4BG0A

Crystal structure of complement factors h and fhl-1 binding protein bbh06 or crasp-2 from borrelia burgdorferi
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
214
structure length
205
Chain Sequence
GRLNQRNINELKIFVEKAKYYSIKLDAIYNECTGAYNDIMTYSDQSKVNQAISIFKKDNKIVNKFKELEKIIEEYKPMFLSKLIDDFAIELDQAVDNARHVADSYKKLRKSVVLAYIESFDVISSKFVDSKFVEASKKFVNKAKEFVEENDLIALECIVKTIGDMVNDREINSRSRYNNFYKKEADFLGAAVELEGAYKAIKQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of Cspz, a Complement Regulator Factor H and Fhl-1 Binding Protein from Borrelia Burgdorferi.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Cell adhesion
molecule keywords COMPLEMENT REGULATOR-ACQUIRING SURFACE PROTEIN 2 (CRASP-2 (C
total genus 88
structure length 205
sequence length 214
ec nomenclature
pdb deposition date 2013-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1640 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bg0A00
4CBEA 4BG0A
chains in the Genus database with same CATH superfamily
1C17M 1L7CA 4U5GA 1CPRA 1Q0KA 2HV7A 4XPWA 2EILC 1PD0A 2R9RB 1OCCC 3ITFA 3UGPA 3GEEA 4MW3A 1LPEA 4P6IC 1NG1A 3EGDA 3L8IA 3RKOF 3KL4A 2NG1A 4BJ6C 3W2VA 4E0HA 5IY5C 3ZSUA 1E84A 1D0ZA 4MVRA 3POVA 4H4KC 4EWCA 2YL3A 4JKVA 3B0UX 1JAFA 5COMA 2A0BA 3B71A 2Z15A 3FOOA 1U6HA 1LI7A 1S05A 2P7VA 4W8KA 3EG9A 4PFOA 5CI9A 1VLSA 4J32B 2B0HA 1V4AA 1TWGA 2J45A 1JRAA 2XL4A 3ASOC 4Z9HA 3U3BA 5A6KA 2EIMC 3UMHA 4CS7A 4JTDB 2L6FA 1E86A 1LIHA 1VYKA 5T3WA 3ZIBA 2A6HF 2L9JA 4BEMJ 4XTKA 1OKKD 3ZVRA 3KMIA 2R03A 3LEVA 4JJFA 1MQVA 4XEKA 1ORYA 2WZFA 2XM4A 1C03A 3IQ6A 3S9OA 5KYWB 2KW3C 5EK0A 3TQOA 3K33A 4AE4B 4YT8A 3EZHA 2J0XA 2MHRA 2YQYA 5L0GA 5KYUB 3I4UA 1Z63A 5DLJA 3QMKA 5A69A 2CGEA 1ZW2A 2VC9A 2R7QA 2Q9BA 3EZIA 2JX0A 2R7SA 2J7PA 2HSQA 3EH1A 2FFHA 4NCQA 5B1AC 1U89A 3DM9B 1G8XA 2PFDA 1NU9C 1ZHYA 4DVZA 5D92A 4IARA 4JEAA 3JYYA 4LDKA 1WOLA 5T3TA 1TWCA 2J0WA 3UMKA 3DKAA 2PP4A 4BEJA 4LLCA 4D4NA 5JT4A 3QTHA 2PX3A 1NFNA 1M2VA 2GAQA 2LIGA 3SEOA 3JYHA 4O7GA 4DRIB 3FOPA 4YL0A 2JD3A 3U8PA 4DRJB 2Y39A 4R32A 3DE9A 3MX3A 3ZC4A 4HE8D 1YDIA 3JSEO 2XL8A 5DS5A 4C7OB 2R7OA 3SXZA 5T1DB 1Z6AA 3O10A 3U3FA 4D4XA 3B0VC 1VLTA 2A69F 4KI2A 1RMVA 2CYDA 2X0CA 3U8VA 4RDAA 1B68A 3CSKA 4MQ9F 3J06A 2L7AA 4U9DA 3T6JA 1ZHXA 4YL1A 2KNHA 2WB7A 1K04A 2EINC 3QW0A 1G5ZA 2R02A 1WTYA 3VRCA 4J7YA 3GWNA 3O55A 1YARO 3RH3A 1DOVA 2EPLX 4EHPA 2ASRA 1YZCA 2YVKA 4LDQA 2F22A 4MTGA 3UR3C 3S29A 3AG1C 2J9BA 4MTOA 1E2XA 2P61A 4OIOF 3S28A 2CNWD 1ZHWA 2OEXA 4KC9A 2PX0A 2YEVA 1U0BB 1FFHA 3K66A 1APCA 3BRJA 4HFFB 5JSLA 4XPXA 1HMOA 1VTMP 4HEAJ 3E70C 4I3MA 4YK5A 4P9TA 4U5HA 3E9VA 2P6VA 1NSGB 4W8PA 2CCYA 2W45A 3AGUA 1RCPA 3ABMC 3LUTB 5L0JA 1OCRC 3H2VA 1PV3A 1T6QA 2AVKA 4K0DA 4G7HF 1ZW3A 2OJQA 1SZIA 2NSGA 3OWTA 3W2WA 3DAGA 3GODA 1HW1A 1L3PA 1V54C 3EHMA 4CSAA 1TR2A 1MNDA 2CDQA 5JRAA 2QLAA 2AWCA 3B0PA 2NUPB 2XLOA 4FAPB 4CX9A 3LS1A 2D5RB 4O6NA 1QKRA 2HUJA 1OW6A 5KYNA 3TOMA 2XLDA 3ZDLA 4ER9A 2HJMA 3QW1A 5E33A 4C3EA 3JTLO 5E2QA 4GQHA 5B3SC 2R7TA 3EPVA 1AVOB 2PBEA 4J7TA 4P9FA 2H7OA 5JS5A 1FR0A 2WVQA 4OINF 2Q7RA 1GM5A 2HKVA 4LDRA 3PDMP 1Y4CA 2D4UA 3LLKA 4A2NB 2L6GA 2AU5A 3HKKA 3LS0A 1HE9A 3W8IA 4IRUA 2VCAA 3MFNA 4ULWA 2A6EF 3GEIA 3UMIA 5L0HA 3GM3A 2LFDA 3C8ZA 2H7BA 4JCZA 4NC3A 2KYHA 4NQFA 4YT5A 4DOZA 3KPHA 4OIPF 3BEHA 4O6MA 1OCZC 1T6IA 1D1AA 2J46A 3L0IA 2RD9A 3WG7C 5D91A 3TK0A 3DXJF 3FVYA 3ZQYA 4H54A 2KGOA 3TULA 4JC7A 4DRHB 3U9MA 4NTBA 2AWYA 1LKXA 3EH2A 1MMDA 1ZZPA 2Q3TA 1JMWA 1CPQA 2YHSA 3SP1A 2R25A 3AGTA 3C7JA 4AE4A 1XZQA 