4BG0A

Crystal structure of complement factors h and fhl-1 binding protein bbh06 or crasp-2 from borrelia burgdorferi
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
214
structure length
205
Chain Sequence
GRLNQRNINELKIFVEKAKYYSIKLDAIYNECTGAYNDIMTYSDQSKVNQAISIFKKDNKIVNKFKELEKIIEEYKPMFLSKLIDDFAIELDQAVDNARHVADSYKKLRKSVVLAYIESFDVISSKFVDSKFVEASKKFVNKAKEFVEENDLIALECIVKTIGDMVNDREINSRSRYNNFYKKEADFLGAAVELEGAYKAIKQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of Cspz, a Complement Regulator Factor H and Fhl-1 Binding Protein from Borrelia Burgdorferi.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Cell adhesion
molecule keywords COMPLEMENT REGULATOR-ACQUIRING SURFACE PROTEIN 2 (CRASP-2 (C
total genus 88
structure length 205
sequence length 214
ec nomenclature
pdb deposition date 2013-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1640 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bg0A00
4CBEA 4BG0A
chains in the Genus database with same CATH superfamily
2R7OA 4MTOA 4DBQA 4IJJA 5COFA 3BEHA 1VB5A 3BRJA 1PV3A 1MMAA 3UMHA 5DS6A 2EPOA 1RJ9B 2AP3A 2LK4A 4FESA 5L0CA 2I8BA 3DE8A 4AL0A 2NUPA 5BQGA 2A68F 1BR4A 4OIRF 2FFHA 2V26A 4G0HA 1QZXA 2CCYA 1M2OA 5KYUA 4PJJA 3MYFA 4CSAA 4Q4ZF 3SZRA 3N0TA 3NYMA 4CDAA 1NBBA 1T6UA 5CI8A 1VYKA 4U5CE 2MWQA 1YYXA 4RDAA 4CJOA 3N2ZB 1LS4A 3JRMO 2KJGA 4FAPB 3EFOA 3HTKC 4AE4B 4JCZA 2XL8A 2J45A 3GANA 3G4XA 3ZSUA 1QLEC 1G4WR 2QNLA 1HE1A 1NFNA 2YLGA 2VCAA 3G50A 4QDLA 3S90A 2P61A 1J8YF 3NKDA 5KYWB 1OKKA 1YA9A 1CPQA 3UGOA 4KNVA 1G8XA 2EINC 2R02A 3U2LA 5JT4A 3NDBB 2Q4FA 4JIOA 5F28E 2EIKC 3CZ6A 3TULA 2LFFA 3KYIA 4MVZA 3G4ZA 1OKKD 1T01A 2YWAA 1LKXA 3LUTB 3DM5A 3B29A 3M15A 1ZHXA 4BJ5C 1XZQA 2R7SA 4JEBA 3L8JA 5BUOA 2HFIA 4ER9A 3U2MA 1QSPA 1LI7A 1ZW3A 2VCCA 2R7TA 5KYYA 3T9OA 4OIOF 1GGQA 3DD7A 4MVMA 2XLWA 1V54C 2YQYA 3LNMB 2Q3TA 3VYWA 1VOMA 2UUHA 2XXAB 1H9GA 4ULWA 1A7EA 1FAPB 1G4US 1TWHA 2RSEB 4QI0A 1LPEA 3SXMA 2NPUA 2AU5A 2M64A 2PF4E 4YL3A 4YT5A 4NQFA 2F22A 2P1AA 2YL0A 3RH3A 3RQGA 3ABKC 1AVOB 1GS9A 1K04A 2VC9A 4IWBA 1F1MA 2WL8A 2EPLX 2YRFA 2EIMC 2LSEA 2XLHA 4PJLA 5EGYA 2EPNA 3F46A 3ABMC 1U6HA 4MNDA 3SP1A 4BJ1A 1WATA 2G62A 3EZIA 4CBEA 5KYUB 4KI2A 1D0XA 2ASRA 1OCZC 1A41A 2YL7A 3U0CA 1E85A 2YEVA 1Z5ZA 3B9QA 3O6XA 4O6YA 3EHMA 2Y3DA 4YT8A 5IY5C 1IZMA 1Q0DA 3LEVA 4CIHA 2XSEA 1NU9C 3RQFA 2FAPB 3LNRA 1ORYA 2PBEA 2DI3A 2BE5F 4FWVA 2XLOA 1OW6A 2BL2A 2L7AA 1LVKA 3JRTA 4XLNF 2Y3BA 1TWGA 2C03A 1ZHTA 2A69F 3GEIA 3ATPA 4XWJA 1E84A 3ZQVA 1JPJA 3EG9A 1RKEA 2OEXA 1FMWA 5JSLA 5E2QA 4DRJB 4N4WA 1Q0MA 4U5HA 2Q00A 1I5NA 1FNTc 4G7HF 1RCPA 2L6GA 4LLEA 4LLCA 2HUJA 3DAGA 3GEEA 3W4YA 2X0CA 3IHUA 1M2VA 3SXZA 3E70C 4LERA 3EQLF 4D4NA 1KTMA 4L6RA 4MVQA 2J7PD 2XM4A 3TQOA 3EPVA 1XZPA 3RW0A 3V7OA 3HJCA 5JS5A 4DBRA 4JRZA 4JEAA 1BR1A 2YL3A 4EBBA 3LS0A 4IAQA 2J9WA 3VF0A 3LEOA 4IAOA 5FCLA 4UDVA 4ZLDA 3RKOF 4DVYP 1UG7A 5BQIA 3AQBA 3AQCA 2R03A 1O5HA 3S28A 4IRUA 5F5HA 1SMYF 4BPMA 3IPMO 1ZU4A 2R9RB 1FTSA 2YHSA 1A7DA 1G5ZA 4EHPA 3K6BA 1LI5A 2I15A 4EBJA 2QE9A 4BEJA 3OA1A 4MS2A 4XLPF 1QVXA 1LE4A 2HV7A 2NSGA 5FZTA 4J7TA 3JCUQ 4P9FA 4I44A 3VAYA 3ITFA 3GM3A 1EI7A 1S7ZA 4JZAA 4WGYA 2OQMA 2J9BA 1VYIA 4XQ1A 2OJQA 3KPHA 2J0XA 3H2VA 3K33A 3ZIBA 5JUAA 1KNYA 2ICWG 4NC3A 5L0DA 1ST6A 3CSKA 5EK0A 5GPGB 1WGWA 4BJ6A 1H9TA 1Q0FA 2J46A 3DXJF 2CGEA 2Q9BA 2Y39A 4LACB 4RBNA 3PDMP 4E0IA 1RXQA 3JTLO 2M4EA 1WASA 2HV6A 2KNHA 1OW8A 3HKKA 2J9UA 4GQHA 2AVKA 1I4YA 2PP4A 3EH2A 3EZHA 4AE4A 3C8ZA 2LCHA 2IM8A 3X1OA 1VMAA 4NTBA 4PFPA 4E18A 