 A;  2HV7 A;  5DQZ A;  4BEJ A;  2E87 A;  4MVM A;  4XPY A;  2IXO A;  5DS4 A;  3FDQ A;  4DVY P;  3T4R A;  4EUK B;  1CGM E;  2YL3 A;  4PFO A;  4N6C A;  1WN0 A;  4CX9 A;  1PCX A;  3NKE A;  3RF3 A;  1G5Z A;  3U2M A;  5TJ5 E;  4C3D A;  2M64 A;  3I5P A;  1R4T A;  2CNW D;  3DM9 B;  3DXJ F;  2FFH A;  3K7D A;  1Q0M A;  2ZXW C;  2AWY A;  4JRZ A;  4RBN A;  4XTK A;  2HUJ A;  2L7A A;  1EI7 A;  1I4Y A;  3UMI A;  1QVX A;  1OXB A;  1YJG A;  4OD4 A;  2R05 A;  3MBG A;  4PJJ A;  3GWL A;  1FTS A;  4HFK B;  4DRI B;  3QTH A;  4MTF A;  1E85 A;  3ECS A;  3QZC A;  1YVI A;  3L1M A;  1JAF A;  5COF A;  4FWV A;  4I1O B;  3NYM A;  2NSG A;  1MMG A;  3JZ0 A;  3G4X A;  4DRJ B;  4DRH B;  3H65 A;  5L0F A;  4YT5 A;  4XQ1 A;  4WGZ A;  3EHM A;  4CJG A;  2IXM A;  3JSZ A;  3ABK C;  2H8A A;  4CIH A;  4RDA A;  4IGG A;  1R5I D;  2EPM X;  4H4K C;  2OU6 A; 
#chains in the Genus database with same CATH homology
 3UMH A;  2L9J A;  4G0H A;  5L3V A;  5KYW A;  4CSA C;  1TR2 A;  4O6Y A;  3EHN A;  2Y3G A;  1OCC C;  3NKD A;  4KNV A;  3EGD A;  4J32 B;  4PJM A;  2CW0 F;  4G7Z F;  3FVY A;  3S27 A;  5CI9 A;  4AE4 A;  4QI2 A;  3EGX A;  2R7R A;  3FHD A;  4N06 A;  2OCC C;  4X0R A;  4YJW A;  3LEV A;  3VYW A;  2IXP A;  1NG1 A;  4U5B E;  3PHF 2;  5EGY A;  3LS1 A;  2GFH A;  3K1I C;  1FMW A;  3SEO A;  2MYS A;  3X2Q C;  3GOD A;  4YWQ A;  2R7O A;  2DGJ A;  2J0W A;  4BG0 A;  3RH3 A;  4Q4Z F;  1OCR C;  5KYX A;  2M4E A;  4OIR F;  2R7U A;  1V54 C;  1M2V A;  2R7Q A;  2Q9B A;  2R7X A;  2YZS A;  2H7V C;  4CSA A;  5B3S C;  4ZLD A;  4MND A;  2W4B A;  3M1C B;  4C3B A;  1BR4 A;  1LVK A;  4ZLC A;  3ZC4 A;  4QI0 A;  3RFY A;  4O7G A;  4XLP F;  1MMA A;  2Q9A A;  4U5G A;  2NG1 A;  1PD0 A;  4LLC A;  2Y69 C;  2J9U A;  1RJ9 A;  3WG7 C;  3AG3 C;  4KC9 A;  5FCL A;  2JD3 A;  2EIL C;  4YN0 B;  3IEE A;  1VK5 A;  4ANJ A;  3KL4 A;  2XSE A;  2WZL A;  1N1C A;  1FFT C;  2WVO A;  2Y3B A;  1JPN A;  3UR3 C;  4DVZ A;  4LER A;  3DAF A;  3AG1 C;  1FFH A;  5KYW B;  4U5H A;  4RD9 A;  2V26 A;  2ZXR A;  3AG2 C;  5BUO A;  2XRH A;  2XXA A;  4Q7C A;  1FMV A;  