2LQGA 4BJ5A 3EFOA 2QY9A 1OW8A 3K6BA 4U9EA 1ST6A 1MMNA 5E3AA 3WHNA 4BJTA 1H9GA 3G4ZA 1SMYF 5L0FA 3C62A 3UGOA 2G3VA 2ZXWC 4PR9A 2I15A 2IXPA 3UNGC 2HJ3A 1YLMA 4OIRF 1MMAA 3T6BA 2Y69C 2R7WA 1F1MA 3Q6NA 1ZHZA 3RYLA 2VASA 4GEHA 2GWWA 3RQGA 4NY3A 4I1MA 2QUPA 3B9QA 4O79A 1TFOB 2G62A 5DVWA 1SR2A 3TOLA 3N0TA 1H7IA 1K05A 4CDYA 4Z9JA 5CI8A 5GPGB 1KNYA 1J8YF 1D0XA 2VB6A 1RJ9A 4U5FE 2OOCA 4PJNA 2R7UA 3LEOA 5A6AA 1M57C 4BG0A 2OQMA 4JE9A 3ZWIA 4DVYP 3ABKC 5BUOA 1ORSC 5HSWA 2DGJA 3F47A 2DYRC 3RW0A 1YVIA 3Q6MA 4EKWA 1K40A 3MLGA 3ZTZA 4FWVA 2ZPAA 3AOUA 1YA7O 3JZ0A 1TWAA 2IXOA 1EKYA 1JR8A 2J9WA 1TQGA 1LVKA 1QPUA 3O6XA 4I1OB 3EGXA 4ZLDA 3NYJA 3LAYA 3DJNB 4IAOA 2W4BA 2XS1A 1A7VA 3GANA 1A7EA 1OXBA 2L81A 2XM0A 4MVOA 1M56C 4K1OA 4PJJA 5CIVA 4XLPF 1CGME 3IPMO 4K7BA 1MMGA 1VMAA 3SZRA 3K1HA 3S27A 5F5HA 1QVXA 3L1MA 4CS9C 3U2MA 4YWQA 2QNLA 3WAQA 4MNDA 1O5HA 2B0JA 3NMIA 1BR2A 3ZTMA 4ANJA 1M2VB 2A68F 4BJ5C 2NUTB 3AG4C 3K7DA 1BR1A 2YL7A 3NKEA 2YLIA 3R7CA 3AG2C 2DI3A 3KYIA 3SYNA 1D1BA 3I5PA 3S0XA 1OCOC 1SF8A 2XL6A 3C8GD 4U5EE 3LJBA 1R5ID 1JOGA 3KYJA 4RBNA 3IQTA 4JRZA 4PACA 5BQHA 5L0DA 1D1CA 3S84A 2LFFA 2Q4FA 1TKNA 1ZYRF 3US6A 1QLEC 1Q0MA 3U0CA 3HLZA 1ZVZA 4QI0A 2G3KA 1Q0GA 2XLHA 1I5NA 2BE5F 3M15A 4LLEA 3A11A 3HNIA 1MNEA 4XEFA 1KTMA 1AEPA 1WGWA 4XQ1A 3T9OA 4EUKB 2EPOA 3H65A 2WL8A 3PHF2 2YWAA 2GDCA 2Y3HA 4YT2A 2IXMA 2MYSA 3EFOB 2NSFA 3RF3A 3SXKA 2W4MA 3AG3C 1LS4A 4O6YA 4OD4A 4KBLA 4U5DE 3V7OA 2IM8A 2NPUA 3Q7LA 1YA9A 4QDLA 4DBRA 1BR4A 2CW0F 4LERA 4MVUA 4PK4A 3RVYA 2XXAA 1YYJA 1IW7F 4B6IA 3X1OA 3T4RA 3M1CB 4Z9IA 5AGFA 2KQ9A 3O39A 1I4ZA 1Z3IX 4JZAA 3T6GB 2V3CC 3EHNA 5KYYA 1Z5ZA 2O9XA 2LK4A 4WABA 1OW7A 3QVZA 3FDQA 3SXMA 1RXQA 2L6HA 1OR2A 1G4US 3PMRA 4OD5A 2XXAB 1G4WR 1CGNA 3ZQVA 3AQCA 2OG2A 4MTFA 1SYQA 3F46A 4KNVA 4DBQA 2HFIA 4N4WA 4JJGA 5L0IA 4EBJA 3RVZA 5L3QA 3R2PA 2VCBA 1HW2A 1WATA 2KJGA 1HMDA 1Z23A 1FNTc 4U5CE 1QZXA 2ZXRA 2YL1A 4AX2A 4JVSA 2M4EA 2MWQA 2OEVA 2A1DD 2R05A 3NYMA 3CEXA 4IGGA 1BDJB 4IWBA 3TJ5A 4M63A 5DQZA 4E18A 1OR3A 5DS4A 2A0UA 2FAPB 2UUHA 3X2QC 2WVOA 3KKBA 5COGA 2J9VA 5B3IA 5BQGA 1LI5A 3CAXA 1T01A 2X51A 1FMWA 3GM2A 2NUPA 1IZMA 3GORA 3RQEA 2EIKC 3NMKA 1JPNA 3IQ5A 256BA 3EGDB 3GWLA 4G0HA 4IAQA 5DQTA 3DZAA 2W9YA 1YZAA 1ORJA 3VM6A 2LSEA 2IBFA 5EHHA 2KSFA 3C8GA 3K1IA 1WN0A 1A7DA 4JTAB 1VK5A 5JVEA 5A6BA 2XSEA 3ZG1A 4MW8A 2EPKX 1M2OA 3FMSA 4CS8A 4WGYA 1M6TA 2XLWA 3DMDA 5A6BD 3OEOA 5HV9A 1FFTC 4FX5A 3U5SA 5JLIA 5EGYA 1E85A 1T9KA 5AC4A 2IYLD 4J30B 4CS9A 5AC5A 3N24A 3EQLF 3TD7A 4CBEA 2XS8A 4XEVA 5JP7A 4PJLA 4E17A 4Q4ZF 1JPJA 1UFBA 4MVMA 2ICWG 1HY5A 1NLXA 3LNRA 3V5ZA 4U5BE 5KYWA 4F4BA 2H7VC 1NBBA 2Y3GA 4ZLCA 3LLIA 5KYYB 3M79A 1VYIA 2YLDA 1LM3B 2TMVP 4YT4A 2ETSA 1PCXA 3M4CA 2XLEA 3EJNA 1NU7D 2Y3DA 3JRTA 3SNHA 3TJ6A 1VOMA 2YLGA 1A41A 1LS1A 4JCHA 3DAFA 4X0RA 4XWJA 1T5OA 4WJ0A 4AL0A 1FTSA 1OQCA 2Q9CA 1TFKB 1S7ZA 1Z7Qc 1XWJA 4LACB 3IEEA 3EGXB 4AK9A 1H6GA 5KYXA 4N06A 1QQ3A 1T6UA 5E3CA 2HSBA 1RKEA 2Y3BA 4DJ9A 5L3VA 2YKZA 3C18A 2E87A 5JUAA 1C02A 1D0YA 2AP3A 1AUEA 3DI5A 3FAPB 3HNKA 2R7VA 2KC3A 2LD6A 4CJOA 4EBBA 1LE2A 1ZU4A 4XPYA 1OXKA 2IXNA 1XZPA 4AL1A 1H9TA 1N1CA 2GFHA 4PFPA 4GYTA 1BBHA 4E7ZA 2BL2A 4DXWA 4WGZA 5BQIA 4JW1A 4A4AA 3RIPA 3C8GB 4Q5SF 3QVYA 3DM5A 3LNMB 1V74B 2OU6A 2JPUA 4KNWA 2CNWA 2FGYA 2OCCC 5TJ5E 2HZ8A 1R4TA 5DS6A 1NFOA 3FHDA 1NZEA 1Q0DA 1A0BA 1Q0FA 3HNLA 3LESA 1EA8A 3RFYA 3RQFA 4CDVA 3MYFA 3GM1A 3NKDA 2DB4A 2OKUA 3VYWA 3ECSA 3JRMO 3DJUB 4EIYA 1CGOA 3ATPA 1WASA 3N2ZB 4OIQF 2OJED 1O87A 3JCUQ 2ZD9A 4YJWA 5F5FA 2QTVA 