1L7CA 1TWAA 1E2XA 2GDCA 3FOOA 4CDVA 2XL6A 3ZTZA 2DB4A 2QLAA 2IBFA 2JD3A 3E9VA 2R7RA 3HNKA 2YZSA 5T3WA 1CGNA 4Z9IA 5B3SC 2FGYA 4P6IC 2R7XA 1IW7F 3AG2C 3NMJA 4EUKB 3Q7GA 3U8VA 2PX0A 1E86A 2DYSC 2EILC 3MFNA 4CX9A 3CAXA 5DQTA 3FAJA 5L0IA 2YLIA 2KC3A 2QTVA 3F47A 2XLVA 1WOLA 1U89A 3IEEA 2GWWA 1DOVA 1HMDA 3Q6MA 4IB4A 1SYQA 4MQ9F 4CS9C 4CJGA 5L0JA 3DAFA 1E83A 1RKEB 2A1DD 1H7IA 3EG9B 4HFKB 1ZHWA 3H65A 4NY3A 2HJMA 1D1CA 3GEHA 1YA7O 1VK5A 3Q7LA 4BJ6C 3C8GD 3JSZA 2R7UA 4XPXA 3GODA 1WTYA 4F4BA 2JX0A 2KGOA 1HE9A 3SNHA 3W8HA 4AX2A 2NUPB 5D92A 3TK0A 1D0ZA 1HW1A 1NU7D 4O6MA 3SXKA 3U3BA 2NG1A 2QY9A 3ZVRA 4XTKA 4CS8C 5L0HA 3UGPA 3IQTA 4M63A 3T4RA 2OCCC 1A7VA 2H7BA 3C8GB 1MMGA 4U5GA 4WABA 4I3MA 5A6BD 3FXHA 4JJFA 3B71A 4HFFB 4NTFA 4JCHA 2WB7A 3SXYA 4DJ9A 4U5DE 3B0VC 4DVZA 2L6HA 1FMVA 5KYNA 3KMIA 2MHRA 1BR2A 2G3VA 4JW1A 3L0IA 2YLDA 3RFYA 3M79A 1VLTA 4XPWA 1XWJA 3S29A 1LM3B 3LLKA 4U5BE 2VCBA 5EHHA 4C7OA 1UFBA 3MYIA 5COGA 1Z7Qc 4BG0A 1M2VB 2YL1A 1OCCC 4ULVA 1BBHA 1Z3IX 2RD9A 4A2NB 1QPUA 4J32B 3ZWIA 3K1HA 2IXMA 1V74B 2X51A 3IQ6A 5E3AA 1U0BB 3AGUA 2ZPAA 2J7PA 1LIHA 3FAPB 2E87A 4LDQA 1D1BA 3S9OA 4JTCB 1TR2A 2QUPA 5L3VA 4WJ0A 3VM6A 4HE8D 4I1OB 4PJNA 3K1IC 2HSBA 3KH2A 3KL4A 1K05A 2J8WA 3LJBA 4AK9A 3X2QC 3OWTA 4CS9A 2ZXRA 4J7YA 2KYHA 4MVRA 4GYTA 4K7BA 5A6KA 2GA0A 3EJNA 1EKYA 2P6VA 1NZEA 2D4UA 2NUTA 1TQGA 5DQZA 1FFTC 2W9YA 1OCRC 3KKBA 1BDJB 5DS4A 5HSWA 2CYDA 3DI5A 3L1MA 1Q0KA 3M4BA 3O55A 3R2PA 3B0UX 2R7VA 1CGOA 3A9CA 3WHNA 1MNDA 1M56C 3U9JA 4RD9A 3AOUA 2ZD9A 2CNWD 3VRCA 1YLMA 2NSFA 3L8IA 4EWCA 1A0BA 3DJUB 1PCXA 4ZLCA 2IXOA 1V55C 1OXBA 4W8KA 5JRAA 5K0IA 2H7VC 2IXNA 2IXPA 3DZAA 3OEOA 4NTAA 4ONSA 2OEVA 3FMSA 3LLIA 3NMIA 3EGDB 3FOPA 4YL0A 5KYXB 4Z9HA 2V3CC 4OIQF 3EGDA 2Y3GA 2YVKA 3R7CA 4JURI 2WZLA 4DXWA 1GQAA 4DRHB 3IQ5A 1O3UA 3V5ZA 5CI9A 2Y3HA 3EFOB 3PHF2 4G7ZF 3J06A 4PACA 3PMRA 3ZTMA 3GORA 3B0PA 2KW3C 1KU2A 1YZCA 2GAQA 3ECSA 3N24A 3RVZA 4AL1A 1EQ1A 2PFDA 5TJ5E 2AWYA 3ZQYA 1FFHA 2UUIA 2DYRC 4YT2A 4HEAJ 1PD0A 1Q0GA 3KYJA 1Z63A 3U9MA 1T6IA 1HW2A 3ABLC 2XLDA 2VASA 3C62A 4MVOA 2ZXPA 4JC7A 2IYLD 2D5RB 2L81A 4JJGA 256BA 2XL4A 3QW1A 3WODF 1OXKA 4A4AA 5A69A 3DMDA 4G78A 1QQ3A 5JP7A 1EA8A 3EH1A 1WWPA 2P0NA 1TWCA 3S27A 3RYLA 1AEPA 1ZHZA 1RMVA 4N6CA 4BJ5A 4O6NA 4FX5A 1JR8A 1O87A 1B68A 2G3KA 4OIPF 3S84A 1YZAA 2CDQA 1D0YA 3C7JA 2W45A 5B1BC 3IQCA 1NSGB 3JT1A 3JYHA 1FR0A 2HSQA 1ZHYA 4N6HA 5A6JA 1YARO 5KYWA 4JKVA 1YJGA 3AG3C 1MNEA 5KYXA 3FDQA 1OR2A 2Q9CA 1Z23A 5B3IA 2OKUA 4EIYA 4CSAC 4IGGA 4E0HA 4OD4A 5HV9A 3U3FA 4R32A 1JOGA 4E17A 5JVEA 2J0WA 3AG4C 4N06A 2CNWA 1SR2A 2WZFA 2B0JA 3JSEO 2R7QA 5DVWA 5A6AA 4MTFA 4KBLA 2HMZA 3QVYA 3T6BA 4CS7A 3AG1C 4E7ZA 1CGME 3ZDLA 2R05A 2Q9AA 1I4ZA 1V4AA 2PNOA 3UR3C 2J9VA 2HJ3A 3M4CA 3NG1A 4X0RA 4YJWA 1Z6AA 4PR9A 3RVYA 4CIPA 1DOWA 1LS1A 3U8PA 2HS5A 2B0HA 3UMIA 3M1CB 2VH3A 4O79A 4XEVA 3RQEA 2LIGA 3TOLA 4JVSA 3TJ5A 4LDRA 2Y69C 3PCVA 2XLMA 3W8IA 4JE9A 2EPKX 4LDKA 2W4BA 1NLXA 1TKNA 5A6BA 5L3QA 4JTDB 4KC9A 3TJ6A 2OOCA 1SF8A 1SZIA 2YKZA 1MQVA 3A11A 3H2UA 3V5XA 1T5OA 4H54A 5BQHA 1TFOB 2MYSA 4YT4A 2EIJC 3C18A 3S0XA 2XRHA 3DE9A 5D91A 2WVOA 3LAYA 2KK1A 4Z9JA 1AUEA 3NKEA 5E33A 4XEFA 1T9KA 1JRAA 1S05A 1WN0A 2TMVP 2A6EF 4JTAB 5F5FA 1VLSA 3SYNA 2KSFA 4IARA 4YN0B 3O39A 5COMA 4Q7CA 3UNGC 1ORSC 5B1AC 3QVZA 4WGZA 3QTHA 4O7GA 4U9EA 5L0GA 4GEHA 1M6TA 3SEOA 3T6JA 2R25A 1ZZPA 3K7DA 4I1MA 2ZXWC 4J30B 1PD1A 4K1OA 5KYYB 1OR3A 1OW7A 3UMKA 3Q6NA 1C17M 1Y4CA 3QW0A 2L9JA 2O9XA 5E3CA 3EGXA 3WG7C 1R5ID 1ORJA 4U9DA 1YAUO 3MX3A 4G7OF 1H6GA 