3ASO C;  3EGX B;  1OKK A;  5KYU A;  3I5Q A;  3EZH A;  2PX0 A;  3X1O A;  3EH2 A;  4ULW A;  4C3E A;  2KJG A;  2C03 A;  5L3Q A;  4NY3 A;  1W2W A;  3PMR A;  3K66 A;  4HE8 D;  3LNR A;  1SMY F;  3CQZ A;  4DBR A;  3KKB A;  2NUP A;  1D0Y A;  3SP1 A;  2R7T A;  1BR2 A;  2PF4 E;  5D92 A;  2CGE A;  1ZHT A;  4CS8 C;  4EWC A;  5EHH A;  3RIP A;  2IXN A;  3UNG C;  1M2V B;  5DVW A;  2R7V A;  3ZVR A;  4LAC B;  4BJ5 C;  4U5D E;  3B0U X;  2VAS A;  4I3M A;  3W2V A;  2A1D D;  1OKK D;  2MWQ A;  2WZF A;  3B9Q A;  4E7S A;  1V55 C;  4IAO A;  1MMD A;  4OD5 A;  5DS6 A;  5KYN A;  3L0I A;  3Q7G A;  2DYS C;  2G3V A;  1RJ9 B;  1ZHW A;  4O79 A;  2I8B A;  3O39 A;  2J9V A;  3K6B A;  1JPJ A;  1MND A;  1Z63 A;  2A6H F;  1TWG A;  1M57 C;  1NU9 C;  1M56 C;  3S28 A;  3UGO A;  3RYL A;  4CS8 A;  5F5F A;  3KH2 A;  3DM5 A;  3NG1 A;  2Q3T A;  3NRH A;  1LS1 A;  3ABM C;  3FAJ A;  4MQ9 F;  5KYU B;  4BJ5 A;  1TWA A;  2J7P A;  3AG4 C;  2WB7 A;  3JCU Q;  4M63 A;  3ZIB A;  4CS7 A;  1ST6 A;  2VH3 A;  4A2N B;  4I44 A;  2NUT A;  2A69 F;  3JT1 A;  4GYT A;  4U5E E;  2VB6 A;  2BE5 F;  2CDQ A;  2EIK C;  2P6V A;  4PJN A;  4O6N A;  5CI8 A;  2HV6 A;  4LLE A;  2NUP B;  4PJL A;  3EFO A;  1TKN A;  2QTV A;  3T6J A;  3AQB A;  4JUR I;  1G8X A;  2A68 F;  4JJG A;  4J30 B;  1O87 A;  2XL4 A;  2WVQ A;  2LSE A;  3DMD A;  5T3T A;  1TWH A;  2ZXP A;  4U5C E;  5E33 A;  4XWJ A;  3MLG A;  2Z15 A;  1D1A A;  2PX3 A;  1J8M F;  2IOQ A;  2KNH A;  4IWB A;  2H7B A;  4O6M A;  3I4U A;  1IW7 F;  1NU7 D;  2J7P D;  3OEO A;  1ZU5 A;  3ITF A;  4YT2 A;  4OIP F;  1OCO C;  3O6X A;  1J8Y F;  3N24 A;  2EIJ C;  3MX3 A;  2O9X A;  3NYJ A;  1QZX A;  1Z6A A;  3EGD B;  3DD7 A;  4JJF A;  4AE4 B;  3KMI A;  1BR1 A;  4BJT A;  2Y39 A;  3W2W A;  3F47 A;  4C7O A;  3W8I A;  2WVN A;  2WL8 A;  3LLI A;  5E3A A;  4FX5 A;  3ZSU A;  1Z23 A;  1D0X A;  3NYL A;  4K0D A;  1VMA A;  1ZHX A;  5E3C A;  3UMK A;  4G7H F;  1D0Z A;  1D1B A;  4BJ1 A;  4K7B A;  3EPV A;  4CBE A;  1VOM A;  3LS0 A;  4KBL A;  2V3C C;  2FGY A;  3VAY A;  5KYX B;  3LES A;  5IY5 C;  3NDB B;  1VYI A;  4BJ6 C;  