1FMVA 2KK1A 1I4YA 4IB4A 3CQZA 3WODF 3U2LA 4G78A 1FAPB 5B1BC 4CJGA 2J8WA 3AJMA 3I5QA 2RSEB 2WVNA 4JTCB 4PJMA 4XLNF 5COFA 2XRHA 3NG1A 3EG9B 3DWWA 2UUIA 3HJCA 1UG7A 2P0NA 2VH3A 3M4BA 2WZGA 4HFKB 3FAJA 2EPMX 3GEHA 4JEBA 2LCHA 4N6HA 2YRFA 3JSZA 4YL3A 4CS8C 5FCLA 2P1AA 2YZSA 4JIOA 4Q7CA 5KYXB 4MVZA 4ULVA 2NUTA 1DOWA 3SXYA 2C04A 1LE4A 4N6CA 2R7RA 3Q7GA 1GGQA 1PD1A 2I8BA 3MYIA 4I44A 3G4XA 4NTFA 1RJ9B 3HTKC 3U9JA 2C03A 2XLMA 4ONSA 1EQ1A 3NMJA 3PCVA 4E0IA 5K0IA 3S90A 1YYXA 4G7OF 2XLVA 2ZXOA 4RD9A 1EI7A 4G7ZF 1RKCA 4CIHA 4MVSA 4JURI 5KYUA 2HS5A 3AQBA 2Q00A 1HE1A 4BJ1A 1WWPA 1GQAA 3L34A 2IOQA 3L8JA 3K1IC 4NTAA 2QE9A 5A6JA 2V26A 1OKKA 1TWHA 1ZHTA 4C7OA 2HMZA 1YAUO 3FXHA 3IQCA 4UDVA 2EPNA 1RKEB 1VB5A 1Y6DA 2H8AA 2BC5A 2J9UA 4E7SA 2R7XA 1BZ4A 3ABLC 3MBGA 4YN0B 3V5YA 4IJJA 3VAYA 1V55C 3ASNC 2ZXPA 4MS2A 5FZTA 4BPMA 4C3BA 3W4YA 3V5XA 1YJGA 2DYSC 3C63A 3KH2A 2J7PD 2M64A 3CZ6A 3IHUA 4EBKA 4QI2A 2LP4A 2VCCA 1GS9A 3JT1A 2PF4E 3OA1A 3W8HA 1KU2A 3G50A 3DE8A 5F28E 4CSAC 3NYLA 1E83A 2HMQA 2GA0A 3DD7A 2WZLA 3QZCA 3HNJA 4BJ6A 4CIPA 1W2WA 3NRHA 3VF0A 1ZU5A 4CDAA 3NDBB 4MVQA 3B29A 5L0CA 2EIJC 1QSPA 4C3DA 4FESA 2PNOA 2Q9AA 4L6RA 3H2UA 2YL0A 1J8MF 1O3UA 3A9CA 2HV6A
chains in the Genus database with same CATH topology
4U5GA 2HV7A 2EILC 1PD0A 1OCCC 3ITFA 3UGPA 4P6IC 1NG1A 3EGDA 3RKOF 4BJ6C 3KL4A 2NG1A 5IY5C 3W2VA 3ZSUA 1D0ZA 3POVA 4H4KC 4EWCA 3B0UX 2Z15A 2P7VA 4W8KA 3EG9A 4PFOA 5CI9A 4J32B 1TWGA 2J45A 2XL4A 3ASOC 2EIMC 3UMHA 4CS7A 1VYKA 5T3WA 3ZIBA 2A6HF 2L9JA 4XTKA 1OKKD 3ZVRA 3KMIA 4JJFA 3LEVA 5KYWB 2WZFA 2KW3C 3K33A 4AE4B 4YT8A 3EZHA 2J0XA 5KYUB 3I4UA 1Z63A 5DLJA 3QMKA 2CGEA 2R7QA 2Q9BA 3EZIA 2R7SA 2J7PA 3EH1A 5B1AC 2FFHA 3DM9B 1G8XA 2PFDA 1NU9C 1ZHYA 4DVZA 5D92A 5T3TA 4BEJA 1TWCA 2J0WA 3UMKA 2PP4A 4LLCA 2PX3A 1M2VA 3SEOA 3JYHA 4O7GA 2JD3A 2Y39A 3MX3A 3ZC4A 4HE8D 5DS5A 4C7OB 2R7OA 3B0VC 5T1DB 1Z6AA 4KI2A 2A69F 4RDAA 3CSKA 4MQ9F 3T6JA 1ZHXA 2KNHA 2WB7A 2EINC 3RH3A 3UR3C 3S29A 3AG1C 4OIOF 3S28A 2CNWD 1ZHWA 4KC9A 2PX0A 2YEVA 1FFHA 3K66A 4HFFB 4HEAJ 3E70C 4I3MA 4U5HA 3E9VA 2P6VA 2W45A 3ABMC 1OCRC 4K0DA 4G7HF 1SZIA 3W2WA 3OWTA 3DAGA 3GODA 1V54C 3EHMA 4CSAA 1TR2A 1MNDA 2CDQA 3B0PA 2NUPB 3LS1A 2D5RB 4O6NA 5KYNA 5E33A 4C3EA 5E2QA 5B3SC 2R7TA 3EPVA 2H7OA 2WVQA 4OINF 3LLKA 4A2NB 3LS0A 3W8IA 4IRUA 4ULWA 3UMIA 2A6EF 4DOZA 2H7BA 4YT5A 4OIPF 4O6MA 1OCZC 1D1AA 2J46A 3L0IA 3WG7C 5D91A 3DXJF 3FVYA 2KGOA 1LKXA 3EH2A 1MMDA 2Q3TA 2YHSA 3SP1A 4AE4A 4BJ5A 3EFOA 2QY9A 3K6BA 1ST6A 1MMNA 5E3AA 4BJTA 1SMYF 3UGOA 2G3VA 2ZXWC 2IXPA 3UNGC 4OIRF 1MMAA 3T6BA 2Y69C 2R7WA 3Q6NA 1ZHZA 3RYLA 2VASA 4GEHA 4NY3A 4I1MA 3B9QA 4O79A 2G62A 5DVWA 3N0TA 5CI8A 1J8YF 1D0XA 2VB6A 1RJ9A 4U5FE 4PJNA 2R7UA 1M57C 4BG0A 4DVYP 3ABKC 5BUOA 5HSWA 2DGJA 3F47A 2DYRC 3Q6MA 3MLGA 4FWVA 2ZPAA 1TWAA 2IXOA 2J9WA 1LVKA 4I1OB 3O6XA 3EGXA 4ZLDA 3NYJA 3LAYA 4IAOA 3DJNB 2W4BA 3GANA 2L81A 4XLPF 1M56C 4PJJA 4K7BA 1MMGA 1VMAA 3SZRA 3K1HA 3S27A 5F5HA 4CS9C 4YWQA 4MNDA 1O5HA 2B0JA 4ANJA 1BR2A 1M2VB 2A68F 4BJ5C 2NUTB 3AG4C 3K7DA 1BR1A 3NKEA 3AG2C 3SYNA 1D1BA 3I5PA 3S0XA 1OCOC 1SF8A 4U5EE 3LJBA 4RBNA 1D1CA 1TKNA 1ZYRF 1QLEC 3HLZA 4QI0A 2G3KA 2BE5F 4LLEA 1MNEA 1WGWA 3H65A 2WL8A 2Y3HA 4YT2A 2IXMA 2MYSA 3EFOB 2W4MA 3AG3C 4O6YA 4OD4A 4KBLA 4U5DE 3V7OA 3Q7LA 4DBRA 4QDLA 2XXAA 1BR4A 2CW0F 4LERA 4PK4A 1IW7F 4B6IA 3X1OA 3T4RA 3M1CB 2KQ9A 3O39A 1Z3IX 4JZAA 2V3CC 3EHNA 5KYYA 1Z5ZA 2O9XA 3FDQA 4OD5A 3PMRA 2XXAB 3AQCA 2OG2A 3F46A 4KNVA 4DBQA 4JJGA 5L3QA 2KJGA 1Z23A 4U5CE 1QZXA 2ZXRA 4AX2A 4JVSA 2M4EA 2MWQA 