2OG2A 5AC5A 1W2WA 3POVA 1CPRA 3RF3A 2NUTB 4MW3A 4MTGA 2WZGA 1RJ9A 3LS1A 3US6A 4YL1A 1TFKB 1YYJA 3V5YA 5DLJA 3NYLA 3EGXB 3CQZA 4KNWA 3W2WA 2OJED 4K0DA 2A0UA 2JPUA 3T6GB 3QZCA 3MLGA 1OQCA 2XS1A 5CIVA 4U5EE 3EHNA 3ZC4A 3NMKA 3I5QA 1MMNA 1C02A 3DKAA 4MW8A 4NCQA 3DM9B 2R7WA 3LESA 2LQGA 3DJNB 2DGJA 3GM1A 2PX3A 4OD5A 2ZXOA 4Q5SF 2HMQA 3I5PA 4P9TA 2VB6A 2XLEA 4DOZA 1MMDA 4MVSA 3TOMA 3ZG1A 5JLIA 1ZU5A 2OU6A 2C04A 4MVUA 3GWLA 2A0BA 3HLZA 1K40A 1BZ4A 4EKWA 3WAQA 2ETSA 2H8AA 2Q7RA 1J8MF 2GFHA 2HZ8A 2BC5A 4C3EA 4C3DA 1LE2A 1NFOA 4XPYA 4W8PA 2H7OA 3MBGA 5L0FA 2W4MA 1VTMP 4YWQA 1M57C 2XM0A 4C3BA 1JAFA 4OINF 3C8GA 1ZYRF 3RIPA 1L3PA 3AGTA 3AJMA 1JMWA 5T1DB 1NG1A 5DS5A 3FVYA 4DRIB 4PFOA 1RKCA 4BEMJ 2WVNA 3HNIA 2CW0F 2A6HF 3FHDA 4QI2A 1YVIA 1C03A 4B6IA 4H4KC 3W2VA 2LD6A 4BJTA 1OCOC 1GM5A 1Y6DA 1R4TA 3NRHA 3JZ0A 3L34A 4PK4A 4D4XA 1QKRA 4XEKA 2IOQA 5AC4A 3ASOC 3JYYA 2P7VA 5AGFA 2L6FA 3O10A 2HKVA 3QMKA 2Z15A 4U5FE 1D1AA 2LP4A 1YDIA 3HNLA 1T6QA 1ZW2A 4PJMA 2KQ9A 4ANJA 3DWWA 1APCA 2XS8A 3HNJA 2AWCA 5T3TA 4C7OB 1ZVZA 4CDYA 3NYJA 3GWNA 3K1IA 3TD7A 1JPNA 2LFDA 4E7SA 3C63A 2XXAA 2WVQA 4YK5A 3U5SA 4CS8A 1N1CA 3ASNC 3K66A 2EPMX 1HY5A 1HMOA 3GM2A 4EBKA 3CEXA 3I4UA
chains in the Genus database with same CATH topology
2R7OA 4DBQA 4IJJA 3UMHA 1MMAA 5DS6A 1RJ9B 4FESA 2I8BA 2NUPA 2A68F 1BR4A 4OIRF 2FFHA 2V26A 4G0HA 1QZXA 1M2OA 5KYUA 4PJJA 4CSAA 4Q4ZF 3SZRA 3N0TA 3NYMA 5CI8A 1VYKA 4U5CE 2MWQA 4RDAA 3N2ZB 2KJGA 3EFOA 3HTKC 4AE4B 2J45A 3GANA 3ZSUA 1QLEC 4QDLA 1J8YF 3NKDA 5KYWB 1OKKA 3UGOA 4KNVA 1G8XA 2EINC 3NDBB 2EIKC 3CZ6A 1OKKD 1LKXA 3DM5A 1ZHXA 4BJ5C 2R7SA 5BUOA 2R7TA 5KYYA 4OIOF 3DD7A 1V54C 2Q3TA 3VYWA 1VOMA 2XXAB 4ULWA 1TWHA 4QI0A 2PF4E 4YT5A 3RH3A 3ABKC 4IWBA 2WL8A 2EIMC 2LSEA 4PJLA 5EGYA 3F46A 3ABMC 4MNDA 3SP1A 4BJ1A 3EZIA 2G62A 4CBEA 5KYUB 4KI2A 1D0XA 1OCZC 2YEVA 1Z5ZA 3B9QA 3O6XA 4O6YA 3EHMA 2Y3DA 4YT8A 5IY5C 1IZMA 4CIHA 3LEVA 2XSEA 1NU9C 3LNRA 2BE5F 4FWVA 1LVKA 3JRTA 4XLNF 2Y3BA 1TWGA 2C03A 1ZHTA 2A69F 4XWJA 1JPJA 3EG9A 1FMWA 5E2QA 4U5HA 4G7HF 4LLEA 4LLCA 3DAGA 1M2VA 3E70C 4LERA 3EQLF 2J7PD 3EPVA 3V7OA 3HJCA 4DBRA 1BR1A 4EBBA 3LS0A 4ZLDA 2J9WA 4IAOA 5FCLA 3RKOF 4DVYP 3AQBA 3AQCA 3S28A 1O5HA 5F5HA 4IRUA 1SMYF 1ZU4A 1FTSA 2YHSA 3K6BA 4BEJA 3OA1A 4XLPF 2HV7A 3JCUQ 4I44A 3VAYA 3ITFA 1S7ZA 4JZAA 1VYIA 2J0XA 3K33A 3ZIBA 1ST6A 3CSKA 4BJ6A 1WGWA 2J46A 3DXJF 2CGEA 2Q9BA 2Y39A 4LACB 4RBNA 2M4EA 2HV6A 2KNHA 2J9UA 3EH2A 2PP4A 3EZHA 4AE4A 3X1OA 1VMAA 4PFPA 1TWAA 2JD3A 3E9VA 2R7RA 2YZSA 5T3WA 5B3SC 2R7XA 2FGYA 4P6IC 1IW7F 3AG2C 3Q7GA 2PX0A 2DYSC 2EILC 5DQTA 3FAJA 2QTVA 3F47A 3IEEA 3Q6MA 4CS9C 4MQ9F 3DAFA 2A1DD 3EG9B 4HFKB 1ZHWA 3H65A 4NY3A 1D1CA 1VK5A 3Q7LA 4BJ6C 2R7UA 3JSZA 3GODA 4F4BA 2KGOA 3SNHA 3W8HA 4AX2A 2NUPB 5D92A 1D0ZA 4O6MA 1NU7D 3ZVRA 4CS8C 2NG1A 2QY9A 3UGPA 4XTKA 3T4RA 4M63A 2OCCC 2H7BA 4U5GA 1MMGA 4I3MA 4JJFA 4HFFB 4JCHA 2WB7A 4U5DE 3B0VC 4DVZA 1FMVA 5KYNA 3KMIA 1BR2A 2G3VA 4JW1A 3L0IA 3RFYA 3S29A 3LLKA 4U5BE 5EHHA 4C7OA 4BG0A 1M2VB 1OCCC 1Z3IX 4A2NB 4J32B 3K1HA 2IXMA 2X51A 5E3AA 2ZPAA 2J7PA 2E87A 1D1BA 1TR2A 5L3VA 4WJ0A 4HE8D 4I1OB 4PJNA 3K1IC 3KL4A 3KH2A 3LJBA 4AK9A 3X2QC 3OWTA 4CS9A 2ZXRA 4GYTA 4K7BA 3EJNA 2P6VA 1NZEA 2NUTA 5DQZA 1FFTC 2W9YA 1OCRC 3KKBA 5DS4A 5HSWA 2R7VA 3B0UX 1MNDA 1M56C 4RD9A 2CNWD 4EWCA 3DJUB 1PCXA 4ZLCA 2IXOA 1V55C 4W8KA 2H7VC 2IXNA 2IXPA 3DZAA 3OEOA 3LLIA 3EGDB 5KYXB 2V3CC 4OIQF 3EGDA 2Y3GA 4JURI 2WZLA 5CI9A 2Y3HA 3EFOB 3PHF2 4G7ZF 3PMRA 3B0PA 2KW3C 1KU2A 3ECSA 3N24A 2PFDA 1FFHA 2DYRC 4YT2A 4HEAJ 