5D91 A;  2X51 A;  2P7V A;  3EFO B;  2G3K A;  4GEH A;  3SNH A;  1ZU4 A;  3B0P A;  3T6B A;  2A6E F;  4JVS A;  4KI2 A;  1ZHZ A;  4FES A;  4Q5S F;  5B1A C;  3S29 A;  4DOZ A;  3Q7L A;  2PFD A;  1ZHY A;  4OIO F;  5E2Q A;  2EIM C;  4IRU A;  4YT8 A;  3K1H A;  3EH1 A;  4YT4 A;  3EQL F;  3JYH A;  2J0X A;  4AX2 A;  3SZR A;  3ABL C;  4HFF B;  5T3W A;  2ZPA A;  3EZI A;  3OWT A;  4DBQ A;  3S0X A;  5B1B C;  3HJC A;  3SYN A;  2EIN C;  1QLE C;  3W8H A;  2YEV A;  4IJJ A;  1Z3I X;  4BJ6 A;  2PP4 A;  3LJB A;  4PFP A;  1O5H A;  3N0T A;  2XXA B;  3E70 C;  3HLZ A;  2Q9C A;  3WOD F;  4F4B A;  3N2Z B;  4P6I C;  5KYY A;  1WGW A;  1IZM A;  4CS9 C;  4C7O B;  3GAN A;  4QDL A;  3CZ6 A;  2YHS A;  3RKO F;  4HEA J;  4G7O F;  3EG9 A;  3JRT A;  1NZE A;  3TD7 A;  2J9W A;  2W9Y A;  2H7O A;  2OG2 A;  2KW3 C;  3DJN B;  4JZA A;  3Q6N A;  3B0V C;  1TWC A;  3L34 A;  4EBB A;  1SZI A;  3CSK A;  1S7Z A;  4I1M A;  4XLN F;  2J46 A;  3LLK A;  4OIN F;  4U5F E;  3OA1 A;  1LKX A;  3LAY A;  5F5H A;  2L81 A;  4JW1 A;  1D1C A;  1ZYR F;  2R7W A;  3ASN C;  1PD1 A;  3UGP A;  2Y3D A;  4CS9 A;  2W45 A;  2R7S A;  5DS5 A;  2QY9 A;  3V7O A;  3DAG A;  5DQT A;  4AK9 A;  4KNW A;  2G62 A;  2ZXO A;  3E9V A;  4W8K A;  4OIQ F;  1MMN A;  2C04 A;  3F46 A;  2J45 A;  1OCZ C;  3QMK A;  3AQC A;  5T1D B;  5HSW A;  1MNE A;  1KU2 A;  2DYR C;  2CNW A;  3DZA A;  3EJN A;  3K33 A;  5KYY B;  2KGO A;  1Z5Z A;  4WJ0 A;  2IYL D;  3HTK C;  4JCH A;  4B6I A;  2Y3H A;  1M2O A;  2NUT B;  2KQ9 A;  3EG9 B;  3POV A;  4PK4 A;  2W4M A;  2WZG A;  1VYK A;  3Q6M A;  5DLJ A;  4E7Z A;  1SF8 A;  3DJU B;  2D5R B;  2B0J A;  4BEJ A;  2HV7 A;  5DQZ A;  5DS4 A;  2E87 A;  3FDQ A;  2IXO A;  4DVY P;  3T4R A;  4PFO A;  1PCX A;  3NKE A;  4C3D A;  3I5P A;  2CNW D;  3DM9 B;  3DXJ F;  3K7D A;  2FFH A;  4XTK A;  2ZXW C;  4RBN A;  3UMI A;  4OD4 A;  4PJJ A;  1FTS A;  4HFK B;  3ECS A;  3QZC A;  4FWV A;  4I1O B;  3NYM A;  1MMG A;  3H65 A;  4YT5 A;  3EHM A;  2IXM A;  3JSZ A;  3ABK C;  4CIH A;  4RDA A;  3ZG1 A;  4H4K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...