3NYMA 2A1DD 4IWBA 5DQZA 4M63A 5DS4A 3X2QC 2WVOA 3KKBA 2J9VA 2X51A 1FMWA 2NUPA 1IZMA 2EIKC 1JPNA 3EGDB 4G0HA 5DQTA 3DZAA 2W9YA 2LSEA 5EHHA 1VK5A 2XSEA 3ZG1A 1M2OA 4CS8A 3DMDA 3OEOA 1FFTC 4FX5A 5EGYA 2IYLD 4J30B 4CS9A 3N24A 3EQLF 3TD7A 4CBEA 4PJLA 4Q4ZF 1JPJA 3LNRA 4U5BE 5KYWA 4F4BA 2H7VC 4ZLCA 2Y3GA 3LLIA 5KYYB 1VYIA 4YT4A 1PCXA 3EJNA 1NU7D 2Y3DA 3JRTA 3SNHA 1VOMA 1LS1A 4JCHA 3DAFA 4X0RA 4XWJA 4WJ0A 1FTSA 2Q9CA 1S7ZA 4LACB 3IEEA 3EGXB 4AK9A 5KYXA 4N06A 5E3CA 2Y3BA 5L3VA 2E87A 1D0YA 2R7VA 4EBBA 1ZU4A 2IXNA 1N1CA 2GFHA 4PFPA 4GYTA 4E7ZA 4JW1A 3RIPA 4Q5SF 3DM5A 4KNWA 2CNWA 2FGYA 2OCCC 5DS6A 3FHDA 1NZEA 3RFYA 3NKDA 3VYWA 3ECSA 3DJUB 3N2ZB 4OIQF 1O87A 3JCUQ 4YJWA 5F5FA 2QTVA 1FMVA 3CQZA 3WODF 5B1BC 3I5QA 2WVNA 4PJMA 4XLNF 2XRHA 3NG1A 3EG9B 3HJCA 2VH3A 4HFKB 3PHF2 2WZGA 3FAJA 3JSZA 4CS8C 5FCLA 2YZSA 4Q7CA 5KYXB 2NUTA 2C04A 2R7RA 3Q7GA 1PD1A 2I8BA 4I44A 1RJ9B 3HTKC 2C03A 4G7OF 2ZXOA 1J8MF 4RD9A 4G7ZF 4CIHA 4JURI 5KYUA 3AQBA 4BJ1A 3L34A 2IOQA 3K1IC 2V26A 1OKKA 1TWHA 1ZHTA 4C7OA 2J9UA 4E7SA 2R7XA 3ABLC 4YN0B 4IJJA 3VAYA 1V55C 3ASNC 2ZXPA 4C3BA 2DYSC 3KH2A 2J7PD 3CZ6A 4QI2A 3JT1A 2PF4E 3OA1A 3W8HA 1KU2A 4CSAC 3NYLA 3DD7A 2WZLA 3QZCA 4BJ6A 1W2WA 3NRHA 1ZU5A 3NDBB 2EIJC 4C3DA 4FESA 2Q9AA 3LESA 2HV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CBE A;  4BG0 A; 
#chains in the Genus database with same CATH topology
 1C17 M;  1L7C A;  4U5G A;  1CPR A;  1Q0K A;  2HV7 A;  4XPW A;  2EIL C;  1PD0 A;  2R9R B;  1OCC C;  3ITF A;  3UGP A;  3GEE A;  4MW3 A;  1LPE A;  4P6I C;  1NG1 A;  3EGD A;  3L8I A;  3RKO F;  3KL4 A;  2NG1 A;  4BJ6 C;  3W2V A;  4E0H A;  5IY5 C;  3ZSU A;  1E84 A;  1D0Z A;  4MVR A;  3POV A;  4H4K C;  4EWC A;  2YL3 A;  4JKV A;  3B0U X;  1JAF A;  5COM A;  2A0B A;  3B71 A;  2Z15 A;  3FOO A;  1U6H A;  1LI7 A;  1S05 A;  2P7V A;  4W8K A;  3EG9 A;  4PFO A;  5CI9 A;  1VLS A;  4J32 B;  2B0H A;  1V4A A;  1TWG A;  2J45 A;  1JRA A;  2XL4 A;  3ASO C;  4Z9H A;  3U3B A;  5A6K A;  2EIM C;  3UMH A;  4CS7 A;  4JTD B;  2L6F A;  1E86 A;  1LIH A;  1VYK A;  5T3W A;  3ZIB A;  2A6H F;  2L9J A;  4BEM J;  4XTK A;  1OKK D;  3ZVR A;  3KMI A;  2R03 A;  3LEV A;  4JJF A;  1MQV A;  4XEK A;  1ORY A;  2WZF A;  2XM4 A;  1C03 A;  3IQ6 A;  3S9O A;  5KYW B;  2KW3 C;  5EK0 A;  3TQO A;  3K33 A;  4AE4 B;  4YT8 A;  3EZH A;  2J0X A;  2MHR A;  2YQY A;  5L0G A;  5KYU B;  3I4U A;  1Z63 A;  5DLJ A;  3QMK A;  5A69 A;  2CGE A;  1ZW2 A;  2VC9 A;  2R7Q A;  2Q9B A;  3EZI A;  2JX0 A;  2R7S A;  2J7P A;  2HSQ A;  3EH1 A;  2FFH A;  4NCQ A;  5B1A C;  1U89 A;  3DM9 B;  1G8X A;  2PFD A;  1NU9 C;  1ZHY A;  4DVZ A;  5D92 A;  4IAR A;  4JEA A;  3JYY A;  4LDK A;  1WOL A;  5T3T A;  1TWC A;  2J0W A;  3UMK A;  3DKA A;  2PP4 A;  4BEJ A;  4LLC A;  4D4N A;  5JT4 A;  3QTH A;  2PX3 A;  1NFN A;  1M2V A;  2GAQ A;  2LIG A;  3SEO A;  3JYH A;  4O7G A;  4DRI B;  3FOP A;  4YL0 A;  2JD3 A;  3U8P A;  4DRJ B;  2Y39 A;  4R32 A;  3DE9 A;  3MX3 A;  3ZC4 A;  4HE8 D;  1YDI A;  3JSE O;  2XL8 A;  5DS5 A;  4C7O B;  2R7O A;  3SXZ A;  5T1D B;  1Z6A A;  3O10 A;  3U3F A;  4D4X A;  3B0V C;  1VLT A;  2A69 F;  4KI2 A;  1RMV A;  2CYD A;  2X0C A;  3U8V A;  4RDA A;  1B68 A;  3CSK A;  4MQ9 F;  3J06 A;  2L7A A;  4U9D A;  3T6J A;  1ZHX A;  4YL1 A;  2KNH A;  2WB7 A;  1K04 A;  2EIN C;  3QW0 A;  1G5Z A;  2R02 A;  1WTY A;  3VRC A;  4J7Y A;  3GWN A;  3O55 A;  1YAR O;  3RH3 A;  1DOV A;  2EPL X;  4EHP A;  2ASR A;  1YZC A;  2YVK A;  4LDQ A;  2F22 A;  4MTG A;  3UR3 C;  3S29 A;  3AG1 C;  2J9B A;  4MTO A;  