1PD0A 1Z63A 3ABLC 2VASA 2ZXPA 2IYLD 2D5RB 2L81A 4JJGA 2XL4A 3WODF 3DMDA 3EH1A 1TWCA 3S27A 3RYLA 1ZHZA 4BJ5A 4O6NA 4FX5A 1O87A 2G3KA 4OIPF 2CDQA 1D0YA 2W45A 5B1BC 3JYHA 3JT1A 1ZHYA 5KYWA 3AG3C 1MNEA 5KYXA 3FDQA 4CSAC 2Q9CA 1Z23A 4OD4A 2J0WA 3AG4C 4N06A 2CNWA 2WZFA 2B0JA 2R7QA 5DVWA 4KBLA 3T6BA 4CS7A 3AG1C 4E7ZA 2Q9AA 3UR3C 2J9VA 3NG1A 4YJWA 4X0RA 1Z6AA 1LS1A 3UMIA 3M1CB 2VH3A 4O79A 4JVSA 2Y69C 3W8IA 2W4BA 1TKNA 5L3QA 4KC9A 1SF8A 1SZIA 2MYSA 4YT4A 2EIJC 3S0XA 2XRHA 5D91A 2WVOA 3LAYA 3NKEA 5E33A 2A6EF 5F5FA 3SYNA 4YN0B 3O39A 4Q7CA 3UNGC 5B1AC 4O7GA 4GEHA 3SEOA 3T6JA 4I1MA 3K7DA 4J30B 2ZXWC 1PD1A 5KYYB 3UMKA 3Q6NA 2L9JA 2O9XA 5E3CA 3EGXA 3WG7C 3MX3A 4G7OF 2OG2A 1W2WA 3POVA 2NUTB 2WZGA 1RJ9A 3LS1A 5DLJA 3NYLA 3EGXB 3CQZA 4KNWA 3W2WA 4K0DA 3QZCA 3MLGA 4U5EE 3EHNA 3ZC4A 3I5QA 1MMNA 2R7WA 3DM9B 3LESA 3DJNB 2DGJA 2PX3A 4OD5A 2ZXOA 4Q5SF 3I5PA 4DOZA 2VB6A 1MMDA 3ZG1A 1ZU5A 2C04A 3HLZA 1J8MF 2GFHA 4C3EA 4C3DA 2H7OA 2W4MA 4YWQA 1M57C 4C3BA 4OINF 1ZYRF 3RIPA 5T1DB 1NG1A 5DS5A 3FVYA 4PFOA 2WVNA 2CW0F 2A6HF 3FHDA 4QI2A 4B6IA 4H4KC 3W2VA 4BJTA 1OCOC 3NRHA 3L34A 4PK4A 2IOQA 3ASOC 2P7VA 3QMKA 2Z15A 4U5FE 1D1AA 4PJMA 2KQ9A 4ANJA 5T3TA 4C7OB 3NYJA 3TD7A 1JPNA 4E7SA 2XXAA 2WVQA 4CS8A 1N1CA 3ASNC 3K66A 3I4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CBE A;  4BG0 A; 
#chains in the Genus database with same CATH topology
 2R7O A;  4MTO A;  4DBQ A;  4IJJ A;  5COF A;  3BEH A;  1VB5 A;  3BRJ A;  1PV3 A;  1MMA A;  3UMH A;  5DS6 A;  2EPO A;  1RJ9 B;  2AP3 A;  2LK4 A;  4FES A;  5L0C A;  2I8B A;  3DE8 A;  4AL0 A;  2NUP A;  5BQG A;  2A68 F;  1BR4 A;  4OIR F;  2FFH A;  2V26 A;  4G0H A;  1QZX A;  2CCY A;  1M2O A;  5KYU A;  4PJJ A;  3MYF A;  4CSA A;  4Q4Z F;  3SZR A;  3N0T A;  3NYM A;  4CDA A;  1NBB A;  1T6U A;  5CI8 A;  1VYK A;  4U5C E;  2MWQ A;  1YYX A;  4RDA A;  4CJO A;  3N2Z B;  1LS4 A;  3JRM O;  2KJG A;  4FAP B;  3EFO A;  3HTK C;  4AE4 B;  4JCZ A;  2XL8 A;  2J45 A;  3GAN A;  3G4X A;  3ZSU A;  1QLE C;  1G4W R;  2QNL A;  1HE1 A;  1NFN A;  2YLG A;  2VCA A;  3G50 A;  4QDL A;  3S90 A;  2P61 A;  1J8Y F;  3NKD A;  5KYW B;  1OKK A;  1YA9 A;  1CPQ A;  3UGO A;  4KNV A;  1G8X A;  2EIN C;  2R02 A;  3U2L A;  5JT4 A;  3NDB B;  2Q4F A;  4JIO A;  5F28 E;  2EIK C;  3CZ6 A;  3TUL A;  2LFF A;  3KYI A;  4MVZ A;  3G4Z A;  1OKK D;  1T01 A;  2YWA A;  1LKX A;  3LUT B;  3DM5 A;  3B29 A;  3M15 A;  1ZHX A;  4BJ5 C;  1XZQ A;  2R7S A;  4JEB A;  3L8J A;  5BUO A;  2HFI A;  4ER9 A;  3U2M A;  1QSP A;  1LI7 A;  1ZW3 A;  2VCC A;  2R7T A;  5KYY A;  3T9O A;  4OIO F;  1GGQ A;  3DD7 A;  4MVM A;  2XLW A;  1V54 C;  2YQY A;  3LNM B;  2Q3T A;  3VYW A;  1VOM A;  2UUH A;  2XXA B;  1H9G A;  4ULW A;  1A7E A;  1FAP B;  1G4U S;  1TWH A;  2RSE B;  4QI0 A;  1LPE A;  3SXM A;  2NPU A;  2AU5 A;  2M64 A;  2PF4 E;  4YL3 A;  4YT5 A;  4NQF A;  2F22 A;  2P1A A;  2YL0 A;  3RH3 A;  3RQG A;  3ABK C;  1AVO B;  1GS9 A;  1K04 A;  2VC9 A;  4IWB A;  1F1M A;  2WL8 A;  2EPL X;  2YRF A;  2EIM C;  2LSE A;  2XLH A;  4PJL A;  5EGY A;  2EPN A;  3F46 A;  3ABM C;  1U6H A;  4MND A;  3SP1 A;  4BJ1 A;  1WAT A;  2G62 A;  3EZI A;  4CBE A;  5KYU B;  4KI2 A;  1D0X A;  2ASR A;  1OCZ C;  1A41 A;  2YL7 A;  3U0C A;  1E85 A;  2YEV A;  1Z5Z A;  3B9Q A;  3O6X A;  4O6Y A;  3EHM A;  2Y3D A;  4YT8 A;  5IY5 C;  1IZM A;  1Q0D A;  3LEV A;  4CIH A;  2XSE A;  1NU9 C;  3RQF A;  2FAP B;  3LNR A;  1ORY A;  2PBE A;  2DI3 A;  2BE5 F;  4FWV A;  2XLO A;  1OW6 A;  2BL2 A;  2L7A A;  1LVK A;  3JRT A;  4XLN F;  2Y3B A;  