1E2X A;  2P61 A;  4OIO F;  3S28 A;  2CNW D;  1ZHW A;  2OEX A;  4KC9 A;  2PX0 A;  2YEV A;  1U0B B;  1FFH A;  3K66 A;  1APC A;  3BRJ A;  4HFF B;  5JSL A;  4XPX A;  1HMO A;  1VTM P;  4HEA J;  3E70 C;  4I3M A;  4YK5 A;  4P9T A;  4U5H A;  3E9V A;  2P6V A;  1NSG B;  4W8P A;  2CCY A;  2W45 A;  3AGU A;  1RCP A;  3ABM C;  3LUT B;  5L0J A;  1OCR C;  3H2V A;  1PV3 A;  1T6Q A;  2AVK A;  4K0D A;  4G7H F;  1ZW3 A;  2OJQ A;  1SZI A;  2NSG A;  3OWT A;  3W2W A;  3DAG A;  3GOD A;  1HW1 A;  1L3P A;  1V54 C;  3EHM A;  4CSA A;  1TR2 A;  1MND A;  2CDQ A;  5JRA A;  2QLA A;  2AWC A;  3B0P A;  2NUP B;  2XLO A;  4FAP B;  4CX9 A;  3LS1 A;  2D5R B;  4O6N A;  1QKR A;  2HUJ A;  1OW6 A;  5KYN A;  3TOM A;  2XLD A;  3ZDL A;  4ER9 A;  2HJM A;  3QW1 A;  5E33 A;  4C3E A;  3JTL O;  5E2Q A;  4GQH A;  5B3S C;  2R7T A;  3EPV A;  1AVO B;  2PBE A;  4J7T A;  4P9F A;  2H7O A;  5JS5 A;  1FR0 A;  2WVQ A;  4OIN F;  2Q7R A;  1GM5 A;  2HKV A;  4LDR A;  3PDM P;  1Y4C A;  2D4U A;  3LLK A;  4A2N B;  2L6G A;  2AU5 A;  3HKK A;  3LS0 A;  1HE9 A;  3W8I A;  4IRU A;  2VCA A;  3MFN A;  4ULW A;  2A6E F;  3GEI A;  3UMI A;  5L0H A;  3GM3 A;  2LFD A;  3C8Z A;  2H7B A;  4JCZ A;  4NC3 A;  2KYH A;  4NQF A;  4YT5 A;  4DOZ A;  3KPH A;  4OIP F;  3BEH A;  4O6M A;  1OCZ C;  1T6I A;  1D1A A;  2J46 A;  3L0I A;  2RD9 A;  3WG7 C;  5D91 A;  3TK0 A;  3DXJ F;  3FVY A;  3ZQY A;  4H54 A;  2KGO A;  3TUL A;  4JC7 A;  4DRH B;  3U9M A;  4NTB A;  2AWY A;  1LKX A;  3EH2 A;  1MMD A;  1ZZP A;  2Q3T A;  1JMW A;  1CPQ A;  2YHS A;  3SP1 A;  2R25 A;  3AGT A;  3C7J A;  4AE4 A;  1XZQ A;  2LQG A;  4BJ5 A;  3EFO A;  2QY9 A;  1OW8 A;  3K6B A;  4U9E A;  1ST6 A;  1MMN A;  5E3A A;  3WHN A;  4BJT A;  1H9G A;  3G4Z A;  1SMY F;  5L0F A;  3C62 A;  3UGO A;  2G3V A;  2ZXW C;  4PR9 A;  2I15 A;  2IXP A;  3UNG C;  2HJ3 A;  1YLM A;  4OIR F;  1MMA A;  3T6B A;  2Y69 C;  2R7W A;  1F1M A;  3Q6N A;  1ZHZ A;  3RYL A;  2VAS A;  4GEH A;  2GWW A;  3RQG A;  4NY3 A;  4I1M A;  2QUP A;  3B9Q A;  4O79 A;  1TFO B;  2G62 A;  5DVW A;  1SR2 A;  3TOL A;  3N0T A;  1H7I A;  1K05 A;  4CDY A;  4Z9J A;  5CI8 A;  5GPG B;  1KNY A;  1J8Y F;  1D0X A;  2VB6 A;  1RJ9 A;  4U5F E;  2OOC A;  4PJN A;  2R7U A;  3LEO A;  5A6A A;  1M57 C;  4BG0 A;  2OQM A;  4JE9 A;  3ZWI A;  4DVY P;  3ABK C;  5BUO A;  1ORS C;  5HSW A;  2DGJ A;  3F47 A;  2DYR C;  3RW0 A;  1YVI A;  3Q6M A;  4EKW A;  1K40 A;  3MLG A;  3ZTZ A;  4FWV A;  2ZPA A;  3AOU A;  1YA7 O;  3JZ0 A;  1TWA A;  2IXO A;  1EKY A;  1JR8 A;  2J9W A;  1TQG A;  1LVK A;  1QPU A;  3O6X A;  4I1O B;  3EGX A;  4ZLD A;  3NYJ A;  3LAY A;  3DJN B;  4IAO A;  2W4B A;  2XS1 A;  1A7V A;  3GAN A;  1A7E A;  1OXB A;  2L81 A;  2XM0 A;  4MVO A;  1M56 C;  4K1O A;  4PJJ A;  5CIV A;  4XLP F;  1CGM E;  3IPM O;  4K7B A;  1MMG A;  1VMA A;  3SZR A;  3K1H A;  3S27 A;  5F5H A;  1QVX A;  3L1M A;  4CS9 C;  3U2M A;  4YWQ A;  2QNL A;  3WAQ A;  4MND A;  1O5H A;  2B0J A;  3NMI A;  1BR2 A;  3ZTM A;  4ANJ A;  1M2V B;  2A68 F;  4BJ5 C;  2NUT B;  3AG4 C;  3K7D A;  1BR1 A;  2YL7 A;  3NKE A;  2YLI A;  3R7C A;  3AG2 C;  2DI3 A;  3KYI A;  3SYN A;  1D1B A;  3I5P A;  3S0X A;  1OCO C;  1SF8 A;  2XL6 A;  3C8G D;  4U5E E;  3LJB A;  1R5I D;  1JOG A;  3KYJ A;  4RBN A;  3IQT A;  4JRZ A;  4PAC A;  5BQH A;  5L0D A;  1D1C A;  3S84 A;  2LFF A;  2Q4F A;  1TKN A;  1ZYR F;  3US6 A;  1QLE C;  1Q0M A;  3U0C A;  3HLZ A;  1ZVZ A;  4QI0 A;  2G3K A;  1Q0G A;  2XLH A;  1I5N A;  2BE5 F;  3M15 A;  4LLE A;  3A11 A;  3HNI A;  1MNE A;  4XEF A;  1KTM A;  1AEP