1TWG A;  2C03 A;  1ZHT A;  2A69 F;  3GEI A;  3ATP A;  4XWJ A;  1E84 A;  3ZQV A;  1JPJ A;  3EG9 A;  1RKE A;  2OEX A;  1FMW A;  5JSL A;  5E2Q A;  4DRJ B;  4N4W A;  1Q0M A;  4U5H A;  2Q00 A;  1I5N A;  1FNT c;  4G7H F;  1RCP A;  2L6G A;  4LLE A;  4LLC A;  2HUJ A;  3DAG A;  3GEE A;  3W4Y A;  2X0C A;  3IHU A;  1M2V A;  3SXZ A;  3E70 C;  4LER A;  3EQL F;  4D4N A;  1KTM A;  4L6R A;  4MVQ A;  2J7P D;  2XM4 A;  3TQO A;  3EPV A;  1XZP A;  3RW0 A;  3V7O A;  3HJC A;  5JS5 A;  4DBR A;  4JRZ A;  4JEA A;  1BR1 A;  2YL3 A;  4EBB A;  3LS0 A;  4IAQ A;  2J9W A;  3VF0 A;  3LEO A;  4IAO A;  5FCL A;  4UDV A;  4ZLD A;  3RKO F;  4DVY P;  1UG7 A;  5BQI A;  3AQB A;  3AQC A;  2R03 A;  1O5H A;  3S28 A;  4IRU A;  5F5H A;  1SMY F;  4BPM A;  3IPM O;  1ZU4 A;  2R9R B;  1FTS A;  2YHS A;  1A7D A;  1G5Z A;  4EHP A;  3K6B A;  1LI5 A;  2I15 A;  4EBJ A;  2QE9 A;  4BEJ A;  3OA1 A;  4MS2 A;  4XLP F;  1QVX A;  1LE4 A;  2HV7 A;  2NSG A;  5FZT A;  4J7T A;  3JCU Q;  4P9F A;  4I44 A;  3VAY A;  3ITF A;  3GM3 A;  1EI7 A;  1S7Z A;  4JZA A;  4WGY A;  2OQM A;  2J9B A;  1VYI A;  4XQ1 A;  2OJQ A;  3KPH A;  2J0X A;  3H2V A;  3K33 A;  3ZIB A;  5JUA A;  1KNY A;  2ICW G;  4NC3 A;  5L0D A;  1ST6 A;  3CSK A;  5EK0 A;  5GPG B;  1WGW A;  4BJ6 A;  1H9T A;  1Q0F A;  2J46 A;  3DXJ F;  2CGE A;  2Q9B A;  2Y39 A;  4LAC B;  4RBN A;  3PDM P;  4E0I A;  1RXQ A;  3JTL O;  2M4E A;  1WAS A;  2HV6 A;  2KNH A;  1OW8 A;  3HKK A;  2J9U A;  4GQH A;  2AVK A;  1I4Y A;  2PP4 A;  3EH2 A;  3EZH A;  4AE4 A;  3C8Z A;  2LCH A;  2IM8 A;  3X1O A;  1VMA A;  4NTB A;  4PFP A;  4E18 A;  1L7C A;  1TWA A;  1E2X A;  2GDC A;  3FOO A;  4CDV A;  2XL6 A;  3ZTZ A;  2DB4 A;  2QLA A;  2IBF A;  2JD3 A;  3E9V A;  2R7R A;  3HNK A;  2YZS A;  5T3W A;  1CGN A;  4Z9I A;  5B3S C;  2FGY A;  4P6I C;  2R7X A;  1IW7 F;  3AG2 C;  3NMJ A;  4EUK B;  3Q7G A;  3U8V A;  2PX0 A;  1E86 A;  2DYS C;  2EIL C;  3MFN A;  4CX9 A;  3CAX A;  5DQT A;  3FAJ A;  5L0I A;  2YLI A;  2KC3 A;  2QTV A;  3F47 A;  2XLV A;  1WOL A;  1U89 A;  3IEE A;  2GWW A;  1DOV A;  1HMD A;  3Q6M A;  4IB4 A;  1SYQ A;  4MQ9 F;  4CS9 C;  4CJG A;  5L0J A;  3DAF A;  1E83 A;  1RKE B;  2A1D D;  1H7I A;  3EG9 B;  4HFK B;  1ZHW A;  3H65 A;  4NY3 A;  2HJM A;  1D1C A;  3GEH A;  1YA7 O;  1VK5 A;  3Q7L A;  4BJ6 C;  3C8G D;  3JSZ A;  2R7U A;  4XPX A;  3GOD A;  1WTY A;  4F4B A;  2JX0 A;  2KGO A;  1HE9 A;  3SNH A;  3W8H A;  4AX2 A;  2NUP B;  5D92 A;  3TK0 A;  1D0Z A;  1HW1 A;  1NU7 D;  4O6M A;  3SXK A;  3U3B A;  2NG1 A;  2QY9 A;  3ZVR A;  4XTK A;  4CS8 C;  5L0H A;  3UGP A;  3IQT A;  4M63 A;  3T4R A;  2OCC C;  1A7V A;  2H7B A;  3C8G B;  1MMG A;  4U5G A;  4WAB A;  4I3M A;  5A6B D;  3FXH A;  4JJF A;  3B71 A;  4HFF B;  4NTF A;  4JCH A;  2WB7 A;  3SXY A;  4DJ9 A;  4U5D E;  3B0V C;  4DVZ A;  2L6H A;  1FMV A;  5KYN A;  3KMI A;  2MHR A;  1BR2 A;  2G3V A;  4JW1 A;  3L0I A;  2YLD A;  3RFY A;  3M79 A;  1VLT A;  4XPW A;  1XWJ A;  3S29 A;  1LM3 B;  3LLK A;  4U5B E;  2VCB A;  5EHH A;  4C7O A;  1UFB A;  3MYI A;  5COG A;  1Z7Q c;  4BG0 A;  1M2V B;  2YL1 A;  1OCC C;  4ULV A;  1BBH A;  1Z3I X;  2RD9 A;  4A2N B;  1QPU A;  4J32 B;  3ZWI A;  3K1H A;  2IXM A;  1V74 B;  2X51 A;  3IQ6 A;  5E3A A;  1U0B B;  3AGU A;  2ZPA A;  2J7P A;  1LIH A;  3FAP B;  2E87 A;  4LDQ A;  1D1B A;  3S9O A;  4JTC B;  1TR2 A;  2QUP A;  5L3V A;  4WJ0 A;  3VM6 A;  4HE8 D;  4I1O B;  4PJN A;  3K1I C;  2HSB A;  3KH2 A;  3KL4 A;  1K05 A;  2J8W A;  3LJB A;  4AK9 A;  3X2Q C;  3OWT A;  4CS9 A;  2ZXR A;  4J7Y A;  2KYH