A;  1WGW A;  4XQ1 A;  3T9O A;  4EUK B;  2EPO A;  3H65 A;  2WL8 A;  3PHF 2;  2YWA A;  2GDC A;  2Y3H A;  4YT2 A;  2IXM A;  2MYS A;  3EFO B;  2NSF A;  3RF3 A;  3SXK A;  2W4M A;  3AG3 C;  1LS4 A;  4O6Y A;  4OD4 A;  4KBL A;  4U5D E;  3V7O A;  2IM8 A;  2NPU A;  3Q7L A;  1YA9 A;  4QDL A;  4DBR A;  1BR4 A;  2CW0 F;  4LER A;  4MVU A;  4PK4 A;  3RVY A;  2XXA A;  1YYJ A;  1IW7 F;  4B6I A;  3X1O A;  3T4R A;  3M1C B;  4Z9I A;  5AGF A;  2KQ9 A;  3O39 A;  1I4Z A;  1Z3I X;  4JZA A;  3T6G B;  2V3C C;  3EHN A;  5KYY A;  1Z5Z A;  2O9X A;  2LK4 A;  4WAB A;  1OW7 A;  3QVZ A;  3FDQ A;  3SXM A;  1RXQ A;  2L6H A;  1OR2 A;  1G4U S;  3PMR A;  4OD5 A;  2XXA B;  1G4W R;  1CGN A;  3ZQV A;  3AQC A;  2OG2 A;  4MTF A;  1SYQ A;  3F46 A;  4KNV A;  4DBQ A;  2HFI A;  4N4W A;  4JJG A;  5L0I A;  4EBJ A;  3RVZ A;  5L3Q A;  3R2P A;  2VCB A;  1HW2 A;  1WAT A;  2KJG A;  1HMD A;  1Z23 A;  1FNT c;  4U5C E;  1QZX A;  2ZXR A;  2YL1 A;  4AX2 A;  4JVS A;  2M4E A;  2MWQ A;  2OEV A;  2A1D D;  2R05 A;  3NYM A;  3CEX A;  4IGG A;  1BDJ B;  4IWB A;  3TJ5 A;  4M63 A;  5DQZ A;  4E18 A;  1OR3 A;  5DS4 A;  2A0U A;  2FAP B;  2UUH A;  3X2Q C;  2WVO A;  3KKB A;  5COG A;  2J9V A;  5B3I A;  5BQG A;  1LI5 A;  3CAX A;  1T01 A;  2X51 A;  1FMW A;  3GM2 A;  2NUP A;  1IZM A;  3GOR A;  3RQE A;  2EIK C;  3NMK A;  1JPN A;  3IQ5 A;  256B A;  3EGD B;  3GWL A;  4G0H A;  4IAQ A;  5DQT A;  3DZA A;  2W9Y A;  1YZA A;  1ORJ A;  3VM6 A;  2LSE A;  2IBF A;  5EHH A;  2KSF A;  3C8G A;  3K1I A;  1WN0 A;  1A7D A;  4JTA B;  1VK5 A;  5JVE A;  5A6B A;  2XSE A;  3ZG1 A;  4MW8 A;  2EPK X;  1M2O A;  3FMS A;  4CS8 A;  4WGY A;  1M6T A;  2XLW A;  3DMD A;  5A6B D;  3OEO A;  5HV9 A;  1FFT C;  4FX5 A;  3U5S A;  5JLI A;  5EGY A;  1E85 A;  1T9K A;  5AC4 A;  2IYL D;  4J30 B;  4CS9 A;  5AC5 A;  3N24 A;  3EQL F;  3TD7 A;  4CBE A;  2XS8 A;  4XEV A;  5JP7 A;  4PJL A;  4E17 A;  4Q4Z F;  1JPJ A;  1UFB A;  4MVM A;  2ICW G;  1HY5 A;  1NLX A;  3LNR A;  3V5Z A;  4U5B E;  5KYW A;  4F4B A;  2H7V C;  1NBB A;  2Y3G A;  4ZLC A;  3LLI A;  5KYY B;  3M79 A;  1VYI A;  2YLD A;  1LM3 B;  2TMV P;  4YT4 A;  2ETS A;  1PCX A;  3M4C A;  2XLE A;  3EJN A;  1NU7 D;  2Y3D A;  3JRT A;  3SNH A;  3TJ6 A;  1VOM A;  2YLG A;  1A41 A;  1LS1 A;  4JCH A;  3DAF A;  4X0R A;  4XWJ A;  1T5O A;  4WJ0 A;  4AL0 A;  1FTS A;  1OQC A;  2Q9C A;  1TFK B;  1S7Z A;  1Z7Q c;  1XWJ A;  4LAC B;  3IEE A;  3EGX B;  4AK9 A;  1H6G A;  5KYX A;  4N06 A;  1QQ3 A;  1T6U A;  5E3C A;  2HSB A;  1RKE A;  2Y3B A;  4DJ9 A;  5L3V A;  2YKZ A;  3C18 A;  2E87 A;  5JUA A;  1C02 A;  1D0Y A;  2AP3 A;  1AUE A;  3DI5 A;  3FAP B;  3HNK A;  2R7V A;  2KC3 A;  2LD6 A;  4CJO A;  4EBB A;  1LE2 A;  1ZU4 A;  4XPY A;  1OXK A;  2IXN A;  1XZP A;  4AL1 A;  1H9T A;  1N1C A;  2GFH A;  4PFP A;  4GYT A;  1BBH A;  4E7Z A;  2BL2 A;  4DXW A;  4WGZ A;  5BQI A;  4JW1 A;  4A4A A;  3RIP A;  3C8G B;  4Q5S F;  3QVY A;  3DM5 A;  3LNM B;  1V74 B;  2OU6 A;  2JPU A;  4KNW A;  2CNW A;  2FGY A;  2OCC C;  5TJ5 E;  2HZ8 A;  1R4T A;  5DS6 A;  1NFO A;  3FHD A;  1NZE A;  1Q0D A;  1A0B A;  1Q0F A;  3HNL A;  3LES A;  1EA8 A;  3RFY A;  3RQF A;  4CDV A;  3MYF A;  3GM1 A;  3NKD A;  2DB4 A;  2OKU A;  3VYW A;  3ECS A;  3JRM O;  3DJU B;  4EIY A;  1CGO A;  3ATP A;  1WAS A;  3N2Z B;  4OIQ F;  2OJE D;  1O87 A;  3JCU Q;  2ZD9 A;  4YJW A;  5F5F A;  2QTV A;  1FMV A;  2KK1 A;  1I4Y A;  4IB4 A;  3CQZ A;  3WOD F;  3U2L A;  4G78 A;  1FAP B;  5B1B C;  4CJG A;  2J8W A;  3AJM A;  3I5Q A;  2RSE B;  2WVN A;  4JTC B;  4PJM A;  4XLN F;  5COF A;  2XRH A;  3NG1 A;  3EG9 B;  3DWW A;  2UUI A;  3HJC A;  1UG7 A;  2P0N A;  2VH3 A;  3M4B A;  2WZG A;  4HFK B;  3FAJ A;  2EPM X;  3GEH A;  4JEB A;  2LCH A;  4N6H A;  2YRF A;  3JSZ A;  4YL3 A;  4CS8 C;  5FCL A;  2P1A A;  2YZS A;  4JIO A;  4Q7C A;  5KYX B;  4MVZ A;  4ULV A;  2NUT A;  1DOW A;  3SXY A;  2C04 A;  1LE4 A;  4N6C A;  2R7R A;  3Q7G A;  1GGQ A;  1PD1 A;  2I8B A;  3MYI A;  4I44 A;  3G4X A;  4NTF A;  1RJ9 B;  3HTK C;  3U9J A;  2C03 A;  2XLM A;  4ONS A;  1EQ1 A;  3NMJ A;  3PCV A;  4E0I A;  5K0I A;  3S90 A;  1YYX A;  4G7O F;  2XLV A;  2ZXO A;  4RD9 A;  1EI7 A;  4G7Z F;  1RKC A;  4CIH A;  4MVS A;  4JUR I;  5KYU A;  2HS5 A;  3AQB A;  2Q00 A;  1HE1 A;  4BJ1 A;  1WWP A;  1GQA A;  3L34 A;  2IOQ A;  3L8J A;  3K1I C;  4NTA A;  2QE9 A;  5A6J A;  2V26 A;  1OKK A;  1TWH A;  1ZHT A;  4C7O A;  2HMZ A;  1YAU O;  3FXH A;  3IQC A;  4UDV A;  2EPN A;  1RKE B;  1VB5 A;  1Y6D A;  2H8A A;  2BC5 A;  2J9U A;  4E7S A;  2R7X A;  1BZ4 A;  3ABL C;  3MBG A;  4YN0 B;  3V5Y A;  4IJJ A;  3VAY A;  1V55 C;  3ASN C;  2ZXP A;  4MS2 A;  5FZT A;  4BPM A;  4C3B A;  3W4Y A;  3V5X A;  1YJG A;  2DYS C;  3C63 A;  3KH2 A;  2J7P D;  2M64 A;  3CZ6 A;  3IHU A;  4EBK A;  4QI2 A;  2LP4 A;  2VCC A;  1GS9 A;  3JT1 A;  2PF4 E;  3OA1 A;  3W8H A;  1KU2 A;  3G50 A;  3DE8 A;  5F28 E;  4CSA C;  3NYL A;  1E83 A;  2HMQ A;  2GA0 A;  3DD7 A;  2WZL A;  3QZC A;  3HNJ A;  4BJ6 A;  4CIP A;  1W2W A;  3NRH A;  3VF0 A;  1ZU5 A;  4CDA A;  3NDB B;  4MVQ A;  3B29 A;  5L0C A;  2EIJ C;  1QSP A;  4C3D A;  4FES A;  2PNO A;  2Q9A A;  4L6R A;  3H2U A;  2YL0 A;  1J8M F;  1O3U A;  3A9C A;  2HV6 A; 
#chains in the Genus database with same CATH homology
 4U5G A;  2HV7 A;  2EIL C;  1PD0 A;  1OCC C;  3ITF A;  3UGP A;  4P6I C;  1NG1 A;  3EGD A;  3RKO F;  4BJ6 C;  3KL4 A;  2NG1 A;  5IY5 C;  3W2V A;  3ZSU A;  1D0Z A;  3POV A;  4H4K C;  4EWC A;  3B0U X;  2Z15 A;  2P7V A;  4W8K A;  3EG9 A;  4PFO A;  5CI9 A;  4J32 B;  1TWG A;  2J45 A;  2XL4 A;  3ASO C;  2EIM C;  3UMH A;  4CS7 A;  1VYK A;  5T3W A;  3ZIB A;  2A6H F;  2L9J A;  4XTK A;  1OKK D;  3ZVR A;  3KMI A;  4JJF A;  3LEV A;  5KYW B;  2WZF A;  2KW3 C;  3K33 A;  4AE4 B;  4YT8 A;  3EZH A;  2J0X A;  5KYU B;  3I4U A;  1Z63 A;  5DLJ A;  3QMK A;  2CGE A;  2R7Q A;  2Q9B A;  3EZI A;  2R7S A;  2J7P A;  3EH1 A;  5B1A C;  2FFH A;  3DM9 B;  1G8X A;  2PFD A;  1NU9 C;  1ZHY A;  4DVZ A;  5D92 A;  5T3T A;  4BEJ A;  1TWC A;  2J0W A;  3UMK A;  2PP4 A;  4LLC A;  2PX3 A;  1M2V A;  3SEO A;  3JYH A;  4O7G A;  2JD3 A;  2Y39 A;  3MX3 A;  3ZC4 A;  4HE8 D;  5DS5 A;  4C7O B;  2R7O A;  3B0V C;  5T1D B;  1Z6A A;  4KI2 A;  2A69 F;  4RDA A;  3CSK A;  4MQ9 F;  3T6J A;  1ZHX A;  2KNH A;  2WB7 A;  2EIN C;  3RH3 A;  3UR3 C;  3S29 A;  3AG1 C;  4OIO F;  3S28 A;  2CNW D;  1ZHW A;  4KC9 A;  2PX0 A;  2YEV A;  1FFH A;  3K66 A;  4HFF B;  4HEA J;  3E70 C;  4I3M A;  4U5H A;  3E9V A;  2P6V A;  2W45 A;  3ABM C;  1OCR C;  4K0D A;  4G7H F;  1SZI A;  3W2W A;  3OWT A;  3DAG A;  3GOD A;  1V54 C;  3EHM A;  4CSA A;  1TR2 A;  1MND A;  2CDQ A;  3B0P A;  2NUP B;  3LS1 A;  2D5R B;  4O6N A;  5KYN A;  5E33 A;  4C3E A;  5E2Q A;  5B3S C;  2R7T A;  3EPV A;  2H7O A;  2WVQ A;  4OIN F;  3LLK A;  4A2N B;  3LS0 A;  3W8I A;  4IRU A;  4ULW A;  3UMI A;  2A6E F;  4DOZ A;  2H7B A;  4YT5 A;  4OIP F;  4O6M A;  1OCZ C;  1D1A A;  2J46 A;  3L0I A;  3WG7 C;  5D91 A;  3DXJ F;  3FVY A;  2KGO A;  1LKX A;  3EH2 A;  1MMD A;  2Q3T A;  2YHS A;  3SP1 A;  4AE4 A;  4BJ5 A;  3EFO A;  2QY9 A;  