A;  4MVR A;  4GYT A;  4K7B A;  5A6K A;  2GA0 A;  3EJN A;  1EKY A;  2P6V A;  1NZE A;  2D4U A;  2NUT A;  1TQG A;  5DQZ A;  1FFT C;  2W9Y A;  1OCR C;  3KKB A;  1BDJ B;  5DS4 A;  5HSW A;  2CYD A;  3DI5 A;  3L1M A;  1Q0K A;  3M4B A;  3O55 A;  3R2P A;  3B0U X;  2R7V A;  1CGO A;  3A9C A;  3WHN A;  1MND A;  1M56 C;  3U9J A;  4RD9 A;  3AOU A;  2ZD9 A;  2CNW D;  3VRC A;  1YLM A;  2NSF A;  3L8I A;  4EWC A;  1A0B A;  3DJU B;  1PCX A;  4ZLC A;  2IXO A;  1V55 C;  1OXB A;  4W8K A;  5JRA A;  5K0I A;  2H7V C;  2IXN A;  2IXP A;  3DZA A;  3OEO A;  4NTA A;  4ONS A;  2OEV A;  3FMS A;  3LLI A;  3NMI A;  3EGD B;  3FOP A;  4YL0 A;  5KYX B;  4Z9H A;  2V3C C;  4OIQ F;  3EGD A;  2Y3G A;  2YVK A;  3R7C A;  4JUR I;  2WZL A;  4DXW A;  1GQA A;  4DRH B;  3IQ5 A;  1O3U A;  3V5Z A;  5CI9 A;  2Y3H A;  3EFO B;  3PHF 2;  4G7Z F;  3J06 A;  4PAC A;  3PMR A;  3ZTM A;  3GOR A;  3B0P A;  2KW3 C;  1KU2 A;  1YZC A;  2GAQ A;  3ECS A;  3N24 A;  3RVZ A;  4AL1 A;  1EQ1 A;  2PFD A;  5TJ5 E;  2AWY A;  3ZQY A;  1FFH A;  2UUI A;  2DYR C;  4YT2 A;  4HEA J;  1PD0 A;  1Q0G A;  3KYJ A;  1Z63 A;  3U9M A;  1T6I A;  1HW2 A;  3ABL C;  2XLD A;  2VAS A;  3C62 A;  4MVO A;  2ZXP A;  4JC7 A;  2IYL D;  2D5R B;  2L81 A;  4JJG A;  256B A;  2XL4 A;  3QW1 A;  3WOD F;  1OXK A;  4A4A A;  5A69 A;  3DMD A;  4G78 A;  1QQ3 A;  5JP7 A;  1EA8 A;  3EH1 A;  1WWP A;  2P0N A;  1TWC A;  3S27 A;  3RYL A;  1AEP A;  1ZHZ A;  1RMV A;  4N6C A;  4BJ5 A;  4O6N A;  4FX5 A;  1JR8 A;  1O87 A;  1B68 A;  2G3K A;  4OIP F;  3S84 A;  1YZA A;  2CDQ A;  1D0Y A;  3C7J A;  2W45 A;  5B1B C;  3IQC A;  1NSG B;  3JT1 A;  3JYH A;  1FR0 A;  2HSQ A;  1ZHY A;  4N6H A;  5A6J A;  1YAR O;  5KYW A;  4JKV A;  1YJG A;  3AG3 C;  1MNE A;  5KYX A;  3FDQ A;  1OR2 A;  2Q9C A;  1Z23 A;  5B3I A;  2OKU A;  4EIY A;  4CSA C;  4IGG A;  4E0H A;  4OD4 A;  5HV9 A;  3U3F A;  4R32 A;  1JOG A;  4E17 A;  5JVE A;  2J0W A;  3AG4 C;  4N06 A;  2CNW A;  1SR2 A;  2WZF A;  2B0J A;  3JSE O;  2R7Q A;  5DVW A;  5A6A A;  4MTF A;  4KBL A;  2HMZ A;  3QVY A;  3T6B A;  4CS7 A;  3AG1 C;  4E7Z A;  1CGM E;  3ZDL A;  2R05 A;  2Q9A A;  1I4Z A;  1V4A A;  2PNO A;  3UR3 C;  2J9V A;  2HJ3 A;  3M4C A;  3NG1 A;  4X0R A;  4YJW A;  1Z6A A;  4PR9 A;  3RVY A;  4CIP A;  1DOW A;  1LS1 A;  3U8P A;  2HS5 A;  2B0H A;  3UMI A;  3M1C B;  2VH3 A;  4O79 A;  4XEV A;  3RQE A;  2LIG A;  3TOL A;  4JVS A;  3TJ5 A;  4LDR A;  2Y69 C;  3PCV A;  2XLM A;  3W8I A;  4JE9 A;  2EPK X;  4LDK A;  2W4B A;  1NLX A;  1TKN A;  5A6B A;  5L3Q A;  4JTD B;  4KC9 A;  3TJ6 A;  2OOC A;  1SF8 A;  1SZI A;  2YKZ A;  1MQV A;  3A11 A;  3H2U A;  3V5X A;  1T5O A;  4H54 A;  5BQH A;  1TFO B;  2MYS A;  4YT4 A;  2EIJ C;  3C18 A;  3S0X A;  2XRH A;  3DE9 A;  5D91 A;  2WVO A;  3LAY A;  2KK1 A;  4Z9J A;  1AUE A;  3NKE A;  5E33 A;  4XEF A;  1T9K A;  1JRA A;  1S05 A;  1WN0 A;  2TMV P;  2A6E F;  4JTA B;  5F5F A;  1VLS A;  3SYN A;  2KSF A;  4IAR A;  4YN0 B;  3O39 A;  5COM A;  4Q7C A;  3UNG C;  1ORS C;  5B1A C;  3QVZ A;  4WGZ A;  3QTH A;  4O7G A;  4U9E A;  5L0G A;  4GEH A;  1M6T A;  3SEO A;  3T6J A;  2R25 A;  1ZZP A;  3K7D A;  4I1M A;  2ZXW C;  4J30 B;  1PD1 A;  4K1O A;  5KYY B;  1OR3 A;  1OW7 A;  3UMK A;  3Q6N A;  1C17 M;  1Y4C A;  3QW0 A;  2L9J A;  2O9X A;  5E3C A;  3EGX A;  3WG7 C;  1R5I D;  1ORJ A;  4U9D A;  1YAU O;  3MX3 A;  4G7O F;  1H6G A;  2OG2 A;  5AC5 A;  1W2W A;  3POV A;  1CPR A;  3RF3 A;  2NUT B;  4MW3 A;  4MTG A;  2WZG A;  1RJ9 A;  3LS1 A;  3US6 A;  4YL1 A;  1TFK B;  1YYJ A;  3V5Y A;  5DLJ A;  