3K6B A;  1ST6 A;  1MMN A;  5E3A A;  4BJT A;  1SMY F;  3UGO A;  2G3V A;  2ZXW C;  2IXP A;  3UNG C;  4OIR F;  1MMA A;  3T6B A;  2Y69 C;  2R7W A;  3Q6N A;  1ZHZ A;  3RYL A;  2VAS A;  4GEH A;  4NY3 A;  4I1M A;  3B9Q A;  4O79 A;  2G62 A;  5DVW A;  3N0T A;  5CI8 A;  1J8Y F;  1D0X A;  2VB6 A;  1RJ9 A;  4U5F E;  4PJN A;  2R7U A;  1M57 C;  4BG0 A;  4DVY P;  3ABK C;  5BUO A;  5HSW A;  2DGJ A;  3F47 A;  2DYR C;  3Q6M A;  3MLG A;  4FWV A;  2ZPA A;  1TWA A;  2IXO A;  2J9W A;  1LVK A;  4I1O B;  3O6X A;  3EGX A;  4ZLD A;  3NYJ A;  3LAY A;  4IAO A;  3DJN B;  2W4B A;  3GAN A;  2L81 A;  4XLP F;  1M56 C;  4PJJ A;  4K7B A;  1MMG A;  1VMA A;  3SZR A;  3K1H A;  3S27 A;  5F5H A;  4CS9 C;  4YWQ A;  4MND A;  1O5H A;  2B0J A;  4ANJ A;  1BR2 A;  1M2V B;  2A68 F;  4BJ5 C;  2NUT B;  3AG4 C;  3K7D A;  1BR1 A;  3NKE A;  3AG2 C;  3SYN A;  1D1B A;  3I5P A;  3S0X A;  1OCO C;  1SF8 A;  4U5E E;  3LJB A;  4RBN A;  1D1C A;  1TKN A;  1ZYR F;  1QLE C;  3HLZ A;  4QI0 A;  2G3K A;  2BE5 F;  4LLE A;  1MNE A;  1WGW A;  3H65 A;  2WL8 A;  2Y3H A;  4YT2 A;  2IXM A;  2MYS A;  3EFO B;  2W4M A;  3AG3 C;  4O6Y A;  4OD4 A;  4KBL A;  4U5D E;  3V7O A;  3Q7L A;  4DBR A;  4QDL A;  2XXA A;  1BR4 A;  2CW0 F;  4LER A;  4PK4 A;  1IW7 F;  4B6I A;  3X1O A;  3T4R A;  3M1C B;  2KQ9 A;  3O39 A;  1Z3I X;  4JZA A;  2V3C C;  3EHN A;  5KYY A;  1Z5Z A;  2O9X A;  3FDQ A;  4OD5 A;  3PMR A;  2XXA B;  3AQC A;  2OG2 A;  3F46 A;  4KNV A;  4DBQ A;  4JJG A;  5L3Q A;  2KJG A;  1Z23 A;  4U5C E;  1QZX A;  2ZXR A;  4AX2 A;  4JVS A;  2M4E A;  2MWQ A;  3NYM A;  2A1D D;  4IWB A;  5DQZ A;  4M63 A;  5DS4 A;  3X2Q C;  2WVO A;  3KKB A;  2J9V A;  2X51 A;  1FMW A;  2NUP A;  1IZM A;  2EIK C;  1JPN A;  3EGD B;  4G0H A;  5DQT A;  3DZA A;  2W9Y A;  2LSE A;  5EHH A;  1VK5 A;  2XSE A;  3ZG1 A;  1M2O A;  4CS8 A;  3DMD A;  3OEO A;  1FFT C;  4FX5 A;  5EGY A;  2IYL D;  4J30 B;  4CS9 A;  3N24 A;  3EQL F;  3TD7 A;  4CBE A;  4PJL A;  4Q4Z F;  1JPJ A;  3LNR A;  4U5B E;  5KYW A;  4F4B A;  2H7V C;  4ZLC A;  2Y3G A;  3LLI A;  5KYY B;  1VYI A;  4YT4 A;  1PCX A;  3EJN A;  1NU7 D;  2Y3D A;  3JRT A;  3SNH A;  1VOM A;  1LS1 A;  4JCH A;  3DAF A;  4X0R A;  4XWJ A;  4WJ0 A;  1FTS A;  2Q9C A;  1S7Z A;  4LAC B;  3IEE A;  3EGX B;  4AK9 A;  5KYX A;  4N06 A;  5E3C A;  2Y3B A;  5L3V A;  2E87 A;  1D0Y A;  2R7V A;  4EBB A;  1ZU4 A;  2IXN A;  1N1C A;  2GFH A;  4PFP A;  4GYT A;  4E7Z A;  4JW1 A;  3RIP A;  4Q5S F;  3DM5 A;  4KNW A;  2CNW A;  2FGY A;  2OCC C;  5DS6 A;  3FHD A;  1NZE A;  3RFY A;  3NKD A;  3VYW A;  3ECS A;  3DJU B;  3N2Z B;  4OIQ F;  1O87 A;  3JCU Q;  4YJW A;  5F5F A;  2QTV A;  1FMV A;  3CQZ A;  3WOD F;  5B1B C;  3I5Q A;  2WVN A;  4PJM A;  4XLN F;  2XRH A;  3NG1 A;  3EG9 B;  3HJC A;  2VH3 A;  4HFK B;  3PHF 2;  2WZG A;  3FAJ A;  3JSZ A;  4CS8 C;  5FCL A;  2YZS A;  4Q7C A;  5KYX B;  2NUT A;  2C04 A;  2R7R A;  3Q7G A;  1PD1 A;  2I8B A;  4I44 A;  1RJ9 B;  3HTK C;  2C03 A;  4G7O F;  2ZXO A;  1J8M F;  4RD9 A;  4G7Z F;  4CIH A;  4JUR I;  5KYU A;  3AQB A;  4BJ1 A;  3L34 A;  2IOQ A;  3K1I C;  2V26 A;  1OKK A;  1TWH A;  1ZHT A;  4C7O A;  2J9U A;  4E7S A;  2R7X A;  3ABL C;  4YN0 B;  4IJJ A;  3VAY A;  1V55 C;  3ASN C;  2ZXP A;  4C3B A;  2DYS C;  3KH2 A;  2J7P D;  3CZ6 A;  4QI2 A;  3JT1 A;  2PF4 E;  3OA1 A;  3W8H A;  1KU2 A;  4CSA C;  3NYL A;  3DD7 A;  2WZL A;  3QZC A;  4BJ6 A;  1W2W A;  3NRH A;  1ZU5 A;  3NDB B;  2EIJ C;  4C3D A;  4FES A;  2Q9A A;  3LES A;  2HV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...