3NYL A;  3EGX B;  3CQZ A;  4KNW A;  3W2W A;  2OJE D;  4K0D A;  2A0U A;  2JPU A;  3T6G B;  3QZC A;  3MLG A;  1OQC A;  2XS1 A;  5CIV A;  4U5E E;  3EHN A;  3ZC4 A;  3NMK A;  3I5Q A;  1MMN A;  1C02 A;  3DKA A;  4MW8 A;  4NCQ A;  3DM9 B;  2R7W A;  3LES A;  2LQG A;  3DJN B;  2DGJ A;  3GM1 A;  2PX3 A;  4OD5 A;  2ZXO A;  4Q5S F;  2HMQ A;  3I5P A;  4P9T A;  2VB6 A;  2XLE A;  4DOZ A;  1MMD A;  4MVS A;  3TOM A;  3ZG1 A;  5JLI A;  1ZU5 A;  2OU6 A;  2C04 A;  4MVU A;  3GWL A;  2A0B A;  3HLZ A;  1K40 A;  1BZ4 A;  4EKW A;  3WAQ A;  2ETS A;  2H8A A;  2Q7R A;  1J8M F;  2GFH A;  2HZ8 A;  2BC5 A;  4C3E A;  4C3D A;  1LE2 A;  1NFO A;  4XPY A;  4W8P A;  2H7O A;  3MBG A;  5L0F A;  2W4M A;  1VTM P;  4YWQ A;  1M57 C;  2XM0 A;  4C3B A;  1JAF A;  4OIN F;  3C8G A;  1ZYR F;  3RIP A;  1L3P A;  3AGT A;  3AJM A;  1JMW A;  5T1D B;  1NG1 A;  5DS5 A;  3FVY A;  4DRI B;  4PFO A;  1RKC A;  4BEM J;  2WVN A;  3HNI A;  2CW0 F;  2A6H F;  3FHD A;  4QI2 A;  1YVI A;  1C03 A;  4B6I A;  4H4K C;  3W2V A;  2LD6 A;  4BJT A;  1OCO C;  1GM5 A;  1Y6D A;  1R4T A;  3NRH A;  3JZ0 A;  3L34 A;  4PK4 A;  4D4X A;  1QKR A;  4XEK A;  2IOQ A;  5AC4 A;  3ASO C;  3JYY A;  2P7V A;  5AGF A;  2L6F A;  3O10 A;  2HKV A;  3QMK A;  2Z15 A;  4U5F E;  1D1A A;  2LP4 A;  1YDI A;  3HNL A;  1T6Q A;  1ZW2 A;  4PJM A;  2KQ9 A;  4ANJ A;  3DWW A;  1APC A;  2XS8 A;  3HNJ A;  2AWC A;  5T3T A;  4C7O B;  1ZVZ A;  4CDY A;  3NYJ A;  3GWN A;  3K1I A;  3TD7 A;  1JPN A;  2LFD A;  4E7S A;  3C63 A;  2XXA A;  2WVQ A;  4YK5 A;  3U5S A;  4CS8 A;  1N1C A;  3ASN C;  3K66 A;  2EPM X;  1HY5 A;  1HMO A;  3GM2 A;  4EBK A;  3CEX A;  3I4U A; 
#chains in the Genus database with same CATH homology
 2R7O A;  4DBQ A;  4IJJ A;  3UMH A;  1MMA A;  5DS6 A;  1RJ9 B;  4FES A;  2I8B A;  2NUP A;  2A68 F;  1BR4 A;  4OIR F;  2FFH A;  2V26 A;  4G0H A;  1QZX A;  1M2O A;  5KYU A;  4PJJ A;  4CSA A;  4Q4Z F;  3SZR A;  3N0T A;  3NYM A;  5CI8 A;  1VYK A;  4U5C E;  2MWQ A;  4RDA A;  3N2Z B;  2KJG A;  3EFO A;  3HTK C;  4AE4 B;  2J45 A;  3GAN A;  3ZSU A;  1QLE C;  4QDL A;  1J8Y F;  3NKD A;  5KYW B;  1OKK A;  3UGO A;  4KNV A;  1G8X A;  2EIN C;  3NDB B;  2EIK C;  3CZ6 A;  1OKK D;  1LKX A;  3DM5 A;  1ZHX A;  4BJ5 C;  2R7S A;  5BUO A;  2R7T A;  5KYY A;  4OIO F;  3DD7 A;  1V54 C;  2Q3T A;  3VYW A;  1VOM A;  2XXA B;  4ULW A;  1TWH A;  4QI0 A;  2PF4 E;  4YT5 A;  3RH3 A;  3ABK C;  4IWB A;  2WL8 A;  2EIM C;  2LSE A;  4PJL A;  5EGY A;  3F46 A;  3ABM C;  4MND A;  3SP1 A;  4BJ1 A;  3EZI A;  2G62 A;  4CBE A;  5KYU B;  4KI2 A;  1D0X A;  1OCZ C;  2YEV A;  1Z5Z A;  3B9Q A;  3O6X A;  4O6Y A;  3EHM A;  2Y3D A;  4YT8 A;  5IY5 C;  1IZM A;  4CIH A;  3LEV A;  2XSE A;  1NU9 C;  3LNR A;  2BE5 F;  4FWV A;  1LVK A;  3JRT A;  4XLN F;  2Y3B A;  1TWG A;  2C03 A;  1ZHT A;  2A69 F;  4XWJ A;  1JPJ A;  3EG9 A;  1FMW A;  5E2Q A;  4U5H A;  4G7H F;  4LLE A;  4LLC A;  3DAG A;  1M2V A;  3E70 C;  4LER A;  3EQL F;  2J7P D;  3EPV A;  3V7O A;  3HJC A;  4DBR A;  1BR1 A;  4EBB A;  3LS0 A;  4ZLD A;  2J9W A;  4IAO A;  5FCL A;  3RKO F;  4DVY P;  3AQB A;  3AQC A;  3S28 A;  1O5H A;  5F5H A;  4IRU A;  1SMY F;  1ZU4 A;  1FTS A;  2YHS A;  3K6B A;  4BEJ A;  3OA1 A;  4XLP F;  2HV7 A;  3JCU Q;  4I44 A;  3VAY A;  3ITF A;  1S7Z A;  4JZA A;  1VYI A;  2J0X A;  3K33 A;  3ZIB A;  1ST6 A;  3CSK A;  4BJ6 A;  1WGW A;  2J46 A;  3DXJ F;  2CGE A;  2Q9B A;  2Y39 A;  4LAC B;  4RBN A;  2M4E A;  2HV6 A;  2KNH A;  2J9U A;  3EH2 A;  2PP4 A;  3EZH A;  4AE4 A;  3X1O A;  1VMA A;  4PFP A;  1TWA A;  2JD3 A;  3E9V A;  2R7R A;  2YZS A;  5T3W A;  5B3S C;  2R7X A;  2FGY A;  4P6I C;  1IW7 F;  3AG2 C;  3Q7G A;  2PX0 A;  2DYS C;  2EIL C;  5DQT A;  3FAJ A;  2QTV A;  3F47 A;  3IEE A;  3Q6M A;  4CS9 C;  4MQ9 F;  3DAF A;  2A1D D;  3EG9 B;  4HFK B;  1ZHW A;  3H65 A;  4NY3 A;  1D1C A;  1VK5 A;  3Q7L A;  4BJ6 C;  2R7U A;  3JSZ A;  3GOD A;  4F4B A;  2KGO A;  3SNH A;  3W8H A;  4AX2 A;  2NUP B;  5D92 A;  1D0Z A;  4O6M A;  1NU7 D;  3ZVR A;  4CS8 C;  2NG1 A;  2QY9 A;  3UGP A;  4XTK A;  3T4R A;  4M63 A;  2OCC C;  2H7B A;  4U5G A;  1MMG A;  4I3M A;  4JJF A;  4HFF B;  4JCH A;  2WB7 A;  4U5D E;  3B0V C;  4DVZ A;  1FMV A;  5KYN A;  3KMI A;  1BR2 A;  2G3V A;  4JW1 A;  3L0I A;  3RFY A;  3S29 A;  3LLK A;  4U5B E;  5EHH A;  4C7O A;  4BG0 A;  1M2V B;  1OCC C;  1Z3I X;  4A2N B;  4J32 B;  3K1H A;  2IXM A;  2X51 A;  5E3A A;  2ZPA A;  2J7P A;  2E87 A;  1D1B A;  1TR2 A;  5L3V A;  4WJ0 A;  4HE8 D;  4I1O B;  4PJN A;  3K1I C;  3KL4 A;  3KH2 A;  3LJB A;  4AK9 A;  3X2Q C;  3OWT A;  4CS9 A;  2ZXR A;  4GYT A;  4K7B A;  3EJN A;  2P6V A;  1NZE A;  2NUT A;  5DQZ A;  1FFT C;  2W9Y A;  1OCR C;  3KKB A;  5DS4 A;  5HSW A;  2R7V A;  3B0U X;  1MND A;  1M56 C;  4RD9 A;  2CNW D;  4EWC A;  3DJU B;  1PCX A;  4ZLC A;  2IXO A;  1V55 C;  4W8K A;  2H7V C;  2IXN A;  2IXP A;  3DZA A;  3OEO A;  3LLI A;  3EGD B;  5KYX B;  2V3C C;  4OIQ F;  3EGD A;  2Y3G A;  4JUR I;  2WZL A;  5CI9 A;  2Y3H A;  3EFO B;  3PHF 2;  4G7Z F;  3PMR A;  3B0P A;  2KW3 C;  1KU2 A;  3ECS A;  3N24 A;  2PFD A;  1FFH A;  2DYR C;  4YT2 A;  4HEA J;  1PD0 A;  1Z63 A;  3ABL C;  2VAS A;  2ZXP A;  2IYL D;  2D5R B;  2L81 A;  4JJG A;  2XL4 A;  3WOD F;  3DMD A;  3EH1 A;  1TWC A;  3S27 A;  3RYL A;  1ZHZ A;  4BJ5 A;  4O6N A;  4FX5 A;  1O87 A;  2G3K A;  4OIP F;  2CDQ A;  1D0Y A;  2W45 A;  5B1B C;  3JYH A;  3JT1 A;  1ZHY A;  5KYW A;  3AG3 C;  1MNE A;  5KYX A;  3FDQ A;  4CSA C;  2Q9C A;  1Z23 A;  4OD4 A;  2J0W A;  3AG4 C;  4N06 A;  2CNW A;  2WZF A;  2B0J A;  2R7Q A;  5DVW A;  4KBL A;  3T6B A;  4CS7 A;  3AG1 C;  4E7Z A;  2Q9A A;  3UR3 C;  2J9V A;  3NG1 A;  4YJW A;  4X0R A;  1Z6A A;  1LS1 A;  3UMI A;  3M1C B;  2VH3 A;  4O79 A;  4JVS A;  2Y69 C;  3W8I A;  2W4B A;  1TKN A;  5L3Q A;  4KC9 A;  1SF8 A;  1SZI A;  2MYS A;  4YT4 A;  2EIJ C;  3S0X A;  2XRH A;  5D91 A;  2WVO A;  3LAY A;  3NKE A;  5E33 A;  2A6E F;  5F5F A;  3SYN A;  4YN0 B;  3O39 A;  4Q7C A;  3UNG C;  5B1A C;  4O7G A;  4GEH A;  3SEO A;  3T6J A;  4I1M A;  3K7D A;  4J30 B;  2ZXW C;  1PD1 A;  5KYY B;  3UMK A;  3Q6N A;  2L9J A;  2O9X A;  5E3C A;  3EGX A;  3WG7 C;  3MX3 A;  4G7O F;  2OG2 A;  1W2W A;  3POV A;  2NUT B;  2WZG A;  1RJ9 A;  3LS1 A;  5DLJ A;  3NYL A;  3EGX B;  3CQZ A;  4KNW A;  3W2W A;  4K0D A;  3QZC A;  3MLG A;  4U5E E;  3EHN A;  3ZC4 A;  3I5Q A;  1MMN A;  2R7W A;  3DM9 B;  3LES A;  3DJN B;  2DGJ A;  2PX3 A;  4OD5 A;  2ZXO A;  4Q5S F;  3I5P A;  4DOZ A;  2VB6 A;  1MMD A;  3ZG1 A;  1ZU5 A;  2C04 A;  3HLZ A;  1J8M F;  2GFH A;  4C3E A;  4C3D A;  2H7O A;  2W4M A;  4YWQ A;  1M57 C;  4C3B A;  4OIN F;  1ZYR F;  3RIP A;  5T1D B;  1NG1 A;  5DS5 A;  3FVY A;  4PFO A;  2WVN A;  2CW0 F;  2A6H F;  3FHD A;  4QI2 A;  4B6I A;  4H4K C;  3W2V A;  4BJT A;  1OCO C;  3NRH A;  3L34 A;  4PK4 A;  2IOQ A;  3ASO C;  2P7V A;  3QMK A;  2Z15 A;  4U5F E;  1D1A A;  4PJM A;  2KQ9 A;  4ANJ A;  5T3T A;  4C7O B;  3NYJ A;  3TD7 A;  1JPN A;  4E7S A;  2XXA A;  2WVQ A;  4CS8 A;  1N1C A;  3ASN C;  3K66 A;  3I4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...